2GUZA

Structure of the tim14-tim16 complex of the mitochondrial protein import motor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
GFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title Structure and function of Tim14 and Tim16, the J and J-like components of the mitochondrial protein import motor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone, protein transport
total genus 23
structure length 71
sequence length 71
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2006-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2guzA00
1XBLA 2EJ7A 2LO1A 2M6YA 1FPOA 2QWQB 3BVOA 2OCHA 2QWPB 2DN9A 4IT5A 2QWRB 2CUGA 2Y4UA 2CTPA 2CTRA 2QSAA 3APOA 3UO3A 1BQ0A 2YS8A 2DMXA 2KQXA 3UCSC 2CTQA 2LGWA 2PF4E 2QWNB 4RWUA 2YUAA 1NZ6A 1IURA 1BQZA 2QWOB 4J80A 4J7ZA 3UO2A 2CTWA 2N05A 2GUZB 1WJZA 2Y4TA 1FAFA 2L6LA 1HDJA 2GUZA 3APQA 1N4CA 2N04A 1GH6A 3AG7A
chains in the Genus database with same CATH superfamily
2JS3A 3GWOA 3JD4A 5KUKA 4E4EA 5L3CA 2UU9B 2QKCA 1SQXH 1KKCA 4MVUA 5IT9N 4B3SB 3STLC 2EIJB 2YXHA 1BHAA 3ETGA 4JYCA 5GONA 1HNZO 1S3JA 3SJAC 2Y69B 4OPHA 2P5OA 3T1YO 2UXDO 1OHHG 5C8YB 1H38A 4CC6A 2ZE5A 2WA3A 3APQA 3K06A 4X62O 1E1RG 5IJ9A 3K9AA 4UB8Z 2YXLA 2IBZH 5EC2C 4PHZA 4H13B 4GKJB 4O4HB 4B7KA 3K3WA 1GM9A 4P2ZA 2F4VO 1AJPA 4QIWF 2JS5A 1YITV 1F7YA 3LSSA 2UXBO 3FYEB 2DYRB 2CTWA 2OIEA 4MS2A 3VQXA 3WG7B 1NKDA 3ABKC 3P3NA 3JARB 1H8HG 4Z1MG 4JZGA 5BY1A 1AP5A 3R65A 1BSMA 1Y74B 4E2LA 4UVBA 1YXBA 4CBCA 1HNWO 1VF6A 4YJ3A 5JVDB 5FNVA 4DV7O 3H1LH 4CZZA 3W7UA 2RJZA 4GKKB 1WPXA 3CCRV 1K4CC 3MHHC 3RGBA 1NR1A 5IE9A 3JASA 1LNQA 2OTLV 4RAIA 3FD9A 5B3SC 1NVPB 3A0BZ 4P30A 3ZBHA 4DYLA 4LCUC 1RP3B 5C8YA 5L3FA 4AILC 5CBFA 4TQDA 4NTYA 1DF5A 1WA8B 1H8EG 1B3QA 1SQPH 1K34A 2IJIA 5B1NA 1XREA 3J7AU 2VQEO 2ZXWB 4O4HA 4D6TH 1ENVA 3ZMZA 3JAWB 2YI8A 1KP2A 1EFRG 1ZLZA 2W6IG 3DGEA 3QO5A 4GX0A 3ZMVA 3DSQA 1AR1B 4RO2A 3SYOA 4BW9A 4DR7O 1VQ6V 3JARA 2ZIOA 3ZMUA 3RVZA 4YHHO 1Q81W 1VQ4V 1JMKC 1R6TA 3SPCA 4J7KA 2RCVA 1Y74A 2YUAA 1S76D 2Q7GA 1VIBA 2B9ZA 4DR3O 4JI3B 2HG5C 3SPGA 3E86A 1VQMV 1IBLO 4B3RO 1M93A 4D7SA 4K35A 1B06A 2X6AA 5FL7G 1GM7A 1QR9A 2A06H 4O4LA 2ARHA 2LGQA 4JI0B 2KG7B 3BEHA 5IY5C 1IVSA 5LMNO 4FJCC 4OPAA 5JQGB 4UUJC 3BRCA 1Q7YW 2P7TC 4H44B 1XMQB 2QWQB 1BGYH 4I0XB 1WA8A 3SPJA 2JDIG 4DV0O 2F66C 3E8BA 1SS3A 1IX9A 1M1KW 4R7CA 4L8JA 5EIBD 2QR4A 5TISZ 2L6LA 3JAWA 3JALB 4DV5B 3AG7A 3CRQA 2UUBB 2B1IA 1P84F 4PJ0Z 1UJWB 3HKCB 2AHYA 4J9ZB 4YXWG 4JI7B 1R3KC 3OR7C 1WNSA 1A32A 3FFQA 3UO2A 4JI2O 4DR4B 2V4DA 1JR9A 4CC5A 1PNKA 4J42A 4DV4O 2EINC 4XDKA 3FAVB 2QWRB 4LFCB 4O2AB 1N33O 4JI4O 1P7GA 2ZD9A 1K5SA 2BTOA 1RPOA 2ZDIC 1KD1W 3H1IH 3I5DA 2KG7A 5LXTB 2K1EA 4DV2B 3RYCB 1ORQC 2D3OW 1QNMA 4ZI7B 2EIMB 5KUMA 3JAMN 5JQGA 3AK3A 4I50B 4I5SA 2QE7G 3PJSK 3RYFB 3CCMV 2CTPA 3KG2A 3GB7C 2HJFC 4I0XA 3E8HA 4FFBB 3TCUA 1QBZA 4FZ0A 2A9HA 3ASOC 4WCEV 2F1MA 3CHXA 2N04A 4QPKA 4C7UA 3FB6C 1PNLA 1YHQV 2DYSC 3ZMTA 4QJFB 3JALA 1M56C 5KAFZ 3CCLV 4X9QA 5L3EA 2FKXA 2HLDG 5H6RA 3AG1C 1I94B 2Q0OC 2Y0IA 3SJCC 3IC9A 3OT7A 1YZBA 3AG2B 2UXXA 4UCUA 2BOBC 4AQYO 2JJ2G 4F6EA 1H2SB 3MD0A 3OEEG 4DV0B 2VRZA 4NVPA 3PN1A 1WB7A 3FAVA 3ABLB 4O2AA 1VQPV 4MT8A 1BQZA 5L3DA 3CCUV 3CCEV 2MK3A 1U97A 1R3IC 3OR6C 4MW3A 4UCVA 4EB6B 3CC7V 1AJNA 3OEHG 5LXTA 3RYCA 1JVMA 2XOKG 1NTMH 4ZI7A 3CXCU 4I50A 2UUAO 2Y48A 1FXKB 5J2UB 4LF8O 1NBMG 3RYFA 4X1YA 4DUYO 2V1DA 3UM7A 4FFBA 2GV9A 1H2LA 5C93A 4FM1A 2QM8A 4KHPB 2QDOA 4GT1A 4J7JA 1AR5A 2XAGA 1L0LH 4YY3O 3JSLA 2MW2B 5EYPB 3BVOA 2Y0PA 1HR0O 3C3TA 3W7TA 2VS0A 4K8XA 4NR1A 2M7WA 1MSDA 3ABUA 1JOYA 4LF6O 1JJ2U 1OCCB 1BE3H 2EILC 3H1HH 3LDDA 3RWRD 5KHHA 1GN3A 4CH5A 4LH7A 1FJGO 4K0KB 2W0FC 4FVMA 4JI6O 1QCEA 4U7NA 1PD3A 1DF4A 5LMUB 1QLEC 2EJRA 3CCSV 3D36C 3BFRA 4YIPA 5B1BC 4WFBV 3P32A 2LFSA 5BXZA 2ZM6B 4X65O 2WLJA 1DGSA 1T5EA 2GDSA 2UXNA 4X89A 3EHBB 1TVKB 4EB6A 3B2EE 3OTOO 4O4JB 1M90W 3MDSA 2UUCB 1BL8A 1KKDA 5BR8O 3CD6V 2X0LA 2IH3C 1UPGA 1FXKA 5J2UA 4OX9B 4G2KA 4GYCB 2WAMA 1Q43A 3CJHB 1J5EB 2P4VA 1SESA 1VQOV 1Q86W 2JJ1G 3HKBB 1HNXO 1US6A 4KP4A 2HP8A 1YDXA 2DN9A 4LBEC 5J9PC 2VQFO 1AROP 5IWAB 4BAYA 1NZ6A 4PV1B 5EIBC 3W7XA 3IJ4A 3T1CA 1IBKO 1SF9A 3G67A 1S5JA 1HW7A 5JJJB 4FLTA 3H1KH 3RVYA 3QO8A 4LF8B 4IYHA 4GX1A 4FIPC 3DC6A 1TUEB 1R3JC 2ZNIA 5FPOA 1IBMB 1LR1A 3OUSA 2X6CA 3T2MA 5LGNA 1ZUQA 1BZKA 4JAVA 3ZHTA 4ZHQB 4Q20A 4WBNB 4JTDB 1K3EA 4HBNA 1VF6C 2E5LO 4IIJA 3O65A 5CMUA 4I9QA 1TVKA 4NXMO 5H2FZ 3L71H 5LGUA 4X64O 1AI6A 3HPLC 3KKYA 3OD4A 4O4JA 1YTFD 3IAYA 3JCUZ 4XDLA 3I56V 4R50A 2DJVA 1PM9A 4JI8B 1XBLA 5KHJA 4JI6B 4YIOA 4YJ2B 4FFKA 5LBQA 2QKSA 1D5NA 1COWG 3CJHA 3N2KB 4LP8A 1VQ7V 3HR0A 3UKMA 3U0ZA 3S3WA 2UXCO 3HKBA 1M9NA 3ZN1A 1KMIZ 3ZHRA 3OGCC 4H0LB 5JJEB 3CMEV 3B77A 4RWUA 2Y69C 4FLZA 1GMGA 1G4YB 3JYCA 1Q5OA 2XUMA 4TUYB 2LW7A 4I7ZB 5J2TA 3JASB 1JFFA 1AI4A 1XOUA 1IXMA 3D3IA 3H9VA 2IJHA 3F5TA 3ZHSA 2OCCB 1PKXA 1OCRB 3ETQA 1BMFG 3B4SA 2LFRA 2AZ2A 3WG7C 1N0JA 2GUZB 1WJZA 3OTFA 3ZS8C 4TWKA 3JCZA 3STZC 4GX2A 1HNXB 2WWWA 3ZHUA 1GM8A 1XNQB 4PA3A 1LUVA 4ZHQA 2KSDA 4WBNA 5EBLC 1GAXA 2F95B 2EIKB 2QWNB 4DR5O 2AHZA 1CP9A 3E22B 3DXRB 3O9OA 3J80N 1R6KA 3AG3B 1VQ5V 2RQ6A 4JPRA 4B3MO 1GN4A 4YJ2A 3N2KA 3JSNA 3W7WA 4LR3A 1FFXA 3K9SA 3APOA 1W59A 5KAIZ 3IC7A 1HWYA 4LF9O 3E8FA 3GWKC 4JI5O 2LP7A 2XAQA 4TUYA 3KZIZ 2JGUA 4MTFA 1OCOB 5LHGA 2QM4A 1WN7A 1N32B 4O4LB 3K5OA 1H2KA 2ZXWC 3CRAA 5JCOC 1W0KG 1XMOO 1B6QA 3CCJV 2GUZA 1YI2V 4LFBO 3ML0A 3SJBC 2UXCB 2YIBD 1EN6A 2CE4A 3FKSG 4LFAO 4DR2B 3C3SA 4HNAB 4LF7O 4GZRB 4DUZO 1GTOA 3SYCA 1AB3A 2QEXV 4U3FH 3HB3B 2OIGA 3E89A 4JI1O 3E22A 3DXRA 3C90A 4X1IA 4UCTA 4LF4O 4TV9B 3K04A 2ZIMA 3ZRSA 3D8CA 5CA0B 1HNZB 4XBFA 3LDEA 4NYKA 1SA0B 3UO3A 3T1YB 1S0VA 2UXDB 3EXAA 2AZ0A 2ZKOA 5B3SB 3FB8C 2PI5A 2FTKA 1U96A 1MG1A 4X62B 4B3TO 1YEWA 1SQVH 5LHIA 3RT3C 5KX5B 3FYIB 2QTSA 3THOA 4ZKIA 2A7WA 3CWBH 2F4VB 4UVAA 1K5QA 4LF5O 2JIZG 4RUFA 2UXBB 4JASA 3TJTA 1W2BU 2AGAA 4MVSA 3SDLA 3CCVV 1SZXA 4I9WA 3E2EA 1TUBB 4JAAA 4J10A 1K9MW 4MVMA 4JYAO 4EKWA 3TGUH 3K0GA 5GTIZ 1OV9A 1SKVA 3P3PA 5KLVH 4BIOA 1KYOF 1HNWB 1TA8A 2P90A 4DV7B 3G71V 4B7EA 2F43G 4HNAA 2DWEC 2DQ3A 1I0HA 4CH6A 5KHIA 2Q9LA 3SYAA 1Q90D 4JZ2A 4PELA 1K92A 1AI5A 1XI1A 4TV9A 4NTWA 2N74A 3UT5B 1Q3EA 4ZIBA 5CA0A 1Z5VA 1MNGA 1EBOA 3FB7C 2VWJA 1EN4A 1SA0A 2PGGA 1L0NH 3FB5C 4R8CA 4LNUB 1NTKH 1Q6UA 3CXHF 1Y6XA 3ETEA 3X2QB 1S5LZ 2EIMC 3WFVA 3CYOA 1RFYA 5KX5A 2VQEB 1CXZB 2IJKA 1V9PA 1M57C 2PY5A 2NR5A 4DO2A 1F4MA 4JAUA 4NXNO 2Q73A 3FX7A 2NLJC 4JF3A 1V54C 4DR7B 2RNBA 4J7ZA 1TUBA 4YHHB 3RBZA 1NH2B 2E74B 5H9CA 1SRYA 2P22C 2DWDC 2H94A 5D5QA 3SPIA 2DW4A 4X1YB 1BS3A 4MVZA 3EFFK 2IM9A 1K7DA 2DMXA 1XEQA 3AG2C 2QWOB 4DR3B 4FPPA 4TSFG 5EBMC 1BCCH 4IGGA 2LW1A 4WF9V 2EZPA 2HVKC 4BR6A 4GLXA 4ICGA 3HKEB 4KL1A 3RYHB 1IBLB 4B3RB 5B66Z 1GN2A 4G27B 4DR1O 1MABG 1AVMA 4GCZA 3E8GA 3M7MX 2ITDC 1TAEA 5KMGB 1RM1B 1M5IA 1K33A 3UT5A 3JATB 4GX5A 3OUFA 2Q7HA 1N36O 4WFHA 4DW0A 4DRXB 5LMNB 1SETA 4LNUA 4QPJA 2JRIA 1ROPA 4DV3O 1QR8A 1W0JG 4QE9A 3JAKB 2Q67A 1F4NA 2WA4A 3KCXA 1JQ0A 4PD4F 4U7OA 1RPRA 3ZHQA 1S72V 2F23A 3QNEA 5D5PA 1XNRO 2HKOA 4UV9A 1NR7A 1QU7A 2ZR3A 3ZEDA 3LDCA 3ASNB 3SYQA 3VQYA 1M56B 3OMIB 4WFAV 1XDCA 1KB9F 3F7VC 1LUWA 3S3XA 4JI2B 4CS3A 5LA6B 4X66O 3LNMB 3CCQV 4J9YB 2PUSA 1OCCC 2ETNA 5KA5A 3OFNG 1KC8W 1OCZB 1NVPD 1WB8A 4MVOA 3G4SV 1N4CA 3H1JH 2QA4V 4DV4B 4DR6O 2JEXA 1SQBH 3RYHA 2B1GA 3HKEA 2ADQB 5LOVA 1VQKV 3A0RA 5B1AC 1N33B 5IYDO 1H2NA 1OJHA 1OZ0A 1WP8A 3G6BA 4QE7A 4JI4B 4FZ1A 1VP7A 2R9RB 2RDCA 3L74H 1BT8A 2Q8VA 4JYBA 4PI0A 3SJQC 2CTQA 2NNUA 4MTXA 4O4IB 2YC0A 5KMGA 5B5EZ 2FL4A 3ABMC 3JATA 1SQQH 1QVGU 2LO1A 4DRXA 3CSXA 2ZDIA 1GO3F 2GHYA 1YJWV 3KCYA 1FXHA 5EBWC 4DXWA 1VQ8V 2LQTA 3JAKA 1GKFA 2CDYA 4J41A 4J11A 4PA9A 3L9DA 2EBOA 3ICXA 2ZE7A 2OYQA 1VQLV 1H2GA 4OXSA 2HHHO 3B8NA 3N27A 2ZINA 2QM7A 3K79A 5BZBA 1EZJA 4IIJB 4RQFA 4ZOLB 5LGTA 4NTXA 5EC1C 1X59A 3SPHA 3T1HO 4DV6O 5LA6A 4KUMA 4AQYB 1WP7A 1JX9A 2Q7EA 4ABMA 2EX3A 4DK1A 4I55B 1MZEA 4Q6GA 3TXSA 1MA1A 4LC1A 3ZMSA 1NS1A 4QGPA 3AG4C 4AHCA 1FD9A 4FLVA 3K5LA 2UU9O 2RN9A 1ZSPA 4B3SO 1ZX3A 1SERA 1QLEB 1L8DA 3TETA 4HYOA 1N8RW 4F6RB 2Z0AA 4O4IA 2VWKA 5J2TB 5B1BB 1JFFB 1TGOA 3L75H 2OT5A 4WFGA 1YCIA 2JEUA 2PYLA 2UUAB 4MVRA 3T4DA 5IYZB 1AJQA 4DUYB 2R9AA 2GTSA 4MVQA 2IW5A 2QGNA 5LYJB 5L3BA 5IYBO 4DR6B 2BTQB 4MSWC 2A3QA 2P4KA 4YY3B 4HZ3A 1HR0B 2M6YA 3J81N 4BW5A 4P9PA 1MOFA 2YEVA 4FM2A 1XL6A 2ZNJA 2ZR2A 4LF6B 2AW9A 4ZOLA 3IGAC 2WLIB 4NKGB 2R70A 3M8AA 4JGSA 3VQVA 3OGIB 5HFLA 2QKAA 1CEZA 1YSCA 4MTGA 3ZCCA 1VEWA 4I55A 1IDSA 1FJGB 4GKKO 2H8PC 5IJ0B 1PP9H 1K4DC 2EIJC 1FFXB 2OCCC 3WU2Z 4PA6A 1OCRC 5DEDA 1K8AW 2LJ2A 1MSWD 1DLBA 3AEIA 2LGWA 3SR2C 1F23A 4KXRA 5A9GA 4WFEA 4NB5A 2NN4A 1XQ8A 3D36A 4F6RA 3RW0A 4X65B 1G1XB 1O9HA 1AILA 5E1AC 2GBOA 2PI4A 2W0XA 3OTOB 1THZA 3DC5A 5BR8B 1Q8IA 3K0DA 5KHGA 5IYZA 2DYRC 3LSQA 1IURA 2IH1C 3MAQA 3OW2U 4EFEA 2HVJC 5EK0A 2DOSA 5CA1A 2YSUB 2E3CA 4BIZA 5LYJA 2ZCEA 2BTQA 2QJ1A 3IFXA 5FPRA 1AR4A 2YIAA 5LP6B 2VQFB 2DE0X 1PNMA 1GK9A 1J95A 3A8TA 5CB4B 1V55B 3WB2A 1IBKB 2L35A 3K5NA 2Z3YA 3QF7A 2Y4TA 2WLIA 2JVDA 4LH6A 4X1IB 2WLLB 4EFBA 1XHXA 3NXSA 1OCOC 4JI3O 3K59A 3JD3A 3EVKA 4CH3A 5IJ0A 1X4TA 2XAJA 3LNNA 1S77D 3VQWA 2YS8A 1XUQA 1E1QG 2KQXA 4QNHB 2PF4E 2X6BA 2F93B 2JGDB 2CH7B 4H33A 2Q0AA 4MTOA 4JI0O 3ZRWB 1D5AA 3ZHVA 2OWOA 1GN6A 5JJNB 5CBGA 2G38A 2E5LB 1PL4A 1RSOA 4FM0A 1Y4MA 4NXMB 3ZX6A 4X64B 4X20B 3AK2A 2ZQMA 2CUGA 4UCSA 1XMQO 4FK5C 4DV1O 2CGNA 1HP8A 2RMKB 3QG5A 4CH4A 2IU3A 4UXNA 3ABKB 4TOIA 5IYCO 3B8MA 3CC4V 4DV5O 2UUBO 3OE7G 5LP6A 4LWSB 3UCSC 3N2GB 3CRRA 2EULA 5CB4A 4JI7O 3F7YC 1CPYA 1E79G 4DR4O 1SC5B 2XASA 3QO7A 4I4TB 1S5HC 4R6ZA 2WLLA 3B40A 3JD0A 1QHTA 4UVCA 4H37A 1WPBA 4RQEA 1NT2B 1H2MA 4LFCO 2A79B 4U3JB 1NJIW 5IDJA 1JPXA 1XILA 3A2FA 1URFA 5HFMA 1WAZA 2JGDA 2CH7A 2ZE6A 2YI9A 4FLXA 1GRJA 5K1PA 1WLEA 5CBHA 3ZRWA 1YJ9V 4ASUG 3CMAV 4P9OA 1KBHA 4DV2O 1IXBA 4DR5B 2QSAA 4X20A 1D2DA 5KHKA 5LHHA 2H3OA 2XAFA 3E83A 1KQSU 2GSMB 2CK3G 1SZTA 5EZYB 5JVDA 2Q68A 3TXQA 4AI8A 2Z5UA 1QQCA 2WPDG 2YDEA 4B3MB 3TK1A 4TV8B 1DK1A 5L3GA 3VOUA 5FLXN 4K3AA 2K9PA 3WB1A 4LF9B 2BE3A 5B1OA 2CTRA 4IYIA 4JTCB 1VF7A 1L1FA 4LWSA 4JI5B 2A0LA 3L73H 3N2GA 1I94O 1PV0A 4L87A 2DQ0A 3X2QC 3P30A 4PDVA 4IHJB 4JYYA 3CS5A 5F2VO 1YVWA 4FLWA 2P6JA 2C2AA 4FLYA 4JV5O 1VARA 4I4TA 1EZVH 2KKWA 4W4KA 4DV1B 2QWPB 4IT5A 5ITZB 2BCCH 2Q5ZA 3K03A 3CRMA 2P06A 1BHBA 1XMOB 3CC2V 1VMGA 2HEPA 3CP1A 4J80A 2IU0A 4Z2WA 4UFZA 1F51A 4U3JA 4LFBB 3BAAA 5JCOA 3JD2A 2B5UA 3CPWU 5IY5B 1Q6HA 4XDJA 2FB5A 4LFAB 4LF7B 4DUZB 2XAHA 2Y4UA 2D2CB 4B08A 3CB2A 3K08A 4JI1B 1ZTEA 3ZJZA 4FLUA 1R6NA 4O2BB 5KA6A 4LF4B 3CE2A 2ZE8A 5EZYA 1IZ3A 1MZFA 4KHPO 1JCHA 4PI2A 4N23A 5E79Z 3QTCA 1VF5B 4TV8A 3WB0A 3UQ8A 3BPZA 1RM1C 1YTFB 1B04A 2XNDG 3A0HZ 3HKDB 1SQFA 4PA4A 4PDMA 3LSUA 4B3TB 3U11A 1XHZA 3ABTA 3B09A 5JH7B 2O57A 5CN0A 1ZL8B 4N21A 4BIUA 5LOVB 1Q82W 4LF5B 4G28B 4IHJA 4ZBMA 3CEIA 2EINB 1M57B 4GUNA 4K0KO 5ITZA 1FS0G 3ABLC 1N34O 5LMUO 5AG2A 1I7FA 2WLHA 4JYAB 1V54B 4RUEA 2HJDA 3ASNC 2WLMA 4CS2A 1Z5WA 2XTAA 1G8MA 1EM1A 4W4LA 3T4ZA 1FPOA 2ZM6O 4X1KB 1FXKC 3HKCA 4PDLA 5LL6Y 3JD1A 2QTOA 4WFFA 3OMAB 2UUCO 1OCZC 2HFEC 3BCCH 3ASOB 1FYJA 4OX9O 4JV5B 1AP6A 4O2BA 3NR7A 2WLKA 1QLNA 1J5EO 2DYSB 2R9IA 1YIJV 3SYPA 2ODMA 3RYIB 3GVMA 1KECA 4KFMA 3ZN0A 2V7QG 1NQTA 3AG1B 1SQGA 3ZIAG 5IWAO 3HKDA 3RFRA 5A2QN 2WLNA 1ZAUA 4EEQA 3U10A 3RN4A 1O9GA 3CRCA 3G80A 5JH7A 1G6UA 3W7SA 1UFIA 4TT3G 1ZL8A 2P67A 3AK1A 2ZT9B 4HAMA 4NXNB 1Z2GA 5CA3A 1PL0A 1NTZH 5DECA 2W6JG 1JA8A 3L72H 5DN6G 1IBMO 3F5WC 1Y76B 2WSSG 1KUQA 1AI7A 1N0NA 3K57A 2HR3A 1NI8A 4JTAB 5H6QA 2OCHA 3G6EV 1YJNV 1I5YA 2ILMA 2OTJV 2Q6AA 1XL4A 3OM3B 2BSKB 3BA8A 4X1KA 3H01A 3LUTB 4Z1VA 3DTUB 3BA9A 4IL6Z 5BMVB 4X8AA 3ETDA 3K58A 4DR1B 1MMMA 2PYJA 1R73A 1Y66A 2YEVB 1K97A 4JI8O 3D3QA 1N34B 5B1AB 3MHSC 4PDRA 2BOCC 3RYIA 1N36B 3ZRXA 1I08A 4D7TA 1FFTB 1I5XA 2E76B 3ABMB 4DV3B 2ADPA 2EILB 1GH6A 3E35A 4UV8A 3Q4HB 1ZWIC 3BY6A 2YICA 2R72A 2PZSA 1Q6IA 2JK5C 1KP3A 4F4LA 1XNRB 1YF2A 2XT9A 1Y67A 2KB1A 4BWAA 4UB6Z 3OMNB 1FKAO 4OGQB 1Y76A 1XNQO 4DK0A 2X7RB 4X66B 2PTMA 5EYPA 3M99B 1PPJH 2ITCC 2CGOA 4GKJO 4K8ZA 2GTAA 2YIDA 5CA1B 2N05A 1R1BA 2BSKA 1QVFU 1K73W 5BMVA 2XHBA 2EJ7A 1DTOA 4PA7A 5GW7A 2YIBA 5H5NA 3AG4B 2Q69A 3L70H 5GONB 2Q4PA 1KU9A 1P49A 1BQ0A 5GTHZ 2FMLA 3VBBA 1FAFA 5IJ9B 3R66A 4X88A 1FXVA 2IJJA 3BHPA 1VQNV 1NH2D 3Q4HA 1EN5A 5DM6V 1N32O 4CS4A 2CAZC 5K1XA 3CX5F 4FMTA 3SGIA 3OAAG 1NU1H 1M4UA 1VQ9V 1P4RA 3QVNA 2HHHB 2FYUH 4MW8A 1R3LC 1RSOB 3ZRVA 5LP6C 3I55V 5JWPA 2AXTZ 3T1HB 4UCOA 1V55C 4UCRA 4YJ3B 3K5MA 4TQFA 4DV6B 5FNVB 2EIKC 1P7BA 2EZOA 2E75B 3BABA 4DR2O 4A5UB 2YXYA 1JJOA 4DW1A 2ATKC 1HDJA 3AG3C
chains in the Genus database with same CATH topology
1XBLA 2EJ7A 2LO1A 2M6YA 1FPOA 2QWQB 3BVOA 2OCHA 2QWPB 2DN9A 4IT5A 2QWRB 2CUGA 2Y4UA 2CTPA 2CTRA 2QSAA 3APOA 3UO3A 1BQ0A 2YS8A 2DMXA 2KQXA 3UCSC 2CTQA 2LGWA 2PF4E 2QWNB 4RWUA 2YUAA 1NZ6A 1IURA 1BQZA 2QWOB 4J80A 4J7ZA 3UO2A 2CTWA 2N05A 2GUZB 1WJZA 2Y4TA 1FAFA 2L6LA 1HDJA 2GUZA 3APQA 1N4CA 2N04A 1GH6A 3AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBL A;  2EJ7 A;  2LO1 A;  2M6Y A;  1FPO A;  2QWQ B;  3BVO A;  2OCH A;  2QWP B;  2DN9 A;  4IT5 A;  2QWR B;  2CUG A;  2Y4U A;  2CTP A;  2CTR A;  2QSA A;  3APO A;  3UO3 A;  1BQ0 A;  2YS8 A;  2DMX A;  2KQX A;  3UCS C;  2CTQ A;  2LGW A;  2PF4 E;  2QWN B;  4RWU A;  2YUA A;  1NZ6 A;  1IUR A;  1BQZ A;  2QWO B;  4J80 A;  4J7Z A;  3UO2 A;  2CTW A;  2N05 A;  2GUZ B;  1WJZ A;  2Y4T A;  1FAF A;  2L6L A;  1HDJ A;  2GUZ A;  3APQ A;  1N4C A;  2N04 A;  1GH6 A;  3AG7 A; 
#chains in the Genus database with same CATH topology
 2JS3 A;  3GWO A;  3JD4 A;  5KUK A;  4E4E A;  5L3C A;  2UU9 B;  2QKC A;  1SQX H;  1KKC A;  4MVU A;  5IT9 N;  4B3S B;  3STL C;  2EIJ B;  2YXH A;  1BHA A;  3ETG A;  4JYC A;  5GON A;  1HNZ O;  1S3J A;  3SJA C;  2Y69 B;  4OPH A;  2P5O A;  3T1Y O;  2UXD O;  1OHH G;  5C8Y B;  1H38 A;  4CC6 A;  2ZE5 A;  2WA3 A;  3APQ A;  3K06 A;  4X62 O;  1E1R G;  5IJ9 A;  3K9A A;  4UB8 Z;  2YXL A;  2IBZ H;  5EC2 C;  4PHZ A;  4H13 B;  4GKJ B;  4O4H B;  4B7K A;  3K3W A;  1GM9 A;  4P2Z A;  2F4V O;  1AJP A;  4QIW F;  2JS5 A;  1YIT V;  1F7Y A;  3LSS A;  2UXB O;  3FYE B;  2DYR B;  2CTW A;  2OIE A;  4MS2 A;  3VQX A;  3WG7 B;  1NKD A;  3ABK C;  3P3N A;  3JAR B;  1H8H G;  4Z1M G;  4JZG A;  5BY1 A;  1AP5 A;  3R65 A;  1BSM A;  1Y74 B;  4E2L A;  4UVB A;  1YXB A;  4CBC A;  1HNW O;  1VF6 A;  4YJ3 A;  5JVD B;  5FNV A;  4DV7 O;  3H1L H;  4CZZ A;  3W7U A;  2RJZ A;  4GKK B;  1WPX A;  3CCR V;  1K4C C;  3MHH C;  3RGB A;  1NR1 A;  5IE9 A;  3JAS A;  1LNQ A;  2OTL V;  4RAI A;  3FD9 A;  5B3S C;  1NVP B;  3A0B Z;  4P30 A;  3ZBH A;  4DYL A;  4LCU C;  1RP3 B;  5C8Y A;  5L3F A;  4AIL C;  5CBF A;  4TQD A;  4NTY A;  1DF5 A;  1WA8 B;  1H8E G;  1B3Q A;  1SQP H;  1K34 A;  2IJI A;  5B1N A;  1XRE A;  3J7A U;  2VQE O;  2ZXW B;  4O4H A;  4D6T H;  1ENV A;  3ZMZ A;  3JAW B;  2YI8 A;  1KP2 A;  1EFR G;  1ZLZ A;  2W6I G;  3DGE A;  3QO5 A;  4GX0 A;  3ZMV A;  3DSQ A;  1AR1 B;  4RO2 A;  3SYO A;  4BW9 A;  4DR7 O;  1VQ6 V;  3JAR A;  2ZIO A;  3ZMU A;  3RVZ A;  4YHH O;  1Q81 W;  1VQ4 V;  1JMK C;  1R6T A;  3SPC A;  4J7K A;  2RCV A;  1Y74 A;  2YUA A;  1S76 D;  2Q7G A;  1VIB A;  2B9Z A;  4DR3 O;  4JI3 B;  2HG5 C;  3SPG A;  3E86 A;  1VQM V;  1IBL O;  4B3R O;  1M93 A;  4D7S A;  4K35 A;  1B06 A;  2X6A A;  5FL7 G;  1GM7 A;  1QR9 A;  2A06 H;  4O4L A;  2ARH A;  2LGQ A;  4JI0 B;  2KG7 B;  3BEH A;  5IY5 C;  1IVS A;  5LMN O;  4FJC C;  4OPA A;  5JQG B;  4UUJ C;  3BRC A;  1Q7Y W;  2P7T C;  4H44 B;  1XMQ B;  2QWQ B;  1BGY H;  4I0X B;  1WA8 A;  3SPJ A;  2JDI G;  4DV0 O;  2F66 C;  3E8B A;  1SS3 A;  1IX9 A;  1M1K W;  4R7C A;  4L8J A;  5EIB D;  2QR4 A;  5TIS Z;  2L6L A;  3JAW A;  3JAL B;  4DV5 B;  3AG7 A;  3CRQ A;  2UUB B;  2B1I A;  1P84 F;  4PJ0 Z;  1UJW B;  3HKC B;  2AHY A;  4J9Z B;  4YXW G;  4JI7 B;  1R3K C;  3OR7 C;  1WNS A;  1A32 A;  3FFQ A;  3UO2 A;  4JI2 O;  4DR4 B;  2V4D A;  1JR9 A;  4CC5 A;  1PNK A;  4J42 A;  4DV4 O;  2EIN C;  4XDK A;  3FAV B;  2QWR B;  4LFC B;  4O2A B;  1N33 O;  4JI4 O;  1P7G A;  2ZD9 A;  1K5S A;  2BTO A;  1RPO A;  2ZDI C;  1KD1 W;  3H1I H;  3I5D A;  2KG7 A;  5LXT B;  2K1E A;  4DV2 B;  3RYC B;  1ORQ C;  2D3O W;  1QNM A;  4ZI7 B;  2EIM B;  5KUM A;  3JAM N;  5JQG A;  3AK3 A;  4I50 B;  4I5S A;  2QE7 G;  3PJS K;  3RYF B;  3CCM V;  2CTP A;  3KG2 A;  3GB7 C;  2HJF C;  4I0X A;  3E8H A;  4FFB B;  3TCU A;  1QBZ A;  4FZ0 A;  2A9H A;  3ASO C;  4WCE V;  2F1M A;  3CHX A;  2N04 A;  4QPK A;  4C7U A;  3FB6 C;  1PNL A;  1YHQ V;  2DYS C;  3ZMT A;  4QJF B;  3JAL A;  1M56 C;  5KAF Z;  3CCL V;  4X9Q A;  5L3E A;  2FKX A;  2HLD G;  5H6R A;  3AG1 C;  1I94 B;  2Q0O C;  2Y0I A;  3SJC C;  3IC9 A;  3OT7 A;  1YZB A;  3AG2 B;  2UXX A;  4UCU A;  2BOB C;  4AQY O;  2JJ2 G;  4F6E A;  1H2S B;  3MD0 A;  3OEE G;  4DV0 B;  2VRZ A;  4NVP A;  3PN1 A;  1WB7 A;  3FAV A;  3ABL B;  4O2A A;  1VQP V;  4MT8 A;  1BQZ A;  5L3D A;  3CCU V;  3CCE V;  2MK3 A;  1U97 A;  1R3I C;  3OR6 C;  4MW3 A;  4UCV A;  4EB6 B;  3CC7 V;  1AJN A;  3OEH G;  5LXT A;  3RYC A;  1JVM A;  2XOK G;  1NTM H;  4ZI7 A;  3CXC U;  4I50 A;  2UUA O;  2Y48 A;  1FXK B;  5J2U B;  4LF8 O;  1NBM G;  3RYF A;  4X1Y A;  4DUY O;  2V1D A;  3UM7 A;  4FFB A;  2GV9 A;  1H2L A;  5C93 A;  4FM1 A;  2QM8 A;  4KHP B;  2QDO A;  4GT1 A;  4J7J A;  1AR5 A;  2XAG A;  1L0L H;  4YY3 O;  3JSL A;  2MW2 B;  5EYP B;  3BVO A;  2Y0P A;  1HR0 O;  3C3T A;  3W7T A;  2VS0 A;  4K8X A;  4NR1 A;  2M7W A;  1MSD A;  3ABU A;  1JOY A;  4LF6 O;  1JJ2 U;  1OCC B;  1BE3 H;  2EIL C;  3H1H H;  3LDD A;  3RWR D;  5KHH A;  1GN3 A;  4CH5 A;  4LH7 A;  1FJG O;  4K0K B;  2W0F C;  4FVM A;  4JI6 O;  1QCE A;  4U7N A;  1PD3 A;  1DF4 A;  5LMU B;  1QLE C;  2EJR A;  3CCS V;  3D36 C;  3BFR A;  4YIP A;  5B1B C;  4WFB V;  3P32 A;  2LFS A;  5BXZ A;  2ZM6 B;  4X65 O;  2WLJ A;  1DGS A;  1T5E A;  2GDS A;  2UXN A;  4X89 A;  3EHB B;  1TVK B;  4EB6 A;  3B2E E;  3OTO O;  4O4J B;  1M90 W;  3MDS A;  2UUC B;  1BL8 A;  1KKD A;  5BR8 O;  3CD6 V;  2X0L A;  2IH3 C;  1UPG A;  1FXK A;  5J2U A;  4OX9 B;  4G2K A;  4GYC B;  2WAM A;  1Q43 A;  3CJH B;  1J5E B;  2P4V A;  1SES A;  1VQO V;  1Q86 W;  2JJ1 G;  3HKB B;  1HNX O;  1US6 A;  4KP4 A;  2HP8 A;  1YDX A;  2DN9 A;  4LBE C;  5J9P C;  2VQF O;  1ARO P;  5IWA B;  4BAY A;  1NZ6 A;  4PV1 B;  5EIB C;  3W7X A;  3IJ4 A;  3T1C A;  1IBK O;  1SF9 A;  3G67 A;  1S5J A;  1HW7 A;  5JJJ B;  4FLT A;  3H1K H;  3RVY A;  3QO8 A;  4LF8 B;  4IYH A;  4GX1 A;  4FIP C;  3DC6 A;  1TUE B;  1R3J C;  2ZNI A;  5FPO A;  1IBM B;  1LR1 A;  3OUS A;  2X6C A;  3T2M A;  5LGN A;  1ZUQ A;  1BZK A;  4JAV A;  3ZHT A;  4ZHQ B;  4Q20 A;  4WBN B;  4JTD B;  1K3E A;  4HBN A;  1VF6 C;  2E5L O;  4IIJ A;  3O65 A;  5CMU A;  4I9Q A;  1TVK A;  4NXM O;  5H2F Z;  3L71 H;  5LGU A;  4X64 O;  1AI6 A;  3HPL C;  3KKY A;  3OD4 A;  4O4J A;  1YTF D;  3IAY A;  3JCU Z;  4XDL A;  3I56 V;  4R50 A;  2DJV A;  1PM9 A;  4JI8 B;  1XBL A;  5KHJ A;  4JI6 B;  4YIO A;  4YJ2 B;  4FFK A;  5LBQ A;  2QKS A;  1D5N A;  1COW G;  3CJH A;  3N2K B;  4LP8 A;  1VQ7 V;  3HR0 A;  3UKM A;  3U0Z A;  3S3W A;  2UXC O;  3HKB A;  1M9N A;  3ZN1 A;  1KMI Z;  3ZHR A;  3OGC C;  4H0L B;  5JJE B;  3CME V;  3B77 A;  4RWU A;  2Y69 C;  4FLZ A;  1GMG A;  1G4Y B;  3JYC A;  1Q5O A;  2XUM A;  4TUY B;  2LW7 A;  4I7Z B;  5J2T A;  3JAS B;  1JFF A;  1AI4 A;  1XOU A;  1IXM A;  3D3I A;  3H9V A;  2IJH A;  3F5T A;  3ZHS A;  2OCC B;  1PKX A;  1OCR B;  3ETQ A;  1BMF G;  3B4S A;  2LFR A;  2AZ2 A;  3WG7 C;  1N0J A;  2GUZ B;  1WJZ A;  3OTF A;  3ZS8 C;  4TWK A;  3JCZ A;  3STZ C;  4GX2 A;  1HNX B;  2WWW A;  3ZHU A;  1GM8 A;  1XNQ B;  4PA3 A;  1LUV A;  4ZHQ A;  2KSD A;  4WBN A;  5EBL C;  1GAX A;  2F95 B;  2EIK B;  2QWN B;  4DR5 O;  2AHZ A;  1CP9 A;  3E22 B;  3DXR B;  3O9O A;  3J80 N;  1R6K A;  3AG3 B;  1VQ5 V;  2RQ6 A;  4JPR A;  4B3M O;  1GN4 A;  4YJ2 A;  3N2K A;  3JSN A;  3W7W A;  4LR3 A;  1FFX A;  3K9S A;  3APO A;  1W59 A;  5KAI Z;  3IC7 A;  1HWY A;  4LF9 O;  3E8F A;  3GWK C;  4JI5 O;  2LP7 A;  2XAQ A;  4TUY A;  3KZI Z;  2JGU A;  4MTF A;  1OCO B;  5LHG A;  2QM4 A;  1WN7 A;  1N32 B;  4O4L B;  3K5O A;  1H2K A;  2ZXW C;  3CRA A;  5JCO C;  1W0K G;  1XMO O;  1B6Q A;  3CCJ V;  2GUZ A;  1YI2 V;  4LFB O;  3ML0 A;  3SJB C;  2UXC B;  2YIB D;  1EN6 A;  2CE4 A;  3FKS G;  4LFA O;  4DR2 B;  3C3S A;  4HNA B;  4LF7 O;  4GZR B;  4DUZ O;  1GTO A;  3SYC A;  1AB3 A;  2QEX V;  4U3F H;  3HB3 B;  2OIG A;  3E89 A;  4JI1 O;  3E22 A;  3DXR A;  3C90 A;  4X1I A;  4UCT A;  4LF4 O;  4TV9 B;  3K04 A;  2ZIM A;  3ZRS A;  3D8C A;  5CA0 B;  1HNZ B;  4XBF A;  3LDE A;  4NYK A;  1SA0 B;  3UO3 A;  3T1Y B;  1S0V A;  2UXD B;  3EXA A;  2AZ0 A;  2ZKO A;  5B3S B;  3FB8 C;  2PI5 A;  2FTK A;  1U96 A;  1MG1 A;  4X62 B;  4B3T O;  1YEW A;  1SQV H;  5LHI A;  3RT3 C;  5KX5 B;  3FYI B;  2QTS A;  3THO A;  4ZKI A;  2A7W A;  3CWB H;  2F4V B;  4UVA A;  1K5Q A;  4LF5 O;  2JIZ G;  4RUF A;  2UXB B;  4JAS A;  3TJT A;  1W2B U;  2AGA A;  4MVS A;  3SDL A;  3CCV V;  1SZX A;  4I9W A;  3E2E A;  1TUB B;  4JAA A;  4J10 A;  1K9M W;  4MVM A;  4JYA O;  4EKW A;  3TGU H;  3K0G A;  5GTI Z;  1OV9 A;  1SKV A;  3P3P A;  5KLV H;  4BIO A;  1KYO F;  1HNW B;  1TA8 A;  2P90 A;  4DV7 B;  3G71 V;  4B7E A;  2F43 G;  4HNA A;  2DWE C;  2DQ3 A;  1I0H A;  4CH6 A;  5KHI A;  2Q9L A;  3SYA A;  1Q90 D;  4JZ2 A;  4PEL A;  1K92 A;  1AI5 A;  1XI1 A;  4TV9 A;  4NTW A;  2N74 A;  3UT5 B;  1Q3E A;  4ZIB A;  5CA0 A;  1Z5V A;  1MNG A;  1EBO A;  3FB7 C;  2VWJ A;  1EN4 A;  1SA0 A;  2PGG A;  1L0N H;  3FB5 C;  4R8C A;  4LNU B;  1NTK H;  1Q6U A;  3CXH F;  1Y6X A;  3ETE A;  3X2Q B;  1S5L Z;  2EIM C;  3WFV A;  3CYO A;  1RFY A;  5KX5 A;  2VQE B;  1CXZ B;  2IJK A;  1V9P A;  1M57 C;  2PY5 A;  2NR5 A;  4DO2 A;  1F4M A;  4JAU A;  4NXN O;  2Q73 A;  3FX7 A;  2NLJ C;  4JF3 A;  1V54 C;  4DR7 B;  2RNB A;  4J7Z A;  1TUB A;  4YHH B;  3RBZ A;  1NH2 B;  2E74 B;  5H9C A;  1SRY A;  2P22 C;  2DWD C;  2H94 A;  5D5Q A;  3SPI A;  2DW4 A;  4X1Y B;  1BS3 A;  4MVZ A;  3EFF K;  2IM9 A;  1K7D A;  2DMX A;  1XEQ A;  3AG2 C;  2QWO B;  4DR3 B;  4FPP A;  4TSF G;  5EBM C;  1BCC H;  4IGG A;  2LW1 A;  4WF9 V;  2EZP A;  2HVK C;  4BR6 A;  4GLX A;  4ICG A;  3HKE B;  4KL1 A;  3RYH B;  1IBL B;  4B3R B;  5B66 Z;  1GN2 A;  4G27 B;  4DR1 O;  1MAB G;  1AVM A;  4GCZ A;  3E8G A;  3M7M X;  2ITD C;  1TAE A;  5KMG B;  1RM1 B;  1M5I A;  1K33 A;  3UT5 A;  3JAT B;  4GX5 A;  3OUF A;  2Q7H A;  1N36 O;  4WFH A;  4DW0 A;  4DRX B;  5LMN B;  1SET A;  4LNU A;  4QPJ A;  2JRI A;  1ROP A;  4DV3 O;  1QR8 A;  1W0J G;  4QE9 A;  3JAK B;  2Q67 A;  1F4N A;  2WA4 A;  3KCX A;  1JQ0 A;  4PD4 F;  4U7O A;  1RPR A;  3ZHQ A;  1S72 V;  2F23 A;  3QNE A;  5D5P A;  1XNR O;  2HKO A;  4UV9 A;  1NR7 A;  1QU7 A;  2ZR3 A;  3ZED A;  3LDC A;  3ASN B;  3SYQ A;  3VQY A;  1M56 B;  3OMI B;  4WFA V;  1XDC A;  1KB9 F;  3F7V C;  1LUW A;  3S3X A;  4JI2 B;  4CS3 A;  5LA6 B;  4X66 O;  3LNM B;  3CCQ V;  4J9Y B;  2PUS A;  1OCC C;  2ETN A;  5KA5 A;  3OFN G;  1KC8 W;  1OCZ B;  1NVP D;  1WB8 A;  4MVO A;  3G4S V;  1N4C A;  3H1J H;  2QA4 V;  4DV4 B;  4DR6 O;  2JEX A;  1SQB H;  3RYH A;  2B1G A;  3HKE A;  2ADQ B;  5LOV A;  1VQK V;  3A0R A;  5B1A C;  1N33 B;  5IYD O;  1H2N A;  1OJH A;  1OZ0 A;  1WP8 A;  3G6B A;  4QE7 A;  4JI4 B;  4FZ1 A;  1VP7 A;  2R9R B;  2RDC A;  3L74 H;  1BT8 A;  2Q8V A;  4JYB A;  4PI0 A;  3SJQ C;  2CTQ A;  2NNU A;  4MTX A;  4O4I B;  2YC0 A;  5KMG A;  5B5E Z;  2FL4 A;  3ABM C;  3JAT A;  1SQQ H;  1QVG U;  2LO1 A;  4DRX A;  3CSX A;  2ZDI A;  1GO3 F;  2GHY A;  1YJW V;  3KCY A;  1FXH A;  5EBW C;  4DXW A;  1VQ8 V;  2LQT A;  3JAK A;  1GKF A;  2CDY A;  4J41 A;  4J11 A;  4PA9 A;  3L9D A;  2EBO A;  3ICX A;  2ZE7 A;  2OYQ A;  1VQL V;  1H2G A;  4OXS A;  2HHH O;  3B8N A;  3N27 A;  2ZIN A;  2QM7 A;  3K79 A;  5BZB A;  1EZJ A;  4IIJ B;  4RQF A;  4ZOL B;  5LGT A;  4NTX A;  5EC1 C;  1X59 A;  3SPH A;  3T1H O;  4DV6 O;  5LA6 A;  4KUM A;  4AQY B;  1WP7 A;  1JX9 A;  2Q7E A;  4ABM A;  2EX3 A;  4DK1 A;  4I55 B;  1MZE A;  4Q6G A;  3TXS A;  1MA1 A;  4LC1 A;  3ZMS A;  1NS1 A;  4QGP A;  3AG4 C;  4AHC A;  1FD9 A;  4FLV A;  3K5L A;  2UU9 O;  2RN9 A;  1ZSP A;  4B3S O;  1ZX3 A;  1SER A;  1QLE B;  1L8D A;  3TET A;  4HYO A;  1N8R W;  4F6R B;  2Z0A A;  4O4I A;  2VWK A;  5J2T B;  5B1B B;  1JFF B;  1TGO A;  3L75 H;  2OT5 A;  4WFG A;  1YCI A;  2JEU A;  2PYL A;  2UUA B;  4MVR A;  3T4D A;  5IYZ B;  1AJQ A;  4DUY B;  2R9A A;  2GTS A;  4MVQ A;  2IW5 A;  2QGN A;  5LYJ B;  5L3B A;  5IYB O;  4DR6 B;  2BTQ B;  4MSW C;  2A3Q A;  2P4K A;  4YY3 B;  4HZ3 A;  1HR0 B;  2M6Y A;  3J81 N;  4BW5 A;  4P9P A;  1MOF A;  2YEV A;  4FM2 A;  1XL6 A;  2ZNJ A;  2ZR2 A;  4LF6 B;  2AW9 A;  4ZOL A;  3IGA C;  2WLI B;  4NKG B;  2R70 A;  3M8A A;  4JGS A;  3VQV A;  3OGI B;  5HFL A;  2QKA A;  1CEZ A;  1YSC A;  4MTG A;  3ZCC A;  1VEW A;  4I55 A;  1IDS A;  1FJG B;  4GKK O;  2H8P C;  5IJ0 B;  1PP9 H;  1K4D C;  2EIJ C;  1FFX B;  2OCC C;  3WU2 Z;  4PA6 A;  1OCR C;  5DED A;  1K8A W;  2LJ2 A;  1MSW D;  1DLB A;  3AEI A;  2LGW A;  3SR2 C;  1F23 A;  4KXR A;  5A9G A;  4WFE A;  4NB5 A;  2NN4 A;  1XQ8 A;  3D36 A;  4F6R A;  3RW0 A;  4X65 B;  1G1X B;  1O9H A;  1AIL A;  5E1A C;  2GBO A;  2PI4 A;  2W0X A;  3OTO B;  1THZ A;  3DC5 A;  5BR8 B;  1Q8I A;  3K0D A;  5KHG A;  5IYZ A;  2DYR C;  3LSQ A;  1IUR A;  2IH1 C;  3MAQ A;  3OW2 U;  4EFE A;  2HVJ C;  5EK0 A;  2DOS A;  5CA1 A;  2YSU B;  2E3C A;  4BIZ A;  5LYJ A;  2ZCE A;  2BTQ A;  2QJ1 A;  3IFX A;  5FPR A;  1AR4 A;  2YIA A;  5LP6 B;  2VQF B;  2DE0 X;  1PNM A;  1GK9 A;  1J95 A;  3A8T A;  5CB4 B;  1V55 B;  3WB2 A;  1IBK B;  2L35 A;  3K5N A;  2Z3Y A;  3QF7 A;  2Y4T A;  2WLI A;  2JVD A;  4LH6 A;  4X1I B;  2WLL B;  4EFB A;  1XHX A;  3NXS A;  1OCO C;  4JI3 O;  3K59 A;  3JD3 A;  3EVK A;  4CH3 A;  5IJ0 A;  1X4T A;  2XAJ A;  3LNN A;  1S77 D;  3VQW A;  2YS8 A;  1XUQ A;  1E1Q G;  2KQX A;  4QNH B;  2PF4 E;  2X6B A;  2F93 B;  2JGD B;  2CH7 B;  4H33 A;  2Q0A A;  4MTO A;  4JI0 O;  3ZRW B;  1D5A A;  3ZHV A;  2OWO A;  1GN6 A;  5JJN B;  5CBG A;  2G38 A;  2E5L B;  1PL4 A;  1RSO A;  4FM0 A;  1Y4M A;  4NXM B;  3ZX6 A;  4X64 B;  4X20 B;  3AK2 A;  2ZQM A;  2CUG A;  4UCS A;  1XMQ O;  4FK5 C;  4DV1 O;  2CGN A;  1HP8 A;  2RMK B;  3QG5 A;  4CH4 A;  2IU3 A;  4UXN A;  3ABK B;  4TOI A;  5IYC O;  3B8M A;  3CC4 V;  4DV5 O;  2UUB O;  3OE7 G;  5LP6 A;  4LWS B;  3UCS C;  3N2G B;  3CRR A;  2EUL A;  5CB4 A;  4JI7 O;  3F7Y C;  1CPY A;  1E79 G;  4DR4 O;  1SC5 B;  2XAS A;  3QO7 A;  4I4T B;  1S5H C;  4R6Z A;  2WLL A;  3B40 A;  3JD0 A;  1QHT A;  4UVC A;  4H37 A;  1WPB A;  4RQE A;  1NT2 B;  1H2M A;  4LFC O;  2A79 B;  4U3J B;  1NJI W;  5IDJ A;  1JPX A;  1XIL A;  3A2F A;  1URF A;  5HFM A;  1WAZ A;  2JGD A;  2CH7 A;  2ZE6 A;  2YI9 A;  4FLX A;  1GRJ A;  5K1P A;  1WLE A;  5CBH A;  3ZRW A;  1YJ9 V;  4ASU G;  3CMA V;  4P9O A;  1KBH A;  4DV2 O;  1IXB A;  4DR5 B;  2QSA A;  4X20 A;  1D2D A;  5KHK A;  5LHH A;  2H3O A;  2XAF A;  3E83 A;  1KQS U;  2GSM B;  2CK3 G;  1SZT A;  5EZY B;  5JVD A;  2Q68 A;  3TXQ A;  4AI8 A;  2Z5U A;  1QQC A;  2WPD G;  2YDE A;  4B3M B;  3TK1 A;  4TV8 B;  1DK1 A;  5L3G A;  3VOU A;  5FLX N;  4K3A A;  2K9P A;  3WB1 A;  4LF9 B;  2BE3 A;  5B1O A;  2CTR A;  4IYI A;  4JTC B;  1VF7 A;  1L1F A;  4LWS A;  4JI5 B;  2A0L A;  3L73 H;  3N2G A;  1I94 O;  1PV0 A;  4L87 A;  2DQ0 A;  3X2Q C;  3P30 A;  4PDV A;  4IHJ B;  4JYY A;  3CS5 A;  5F2V O;  1YVW A;  4FLW A;  2P6J A;  2C2A A;  4FLY A;  4JV5 O;  1VAR A;  4I4T A;  1EZV H;  2KKW A;  4W4K A;  4DV1 B;  2QWP B;  4IT5 A;  5ITZ B;  2BCC H;  2Q5Z A;  3K03 A;  3CRM A;  2P06 A;  1BHB A;  1XMO B;  3CC2 V;  1VMG A;  2HEP A;  3CP1 A;  4J80 A;  2IU0 A;  4Z2W A;  4UFZ A;  1F51 A;  4U3J A;  4LFB B;  3BAA A;  5JCO A;  3JD2 A;  2B5U A;  3CPW U;  5IY5 B;  1Q6H A;  4XDJ A;  2FB5 A;  4LFA B;  4LF7 B;  4DUZ B;  2XAH A;  2Y4U A;  2D2C B;  4B08 A;  3CB2 A;  3K08 A;  4JI1 B;  1ZTE A;  3ZJZ A;  4FLU A;  1R6N A;  4O2B B;  5KA6 A;  4LF4 B;  3CE2 A;  2ZE8 A;  5EZY A;  1IZ3 A;  1MZF A;  4KHP O;  1JCH A;  4PI2 A;  4N23 A;  5E79 Z;  3QTC A;  1VF5 B;  4TV8 A;  3WB0 A;  3UQ8 A;  3BPZ A;  1RM1 C;  1YTF B;  1B04 A;  2XND G;  3A0H Z;  3HKD B;  1SQF A;  4PA4 A;  4PDM A;  3LSU A;  4B3T B;  3U11 A;  1XHZ A;  3ABT A;  3B09 A;  5JH7 B;  2O57 A;  5CN0 A;  1ZL8 B;  4N21 A;  4BIU A;  5LOV B;  1Q82 W;  4LF5 B;  4G28 B;  4IHJ A;  4ZBM A;  3CEI A;  2EIN B;  1M57 B;  4GUN A;  4K0K O;  5ITZ A;  1FS0 G;  3ABL C;  1N34 O;  5LMU O;  5AG2 A;  1I7F A;  2WLH A;  4JYA B;  1V54 B;  4RUE A;  2HJD A;  3ASN C;  2WLM A;  4CS2 A;  1Z5W A;  2XTA A;  1G8M A;  1EM1 A;  4W4L A;  3T4Z A;  1FPO A;  2ZM6 O;  4X1K B;  1FXK C;  3HKC A;  4PDL A;  5LL6 Y;  3JD1 A;  2QTO A;  4WFF A;  3OMA B;  2UUC O;  1OCZ C;  2HFE C;  3BCC H;  3ASO B;  1FYJ A;  4OX9 O;  4JV5 B;  1AP6 A;  4O2B A;  3NR7 A;  2WLK A;  1QLN A;  1J5E O;  2DYS B;  2R9I A;  1YIJ V;  3SYP A;  2ODM A;  3RYI B;  3GVM A;  1KEC A;  4KFM A;  3ZN0 A;  2V7Q G;  1NQT A;  3AG1 B;  1SQG A;  3ZIA G;  5IWA O;  3HKD A;  3RFR A;  5A2Q N;  2WLN A;  1ZAU A;  4EEQ A;  3U10 A;  3RN4 A;  1O9G A;  3CRC A;  3G80 A;  5JH7 A;  1G6U A;  3W7S A;  1UFI A;  4TT3 G;  1ZL8 A;  2P67 A;  3AK1 A;  2ZT9 B;  4HAM A;  4NXN B;  1Z2G A;  5CA3 A;  1PL0 A;  1NTZ H;  5DEC A;  2W6J G;  1JA8 A;  3L72 H;  5DN6 G;  1IBM O;  3F5W C;  1Y76 B;  2WSS G;  1KUQ A;  1AI7 A;  1N0N A;  3K57 A;  2HR3 A;  1NI8 A;  4JTA B;  5H6Q A;  2OCH A;  3G6E V;  1YJN V;  1I5Y A;  2ILM A;  2OTJ V;  2Q6A A;  1XL4 A;  3OM3 B;  2BSK B;  3BA8 A;  4X1K A;  3H01 A;  3LUT B;  4Z1V A;  3DTU B;  3BA9 A;  4IL6 Z;  5BMV B;  4X8A A;  3ETD A;  3K58 A;  4DR1 B;  1MMM A;  2PYJ A;  1R73 A;  1Y66 A;  2YEV B;  1K97 A;  4JI8 O;  3D3Q A;  1N34 B;  5B1A B;  3MHS C;  4PDR A;  2BOC C;  3RYI A;  1N36 B;  3ZRX A;  1I08 A;  4D7T A;  1FFT B;  1I5X A;  2E76 B;  3ABM B;  4DV3 B;  2ADP A;  2EIL B;  1GH6 A;  3E35 A;  4UV8 A;  3Q4H B;  1ZWI C;  3BY6 A;  2YIC A;  2R72 A;  2PZS A;  1Q6I A;  2JK5 C;  1KP3 A;  4F4L A;  1XNR B;  1YF2 A;  2XT9 A;  1Y67 A;  2KB1 A;  4BWA A;  4UB6 Z;  3OMN B;  1FKA O;  4OGQ B;  1Y76 A;  1XNQ O;  4DK0 A;  2X7R B;  4X66 B;  2PTM A;  5EYP A;  3M99 B;  1PPJ H;  2ITC C;  2CGO A;  4GKJ O;  4K8Z A;  2GTA A;  2YID A;  5CA1 B;  2N05 A;  1R1B A;  2BSK A;  1QVF U;  1K73 W;  5BMV A;  2XHB A;  2EJ7 A;  1DTO A;  4PA7 A;  5GW7 A;  2YIB A;  5H5N A;  3AG4 B;  2Q69 A;  3L70 H;  5GON B;  2Q4P A;  1KU9 A;  1P49 A;  1BQ0 A;  5GTH Z;  2FML A;  3VBB A;  1FAF A;  5IJ9 B;  3R66 A;  4X88 A;  1FXV A;  2IJJ A;  3BHP A;  1VQN V;  1NH2 D;  3Q4H A;  1EN5 A;  5DM6 V;  1N32 O;  4CS4 A;  2CAZ C;  5K1X A;  3CX5 F;  4FMT A;  3SGI A;  3OAA G;  1NU1 H;  1M4U A;  1VQ9 V;  1P4R A;  3QVN A;  2HHH B;  2FYU H;  4MW8 A;  1R3L C;  1RSO B;  3ZRV A;  5LP6 C;  3I55 V;  5JWP A;  2AXT Z;  3T1H B;  4UCO A;  1V55 C;  4UCR A;  4YJ3 B;  3K5M A;  4TQF A;  4DV6 B;  5FNV B;  2EIK C;  1P7B A;  2EZO A;  2E75 B;  3BAB A;  4DR2 O;  4A5U B;  2YXY A;  1JJO A;  4DW1 A;  2ATK C;  1HDJ A;  3AG3 C; 
#chains in the Genus database with same CATH homology
 1XBL A;  2EJ7 A;  2LO1 A;  2M6Y A;  1FPO A;  2QWQ B;  3BVO A;  2OCH A;  2QWP B;  2DN9 A;  4IT5 A;  2QWR B;  2CUG A;  2Y4U A;  2CTP A;  2CTR A;  2QSA A;  3APO A;  3UO3 A;  1BQ0 A;  2YS8 A;  2DMX A;  2KQX A;  3UCS C;  2CTQ A;  2LGW A;  2PF4 E;  2QWN B;  4RWU A;  2YUA A;  1NZ6 A;  1IUR A;  1BQZ A;  2QWO B;  4J80 A;  4J7Z A;  3UO2 A;  2CTW A;  2N05 A;  2GUZ B;  1WJZ A;  2Y4T A;  1FAF A;  2L6L A;  1HDJ A;  2GUZ A;  3APQ A;  1N4C A;  2N04 A;  1GH6 A;  3AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...