4LFCO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfcO00
4B3RO 1J5EO 5H5NA 4X62O 4YY3O 1D2DA 2Z0AA 2UUAO 3JAMN 4JI5O 2UXBO 1XMOO 4LF9O 1XEQA 4DR5O 4NXMO 4DV1O 4B3TO 3J80N 1KUQA 2VQEO 4NXNO 5BY1A 1FYJA 1XNRO 4K0KO 4AQYO 4DV2O 4LFAO 4DR3O 1HNWO 4OPHA 4LF7O 4DR4O 3T1YO 2UUCO 5LMNO 4DUYO 4DR7O 4GKKO 1HNXO 1FKAO 3R66A 4X64O 1DK1A 4JV5O 4JYAO 1XNQO 4JI7O 3J7AU 4GKJO 1FJGO 1I94O 4OPAA 2ZKOA 2AGAA 2FKXA 2N74A 4JI1O 3OTOO 4LF4O 5A2QN 4DUZO 1G1XB 5LMUO 1IBLO 4DV5O 2UUBO 1R6TA 5BR8O 1R1BA 3M8AA 4LF8O 3T1HO 4JI4O 1N32O 1HNZO 5BXZA 4DV6O 4B3MO 3O65A 5FLXN 4DV4O 4JI8O 2VQFO 4JI3O 2DJVA 4JI2O 4A5UB 1N33O 3SDLA 1F7YA 5IWAO 4JI6O 1HR0O 4X66O 4DR1O 1AILA 4LF5O 2ZM6O 1AB3A 1A32A 4DR2O 5LL6Y 3J81N 4LFCO 5IT9N 1N36O 4B3SO 2HHHO 2JRIA 4LF6O 2F4VO 2UXDO 4LFBO 1IBKO 2UXCO 4DV3O 2UU9O 4OX9O 1NS1A 2DOSA 4DV7O 4X65O 1N34O 4KHPO 1XMQO 1IBMO 4DR6O 1X59A 3RT3C 4JI0O 3F5TA 2E5LO 4YHHO 1YZBA 4DV0O 2LW7A
chains in the Genus database with same CATH superfamily
1AI4A 1N0JA 4Z1MG 1AJQA 4GZRB 5KMGA 1YJ9V 1AI7A 1KKCA 3ZN0A 2RN9A 4J80A 4UCUA 3A0BZ 2ZIOA 3DXRA 5CBGA 4K3AA 2HG5C 1L1FA 5GTHZ 1MSWD 4AHCA 1NZ6A 4GX5A 4LFCB 1ZLZA 4CBCA 1S72V 3UO3A 4LR3A 1SC5B 3KKYA 3RN4A 4DV7B 1HNXO 4I4TB 1AP5A 3R66A 2L35A 1RM1B 4OXSA 1H38A 4QGPA 2DW4A 1SF9A 1P84F 5LP6A 4JASA 3ML0A 1MZFA 1RPRA 4LF4O 2BSKA 2PYLA 1JVMA 1S76D 1Q6UA 1RPOA 2BTQB 4ZIBA 4LF9B 2XAJA 2WLJA 4IHJB 4DV1B 2Q73A 3BCCH 1AJPA 1YCIA 1OCRC 3HPLC 3F5WC 1PNMA 1HWYA 1K5SA 1RSOB 4BWAA 1OJHA 2EIMC 2ZT9B 4FVMA 4DO2A 3M7MX 2P06A 1TAEA 1WB7A 4GYCB 3SYPA 3VQXA 5KUKA 3ZRWA 1GM7A 3L9DA 3CCEV 1Q5OA 2Z5UA 5J2UA 3ZIAG 4IYIA 1TUEB 4J42A 1SZTA 5LOVB 2CTQA 2K1EA 4ZHQA 1DF4A 2ZE8A 3J81N 4X9QA 3SYAA 2L6LA 1F51A 5EYPA 4W4LA 4LFBO 3LDCA 4LH6A 3P3PA 1IBLB 3CCVV 2WWWA 2EIJC 3GWOA 1K4DC 2X6BA 2B1GA 3OEHG 3SJQC 1SA0B 3MHHC 2ADPA 4BAYA 4I7ZB 5CB4A 2IJHA 1VQ4V 3AG1B 3ZEDA 1R3IC 3J80N 2EIKC 5LYJB 1TVKA 5GTIZ 1GRJA 3SPCA 5JJEB 1GK9A 5JWPA 2CUGA 2HKOA 2A0LA 2Q67A 4DV3B 4GKKO 3ABLB 1N34B 3RBZA 3ZRXA 3PJSK 1ZWIC 3G6BA 4DR4B 1I94O 3IFXA 2HJDA 4LC1A 2YC0A 4CS3A 4MVSA 1PNLA 5H6RA 4FLTA 2LO1A 2KQXA 3RYIB 5CA0A 3UCSC 5CN0A 1JX9A 1YXBA 4I55B 1P4RA 1WN7A 2CGNA 3BA8A 1GN2A 4O4LB 3CD6V 1SQBH 2YIBD 3ASNC 2ZXWC 3H1JH 3T1YB 1Y74A 2N04A 3OE7G 3W7UA 3STZC 1W0KG 3R65A 4RUEA 1F7YA 4UUJC 1WLEA 3D8CA 1BGYH 1N32B 2QKCA 1IZ3A 3D36A 4ZKIA 1A32A 1ROPA 2WLIB 4EKWA 4K8ZA 3OMNB 4LWSA 3JCZA 1WA8B 1ORQC 2F66C 2IJJA 3JD0A 1WAZA 3N2KA 4O4IA 4X89A 5KX5A 2UU9O 2JS3A 2OIEA 4KHPO 3JAWB 1NR1A 2HVKC 4PHZA 5C93A 4JPRA 5FNVA 5KMGB 3VOUA 4DV0O 3JSLA 2Q9LA 2XHBA 3WU2Z 1FFXA 3G4SV 1PKXA 4WBNA 2JDIG 4X1IA 4UV8A 2PF4E 3RGBA 3JCUZ 1MABG 4FIPC 2HLDG 1KP2A 3ZJZA 2QGNA 5JH7B 5KHJA 1QCEA 3ZRVA 3K08A 3AEIA 4CH6A 4H0LB 3KCXA 5L3EA 1KU9A 5JQGB 4MTOA 3CCMV 4DXWA 1BT8A 4R6ZA 2W0XA 1VQ7V 4WFHA 1XMQB 1W0JG 2V1DA 4PV1B 1VF7A 3CPWU 5B1BC 4QPKA 4RAIA 2E5LB 4JI7O 3VBBA 2FKXA 3OTOO 2ETNA 5JCOC 1UPGA 5LHHA 3E22A 4ABMA 1WPXA 3LDDA 1NTMH 3HKEA 2RMKB 3EHBB 1KMIZ 5L3FA 2VQEB 4YJ2B 3CCUV 2YXHA 2ILMA 4O2BA 1HNWB 1E1RG 3HKCB 3ZRWB 2P7TC 5IY5B 2BCCH 4DUYB 4PI2A 4IIJA 3VQYA 3TK1A 2JS5A 1VQ9V 3SGIA 3CXCU 1SQGA 1M56B 5EYPB 4X1KB 4B3SO 2HHHO 2PI5A 1YIJV 3PN1A 3IJ4A 3ZN1A 1XOUA 1AJNA 4UVBA 2Q0OC 1EFRG 2ZNIA 1YITV 4L8JA 2PI4A 5HFMA 2GSMB 4EB6A 4YHHO 1WJZA 3T1HB 1SZXA 3FB6C 4X65B 4JI8B 1PD3A 2GDSA 4HNAB 4PDVA 1AVMA 2ZE5A 1M9NA 1OHHG 1QVGU 1XMOO 1DGSA 2VWKA 1KD1W 2ZR2A 3CCQV 4JTDB 3K3WA 5L3BA 1K92A 2FMLA 4JZ2A 5J2TA 4LF6B 1U97A 1SS3A 2UUCO 2UXCB 2YXYA 1AR1B 2RDCA 4NKGB 2QTOA 5AG2A 2VRZA 5IYZB 2KKWA 4DR6B 4FM1A 4MTFA 2FL4A 4EFBA 5H9CA 1BS3A 3K06A 4JTCB 4X62B 4JI1O 2RQ6A 4UFZA 2WAMA 3QVNA 4NR1A 5DEDA 3K59A 3ABKC 3T4ZA 4JYYA 1YVWA 4K35A 4CH4A 3FAVB 2GTSA 2JEXA 5H2FZ 1VF5B 3QG5A 1CXZB 1Y74B 1SESA 1MA1A 3CP1A 1NT2B 4I4TA 4LF7B 1YF2A 3SYOA 3K0GA 1H2SB 1P7GA 4XDLA 3G80A 3SDLA 1AR4A 1N8RW 2JJ2G 4JAVA 2JGDA 4JYAB 1FD9A 4B3MB 2ZM6O 1IXMA 3ABMB 1KB9F 1XI1A 2GUZB 1R3LC 2BTQA 5KX5B 1JFFB 1JPXA 3SYQA 1QNMA 3P3NA 2DOSA 2DQ0A 4G27B 1RSOA 1T5EA 5LMUB 3OW2U 3I5DA 3K79A 5FNVB 3RVZA 2X7RB 4MSWC 2IW5A 4LF8B 1VP7A 3CMAV 2MK3A 3SPHA 1RP3B 3B4SA 1MOFA 3B09A 5IYBO 1J5EO 1FFXB 4WBNB 4X1IB 3H1LH 4JI2B 1H2NA 3CRQA 2UUAO 5B1NA 4JI5O 5LOVA 2X6CA 5IWAB 3T4DA 1K7DA 4ICGA 3E35A 1VEWA 4J9YB 2A7WA 1VF6C 2NN4A 3AG2C 3FB8C 1VQ5V 1IBKB 1VIBA 4OX9B 4DR7O 1NVPD 3DGEA 3HR0A 2CAZC 3OR7C 2LJ2A 3J7AU 3CRCA 3FFQA 2ZKOA 2QDOA 3C3SA 4FLVA 3E2EA 5LYJA 1G1XB 2EJ7A 3E8GA 5D5QA 4J9ZB 5HFLA 5B66Z 4NXMB 3AK1A 3M8AA 4I9WA 4O2BB 1AROP 2N05A 4X88A 1M5IA 1BCCH 1K73W 4IIJB 2EZPA 2F23A 5FLXN 4PDLA 2EX3A 5BMVB 2DWEC 3ETDA 1KBHA 2WA3A 4FMTA 4JI6O 3APQA 3WB0A 2XUMA 2WLHA 4DR1O 1WNSA 3QO8A 5IT9N 1PL4A 4BW5A 2QEXV 4TV8B 1V55C 4I55A 3H1HH 4EB6B 1ZL8A 1XUQA 4G28B 1H2LA 4N21A 1AI5A 2WLKA 1ENVA 2UXBO 1OCRB 4PA6A 1WPBA 3ZMTA 4J11A 1LR1A 1QLEC 2EIMB 4JI3B 3SJAC 4ZI7B 3ZHUA 1B06A 1MMMA 2YICA 4J7ZA 4QNHB 2LGWA 4YXWG 4R50A 4WF9V 4B3TO 5E79Z 4NXNO 1OCZC 5J2TB 3K9SA 3JAKB 5L3CA 2WA4A 4DR3O 3E86A 1M57C 3L73H 1DTOA 2AZ2A 1XHXA 1E1QG 4TT3G 1COWG 4H13B 1XREA 2B9ZA 4OGQB 1IBMB 2PYJA 4JV5O 2EIJB 2F1MA 4E4EA 1HDJA 3MDSA 4JAAA 3I56V 5CMUA 3TJTA 2WPDG 3UO2A 4B3RB 1L8DA 3FB7C 4NTXA 3CEIA 4JYCA 1M1KW 1GO3F 1Y76A 2IJKA 1R73A 2QWPB 3RYHB 1P7BA 5JH7A 4X1YB 3OFNG 1NJIW 3A0HZ 3E8HA 2ATKC 2P5OA 1XNRB 2EIKB 4YJ3B 5JQGA 2QKAA 3F7YC 4LNUA 5FPRA 1L0LH 3BHPA 2JGDB 1M4UA 5K1PA 4FFBA 1KP3A 1QQCA 5EK0A 4O2AA 1AILA 4LP8A 3FKSG 3QNEA 2H8PC 4LFCO 2ZE6A 2ZNJA 2IJIA 1JR9A 4DV7O 4YJ2A 5TISZ 2UUBB 4H37A 4RQFA 3LSQA 5KA6A 3MHSC 3HKCA 3RT3C 3RYFA 2HJFC 2LP7A 4MW3A 1I08A 4AILC 4R8CA 3BABA 3JD3A 1NVPB 3ASNB 2ZXWB 1N33B 5B3SC 3HKDA 4LF9O 1B04A 1R3JC 1XEQA 4X1KA 4CS2A 4DV1O 1SQPH 4DR2B 3H1IH 3CS5A 1FYJA 1XBLA 4XDKA 3W7TA 5L3GA 3KZIZ 2F4VB 5CBFA 1PPJH 3T1CA 5E1AC 1I5YA 1DK1A 3OEEG 4BIOA 1Q81W 2DYSC 4HNAA 4WFFA 4YY3B 5A2QN 3BEHA 4WFGA 1IBLO 1CPYA 5LGTA 2Q69A 4JAUA 4LH7A 1R1BA 2A3QA 3SJBC 2MW2B 5JVDB 4K0KB 3MD0A 4O4HB 4BR6A 5B5EZ 5IYZA 5EC1C 3AG3C 1UFIA 2P22C 2UXNA 3QO7A 2YIBA 2HEPA 1XNQB 3OM3B 4JYBA 1B6QA 1URFA 4GX1A 4RO2A 1OZ0A 5B1BB 3BVOA 1XQ8A 1ZL8B 3FAVA 1TGOA 4DV3O 1GN4A 2HFEC 1N34O 4B08A 5BR8B 1KECA 2OTLV 3BPZA 4I0XA 2FTKA 5IYDO 1QU7A 4JI4B 4FZ0A 3K5NA 5IJ9B 3HB3B 4UVAA 5H5NA 4MTXA 3E8BA 3NR7A 1M90W 2IM9A 4PA7A 4ZOLA 2V7QG 3B8NA 3OR6C 2GUZA 1XILA 4MVQA 1W59A 1M93A 1JCHA 1JFFA 1NQTA 1VQKV 2R72A 3H01A 2A06H 2UXDB 3JYCA 1FAFA 3OD4A 3T1YO 1GM9A 1NU1H 1V54C 2CDYA 1IX9A 4L87A 1NTKH 2DMXA 4JI0B 4QIWF 5LBQA 4RWUA 1Y76B 3D3QA 3JARB 1NH2D 5CA1B 4JI7B 1OCOC 3AG4C 1R6TA 3L71H 2Q7GA 3CYOA 2QWOB 3RYCB 4ASUG 3OTOB 3ZHSA 1ZAUA 4LNUB 2JGUA 2BE3A 4AQYB 1SRYA 1WP8A 4PDMA 2XAHA 4FFBB 2BOCC 2XAGA 2DWDC 3CX5F 5C8YB 1FFTB 3CXHF 4O2AB 2ZQMA 4A5UB 2Q68A 1F4MA 4U3JB 3JALB 1SQFA 4X64B 5EZYB 1AB3A 4GKJB 5KHIA 5KAFZ 1K97A 3WG7B 4DUZB 5DECA 4FFKA 1NS1A 3LSSA 5ITZB 5FPOA 3RYFB 1HP8A 1XMQO 2LFRA 1MZEA 3UQ8A 3ABKB 3NXSA 2QE7G 4C7UA 5BMVA 2E5LO 1GMGA 2CE4A 1HNZB 3LDEA 2M7WA 3K57A 2H3OA 4DV4B 3THOA 3HKDB 1AP6A 3D3IA 3JD2A 1Y67A 2LW1A 1XL6A 2ZDIC 4DYLA 1SQQH 1PV0A 3E8FA 4RUFA 2VQEO 4TV8A 5BY1A 3LNNA 5EBLC 2R70A 2BOBC 2Q8VA 1HNWO 2E3CA 4CH5A 4DUYO 2LGQA 4J7JA 2Z3YA 2W6JG 5EBWC 3DC6A 4ZI7A 5BZBA 1I5XA 4Q6GA 3A0RA 2YIDA 1F4NA 3I55V 2A9HA 2N74A 1HW7A 2QM8A 3G67A 1Q86W 2IU0A 3JAKA 4J41A 2KSDA 3CC2V 1VARA 2EBOA 4CC6A 4JI1B 4IT5A 4HBNA 3T1HO 4DK1A 4LFAB 1JOYA 4AI8A 3OUFA 4JI8O 4FLWA 5LP6C 3AG2B 3WG7C 4PD4F 5GW7A 5LGNA 2EINC 1BHBA 4MVOA 2OT5A 1FJGB 4D7TA 2IU3A 1G4YB 3RYHA 4FLUA 4H44B 2CGOA 4X1YA 2JRIA 2LQTA 4LF6O 1VQ6V 2UXCO 2R9IA 3H9VA 4I0XB 2P6JA 4WFEA 4DV5B 2B1IA 4YJ3A 4BW9A 4HAMA 4I50B 4DR6O 2Y0IA 2UXXA 1X59A 2ZD9A 3ZMZA 5GONB 2GBOA 3CCSV 1H8HG 1D5NA 3O9OA 4DV6B 3ABUA 2WLNA 4ZOLB 4X62O 4PA4A 2Z0AA 3T2MA 2VQFB 2XNDG 1O9GA 5CBHA 4D7SA 4DRXA 1LUVA 3ZHQA 2Y0PA 4X66B 4LF5B 3UT5B 1J5EB 1QHTA 3QTCA 2Y48A 2NLJC 4TQDA 3ETGA 3CJHB 2CTRA 3ZX6A 4CC5A 1N0NA 4GX2A 4DW0A 1N36B 4CZZA 3K0DA 1PL0A 4LF7O 1NH2B 1SQXH 4P9PA 1V55B 1JJOA 1GN6A 2XASA 4JYAO 2Y4UA 1G6UA 3B2EE 3SR2C 1W2BU 1UJWB 3ASOC 3TETA 3ZMUA 1S5JA 3JATA 3CC4V 3STLC 1GKFA 2DN9A 2YEVB 3ZS8C 1QLEB 2YIAA 5LMUO 4DR5B 1FXHA 3KG2A 1G8MA 2YS8A 4LF8O 4F6EA 5BXZA 4UB8Z 1OCZB 3WB1A 4DV2B 3JD4A 3IGAC 4FJCC 1K3EA 4JI2O 4WFBV 5LMNB 3L75H 1M57B 3SYCA 5IWAO 1Y4MA 4UXNA 3OTFA 3H1KH 1GH6A 1MSDA 1DF5A 2OCCC 1QR8A 2XAQA 4JI6B 3B40A 1IBKO 2IH1C 1VQ8V 4OX9O 5JVDA 4O4HA 2QA4V 2R9AA 3Q4HB 5LXTB 4MVMA 3DSQA 3F5TA 2IH3C 1THZA 1PP9H 2LW7A 1TA8A 3QF7A 3G6EV 5EC2C 5KLVH 1OCCB 1YSCA 3C90A 1ZSPA 1PM9A 4FK5C 2ZR3A 3OMIB 2PY5A 4NXMO 1GAXA 2CH7B 1GTOA 1YEWA 3FD9A 4JTAB 2OYQA 3A8TA 5JCOA 1KQSU 2Q7EA 2KG7B 4KFMA 3RW0A 1TUBB 3P32A 1S5LZ 1MG1A 1QLNA 1NTZH 1FKAO 4U7NA 5IJ9A 2QM7A 3ETQA 4Z1VA 4FM2A 3JSNA 3AK2A 3IC7A 1VMGA 2ZE7A 4WFAV 4QPJA 2Q0AA 1QVFU 3C3TA 2LFSA 5F2VO 1K4CC 3CB2A 3RWRD 2M6YA 5DM6V 4KP4A 1IVSA 3GB7C 2VWJA 2D3OW 5B3SB 1H2MA 4FLYA 2FB5A 2X0LA 4R7CA 2DYRC 5EIBC 1R6KA 1J95A 3ABTA 3X2QC 4X20B 1I0HA 5KA5A 4JI3O 2NR5A 3BA9A 1HNXB 4JGSA 2HR3A 1HR0O 2JEUA 3SJCC 4EFEA 3OMAB 1IURA 2OIGA 3JARA 5CA1A 2XT9A 1NBMG 4FLXA 5LA6A 1Y66A 4WCEV 2DYSB 2AZ0A 2Y4TA 4LF4B 4ZBMA 5IJ0B 3RYCA 2VS0A 4UCTA 2JIZG 1OCCC 3ZMVA 1IBMO 1IXBA 2QWRB 3W7WA 4UVCA 5C8YA 2QWNB 2AHYA 4B3RO 2H94A 4U3JA 3JALA 3CHXA 3L70H 4DRXB 1EBOA 4TUYB 3AG7A 5EZYA 1BSMA 4CH3A 3AG3B 3CE2A 4FPPA 2BTOA 3FX7A 5LHGA 3EXAA 3TGUH 5B1AC 1CP9A 1DLBA 2YI8A 2OCHA 3G71V 1XNRO 3K03A 5ITZA 3U11A 1EZVH 2ITDC 4LFBB 4Q20A 3GWKC 2D2CB 1Q7YW 3EVKA 2PUSA 2YXLA 3W7XA 4PELA 3CRAA 3EFFK 1ZUQA 2XTAA 4X8AA 2NNUA 3JATB 2WSSG 2EJRA 4OPAA 1EN4A 2FYUH 3OAAG 4I5SA 2X6AA 3K04A 2ZIMA 1N4CA 1YI2V 4I9QA 5FL7G 2QTSA 2UUBO 1Y6XA 2P4KA 3QO5A 4BIUA 3JASB 4N23A 4PI0A 2G38A 2E74B 4F6RA 1Q82W 3CRRA 1Z5WA 4PJ0Z 4B7EA 1BQ0A 4EEQA 5LHIA 4GKKB 1N33O 4TV9B 4MTGA 1V54B 5L3DA 1Z5VA 2YDEA 4P30A 5KHHA 4LBEC 3OGCC 1JMKC 4DR2O 5LL6Y 3S3XA 1I94B 4NB5A 3TXQA 4U3FH 3GVMA 2Q4PA 4YIOA 2F4VO 1SETA 3LUTB 2HVJC 4HZ3A 1EZJA 5KHGA 3HKBB 1RM1C 1YJWV 5K1XA 1OCOB 3AG4B 4GUNA 1Q8IA 3A2FA 1XDCA 3ZCCA 1LNQA 1VF6A 3B8MA 3K58A 4LCUC 1KC8W 1BE3H 2AXTZ 4YY3O 2ITCC 4G2KA 1BMFG 3CCJV 1JJ2U 3CCRV 2PTMA 2PGGA 4TSFG 1YTFD 4W4KA 1H2GA 2F43G 4FLZA 1S77D 3RVYA 3SPIA 2P67A 4K0KO 1AR5A 1EM1A 2DE0X 2WLLB 4I50A 4DR4O 5CA3A 2K9PA 2UU9B 5GONA 4KHPB 4D6TH 3DTUB 5IYCO 3L72H 4P2ZA 2Q5ZA 4MT8A 4UCRA 3CWBH 1XNQO 1ZTEA 4KUMA 4DV0B 2RNBA 1O9HA 4IYHA 4TQFA 1YDXA 1FXKB 3UT5A 1K9MW 4UCVA 1PNKA 4GCZA 3CC7V 2QSAA 3CJHA 3S3WA 5BR8O 1B3QA 3APOA 4J7KA 1K33A 4QJFB 4JI4O 3N2GA 1N32O 3UM7A 3KCYA 3AK3A 4NTYA 3ETEA 3FYIB 1GN3A 3AG1C 2DJVA 4HYOA 4GX0A 4NYKA 2ARHA 1S0VA 4MS2A 2YEVA 2E76B 5LA6B 4MVRA 3DXRB 4GLXA 2UXDO 3CCLV 3MAQA 3ABLC 4Z2WA 3VQWA 5A9GA 1JQ0A 1EN6A 1Q6HA 5JJJB 2QWQB 1F23A 3K5OA 4F4LA 2AW9A 4JI0O 1E79G 4PA9A 1YZBA 5JJNB 2YUAA 4UCOA 4TWKA 4UV9A 3ZMSA 1WB8A 2ODMA 5LP6B 4K8XA 2Y69B 4JZGA 3BY6A 2BSKB 2OWOA 1VQLV 1NKDA 1BL8A 1KUQA 2P90A 5IDJA 2EINB 3DC5A 4AQYO 1FPOA 4B3SB 2HHHB 4OPHA 5EIBD 1V9PA 1FXKC 3Q4HA 5LXTA 3K5MA 4GT1A 3OT7A 1OV9A 4X64O 4O4JA 1Q90D 1SQVH 2CTWA 4YHHB 3ZHVA 4GKJO 1BQZA 1VQMV 5J2UB 3E83A 4UB6Z 1LUWA 2CH7A 4DUZO 4ZHQB 1K34A 2IBZH 3OUSA 1XMOB 4PDRA 2KG7A 1S5HC 3ZHTA 1NI8A 4F6RB 4JF3A 4KXRA 4B7KA 1TUBA 2RJZA 1FXVA 4H33A 4FM0A 1HNZO 3ZRSA 2QKSA 4DV4O 2UUCB 1GM8A 1R6NA 1I7FA 1Z2GA 2WLMA 1AI6A 5CB4B 1ZX3A 1Q3EA 3ASOB 2CTPA 3ICXA 4MVUA 4XBFA 3LNMB 3FB5C 1TVKB 1YTFB 1P49A 4X65O 1R3KC 2Y69C 3BRCA 4X20A 1S3JA 3IC9A 2XOKG 3P30A 2O57A 1Q6IA 2E75B 5KAIZ 2HP8A 1WP7A 3IAYA 2W0FC 2YI9A 2P4VA 3JAMN 1VQPV 2AHZA 2A79B 3CSXA 4QE7A 3JD1A 1Q43A 2ZM6B 1EN5A 1D5AA 1VQNV 5CA0B 5IJ0A 4DW1A 5H6QA 3F7VC 5IY5C 4LFAO 2EILB 5LGUA 2OCCB 3ZBHA 3TCUA 4BIZA 1IDSA 2JVDA 1M56C 3WB2A 4XDJA 1SKVA 2C2AA 4TUYA 1FJGO 2AGAA 3LSUA 3TXSA 4DK0A 1FS0G 2F95B 4LWSB 2UUAB 2GHYA 4JI5B 5DN6G 3N2KB 3M99B 4DV5O 1KKDA 1SERA 3N2GB 4O4IB 1H2KA 2Q6AA 2CK3G 4IHJA 3FYEB 2EZOA 4DV6O 4B3MO 3O65A 3VQVA 4PA3A 3BFRA 1H8EG 2VQFO 2JJ1G 2PZSA 4DR7B 4FZ1A 2R9RB 2YSUB 4X66O 4LF5O 2W6IG 3W7SA 1N36O 2V4DA 1RFYA 4U7OA 1BHAA 3U10A 2OTJV 4UCSA 3JASA 2QM4A 1MNGA 4QE9A 4RQEA 2DYRB 4TV9A 1SA0A 4KL1A 1D2DA 2EILC 3X2QB 2DQ3A 2JK5C 3L74H 4YIPA 4J10A 4DR1B 4DR5O 1VQOV 3SPJA 3BAAA 4TOIA 3CRMA 3E22B 3CMEV 5KHKA 3B77A 1JA8A 3HKEB 3SPGA 1K8AW 2GV9A 2ADQB 3E89A 4DV2O 5IE9A 3HKBA 4E2LA 1NR7A 4IGGA 1U96A 3D36C 5LMNO 3WFVA 4O4JB 3UKMA 2QR4A 2GTAA 3ABMC 1XL4A 2ZINA 1L0NH 2UXBB 2RCVA 1KYOF 2KB1A 3ZHRA 2ZCEA 1XHZA 3OGIB 5KUMA 3K5LA 4IL6Z 2F93B 2B5UA 3RFRA 4B3TB 2WLLA 3RYIA 1CEZA 3N27A 4NXNB 5B1AB 5B1OA 4DR3B 4NTWA 4O4LA 4MVZA 2QJ1A 1FXKA 1X4TA 1QR9A 4JV5B 2Q7HA 2EULA 4MW8A 4CS4A 5EBMC 3U0ZA 2WLIA 1BZKA 1US6A 5D5PA 1WA8A 1HR0B 1K5QA 2XAFA 2ZDIA 4P9OA 4NVPA 5J9PC 3K9AA 1QBZA 3JAWA 1YJNV 1YHQV
chains in the Genus database with same CATH topology
4B3RO 1J5EO 5H5NA 4X62O 4YY3O 1D2DA 2Z0AA 2UUAO 3JAMN 4JI5O 2UXBO 1XMOO 4LF9O 1XEQA 4DR5O 4NXMO 4DV1O 4B3TO 3J80N 1KUQA 2VQEO 4NXNO 5BY1A 1FYJA 1XNRO 4K0KO 4AQYO 4DV2O 4LFAO 4DR3O 1HNWO 4OPHA 4LF7O 4DR4O 3T1YO 2UUCO 5LMNO 4DUYO 4DR7O 4GKKO 1HNXO 1FKAO 3R66A 4X64O 1DK1A 4JV5O 4JYAO 1XNQO 4JI7O 3J7AU 4GKJO 1FJGO 1I94O 4OPAA 2ZKOA 2AGAA 2FKXA 2N74A 4JI1O 3OTOO 4LF4O 5A2QN 4DUZO 1G1XB 5LMUO 1IBLO 4DV5O 2UUBO 1R6TA 5BR8O 1R1BA 3M8AA 4LF8O 3T1HO 4JI4O 1N32O 1HNZO 5BXZA 4DV6O 4B3MO 3O65A 5FLXN 4DV4O 4JI8O 2VQFO 4JI3O 2DJVA 4JI2O 4A5UB 1N33O 3SDLA 1F7YA 5IWAO 4JI6O 1HR0O 4X66O 4DR1O 1AILA 4LF5O 2ZM6O 1AB3A 1A32A 4DR2O 5LL6Y 3J81N 4LFCO 5IT9N 1N36O 4B3SO 2HHHO 2JRIA 4LF6O 2F4VO 2UXDO 4LFBO 1IBKO 2UXCO 4DV3O 2UU9O 4OX9O 1NS1A 2DOSA 4DV7O 4X65O 1N34O 4KHPO 1XMQO 1IBMO 4DR6O 1X59A 3RT3C 4JI0O 3F5TA 2E5LO 4YHHO 1YZBA 4DV0O 2LW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R O;  1J5E O;  5H5N A;  4X62 O;  4YY3 O;  1D2D A;  2Z0A A;  2UUA O;  3JAM N;  4JI5 O;  2UXB O;  1XMO O;  4LF9 O;  1XEQ A;  4DR5 O;  4NXM O;  4DV1 O;  4B3T O;  3J80 N;  1KUQ A;  2VQE O;  4NXN O;  5BY1 A;  1FYJ A;  1XNR O;  4K0K O;  4AQY O;  4DV2 O;  4LFA O;  4DR3 O;  1HNW O;  4OPH A;  4LF7 O;  4DR4 O;  3T1Y O;  2UUC O;  5LMN O;  4DUY O;  4DR7 O;  4GKK O;  1HNX O;  1FKA O;  3R66 A;  4X64 O;  1DK1 A;  4JV5 O;  4JYA O;  1XNQ O;  4JI7 O;  3J7A U;  4GKJ O;  1FJG O;  1I94 O;  4OPA A;  2ZKO A;  2AGA A;  2FKX A;  2N74 A;  4JI1 O;  3OTO O;  4LF4 O;  5A2Q N;  4DUZ O;  1G1X B;  5LMU O;  1IBL O;  4DV5 O;  2UUB O;  1R6T A;  5BR8 O;  1R1B A;  3M8A A;  4LF8 O;  3T1H O;  4JI4 O;  1N32 O;  1HNZ O;  5BXZ A;  4DV6 O;  4B3M O;  3O65 A;  5FLX N;  4DV4 O;  4JI8 O;  2VQF O;  4JI3 O;  2DJV A;  4JI2 O;  4A5U B;  1N33 O;  3SDL A;  1F7Y A;  5IWA O;  4JI6 O;  1HR0 O;  4X66 O;  4DR1 O;  1AIL A;  4LF5 O;  2ZM6 O;  1AB3 A;  1A32 A;  4DR2 O;  5LL6 Y;  3J81 N;  4LFC O;  5IT9 N;  1N36 O;  4B3S O;  2HHH O;  2JRI A;  4LF6 O;  2F4V O;  2UXD O;  4LFB O;  1IBK O;  2UXC O;  4DV3 O;  2UU9 O;  4OX9 O;  1NS1 A;  2DOS A;  4DV7 O;  4X65 O;  1N34 O;  4KHP O;  1XMQ O;  1IBM O;  4DR6 O;  1X59 A;  3RT3 C;  4JI0 O;  3F5T A;  2E5L O;  4YHH O;  1YZB A;  4DV0 O;  2LW7 A; 
#chains in the Genus database with same CATH topology
 1AI4 A;  1N0J A;  4Z1M G;  1AJQ A;  4GZR B;  5KMG A;  1YJ9 V;  1AI7 A;  1KKC A;  3ZN0 A;  2RN9 A;  4J80 A;  4UCU A;  3A0B Z;  2ZIO A;  3DXR A;  5CBG A;  4K3A A;  2HG5 C;  1L1F A;  5GTH Z;  1MSW D;  4AHC A;  1NZ6 A;  4GX5 A;  4LFC B;  1ZLZ A;  4CBC A;  1S72 V;  3UO3 A;  4LR3 A;  1SC5 B;  3KKY A;  3RN4 A;  4DV7 B;  1HNX O;  4I4T B;  1AP5 A;  3R66 A;  2L35 A;  1RM1 B;  4OXS A;  1H38 A;  4QGP A;  2DW4 A;  1SF9 A;  1P84 F;  5LP6 A;  4JAS A;  3ML0 A;  1MZF A;  1RPR A;  4LF4 O;  2BSK A;  2PYL A;  1JVM A;  1S76 D;  1Q6U A;  1RPO A;  2BTQ B;  4ZIB A;  4LF9 B;  2XAJ A;  2WLJ A;  4IHJ B;  4DV1 B;  2Q73 A;  3BCC H;  1AJP A;  1YCI A;  1OCR C;  3HPL C;  3F5W C;  1PNM A;  1HWY A;  1K5S A;  1RSO B;  4BWA A;  1OJH A;  2EIM C;  2ZT9 B;  4FVM A;  4DO2 A;  3M7M X;  2P06 A;  1TAE A;  1WB7 A;  4GYC B;  3SYP A;  3VQX A;  5KUK A;  3ZRW A;  1GM7 A;  3L9D A;  3CCE V;  1Q5O A;  2Z5U A;  5J2U A;  3ZIA G;  4IYI A;  1TUE B;  4J42 A;  1SZT A;  5LOV B;  2CTQ A;  2K1E A;  4ZHQ A;  1DF4 A;  2ZE8 A;  3J81 N;  4X9Q A;  3SYA A;  2L6L A;  1F51 A;  5EYP A;  4W4L A;  4LFB O;  3LDC A;  4LH6 A;  3P3P A;  1IBL B;  3CCV V;  2WWW A;  2EIJ C;  3GWO A;  1K4D C;  2X6B A;  2B1G A;  3OEH G;  3SJQ C;  1SA0 B;  3MHH C;  2ADP A;  4BAY A;  4I7Z B;  5CB4 A;  2IJH A;  1VQ4 V;  3AG1 B;  3ZED A;  1R3I C;  3J80 N;  2EIK C;  5LYJ B;  1TVK A;  5GTI Z;  1GRJ A;  3SPC A;  5JJE B;  1GK9 A;  5JWP A;  2CUG A;  2HKO A;  2A0L A;  2Q67 A;  4DV3 B;  4GKK O;  3ABL B;  1N34 B;  3RBZ A;  3ZRX A;  3PJS K;  1ZWI C;  3G6B A;  4DR4 B;  1I94 O;  3IFX A;  2HJD A;  4LC1 A;  2YC0 A;  4CS3 A;  4MVS A;  1PNL A;  5H6R A;  4FLT A;  2LO1 A;  2KQX A;  3RYI B;  5CA0 A;  3UCS C;  5CN0 A;  1JX9 A;  1YXB A;  4I55 B;  1P4R A;  1WN7 A;  2CGN A;  3BA8 A;  1GN2 A;  4O4L B;  3CD6 V;  1SQB H;  2YIB D;  3ASN C;  2ZXW C;  3H1J H;  3T1Y B;  1Y74 A;  2N04 A;  3OE7 G;  3W7U A;  3STZ C;  1W0K G;  3R65 A;  4RUE A;  1F7Y A;  4UUJ C;  1WLE A;  3D8C A;  1BGY H;  1N32 B;  2QKC A;  1IZ3 A;  3D36 A;  4ZKI A;  1A32 A;  1ROP A;  2WLI B;  4EKW A;  4K8Z A;  3OMN B;  4LWS A;  3JCZ A;  1WA8 B;  1ORQ C;  2F66 C;  2IJJ A;  3JD0 A;  1WAZ A;  3N2K A;  4O4I A;  4X89 A;  5KX5 A;  2UU9 O;  2JS3 A;  2OIE A;  4KHP O;  3JAW B;  1NR1 A;  2HVK C;  4PHZ A;  5C93 A;  4JPR A;  5FNV A;  5KMG B;  3VOU A;  4DV0 O;  3JSL A;  2Q9L A;  2XHB A;  3WU2 Z;  1FFX A;  3G4S V;  1PKX A;  4WBN A;  2JDI G;  4X1I A;  4UV8 A;  2PF4 E;  3RGB A;  3JCU Z;  1MAB G;  4FIP C;  2HLD G;  1KP2 A;  3ZJZ A;  2QGN A;  5JH7 B;  5KHJ A;  1QCE A;  3ZRV A;  3K08 A;  3AEI A;  4CH6 A;  4H0L B;  3KCX A;  5L3E A;  1KU9 A;  5JQG B;  4MTO A;  3CCM V;  4DXW A;  1BT8 A;  4R6Z A;  2W0X A;  1VQ7 V;  4WFH A;  1XMQ B;  1W0J G;  2V1D A;  4PV1 B;  1VF7 A;  3CPW U;  5B1B C;  4QPK A;  4RAI A;  2E5L B;  4JI7 O;  3VBB A;  2FKX A;  3OTO O;  2ETN A;  5JCO C;  1UPG A;  5LHH A;  3E22 A;  4ABM A;  1WPX A;  3LDD A;  1NTM H;  3HKE A;  2RMK B;  3EHB B;  1KMI Z;  5L3F A;  2VQE B;  4YJ2 B;  3CCU V;  2YXH A;  2ILM A;  4O2B A;  1HNW B;  1E1R G;  3HKC B;  3ZRW B;  2P7T C;  5IY5 B;  2BCC H;  4DUY B;  4PI2 A;  4IIJ A;  3VQY A;  3TK1 A;  2JS5 A;  1VQ9 V;  3SGI A;  3CXC U;  1SQG A;  1M56 B;  5EYP B;  4X1K B;  4B3S O;  2HHH O;  2PI5 A;  1YIJ V;  3PN1 A;  3IJ4 A;  3ZN1 A;  1XOU A;  1AJN A;  4UVB A;  2Q0O C;  1EFR G;  2ZNI A;  1YIT V;  4L8J A;  2PI4 A;  5HFM A;  2GSM B;  4EB6 A;  4YHH O;  1WJZ A;  3T1H B;  1SZX A;  3FB6 C;  4X65 B;  4JI8 B;  1PD3 A;  2GDS A;  4HNA B;  4PDV A;  1AVM A;  2ZE5 A;  1M9N A;  1OHH G;  1QVG U;  1XMO O;  1DGS A;  2VWK A;  1KD1 W;  2ZR2 A;  3CCQ V;  4JTD B;  3K3W A;  5L3B A;  1K92 A;  2FML A;  4JZ2 A;  5J2T A;  4LF6 B;  1U97 A;  1SS3 A;  2UUC O;  2UXC B;  2YXY A;  1AR1 B;  2RDC A;  4NKG B;  2QTO A;  5AG2 A;  2VRZ A;  5IYZ B;  2KKW A;  4DR6 B;  4FM1 A;  4MTF A;  2FL4 A;  4EFB A;  5H9C A;  1BS3 A;  3K06 A;  4JTC B;  4X62 B;  4JI1 O;  2RQ6 A;  4UFZ A;  2WAM A;  3QVN A;  4NR1 A;  5DED A;  3K59 A;  3ABK C;  3T4Z A;  4JYY A;  1YVW A;  4K35 A;  4CH4 A;  3FAV B;  2GTS A;  2JEX A;  5H2F Z;  1VF5 B;  3QG5 A;  1CXZ B;  1Y74 B;  1SES A;  1MA1 A;  3CP1 A;  1NT2 B;  4I4T A;  4LF7 B;  1YF2 A;  3SYO A;  3K0G A;  1H2S B;  1P7G A;  4XDL A;  3G80 A;  3SDL A;  1AR4 A;  1N8R W;  2JJ2 G;  4JAV A;  2JGD A;  4JYA B;  1FD9 A;  4B3M B;  2ZM6 O;  1IXM A;  3ABM B;  1KB9 F;  1XI1 A;  2GUZ B;  1R3L C;  2BTQ A;  5KX5 B;  1JFF B;  1JPX A;  3SYQ A;  1QNM A;  3P3N A;  2DOS A;  2DQ0 A;  4G27 B;  1RSO A;  1T5E A;  5LMU B;  3OW2 U;  3I5D A;  3K79 A;  5FNV B;  3RVZ A;  2X7R B;  4MSW C;  2IW5 A;  4LF8 B;  1VP7 A;  3CMA V;  2MK3 A;  3SPH A;  1RP3 B;  3B4S A;  1MOF A;  3B09 A;  5IYB O;  1J5E O;  1FFX B;  4WBN B;  4X1I B;  3H1L H;  4JI2 B;  1H2N A;  3CRQ A;  2UUA O;  5B1N A;  4JI5 O;  5LOV A;  2X6C A;  5IWA B;  3T4D A;  1K7D A;  4ICG A;  3E35 A;  1VEW A;  4J9Y B;  2A7W A;  1VF6 C;  2NN4 A;  3AG2 C;  3FB8 C;  1VQ5 V;  1IBK B;  1VIB A;  4OX9 B;  4DR7 O;  1NVP D;  3DGE A;  3HR0 A;  2CAZ C;  3OR7 C;  2LJ2 A;  3J7A U;  3CRC A;  3FFQ A;  2ZKO A;  2QDO A;  3C3S A;  4FLV A;  3E2E A;  5LYJ A;  1G1X B;  2EJ7 A;  3E8G A;  5D5Q A;  4J9Z B;  5HFL A;  5B66 Z;  4NXM B;  3AK1 A;  3M8A A;  4I9W A;  4O2B B;  1ARO P;  2N05 A;  4X88 A;  1M5I A;  1BCC H;  1K73 W;  4IIJ B;  2EZP A;  2F23 A;  5FLX N;  4PDL A;  2EX3 A;  5BMV B;  2DWE C;  3ETD A;  1KBH A;  2WA3 A;  4FMT A;  4JI6 O;  3APQ A;  3WB0 A;  2XUM A;  2WLH A;  4DR1 O;  1WNS A;  3QO8 A;  5IT9 N;  1PL4 A;  4BW5 A;  2QEX V;  4TV8 B;  1V55 C;  4I55 A;  3H1H H;  4EB6 B;  1ZL8 A;  1XUQ A;  4G28 B;  1H2L A;  4N21 A;  1AI5 A;  2WLK A;  1ENV A;  2UXB O;  1OCR B;  4PA6 A;  1WPB A;  3ZMT A;  4J11 A;  1LR1 A;  1QLE C;  2EIM B;  4JI3 B;  3SJA C;  4ZI7 B;  3ZHU A;  1B06 A;  1MMM A;  2YIC A;  4J7Z A;  4QNH B;  2LGW A;  4YXW G;  4R50 A;  4WF9 V;  4B3T O;  5E79 Z;  4NXN O;  1OCZ C;  5J2T B;  3K9S A;  3JAK B;  5L3C A;  2WA4 A;  4DR3 O;  3E86 A;  1M57 C;  3L73 H;  1DTO A;  2AZ2 A;  1XHX A;  1E1Q G;  4TT3 G;  1COW G;  4H13 B;  1XRE A;  2B9Z A;  4OGQ B;  1IBM B;  2PYJ A;  4JV5 O;  2EIJ B;  2F1M A;  4E4E A;  1HDJ A;  3MDS A;  4JAA A;  3I56 V;  5CMU A;  3TJT A;  2WPD G;  3UO2 A;  4B3R B;  1L8D A;  3FB7 C;  4NTX A;  3CEI A;  4JYC A;  1M1K W;  1GO3 F;  1Y76 A;  2IJK A;  1R73 A;  2QWP B;  3RYH B;  1P7B A;  5JH7 A;  4X1Y B;  3OFN G;  1NJI W;  3A0H Z;  3E8H A;  2ATK C;  2P5O A;  1XNR B;  2EIK B;  4YJ3 B;  5JQG A;  2QKA A;  3F7Y C;  4LNU A;  5FPR A;  1L0L H;  3BHP A;  2JGD B;  1M4U A;  5K1P A;  4FFB A;  1KP3 A;  1QQC A;  5EK0 A;  4O2A A;  1AIL A;  4LP8 A;  3FKS G;  3QNE A;  2H8P C;  4LFC O;  2ZE6 A;  2ZNJ A;  2IJI A;  1JR9 A;  4DV7 O;  4YJ2 A;  5TIS Z;  2UUB B;  4H37 A;  4RQF A;  3LSQ A;  5KA6 A;  3MHS C;  3HKC A;  3RT3 C;  3RYF A;  2HJF C;  2LP7 A;  4MW3 A;  1I08 A;  4AIL C;  4R8C A;  3BAB A;  3JD3 A;  1NVP B;  3ASN B;  2ZXW B;  1N33 B;  5B3S C;  3HKD A;  4LF9 O;  1B04 A;  1R3J C;  1XEQ A;  4X1K A;  4CS2 A;  4DV1 O;  1SQP H;  4DR2 B;  3H1I H;  3CS5 A;  1FYJ A;  1XBL A;  4XDK A;  3W7T A;  5L3G A;  3KZI Z;  2F4V B;  5CBF A;  1PPJ H;  3T1C A;  5E1A C;  1I5Y A;  1DK1 A;  3OEE G;  4BIO A;  1Q81 W;  2DYS C;  4HNA A;  4WFF A;  4YY3 B;  5A2Q N;  3BEH A;  4WFG A;  1IBL O;  1CPY A;  5LGT A;  2Q69 A;  4JAU A;  4LH7 A;  1R1B A;  2A3Q A;  3SJB C;  2MW2 B;  5JVD B;  4K0K B;  3MD0 A;  4O4H B;  4BR6 A;  5B5E Z;  5IYZ A;  5EC1 C;  3AG3 C;  1UFI A;  2P22 C;  2UXN A;  3QO7 A;  2YIB A;  2HEP A;  1XNQ B;  3OM3 B;  4JYB A;  1B6Q A;  1URF A;  4GX1 A;  4RO2 A;  1OZ0 A;  5B1B B;  3BVO A;  1XQ8 A;  1ZL8 B;  3FAV A;  1TGO A;  4DV3 O;  1GN4 A;  2HFE C;  1N34 O;  4B08 A;  5BR8 B;  1KEC A;  2OTL V;  3BPZ A;  4I0X A;  2FTK A;  5IYD O;  1QU7 A;  4JI4 B;  4FZ0 A;  3K5N A;  5IJ9 B;  3HB3 B;  4UVA A;  5H5N A;  4MTX A;  3E8B A;  3NR7 A;  1M90 W;  2IM9 A;  4PA7 A;  4ZOL A;  2V7Q G;  3B8N A;  3OR6 C;  2GUZ A;  1XIL A;  4MVQ A;  1W59 A;  1M93 A;  1JCH A;  1JFF A;  1NQT A;  1VQK V;  2R72 A;  3H01 A;  2A06 H;  2UXD B;  3JYC A;  1FAF A;  3OD4 A;  3T1Y O;  1GM9 A;  1NU1 H;  1V54 C;  2CDY A;  1IX9 A;  4L87 A;  1NTK H;  2DMX A;  4JI0 B;  4QIW F;  5LBQ A;  4RWU A;  1Y76 B;  3D3Q A;  3JAR B;  1NH2 D;  5CA1 B;  4JI7 B;  1OCO C;  3AG4 C;  1R6T A;  3L71 H;  2Q7G A;  3CYO A;  2QWO B;  3RYC B;  4ASU G;  3OTO B;  3ZHS A;  1ZAU A;  4LNU B;  2JGU A;  2BE3 A;  4AQY B;  1SRY A;  1WP8 A;  4PDM A;  2XAH A;  4FFB B;  2BOC C;  2XAG A;  2DWD C;  3CX5 F;  5C8Y B;  1FFT B;  3CXH F;  4O2A B;  2ZQM A;  4A5U B;  2Q68 A;  1F4M A;  4U3J B;  3JAL B;  1SQF A;  4X64 B;  5EZY B;  1AB3 A;  4GKJ B;  5KHI A;  5KAF Z;  1K97 A;  3WG7 B;  4DUZ B;  5DEC A;  4FFK A;  1NS1 A;  3LSS A;  5ITZ B;  5FPO A;  3RYF B;  1HP8 A;  1XMQ O;  2LFR A;  1MZE A;  3UQ8 A;  3ABK B;  3NXS A;  2QE7 G;  4C7U A;  5BMV A;  2E5L O;  1GMG A;  2CE4 A;  1HNZ B;  3LDE A;  2M7W A;  3K57 A;  2H3O A;  4DV4 B;  3THO A;  3HKD B;  1AP6 A;  3D3I A;  3JD2 A;  1Y67 A;  2LW1 A;  1XL6 A;  2ZDI C;  4DYL A;  1SQQ H;  1PV0 A;  3E8F A;  4RUF A;  2VQE O;  4TV8 A;  5BY1 A;  3LNN A;  5EBL C;  2R70 A;  2BOB C;  2Q8V A;  1HNW O;  2E3C A;  4CH5 A;  4DUY O;  2LGQ A;  4J7J A;  2Z3Y A;  2W6J G;  5EBW C;  3DC6 A;  4ZI7 A;  5BZB A;  1I5X A;  4Q6G A;  3A0R A;  2YID A;  1F4N A;  3I55 V;  2A9H A;  2N74 A;  1HW7 A;  2QM8 A;  3G67 A;  1Q86 W;  2IU0 A;  3JAK A;  4J41 A;  2KSD A;  3CC2 V;  1VAR A;  2EBO A;  4CC6 A;  4JI1 B;  4IT5 A;  4HBN A;  3T1H O;  4DK1 A;  4LFA B;  1JOY A;  4AI8 A;  3OUF A;  4JI8 O;  4FLW A;  5LP6 C;  3AG2 B;  3WG7 C;  4PD4 F;  5GW7 A;  5LGN A;  2EIN C;  1BHB A;  4MVO A;  2OT5 A;  1FJG B;  4D7T A;  2IU3 A;  1G4Y B;  3RYH A;  4FLU A;  4H44 B;  2CGO A;  4X1Y A;  2JRI A;  2LQT A;  4LF6 O;  1VQ6 V;  2UXC O;  2R9I A;  3H9V A;  4I0X B;  2P6J A;  4WFE A;  4DV5 B;  2B1I A;  4YJ3 A;  4BW9 A;  4HAM A;  4I50 B;  4DR6 O;  2Y0I A;  2UXX A;  1X59 A;  2ZD9 A;  3ZMZ A;  5GON B;  2GBO A;  3CCS V;  1H8H G;  1D5N A;  3O9O A;  4DV6 B;  3ABU A;  2WLN A;  4ZOL B;  4X62 O;  4PA4 A;  2Z0A A;  3T2M A;  2VQF B;  2XND G;  1O9G A;  5CBH A;  4D7S A;  4DRX A;  1LUV A;  3ZHQ A;  2Y0P A;  4X66 B;  4LF5 B;  3UT5 B;  1J5E B;  1QHT A;  3QTC A;  2Y48 A;  2NLJ C;  4TQD A;  3ETG A;  3CJH B;  2CTR A;  3ZX6 A;  4CC5 A;  1N0N A;  4GX2 A;  4DW0 A;  1N36 B;  4CZZ A;  3K0D A;  1PL0 A;  4LF7 O;  1NH2 B;  1SQX H;  4P9P A;  1V55 B;  1JJO A;  1GN6 A;  2XAS A;  4JYA O;  2Y4U A;  1G6U A;  3B2E E;  3SR2 C;  1W2B U;  1UJW B;  3ASO C;  3TET A;  3ZMU A;  1S5J A;  3JAT A;  3CC4 V;  3STL C;  1GKF A;  2DN9 A;  2YEV B;  3ZS8 C;  1QLE B;  2YIA A;  5LMU O;  4DR5 B;  1FXH A;  3KG2 A;  1G8M A;  2YS8 A;  4LF8 O;  4F6E A;  5BXZ A;  4UB8 Z;  1OCZ B;  3WB1 A;  4DV2 B;  3JD4 A;  3IGA C;  4FJC C;  1K3E A;  4JI2 O;  4WFB V;  5LMN B;  3L75 H;  1M57 B;  3SYC A;  5IWA O;  1Y4M A;  4UXN A;  3OTF A;  3H1K H;  1GH6 A;  1MSD A;  1DF5 A;  2OCC C;  1QR8 A;  2XAQ A;  4JI6 B;  3B40 A;  1IBK O;  2IH1 C;  1VQ8 V;  4OX9 O;  5JVD A;  4O4H A;  2QA4 V;  2R9A A;  3Q4H B;  5LXT B;  4MVM A;  3DSQ A;  3F5T A;  2IH3 C;  1THZ A;  1PP9 H;  2LW7 A;  1TA8 A;  3QF7 A;  3G6E V;  5EC2 C;  5KLV H;  1OCC B;  1YSC A;  3C90 A;  1ZSP A;  1PM9 A;  4FK5 C;  2ZR3 A;  3OMI B;  2PY5 A;  4NXM O;  1GAX A;  2CH7 B;  1GTO A;  1YEW A;  3FD9 A;  4JTA B;  2OYQ A;  3A8T A;  5JCO A;  1KQS U;  2Q7E A;  2KG7 B;  4KFM A;  3RW0 A;  1TUB B;  3P32 A;  1S5L Z;  1MG1 A;  1QLN A;  1NTZ H;  1FKA O;  4U7N A;  5IJ9 A;  2QM7 A;  3ETQ A;  4Z1V A;  4FM2 A;  3JSN A;  3AK2 A;  3IC7 A;  1VMG A;  2ZE7 A;  4WFA V;  4QPJ A;  2Q0A A;  1QVF U;  3C3T A;  2LFS A;  5F2V O;  1K4C C;  3CB2 A;  3RWR D;  2M6Y A;  5DM6 V;  4KP4 A;  1IVS A;  3GB7 C;  2VWJ A;  2D3O W;  5B3S B;  1H2M A;  4FLY A;  2FB5 A;  2X0L A;  4R7C A;  2DYR C;  5EIB C;  1R6K A;  1J95 A;  3ABT A;  3X2Q C;  4X20 B;  1I0H A;  5KA5 A;  4JI3 O;  2NR5 A;  3BA9 A;  1HNX B;  4JGS A;  2HR3 A;  1HR0 O;  2JEU A;  3SJC C;  4EFE A;  3OMA B;  1IUR A;  2OIG A;  3JAR A;  5CA1 A;  2XT9 A;  1NBM G;  4FLX A;  5LA6 A;  1Y66 A;  4WCE V;  2DYS B;  2AZ0 A;  2Y4T A;  4LF4 B;  4ZBM A;  5IJ0 B;  3RYC A;  2VS0 A;  4UCT A;  2JIZ G;  1OCC C;  3ZMV A;  1IBM O;  1IXB A;  2QWR B;  3W7W A;  4UVC A;  5C8Y A;  2QWN B;  2AHY A;  4B3R O;  2H94 A;  4U3J A;  3JAL A;  3CHX A;  3L70 H;  4DRX B;  1EBO A;  4TUY B;  3AG7 A;  5EZY A;  1BSM A;  4CH3 A;  3AG3 B;  3CE2 A;  4FPP A;  2BTO A;  3FX7 A;  5LHG A;  3EXA A;  3TGU H;  5B1A C;  1CP9 A;  1DLB A;  2YI8 A;  2OCH A;  3G71 V;  1XNR O;  3K03 A;  5ITZ A;  3U11 A;  1EZV H;  2ITD C;  4LFB B;  4Q20 A;  3GWK C;  2D2C B;  1Q7Y W;  3EVK A;  2PUS A;  2YXL A;  3W7X A;  4PEL A;  3CRA A;  3EFF K;  1ZUQ A;  2XTA A;  4X8A A;  2NNU A;  3JAT B;  2WSS G;  2EJR A;  4OPA A;  1EN4 A;  2FYU H;  3OAA G;  4I5S A;  2X6A A;  3K04 A;  2ZIM A;  1N4C A;  1YI2 V;  4I9Q A;  5FL7 G;  2QTS A;  2UUB O;  1Y6X A;  2P4K A;  3QO5 A;  4BIU A;  3JAS B;  4N23 A;  4PI0 A;  2G38 A;  2E74 B;  4F6R A;  1Q82 W;  3CRR A;  1Z5W A;  4PJ0 Z;  4B7E A;  1BQ0 A;  4EEQ A;  5LHI A;  4GKK B;  1N33 O;  4TV9 B;  4MTG A;  1V54 B;  5L3D A;  1Z5V A;  2YDE A;  4P30 A;  5KHH A;  4LBE C;  3OGC C;  1JMK C;  4DR2 O;  5LL6 Y;  3S3X A;  1I94 B;  4NB5 A;  3TXQ A;  4U3F H;  3GVM A;  2Q4P A;  4YIO A;  2F4V O;  1SET A;  3LUT B;  2HVJ C;  4HZ3 A;  1EZJ A;  5KHG A;  3HKB B;  1RM1 C;  1YJW V;  5K1X A;  1OCO B;  3AG4 B;  4GUN A;  1Q8I A;  3A2F A;  1XDC A;  3ZCC A;  1LNQ A;  1VF6 A;  3B8M A;  3K58 A;  4LCU C;  1KC8 W;  1BE3 H;  2AXT Z;  4YY3 O;  2ITC C;  4G2K A;  1BMF G;  3CCJ V;  1JJ2 U;  3CCR V;  2PTM A;  2PGG A;  4TSF G;  1YTF D;  4W4K A;  1H2G A;  2F43 G;  4FLZ A;  1S77 D;  3RVY A;  3SPI A;  2P67 A;  4K0K O;  1AR5 A;  1EM1 A;  2DE0 X;  2WLL B;  4I50 A;  4DR4 O;  5CA3 A;  2K9P A;  2UU9 B;  5GON A;  4KHP B;  4D6T H;  3DTU B;  5IYC O;  3L72 H;  4P2Z A;  2Q5Z A;  4MT8 A;  4UCR A;  3CWB H;  1XNQ O;  1ZTE A;  4KUM A;  4DV0 B;  2RNB A;  1O9H A;  4IYH A;  4TQF A;  1YDX A;  1FXK B;  3UT5 A;  1K9M W;  4UCV A;  1PNK A;  4GCZ A;  3CC7 V;  2QSA A;  3CJH A;  3S3W A;  5BR8 O;  1B3Q A;  3APO A;  4J7K A;  1K33 A;  4QJF B;  4JI4 O;  3N2G A;  1N32 O;  3UM7 A;  3KCY A;  3AK3 A;  4NTY A;  3ETE A;  3FYI B;  1GN3 A;  3AG1 C;  2DJV A;  4HYO A;  4GX0 A;  4NYK A;  2ARH A;  1S0V A;  4MS2 A;  2YEV A;  2E76 B;  5LA6 B;  4MVR A;  3DXR B;  4GLX A;  2UXD O;  3CCL V;  3MAQ A;  3ABL C;  4Z2W A;  3VQW A;  5A9G A;  1JQ0 A;  1EN6 A;  1Q6H A;  5JJJ B;  2QWQ B;  1F23 A;  3K5O A;  4F4L A;  2AW9 A;  4JI0 O;  1E79 G;  4PA9 A;  1YZB A;  5JJN B;  2YUA A;  4UCO A;  4TWK A;  4UV9 A;  3ZMS A;  1WB8 A;  2ODM A;  5LP6 B;  4K8X A;  2Y69 B;  4JZG A;  3BY6 A;  2BSK B;  2OWO A;  1VQL V;  1NKD A;  1BL8 A;  1KUQ A;  2P90 A;  5IDJ A;  2EIN B;  3DC5 A;  4AQY O;  1FPO A;  4B3S B;  2HHH B;  4OPH A;  5EIB D;  1V9P A;  1FXK C;  3Q4H A;  5LXT A;  3K5M A;  4GT1 A;  3OT7 A;  1OV9 A;  4X64 O;  4O4J A;  1Q90 D;  1SQV H;  2CTW A;  4YHH B;  3ZHV A;  4GKJ O;  1BQZ A;  1VQM V;  5J2U B;  3E83 A;  4UB6 Z;  1LUW A;  2CH7 A;  4DUZ O;  4ZHQ B;  1K34 A;  2IBZ H;  3OUS A;  1XMO B;  4PDR A;  2KG7 A;  1S5H C;  3ZHT A;  1NI8 A;  4F6R B;  4JF3 A;  4KXR A;  4B7K A;  1TUB A;  2RJZ A;  1FXV A;  4H33 A;  4FM0 A;  1HNZ O;  3ZRS A;  2QKS A;  4DV4 O;  2UUC B;  1GM8 A;  1R6N A;  1I7F A;  1Z2G A;  2WLM A;  1AI6 A;  5CB4 B;  1ZX3 A;  1Q3E A;  3ASO B;  2CTP A;  3ICX A;  4MVU A;  4XBF A;  3LNM B;  3FB5 C;  1TVK B;  1YTF B;  1P49 A;  4X65 O;  1R3K C;  2Y69 C;  3BRC A;  4X20 A;  1S3J A;  3IC9 A;  2XOK G;  3P30 A;  2O57 A;  1Q6I A;  2E75 B;  5KAI Z;  2HP8 A;  1WP7 A;  3IAY A;  2W0F C;  2YI9 A;  2P4V A;  3JAM N;  1VQP V;  2AHZ A;  2A79 B;  3CSX A;  4QE7 A;  3JD1 A;  1Q43 A;  2ZM6 B;  1EN5 A;  1D5A A;  1VQN V;  5CA0 B;  5IJ0 A;  4DW1 A;  5H6Q A;  3F7V C;  5IY5 C;  4LFA O;  2EIL B;  5LGU A;  2OCC B;  3ZBH A;  3TCU A;  4BIZ A;  1IDS A;  2JVD A;  1M56 C;  3WB2 A;  4XDJ A;  1SKV A;  2C2A A;  4TUY A;  1FJG O;  2AGA A;  3LSU A;  3TXS A;  4DK0 A;  1FS0 G;  2F95 B;  4LWS B;  2UUA B;  2GHY A;  4JI5 B;  5DN6 G;  3N2K B;  3M99 B;  4DV5 O;  1KKD A;  1SER A;  3N2G B;  4O4I B;  1H2K A;  2Q6A A;  2CK3 G;  4IHJ A;  3FYE B;  2EZO A;  4DV6 O;  4B3M O;  3O65 A;  3VQV A;  4PA3 A;  3BFR A;  1H8E G;  2VQF O;  2JJ1 G;  2PZS A;  4DR7 B;  4FZ1 A;  2R9R B;  2YSU B;  4X66 O;  4LF5 O;  2W6I G;  3W7S A;  1N36 O;  2V4D A;  1RFY A;  4U7O A;  1BHA A;  3U10 A;  2OTJ V;  4UCS A;  3JAS A;  2QM4 A;  1MNG A;  4QE9 A;  4RQE A;  2DYR B;  4TV9 A;  1SA0 A;  4KL1 A;  1D2D A;  2EIL C;  3X2Q B;  2DQ3 A;  2JK5 C;  3L74 H;  4YIP A;  4J10 A;  4DR1 B;  4DR5 O;  1VQO V;  3SPJ A;  3BAA A;  4TOI A;  3CRM A;  3E22 B;  3CME V;  5KHK A;  3B77 A;  1JA8 A;  3HKE B;  3SPG A;  1K8A W;  2GV9 A;  2ADQ B;  3E89 A;  4DV2 O;  5IE9 A;  3HKB A;  4E2L A;  1NR7 A;  4IGG A;  1U96 A;  3D36 C;  5LMN O;  3WFV A;  4O4J B;  3UKM A;  2QR4 A;  2GTA A;  3ABM C;  1XL4 A;  2ZIN A;  1L0N H;  2UXB B;  2RCV A;  1KYO F;  2KB1 A;  3ZHR A;  2ZCE A;  1XHZ A;  3OGI B;  5KUM A;  3K5L A;  4IL6 Z;  2F93 B;  2B5U A;  3RFR A;  4B3T B;  2WLL A;  3RYI A;  1CEZ A;  3N27 A;  4NXN B;  5B1A B;  5B1O A;  4DR3 B;  4NTW A;  4O4L A;  4MVZ A;  2QJ1 A;  1FXK A;  1X4T A;  1QR9 A;  4JV5 B;  2Q7H A;  2EUL A;  4MW8 A;  4CS4 A;  5EBM C;  3U0Z A;  2WLI A;  1BZK A;  1US6 A;  5D5P A;  1WA8 A;  1HR0 B;  1K5Q A;  2XAF A;  2ZDI A;  4P9O A;  4NVP A;  5J9P C;  3K9A A;  1QBZ A;  3JAW A;  1YJN V;  1YHQ V; 
#chains in the Genus database with same CATH homology
 4B3R O;  1J5E O;  5H5N A;  4X62 O;  4YY3 O;  1D2D A;  2Z0A A;  2UUA O;  3JAM N;  4JI5 O;  2UXB O;  1XMO O;  4LF9 O;  1XEQ A;  4DR5 O;  4NXM O;  4DV1 O;  4B3T O;  3J80 N;  1KUQ A;  2VQE O;  4NXN O;  5BY1 A;  1FYJ A;  1XNR O;  4K0K O;  4AQY O;  4DV2 O;  4LFA O;  4DR3 O;  1HNW O;  4OPH A;  4LF7 O;  4DR4 O;  3T1Y O;  2UUC O;  5LMN O;  4DUY O;  4DR7 O;  4GKK O;  1HNX O;  1FKA O;  3R66 A;  4X64 O;  1DK1 A;  4JV5 O;  4JYA O;  1XNQ O;  4JI7 O;  3J7A U;  4GKJ O;  1FJG O;  1I94 O;  4OPA A;  2ZKO A;  2AGA A;  2FKX A;  2N74 A;  4JI1 O;  3OTO O;  4LF4 O;  5A2Q N;  4DUZ O;  1G1X B;  5LMU O;  1IBL O;  4DV5 O;  2UUB O;  1R6T A;  5BR8 O;  1R1B A;  3M8A A;  4LF8 O;  3T1H O;  4JI4 O;  1N32 O;  1HNZ O;  5BXZ A;  4DV6 O;  4B3M O;  3O65 A;  5FLX N;  4DV4 O;  4JI8 O;  2VQF O;  4JI3 O;  2DJV A;  4JI2 O;  4A5U B;  1N33 O;  3SDL A;  1F7Y A;  5IWA O;  4JI6 O;  1HR0 O;  4X66 O;  4DR1 O;  1AIL A;  4LF5 O;  2ZM6 O;  1AB3 A;  1A32 A;  4DR2 O;  5LL6 Y;  3J81 N;  4LFC O;  5IT9 N;  1N36 O;  4B3S O;  2HHH O;  2JRI A;  4LF6 O;  2F4V O;  2UXD O;  4LFB O;  1IBK O;  2UXC O;  4DV3 O;  2UU9 O;  4OX9 O;  1NS1 A;  2DOS A;  4DV7 O;  4X65 O;  1N34 O;  4KHP O;  1XMQ O;  1IBM O;  4DR6 O;  1X59 A;  3RT3 C;  4JI0 O;  3F5T A;  2E5L O;  4YHH O;  1YZB A;  4DV0 O;  2LW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...