2GUZA

Structure of the tim14-tim16 complex of the mitochondrial protein import motor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
GFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone, protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title Structure and function of Tim14 and Tim16, the J and J-like components of the mitochondrial protein import motor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 71
sequence length 71
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2006-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2guzA00
3UO2A 2Y4TA 1NZ6A 2CUGA 2M6YA 2N05A 2KQXA 1WJZA 4J80A 2DMXA 3UO3A 2OCHA 2N04A 2EJ7A 2QWRB 1XBLA 4J7ZA 2QSAA 1HDJA 2CTPA 2CTRA 2PF4E 1IURA 4IT5A 3BVOA 3UCSC 1BQZA 3AG7A 1N4CA 2YUAA 2QWOB 2L6LA 2LO1A 4RWUA 2GUZA 1FAFA 2QWPB 3APQA 2QWQB 2QWNB 2CTQA 3APOA 1GH6A 2DN9A 2YS8A 1BQ0A 2GUZB 2CTWA 2LGWA 2Y4UA 1FPOA
chains in the Genus database with same CATH superfamily
1VQKV 2H8PC 1RM1B 3OGIB 4FLTA 3BABA 4GT1A 2JGUA 4QJFB 2X6CA 4O4JA 4OPHA 4LR3A 5LXTB 4CH3A 5GONA 1Q81W 2GTAA 2QWOB 3WFVA 2QEXV 2UXDO 2HJDA 3W7WA 1UJWB 1FS0G 3ZMSA 4AI8A 2P7TC 3K9SA 1FXKC 2EJ7A 1GRJA 1KQSU 3JALB 4I55B 1R1BA 2DYRB 4DW1A 2UUBB 4X9QA 4YXWG 3HKBB 5EC1C 2ITDC 3QO7A 3CRQA 3NR7A 4K8ZA 4WFAV 5LYJB 4NXMB 1TVKB 1WP7A 3HKEB 1JFFB 3J80N 3WG7C 4XDJA 1KECA 4X65O 3MHHC 3FB5C 4L8JA 5KX5B 1XNRB 1Q6IA 2UXBO 5LL6Y 3M7MX 2ZE7A 3CJHB 2LFRA 5DN6G 1HR0B 5LHHA 5C8YB 3TK1A 2BTQB 3OGCC 2QGNA 4DR5B 4LF8B 1HNWB 2ZKOA 1FFXB 5EYPB 4DV0B 4B3SB 4KP4A 1V9PA 4IYIA 3CCLV 4O2AA 2E75B 2CH7B 4X64B 1SKVA 1GN2A 3ZHRA 5F2VO 4CBCA 1S76D 1SQFA 1BZKA 2EINC 3BRCA 2Y0PA 3U11A 2IJJA 3L9DA 5IDJA 3VQWA 1HR0O 4DR5O 5CBFA 1HNWO 2L6LA 2ZCEA 1K33A 2B9ZA 4B3SO 1YTFD 4JASA 1YSCA 5KMGA 5LP6B 2IU3A 4X66B 4JYAO 2AZ0A 2Q0OC 1YEWA 4WCEV 2E76B 4X64O 1GMGA 4OGQB 1QHTA 4LF7O 4P2ZA 1IXMA 1K5QA 3ABMB 1H8HG 4QE9A 3JSNA 1Y76B 3D36C 4F6RB 1NR1A 3CRAA 4H37A 3JASB 3U10A 4FM2A 3RN4A 3H1KH 3KG2A 1S0VA 4DV3B 2VQEB 2LW1A 2R9RB 2X6AA 1EN5A 1RPRA 3W7XA 2B1IA 2Y4UA 1WPBA 4UCVA 1SQBH 1AR4A 2VWJA 4UV9A 2YEVA 2ITCC 3ASOB 3OUSA 4PELA 1T5EA 5LA6A 1HDJA 2Q9LA 3ZN0A 1K8AW 2W0XA 3AG7A 2K1EA 4GKJB 4QE7A 2BSKA 2YSUB 2HLDG 2IH1C 3OT7A 4DV3O 2M6YA 1IX9A 2LP7A 1Z5VA 1VQ9V 2W6JG 2EIMB 5LGTA 1XBLA 2F1MA 2YIAA 4W4LA 3J7AU 4HYOA 2QM4A 4JI0O 3OEEG 1K9MW 3CE2A 4X62B 1I94O 2O57A 2ZD9A 2EIJC 4BWAA 2ZE5A 4JTCB 3J81N 5C93A 5E79Z 1GH6A 1Q86W 4U7OA 2BTOA 3B09A 2EBOA 4DYLA 1E1QG 3W7SA 1KC8W 3ETGA 4GKJO 5B1AC 5B5EZ 1D2DA 1CPYA 1BS3A 3SPIA 3BHPA 3TXQA 1X59A 2GV9A 4DXWA 4TV8B 1SESA 1JJOA 3KCYA 2Q7EA 2HKOA 1M56B 3MHSC 4O4HB 1Q82W 2EZPA 4I7ZB 4PDMA 1XILA 4LFCB 1AP6A 1FXKA 5H6QA 4B3RB 1CXZB 3BA8A 2YXLA 4LH7A 1VQPV 3RYHB 1TUEB 4E4EA 4FM1A 2UXNA 4LH6A 1R6TA 1SQPH 2Y0IA 1E79G 2LJ2A 3L75H 2LGWA 3FX7A 1NR7A 4DV5B 3IC9A 2RJZA 2BOBC 1V55C 4YIPA 2PF4E 3JD3A 4JI1B 2XOKG 1AJNA 3LDEA 5EIBD 3P3NA 4CC5A 2RQ6A 1BE3H 3FB7C 3OMNB 4OX9B 3T1YO 1WP8A 4TV9A 1M90W 2ZE8A 1VQ6V 2EJRA 3JATB 4JTAB 5KLVH 2X6BA 3LDCA 4JI1O 3S3XA 2Q69A 1KUQA 4JI8O 3G71V 5GTHZ 1J95A 1K97A 5IJ9B 1PM9A 4MS2A 4B3MB 2R9IA 2R72A 1IBLB 5EBMC 1S5JA 3CPWU 5BZBA 2DE0X 2QKAA 4DO2A 2GDSA 4OX9O 5JCOC 3RYIA 4DR7B 3WG7B 2JDIG 5KA6A 3JARB 2NLJC 2A06H 3WU2Z 4J7JA 1GM8A 1PPJH 1PD3A 4KHPB 4FIPC 1WJZA 2RNBA 2LGQA 5D5QA 1MNGA 5BXZA 2VQFB 4IIJA 3G80A 4R8CA 1N36B 3D36A 4U3JA 2EZOA 1OV9A 3DXRA 2ZQMA 2AXTZ 3ZN1A 2JJ1G 2QWQB 4I0XA 2UU9B 3AG4C 2JGDB 2JVDA 4JAVA 4B3MO 2Q5ZA 1M57C 5A9GA 4JI6B 1D5AA 3D8CA 3SPJA 1GKFA 1YXBA 4JZ2A 4X1KB 4J42A 1XL4A 3N2KA 1YJWV 4DR7O 2HVKC 2FB5A 3ABKC 2F43G 2EIKB 3ZRWA 4LF5B 4WFEA 3ZX6A 1WA8A 4P9PA 1YIJV 2XAGA 1GN4A 4K8XA 4MTXA 2Q68A 1IDSA 2DN9A 2GUZB 4GX1A 3K59A 1P7BA 5B1BC 4DR4B 3JAWA 2NNUA 2FL4A 4I4TA 3AG1C 1Q5OA 2CTPA 4FZ0A 4H33A 3AG2B 1GTOA 2D3OW 2WLKA 3JAKA 5CA0A 1FFTB 4P9OA 1W59A 3N2GB 3SDLA 1QCEA 3APQA 3Q4HA 2IJKA 2LFSA 4HNAA 2XUMA 1P49A 3ABTA 2N05A 2QJ1A 1B04A 1PNMA 2YIBA 2R9AA 3W7TA 2ADPA 1XL6A 1NI8A 4MW8A 3BFRA 1WAZA 4PDVA 3I5DA 1I5XA 2PGGA 2Q73A 2P5OA 3M8AA 2EX3A 3THOA 2CGNA 3AK2A 3JD2A 3K5OA 1YI2V 2Y69B 1R3LC 3RYCA 1EN6A 1TAEA 2HHHB 1ENVA 2EILC 1I7FA 1DLBA 2DOSA 1L1FA 1IURA 5J2TB 3UQ8A 1JX9A 4UCRA 2LO1A 3CCUV 3ASNC 2WLLA 3F7VC 4YJ2B 3ZHTA 3RBZA 4Z2WA 5LMUB 4J11A 4NTWA 4EEQA 2OT5A 3K79A 2CAZC 4J9ZB 5CB4B 4UVAA 1N0JA 4ZI7B 4FLYA 1V54C 5B1AB 3H9VA 3QG5A 2DWEC 4CH6A 2F95B 2YDEA 3O9OA 3SPCA 2CTQA 1H2NA 2CTWA 3RFRA 2WLIB 2P4KA 2Y4TA 1K7DA 5JQGA 4JGSA 3CCVV 3K9AA 4W4KA 1VIBA 2XAFA 1KD1W 1RFYA 2QTSA 1K73W 4PD4F 1BSMA 2JEUA 4DR3B 4TWKA 3BA9A 1W0JG 1Y66A 3QTCA 1LNQA 3ZRSA 4JV5B 3C3TA 2QKCA 4ZHQA 4DUZB 4IGGA 3VBBA 4MVMA 2AW9A 4KL1A 2JIZG 3RGBA 4H0LB 4KFMA 2AGAA 2ETNA 4I5SA 1P4RA 4DR6O 1QVGU 1BHBA 4I50B 3G6BA 4Z1MG 1XQ8A 4H13B 4DR3O 5JCOA 5IJ0A 1RSOA 2P67A 3ZRXA 4MSWC 3FKSG 1TA8A 3RYFA 5H9CA 5J2UA 5IYZB 3X2QC 4DUZO 4DUYB 3JCZA 3CHXA 3CS5A 4WFHA 5DECA 4B7EA 4FLVA 3I55V 1NTKH 1G4YB 3OAAG 5L3DA 1M1KW 3TETA 4X89A 1SS3A 2L35A 1LUVA 2P06A 1MABG 1QVFU 1L0LH 3B2EE 3GB7C 2IJIA 4DUYO 3H1LH 2OCCC 3F7YC 4R6ZA 1JJ2U 5CN0A 4FFBB 5IYBO 4FK5C 1KP3A 2DMXA 4TUYB 1OCRB 2DYSB 3LSSA 1L8DA 4EKWA 3IJ4A 1VQLV 3W7UA 1EZJA 4AQYB 2GTSA 3OMAB 4JI5B 1PNLA 4O4LA 1VF7A 4UCOA 4O4JB 1BCCH 4D7SA 4GKKB 3D3IA 4N23A 4B3TB 5GONB 1DK1A 1M9NA 1Y67A 3QO8A 2ZXWB 2UUBO 1DTOA 1TGOA 3CP1A 1KYOF 1Y74A 4FLXA 1H8EG 3JCUZ 4RO2A 1H2SB 2K9PA 4CS3A 1PV0A 4MVSA 1K34A 3BEHA 2PTMA 4QGPA 5K1PA 4UVCA 1MA1A 4NXMO 5B66Z 1DGSA 3ABKB 3JD4A 3B8MA 4FM0A 3BY6A 3OEHG 3SJAC 1HP8A 1OCOC 2XT9A 4FLZA 3UT5A 2N74A 4AQYO 1R3IC 1W0KG 3L70H 1OCZC 1XNRO 3SJCC 4GKKO 1S5HC 4BIOA 5J9PC 4RUEA 4B3TO 1Y4MA 3ZMZA 4X1YA 5B3SC 3FYIB 3L74H 4FZ1A 3AG1B 4CS4A 4MVUA 4LF8O 5HFLA 5BY1A 4DV0O 4YJ3A 3FB6C 1BL8A 1QLEC 3K5LA 2YS8A 5IY5C 4TOIA 3MDSA 5A2QN 1ROPA 2A3QA 2LW7A 1H38A 1YF2A 3VQVA 4LFBB 2M7WA 5KHKA 1W2BU 5CMUA 2QSAA 5ITZA 4LNUA 1IBKB 2QTOA 2Q67A 3F5TA 1XEQA 1K3EA 1ORQC 4IHJA 4PDRA 5IYDO 3APOA 2WSSG 4IL6Z 2V7QG 1Z5WA 1BGYH 2KG7A 3ABUA 3PJSK 4JF3A 1YCIA 1AJPA 3T4ZA 1WB8A 4X66O 4UFZA 2XTAA 2ARHA 2DW4A 3B77A 1N0NA 1ZAUA 4JI7B 2XHBA 4L87A 4BW5A 1QNMA 4UVBA 3ICXA 2EILB 1NTMH 2P6JA 3K5MA 1EN4A 3ZHQA 5KMGB 2VQEO 4LWSA 2WA3A 4PI2A 1FYJA 2Q7HA 2RDCA 3L72H 1QLNA 3CMAV 3CSXA 1BHAA 3GWOA 3K03A 3QNEA 4AILC 4J10A 3K3WA 1GO3F 1V54B 3E8FA 4IYHA 1VEWA 4F4LA 2OIGA 4JI7O 1AJQA 2ADQB 3E35A 2CUGA 2VS0A 4DV2B 1XOUA 4G2KA 3M99B 1G6UA 3LNNA 2XASA 3A0BZ 4BR6A 1DF4A 4LFAB 4MW3A 3ZMUA 2YEVB 4EFBA 3SYOA 2XAHA 5LA6B 4RWUA 3AG3B 4PA7A 1MG1A 4PA3A 1QR9A 4ZKIA 5IE9A 2ZE6A 1AROP 4RAIA 2WLJA 4X62O 2BSKB 1MSDA 1JMKC 3TXSA 4UCTA 2R70A 1GAXA 1KP2A 3LDDA 4DV4B 4DV2O 1XI1A 2OTLV 4X88A 1ZX3A 5JH7A 1TUBA 1QBZA 2C2AA 1OCCB 4NVPA 1A32A 4WF9V 3CCRV 5EBLC 3CCMV 1IVSA 5B1OA 2X7RB 5LMNB 4NXNB 5IT9N 5CA1A 2OTJV 3X2QB 1OJHA 5EK0A 3HKDA 3E89A 4LFCO 1XUQA 1P7GA 4B3RO 1WB7A 4DV4O 1SQQH 4DR2B 2WPDG 3RT3C 4HZ3A 1WLEA 3B40A 5KAFZ 2H3OA 4H44B 4CH5A 4WBNA 3FFQA 3U0ZA 3C3SA 1QU7A 4MTGA 2JS3A 4X20A 4Z1VA 1FXKB 4DV5O 3L73H 4G27B 5LMNO 2PI4A 3FB8C 1RM1C 1NTZH 1FJGB 1VARA 1MSWD 3OUFA 4JYBA 4UUJC 1NJIW 3JAMN 1M93A 4P30A 4B08A 3CC7V 4DR2O 4K0KB 3T4DA 2WA4A 1ZTEA 3E8HA 1FAFA 2V4DA 2DWDC 5JVDB 3E22A 2V1DA 2X0LA 5H6RA 1AI7A 2DYRC 3STZC 5GW7A 1FJGO 5LOVA 1MZEA 1VF5B 5L3CA 1SZTA 1AI6A 3KCXA 1Q6HA 3JD1A 4UB6Z 3CC2V 5EIBC 3BPZA 4YY3B 5BMVA 2WAMA 2EULA 4K0KO 1ZL8A 4MVZA 3K58A 4TV9B 1SA0A 1IBLO 2F23A 1FPOA 2Q6AA 2RCVA 2W0FC 3G4SV 1HNXB 1F51A 5DEDA 3A2FA 1R6NA 2RN9A 4XDLA 4GCZA 1YDXA 4DV6B 3UKMA 4DRXA 4LF9B 4O4IA 3A8TA 2FYUH 3DC5A 4KHPO 2EINB 2IW5A 4ICGA 5EZYA 3EHBB 1D5NA 3CYOA 4PHZA 2VQFO 1N36O 2A9HA 3HKCA 1Q7YW 4CS2A 4YY3O 3RYIB 1VQ8V 1UFIA 5CA3A 5AG2A 2UU9O 2H94A 2N04A 1AB3A 2XAJA 4J7ZA 4LCUC 1XMOB 1KMIZ 5FNVA 2ODMA 4JI6O 2KB1A 5CBHA 1HNXO 3RW0A 4JAAA 2DJVA 4IIJB 2CDYA 2WLNA 4U3JB 2ZM6B 2GSMB 4DV6O 3DXRB 2YI8A 1KU9A 3B4SA 2OIEA 2PYLA 4LF5O 1US6A 4I0XB 3H01A 2MK3A 1R3JC 1FXVA 3CCSV 3E2EA 2F66C 3ZHVA 4O2BA 1X4TA 3N2KB 5LP6C 4ASUG 4DR4O 4J7KA 4IT5A 5LHIA 5K1XA 3ZRWB 1XMOO 2HFEC 4GUNA 3WB0A 1WA8B 5EC2C 3QVNA 1SETA 3O65A 4D7TA 2PI5A 2PYJA 1EM1A 2PZSA 4N21A 1WNSA 1DF5A 3TGUH 3ETQA 4JI3B 3OTFA 3JAWB 1WN7A 4XBFA 5E1AC 1XNQB 4UCSA 1F4MA 1Q6UA 2B5UA 4I4TB 3C90A 1J5EB 3N27A 4F6EA 2JRIA 2E74B 3JAKB 3VQXA 1SQVH 5CA0B 3ASOC 4EB6A 3T2MA 3Q4HB 2UXCB 1H2LA 2EIJB 4HNAB 3OTOB 3SGIA 4LF6B 5BR8B 4ZBMA 3ML0A 5KHHA 2F93B 3CXCU 3K0GA 2A79B 4ZOLA 4ZIBA 2JEXA 3OR7C 5KHIA 4LC1A 1XMQB 4GZRB 2HHHO 1XNQO 4UV8A 2EIMC 2WLHA 3EXAA 5L3BA 4X1IA 1Z2GA 1J5EO 3STLC 1NZ6A 2HJFC 1IXBA 5LMUO 3ZRVA 3DTUB 1NVPB 2UXCO 1R73A 2ZDIC 2NR5A 4CH4A 1JCHA 3FAVA 3RYCB 4LF6O 1S3JA 4CC6A 5BR8O 1PL0A 2W6IG 2YUAA 2XAQA 3HPLC 2Q7GA 1NT2B 2WLLB 4NB5A 3B8NA 3ETDA 1H2KA 1XMQO 2PUSA 4J41A 5LXTA 3ZJZA 1SZXA 1MZFA 1MMMA 5IYCO 2CK3G 1JPXA 1M56C 1BT8A 3A0RA 3I56V 3CCQV 1V55B 1SQGA 3JSLA 4JAUA 2FMLA 1AR1B 3CMEV 4MVRA 3JALA 4I55A 4JV5O 1KBHA 1GK9A 3OFNG 3DC6A 4XDKA 5JQGB 4TT3G 2UXDB 3HKBA 2QKSA 5HFMA 1PKXA 1N4CA 4A5UB 5L3FA 5LYJA 4WFBV 1SC5B 1TVKA 4FLUA 3JYCA 3HKEA 1JFFA 2FKXA 3RVZA 3P30A 4ZHQB 4FPPA 4I9QA 2Z3YA 4FFKA 2DQ3A 3AK3A 5KX5A 4BW9A 1YHQV 1LR1A 4PJ0Z 1ZUQA 1MOFA 1ZLZA 3E8GA 3CB2A 1NBMG 3CJHA 2ILMA 2A7WA 4DW0A 5C8YA 1YITV 2BTQA 4FLWA 1FFXA 5EYPA 2YXHA 2KQXA 5IJ0B 4JTDB 1RSOB 4X65B 2CH7A 2UXBB 4C7UA 3RYFB 3ZHSA 5J2UB 1JR9A 2IU0A 2QWNB 2ZNIA 1COWG 1ZSPA 1H2MA 3K0DA 3SYQA 3QO5A 3ZMTA 3AG4B 5DM6V 1QR8A 1M57B 4ABMA 5KA5A 2HG5C 5LP6A 1P84F 1YZBA 4EFEA 2Y48A 1SQXH 1JA8A 3IAYA 2G38A 5LHGA 1GM7A 4JI5O 1EFRG 3KZIZ 3ZEDA 4MT8A 1Y76A 4JYCA 4F6RA 1R3KC 5FPRA 2OYQA 3JASA 4PI0A 2HP8A 2DQ0A 3L71H 4JYAB 1N33B 5B1BB 1NH2B 3OR6C 2BOCC 4NKGB 2YXYA 3LNMB 3BVOA 4LF7B 1BMFG 4MTOA 2ATKC 4R50A 1R6KA 1IBMB 4O4LB 1LUWA 2EIKC 1AI5A 3QF7A 3ZBHA 2IJHA 1Y74B 3F5WC 3FD9A 4TSFG 5LBQA 2AHZA 3P3PA 2GBOA 3OE7G 4NTYA 1N33O 1RPOA 1PL4A 4O2AB 3LUTB 3ABLC 4NYKA 3RWRD 3AG2C 3UT5B 3OMIB 1EBOA 5KAIZ 1VF6A 1IBMO 1YVWA 2MW2B 3K04A 2YIBD 2CTRA 4X1YB 2ZDIA 4CZZA 3H1JH 2D2CB 4LFBO 4NR1A 2OWOA 1PP9H 4HAMA 1IBKO 4JI0B 3ASNB 1SERA 4YJ3B 1I94B 1NVPD 1AI4A 4TV8A 1URFA 3E83A 4QIWF 2WLMA 4RQFA 3LSQA 1OZ0A 2LQTA 3IC7A 4LNUB 4O4HA 3EFFK 5ITZB 2Y69C 1KB9F 5FLXN 2QM7A 4IHJB 2QM8A 1G8MA 3G6EV 1VMGA 1FD9A 3UO3A 2KKWA 2KG7B 3RYHA 1Q43A 2F4VB 5CBGA 1ZWIC 4U3FH 2IH3C 2ZR2A 3FYEB 4MTFA 2QWPB 4YHHB 5H2FZ 3CRMA 3E8BA 2Q0AA 1S72V 3GWKC 2UUAB 3SJBC 1NQTA 4HBNA 1I0HA 4TQFA 2OCHA 4G28B 4UCUA 1AILA 2E5LB 4GX0A 4LWSB 3ZMVA 3G67A 5EBWC 1AVMA 1I08A 3DSQA 2F4VO 3VOUA 4LFAO 1K4DC 4YHHO 1M4UA 4DV1B 3ZCCA 4PA6A 3SYAA 4PA4A 2UUAO 4FVMA 1Q90D 2CE4A 1GN6A 5L3GA 3JATA 3OW2U 3UCSC 4FJCC 3BCCH 2QE7G 4JI4B 5D5PA 2E5LO 4U7NA 1VQNV 3T1YB 5IJ9A 1VQOV 2IM9A 2Z0AA 4OPAA 2QWRB 2ZINA 4R7CA 1O9GA 4MVOA 5JVDA 4DV7B 3NXSA 1Q8IA 3JARA 4DV1O 1NKDA 5H5NA 2JK5C 4JI8B 1GN3A 3T1CA 3R65A 3JD0A 4NXNO 3P32A 1VQ5V 5JH7B 1TUBB 4OXSA 4JI4O 4J80A 2OCCB 3SR2C 2YC0A 2AZ2A 1E1RG 2JJ2G 4AHCA 2Q4PA 1F7YA 3ZIAG 5JWPA 2JGDA 3TCUA 3IGAC 4BIZA 4DR1B 3HR0A 3LSUA 3HB3B 5CA1B 1M5IA 4X1KA 3E86A 4DV7O 2NN4A 3HKDB 3ZS8C 5LGUA 3CRRA 2RMKB 1CP9A 2Z5UA 2JS5A 3ETEA 4RQEA 3IFXA 1SRYA 2YICA 1NH2D 2YI9A 4BAYA 3K08A 4WBNB 1VQ7V 3OM3B 3WB2A 3AK1A 2GHYA 1N34B 3CCJV 2GUZA 1PNKA 5KUMA 4X20B 1S5LZ 1OCRC 5JJJB 2DYSC 2XNDG 1N32B 4DR1O 3UM7A 1OCOB 1SF9A 4RUFA 1AP5A 3GVMA 4WFFA 1U96A 5L3EA 4LF4B 1XREA 3CWBH 4QPJA 4E2LA 1B06A 4YIOA 3BAAA 5JJNB 1OCZB 3N2GA 5GTIZ 2UXXA 4GLXA 3CRCA 2ZXWC 5B3SB 3SYPA 1N34O 2P90A 2ZIOA 2IBZH 3VQYA 3E22B 2WWWA 3AEIA 4PV1B 1QLEB 5IY5B 3PN1A 4DK1A 1N32O 2VRZA 3K06A 5LOVB 4B7KA 1EZVH 1S77D 4K35A 2ZR3A 2QA4V 4LF4O 2BE3A 5KHGA 4PDLA 1YJ9V 2ZIMA 1HWYA 4LF9O 1BQ0A 5BMVB 3SPHA 2P22C 3UO2A 1ZL8B 4KXRA 3ABLB 3ZHUA 1N8RW 1B3QA 2CGOA 4UB8Z 1O9HA 1SA0B 4PA9A 3OD4A 2HEPA 2Q8VA 5J2TA 1VQ4V 2PY5A 1HW7A 4BIUA 4YJ2A 3WB1A 4FMTA 3H1HH 1HNZB 1H2GA 4DRXB 2VWKA 4O4IB 4DK0A 4LP8A 5CB4A 4QPKA 3CEIA 5EZYB 4ZI7A 3ABMC 1UPGA 3R66A 4WFGA 1RP3B 1G1XB 4GX5A 3HKCB 2ZM6O 3TJTA 3MD0A 4JI2B 5FPOA 1IZ3A 5JJEB 1K4CC 5FNVB 2WLIA 1VQMV 2P4VA 1YTFB 1B6QA 3CXHF 1THZA 2YIDA 4QNHB 1WPXA 3KKYA 1FKAO 1HNZO 2BCCH 1OHHG 1XHZA 4I9WA 3CX5F 1CEZA 1Q3EA 3SYCA 4NTXA 4JYYA 5LGNA 1BQZA 3T1HB 3CC4V 1L0NH 4J9YB 4O2BB 1K5SA 4JI3O 4JI2O 4LBEC 5IWAB 4MVQA 1F4NA 1F23A 1YJNV 2UUCB 1AR5A 5FL7G 4Q6GA 1VF6C 1VP7A 1XDCA 1JQ0A 1Y6XA 4Q20A 1U97A 4I50A 4KUMA 3OTOO 4JZGA 5KHJA 3A0HZ 2AHYA 3RVYA 4K3AA 3S3WA 2ZT9B 3CD6V 5IYZA 1KKDA 3T1HO 4X8AA 3K5NA 4TQDA 4DR6B 2FTKA 4EB6B 3EVKA 5IWAO 3AG3C 4GYCB 3SJQC 3D3QA 2A0LA 3K57A 2UUCO 3H1IH 1XHXA 4UXNA 1JOYA 1GM9A 1NS1A 2HVJC 2E3CA 3CCEV 5TISZ 4ZOLB 2QR4A 4GX2A 3MAQA 1JVMA 2KSDA 3DGEA 1I5YA 4D6TH 1KKCA 2HR3A 4X1IB 3SPGA 1QQCA 1FXHA 2QDOA 2B1GA 1OCCC 1K92A 2ZNJA 4JPRA 1NU1H 3FAVB 5KUKA 5B1NA 4FFBA 4TUYA
chains in the Genus database with same CATH topology
3UO2A 2Y4TA 1NZ6A 2CUGA 2M6YA 2N05A 2KQXA 1WJZA 4J80A 2DMXA 3UO3A 2OCHA 2N04A 2EJ7A 2QWRB 1XBLA 4J7ZA 2QSAA 1HDJA 2CTPA 2CTRA 2PF4E 1IURA 4IT5A 3BVOA 3UCSC 1BQZA 3AG7A 1N4CA 2YUAA 2QWOB 2L6LA 2LO1A 4RWUA 2GUZA 1FAFA 2QWPB 3APQA 2QWQB 2QWNB 2CTQA 3APOA 1GH6A 2DN9A 2YS8A 1BQ0A 2GUZB 2CTWA 2LGWA 2Y4UA 1FPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO2 A;  2Y4T A;  1NZ6 A;  2CUG A;  2M6Y A;  2N05 A;  2KQX A;  1WJZ A;  4J80 A;  2DMX A;  3UO3 A;  2OCH A;  2N04 A;  2EJ7 A;  2QWR B;  1XBL A;  4J7Z A;  2QSA A;  1HDJ A;  2CTP A;  2CTR A;  2PF4 E;  1IUR A;  4IT5 A;  3BVO A;  3UCS C;  1BQZ A;  3AG7 A;  1N4C A;  2YUA A;  2QWO B;  2L6L A;  2LO1 A;  4RWU A;  2GUZ A;  1FAF A;  2QWP B;  3APQ A;  2QWQ B;  2QWN B;  2CTQ A;  3APO A;  1GH6 A;  2DN9 A;  2YS8 A;  1BQ0 A;  2GUZ B;  2CTW A;  2LGW A;  2Y4U A;  1FPO A; 
#chains in the Genus database with same CATH topology
 1VQK V;  2H8P C;  1RM1 B;  3OGI B;  4FLT A;  3BAB A;  4GT1 A;  2JGU A;  4QJF B;  2X6C A;  4O4J A;  4OPH A;  4LR3 A;  5LXT B;  4CH3 A;  5GON A;  1Q81 W;  2GTA A;  2QWO B;  3WFV A;  2QEX V;  2UXD O;  2HJD A;  3W7W A;  1UJW B;  1FS0 G;  3ZMS A;  4AI8 A;  2P7T C;  3K9S A;  1FXK C;  2EJ7 A;  1GRJ A;  1KQS U;  3JAL B;  4I55 B;  1R1B A;  2DYR B;  4DW1 A;  2UUB B;  4X9Q A;  4YXW G;  3HKB B;  5EC1 C;  2ITD C;  3QO7 A;  3CRQ A;  3NR7 A;  4K8Z A;  4WFA V;  5LYJ B;  4NXM B;  1TVK B;  1WP7 A;  3HKE B;  1JFF B;  3J80 N;  3WG7 C;  4XDJ A;  1KEC A;  4X65 O;  3MHH C;  3FB5 C;  4L8J A;  5KX5 B;  1XNR B;  1Q6I A;  2UXB O;  5LL6 Y;  3M7M X;  2ZE7 A;  3CJH B;  2LFR A;  5DN6 G;  1HR0 B;  5LHH A;  5C8Y B;  3TK1 A;  2BTQ B;  3OGC C;  2QGN A;  4DR5 B;  4LF8 B;  1HNW B;  2ZKO A;  1FFX B;  5EYP B;  4DV0 B;  4B3S B;  4KP4 A;  1V9P A;  4IYI A;  3CCL V;  4O2A A;  2E75 B;  2CH7 B;  4X64 B;  1SKV A;  1GN2 A;  3ZHR A;  5F2V O;  4CBC A;  1S76 D;  1SQF A;  1BZK A;  2EIN C;  3BRC A;  2Y0P A;  3U11 A;  2IJJ A;  3L9D A;  5IDJ A;  3VQW A;  1HR0 O;  4DR5 O;  5CBF A;  1HNW O;  2L6L A;  2ZCE A;  1K33 A;  2B9Z A;  4B3S O;  1YTF D;  4JAS A;  1YSC A;  5KMG A;  5LP6 B;  2IU3 A;  4X66 B;  4JYA O;  2AZ0 A;  2Q0O C;  1YEW A;  4WCE V;  2E76 B;  4X64 O;  1GMG A;  4OGQ B;  1QHT A;  4LF7 O;  4P2Z A;  1IXM A;  1K5Q A;  3ABM B;  1H8H G;  4QE9 A;  3JSN A;  1Y76 B;  3D36 C;  4F6R B;  1NR1 A;  3CRA A;  4H37 A;  3JAS B;  3U10 A;  4FM2 A;  3RN4 A;  3H1K H;  3KG2 A;  1S0V A;  4DV3 B;  2VQE B;  2LW1 A;  2R9R B;  2X6A A;  1EN5 A;  1RPR A;  3W7X A;  2B1I A;  2Y4U A;  1WPB A;  4UCV A;  1SQB H;  1AR4 A;  2VWJ A;  4UV9 A;  2YEV A;  2ITC C;  3ASO B;  3OUS A;  4PEL A;  1T5E A;  5LA6 A;  1HDJ A;  2Q9L A;  3ZN0 A;  1K8A W;  2W0X A;  3AG7 A;  2K1E A;  4GKJ B;  4QE7 A;  2BSK A;  2YSU B;  2HLD G;  2IH1 C;  3OT7 A;  4DV3 O;  2M6Y A;  1IX9 A;  2LP7 A;  1Z5V A;  1VQ9 V;  2W6J G;  2EIM B;  5LGT A;  1XBL A;  2F1M A;  2YIA A;  4W4L A;  3J7A U;  4HYO A;  2QM4 A;  4JI0 O;  3OEE G;  1K9M W;  3CE2 A;  4X62 B;  1I94 O;  2O57 A;  2ZD9 A;  2EIJ C;  4BWA A;  2ZE5 A;  4JTC B;  3J81 N;  5C93 A;  5E79 Z;  1GH6 A;  1Q86 W;  4U7O A;  2BTO A;  3B09 A;  2EBO A;  4DYL A;  1E1Q G;  3W7S A;  1KC8 W;  3ETG A;  4GKJ O;  5B1A C;  5B5E Z;  1D2D A;  1CPY A;  1BS3 A;  3SPI A;  3BHP A;  3TXQ A;  1X59 A;  2GV9 A;  4DXW A;  4TV8 B;  1SES A;  1JJO A;  3KCY A;  2Q7E A;  2HKO A;  1M56 B;  3MHS C;  4O4H B;  1Q82 W;  2EZP A;  4I7Z B;  4PDM A;  1XIL A;  4LFC B;  1AP6 A;  1FXK A;  5H6Q A;  4B3R B;  1CXZ B;  3BA8 A;  2YXL A;  4LH7 A;  1VQP V;  3RYH B;  1TUE B;  4E4E A;  4FM1 A;  2UXN A;  4LH6 A;  1R6T A;  1SQP H;  2Y0I A;  1E79 G;  2LJ2 A;  3L75 H;  2LGW A;  3FX7 A;  1NR7 A;  4DV5 B;  3IC9 A;  2RJZ A;  2BOB C;  1V55 C;  4YIP A;  2PF4 E;  3JD3 A;  4JI1 B;  2XOK G;  1AJN A;  3LDE A;  5EIB D;  3P3N A;  4CC5 A;  2RQ6 A;  1BE3 H;  3FB7 C;  3OMN B;  4OX9 B;  3T1Y O;  1WP8 A;  4TV9 A;  1M90 W;  2ZE8 A;  1VQ6 V;  2EJR A;  3JAT B;  4JTA B;  5KLV H;  2X6B A;  3LDC A;  4JI1 O;  3S3X A;  2Q69 A;  1KUQ A;  4JI8 O;  3G71 V;  5GTH Z;  1J95 A;  1K97 A;  5IJ9 B;  1PM9 A;  4MS2 A;  4B3M B;  2R9I A;  2R72 A;  1IBL B;  5EBM C;  1S5J A;  3CPW U;  5BZB A;  2DE0 X;  2QKA A;  4DO2 A;  2GDS A;  4OX9 O;  5JCO C;  3RYI A;  4DR7 B;  3WG7 B;  2JDI G;  5KA6 A;  3JAR B;  2NLJ C;  2A06 H;  3WU2 Z;  4J7J A;  1GM8 A;  1PPJ H;  1PD3 A;  4KHP B;  4FIP C;  1WJZ A;  2RNB A;  2LGQ A;  5D5Q A;  1MNG A;  5BXZ A;  2VQF B;  4IIJ A;  3G80 A;  4R8C A;  1N36 B;  3D36 A;  4U3J A;  2EZO A;  1OV9 A;  3DXR A;  2ZQM A;  2AXT Z;  3ZN1 A;  2JJ1 G;  2QWQ B;  4I0X A;  2UU9 B;  3AG4 C;  2JGD B;  2JVD A;  4JAV A;  4B3M O;  2Q5Z A;  1M57 C;  5A9G A;  4JI6 B;  1D5A A;  3D8C A;  3SPJ A;  1GKF A;  1YXB A;  4JZ2 A;  4X1K B;  4J42 A;  1XL4 A;  3N2K A;  1YJW V;  4DR7 O;  2HVK C;  2FB5 A;  3ABK C;  2F43 G;  2EIK B;  3ZRW A;  4LF5 B;  4WFE A;  3ZX6 A;  1WA8 A;  4P9P A;  1YIJ V;  2XAG A;  1GN4 A;  4K8X A;  4MTX A;  2Q68 A;  1IDS A;  2DN9 A;  2GUZ B;  4GX1 A;  3K59 A;  1P7B A;  5B1B C;  4DR4 B;  3JAW A;  2NNU A;  2FL4 A;  4I4T A;  3AG1 C;  1Q5O A;  2CTP A;  4FZ0 A;  4H33 A;  3AG2 B;  1GTO A;  2D3O W;  2WLK A;  3JAK A;  5CA0 A;  1FFT B;  4P9O A;  1W59 A;  3N2G B;  3SDL A;  1QCE A;  3APQ A;  3Q4H A;  2IJK A;  2LFS A;  4HNA A;  2XUM A;  1P49 A;  3ABT A;  2N05 A;  2QJ1 A;  1B04 A;  1PNM A;  2YIB A;  2R9A A;  3W7T A;  2ADP A;  1XL6 A;  1NI8 A;  4MW8 A;  3BFR A;  1WAZ A;  4PDV A;  3I5D A;  1I5X A;  2PGG A;  2Q73 A;  2P5O A;  3M8A A;  2EX3 A;  3THO A;  2CGN A;  3AK2 A;  3JD2 A;  3K5O A;  1YI2 V;  2Y69 B;  1R3L C;  3RYC A;  1EN6 A;  1TAE A;  2HHH B;  1ENV A;  2EIL C;  1I7F A;  1DLB A;  2DOS A;  1L1F A;  1IUR A;  5J2T B;  3UQ8 A;  1JX9 A;  4UCR A;  2LO1 A;  3CCU V;  3ASN C;  2WLL A;  3F7V C;  4YJ2 B;  3ZHT A;  3RBZ A;  4Z2W A;  5LMU B;  4J11 A;  4NTW A;  4EEQ A;  2OT5 A;  3K79 A;  2CAZ C;  4J9Z B;  5CB4 B;  4UVA A;  1N0J A;  4ZI7 B;  4FLY A;  1V54 C;  5B1A B;  3H9V A;  3QG5 A;  2DWE C;  4CH6 A;  2F95 B;  2YDE A;  3O9O A;  3SPC A;  2CTQ A;  1H2N A;  2CTW A;  3RFR A;  2WLI B;  2P4K A;  2Y4T A;  1K7D A;  5JQG A;  4JGS A;  3CCV V;  3K9A A;  4W4K A;  1VIB A;  2XAF A;  1KD1 W;  1RFY A;  2QTS A;  1K73 W;  4PD4 F;  1BSM A;  2JEU A;  4DR3 B;  4TWK A;  3BA9 A;  1W0J G;  1Y66 A;  3QTC A;  1LNQ A;  3ZRS A;  4JV5 B;  3C3T A;  2QKC A;  4ZHQ A;  4DUZ B;  4IGG A;  3VBB A;  4MVM A;  2AW9 A;  4KL1 A;  2JIZ G;  3RGB A;  4H0L B;  4KFM A;  2AGA A;  2ETN A;  4I5S A;  1P4R A;  4DR6 O;  1QVG U;  1BHB A;  4I50 B;  3G6B A;  4Z1M G;  1XQ8 A;  4H13 B;  4DR3 O;  5JCO A;  5IJ0 A;  1RSO A;  2P67 A;  3ZRX A;  4MSW C;  3FKS G;  1TA8 A;  3RYF A;  5H9C A;  5J2U A;  5IYZ B;  3X2Q C;  4DUZ O;  4DUY B;  3JCZ A;  3CHX A;  3CS5 A;  4WFH A;  5DEC A;  4B7E A;  4FLV A;  3I55 V;  1NTK H;  1G4Y B;  3OAA G;  5L3D A;  1M1K W;  3TET A;  4X89 A;  1SS3 A;  2L35 A;  1LUV A;  2P06 A;  1MAB G;  1QVF U;  1L0L H;  3B2E E;  3GB7 C;  2IJI A;  4DUY O;  3H1L H;  2OCC C;  3F7Y C;  4R6Z A;  1JJ2 U;  5CN0 A;  4FFB B;  5IYB O;  4FK5 C;  1KP3 A;  2DMX A;  4TUY B;  1OCR B;  2DYS B;  3LSS A;  1L8D A;  4EKW A;  3IJ4 A;  1VQL V;  3W7U A;  1EZJ A;  4AQY B;  2GTS A;  3OMA B;  4JI5 B;  1PNL A;  4O4L A;  1VF7 A;  4UCO A;  4O4J B;  1BCC H;  4D7S A;  4GKK B;  3D3I A;  4N23 A;  4B3T B;  5GON B;  1DK1 A;  1M9N A;  1Y67 A;  3QO8 A;  2ZXW B;  2UUB O;  1DTO A;  1TGO A;  3CP1 A;  1KYO F;  1Y74 A;  4FLX A;  1H8E G;  3JCU Z;  4RO2 A;  1H2S B;  2K9P A;  4CS3 A;  1PV0 A;  4MVS A;  1K34 A;  3BEH A;  2PTM A;  4QGP A;  5K1P A;  4UVC A;  1MA1 A;  4NXM O;  5B66 Z;  1DGS A;  3ABK B;  3JD4 A;  3B8M A;  4FM0 A;  3BY6 A;  3OEH G;  3SJA C;  1HP8 A;  1OCO C;  2XT9 A;  4FLZ A;  3UT5 A;  2N74 A;  4AQY O;  1R3I C;  1W0K G;  3L70 H;  1OCZ C;  1XNR O;  3SJC C;  4GKK O;  1S5H C;  4BIO A;  5J9P C;  4RUE A;  4B3T O;  1Y4M A;  3ZMZ A;  4X1Y A;  5B3S C;  3FYI B;  3L74 H;  4FZ1 A;  3AG1 B;  4CS4 A;  4MVU A;  4LF8 O;  5HFL A;  5BY1 A;  4DV0 O;  4YJ3 A;  3FB6 C;  1BL8 A;  1QLE C;  3K5L A;  2YS8 A;  5IY5 C;  4TOI A;  3MDS A;  5A2Q N;  1ROP A;  2A3Q A;  2LW7 A;  1H38 A;  1YF2 A;  3VQV A;  4LFB B;  2M7W A;  5KHK A;  1W2B U;  5CMU A;  2QSA A;  5ITZ A;  4LNU A;  1IBK B;  2QTO A;  2Q67 A;  3F5T A;  1XEQ A;  1K3E A;  1ORQ C;  4IHJ A;  4PDR A;  5IYD O;  3APO A;  2WSS G;  4IL6 Z;  2V7Q G;  1Z5W A;  1BGY H;  2KG7 A;  3ABU A;  3PJS K;  4JF3 A;  1YCI A;  1AJP A;  3T4Z A;  1WB8 A;  4X66 O;  4UFZ A;  2XTA A;  2ARH A;  2DW4 A;  3B77 A;  1N0N A;  1ZAU A;  4JI7 B;  2XHB A;  4L87 A;  4BW5 A;  1QNM A;  4UVB A;  3ICX A;  2EIL B;  1NTM H;  2P6J A;  3K5M A;  1EN4 A;  3ZHQ A;  5KMG B;  2VQE O;  4LWS A;  2WA3 A;  4PI2 A;  1FYJ A;  2Q7H A;  2RDC A;  3L72 H;  1QLN A;  3CMA V;  3CSX A;  1BHA A;  3GWO A;  3K03 A;  3QNE A;  4AIL C;  4J10 A;  3K3W A;  1GO3 F;  1V54 B;  3E8F A;  4IYH A;  1VEW A;  4F4L A;  2OIG A;  4JI7 O;  1AJQ A;  2ADQ B;  3E35 A;  2CUG A;  2VS0 A;  4DV2 B;  1XOU A;  4G2K A;  3M99 B;  1G6U A;  3LNN A;  2XAS A;  3A0B Z;  4BR6 A;  1DF4 A;  4LFA B;  4MW3 A;  3ZMU A;  2YEV B;  4EFB A;  3SYO A;  2XAH A;  5LA6 B;  4RWU A;  3AG3 B;  4PA7 A;  1MG1 A;  4PA3 A;  1QR9 A;  4ZKI A;  5IE9 A;  2ZE6 A;  1ARO P;  4RAI A;  2WLJ A;  4X62 O;  2BSK B;  1MSD A;  1JMK C;  3TXS A;  4UCT A;  2R70 A;  1GAX A;  1KP2 A;  3LDD A;  4DV4 B;  4DV2 O;  1XI1 A;  2OTL V;  4X88 A;  1ZX3 A;  5JH7 A;  1TUB A;  1QBZ A;  2C2A A;  1OCC B;  4NVP A;  1A32 A;  4WF9 V;  3CCR V;  5EBL C;  3CCM V;  1IVS A;  5B1O A;  2X7R B;  5LMN B;  4NXN B;  5IT9 N;  5CA1 A;  2OTJ V;  3X2Q B;  1OJH A;  5EK0 A;  3HKD A;  3E89 A;  4LFC O;  1XUQ A;  1P7G A;  4B3R O;  1WB7 A;  4DV4 O;  1SQQ H;  4DR2 B;  2WPD G;  3RT3 C;  4HZ3 A;  1WLE A;  3B40 A;  5KAF Z;  2H3O A;  4H44 B;  4CH5 A;  4WBN A;  3FFQ A;  3U0Z A;  3C3S A;  1QU7 A;  4MTG A;  2JS3 A;  4X20 A;  4Z1V A;  1FXK B;  4DV5 O;  3L73 H;  4G27 B;  5LMN O;  2PI4 A;  3FB8 C;  1RM1 C;  1NTZ H;  1FJG B;  1VAR A;  1MSW D;  3OUF A;  4JYB A;  4UUJ C;  1NJI W;  3JAM N;  1M93 A;  4P30 A;  4B08 A;  3CC7 V;  4DR2 O;  4K0K B;  3T4D A;  2WA4 A;  1ZTE A;  3E8H A;  1FAF A;  2V4D A;  2DWD C;  5JVD B;  3E22 A;  2V1D A;  2X0L A;  5H6R A;  1AI7 A;  2DYR C;  3STZ C;  5GW7 A;  1FJG O;  5LOV A;  1MZE A;  1VF5 B;  5L3C A;  1SZT A;  1AI6 A;  3KCX A;  1Q6H A;  3JD1 A;  4UB6 Z;  3CC2 V;  5EIB C;  3BPZ A;  4YY3 B;  5BMV A;  2WAM A;  2EUL A;  4K0K O;  1ZL8 A;  4MVZ A;  3K58 A;  4TV9 B;  1SA0 A;  1IBL O;  2F23 A;  1FPO A;  2Q6A A;  2RCV A;  2W0F C;  3G4S V;  1HNX B;  1F51 A;  5DED A;  3A2F A;  1R6N A;  2RN9 A;  4XDL A;  4GCZ A;  1YDX A;  4DV6 B;  3UKM A;  4DRX A;  4LF9 B;  4O4I A;  3A8T A;  2FYU H;  3DC5 A;  4KHP O;  2EIN B;  2IW5 A;  4ICG A;  5EZY A;  3EHB B;  1D5N A;  3CYO A;  4PHZ A;  2VQF O;  1N36 O;  2A9H A;  3HKC A;  1Q7Y W;  4CS2 A;  4YY3 O;  3RYI B;  1VQ8 V;  1UFI A;  5CA3 A;  5AG2 A;  2UU9 O;  2H94 A;  2N04 A;  1AB3 A;  2XAJ A;  4J7Z A;  4LCU C;  1XMO B;  1KMI Z;  5FNV A;  2ODM A;  4JI6 O;  2KB1 A;  5CBH A;  1HNX O;  3RW0 A;  4JAA A;  2DJV A;  4IIJ B;  2CDY A;  2WLN A;  4U3J B;  2ZM6 B;  2GSM B;  4DV6 O;  3DXR B;  2YI8 A;  1KU9 A;  3B4S A;  2OIE A;  2PYL A;  4LF5 O;  1US6 A;  4I0X B;  3H01 A;  2MK3 A;  1R3J C;  1FXV A;  3CCS V;  3E2E A;  2F66 C;  3ZHV A;  4O2B A;  1X4T A;  3N2K B;  5LP6 C;  4ASU G;  4DR4 O;  4J7K A;  4IT5 A;  5LHI A;  5K1X A;  3ZRW B;  1XMO O;  2HFE C;  4GUN A;  3WB0 A;  1WA8 B;  5EC2 C;  3QVN A;  1SET A;  3O65 A;  4D7T A;  2PI5 A;  2PYJ A;  1EM1 A;  2PZS A;  4N21 A;  1WNS A;  1DF5 A;  3TGU H;  3ETQ A;  4JI3 B;  3OTF A;  3JAW B;  1WN7 A;  4XBF A;  5E1A C;  1XNQ B;  4UCS A;  1F4M A;  1Q6U A;  2B5U A;  4I4T B;  3C90 A;  1J5E B;  3N27 A;  4F6E A;  2JRI A;  2E74 B;  3JAK B;  3VQX A;  1SQV H;  5CA0 B;  3ASO C;  4EB6 A;  3T2M A;  3Q4H B;  2UXC B;  1H2L A;  2EIJ B;  4HNA B;  3OTO B;  3SGI A;  4LF6 B;  5BR8 B;  4ZBM A;  3ML0 A;  5KHH A;  2F93 B;  3CXC U;  3K0G A;  2A79 B;  4ZOL A;  4ZIB A;  2JEX A;  3OR7 C;  5KHI A;  4LC1 A;  1XMQ B;  4GZR B;  2HHH O;  1XNQ O;  4UV8 A;  2EIM C;  2WLH A;  3EXA A;  5L3B A;  4X1I A;  1Z2G A;  1J5E O;  3STL C;  1NZ6 A;  2HJF C;  1IXB A;  5LMU O;  3ZRV A;  3DTU B;  1NVP B;  2UXC O;  1R73 A;  2ZDI C;  2NR5 A;  4CH4 A;  1JCH A;  3FAV A;  3RYC B;  4LF6 O;  1S3J A;  4CC6 A;  5BR8 O;  1PL0 A;  2W6I G;  2YUA A;  2XAQ A;  3HPL C;  2Q7G A;  1NT2 B;  2WLL B;  4NB5 A;  3B8N A;  3ETD A;  1H2K A;  1XMQ O;  2PUS A;  4J41 A;  5LXT A;  3ZJZ A;  1SZX A;  1MZF A;  1MMM A;  5IYC O;  2CK3 G;  1JPX A;  1M56 C;  1BT8 A;  3A0R A;  3I56 V;  3CCQ V;  1V55 B;  1SQG A;  3JSL A;  4JAU A;  2FML A;  1AR1 B;  3CME V;  4MVR A;  3JAL A;  4I55 A;  4JV5 O;  1KBH A;  1GK9 A;  3OFN G;  3DC6 A;  4XDK A;  5JQG B;  4TT3 G;  2UXD B;  3HKB A;  2QKS A;  5HFM A;  1PKX A;  1N4C A;  4A5U B;  5L3F A;  5LYJ A;  4WFB V;  1SC5 B;  1TVK A;  4FLU A;  3JYC A;  3HKE A;  1JFF A;  2FKX A;  3RVZ A;  3P30 A;  4ZHQ B;  4FPP A;  4I9Q A;  2Z3Y A;  4FFK A;  2DQ3 A;  3AK3 A;  5KX5 A;  4BW9 A;  1YHQ V;  1LR1 A;  4PJ0 Z;  1ZUQ A;  1MOF A;  1ZLZ A;  3E8G A;  3CB2 A;  1NBM G;  3CJH A;  2ILM A;  2A7W A;  4DW0 A;  5C8Y A;  1YIT V;  2BTQ A;  4FLW A;  1FFX A;  5EYP A;  2YXH A;  2KQX A;  5IJ0 B;  4JTD B;  1RSO B;  4X65 B;  2CH7 A;  2UXB B;  4C7U A;  3RYF B;  3ZHS A;  5J2U B;  1JR9 A;  2IU0 A;  2QWN B;  2ZNI A;  1COW G;  1ZSP A;  1H2M A;  3K0D A;  3SYQ A;  3QO5 A;  3ZMT A;  3AG4 B;  5DM6 V;  1QR8 A;  1M57 B;  4ABM A;  5KA5 A;  2HG5 C;  5LP6 A;  1P84 F;  1YZB A;  4EFE A;  2Y48 A;  1SQX H;  1JA8 A;  3IAY A;  2G38 A;  5LHG A;  1GM7 A;  4JI5 O;  1EFR G;  3KZI Z;  3ZED A;  4MT8 A;  1Y76 A;  4JYC A;  4F6R A;  1R3K C;  5FPR A;  2OYQ A;  3JAS A;  4PI0 A;  2HP8 A;  2DQ0 A;  3L71 H;  4JYA B;  1N33 B;  5B1B B;  1NH2 B;  3OR6 C;  2BOC C;  4NKG B;  2YXY A;  3LNM B;  3BVO A;  4LF7 B;  1BMF G;  4MTO A;  2ATK C;  4R50 A;  1R6K A;  1IBM B;  4O4L B;  1LUW A;  2EIK C;  1AI5 A;  3QF7 A;  3ZBH A;  2IJH A;  1Y74 B;  3F5W C;  3FD9 A;  4TSF G;  5LBQ A;  2AHZ A;  3P3P A;  2GBO A;  3OE7 G;  4NTY A;  1N33 O;  1RPO A;  1PL4 A;  4O2A B;  3LUT B;  3ABL C;  4NYK A;  3RWR D;  3AG2 C;  3UT5 B;  3OMI B;  1EBO A;  5KAI Z;  1VF6 A;  1IBM O;  1YVW A;  2MW2 B;  3K04 A;  2YIB D;  2CTR A;  4X1Y B;  2ZDI A;  4CZZ A;  3H1J H;  2D2C B;  4LFB O;  4NR1 A;  2OWO A;  1PP9 H;  4HAM A;  1IBK O;  4JI0 B;  3ASN B;  1SER A;  4YJ3 B;  1I94 B;  1NVP D;  1AI4 A;  4TV8 A;  1URF A;  3E83 A;  4QIW F;  2WLM A;  4RQF A;  3LSQ A;  1OZ0 A;  2LQT A;  3IC7 A;  4LNU B;  4O4H A;  3EFF K;  5ITZ B;  2Y69 C;  1KB9 F;  5FLX N;  2QM7 A;  4IHJ B;  2QM8 A;  1G8M A;  3G6E V;  1VMG A;  1FD9 A;  3UO3 A;  2KKW A;  2KG7 B;  3RYH A;  1Q43 A;  2F4V B;  5CBG A;  1ZWI C;  4U3F H;  2IH3 C;  2ZR2 A;  3FYE B;  4MTF A;  2QWP B;  4YHH B;  5H2F Z;  3CRM A;  3E8B A;  2Q0A A;  1S72 V;  3GWK C;  2UUA B;  3SJB C;  1NQT A;  4HBN A;  1I0H A;  4TQF A;  2OCH A;  4G28 B;  4UCU A;  1AIL A;  2E5L B;  4GX0 A;  4LWS B;  3ZMV A;  3G67 A;  5EBW C;  1AVM A;  1I08 A;  3DSQ A;  2F4V O;  3VOU A;  4LFA O;  1K4D C;  4YHH O;  1M4U A;  4DV1 B;  3ZCC A;  4PA6 A;  3SYA A;  4PA4 A;  2UUA O;  4FVM A;  1Q90 D;  2CE4 A;  1GN6 A;  5L3G A;  3JAT A;  3OW2 U;  3UCS C;  4FJC C;  3BCC H;  2QE7 G;  4JI4 B;  5D5P A;  2E5L O;  4U7N A;  1VQN V;  3T1Y B;  5IJ9 A;  1VQO V;  2IM9 A;  2Z0A A;  4OPA A;  2QWR B;  2ZIN A;  4R7C A;  1O9G A;  4MVO A;  5JVD A;  4DV7 B;  3NXS A;  1Q8I A;  3JAR A;  4DV1 O;  1NKD A;  5H5N A;  2JK5 C;  4JI8 B;  1GN3 A;  3T1C A;  3R65 A;  3JD0 A;  4NXN O;  3P32 A;  1VQ5 V;  5JH7 B;  1TUB B;  4OXS A;  4JI4 O;  4J80 A;  2OCC B;  3SR2 C;  2YC0 A;  2AZ2 A;  1E1R G;  2JJ2 G;  4AHC A;  2Q4P A;  1F7Y A;  3ZIA G;  5JWP A;  2JGD A;  3TCU A;  3IGA C;  4BIZ A;  4DR1 B;  3HR0 A;  3LSU A;  3HB3 B;  5CA1 B;  1M5I A;  4X1K A;  3E86 A;  4DV7 O;  2NN4 A;  3HKD B;  3ZS8 C;  5LGU A;  3CRR A;  2RMK B;  1CP9 A;  2Z5U A;  2JS5 A;  3ETE A;  4RQE A;  3IFX A;  1SRY A;  2YIC A;  1NH2 D;  2YI9 A;  4BAY A;  3K08 A;  4WBN B;  1VQ7 V;  3OM3 B;  3WB2 A;  3AK1 A;  2GHY A;  1N34 B;  3CCJ V;  2GUZ A;  1PNK A;  5KUM A;  4X20 B;  1S5L Z;  1OCR C;  5JJJ B;  2DYS C;  2XND G;  1N32 B;  4DR1 O;  3UM7 A;  1OCO B;  1SF9 A;  4RUF A;  1AP5 A;  3GVM A;  4WFF A;  1U96 A;  5L3E A;  4LF4 B;  1XRE A;  3CWB H;  4QPJ A;  4E2L A;  1B06 A;  4YIO A;  3BAA A;  5JJN B;  1OCZ B;  3N2G A;  5GTI Z;  2UXX A;  4GLX A;  3CRC A;  2ZXW C;  5B3S B;  3SYP A;  1N34 O;  2P90 A;  2ZIO A;  2IBZ H;  3VQY A;  3E22 B;  2WWW A;  3AEI A;  4PV1 B;  1QLE B;  5IY5 B;  3PN1 A;  4DK1 A;  1N32 O;  2VRZ A;  3K06 A;  5LOV B;  4B7K A;  1EZV H;  1S77 D;  4K35 A;  2ZR3 A;  2QA4 V;  4LF4 O;  2BE3 A;  5KHG A;  4PDL A;  1YJ9 V;  2ZIM A;  1HWY A;  4LF9 O;  1BQ0 A;  5BMV B;  3SPH A;  2P22 C;  3UO2 A;  1ZL8 B;  4KXR A;  3ABL B;  3ZHU A;  1N8R W;  1B3Q A;  2CGO A;  4UB8 Z;  1O9H A;  1SA0 B;  4PA9 A;  3OD4 A;  2HEP A;  2Q8V A;  5J2T A;  1VQ4 V;  2PY5 A;  1HW7 A;  4BIU A;  4YJ2 A;  3WB1 A;  4FMT A;  3H1H H;  1HNZ B;  1H2G A;  4DRX B;  2VWK A;  4O4I B;  4DK0 A;  4LP8 A;  5CB4 A;  4QPK A;  3CEI A;  5EZY B;  4ZI7 A;  3ABM C;  1UPG A;  3R66 A;  4WFG A;  1RP3 B;  1G1X B;  4GX5 A;  3HKC B;  2ZM6 O;  3TJT A;  3MD0 A;  4JI2 B;  5FPO A;  1IZ3 A;  5JJE B;  1K4C C;  5FNV B;  2WLI A;  1VQM V;  2P4V A;  1YTF B;  1B6Q A;  3CXH F;  1THZ A;  2YID A;  4QNH B;  1WPX A;  3KKY A;  1FKA O;  1HNZ O;  2BCC H;  1OHH G;  1XHZ A;  4I9W A;  3CX5 F;  1CEZ A;  1Q3E A;  3SYC A;  4NTX A;  4JYY A;  5LGN A;  1BQZ A;  3T1H B;  3CC4 V;  1L0N H;  4J9Y B;  4O2B B;  1K5S A;  4JI3 O;  4JI2 O;  4LBE C;  5IWA B;  4MVQ A;  1F4N A;  1F23 A;  1YJN V;  2UUC B;  1AR5 A;  5FL7 G;  4Q6G A;  1VF6 C;  1VP7 A;  1XDC A;  1JQ0 A;  1Y6X A;  4Q20 A;  1U97 A;  4I50 A;  4KUM A;  3OTO O;  4JZG A;  5KHJ A;  3A0H Z;  2AHY A;  3RVY A;  4K3A A;  3S3W A;  2ZT9 B;  3CD6 V;  5IYZ A;  1KKD A;  3T1H O;  4X8A A;  3K5N A;  4TQD A;  4DR6 B;  2FTK A;  4EB6 B;  3EVK A;  5IWA O;  3AG3 C;  4GYC B;  3SJQ C;  3D3Q A;  2A0L A;  3K57 A;  2UUC O;  3H1I H;  1XHX A;  4UXN A;  1JOY A;  1GM9 A;  1NS1 A;  2HVJ C;  2E3C A;  3CCE V;  5TIS Z;  4ZOL B;  2QR4 A;  4GX2 A;  3MAQ A;  1JVM A;  2KSD A;  3DGE A;  1I5Y A;  4D6T H;  1KKC A;  2HR3 A;  4X1I B;  3SPG A;  1QQC A;  1FXH A;  2QDO A;  2B1G A;  1OCC C;  1K92 A;  2ZNJ A;  4JPR A;  1NU1 H;  3FAV B;  5KUK A;  5B1N A;  4FFB A;  4TUY A; 
#chains in the Genus database with same CATH homology
 3UO2 A;  2Y4T A;  1NZ6 A;  2CUG A;  2M6Y A;  2N05 A;  2KQX A;  1WJZ A;  4J80 A;  2DMX A;  3UO3 A;  2OCH A;  2N04 A;  2EJ7 A;  2QWR B;  1XBL A;  4J7Z A;  2QSA A;  1HDJ A;  2CTP A;  2CTR A;  2PF4 E;  1IUR A;  4IT5 A;  3BVO A;  3UCS C;  1BQZ A;  3AG7 A;  1N4C A;  2YUA A;  2QWO B;  2L6L A;  2LO1 A;  4RWU A;  2GUZ A;  1FAF A;  2QWP B;  3APQ A;  2QWQ B;  2QWN B;  2CTQ A;  3APO A;  1GH6 A;  2DN9 A;  2YS8 A;  1BQ0 A;  2GUZ B;  2CTW A;  2LGW A;  2Y4U A;  1FPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...