2GUZA

Structure of the tim14-tim16 complex of the mitochondrial protein import motor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
GFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of Tim14 and Tim16, the J and J-like components of the mitochondrial protein import motor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone, protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
total genus 23
structure length 71
sequence length 71
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2006-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2guzA00
2Y4TA 2QWQB 4J7ZA 2CTWA 2YS8A 1N4CA 1IURA 2DN9A 4J80A 2DMXA 2QSAA 3UCSC 2CTQA 1FAFA 2CTPA 2QWRB 2QWOB 2Y4UA 2L6LA 2N04A 2N05A 2PF4E 2CUGA 3BVOA 1WJZA 1NZ6A 2KQXA 2M6YA 2CTRA 2YUAA 4IT5A 1XBLA 2QWNB 2QWPB 3UO2A 2LGWA 2GUZA 3AG7A 1GH6A 2OCHA 1HDJA 2EJ7A 4RWUA 1FPOA 3APOA 2GUZB 1BQ0A 3UO3A 2LO1A 1BQZA 3APQA
chains in the Genus database with same CATH superfamily
1M9NA 1IBMB 1S76D 1BT8A 1BGYH 3ZMSA 1N34B 4MT8A 3ABTA 3ABKB 2CGNA 3X2QC 3ASOB 3CCQV 2M6YA 5JCOA 4NR1A 5A9GA 3UO3A 1LNQA 3P3PA 1X59A 2A7WA 4X62O 4DR5B 1M90W 2UXCO 1R1BA 2BTQB 2ADPA 1S72V 2BOBC 4YJ2B 3CRMA 1PM9A 5CBGA 3KCYA 1TA8A 1EZJA 2YXHA 4GZRB 2P7TC 3CX5F 3S3XA 2JGDA 3M8AA 1OZ0A 2E76B 2YS8A 3CRQA 2CH7A 2ZDIC 1SRYA 2EULA 4LC1A 3HKBB 1WA8A 2IH1C 2E75B 1ZTEA 1AR5A 3G80A 2PUSA 1JJOA 1RSOB 1IVSA 3F7VC 3LSUA 2HVJC 3JAMN 1H2LA 4D6TH 3P30A 3HKCA 3ETEA 4OPAA 1DTOA 4TQDA 2Y4TA 1KECA 3H1KH 3SGIA 4U3JB 3ASOC 5EBMC 4FIPC 5FL7G 3AG1B 1VQMV 1QBZA 5IYCO 3AG2B 1NT2B 1SESA 4FLVA 4FMTA 1NH2D 4LF7O 4UCSA 3GVMA 1FXHA 4JI8B 1N8RW 1S5HC 3CCVV 1VF6A 4DV6B 4AQYB 1KYOF 3JD3A 4PDRA 2ZIOA 4UVCA 2A79B 2N04A 1XOUA 4DV2B 2EIJC 1G1XB 3WG7C 4PI0A 1MSWD 2QKCA 3CSXA 1H2SB 4LNUB 5LXTA 5BZBA 3TGUH 5L3FA 2XAGA 1IBKO 2ZM6O 4XDKA 4I50B 2Q5ZA 2ZR2A 5ITZA 1SETA 4JI4B 2QTSA 2KG7B 3HB3B 4WFEA 4GT1A 2ZE6A 3SPGA 4QE9A 3LDCA 2IU3A 3U10A 2R9AA 4LFBO 3G6BA 4K0KO 2DQ3A 4LWSB 2JIZG 4JASA 5CA0B 3G4SV 4UV8A 4R7CA 1FXKA 2BCCH 5KUKA 5KHJA 4LF6B 1UFIA 4TSFG 2QR4A 2XAJA 4GCZA 3RWRD 4B3RO 3AG3C 2M7WA 1G4YB 4MTGA 1VMGA 1Z2GA 3BRCA 1Q7YW 4ZHQB 2EJ7A 1L8DA 1BZKA 3B8MA 4HNAB 1XI1A 2KB1A 1VQ4V 2GHYA 2A0LA 2JS3A 3CE2A 4MW8A 3DXRA 4PA4A 4B3TO 4I4TA 3U0ZA 3T1YB 4K0KB 3L74H 2B9ZA 3SYCA 1N33B 5EC2C 3OE7G 3E22B 5LYJB 4N23A 2YXLA 3I56V 1WAZA 1FJGB 1VQKV 3ABUA 4IIJA 1R3LC 4FJCC 1WP8A 2QGNA 3K9AA 4JYYA 4MVRA 4U7OA 2BE3A 5CN0A 3SYAA 3HKBA 1IZ3A 5H5NA 5LOVB 4F6EA 2R9IA 2L6LA 1YI2V 2CUGA 2IJIA 3ZHSA 1FFTB 5K1PA 2UUAB 2R70A 2DWDC 5IWAO 2ETNA 5L3GA 4WFHA 1WP7A 1WN7A 2WLNA 1F7YA 3NR7A 2BOCC 3LNNA 5LP6C 1OJHA 2HP8A 3SJCC 4O4LB 1NJIW 4X66O 4UXNA 2EINC 3B8NA 1Y6XA 5B3SB 3STLC 1X4TA 2A3QA 4FLZA 2EJRA 3GB7C 1SQGA 3UT5B 4RUEA 3BHPA 3UO2A 1QR8A 5CB4B 1GH6A 2FTKA 1VQNV 2ZINA 3ZRWA 1QLEB 4LH7A 3G67A 4MS2A 3BY6A 1AJPA 2CTQA 4IGGA 3ZMZA 4DR7B 4JAVA 4PD4F 3ZRSA 3MDSA 3CB2A 4LCUC 2QTOA 3UM7A 5DEDA 1NI8A 5IYDO 3FYEB 5EIBD 2LQTA 1K4DC 3JATA 2GBOA 4B3SO 4J80A 2DMXA 2DYSB 1OCOC 1TVKB 2YEVB 2YIBD 3ZRVA 1BCCH 4ASUG 2E74B 3C3TA 3JSNA 1R3KC 3N2KA 1V55B 1I5YA 2Q73A 4HAMA 4WFAV 4ZIBA 1VQ8V 1I7FA 3RBZA 1G6UA 4AHCA 3JARB 3BEHA 1PNKA 5B3SC 4EFBA 2V4DA 3JAWA 5C8YB 2QSAA 1K9MW 5LA6A 2UXDB 4LF8O 3DXRB 1NR7A 1JPXA 4KP4A 3ZMVA 3CC7V 1FFXA 1Q86W 5JWPA 1Q6IA 3E22A 5CBFA 4CS2A 4MVQA 2LFRA 3CC2V 5KAIZ 2ZDIA 3AK2A 4W4KA 3K58A 1AP5A 1P49A 1Y4MA 3EHBB 2CAZC 4FFKA 1R6TA 5CA3A 4U7NA 5KAFZ 2ODMA 3JAKA 1WJZA 5HFMA 1ZUQA 3K9SA 2WPDG 1JFFA 2LJ2A 4NTYA 5LMUB 5KUMA 2IU0A 2JRIA 3RYCB 4FLYA 1MNGA 3FAVB 2ZXWC 4B3SB 3WB2A 2YIDA 2XOKG 3ZMUA 1LUWA 4X65O 4O4IA 4R50A 2AGAA 1YJNV 3SJBC 1Y76B 3E83A 3OFNG 2VQFO 1ROPA 1N36B 2EIMB 1NR1A 2D3OW 1DK1A 1CXZB 5CA1A 5JJEB 1FYJA 3I5DA 3TXSA 4D7SA 4U3FH 5JCOC 1D2DA 4DR6O 5IY5B 4IL6Z 3GWKC 3KCXA 1QLNA 1XEQA 4TV9A 4TQFA 2EZOA 3A0RA 4J7JA 4BIUA 4DUYO 1ZL8B 5CB4A 1FXVA 1M57B 5LGNA 3MAQA 3T1CA 3FD9A 4A5UB 1YZBA 2ZM6B 4GX0A 1IBKB 4WBNA 4OPHA 4KHPB 3E8GA 1W0JG 4X88A 4NXMO 4DYLA 2F4VB 3A0BZ 1OCOB 3VBBA 5BXZA 3BVOA 2KG7A 3J81N 3K3WA 3ML0A 1R73A 2Z0AA 4AQYO 2YC0A 1EM1A 1DF4A 2GV9A 3ZRWB 2OTLV 3F7YC 3AG4B 3OUFA 4CBCA 3OUSA 4UB8Z 3K59A 4O4JA 4NTXA 2A9HA 1SQXH 4HZ3A 3TJTA 2BTQA 2IJKA 3HPLC 4JYAO 3K79A 2WLMA 4PV1B 5EZYA 1F4NA 2YI8A 2OT5A 3GWOA 2PGGA 5EYPB 3X2QB 3H01A 2FKXA 4UCTA 2JJ1G 2LP7A 5L3CA 4YJ3B 2A06H 1TUEB 5E79Z 5D5QA 2AZ2A 1BQZA 4JI7O 1VIBA 3LSSA 4J42A 3AEIA 4QNHB 1TUBB 3JD0A 1JJ2U 4DUZO 2CH7B 3UCSC 2QJ1A 2Q0AA 2AHZA 2HVKC 4Q20A 3K5MA 1MG1A 2HR3A 2E5LO 1SC5B 2RDCA 1VQLV 1XHZA 2JDIG 3JD2A 1EN5A 1YJ9V 1K97A 3VQWA 2X6AA 3IJ4A 1QU7A 3E35A 4QJFB 2QEXV 2UUAO 4I55A 5GTIZ 1OHHG 2XAHA 1IX9A 1Q3EA 2PTMA 4UFZA 2QWRB 1NVPD 1NU1H 2NLJC 1M4UA 3CRAA 3R65A 3JASA 5BMVA 4GKKB 4JGSA 3TETA 2ZNJA 1JQ0A 2UUBB 3E8HA 4UVAA 2EIKC 3OEHG 4X62B 4BR6A 3N2GA 3OTOB 2OCCC 3OR6C 5LP6A 3MHHC 3OTFA 4X1KB 4UCUA 1GO3F 5LL6Y 4NXNO 1K34A 1RP3B 2IJHA 5H6QA 3JAKB 1XREA 4DR4B 5IY5C 1ZX3A 2Y48A 4LFCO 1VF7A 2UXDO 1ZL8A 1MSDA 3CD6V 1VEWA 2JEXA 4GLXA 1V55C 4FZ0A 2B1GA 4UCRA 1XDCA 1UJWB 3R66A 3OR7C 1B04A 3O65A 3F5WC 4FLUA 2Q7EA 3STZC 4LF7B 3CCJV 4LF9O 4TOIA 4J7KA 3PN1A 4DV7O 1GAXA 3HKEA 3APOA 1QQCA 3Q4HB 5JVDA 1PL4A 2XHBA 2HFEC 4B3MO 4Q6GA 1NQTA 2HKOA 2QWOB 2EILC 1JVMA 1R6KA 4O2AA 1COWG 4OGQB 4DV3B 2ZQMA 3CCEV 4JI0O 3KKYA 1SZXA 1V54B 3SPHA 1H8EG 1FD9A 3SPIA 4I7ZB 5JJJB 5BY1A 2W6IG 1AI7A 2Q4PA 1NTMH 3APQA 2RCVA 4GKJO 3AG1C 4FLWA 1OCRC 1UPGA 4OXSA 1QVFU 3BAAA 3S3WA 2DWEC 1GN4A 1K8AW 2CGOA 3DTUB 2Y4UA 4JI2O 3CMAV 4P9PA 1K4CC 3J7AU 4IHJB 3FYIB 3A0HZ 2JGDB 1FXKB 1H38A 2DQ0A 4E4EA 2HG5C 4OX9O 5EZYB 2Q8VA 1GM9A 2HJFC 3CC4V 5J9PC 2PI5A 3I55V 4DR4O 1PNLA 4WCEV 4X8AA 2DYRC 2W0XA 4C7UA 4JAUA 2XUMA 4JI5B 1Q81W 1BQ0A 2Y69C 4ZKIA 5L3DA 2EX3A 4MVMA 1S0VA 4IIJB 1WB8A 4FK5C 2HHHB 2UUBO 2XASA 3N27A 4ZI7A 4YIOA 1OCCC 3CRRA 4MSWC 4LFAO 1XL4A 1WA8B 1N32B 5LBQA 4ICGA 4WFGA 5IYBO 3VOUA 1MMMA 2GUZA 2V7QG 3QG5A 1Y76A 1OCRB 1T5EA 4X65B 3OT7A 2QWQB 2P6JA 2UXXA 3ZHVA 1XILA 2CK3G 2P67A 1H2MA 2ITDC 2ARHA 2F95B 4DK0A 1YVWA 5LMUO 4J11A 4J9YB 4MW3A 4DUZB 4CH5A 1QR9A 4LNUA 1AB3A 3HKEB 1LUVA 1BMFG 1V9PA 2X7RB 4YHHO 1EFRG 1YSCA 2YI9A 4PDMA 3O9OA 4RUFA 1QHTA 1YHQV 1I94B 3AK1A 3UKMA 1N34O 1KP2A 4JPRA 2Q0OC 4HBNA 3JALB 3ZBHA 3CP1A 3IC7A 1P84F 1MZFA 3BABA 5EBWC 5CA1B 3LDEA 1RM1B 1JR9A 3IFXA 3TK1A 3OD4A 3B09A 4LWSA 4X20B 3IAYA 2QKSA 4KL1A 1NTKH 4P2ZA 1D5NA 5GTHZ 2UU9B 1VF5B 4NXMB 1K7DA 2VQEB 1JCHA 2OCHA 1AJQA 1CPYA 1J5EB 2UUCO 2VS0A 2EINB 4RQFA 4JI2B 5TISZ 1Y74B 3ZX6A 2JJ2G 1VQOV 5GW7A 4JI3B 4TV8A 1VARA 2YEVA 4QPJA 4D7TA 4PA3A 4JV5B 3HR0A 1SF9A 4GKJB 3RFRA 2Y0IA 5DECA 2Z5UA 1W2BU 1QCEA 1Q8IA 3W7WA 1FPOA 1ZLZA 1YDXA 4DV3O 4ZOLA 3JSLA 1TVKA 3L72H 4UCOA 4FVMA 1VQ5V 3CHXA 5C93A 3OAAG 4IYHA 4LP8A 2VWKA 1XUQA 4EKWA 4YY3O 4BIZA 4CH6A 1SQPH 1KU9A 1KKCA 4DV5B 1F23A 3FB6C 5B1BC 4U3JA 2ZT9B 4X66B 4O4LA 3CPWU 3H1JH 3RVYA 2QM4A 3IGAC 1FFXB 3JD1A 1GTOA 5EK0A 3K03A 3E2EA 1BHBA 4MVZA 1SKVA 1IDSA 3ASNB 1P4RA 1ZSPA 2ZXWB 4RAIA 4JZGA 2JK5C 1E1RG 3DGEA 3U11A 4JTAB 3ZN1A 4JTDB 1L0LH 3T1HB 3G6EV 1IXBA 2BSKB 4H44B 2HHHO 3M99B 4FM0A 1R6NA 3SPJA 5IE9A 1WLEA 1M93A 3N2GB 3BA8A 1KB9F 2H94A 3ZRXA 4GKKO 5FNVB 4L8JA 2YDEA 3QO7A 4GX2A 5JVDB 2F43G 2Q6AA 1H8HG 4E2LA 2C2AA 1KC8W 2N05A 2DOSA 4UB6Z 3BPZA 3QVNA 1XBLA 1S77D 2DE0X 1S5LZ 5KX5B 5J2UA 4MTFA 2E5LB 2WLIA 2CTWA 3OM3B 2KKWA 5EC1C 1TUBA 1SS3A 3MHSC 2UXBB 3L9DA 1BL8A 4TT3G 3RVZA 4QGPA 2ILMA 4JI7B 4X64O 3D3QA 3AG4C 4I0XA 1K3EA 2WA4A 5E1AC 4JI0B 1XNQO 4JI4O 5C8YA 1KD1W 5LMNO 4X1IB 2F23A 2UXBO 4RQEA 5J2TA 3TCUA 5A2QN 4NVPA 2XNDG 5JQGB 4OX9B 4TUYB 5DN6G 3FFQA 2NN4A 1LR1A 2UU9O 4DR3B 2ATKC 1IURA 2RN9A 1XNRB 1PL0A 3BA9A 1Q82W 1MOFA 5IWAB 3OGCC 5EYPA 4ABMA 3G71V 1J95A 4JI8O 4KHPO 4IT5A 2FL4A 5H9CA 2ZKOA 4J41A 2WSSG 4B7EA 4H13B 3NXSA 2D2CB 1XMOO 3ASNC 4DUYB 2FB5A 3JCUZ 1AI5A 1KBHA 1SQVH 1FKAO 4PA9A 3KG2A 4DR6B 5JH7A 4WFFA 2WLKA 1P7GA 3K0DA 2LFSA 2CTRA 2XAQA 3OMNB 2L35A 1Q5OA 2H3OA 1Q43A 3CXCU 1O9HA 4DR2O 5B1OA 3ZHRA 3ZHTA 1U96A 1Q90D 4BAYA 4R8CA 3A8TA 2VRZA 3OMAB 1SQBH 3VQXA 1JOYA 4LF5B 2CE4A 5FPOA 2O57A 4LF9B 3HKDB 2QWNB 1P7BA 4UCVA 3LUTB 4WFBV 4KFMA 2LW7A 3W7UA 4EB6A 3EFFK 5LP6B 1K73W 2AZ0A 5D5PA 4MTXA 3B40A 4DR1B 3T4ZA 1XMQB 2Q9LA 5IJ9B 4LF4O 4X89A 1O9GA 1B3QA 2ZE5A 4PA7A 5KA5A 2OCCB 4HYOA 5KA6A 3CMEV 1PP9H 5J2UB 5KX5A 1PPJH 5CMUA 4B7KA 4IHJA 2B5UA 4X1YB 2YIAA 1VP7A 2DJVA 3JAWB 4G28B 4TWKA 1WPXA 3H9VA 4K8ZA 4X1IA 2OWOA 5F2VO 4XDJA 3JALA 3K5OA 1GM8A 4JI3O 1PV0A 3RYHA 4DW0A 4J7ZA 1KP3A 2FYUH 1XQ8A 4CH3A 3RYFA 4GYCB 4MTOA 3K57A 5KMGB 1YTFD 4CS3A 4FM2A 1H2KA 1S3JA 5IJ0B 1HR0O 4JZ2A 2PYLA 2DW4A 1S5JA 4CS4A 3K06A 2QM7A 2LGQA 2YIBA 3LDDA 3FB7C 4Z1VA 1W0KG 4NB5A 1YITV 1FXKC 3H1HH 3W7TA 4L87A 1GRJA 4JI1O 2Y69B 5KMGA 1KQSU 4X1KA 4O2BA 3FAVA 2AHYA 3CS5A 2IM9A 2W6JG 5H6RA 4MVOA 5JQGA 3AG7A 4JV5O 3LSQA 1VQ6V 1NH2B 3JD4A 1B6QA 2DYSC 2Q7HA 2P4KA 1ZWIC 4ZI7B 4FLXA 1BE3H 1U97A 3CRCA 4K8XA 3K5LA 1Q6HA 4PELA 1KMIZ 2PF4E 4DK1A 4NKGB 4DV1O 3QO8A 2YUAA 1JFFB 4BW9A 5JJNB 1IBLO 3FKSG 1Y66A 2JEUA 4RO2A 1OV9A 2ZD9A 3OW2U 3VQVA 4BIOA 1YXBA 3SR2C 1GMGA 3C90A 5LOVA 1QLEC 2Q68A 5KHGA 2F66C 2EBOA 2P5OA 2QDOA 4O4HB 5LMNB 1R3IC 1NS1A 5L3EA 3QTCA 1XNQB 3ABKC 3H1LH 5KHKA 3BFRA 3A2FA 3HKCB 5KLVH 1HDJA 1AJNA 2WA3A 1Z5VA 3ABLC 4B08A 3D36C 1H2GA 2NR5A 4LR3A 4J9ZB 1AP6A 4N21A 3JATB 1RM1C 1HNZO 4O4HA 1Q6UA 2Q7GA 4Z2WA 4B3TB 5B1NA 1TGOA 2JVDA 5B1AC 1IBLB 1VF6C 2K9PA 2GSMB 3RGBA 3BCCH 3ETQA 4JAAA 3ZEDA 1YEWA 4I5SA 4B3RB 2IJJA 1L1FA 5LHGA 4LF6O 3QO5A 4CC6A 4YJ2A 3M7MX 1AILA 1EBOA 4MVUA 4UUJC 3MD0A 2ZNIA 3E8BA 3K08A 3RYIB 3ZMTA 2MK3A 1XL6A 3D3IA 1EN6A 2IW5A 2YXYA 1PKXA 1Y74A 1YCIA 4CZZA 4ZHQA 3QNEA 4H0LB 2P4VA 4HNAA 5CBHA 4ZOLB 3SJAC 3ZIAG 1KKDA 4JYAB 2R72A 1DF5A 2QKAA 4AI8A 1YJWV 4FFBA 1PNMA 2G38A 2LGWA 4J10A 1WPBA 3E89A 2KSDA 1QVGU 3LNMB 4DV7B 4WF9V 2F93B 4DV1B 5KHIA 2DN9A 2WLHA 2ITCC 3RW0A 2UUCB 4DV6O 2KQXA 4NYKA 5J2TB 2VQEO 2QWPB 1MA1A 2GUZB 4H33A 5BR8O 2OIGA 4AILC 2R9RB 2EIMC 1GM7A 2AXTZ 4I4TB 1SA0B 1G8MA 1OCZC 1ZAUA 1MZEA 1K5QA 2EIKB 2B1IA 4JI1B 2Z3YA 2UXNA 2X6CA 3OTOO 3CEIA 2VQFB 1N36O 4P30A 2LO1A 3ZS8C 1AI6A 2XAFA 1Y67A 5FNVA 1QNMA 4W4LA 2JS5A 2IH3C 3T1YO 1HNWO 2QM8A 3UT5A 4JYBA 4IYIA 4R6ZA 2ZE8A 3WB1A 3OMIB 5B1AB 4PJ0Z 1PD3A 2EIJB 3SDLA 1K33A 3DC6A 1THZA 1RFYA 2W0FC 4QIWF 3DC5A 4Z1MG 4I0XB 3H1IH 2RJZA 4JF3A 4KXRA 3WFVA 2Y0PA 1IXMA 5IDJA 3KZIZ 5CA0A 3WG7B 4PI2A 4CC5A 4QPKA 2YSUB 4ZBMA 3WU2Z 1HNZB 1BSMA 4FZ1A 4EB6B 4LFBB 4NXNB 1AVMA 1VQPV 1A32A 1OCZB 2EILB 1FJGO 1TAEA 4LF4B 4F6RA 2HEPA 4BW5A 4O2AB 1XMOB 1KUQA 2OIEA 1N33O 5LHHA 1XMQO 1JX9A 5LXTB 1GN6A 3FB8C 1I0HA 3D36A 3AG3B 1SERA 2WLIB 4O4JB 3FB5C 4K3AA 5GONB 1CP9A 3SYPA 3RYFB 5K1XA 3E8FA 3P3NA 4UVBA 1HP8A 4I55B 2V1DA 3CCLV 2HJDA 4LF5O 1DGSA 1FS0G 4DV0B 1NZ6A 1RSOA 2X6BA 2ZR3A 5LGUA 4TUYA 3TXQA 2RNBA 2OTJV 5GONA 1R3JC 4H37A 4JTCB 5FPRA 4I9QA 2IBZH 4YY3B 3E86A 1HW7A 1NKDA 4DO2A 1N32O 3ABLB 3UQ8A 1BS3A 4DR7O 3L75H 4LFAB 2QA4V 2WLLB 3L70H 2EZPA 5JH7B 1XHXA 1Z5WA 1B06A 2K1EA 3SPCA 5IT9N 1YIJV 3EXAA 4DW1A 4EEQA 2RQ6A 4FM1A 2LW1A 4JI5O 1V54C 1H2NA 1D5AA 5EBLC 4DXWA 1E79G 1AROP 4PDVA 4GX5A 2JGUA 4B3MB 3CWBH 2ZIMA 1HNXO 4X9QA 1HR0B 4DV4B 1ORQC 1US6A 3JASB 2ADQB 3ETDA 3W7SA 2FMLA 4O4IB 3OGIB 1L0NH 1I08A 5BR8B 4PHZA 4XBFA 5DM6V 2BSKA 1MABG 4DR3O 3T4DA 2BTOA 3J80N 1YTFB 1NTZH 4CH4A 1F4MA 1J5EO 4WBNB 1CEZA 3K0GA 1M56B 1W59A 2QE7G 2MW2B 4UV9A 1SQQH 5AG2A 3CCSV 4X20A 3AK3A 2WLJA 1N0JA 3ZCCA 3SJQC 5H2FZ 3N2KB 1NBMG 5HFLA 3IC9A 2GTAA 2F1MA 3ZN0A 3T1HO 2P06A 1RPRA 1OCCB 4G27B 4I50A 5ITZB 1YF2A 5LA6B 1GN3A 4F4LA 4LF8B 1GK9A 2YICA 3RYIA 1IBMO 1GN2A 2AW9A 3P32A 4GUNA 4I9WA 3B4SA 3SYOA 4DR1O 2CDYA 1JMKC 1F51A 2X0LA 1SZTA 4F6RB 4DV5O 1M1KW 3CCMV 2PI4A 1HNWB 2Q67A 4PA6A 3RN4A 4XDLA 2N74A 1M56C 2DYRB 3L73H 3THOA 4DR2B 4TV8B 4LFCB 2HLDG 2UXCB 4JYCA 3K5NA 5IJ0A 3F5TA 4O2BB 2VWJA 5EIBC 1EZVH 3FX7A 1ENVA 4KUMA 3T2MA 4YJ3A 1SQFA 1M5IA 3RYHB 1NVPB 5L3BA 4RWUA 5LYJA 1AR4A 3QF7A 4K35A 2GDSA 1WNSA 4FLTA 4EFEA 3ABMB 4NTWA 4DV2O 3RT3C 1WB7A 1E1QG 2PZSA 1AR1B 1VQ7V 5LGTA 3CCRV 1EN4A 3W7XA 3B2EE 4LH6A 1HWYA 4FFBB 4QE7A 4TV9B 3K04A 4PDLA 1I5XA 2XTAA 1XNRO 4DRXA 4FPPA 3OEEG 3SYQA 2F4VO 3CJHA 3JYCA 2H8PC 1JA8A 1SA0A 2WLLA 4DV4O 5B66Z 1FAFA 1HNXB 2OYQA 5IJ9A 5BMVB 2RMKB 5IYZB 3WB0A 4DRXB 1RPOA 3HKDA 5LHIA 3VQYA 1N0NA 3CJHB 1M57C 3PJSK 2ZCEA 3RYCA 1I94O 4JI6B 4X1YA 4JI6O 1N4CA 2GTSA 3JCZA 4G2KA 3EVKA 3AG2C 5KHHA 4YHHB 2PYJA 4BWAA 4X64B 3C3SA 5IYZA 2PY5A 4P9OA 1BHAA 3ETGA 3CCUV 2ZE7A 2XT9A 1K92A 4GX1A 4YIPA 3CXHF 3ABMC 3Q4HA 2WAMA 5B1BB 5B5EZ 2P22C 3ZHQA 4DV0O 5FLXN 2Q69A 2E3CA 3D8CA 4YXWG 1DLBA 2CTPA 3ICXA 3CYOA 3ZJZA 1VQ9V 1URFA 2NNUA 3L71H 4MVSA 3DSQA 4DR5O 1GKFA 3B77A 4LBEC 1AI4A 2P90A 3ZHUA 2WWWA 1K5SA 3JARA
chains in the Genus database with same CATH topology
2Y4TA 2QWQB 4J7ZA 2CTWA 2YS8A 1N4CA 1IURA 2DN9A 4J80A 2DMXA 2QSAA 3UCSC 2CTQA 1FAFA 2CTPA 2QWRB 2QWOB 2Y4UA 2L6LA 2N04A 2N05A 2PF4E 2CUGA 3BVOA 1WJZA 1NZ6A 2KQXA 2M6YA 2CTRA 2YUAA 4IT5A 1XBLA 2QWNB 2QWPB 3UO2A 2LGWA 2GUZA 3AG7A 1GH6A 2OCHA 1HDJA 2EJ7A 4RWUA 1FPOA 3APOA 2GUZB 1BQ0A 3UO3A 2LO1A 1BQZA 3APQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  2QWQ B;  4J7Z A;  2CTW A;  2YS8 A;  1N4C A;  1IUR A;  2DN9 A;  4J80 A;  2DMX A;  2QSA A;  3UCS C;  2CTQ A;  1FAF A;  2CTP A;  2QWR B;  2QWO B;  2Y4U A;  2L6L A;  2N04 A;  2N05 A;  2PF4 E;  2CUG A;  3BVO A;  1WJZ A;  1NZ6 A;  2KQX A;  2M6Y A;  2CTR A;  2YUA A;  4IT5 A;  1XBL A;  2QWN B;  2QWP B;  3UO2 A;  2LGW A;  2GUZ A;  3AG7 A;  1GH6 A;  2OCH A;  1HDJ A;  2EJ7 A;  4RWU A;  1FPO A;  3APO A;  2GUZ B;  1BQ0 A;  3UO3 A;  2LO1 A;  1BQZ A;  3APQ A; 
#chains in the Genus database with same CATH topology
 1M9N A;  1IBM B;  1S76 D;  1BT8 A;  1BGY H;  3ZMS A;  1N34 B;  4MT8 A;  3ABT A;  3ABK B;  2CGN A;  3X2Q C;  3ASO B;  3CCQ V;  2M6Y A;  5JCO A;  4NR1 A;  5A9G A;  3UO3 A;  1LNQ A;  3P3P A;  1X59 A;  2A7W A;  4X62 O;  4DR5 B;  1M90 W;  2UXC O;  1R1B A;  2BTQ B;  2ADP A;  1S72 V;  2BOB C;  4YJ2 B;  3CRM A;  1PM9 A;  5CBG A;  3KCY A;  1TA8 A;  1EZJ A;  2YXH A;  4GZR B;  2P7T C;  3CX5 F;  3S3X A;  2JGD A;  3M8A A;  1OZ0 A;  2E76 B;  2YS8 A;  3CRQ A;  2CH7 A;  2ZDI C;  1SRY A;  2EUL A;  4LC1 A;  3HKB B;  1WA8 A;  2IH1 C;  2E75 B;  1ZTE A;  1AR5 A;  3G80 A;  2PUS A;  1JJO A;  1RSO B;  1IVS A;  3F7V C;  3LSU A;  2HVJ C;  3JAM N;  1H2L A;  4D6T H;  3P30 A;  3HKC A;  3ETE A;  4OPA A;  1DTO A;  4TQD A;  2Y4T A;  1KEC A;  3H1K H;  3SGI A;  4U3J B;  3ASO C;  5EBM C;  4FIP C;  5FL7 G;  3AG1 B;  1VQM V;  1QBZ A;  5IYC O;  3AG2 B;  1NT2 B;  1SES A;  4FLV A;  4FMT A;  1NH2 D;  4LF7 O;  4UCS A;  3GVM A;  1FXH A;  4JI8 B;  1N8R W;  1S5H C;  3CCV V;  1VF6 A;  4DV6 B;  4AQY B;  1KYO F;  3JD3 A;  4PDR A;  2ZIO A;  4UVC A;  2A79 B;  2N04 A;  1XOU A;  4DV2 B;  2EIJ C;  1G1X B;  3WG7 C;  4PI0 A;  1MSW D;  2QKC A;  3CSX A;  1H2S B;  4LNU B;  5LXT A;  5BZB A;  3TGU H;  5L3F A;  2XAG A;  1IBK O;  2ZM6 O;  4XDK A;  4I50 B;  2Q5Z A;  2ZR2 A;  5ITZ A;  1SET A;  4JI4 B;  2QTS A;  2KG7 B;  3HB3 B;  4WFE A;  4GT1 A;  2ZE6 A;  3SPG A;  4QE9 A;  3LDC A;  2IU3 A;  3U10 A;  2R9A A;  4LFB O;  3G6B A;  4K0K O;  2DQ3 A;  4LWS B;  2JIZ G;  4JAS A;  5CA0 B;  3G4S V;  4UV8 A;  4R7C A;  1FXK A;  2BCC H;  5KUK A;  5KHJ A;  4LF6 B;  1UFI A;  4TSF G;  2QR4 A;  2XAJ A;  4GCZ A;  3RWR D;  4B3R O;  3AG3 C;  2M7W A;  1G4Y B;  4MTG A;  1VMG A;  1Z2G A;  3BRC A;  1Q7Y W;  4ZHQ B;  2EJ7 A;  1L8D A;  1BZK A;  3B8M A;  4HNA B;  1XI1 A;  2KB1 A;  1VQ4 V;  2GHY A;  2A0L A;  2JS3 A;  3CE2 A;  4MW8 A;  3DXR A;  4PA4 A;  4B3T O;  4I4T A;  3U0Z A;  3T1Y B;  4K0K B;  3L74 H;  2B9Z A;  3SYC A;  1N33 B;  5EC2 C;  3OE7 G;  3E22 B;  5LYJ B;  4N23 A;  2YXL A;  3I56 V;  1WAZ A;  1FJG B;  1VQK V;  3ABU A;  4IIJ A;  1R3L C;  4FJC C;  1WP8 A;  2QGN A;  3K9A A;  4JYY A;  4MVR A;  4U7O A;  2BE3 A;  5CN0 A;  3SYA A;  3HKB A;  1IZ3 A;  5H5N A;  5LOV B;  4F6E A;  2R9I A;  2L6L A;  1YI2 V;  2CUG A;  2IJI A;  3ZHS A;  1FFT B;  5K1P A;  2UUA B;  2R70 A;  2DWD C;  5IWA O;  2ETN A;  5L3G A;  4WFH A;  1WP7 A;  1WN7 A;  2WLN A;  1F7Y A;  3NR7 A;  2BOC C;  3LNN A;  5LP6 C;  1OJH A;  2HP8 A;  3SJC C;  4O4L B;  1NJI W;  4X66 O;  4UXN A;  2EIN C;  3B8N A;  1Y6X A;  5B3S B;  3STL C;  1X4T A;  2A3Q A;  4FLZ A;  2EJR A;  3GB7 C;  1SQG A;  3UT5 B;  4RUE A;  3BHP A;  3UO2 A;  1QR8 A;  5CB4 B;  1GH6 A;  2FTK A;  1VQN V;  2ZIN A;  3ZRW A;  1QLE B;  4LH7 A;  3G67 A;  4MS2 A;  3BY6 A;  1AJP A;  2CTQ A;  4IGG A;  3ZMZ A;  4DR7 B;  4JAV A;  4PD4 F;  3ZRS A;  3MDS A;  3CB2 A;  4LCU C;  2QTO A;  3UM7 A;  5DED A;  1NI8 A;  5IYD O;  3FYE B;  5EIB D;  2LQT A;  1K4D C;  3JAT A;  2GBO A;  4B3S O;  4J80 A;  2DMX A;  2DYS B;  1OCO C;  1TVK B;  2YEV B;  2YIB D;  3ZRV A;  1BCC H;  4ASU G;  2E74 B;  3C3T A;  3JSN A;  1R3K C;  3N2K A;  1V55 B;  1I5Y A;  2Q73 A;  4HAM A;  4WFA V;  4ZIB A;  1VQ8 V;  1I7F A;  3RBZ A;  1G6U A;  4AHC A;  3JAR B;  3BEH A;  1PNK A;  5B3S C;  4EFB A;  2V4D A;  3JAW A;  5C8Y B;  2QSA A;  1K9M W;  5LA6 A;  2UXD B;  4LF8 O;  3DXR B;  1NR7 A;  1JPX A;  4KP4 A;  3ZMV A;  3CC7 V;  1FFX A;  1Q86 W;  5JWP A;  1Q6I A;  3E22 A;  5CBF A;  4CS2 A;  4MVQ A;  2LFR A;  3CC2 V;  5KAI Z;  2ZDI A;  3AK2 A;  4W4K A;  3K58 A;  1AP5 A;  1P49 A;  1Y4M A;  3EHB B;  2CAZ C;  4FFK A;  1R6T A;  5CA3 A;  4U7N A;  5KAF Z;  2ODM A;  3JAK A;  1WJZ A;  5HFM A;  1ZUQ A;  3K9S A;  2WPD G;  1JFF A;  2LJ2 A;  4NTY A;  5LMU B;  5KUM A;  2IU0 A;  2JRI A;  3RYC B;  4FLY A;  1MNG A;  3FAV B;  2ZXW C;  4B3S B;  3WB2 A;  2YID A;  2XOK G;  3ZMU A;  1LUW A;  4X65 O;  4O4I A;  4R50 A;  2AGA A;  1YJN V;  3SJB C;  1Y76 B;  3E83 A;  3OFN G;  2VQF O;  1ROP A;  1N36 B;  2EIM B;  1NR1 A;  2D3O W;  1DK1 A;  1CXZ B;  5CA1 A;  5JJE B;  1FYJ A;  3I5D A;  3TXS A;  4D7S A;  4U3F H;  5JCO C;  1D2D A;  4DR6 O;  5IY5 B;  4IL6 Z;  3GWK C;  3KCX A;  1QLN A;  1XEQ A;  4TV9 A;  4TQF A;  2EZO A;  3A0R A;  4J7J A;  4BIU A;  4DUY O;  1ZL8 B;  5CB4 A;  1FXV A;  1M57 B;  5LGN A;  3MAQ A;  3T1C A;  3FD9 A;  4A5U B;  1YZB A;  2ZM6 B;  4GX0 A;  1IBK B;  4WBN A;  4OPH A;  4KHP B;  3E8G A;  1W0J G;  4X88 A;  4NXM O;  4DYL A;  2F4V B;  3A0B Z;  1OCO B;  3VBB A;  5BXZ A;  3BVO A;  2KG7 A;  3J81 N;  3K3W A;  3ML0 A;  1R73 A;  2Z0A A;  4AQY O;  2YC0 A;  1EM1 A;  1DF4 A;  2GV9 A;  3ZRW B;  2OTL V;  3F7Y C;  3AG4 B;  3OUF A;  4CBC A;  3OUS A;  4UB8 Z;  3K59 A;  4O4J A;  4NTX A;  2A9H A;  1SQX H;  4HZ3 A;  3TJT A;  2BTQ A;  2IJK A;  3HPL C;  4JYA O;  3K79 A;  2WLM A;  4PV1 B;  5EZY A;  1F4N A;  2YI8 A;  2OT5 A;  3GWO A;  2PGG A;  5EYP B;  3X2Q B;  3H01 A;  2FKX A;  4UCT A;  2JJ1 G;  2LP7 A;  5L3C A;  4YJ3 B;  2A06 H;  1TUE B;  5E79 Z;  5D5Q A;  2AZ2 A;  1BQZ A;  4JI7 O;  1VIB A;  3LSS A;  4J42 A;  3AEI A;  4QNH B;  1TUB B;  3JD0 A;  1JJ2 U;  4DUZ O;  2CH7 B;  3UCS C;  2QJ1 A;  2Q0A A;  2AHZ A;  2HVK C;  4Q20 A;  3K5M A;  1MG1 A;  2HR3 A;  2E5L O;  1SC5 B;  2RDC A;  1VQL V;  1XHZ A;  2JDI G;  3JD2 A;  1EN5 A;  1YJ9 V;  1K97 A;  3VQW A;  2X6A A;  3IJ4 A;  1QU7 A;  3E35 A;  4QJF B;  2QEX V;  2UUA O;  4I55 A;  5GTI Z;  1OHH G;  2XAH A;  1IX9 A;  1Q3E A;  2PTM A;  4UFZ A;  2QWR B;  1NVP D;  1NU1 H;  2NLJ C;  1M4U A;  3CRA A;  3R65 A;  3JAS A;  5BMV A;  4GKK B;  4JGS A;  3TET A;  2ZNJ A;  1JQ0 A;  2UUB B;  3E8H A;  4UVA A;  2EIK C;  3OEH G;  4X62 B;  4BR6 A;  3N2G A;  3OTO B;  2OCC C;  3OR6 C;  5LP6 A;  3MHH C;  3OTF A;  4X1K B;  4UCU A;  1GO3 F;  5LL6 Y;  4NXN O;  1K34 A;  1RP3 B;  2IJH A;  5H6Q A;  3JAK B;  1XRE A;  4DR4 B;  5IY5 C;  1ZX3 A;  2Y48 A;  4LFC O;  1VF7 A;  2UXD O;  1ZL8 A;  1MSD A;  3CD6 V;  1VEW A;  2JEX A;  4GLX A;  1V55 C;  4FZ0 A;  2B1G A;  4UCR A;  1XDC A;  1UJW B;  3R66 A;  3OR7 C;  1B04 A;  3O65 A;  3F5W C;  4FLU A;  2Q7E A;  3STZ C;  4LF7 B;  3CCJ V;  4LF9 O;  4TOI A;  4J7K A;  3PN1 A;  4DV7 O;  1GAX A;  3HKE A;  3APO A;  1QQC A;  3Q4H B;  5JVD A;  1PL4 A;  2XHB A;  2HFE C;  4B3M O;  4Q6G A;  1NQT A;  2HKO A;  2QWO B;  2EIL C;  1JVM A;  1R6K A;  4O2A A;  1COW G;  4OGQ B;  4DV3 B;  2ZQM A;  3CCE V;  4JI0 O;  3KKY A;  1SZX A;  1V54 B;  3SPH A;  1H8E G;  1FD9 A;  3SPI A;  4I7Z B;  5JJJ B;  5BY1 A;  2W6I G;  1AI7 A;  2Q4P A;  1NTM H;  3APQ A;  2RCV A;  4GKJ O;  3AG1 C;  4FLW A;  1OCR C;  1UPG A;  4OXS A;  1QVF U;  3BAA A;  3S3W A;  2DWE C;  1GN4 A;  1K8A W;  2CGO A;  3DTU B;  2Y4U A;  4JI2 O;  3CMA V;  4P9P A;  1K4C C;  3J7A U;  4IHJ B;  3FYI B;  3A0H Z;  2JGD B;  1FXK B;  1H38 A;  2DQ0 A;  4E4E A;  2HG5 C;  4OX9 O;  5EZY B;  2Q8V A;  1GM9 A;  2HJF C;  3CC4 V;  5J9P C;  2PI5 A;  3I55 V;  4DR4 O;  1PNL A;  4WCE V;  4X8A A;  2DYR C;  2W0X A;  4C7U A;  4JAU A;  2XUM A;  4JI5 B;  1Q81 W;  1BQ0 A;  2Y69 C;  4ZKI A;  5L3D A;  2EX3 A;  4MVM A;  1S0V A;  4IIJ B;  1WB8 A;  4FK5 C;  2HHH B;  2UUB O;  2XAS A;  3N27 A;  4ZI7 A;  4YIO A;  1OCC C;  3CRR A;  4MSW C;  4LFA O;  1XL4 A;  1WA8 B;  1N32 B;  5LBQ A;  4ICG A;  4WFG A;  5IYB O;  3VOU A;  1MMM A;  2GUZ A;  2V7Q G;  3QG5 A;  1Y76 A;  1OCR B;  1T5E A;  4X65 B;  3OT7 A;  2QWQ B;  2P6J A;  2UXX A;  3ZHV A;  1XIL A;  2CK3 G;  2P67 A;  1H2M A;  2ITD C;  2ARH A;  2F95 B;  4DK0 A;  1YVW A;  5LMU O;  4J11 A;  4J9Y B;  4MW3 A;  4DUZ B;  4CH5 A;  1QR9 A;  4LNU A;  1AB3 A;  3HKE B;  1LUV A;  1BMF G;  1V9P A;  2X7R B;  4YHH O;  1EFR G;  1YSC A;  2YI9 A;  4PDM A;  3O9O A;  4RUF A;  1QHT A;  1YHQ V;  1I94 B;  3AK1 A;  3UKM A;  1N34 O;  1KP2 A;  4JPR A;  2Q0O C;  4HBN A;  3JAL B;  3ZBH A;  3CP1 A;  3IC7 A;  1P84 F;  1MZF A;  3BAB A;  5EBW C;  5CA1 B;  3LDE A;  1RM1 B;  1JR9 A;  3IFX A;  3TK1 A;  3OD4 A;  3B09 A;  4LWS A;  4X20 B;  3IAY A;  2QKS A;  4KL1 A;  1NTK H;  4P2Z A;  1D5N A;  5GTH Z;  2UU9 B;  1VF5 B;  4NXM B;  1K7D A;  2VQE B;  1JCH A;  2OCH A;  1AJQ A;  1CPY A;  1J5E B;  2UUC O;  2VS0 A;  2EIN B;  4RQF A;  4JI2 B;  5TIS Z;  1Y74 B;  3ZX6 A;  2JJ2 G;  1VQO V;  5GW7 A;  4JI3 B;  4TV8 A;  1VAR A;  2YEV A;  4QPJ A;  4D7T A;  4PA3 A;  4JV5 B;  3HR0 A;  1SF9 A;  4GKJ B;  3RFR A;  2Y0I A;  5DEC A;  2Z5U A;  1W2B U;  1QCE A;  1Q8I A;  3W7W A;  1FPO A;  1ZLZ A;  1YDX A;  4DV3 O;  4ZOL A;  3JSL A;  1TVK A;  3L72 H;  4UCO A;  4FVM A;  1VQ5 V;  3CHX A;  5C93 A;  3OAA G;  4IYH A;  4LP8 A;  2VWK A;  1XUQ A;  4EKW A;  4YY3 O;  4BIZ A;  4CH6 A;  1SQP H;  1KU9 A;  1KKC A;  4DV5 B;  1F23 A;  3FB6 C;  5B1B C;  4U3J A;  2ZT9 B;  4X66 B;  4O4L A;  3CPW U;  3H1J H;  3RVY A;  2QM4 A;  3IGA C;  1FFX B;  3JD1 A;  1GTO A;  5EK0 A;  3K03 A;  3E2E A;  1BHB A;  4MVZ A;  1SKV A;  1IDS A;  3ASN B;  1P4R A;  1ZSP A;  2ZXW B;  4RAI A;  4JZG A;  2JK5 C;  1E1R G;  3DGE A;  3U11 A;  4JTA B;  3ZN1 A;  4JTD B;  1L0L H;  3T1H B;  3G6E V;  1IXB A;  2BSK B;  4H44 B;  2HHH O;  3M99 B;  4FM0 A;  1R6N A;  3SPJ A;  5IE9 A;  1WLE A;  1M93 A;  3N2G B;  3BA8 A;  1KB9 F;  2H94 A;  3ZRX A;  4GKK O;  5FNV B;  4L8J A;  2YDE A;  3QO7 A;  4GX2 A;  5JVD B;  2F43 G;  2Q6A A;  1H8H G;  4E2L A;  2C2A A;  1KC8 W;  2N05 A;  2DOS A;  4UB6 Z;  3BPZ A;  3QVN A;  1XBL A;  1S77 D;  2DE0 X;  1S5L Z;  5KX5 B;  5J2U A;  4MTF A;  2E5L B;  2WLI A;  2CTW A;  3OM3 B;  2KKW A;  5EC1 C;  1TUB A;  1SS3 A;  3MHS C;  2UXB B;  3L9D A;  1BL8 A;  4TT3 G;  3RVZ A;  4QGP A;  2ILM A;  4JI7 B;  4X64 O;  3D3Q A;  3AG4 C;  4I0X A;  1K3E A;  2WA4 A;  5E1A C;  4JI0 B;  1XNQ O;  4JI4 O;  5C8Y A;  1KD1 W;  5LMN O;  4X1I B;  2F23 A;  2UXB O;  4RQE A;  5J2T A;  3TCU A;  5A2Q N;  4NVP A;  2XND G;  5JQG B;  4OX9 B;  4TUY B;  5DN6 G;  3FFQ A;  2NN4 A;  1LR1 A;  2UU9 O;  4DR3 B;  2ATK C;  1IUR A;  2RN9 A;  1XNR B;  1PL0 A;  3BA9 A;  1Q82 W;  1MOF A;  5IWA B;  3OGC C;  5EYP A;  4ABM A;  3G71 V;  1J95 A;  4JI8 O;  4KHP O;  4IT5 A;  2FL4 A;  5H9C A;  2ZKO A;  4J41 A;  2WSS G;  4B7E A;  4H13 B;  3NXS A;  2D2C B;  1XMO O;  3ASN C;  4DUY B;  2FB5 A;  3JCU Z;  1AI5 A;  1KBH A;  1SQV H;  1FKA O;  4PA9 A;  3KG2 A;  4DR6 B;  5JH7 A;  4WFF A;  2WLK A;  1P7G A;  3K0D A;  2LFS A;  2CTR A;  2XAQ A;  3OMN B;  2L35 A;  1Q5O A;  2H3O A;  1Q43 A;  3CXC U;  1O9H A;  4DR2 O;  5B1O A;  3ZHR A;  3ZHT A;  1U96 A;  1Q90 D;  4BAY A;  4R8C A;  3A8T A;  2VRZ A;  3OMA B;  1SQB H;  3VQX A;  1JOY A;  4LF5 B;  2CE4 A;  5FPO A;  2O57 A;  4LF9 B;  3HKD B;  2QWN B;  1P7B A;  4UCV A;  3LUT B;  4WFB V;  4KFM A;  2LW7 A;  3W7U A;  4EB6 A;  3EFF K;  5LP6 B;  1K73 W;  2AZ0 A;  5D5P A;  4MTX A;  3B40 A;  4DR1 B;  3T4Z A;  1XMQ B;  2Q9L A;  5IJ9 B;  4LF4 O;  4X89 A;  1O9G A;  1B3Q A;  2ZE5 A;  4PA7 A;  5KA5 A;  2OCC B;  4HYO A;  5KA6 A;  3CME V;  1PP9 H;  5J2U B;  5KX5 A;  1PPJ H;  5CMU A;  4B7K A;  4IHJ A;  2B5U A;  4X1Y B;  2YIA A;  1VP7 A;  2DJV A;  3JAW B;  4G28 B;  4TWK A;  1WPX A;  3H9V A;  4K8Z A;  4X1I A;  2OWO A;  5F2V O;  4XDJ A;  3JAL A;  3K5O A;  1GM8 A;  4JI3 O;  1PV0 A;  3RYH A;  4DW0 A;  4J7Z A;  1KP3 A;  2FYU H;  1XQ8 A;  4CH3 A;  3RYF A;  4GYC B;  4MTO A;  3K57 A;  5KMG B;  1YTF D;  4CS3 A;  4FM2 A;  1H2K A;  1S3J A;  5IJ0 B;  1HR0 O;  4JZ2 A;  2PYL A;  2DW4 A;  1S5J A;  4CS4 A;  3K06 A;  2QM7 A;  2LGQ A;  2YIB A;  3LDD A;  3FB7 C;  4Z1V A;  1W0K G;  4NB5 A;  1YIT V;  1FXK C;  3H1H H;  3W7T A;  4L87 A;  1GRJ A;  4JI1 O;  2Y69 B;  5KMG A;  1KQS U;  4X1K A;  4O2B A;  3FAV A;  2AHY A;  3CS5 A;  2IM9 A;  2W6J G;  5H6R A;  4MVO A;  5JQG A;  3AG7 A;  4JV5 O;  3LSQ A;  1VQ6 V;  1NH2 B;  3JD4 A;  1B6Q A;  2DYS C;  2Q7H A;  2P4K A;  1ZWI C;  4ZI7 B;  4FLX A;  1BE3 H;  1U97 A;  3CRC A;  4K8X A;  3K5L A;  1Q6H A;  4PEL A;  1KMI Z;  2PF4 E;  4DK1 A;  4NKG B;  4DV1 O;  3QO8 A;  2YUA A;  1JFF B;  4BW9 A;  5JJN B;  1IBL O;  3FKS G;  1Y66 A;  2JEU A;  4RO2 A;  1OV9 A;  2ZD9 A;  3OW2 U;  3VQV A;  4BIO A;  1YXB A;  3SR2 C;  1GMG A;  3C90 A;  5LOV A;  1QLE C;  2Q68 A;  5KHG A;  2F66 C;  2EBO A;  2P5O A;  2QDO A;  4O4H B;  5LMN B;  1R3I C;  1NS1 A;  5L3E A;  3QTC A;  1XNQ B;  3ABK C;  3H1L H;  5KHK A;  3BFR A;  3A2F A;  3HKC B;  5KLV H;  1HDJ A;  1AJN A;  2WA3 A;  1Z5V A;  3ABL C;  4B08 A;  3D36 C;  1H2G A;  2NR5 A;  4LR3 A;  4J9Z B;  1AP6 A;  4N21 A;  3JAT B;  1RM1 C;  1HNZ O;  4O4H A;  1Q6U A;  2Q7G A;  4Z2W A;  4B3T B;  5B1N A;  1TGO A;  2JVD A;  5B1A C;  1IBL B;  1VF6 C;  2K9P A;  2GSM B;  3RGB A;  3BCC H;  3ETQ A;  4JAA A;  3ZED A;  1YEW A;  4I5S A;  4B3R B;  2IJJ A;  1L1F A;  5LHG A;  4LF6 O;  3QO5 A;  4CC6 A;  4YJ2 A;  3M7M X;  1AIL A;  1EBO A;  4MVU A;  4UUJ C;  3MD0 A;  2ZNI A;  3E8B A;  3K08 A;  3RYI B;  3ZMT A;  2MK3 A;  1XL6 A;  3D3I A;  1EN6 A;  2IW5 A;  2YXY A;  1PKX A;  1Y74 A;  1YCI A;  4CZZ A;  4ZHQ A;  3QNE A;  4H0L B;  2P4V A;  4HNA A;  5CBH A;  4ZOL B;  3SJA C;  3ZIA G;  1KKD A;  4JYA B;  2R72 A;  1DF5 A;  2QKA A;  4AI8 A;  1YJW V;  4FFB A;  1PNM A;  2G38 A;  2LGW A;  4J10 A;  1WPB A;  3E89 A;  2KSD A;  1QVG U;  3LNM B;  4DV7 B;  4WF9 V;  2F93 B;  4DV1 B;  5KHI A;  2DN9 A;  2WLH A;  2ITC C;  3RW0 A;  2UUC B;  4DV6 O;  2KQX A;  4NYK A;  5J2T B;  2VQE O;  2QWP B;  1MA1 A;  2GUZ B;  4H33 A;  5BR8 O;  2OIG A;  4AIL C;  2R9R B;  2EIM C;  1GM7 A;  2AXT Z;  4I4T B;  1SA0 B;  1G8M A;  1OCZ C;  1ZAU A;  1MZE A;  1K5Q A;  2EIK B;  2B1I A;  4JI1 B;  2Z3Y A;  2UXN A;  2X6C A;  3OTO O;  3CEI A;  2VQF B;  1N36 O;  4P30 A;  2LO1 A;  3ZS8 C;  1AI6 A;  2XAF A;  1Y67 A;  5FNV A;  1QNM A;  4W4L A;  2JS5 A;  2IH3 C;  3T1Y O;  1HNW O;  2QM8 A;  3UT5 A;  4JYB A;  4IYI A;  4R6Z A;  2ZE8 A;  3WB1 A;  3OMI B;  5B1A B;  4PJ0 Z;  1PD3 A;  2EIJ B;  3SDL A;  1K33 A;  3DC6 A;  1THZ A;  1RFY A;  2W0F C;  4QIW F;  3DC5 A;  4Z1M G;  4I0X B;  3H1I H;  2RJZ A;  4JF3 A;  4KXR A;  3WFV A;  2Y0P A;  1IXM A;  5IDJ A;  3KZI Z;  5CA0 A;  3WG7 B;  4PI2 A;  4CC5 A;  4QPK A;  2YSU B;  4ZBM A;  3WU2 Z;  1HNZ B;  1BSM A;  4FZ1 A;  4EB6 B;  4LFB B;  4NXN B;  1AVM A;  1VQP V;  1A32 A;  1OCZ B;  2EIL B;  1FJG O;  1TAE A;  4LF4 B;  4F6R A;  2HEP A;  4BW5 A;  4O2A B;  1XMO B;  1KUQ A;  2OIE A;  1N33 O;  5LHH A;  1XMQ O;  1JX9 A;  5LXT B;  1GN6 A;  3FB8 C;  1I0H A;  3D36 A;  3AG3 B;  1SER A;  2WLI B;  4O4J B;  3FB5 C;  4K3A A;  5GON B;  1CP9 A;  3SYP A;  3RYF B;  5K1X A;  3E8F A;  3P3N A;  4UVB A;  1HP8 A;  4I55 B;  2V1D A;  3CCL V;  2HJD A;  4LF5 O;  1DGS A;  1FS0 G;  4DV0 B;  1NZ6 A;  1RSO A;  2X6B A;  2ZR3 A;  5LGU A;  4TUY A;  3TXQ A;  2RNB A;  2OTJ V;  5GON A;  1R3J C;  4H37 A;  4JTC B;  5FPR A;  4I9Q A;  2IBZ H;  4YY3 B;  3E86 A;  1HW7 A;  1NKD A;  4DO2 A;  1N32 O;  3ABL B;  3UQ8 A;  1BS3 A;  4DR7 O;  3L75 H;  4LFA B;  2QA4 V;  2WLL B;  3L70 H;  2EZP A;  5JH7 B;  1XHX A;  1Z5W A;  1B06 A;  2K1E A;  3SPC A;  5IT9 N;  1YIJ V;  3EXA A;  4DW1 A;  4EEQ A;  2RQ6 A;  4FM1 A;  2LW1 A;  4JI5 O;  1V54 C;  1H2N A;  1D5A A;  5EBL C;  4DXW A;  1E79 G;  1ARO P;  4PDV A;  4GX5 A;  2JGU A;  4B3M B;  3CWB H;  2ZIM A;  1HNX O;  4X9Q A;  1HR0 B;  4DV4 B;  1ORQ C;  1US6 A;  3JAS B;  2ADQ B;  3ETD A;  3W7S A;  2FML A;  4O4I B;  3OGI B;  1L0N H;  1I08 A;  5BR8 B;  4PHZ A;  4XBF A;  5DM6 V;  2BSK A;  1MAB G;  4DR3 O;  3T4D A;  2BTO A;  3J80 N;  1YTF B;  1NTZ H;  4CH4 A;  1F4M A;  1J5E O;  4WBN B;  1CEZ A;  3K0G A;  1M56 B;  1W59 A;  2QE7 G;  2MW2 B;  4UV9 A;  1SQQ H;  5AG2 A;  3CCS V;  4X20 A;  3AK3 A;  2WLJ A;  1N0J A;  3ZCC A;  3SJQ C;  5H2F Z;  3N2K B;  1NBM G;  5HFL A;  3IC9 A;  2GTA A;  2F1M A;  3ZN0 A;  3T1H O;  2P06 A;  1RPR A;  1OCC B;  4G27 B;  4I50 A;  5ITZ B;  1YF2 A;  5LA6 B;  1GN3 A;  4F4L A;  4LF8 B;  1GK9 A;  2YIC A;  3RYI A;  1IBM O;  1GN2 A;  2AW9 A;  3P32 A;  4GUN A;  4I9W A;  3B4S A;  3SYO A;  4DR1 O;  2CDY A;  1JMK C;  1F51 A;  2X0L A;  1SZT A;  4F6R B;  4DV5 O;  1M1K W;  3CCM V;  2PI4 A;  1HNW B;  2Q67 A;  4PA6 A;  3RN4 A;  4XDL A;  2N74 A;  1M56 C;  2DYR B;  3L73 H;  3THO A;  4DR2 B;  4TV8 B;  4LFC B;  2HLD G;  2UXC B;  4JYC A;  3K5N A;  5IJ0 A;  3F5T A;  4O2B B;  2VWJ A;  5EIB C;  1EZV H;  3FX7 A;  1ENV A;  4KUM A;  3T2M A;  4YJ3 A;  1SQF A;  1M5I A;  3RYH B;  1NVP B;  5L3B A;  4RWU A;  5LYJ A;  1AR4 A;  3QF7 A;  4K35 A;  2GDS A;  1WNS A;  4FLT A;  4EFE A;  3ABM B;  4NTW A;  4DV2 O;  3RT3 C;  1WB7 A;  1E1Q G;  2PZS A;  1AR1 B;  1VQ7 V;  5LGT A;  3CCR V;  1EN4 A;  3W7X A;  3B2E E;  4LH6 A;  1HWY A;  4FFB B;  4QE7 A;  4TV9 B;  3K04 A;  4PDL A;  1I5X A;  2XTA A;  1XNR O;  4DRX A;  4FPP A;  3OEE G;  3SYQ A;  2F4V O;  3CJH A;  3JYC A;  2H8P C;  1JA8 A;  1SA0 A;  2WLL A;  4DV4 O;  5B66 Z;  1FAF A;  1HNX B;  2OYQ A;  5IJ9 A;  5BMV B;  2RMK B;  5IYZ B;  3WB0 A;  4DRX B;  1RPO A;  3HKD A;  5LHI A;  3VQY A;  1N0N A;  3CJH B;  1M57 C;  3PJS K;  2ZCE A;  3RYC A;  1I94 O;  4JI6 B;  4X1Y A;  4JI6 O;  1N4C A;  2GTS A;  3JCZ A;  4G2K A;  3EVK A;  3AG2 C;  5KHH A;  4YHH B;  2PYJ A;  4BWA A;  4X64 B;  3C3S A;  5IYZ A;  2PY5 A;  4P9O A;  1BHA A;  3ETG A;  3CCU V;  2ZE7 A;  2XT9 A;  1K92 A;  4GX1 A;  4YIP A;  3CXH F;  3ABM C;  3Q4H A;  2WAM A;  5B1B B;  5B5E Z;  2P22 C;  3ZHQ A;  4DV0 O;  5FLX N;  2Q69 A;  2E3C A;  3D8C A;  4YXW G;  1DLB A;  2CTP A;  3ICX A;  3CYO A;  3ZJZ A;  1VQ9 V;  1URF A;  2NNU A;  3L71 H;  4MVS A;  3DSQ A;  4DR5 O;  1GKF A;  3B77 A;  4LBE C;  1AI4 A;  2P90 A;  3ZHU A;  2WWW A;  1K5S A;  3JAR A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  2QWQ B;  4J7Z A;  2CTW A;  2YS8 A;  1N4C A;  1IUR A;  2DN9 A;  4J80 A;  2DMX A;  2QSA A;  3UCS C;  2CTQ A;  1FAF A;  2CTP A;  2QWR B;  2QWO B;  2Y4U A;  2L6L A;  2N04 A;  2N05 A;  2PF4 E;  2CUG A;  3BVO A;  1WJZ A;  1NZ6 A;  2KQX A;  2M6Y A;  2CTR A;  2YUA A;  4IT5 A;  1XBL A;  2QWN B;  2QWP B;  3UO2 A;  2LGW A;  2GUZ A;  3AG7 A;  1GH6 A;  2OCH A;  1HDJ A;  2EJ7 A;  4RWU A;  1FPO A;  3APO A;  2GUZ B;  1BQ0 A;  3UO3 A;  2LO1 A;  1BQZ A;  3APQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...