4LFCO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfcO00
1R6TA 3SDLA 4JI1O 2UXBO 4JI3O 5BR8O 4DV5O 4JI4O 4JI5O 4DV2O 1X59A 4GKKO 1XNQO 4LF4O 5LMUO 2VQFO 4DV7O 5LMNO 2DJVA 1HNZO 3J80N 4JV5O 1IBMO 4NXNO 2UUCO 4OX9O 1N34O 2FKXA 2UUAO 1J5EO 4KHPO 1AILA 4LF8O 5BXZA 2F4VO 1F7YA 4GKJO 4DR5O 4DUZO 1AB3A 2N74A 1IBLO 4JI2O 3OTOO 1HNWO 4B3TO 4JI0O 4X62O 2ZKOA 1N33O 3JAMN 2E5LO 1N36O 4DR3O 4JI7O 1A32A 4OPHA 1FKAO 1YZBA 4AQYO 2UXDO 2Z0AA 3RT3C 4DV6O 4LFBO 2AGAA 2DOSA 4OPAA 2UUBO 4DR4O 4DV0O 1XMQO 1XMOO 4DV3O 2LW7A 1KUQA 4DR7O 1XEQA 5A2QN 4A5UB 4DV1O 1HNXO 1N32O 4LFAO 4DR1O 1I94O 1HR0O 4LF6O 1R1BA 5H5NA 1FYJA 5IT9N 4JYAO 4JI6O 4DR6O 3J81N 5IWAO 4DV4O 3T1YO 5FLXN 1FJGO 2UXCO 3J7AU 4LF5O 4LF9O 4X65O 1IBKO 4DR2O 2JRIA 5LL6Y 3T1HO 2HHHO 4X66O 1DK1A 4B3SO 4YHHO 4LF7O 4NXMO 3R66A 4X64O 3O65A 2UU9O 4K0KO 2VQEO 5BY1A 1XNRO 4LFCO 4DUYO 4JI8O 1NS1A 2ZM6O 1G1XB 4YY3O 4B3RO 3F5TA 3M8AA 1D2DA 4B3MO
chains in the Genus database with same CATH superfamily
4R7CA 4JI1O 3CCQV 2XNDG 1Q5OA 4DV2O 1NU1H 1X59A 1RM1B 2ZDIC 4JI6B 1XI1A 3SPGA 5LXTA 5IWAB 5IY5C 4FZ1A 3J80N 1NR7A 2CTWA 1DGSA 5IYZB 1UPGA 2WA4A 3JATB 1JFFB 2RDCA 4KHPO 4LF8O 3H1LH 3ABMC 4H37A 3B09A 1K4CC 3OTOO 1FS0G 4K0KB 2ZKOA 2GUZA 3ETDA 4QIWF 4XBFA 2E5LO 4O2BA 4O2AA 3F7VC 5IE9A 4KP4A 2E3CA 2RJZA 3HKCB 4YJ3A 4TV8B 4NVPA 4TV9B 1YDXA 3ZRWB 2IW5A 2DN9A 1XHXA 2Y69B 2EIJC 1XNQB 3OE7G 3E83A 3IAYA 5JJNB 1Y76B 1NI8A 4X20B 2EIMB 1SERA 2OCCB 1H2SB 1P84F 5B5EZ 1XEQA 1G6UA 1H2GA 1Q90D 1S72V 2B5UA 1QBZA 3JD0A 1YJWV 2UXBB 1FXKC 2XT9A 3J81N 4DV5B 5C8YB 5FLXN 3L74H 4EFBA 4TWKA 3P3NA 1IBKO 2Q4PA 5LL6Y 4AQYB 2QSAA 2P22C 4YHHO 3O65A 2QWOB 3G4SV 3RVZA 3RYCB 4JI8O 1OCRC 4J41A 1IBLB 3M8AA 2QM7A 2UXBO 2OYQA 2ZIMA 4DV5O 1PKXA 3ZEDA 1SQBH 1S3JA 3OMAB 2BE3A 1XHZA 3CJHB 1ZLZA 5B1BC 5EIBD 4DV7O 4PDRA 1VF6C 5E1AC 3UT5B 3VQVA 1PD3A 4IL6Z 1JVMA 5KLVH 3ZHVA 1ZX3A 5GONA 2UUCO 5BXZA 1XQ8A 2D2CB 5IDJA 3CCEV 4DR5O 1IBLO 2QWPB 3ZHRA 3CHXA 1HR0B 1QNMA 4ZIBA 5LP6B 3CCRV 4YY3B 4WFGA 5C93A 2ZE6A 3B8NA 3K57A 5EBWC 3ZBHA 1Q6UA 2ILMA 5KHJA 1DLBA 2RMKB 3B40A 1YI2V 2IH1C 3AEIA 1GN2A 2W6JG 1LUVA 2IJKA 3FAVB 1BCCH 1JR9A 2WLKA 1B06A 3EFFK 2A9HA 4XDJA 4FM1A 4JTAB 1HR0O 3VQWA 1F4MA 3AG2C 3MAQA 1GM7A 4W4KA 1VF6A 2D3OW 3K04A 1TA8A 5ITZA 2LGWA 2YEVA 2Q0AA 3U11A 2F43G 2PTMA 4GLXA 1WP8A 4YXWG 3ASNB 4WCEV 1TUBA 2YI8A 1VQ4V 3HKBA 4RQEA 2DYSB 3BFRA 2A06H 4U3JB 3LDCA 4QPKA 1Q82W 3CPWU 3RFRA 4GT1A 1PP9H 5IYDO 1JX9A 3P30A 2C2AA 4ABMA 4N21A 1MZFA 1VQMV 1B04A 2CTRA 5IY5B 1PL4A 2Z5UA 1CEZA 1EN5A 2HJFC 2VWKA 5IYCO 2R9IA 4FLWA 3ABMB 1XMOB 2EBOA 2CH7B 3I56V 4J42A 2P67A 5H9CA 3K3WA 3JCZA 2ATKC 1ROPA 5GTHZ 4O4HB 2YIBA 3W7UA 4LF5B 4UCSA 3C90A 1BL8A 1K97A 5CB4A 3BCCH 4PI2A 2EIJB 1EBOA 1WJZA 1GTOA 3HKDB 4NTWA 3RYHB 4FLUA 5JJJB 1XMOO 2XHBA 5LMNB 2FMLA 5L3DA 4EFEA 4DR7O 3E8GA 1AJNA 1ZSPA 3D8CA 1US6A 1S5JA 4HAMA 1WAZA 1YTFB 1FXKB 4JI0B 3JALB 3WU2Z 1V54B 2ZINA 4LF5O 3JD4A 4DR2O 3IGAC 4MVOA 2AZ2A 4K35A 3RBZA 2V7QG 1HNZB 1XDCA 1ZL8A 5IJ0A 3L9DA 1GMGA 2ARHA 3I55V 4DXWA 3F7YC 3OD4A 4DK1A 4GYCB 2HP8A 1GAXA 4O4JB 3K5LA 2BTQA 1OCRB 1GO3F 3CRCA 4HYOA 1UJWB 1RPRA 3E35A 3HR0A 2IM9A 4MVQA 3K5MA 1NH2D 4CH5A 4F6RA 1MG1A 1AVMA 2X7RB 3ABLC 5B1BB 5EC1C 2X6AA 4K8XA 2DJVA 1HNZO 5L3EA 4D7TA 4MVMA 2UXCB 3AG4C 1XILA 2KSDA 2HKOA 4ZI7B 2ZE5A 5KA6A 4H13B 2YUAA 2QWNB 4X88A 4DW1A 2JEUA 2VQEB 4X62O 4RUEA 5CA0B 3JYCA 1R6NA 2K9PA 4PHZA 3STLC 1SA0B 1L0LH 4LNUA 3QVNA 3W7XA 3K9SA 5LYJA 3S3WA 2H8PC 4J10A 2AXTZ 4LF4B 5KX5A 5LBQA 4C7UA 3WG7C 1KKDA 1QVFU 1QQCA 3RVYA 1VP7A 2E74B 1IXMA 2OT5A 5J2UA 1D5NA 5A2QN 4A5UB 4J9YB 3LUTB 2UUAB 2P5OA 3IJ4A 5CA1A 4XDKA 2OIEA 1AP5A 1J95A 4JI3B 3W7SA 4J11A 2HEPA 3RN4A 5JJEB 1WB8A 1DK1A 4K3AA 1XL6A 2MW2B 2O57A 4R50A 5HFMA 1KECA 4JPRA 4CH3A 5CB4B 3KCYA 3QO8A 3RYFA 2F4VB 4DUZB 4J9ZB 3QTCA 4MTFA 4DV3B 4JI3O 3R65A 2GDSA 5IYZA 5H6RA 1Y6XA 1JFFA 2CGNA 2DMXA 2CGOA 4UVAA 2YICA 4L87A 2QM4A 3Q4HB 3OGCC 2R9AA 2A3QA 5BZBA 3G6BA 1FPOA 3HKCA 4X89A 4TV8A 3E2EA 3WB0A 5EBLC 2WA3A 1TGOA 3JAKA 2F4VO 3B8MA 3ASOC 4DUZO 3ML0A 4X64B 4BAYA 2PY5A 5JWPA 3KKYA 5IJ0B 2QKCA 3AK1A 1L1FA 2CE4A 1Y67A 5LOVB 1Y76A 4Z1VA 4WF9V 4QE9A 3A0BZ 2HG5C 4B3MB 3SGIA 2R70A 2MK3A 5B66Z 2JEXA 1AI6A 1BGYH 4P9PA 1EZJA 3JSNA 4I55B 4WFFA 1XUQA 2FYUH 1VQ8V 3D3IA 5JQGB 4IHJB 2EZPA 5C8YA 4B08A 1JCHA 4DV1O 4JV5B 3OTFA 5EBMC 4FZ0A 1N32O 3VQXA 1Z5VA 1W2BU 4B3RB 1YVWA 4MW3A 2ZNJA 2B1GA 4IYHA 1NVPB 3RYCA 4MW8A 4L8JA 2DE0X 2JGUA 4TSFG 1I7FA 4HNAB 4PDMA 1DF5A 4CH6A 2Q67A 3OR7C 4LNUB 4UCOA 5BY1A 2XAJA 4LFCO 4CH4A 3K59A 1V55C 5LGTA 4IIJB 3CJHA 2F23A 2Z3YA 4B3RO 4UVBA 1KU9A 3G71V 5K1XA 1W0KG 3UT5A 2BTOA 3BVOA 5BR8O 5J2UB 3ZIAG 3TK1A 4G2KA 4OGQB 1S5LZ 2E76B 1PM9A 5K1PA 4DW0A 3ABLB 2ZE8A 1GN4A 5TISZ 4JAUA 2ZNIA 3FFQA 3AG4B 3JAWB 2Q7HA 1GN6A 5LP6A 2HR3A 4X1IA 3G6EV 4E2LA 1OCOC 3ZHQA 1XNRB 3U10A 1AP6A 1VQLV 3OUFA 3X2QC 3FX7A 3QO7A 3IFXA 4OPHA 3LNNA 3RYFB 4FFBA 3BABA 2VWJA 1KMIZ 3FAVA 5JH7B 2Y0PA 3APOA 2YIDA 4JI5B 3OEHG 4UUJC 3JD1A 4WBNB 2ZE7A 2EULA 3ZRXA 4Q6GA 5LGNA 3WG7B 4UCUA 1D5AA 4JZGA 4P2ZA 1YEWA 3LDEA 3ZRVA 3K03A 3JAKB 4LP8A 2F93B 4JI6O 2CAZC 2Y0IA 4J7JA 5FNVB 1SZTA 5LHHA 5IWAO 3L73H 4FM0A 3BEHA 3OGIB 4U3JA 2JK5C 5D5QA 2ZD9A 4PI0A 1WPBA 2RCVA 3WB1A 1RP3B 4J7ZA 1F51A 4K0KO 3CX5F 1K8AW 3B4SA 2VRZA 1M56C 4DV6B 1VQ9V 4NTYA 2B1IA 2ZDIA 1JMKC 3E22A 1IVSA 1V54C 1XREA 3FYEB 4PA3A 4K8ZA 4PDLA 2Y48A 3ZMSA 4DO2A 1SS3A 1XNQO 4RWUA 2CH7A 2KB1A 5EK0A 1GRJA 4UCTA 3FB6C 1N8RW 1T5EA 3K5NA 5IYBO 2QJ1A 2ZR2A 1EN4A 4O4HA 1HW7A 2H94A 5CN0A 3ZN1A 3ASOB 3N2GA 3CB2A 4U7OA 2UU9B 3SJCC 1Y74B 2CTPA 5JCOC 3HKDA 3UKMA 3OFNG 3RYHA 2Q7EA 3ZMZA 5KUKA 4AQYO 4O4LA 2QTSA 3MHHC 3JASB 2EZOA 3BA9A 5KUMA 4OXSA 5EZYB 2IH3C 3T4ZA 2HHHB 1XOUA 1B3QA 5LMUB 1FXKA 3JALA 2BSKB 2LW7A 2JGDB 1IBMB 1EFRG 2QA4V 3CXCU 2NR5A 3CRAA 4X1IB 2ADQB 5IT9N 1B6QA 1V9PA 2P06A 1BT8A 3ETQA 2YI9A 2N04A 4CC5A 1MZEA 4O4JA 2R72A 1YJ9V 3MD0A 4CC6A 2FTKA 3H1HH 2IJJA 2Q68A 1SESA 4FFBB 2HHHO 3ABKC 1FD9A 5J9PC 2AZ0A 3STZC 4GX2A 2GTAA 2PUSA 1V55B 2JJ2G 3IC9A 4OX9B 3I5DA 2QEXV 2PYJA 4CS3A 3CE2A 4YY3O 4LC1A 2AHZA 3OEEG 3OW2U 1M93A 4ZI7A 4I5SA 4ZHQB 4LFAB 1G4YB 3TXSA 3ZMTA 4NB5A 3TETA 3H1IH 4JYAB 1BQ0A 1IDSA 4LCUC 4DR6B 4EB6B 3T1YB 5LGUA 1M57C 4LF9B 5CA0A 2LGQA 4OX9O 3SYCA 1SA0A 1XMQB 1FXVA 2H3OA 3FB7C 1EM1A 1OCOB 1N4CA 1N0NA 2JIZG 4CS4A 1LUWA 1Q6HA 3X2QB 2EIKB 3THOA 1KBHA 2LQTA 3E22B 4JYCA 2CTQA 2Q5ZA 5A9GA 1OHHG 3NXSA 1X4TA 1SQXH 5DEDA 3T1HB 1VF7A 4JZ2A 2YIBD 3CCUV 1NZ6A 2QDOA 1GM9A 2PZSA 2FL4A 1AJPA 1E1RG 1XMQO 3SJBC 4IGGA 3B2EE 3K79A 2GHYA 4JGSA 4XDLA 5L3BA 2PI4A 3CSXA 1QLEC 4NXNB 1KKCA 4MTXA 4PA7A 1FFXB 3N2GB 1M4UA 2NLJC 1JOYA 4FIPC 4GKKB 3CCSV 3NR7A 1RPOA 1K4DC 1R73A 4X1KB 2VQFB 1BS3A 3T1HO 1NTZH 1AROP 2ZCEA 4O4LB 1YITV 3RYIA 2F1MA 1NJIW 2WPDG 2BOCC 2HVKC 1M56B 3UCSC 3BPZA 3Q4HA 2A7WA 2BCCH 5BMVA 5DN6G 3F5TA 1Y66A 1D2DA 5CBHA 5KAFZ 4BIOA 3CP1A 1Q81W 2RN9A 1URFA 1PNMA 4GKKO 4PA9A 3OM3B 2UXDB 5B1OA 5KAIZ 4D7SA 2VQFO 2R9RB 1NQTA 2WLIB 5LMNO 4RAIA 4WFEA 4FK5C 2FB5A 4IT5A 1ZUQA 4X65B 1E79G 1SRYA 5LOVA 3CRMA 3W7TA 4LF7B 4Z1MG 4GZRB 3TGUH 4JI0O 3M7MX 4I55A 3E8FA 3JD2A 2V1DA 1W59A 5JQGA 4IHJA 3RWRD 2UXDO 3AK3A 5FL7G 4FM2A 1KYOF 5B1NA 2LO1A 1YCIA 1SKVA 3UM7A 3ZS8C 4OPAA 2M6YA 3VOUA 2P90A 2NN4A 2W0FC 3DTUB 1K3EA 2LP7A 1JA8A 1NBMG 1PNKA 2PGGA 1XL4A 3N2KB 4HNAA 1BE3H 1GKFA 2ZXWC 2XTAA 1ZAUA 2B9ZA 4UV9A 2P6JA 3ABUA 2WLJA 3O9OA 2DWDC 3DXRA 4IIJA 2UXCO 3SPCA 1Z5WA 1YSCA 2ADPA 3ABKB 1FFTB 1KD1W 1S5HC 2VQEO 2CDYA 2PYLA 2E75B 1OJHA 4PELA 1SC5B 2V4DA 2UUBB 3N27A 4J80A 4ICGA 4UV8A 5KHKA 4Z2WA 3JAWA 4EEQA 4MVZA 1I94B 1M90W 4LF4O 1R3KC 1VQOV 2WLLB 1SQGA 1QR8A 5B3SC 1NTMH 1COWG 1I5YA 1FJGB 3FYIB 2Q8VA 3SPHA 1M57B 2EJ7A 3SR2C 1Q86W 1IXBA 2IBZH 4Q20A 2UUAO 1H2LA 3SPJA 3TJTA 5FPRA 5JH7A 1F7YA 1TVKB 3RYIB 1AI7A 2M7WA 3ZHTA 2DWEC 4WBNA 5BMVB 4YJ2A 1SQPH 1YXBA 4DV4B 4PD4F 5KMGB 4JI4B 3CMEV 1MABG 2WAMA 1M5IA 4JTDB 2AGAA 4NXMB 1R3JC 5FNVA 5DM6V 4DV3O 1GH6A 4TUYA 1L0NH 1Q7YW 4H33A 1QLEB 5JVDB 1H8EG 1N34B 1KB9F 2AHYA 5H5NA 4GKJB 1EZVH 2ITCC 1HNWB 1FXHA 3ABTA 3PN1A 3K06A 4DV4O 1L8DA 4ZOLA 1N33B 2P4VA 1K9MW 1N36B 3ZJZA 2OWOA 3SJAC 3UO2A 2XAHA 1BQZA 5CMUA 3FB8C 4F6EA 1H8HG 4PV1B 4NXMO 4JYYA 4X64O 1GK9A 1SQVH 4FLXA 4AHCA 2AW9A 2WLHA 1KC8W 4MVUA 1RSOB 2UXXA 2P7TC 4FFKA 4JI2B 4B3MO 2YXLA 4B3TB 2JDIG 4BIUA 3ZMVA 1WPXA 1Q3EA 1SQFA 2OIGA 1H2NA 4I50B 4DYLA 1GM8A 2GBOA 1WA8B 1Y74A 3L70H 1NH2B 3DXRB 4JV5O 3TXQA 3HKEB 4MT8A 3L72H 2JVDA 1TUEB 4CZZA 3JASA 2DQ0A 2N74A 4JI2O 4B3TO 1YF2A 5EZYA 4FLZA 4FJCC 4FMTA 3OMIB 3GB7C 4LR3A 3EHBB 1YZBA 2BSKA 3W7WA 3DC6A 2JGDA 2Z0AA 4U7NA 4LWSB 4JI1B 1NT2B 5H2FZ 1GN3A 2Q0OC 4KUMA 5LA6B 3HB3B 5FPOA 4DV2B 3AG7A 3CC7V 3ZCCA 2WSSG 4JF3A 1QHTA 1KP3A 2DQ3A 2EJRA 1M1KW 2EIKC 3T4DA 2ZXWB 2G38A 1JJOA 5CA3A 1THZA 3AG3C 3E86A 3BHPA 4KHPB 4LF8B 3GVMA 3K0GA 4R6ZA 5IJ9B 3OTOB 3A0HZ 4G28B 4MVRA 3J7AU 3CCJV 2E5LB 2X6BA 3OUSA 5L3FA 2IJIA 4RQFA 4UVCA 4IYIA 5J2TA 3CCLV 4YJ2B 1IZ3A 1SETA 3CXHF 3BRCA 1XNRO 4ZHQA 2QR4A 3U0ZA 1QLNA 1K33A 4EB6A 2Y4UA 4J7KA 1YIJV 3C3SA 1WP7A 4TUYB 4JI5O 4X1YB 2A79B 3GWOA 1NTKH 4QPJA 4LBEC 4ZKIA 2F95B 5B3SB 1VQ5V 4RUFA 2DYRC 1P7GA 1H38A 4ZOLB 3CEIA 1IBKB 2ODMA 1K7DA 1AILA 1E1QG 4DR4B 2JJ1G 4YHHB 5AG2A 5EYPB 4JI8B 5B1AC 4LF6B 4P30A 2GSMB 1JJ2U 3CCMV 1Y4MA 3BY6A 2QTOA 3UO3A 3JD3A 5EIBC 4FLYA 3RT3C 2L35A 4DV6O 2X0LA 4G27B 5LHIA 1HWYA 2DOSA 2OTJV 1S76D 1FFXA 4H0LB 4DR4O 4DV7B 4B7EA 5EC2C 1KUQA 4TT3G 3OMNB 3FD9A 2IU0A 4X1KA 3ICXA 1YTFD 4R8CA 3F5WC 2UUCB 4LF6O 2Q9LA 4RO2A 1NR1A 3FKSG 1R1BA 4DR5B 1JPXA 4I4TA 2IU3A 3RGBA 1CP9A 2KG7A 3H01A 2Q6AA 1WN7A 2W0XA 3OAAG 1ZWIC 5KHGA 4X8AA 2YIAA 3M99B 3ETEA 3KCXA 2UU9O 2ETNA 2ZR3A 3E89A 3LSUA 2A0LA 3KZIZ 2N05A 3AK2A 3JARB 4TOIA 3CC4V 2WLIA 2KQXA 2EILC 1VQNV 1OCZB 4O4IA 4DR3B 5L3CA 1I5XA 4PA6A 4I0XA 1RFYA 1WB7A 5LMUO 4BWAA 4QGPA 1QVGU 2XAGA 3P32A 2QE7G 3CYOA 5JCOA 1K92A 4FLTA 2KKWA 2GTSA 4BR6A 4NKGB 1IBMO 5KHIA 1LNQA 1I08A 5J2TB 3AG1C 2RNBA 3A8TA 3QG5A 1O9GA 5CBFA 1AJQA 1R3IC 2Q69A 4AI8A 1OZ0A 3JCUZ 1ORQC 3LDDA 2BOBC 4MTOA 5LXTB 4DR1B 1VQPV 4DR3O 3CD6V 4JYBA 2XAFA 2LJ2A 2DW4A 1H2KA 1AR5A 3QF7A 2ZT9B 4UCRA 4DRXA 3N2KA 4ASUG 4UFZA 3CC2V 5HFLA 4MTGA 2GUZB 4FLVA 2K1EA 4PDVA 2YC0A 4UXNA 3H1JH 4O2AB 4O2BB 4YJ3B 1I0HA 3D36C 1QU7A 2ZQMA 4NTXA 2LFRA 4WFAV 3VBBA 3FB5C 2XAQA 1SF9A 2ZM6B 4LFAO 4DR1O 4YIPA 3AG3B 4WFHA 1FYJA 4JYAO 1KP2A 2ITDC 4DR6O 3T1YO 2CUGA 1WLEA 4KL1A 4LF9O 4KXRA 3WFVA 1OCCC 4W4LA 5E79Z 4YIOA 2XOKG 3OR6C 1IX9A 4MS2A 3R66A 2NNUA 1R3LC 4BW9A 1O9HA 1P4RA 2WLLA 2P4KA 2ZM6O 3G67A 1VQ6V 2HJDA 3MDSA 1SQQH 2YXYA 3SPIA 2CK3G 1EN6A 4DR7B 4PJ0Z 4HBNA 3UQ8A 1YJNV 3PJSK 2JS3A 2WLMA 1TVKA 1VQKV 2EINC 1P49A 3CMAV 3D36A 1AR1B 4I4TB 2DYRB 2KG7B 2L6LA 2RQ6A 3H1KH 3ZX6A 4NXNO 4JASA 2QKAA 4DR2B 2EX3A 1HP8A 1S0VA 4DV0B 4JAVA 4UB8Z 2QGNA 4E4EA 1Q8IA 1MA1A 4GX0A 3D3QA 1NKDA 1Q43A 1YHQV 5KMGA 4LH7A 1PNLA 1LR1A 2LW1A 3A2FA 1BHAA 4UB6Z 5B1AB 2OCHA 1XBLA 4GCZA 3SYQA 5GONB 4QE7A 3RW0A 5D5PA 4LH6A 1K5QA 1K5SA 1MNGA 5F2VO 4BW5A 2GV9A 4O4IB 4CS2A 5JVDA 3C3TA 1K34A 2QKSA 4I0XB 3BAAA 4X66B 4B3SB 2QM8A 3P3PA 4DV0O 4GUNA 4TQFA 4FVMA 3LSSA 1M9NA 2YS8A 4BIZA 3VQYA 3DGEA 1NVPD 1VARA 1U96A 3E8BA 1BMFG 4X62B 2WLNA 2QWRB 1S77D 2X6CA 3K9AA 4X65O 4QNHB 1RSOA 1CPYA 4X66O 4B3SO 4LF7O 4DRXB 3JSLA 3ZRSA 3LSQA 4I50A 4WFBV 1NS1A 5ITZB 1J5EB 2YEVB 4KFMA 3K5OA 1G1XB 1N0JA 1WA8A 5KA5A 4GX1A 2EILB 2XASA 3DSQA 4P9OA 2YXHA 1TUBB 3HKEA 4JTCB 4JI7B 3SYPA 3HKBB 1AR4A 4EKWA 3ZMUA 1RM1C 3T1CA 3B77A 3CWBH 4MVSA 1H2MA 1MMMA 3TCUA 1W0JG 2PF4E 3HPLC 3T2MA 1MSDA 3K08A 1J5EO 1ZTEA 1JQ0A 1ENVA 4LWSA 3IC7A 1AB3A 3AG1B 4MSWC 5LA6A 3CRRA 1PL0A 3JAMN 2JS5A 4H44B 4JI7O 4GX5A 1FAFA 1FKAO 3H9VA 5GW7A 3AG2B 1VQ7V 1G8MA 2Y69C 5GTIZ 3OT7A 3QO5A 2UUBO 5IJ9A 3G80A 2ZIOA 3SJQC 2EIMC 2OCCC 4FPPA 1DTOA 2YDEA 3DC5A 1K73W 1UFIA 3MHSC 4DK0A 4UCVA 1I94O 2WWWA 1PPJH 1Z2GA 1FJGO 1OV9A 1PV0A 4CBCA 3EXAA 3GWKC 2XUMA 3CRQA 3JATA 1OCCB 4I7ZB 5H6QA 1MOFA 4X1YA 1BHBA 1AI5A 1AI4A 3L75H 4D6TH 2UXNA 1F4NA 1R6TA 4TV9A 1VIBA 3SDLA 3E8HA 3ZRWA 4JI4O 4DV1B 1ZL8B 1N32B 2HVJC 4JAAA 3APQA 2HFEC 1KQSU 2BTQB 1HDJA 4X20A 2EINB 5EYPA 2LFSA 3A0RA 4LFBB 4NR1A 4B7KA 1N34O 2FKXA 3CCVV 4GKJO 5CBGA 4F6RB 1OCZC 1QCEA 3ZHSA 3K58A 1HNWO 3S3XA 4LFCB 1VF5B 1HNXB 1VEWA 1N33O 1DF4A 3QNEA 1N36O 2Q7GA 1WNSA 3BA8A 1A32A 4TQDA 4F4LA 5LP6C 2W6IG 3SYOA 1MSWD 4I9QA 3KG2A 4HZ3A 1U97A 4I9WA 2F66C 4PA4A 5BR8B 4ZBMA 4LFBO 5LHGA 2HLDG 1QR9A 3LNMB 2PI5A 3SYAA 4NYKA 5KHHA 1BZKA 2IJHA 3ZN0A 3L71H 1R6KA 2VS0A 1Q6IA 4DUYB 4U3FH 4N23A 1SZXA 5LYJB 1HNXO 2OTLV 4X9QA 5KX5B 2Q73A 1TAEA 4AILC 3ETGA 1IURA 1CXZB 1F23A 3JARA 2JRIA 3CS5A 5L3GA 5CA1B 3ASNC 2YSUB 1VMGA 1BSMA 4DUYO 5DECA 3K0DA 3WB2A 2DYSC 3ZHUA 3EVKA 4QJFB 1P7BA 2QWQB 2Y4TA
chains in the Genus database with same CATH topology
1R6TA 3SDLA 4JI1O 2UXBO 4JI3O 5BR8O 4DV5O 4JI4O 4JI5O 4DV2O 1X59A 4GKKO 1XNQO 4LF4O 5LMUO 2VQFO 4DV7O 5LMNO 2DJVA 1HNZO 3J80N 4JV5O 1IBMO 4NXNO 2UUCO 4OX9O 1N34O 2FKXA 2UUAO 1J5EO 4KHPO 1AILA 4LF8O 5BXZA 2F4VO 1F7YA 4GKJO 4DR5O 4DUZO 1AB3A 2N74A 1IBLO 4JI2O 3OTOO 1HNWO 4B3TO 4JI0O 4X62O 2ZKOA 1N33O 3JAMN 2E5LO 1N36O 4DR3O 4JI7O 1A32A 4OPHA 1FKAO 1YZBA 4AQYO 2UXDO 2Z0AA 3RT3C 4DV6O 4LFBO 2AGAA 2DOSA 4OPAA 2UUBO 4DR4O 4DV0O 1XMQO 1XMOO 4DV3O 2LW7A 1KUQA 4DR7O 1XEQA 5A2QN 4A5UB 4DV1O 1HNXO 1N32O 4LFAO 4DR1O 1I94O 1HR0O 4LF6O 1R1BA 5H5NA 1FYJA 5IT9N 4JYAO 4JI6O 4DR6O 3J81N 5IWAO 4DV4O 3T1YO 5FLXN 1FJGO 2UXCO 3J7AU 4LF5O 4LF9O 4X65O 1IBKO 4DR2O 2JRIA 5LL6Y 3T1HO 2HHHO 4X66O 1DK1A 4B3SO 4YHHO 4LF7O 4NXMO 3R66A 4X64O 3O65A 2UU9O 4K0KO 2VQEO 5BY1A 1XNRO 4LFCO 4DUYO 4JI8O 1NS1A 2ZM6O 1G1XB 4YY3O 4B3RO 3F5TA 3M8AA 1D2DA 4B3MO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6T A;  3SDL A;  4JI1 O;  2UXB O;  4JI3 O;  5BR8 O;  4DV5 O;  4JI4 O;  4JI5 O;  4DV2 O;  1X59 A;  4GKK O;  1XNQ O;  4LF4 O;  5LMU O;  2VQF O;  4DV7 O;  5LMN O;  2DJV A;  1HNZ O;  3J80 N;  4JV5 O;  1IBM O;  4NXN O;  2UUC O;  4OX9 O;  1N34 O;  2FKX A;  2UUA O;  1J5E O;  4KHP O;  1AIL A;  4LF8 O;  5BXZ A;  2F4V O;  1F7Y A;  4GKJ O;  4DR5 O;  4DUZ O;  1AB3 A;  2N74 A;  1IBL O;  4JI2 O;  3OTO O;  1HNW O;  4B3T O;  4JI0 O;  4X62 O;  2ZKO A;  1N33 O;  3JAM N;  2E5L O;  1N36 O;  4DR3 O;  4JI7 O;  1A32 A;  4OPH A;  1FKA O;  1YZB A;  4AQY O;  2UXD O;  2Z0A A;  3RT3 C;  4DV6 O;  4LFB O;  2AGA A;  2DOS A;  4OPA A;  2UUB O;  4DR4 O;  4DV0 O;  1XMQ O;  1XMO O;  4DV3 O;  2LW7 A;  1KUQ A;  4DR7 O;  1XEQ A;  5A2Q N;  4A5U B;  4DV1 O;  1HNX O;  1N32 O;  4LFA O;  4DR1 O;  1I94 O;  1HR0 O;  4LF6 O;  1R1B A;  5H5N A;  1FYJ A;  5IT9 N;  4JYA O;  4JI6 O;  4DR6 O;  3J81 N;  5IWA O;  4DV4 O;  3T1Y O;  5FLX N;  1FJG O;  2UXC O;  3J7A U;  4LF5 O;  4LF9 O;  4X65 O;  1IBK O;  4DR2 O;  2JRI A;  5LL6 Y;  3T1H O;  2HHH O;  4X66 O;  1DK1 A;  4B3S O;  4YHH O;  4LF7 O;  4NXM O;  3R66 A;  4X64 O;  3O65 A;  2UU9 O;  4K0K O;  2VQE O;  5BY1 A;  1XNR O;  4LFC O;  4DUY O;  4JI8 O;  1NS1 A;  2ZM6 O;  1G1X B;  4YY3 O;  4B3R O;  3F5T A;  3M8A A;  1D2D A;  4B3M O; 
#chains in the Genus database with same CATH topology
 4R7C A;  4JI1 O;  3CCQ V;  2XND G;  1Q5O A;  4DV2 O;  1NU1 H;  1X59 A;  1RM1 B;  2ZDI C;  4JI6 B;  1XI1 A;  3SPG A;  5LXT A;  5IWA B;  5IY5 C;  4FZ1 A;  3J80 N;  1NR7 A;  2CTW A;  1DGS A;  5IYZ B;  1UPG A;  2WA4 A;  3JAT B;  1JFF B;  2RDC A;  4KHP O;  4LF8 O;  3H1L H;  3ABM C;  4H37 A;  3B09 A;  1K4C C;  3OTO O;  1FS0 G;  4K0K B;  2ZKO A;  2GUZ A;  3ETD A;  4QIW F;  4XBF A;  2E5L O;  4O2B A;  4O2A A;  3F7V C;  5IE9 A;  4KP4 A;  2E3C A;  2RJZ A;  3HKC B;  4YJ3 A;  4TV8 B;  4NVP A;  4TV9 B;  1YDX A;  3ZRW B;  2IW5 A;  2DN9 A;  1XHX A;  2Y69 B;  2EIJ C;  1XNQ B;  3OE7 G;  3E83 A;  3IAY A;  5JJN B;  1Y76 B;  1NI8 A;  4X20 B;  2EIM B;  1SER A;  2OCC B;  1H2S B;  1P84 F;  5B5E Z;  1XEQ A;  1G6U A;  1H2G A;  1Q90 D;  1S72 V;  2B5U A;  1QBZ A;  3JD0 A;  1YJW V;  2UXB B;  1FXK C;  2XT9 A;  3J81 N;  4DV5 B;  5C8Y B;  5FLX N;  3L74 H;  4EFB A;  4TWK A;  3P3N A;  1IBK O;  2Q4P A;  5LL6 Y;  4AQY B;  2QSA A;  2P22 C;  4YHH O;  3O65 A;  2QWO B;  3G4S V;  3RVZ A;  3RYC B;  4JI8 O;  1OCR C;  4J41 A;  1IBL B;  3M8A A;  2QM7 A;  2UXB O;  2OYQ A;  2ZIM A;  4DV5 O;  1PKX A;  3ZED A;  1SQB H;  1S3J A;  3OMA B;  2BE3 A;  1XHZ A;  3CJH B;  1ZLZ A;  5B1B C;  5EIB D;  4DV7 O;  4PDR A;  1VF6 C;  5E1A C;  3UT5 B;  3VQV A;  1PD3 A;  4IL6 Z;  1JVM A;  5KLV H;  3ZHV A;  1ZX3 A;  5GON A;  2UUC O;  5BXZ A;  1XQ8 A;  2D2C B;  5IDJ A;  3CCE V;  4DR5 O;  1IBL O;  2QWP B;  3ZHR A;  3CHX A;  1HR0 B;  1QNM A;  4ZIB A;  5LP6 B;  3CCR V;  4YY3 B;  4WFG A;  5C93 A;  2ZE6 A;  3B8N A;  3K57 A;  5EBW C;  3ZBH A;  1Q6U A;  2ILM A;  5KHJ A;  1DLB A;  2RMK B;  3B40 A;  1YI2 V;  2IH1 C;  3AEI A;  1GN2 A;  2W6J G;  1LUV A;  2IJK A;  3FAV B;  1BCC H;  1JR9 A;  2WLK A;  1B06 A;  3EFF K;  2A9H A;  4XDJ A;  4FM1 A;  4JTA B;  1HR0 O;  3VQW A;  1F4M A;  3AG2 C;  3MAQ A;  1GM7 A;  4W4K A;  1VF6 A;  2D3O W;  3K04 A;  1TA8 A;  5ITZ A;  2LGW A;  2YEV A;  2Q0A A;  3U11 A;  2F43 G;  2PTM A;  4GLX A;  1WP8 A;  4YXW G;  3ASN B;  4WCE V;  1TUB A;  2YI8 A;  1VQ4 V;  3HKB A;  4RQE A;  2DYS B;  3BFR A;  2A06 H;  4U3J B;  3LDC A;  4QPK A;  1Q82 W;  3CPW U;  3RFR A;  4GT1 A;  1PP9 H;  5IYD O;  1JX9 A;  3P30 A;  2C2A A;  4ABM A;  4N21 A;  1MZF A;  1VQM V;  1B04 A;  2CTR A;  5IY5 B;  1PL4 A;  2Z5U A;  1CEZ A;  1EN5 A;  2HJF C;  2VWK A;  5IYC O;  2R9I A;  4FLW A;  3ABM B;  1XMO B;  2EBO A;  2CH7 B;  3I56 V;  4J42 A;  2P67 A;  5H9C A;  3K3W A;  3JCZ A;  2ATK C;  1ROP A;  5GTH Z;  4O4H B;  2YIB A;  3W7U A;  4LF5 B;  4UCS A;  3C90 A;  1BL8 A;  1K97 A;  5CB4 A;  3BCC H;  4PI2 A;  2EIJ B;  1EBO A;  1WJZ A;  1GTO A;  3HKD B;  4NTW A;  3RYH B;  4FLU A;  5JJJ B;  1XMO O;  2XHB A;  5LMN B;  2FML A;  5L3D A;  4EFE A;  4DR7 O;  3E8G A;  1AJN A;  1ZSP A;  3D8C A;  1US6 A;  1S5J A;  4HAM A;  1WAZ A;  1YTF B;  1FXK B;  4JI0 B;  3JAL B;  3WU2 Z;  1V54 B;  2ZIN A;  4LF5 O;  3JD4 A;  4DR2 O;  3IGA C;  4MVO A;  2AZ2 A;  4K35 A;  3RBZ A;  2V7Q G;  1HNZ B;  1XDC A;  1ZL8 A;  5IJ0 A;  3L9D A;  1GMG A;  2ARH A;  3I55 V;  4DXW A;  3F7Y C;  3OD4 A;  4DK1 A;  4GYC B;  2HP8 A;  1GAX A;  4O4J B;  3K5L A;  2BTQ A;  1OCR B;  1GO3 F;  3CRC A;  4HYO A;  1UJW B;  1RPR A;  3E35 A;  3HR0 A;  2IM9 A;  4MVQ A;  3K5M A;  1NH2 D;  4CH5 A;  4F6R A;  1MG1 A;  1AVM A;  2X7R B;  3ABL C;  5B1B B;  5EC1 C;  2X6A A;  4K8X A;  2DJV A;  1HNZ O;  5L3E A;  4D7T A;  4MVM A;  2UXC B;  3AG4 C;  1XIL A;  2KSD A;  2HKO A;  4ZI7 B;  2ZE5 A;  5KA6 A;  4H13 B;  2YUA A;  2QWN B;  4X88 A;  4DW1 A;  2JEU A;  2VQE B;  4X62 O;  4RUE A;  5CA0 B;  3JYC A;  1R6N A;  2K9P A;  4PHZ A;  3STL C;  1SA0 B;  1L0L H;  4LNU A;  3QVN A;  3W7X A;  3K9S A;  5LYJ A;  3S3W A;  2H8P C;  4J10 A;  2AXT Z;  4LF4 B;  5KX5 A;  5LBQ A;  4C7U A;  3WG7 C;  1KKD A;  1QVF U;  1QQC A;  3RVY A;  1VP7 A;  2E74 B;  1IXM A;  2OT5 A;  5J2U A;  1D5N A;  5A2Q N;  4A5U B;  4J9Y B;  3LUT B;  2UUA B;  2P5O A;  3IJ4 A;  5CA1 A;  4XDK A;  2OIE A;  1AP5 A;  1J95 A;  4JI3 B;  3W7S A;  4J11 A;  2HEP A;  3RN4 A;  5JJE B;  1WB8 A;  1DK1 A;  4K3A A;  1XL6 A;  2MW2 B;  2O57 A;  4R50 A;  5HFM A;  1KEC A;  4JPR A;  4CH3 A;  5CB4 B;  3KCY A;  3QO8 A;  3RYF A;  2F4V B;  4DUZ B;  4J9Z B;  3QTC A;  4MTF A;  4DV3 B;  4JI3 O;  3R65 A;  2GDS A;  5IYZ A;  5H6R A;  1Y6X A;  1JFF A;  2CGN A;  2DMX A;  2CGO A;  4UVA A;  2YIC A;  4L87 A;  2QM4 A;  3Q4H B;  3OGC C;  2R9A A;  2A3Q A;  5BZB A;  3G6B A;  1FPO A;  3HKC A;  4X89 A;  4TV8 A;  3E2E A;  3WB0 A;  5EBL C;  2WA3 A;  1TGO A;  3JAK A;  2F4V O;  3B8M A;  3ASO C;  4DUZ O;  3ML0 A;  4X64 B;  4BAY A;  2PY5 A;  5JWP A;  3KKY A;  5IJ0 B;  2QKC A;  3AK1 A;  1L1F A;  2CE4 A;  1Y67 A;  5LOV B;  1Y76 A;  4Z1V A;  4WF9 V;  4QE9 A;  3A0B Z;  2HG5 C;  4B3M B;  3SGI A;  2R70 A;  2MK3 A;  5B66 Z;  2JEX A;  1AI6 A;  1BGY H;  4P9P A;  1EZJ A;  3JSN A;  4I55 B;  4WFF A;  1XUQ A;  2FYU H;  1VQ8 V;  3D3I A;  5JQG B;  4IHJ B;  2EZP A;  5C8Y A;  4B08 A;  1JCH A;  4DV1 O;  4JV5 B;  3OTF A;  5EBM C;  4FZ0 A;  1N32 O;  3VQX A;  1Z5V A;  1W2B U;  4B3R B;  1YVW A;  4MW3 A;  2ZNJ A;  2B1G A;  4IYH A;  1NVP B;  3RYC A;  4MW8 A;  4L8J A;  2DE0 X;  2JGU A;  4TSF G;  1I7F A;  4HNA B;  4PDM A;  1DF5 A;  4CH6 A;  2Q67 A;  3OR7 C;  4LNU B;  4UCO A;  5BY1 A;  2XAJ A;  4LFC O;  4CH4 A;  3K59 A;  1V55 C;  5LGT A;  4IIJ B;  3CJH A;  2F23 A;  2Z3Y A;  4B3R O;  4UVB A;  1KU9 A;  3G71 V;  5K1X A;  1W0K G;  3UT5 A;  2BTO A;  3BVO A;  5BR8 O;  5J2U B;  3ZIA G;  3TK1 A;  4G2K A;  4OGQ B;  1S5L Z;  2E76 B;  1PM9 A;  5K1P A;  4DW0 A;  3ABL B;  2ZE8 A;  1GN4 A;  5TIS Z;  4JAU A;  2ZNI A;  3FFQ A;  3AG4 B;  3JAW B;  2Q7H A;  1GN6 A;  5LP6 A;  2HR3 A;  4X1I A;  3G6E V;  4E2L A;  1OCO C;  3ZHQ A;  1XNR B;  3U10 A;  1AP6 A;  1VQL V;  3OUF A;  3X2Q C;  3FX7 A;  3QO7 A;  3IFX A;  4OPH A;  3LNN A;  3RYF B;  4FFB A;  3BAB A;  2VWJ A;  1KMI Z;  3FAV A;  5JH7 B;  2Y0P A;  3APO A;  2YID A;  4JI5 B;  3OEH G;  4UUJ C;  3JD1 A;  4WBN B;  2ZE7 A;  2EUL A;  3ZRX A;  4Q6G A;  5LGN A;  3WG7 B;  4UCU A;  1D5A A;  4JZG A;  4P2Z A;  1YEW A;  3LDE A;  3ZRV A;  3K03 A;  3JAK B;  4LP8 A;  2F93 B;  4JI6 O;  2CAZ C;  2Y0I A;  4J7J A;  5FNV B;  1SZT A;  5LHH A;  5IWA O;  3L73 H;  4FM0 A;  3BEH A;  3OGI B;  4U3J A;  2JK5 C;  5D5Q A;  2ZD9 A;  4PI0 A;  1WPB A;  2RCV A;  3WB1 A;  1RP3 B;  4J7Z A;  1F51 A;  4K0K O;  3CX5 F;  1K8A W;  3B4S A;  2VRZ A;  1M56 C;  4DV6 B;  1VQ9 V;  4NTY A;  2B1I A;  2ZDI A;  1JMK C;  3E22 A;  1IVS A;  1V54 C;  1XRE A;  3FYE B;  4PA3 A;  4K8Z A;  4PDL A;  2Y48 A;  3ZMS A;  4DO2 A;  1SS3 A;  1XNQ O;  4RWU A;  2CH7 A;  2KB1 A;  5EK0 A;  1GRJ A;  4UCT A;  3FB6 C;  1N8R W;  1T5E A;  3K5N A;  5IYB O;  2QJ1 A;  2ZR2 A;  1EN4 A;  4O4H A;  1HW7 A;  2H94 A;  5CN0 A;  3ZN1 A;  3ASO B;  3N2G A;  3CB2 A;  4U7O A;  2UU9 B;  3SJC C;  1Y74 B;  2CTP A;  5JCO C;  3HKD A;  3UKM A;  3OFN G;  3RYH A;  2Q7E A;  3ZMZ A;  5KUK A;  4AQY O;  4O4L A;  2QTS A;  3MHH C;  3JAS B;  2EZO A;  3BA9 A;  5KUM A;  4OXS A;  5EZY B;  2IH3 C;  3T4Z A;  2HHH B;  1XOU A;  1B3Q A;  5LMU B;  1FXK A;  3JAL A;  2BSK B;  2LW7 A;  2JGD B;  1IBM B;  1EFR G;  2QA4 V;  3CXC U;  2NR5 A;  3CRA A;  4X1I B;  2ADQ B;  5IT9 N;  1B6Q A;  1V9P A;  2P06 A;  1BT8 A;  3ETQ A;  2YI9 A;  2N04 A;  4CC5 A;  1MZE A;  4O4J A;  2R72 A;  1YJ9 V;  3MD0 A;  4CC6 A;  2FTK A;  3H1H H;  2IJJ A;  2Q68 A;  1SES A;  4FFB B;  2HHH O;  3ABK C;  1FD9 A;  5J9P C;  2AZ0 A;  3STZ C;  4GX2 A;  2GTA A;  2PUS A;  1V55 B;  2JJ2 G;  3IC9 A;  4OX9 B;  3I5D A;  2QEX V;  2PYJ A;  4CS3 A;  3CE2 A;  4YY3 O;  4LC1 A;  2AHZ A;  3OEE G;  3OW2 U;  1M93 A;  4ZI7 A;  4I5S A;  4ZHQ B;  4LFA B;  1G4Y B;  3TXS A;  3ZMT A;  4NB5 A;  3TET A;  3H1I H;  4JYA B;  1BQ0 A;  1IDS A;  4LCU C;  4DR6 B;  4EB6 B;  3T1Y B;  5LGU A;  1M57 C;  4LF9 B;  5CA0 A;  2LGQ A;  4OX9 O;  3SYC A;  1SA0 A;  1XMQ B;  1FXV A;  2H3O A;  3FB7 C;  1EM1 A;  1OCO B;  1N4C A;  1N0N A;  2JIZ G;  4CS4 A;  1LUW A;  1Q6H A;  3X2Q B;  2EIK B;  3THO A;  1KBH A;  2LQT A;  3E22 B;  4JYC A;  2CTQ A;  2Q5Z A;  5A9G A;  1OHH G;  3NXS A;  1X4T A;  1SQX H;  5DED A;  3T1H B;  1VF7 A;  4JZ2 A;  2YIB D;  3CCU V;  1NZ6 A;  2QDO A;  1GM9 A;  2PZS A;  2FL4 A;  1AJP A;  1E1R G;  1XMQ O;  3SJB C;  4IGG A;  3B2E E;  3K79 A;  2GHY A;  4JGS A;  4XDL A;  5L3B A;  2PI4 A;  3CSX A;  1QLE C;  4NXN B;  1KKC A;  4MTX A;  4PA7 A;  1FFX B;  3N2G B;  1M4U A;  2NLJ C;  1JOY A;  4FIP C;  4GKK B;  3CCS V;  3NR7 A;  1RPO A;  1K4D C;  1R73 A;  4X1K B;  2VQF B;  1BS3 A;  3T1H O;  1NTZ H;  1ARO P;  2ZCE A;  4O4L B;  1YIT V;  3RYI A;  2F1M A;  1NJI W;  2WPD G;  2BOC C;  2HVK C;  1M56 B;  3UCS C;  3BPZ A;  3Q4H A;  2A7W A;  2BCC H;  5BMV A;  5DN6 G;  3F5T A;  1Y66 A;  1D2D A;  5CBH A;  5KAF Z;  4BIO A;  3CP1 A;  1Q81 W;  2RN9 A;  1URF A;  1PNM A;  4GKK O;  4PA9 A;  3OM3 B;  2UXD B;  5B1O A;  5KAI Z;  4D7S A;  2VQF O;  2R9R B;  1NQT A;  2WLI B;  5LMN O;  4RAI A;  4WFE A;  4FK5 C;  2FB5 A;  4IT5 A;  1ZUQ A;  4X65 B;  1E79 G;  1SRY A;  5LOV A;  3CRM A;  3W7T A;  4LF7 B;  4Z1M G;  4GZR B;  3TGU H;  4JI0 O;  3M7M X;  4I55 A;  3E8F A;  3JD2 A;  2V1D A;  1W59 A;  5JQG A;  4IHJ A;  3RWR D;  2UXD O;  3AK3 A;  5FL7 G;  4FM2 A;  1KYO F;  5B1N A;  2LO1 A;  1YCI A;  1SKV A;  3UM7 A;  3ZS8 C;  4OPA A;  2M6Y A;  3VOU A;  2P90 A;  2NN4 A;  2W0F C;  3DTU B;  1K3E A;  2LP7 A;  1JA8 A;  1NBM G;  1PNK A;  2PGG A;  1XL4 A;  3N2K B;  4HNA A;  1BE3 H;  1GKF A;  2ZXW C;  2XTA A;  1ZAU A;  2B9Z A;  4UV9 A;  2P6J A;  3ABU A;  2WLJ A;  3O9O A;  2DWD C;  3DXR A;  4IIJ A;  2UXC O;  3SPC A;  1Z5W A;  1YSC A;  2ADP A;  3ABK B;  1FFT B;  1KD1 W;  1S5H C;  2VQE O;  2CDY A;  2PYL A;  2E75 B;  1OJH A;  4PEL A;  1SC5 B;  2V4D A;  2UUB B;  3N27 A;  4J80 A;  4ICG A;  4UV8 A;  5KHK A;  4Z2W A;  3JAW A;  4EEQ A;  4MVZ A;  1I94 B;  1M90 W;  4LF4 O;  1R3K C;  1VQO V;  2WLL B;  1SQG A;  1QR8 A;  5B3S C;  1NTM H;  1COW G;  1I5Y A;  1FJG B;  3FYI B;  2Q8V A;  3SPH A;  1M57 B;  2EJ7 A;  3SR2 C;  1Q86 W;  1IXB A;  2IBZ H;  4Q20 A;  2UUA O;  1H2L A;  3SPJ A;  3TJT A;  5FPR A;  5JH7 A;  1F7Y A;  1TVK B;  3RYI B;  1AI7 A;  2M7W A;  3ZHT A;  2DWE C;  4WBN A;  5BMV B;  4YJ2 A;  1SQP H;  1YXB A;  4DV4 B;  4PD4 F;  5KMG B;  4JI4 B;  3CME V;  1MAB G;  2WAM A;  1M5I A;  4JTD B;  2AGA A;  4NXM B;  1R3J C;  5FNV A;  5DM6 V;  4DV3 O;  1GH6 A;  4TUY A;  1L0N H;  1Q7Y W;  4H33 A;  1QLE B;  5JVD B;  1H8E G;  1N34 B;  1KB9 F;  2AHY A;  5H5N A;  4GKJ B;  1EZV H;  2ITC C;  1HNW B;  1FXH A;  3ABT A;  3PN1 A;  3K06 A;  4DV4 O;  1L8D A;  4ZOL A;  1N33 B;  2P4V A;  1K9M W;  1N36 B;  3ZJZ A;  2OWO A;  3SJA C;  3UO2 A;  2XAH A;  1BQZ A;  5CMU A;  3FB8 C;  4F6E A;  1H8H G;  4PV1 B;  4NXM O;  4JYY A;  4X64 O;  1GK9 A;  1SQV H;  4FLX A;  4AHC A;  2AW9 A;  2WLH A;  1KC8 W;  4MVU A;  1RSO B;  2UXX A;  2P7T C;  4FFK A;  4JI2 B;  4B3M O;  2YXL A;  4B3T B;  2JDI G;  4BIU A;  3ZMV A;  1WPX A;  1Q3E A;  1SQF A;  2OIG A;  1H2N A;  4I50 B;  4DYL A;  1GM8 A;  2GBO A;  1WA8 B;  1Y74 A;  3L70 H;  1NH2 B;  3DXR B;  4JV5 O;  3TXQ A;  3HKE B;  4MT8 A;  3L72 H;  2JVD A;  1TUE B;  4CZZ A;  3JAS A;  2DQ0 A;  2N74 A;  4JI2 O;  4B3T O;  1YF2 A;  5EZY A;  4FLZ A;  4FJC C;  4FMT A;  3OMI B;  3GB7 C;  4LR3 A;  3EHB B;  1YZB A;  2BSK A;  3W7W A;  3DC6 A;  2JGD A;  2Z0A A;  4U7N A;  4LWS B;  4JI1 B;  1NT2 B;  5H2F Z;  1GN3 A;  2Q0O C;  4KUM A;  5LA6 B;  3HB3 B;  5FPO A;  4DV2 B;  3AG7 A;  3CC7 V;  3ZCC A;  2WSS G;  4JF3 A;  1QHT A;  1KP3 A;  2DQ3 A;  2EJR A;  1M1K W;  2EIK C;  3T4D A;  2ZXW B;  2G38 A;  1JJO A;  5CA3 A;  1THZ A;  3AG3 C;  3E86 A;  3BHP A;  4KHP B;  4LF8 B;  3GVM A;  3K0G A;  4R6Z A;  5IJ9 B;  3OTO B;  3A0H Z;  4G28 B;  4MVR A;  3J7A U;  3CCJ V;  2E5L B;  2X6B A;  3OUS A;  5L3F A;  2IJI A;  4RQF A;  4UVC A;  4IYI A;  5J2T A;  3CCL V;  4YJ2 B;  1IZ3 A;  1SET A;  3CXH F;  3BRC A;  1XNR O;  4ZHQ A;  2QR4 A;  3U0Z A;  1QLN A;  1K33 A;  4EB6 A;  2Y4U A;  4J7K A;  1YIJ V;  3C3S A;  1WP7 A;  4TUY B;  4JI5 O;  4X1Y B;  2A79 B;  3GWO A;  1NTK H;  4QPJ A;  4LBE C;  4ZKI A;  2F95 B;  5B3S B;  1VQ5 V;  4RUF A;  2DYR C;  1P7G A;  1H38 A;  4ZOL B;  3CEI A;  1IBK B;  2ODM A;  1K7D A;  1AIL A;  1E1Q G;  4DR4 B;  2JJ1 G;  4YHH B;  5AG2 A;  5EYP B;  4JI8 B;  5B1A C;  4LF6 B;  4P30 A;  2GSM B;  1JJ2 U;  3CCM V;  1Y4M A;  3BY6 A;  2QTO A;  3UO3 A;  3JD3 A;  5EIB C;  4FLY A;  3RT3 C;  2L35 A;  4DV6 O;  2X0L A;  4G27 B;  5LHI A;  1HWY A;  2DOS A;  2OTJ V;  1S76 D;  1FFX A;  4H0L B;  4DR4 O;  4DV7 B;  4B7E A;  5EC2 C;  1KUQ A;  4TT3 G;  3OMN B;  3FD9 A;  2IU0 A;  4X1K A;  3ICX A;  1YTF D;  4R8C A;  3F5W C;  2UUC B;  4LF6 O;  2Q9L A;  4RO2 A;  1NR1 A;  3FKS G;  1R1B A;  4DR5 B;  1JPX A;  4I4T A;  2IU3 A;  3RGB A;  1CP9 A;  2KG7 A;  3H01 A;  2Q6A A;  1WN7 A;  2W0X A;  3OAA G;  1ZWI C;  5KHG A;  4X8A A;  2YIA A;  3M99 B;  3ETE A;  3KCX A;  2UU9 O;  2ETN A;  2ZR3 A;  3E89 A;  3LSU A;  2A0L A;  3KZI Z;  2N05 A;  3AK2 A;  3JAR B;  4TOI A;  3CC4 V;  2WLI A;  2KQX A;  2EIL C;  1VQN V;  1OCZ B;  4O4I A;  4DR3 B;  5L3C A;  1I5X A;  4PA6 A;  4I0X A;  1RFY A;  1WB7 A;  5LMU O;  4BWA A;  4QGP A;  1QVG U;  2XAG A;  3P32 A;  2QE7 G;  3CYO A;  5JCO A;  1K92 A;  4FLT A;  2KKW A;  2GTS A;  4BR6 A;  4NKG B;  1IBM O;  5KHI A;  1LNQ A;  1I08 A;  5J2T B;  3AG1 C;  2RNB A;  3A8T A;  3QG5 A;  1O9G A;  5CBF A;  1AJQ A;  1R3I C;  2Q69 A;  4AI8 A;  1OZ0 A;  3JCU Z;  1ORQ C;  3LDD A;  2BOB C;  4MTO A;  5LXT B;  4DR1 B;  1VQP V;  4DR3 O;  3CD6 V;  4JYB A;  2XAF A;  2LJ2 A;  2DW4 A;  1H2K A;  1AR5 A;  3QF7 A;  2ZT9 B;  4UCR A;  4DRX A;  3N2K A;  4ASU G;  4UFZ A;  3CC2 V;  5HFL A;  4MTG A;  2GUZ B;  4FLV A;  2K1E A;  4PDV A;  2YC0 A;  4UXN A;  3H1J H;  4O2A B;  4O2B B;  4YJ3 B;  1I0H A;  3D36 C;  1QU7 A;  2ZQM A;  4NTX A;  2LFR A;  4WFA V;  3VBB A;  3FB5 C;  2XAQ A;  1SF9 A;  2ZM6 B;  4LFA O;  4DR1 O;  4YIP A;  3AG3 B;  4WFH A;  1FYJ A;  4JYA O;  1KP2 A;  2ITD C;  4DR6 O;  3T1Y O;  2CUG A;  1WLE A;  4KL1 A;  4LF9 O;  4KXR A;  3WFV A;  1OCC C;  4W4L A;  5E79 Z;  4YIO A;  2XOK G;  3OR6 C;  1IX9 A;  4MS2 A;  3R66 A;  2NNU A;  1R3L C;  4BW9 A;  1O9H A;  1P4R A;  2WLL A;  2P4K A;  2ZM6 O;  3G67 A;  1VQ6 V;  2HJD A;  3MDS A;  1SQQ H;  2YXY A;  3SPI A;  2CK3 G;  1EN6 A;  4DR7 B;  4PJ0 Z;  4HBN A;  3UQ8 A;  1YJN V;  3PJS K;  2JS3 A;  2WLM A;  1TVK A;  1VQK V;  2EIN C;  1P49 A;  3CMA V;  3D36 A;  1AR1 B;  4I4T B;  2DYR B;  2KG7 B;  2L6L A;  2RQ6 A;  3H1K H;  3ZX6 A;  4NXN O;  4JAS A;  2QKA A;  4DR2 B;  2EX3 A;  1HP8 A;  1S0V A;  4DV0 B;  4JAV A;  4UB8 Z;  2QGN A;  4E4E A;  1Q8I A;  1MA1 A;  4GX0 A;  3D3Q A;  1NKD A;  1Q43 A;  1YHQ V;  5KMG A;  4LH7 A;  1PNL A;  1LR1 A;  2LW1 A;  3A2F A;  1BHA A;  4UB6 Z;  5B1A B;  2OCH A;  1XBL A;  4GCZ A;  3SYQ A;  5GON B;  4QE7 A;  3RW0 A;  5D5P A;  4LH6 A;  1K5Q A;  1K5S A;  1MNG A;  5F2V O;  4BW5 A;  2GV9 A;  4O4I B;  4CS2 A;  5JVD A;  3C3T A;  1K34 A;  2QKS A;  4I0X B;  3BAA A;  4X66 B;  4B3S B;  2QM8 A;  3P3P A;  4DV0 O;  4GUN A;  4TQF A;  4FVM A;  3LSS A;  1M9N A;  2YS8 A;  4BIZ A;  3VQY A;  3DGE A;  1NVP D;  1VAR A;  1U96 A;  3E8B A;  1BMF G;  4X62 B;  2WLN A;  2QWR B;  1S77 D;  2X6C A;  3K9A A;  4X65 O;  4QNH B;  1RSO A;  1CPY A;  4X66 O;  4B3S O;  4LF7 O;  4DRX B;  3JSL A;  3ZRS A;  3LSQ A;  4I50 A;  4WFB V;  1NS1 A;  5ITZ B;  1J5E B;  2YEV B;  4KFM A;  3K5O A;  1G1X B;  1N0J A;  1WA8 A;  5KA5 A;  4GX1 A;  2EIL B;  2XAS A;  3DSQ A;  4P9O A;  2YXH A;  1TUB B;  3HKE A;  4JTC B;  4JI7 B;  3SYP A;  3HKB B;  1AR4 A;  4EKW A;  3ZMU A;  1RM1 C;  3T1C A;  3B77 A;  3CWB H;  4MVS A;  1H2M A;  1MMM A;  3TCU A;  1W0J G;  2PF4 E;  3HPL C;  3T2M A;  1MSD A;  3K08 A;  1J5E O;  1ZTE A;  1JQ0 A;  1ENV A;  4LWS A;  3IC7 A;  1AB3 A;  3AG1 B;  4MSW C;  5LA6 A;  3CRR A;  1PL0 A;  3JAM N;  2JS5 A;  4H44 B;  4JI7 O;  4GX5 A;  1FAF A;  1FKA O;  3H9V A;  5GW7 A;  3AG2 B;  1VQ7 V;  1G8M A;  2Y69 C;  5GTI Z;  3OT7 A;  3QO5 A;  2UUB O;  5IJ9 A;  3G80 A;  2ZIO A;  3SJQ C;  2EIM C;  2OCC C;  4FPP A;  1DTO A;  2YDE A;  3DC5 A;  1K73 W;  1UFI A;  3MHS C;  4DK0 A;  4UCV A;  1I94 O;  2WWW A;  1PPJ H;  1Z2G A;  1FJG O;  1OV9 A;  1PV0 A;  4CBC A;  3EXA A;  3GWK C;  2XUM A;  3CRQ A;  3JAT A;  1OCC B;  4I7Z B;  5H6Q A;  1MOF A;  4X1Y A;  1BHB A;  1AI5 A;  1AI4 A;  3L75 H;  4D6T H;  2UXN A;  1F4N A;  1R6T A;  4TV9 A;  1VIB A;  3SDL A;  3E8H A;  3ZRW A;  4JI4 O;  4DV1 B;  1ZL8 B;  1N32 B;  2HVJ C;  4JAA A;  3APQ A;  2HFE C;  1KQS U;  2BTQ B;  1HDJ A;  4X20 A;  2EIN B;  5EYP A;  2LFS A;  3A0R A;  4LFB B;  4NR1 A;  4B7K A;  1N34 O;  2FKX A;  3CCV V;  4GKJ O;  5CBG A;  4F6R B;  1OCZ C;  1QCE A;  3ZHS A;  3K58 A;  1HNW O;  3S3X A;  4LFC B;  1VF5 B;  1HNX B;  1VEW A;  1N33 O;  1DF4 A;  3QNE A;  1N36 O;  2Q7G A;  1WNS A;  3BA8 A;  1A32 A;  4TQD A;  4F4L A;  5LP6 C;  2W6I G;  3SYO A;  1MSW D;  4I9Q A;  3KG2 A;  4HZ3 A;  1U97 A;  4I9W A;  2F66 C;  4PA4 A;  5BR8 B;  4ZBM A;  4LFB O;  5LHG A;  2HLD G;  1QR9 A;  3LNM B;  2PI5 A;  3SYA A;  4NYK A;  5KHH A;  1BZK A;  2IJH A;  3ZN0 A;  3L71 H;  1R6K A;  2VS0 A;  1Q6I A;  4DUY B;  4U3F H;  4N23 A;  1SZX A;  5LYJ B;  1HNX O;  2OTL V;  4X9Q A;  5KX5 B;  2Q73 A;  1TAE A;  4AIL C;  3ETG A;  1IUR A;  1CXZ B;  1F23 A;  3JAR A;  2JRI A;  3CS5 A;  5L3G A;  5CA1 B;  3ASN C;  2YSU B;  1VMG A;  1BSM A;  4DUY O;  5DEC A;  3K0D A;  3WB2 A;  2DYS C;  3ZHU A;  3EVK A;  4QJF B;  1P7B A;  2QWQ B;  2Y4T A; 
#chains in the Genus database with same CATH homology
 1R6T A;  3SDL A;  4JI1 O;  2UXB O;  4JI3 O;  5BR8 O;  4DV5 O;  4JI4 O;  4JI5 O;  4DV2 O;  1X59 A;  4GKK O;  1XNQ O;  4LF4 O;  5LMU O;  2VQF O;  4DV7 O;  5LMN O;  2DJV A;  1HNZ O;  3J80 N;  4JV5 O;  1IBM O;  4NXN O;  2UUC O;  4OX9 O;  1N34 O;  2FKX A;  2UUA O;  1J5E O;  4KHP O;  1AIL A;  4LF8 O;  5BXZ A;  2F4V O;  1F7Y A;  4GKJ O;  4DR5 O;  4DUZ O;  1AB3 A;  2N74 A;  1IBL O;  4JI2 O;  3OTO O;  1HNW O;  4B3T O;  4JI0 O;  4X62 O;  2ZKO A;  1N33 O;  3JAM N;  2E5L O;  1N36 O;  4DR3 O;  4JI7 O;  1A32 A;  4OPH A;  1FKA O;  1YZB A;  4AQY O;  2UXD O;  2Z0A A;  3RT3 C;  4DV6 O;  4LFB O;  2AGA A;  2DOS A;  4OPA A;  2UUB O;  4DR4 O;  4DV0 O;  1XMQ O;  1XMO O;  4DV3 O;  2LW7 A;  1KUQ A;  4DR7 O;  1XEQ A;  5A2Q N;  4A5U B;  4DV1 O;  1HNX O;  1N32 O;  4LFA O;  4DR1 O;  1I94 O;  1HR0 O;  4LF6 O;  1R1B A;  5H5N A;  1FYJ A;  5IT9 N;  4JYA O;  4JI6 O;  4DR6 O;  3J81 N;  5IWA O;  4DV4 O;  3T1Y O;  5FLX N;  1FJG O;  2UXC O;  3J7A U;  4LF5 O;  4LF9 O;  4X65 O;  1IBK O;  4DR2 O;  2JRI A;  5LL6 Y;  3T1H O;  2HHH O;  4X66 O;  1DK1 A;  4B3S O;  4YHH O;  4LF7 O;  4NXM O;  3R66 A;  4X64 O;  3O65 A;  2UU9 O;  4K0K O;  2VQE O;  5BY1 A;  1XNR O;  4LFC O;  4DUY O;  4JI8 O;  1NS1 A;  2ZM6 O;  1G1X B;  4YY3 O;  4B3R O;  3F5T A;  3M8A A;  1D2D A;  4B3M O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...