4LFCO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfcO00
3R66A 2UUCO 5BY1A 1XEQA 4DUZO 4LF8O 4K0KO 1XNRO 3J7AU 5FLXN 4LFBO 4X66O 1HNZO 4DV3O 2UUAO 4DV7O 4KHPO 2E5LO 2JRIA 4JV5O 2UUBO 3T1YO 5H5NA 5LMUO 3OTOO 4JI6O 4OX9O 3J81N 5LL6Y 4B3RO 2DOSA 4JI5O 5IWAO 1XMOO 2LW7A 4DV2O 4DR3O 2VQEO 4LF9O 4DR2O 4JI7O 2UXCO 4DV6O 1I94O 2F4VO 3RT3C 4LF7O 1N32O 2VQFO 2ZM6O 4JI4O 3F5TA 1NS1A 4GKJO 4DV4O 4LF4O 4LF6O 1FYJA 1F7YA 1A32A 4DR5O 1R1BA 2DJVA 1N36O 1XMQO 4DR1O 4JI0O 4JI2O 4JI8O 4DR7O 4JYAO 1AILA 4DV5O 2HHHO 5BR8O 1J5EO 4LFCO 4YHHO 1AB3A 3SDLA 4B3SO 4NXNO 1HNWO 4JI3O 1FJGO 4A5UB 4B3TO 4LF5O 4DR4O 2AGAA 4DV1O 4X62O 3J80N 5IT9N 1XNQO 4NXMO 2Z0AA 4DR6O 1R6TA 1IBLO 4GKKO 4JI1O 5LMNO 1X59A 4OPHA 2N74A 3JAMN 4LFAO 3T1HO 1N33O 1DK1A 1HR0O 4X64O 1FKAO 1KUQA 4AQYO 1G1XB 1IBMO 4X65O 2UXDO 2ZKOA 2FKXA 5A2QN 5BXZA 4DV0O 4YY3O 4B3MO 3M8AA 4DUYO 1IBKO 1D2DA 1YZBA 1HNXO 3O65A 4OPAA 2UXBO 1N34O 2UU9O
chains in the Genus database with same CATH superfamily
4J9ZB 3HKEB 1DF4A 2QKCA 4EFEA 4LCUC 2NLJC 5E79Z 1VQOV 3CC4V 1BE3H 4KP4A 1GMGA 1XBLA 3WB0A 4LF5B 1QNMA 4DV0B 4KHPO 1F4NA 3HKEA 4GT1A 2UUBO 1V9PA 2LGWA 4NTXA 4P30A 2QEXV 3BAAA 4LFBB 5CN0A 1HNZB 1H8EG 4K8XA 2BCCH 3RYIB 3CCSV 3I5DA 4B7KA 3K5LA 3QG5A 4IYHA 1FFXB 1AP6A 1CXZB 5GONB 3APOA 2JVDA 2PTMA 1BZKA 3PN1A 3RYIA 1H38A 3E2EA 1BT8A 1D5NA 3SJAC 4DV4O 1K3EA 1FYJA 4NTYA 1F7YA 5GONA 3K08A 4K35A 4W4LA 5B1AC 4JYAO 3GB7C 3CJHA 3JAWB 3QF7A 2HHHO 2HG5C 3B8MA 2ADPA 2QTOA 3BPZA 4MW8A 1PNLA 5LGTA 2PUSA 3K79A 4B3TO 3JAWA 5EZYB 4YJ3B 1BCCH 2CTWA 4LWSA 1OV9A 4DR6O 2WA3A 3L71H 3LSQA 4DV2B 5EZYA 1UJWB 3ZBHA 2QM4A 2PGGA 3BRCA 2D2CB 3JCUZ 3AG1B 2EX3A 1G1XB 4RQFA 3JATA 3GVMA 5K1XA 2EIJB 2FTKA 3EHBB 4DV0O 2A3QA 2ITCC 4AHCA 1S0VA 1QR8A 3H1JH 4J80A 3AG3C 2ZNIA 1SQQH 5IJ9B 4UCSA 1Q5OA 4BIZA 3OEEG 2W0XA 5FLXN 4LFBO 2PI4A 1HNZO 2WLNA 3THOA 5KHIA 2R72A 3QVNA 3T4DA 5LMNB 1YTFD 1W59A 4J9YB 1P7GA 5CBHA 1NT2B 4DR3O 1M9NA 3I55V 1MABG 4I5SA 4DW0A 1JMKC 2Y48A 4O4JB 2BOBC 3VQVA 1AP5A 1VF6C 5JVDB 1JQ0A 2DWEC 3FB6C 2LQTA 2IW5A 4H13B 4UVCA 4NKGB 4FLVA 4O4JA 5KLVH 5JVDA 4NXNO 3AEIA 4B08A 2YEVA 4QJFB 3QTCA 4TUYA 1Q6UA 1IVSA 1FAFA 3EFFK 1FXKB 1H2LA 1GH6A 4JI5B 3A0RA 2EIKB 4UV8A 1M1KW 2GTSA 4QPJA 4QNHB 1FXKA 2G38A 2KG7B 5GTIZ 2CDYA 4J11A 3H01A 1JA8A 2CE4A 5CB4B 1NR7A 4MTXA 4LBEC 3ZMTA 2VRZA 4I50B 2RQ6A 3ETDA 2B9ZA 2KG7A 1XREA 4I55B 5CB4A 1I0HA 1VQNV 4CH6A 3CRCA 4I50A 4JYBA 4UVBA 5H6RA 4UCOA 5B66Z 4YY3B 2L35A 3ABUA 2ZE7A 1L1FA 1ORQC 1IBLB 4FM2A 3ZHUA 4JI1B 1RSOA 3SYCA 1YEWA 4YIOA 3RYCB 1OCRC 4GUNA 2PY5A 3AG2C 5H6QA 1OCRB 3W7UA 2EILB 2YIDA 4O4LA 3AG2B 2XNDG 3RYCA 4MT8A 1OCZB 4PA4A 1IDSA 3HKCA 3ZHQA 3BA8A 2IH1C 1ZUQA 2UUAB 3SGIA 1GRJA 1K73W 5IYDO 1K4DC 1Y74B 2JIZG 2EZPA 2X0LA 2Z5UA 4JI3O 3B8NA 1TAEA 2EIMB 5K1PA 2PI5A 5LHHA 2EJRA 1JFFB 2QTSA 3G67A 1SA0B 1Y74A 5BMVB 1AJQA 3MD0A 4CBCA 1X59A 3FYIB 2GUZB 2QM7A 1ZL8A 1JFFA 2JS3A 4PA6A 5JCOC 3CX5F 4DR4B 3K3WA 4CH3A 2QDOA 5JQGA 2QGNA 1FKAO 1KUQA 4AQYO 2UXNA 4FLZA 2ZE8A 4JTAB 2GUZA 5LGNA 1DGSA 2V4DA 2YI9A 4YY3O 1NZ6A 3K03A 1N34O 3KKYA 2F43G 2DYRC 5JCOA 3T1HB 2XT9A 1Y76B 3LNNA 4O2AB 3ZHRA 4X65B 2EBOA 3CXCU 1PM9A 2K9PA 4J42A 2Q8VA 4CS2A 3O9OA 1QCEA 3J81N 1XNRB 1KP3A 2DYSC 3JD3A 5JH7A 2DYSB 3E83A 1NQTA 2QJ1A 5LMUB 1M57B 1SS3A 2E74B 4ZIBA 5BZBA 1KBHA 2DE0X 4FJCC 5JWPA 2Q7HA 1GAXA 4K0KB 2IJJA 3ZEDA 5B1BC 3QO5A 4X66B 4DR2B 3JALB 1YJWV 4DV3B 1CP9A 2JEUA 1SQGA 4YHHO 5B1BB 2P4VA 4UFZA 4CS3A 3OMIB 2YSUB 1CEZA 2ZE5A 4MVSA 2R9IA 3B77A 2WLKA 5IY5C 3JCZA 1NVPD 4DR4O 1N36B 4DR7B 5IT9N 4FFBB 2VWJA 1COWG 3T4ZA 1GK9A 4RUFA 3OM3B 1KYOF 2IBZH 1VIBA 3K5MA 4IT5A 3CPWU 3S3WA 4H44B 3TK1A 3T1HO 4X64O 3JARA 4X65O 2ZKOA 3CXHF 4XDJA 2YUAA 1WB8A 3AK1A 1YJ9V 4F6RB 2KKWA 1Q90D 3WG7C 2QM8A 2RMKB 1TA8A 3JD1A 4X1KB 3ZCCA 1R3KC 4U3JB 1XNRO 1K92A 4HAMA 1RPRA 1JJ2U 3ABTA 3G6BA 1H2SB 4JTCB 5L3FA 1TVKB 3CB2A 1OCOC 3P3NA 1SESA 3ASOC 4ICGA 1XI1A 5LMUO 2JS5A 4OGQB 2LO1A 4R6ZA 4U3JA 3NR7A 3BEHA 5LP6C 4I4TB 1SQVH 4XDKA 2Y69C 1H2GA 2DOSA 4TSFG 4LP8A 2ZE6A 2LW7A 2L6LA 3ABKC 4DR2O 4FM1A 2Q69A 4I4TA 3K5OA 3OAAG 5J2TB 3ABKB 1VQPV 3RT3C 4XDLA 3W7WA 5LP6A 1THZA 2ZQMA 1NS1A 5KMGB 1LR1A 1PNMA 2YIBA 4DR5O 1N36O 4DR7O 1Z5VA 4KHPB 3GWKC 2PZSA 4X1YB 1B3QA 4MTOA 4XBFA 4EB6A 1KQSU 5FPRA 3H1HH 2UUBB 1XL4A 4K8ZA 2EINB 1SZXA 1XMQB 4IHJB 4X1YA 1O9GA 4NXMO 1S72V 5LYJB 4X8AA 3F7YC 1XOUA 3MDSA 1QBZA 4ZBMA 1UPGA 5DECA 3VQWA 3PJSK 1S76D 3W7XA 1G6UA 3R65A 2CH7B 3ZMZA 4MTFA 3L74H 4X88A 4ZOLB 5KHKA 5EBWC 3CWBH 1VMGA 5LHGA 4JAVA 2CH7A 3M8AA 3CCRV 1Z5WA 3ZHSA 1BQ0A 5TISZ 1F51A 1NTMH 1AJPA 2P67A 4ZOLA 1BL8A 1N33B 3ABLB 4MVRA 2Q7EA 2OT5A 3CC2V 2M7WA 4KUMA 3WU2Z 3A8TA 4WFHA 5L3BA 2OYQA 2EULA 5F2VO 1M90W 2ADQB 2LW1A 3QO8A 3ZRSA 4ZKIA 1SQBH 3SPGA 1AJNA 4JV5B 4LF9O 3CD6V 2B1IA 1JCHA 3C3TA 4J10A 4HBNA 3I56V 2UXCO 2YC0A 1BS3A 2E75B 4I9QA 3L72H 2JDIG 1Z2GA 1SETA 2XUMA 1QQCA 3IFXA 1XMQO 2F93B 3DTUB 2N05A 3WB2A 2D3OW 5FL7G 4ZHQB 1PP9H 3JYCA 1EN6A 4LF7B 4L8JA 4K3AA 4R7CA 1N32B 3ASNC 2GTAA 3S3XA 1OCCC 3IAYA 2JEXA 4ZHQA 3CJHB 2Z3YA 4JI2B 1OCCB 1K4CC 4DV5B 4DR3B 3ZIAG 2WLLB 3FX7A 1JJOA 3BY6A 4PDLA 1Q43A 3JAMN 5B1AB 3OR6C 4LWSB 4YIPA 1N33O 5CA1A 3CS5A 2QSAA 2WLLA 2Q68A 3P30A 4RAIA 1FPOA 3LSSA 1VQ9V 3X2QC 4LC1A 4IGGA 1QLEC 2XAGA 4H33A 1NBMG 2WAMA 4LFAB 2YXHA 3M99B 4NXNB 3CCMV 1YDXA 3JATB 2CAZC 4E2LA 1MZFA 3TXQA 2Q7GA 2W6IG 3IC9A 4G28B 1K5QA 3AK3A 4JV5O 2C2AA 4MW3A 2ZIOA 2W6JG 2UU9B 2A7WA 2NN4A 1AR5A 1WAZA 1J95A 4EEQA 1K9MW 1VQ7V 3LUTB 4NR1A 5B3SC 3AG3B 1XMOO 4DXWA 3OTOB 3HKBB 4JI6B 4WBNA 2B1GA 4U3FH 3JASB 4LF7O 4DW1A 1N32O 2VQFO 1E1QG 1WPXA 1P49A 4CC5A 1M4UA 1YXBA 2UXXA 3ETEA 3HKBA 1PV0A 4JI2O 2RNBA 1PPJH 3ZJZA 2H94A 3RFRA 4DV5O 3JASA 1ZLZA 1I5YA 5IJ0A 5DN6G 4ZI7A 2ATKC 4CZZA 3FFQA 4BR6A 1RM1C 3CC7V 4BIUA 4GX0A 1AI4A 1GTOA 4UCVA 1RM1B 2AW9A 5EC1C 3VOUA 4FPPA 4PI0A 3RYFA 4LFCB 2YEVB 1SQFA 4TUYB 2CUGA 1V55C 5LHIA 2N74A 2HKOA 1V55B 3MHSC 4LFAO 3UM7A 2R9AA 4X20A 1VF6A 2EZOA 2UXDO 2ZXWC 5BXZA 4BW5A 2ZXWB 3FD9A 1GN6A 1VQMV 4WFFA 1AROP 4FK5C 2UU9O 4FLYA 2P6JA 3UT5B 3STZC 2ZNJA 4JI3B 3ZRXA 2XHBA 1YHQV 2O57A 2IJIA 1LUWA 4UB6Z 2JRIA 3UT5A 2XAHA 1EM1A 3OTOO 4ASUG 1W0JG 4JI6O 3EXAA 1YTFB 4MVOA 1N0NA 3BHPA 3UO2A 4BWAA 1BMFG 2WLIA 1S3JA 5EIBD 3IJ4A 2CK3G 1R6KA 4AQYB 1OHHG 3D36C 4GLXA 4GCZA 2H8PC 5LXTB 3OR7C 1BHBA 1MNGA 1RSOB 1BQZA 1YI2V 2K1EA 4OX9B 3CRRA 1CPYA 4PA3A 1N34B 5H9CA 1IXMA 2XAJA 1OJHA 4JZ2A 1WP8A 4Q20A 1XILA 3ZS8C 5LXTA 1Q86W 2DJVA 3D36A 4LR3A 1AILA 4JI7B 4O4LB 2HJDA 2P06A 3RW0A 3K0GA 4LFCO 4WCEV 3TXSA 4RQEA 3HKCB 4GX1A 1U97A 4JI0B 3H1IH 2ILMA 3OMNB 3CE2A 1XQ8A 1T5EA 2HP8A 1L0LH 3B40A 4JF3A 4O2BB 2BE3A 3K57A 1JX9A 1ZX3A 3F7VC 2ZD9A 3D8CA 4O2BA 2V7QG 3B2EE 1K5SA 5KHHA 1VQ5V 3LSUA 4KL1A 4Z1VA 1ZL8B 2NNUA 1IBKO 1O9HA 3DC6A 2ETNA 4MVUA 1YITV 4JYCA 5KUKA 2GHYA 4YHHB 5AG2A 5JQGB 2HFEC 5BY1A 1WA8B 3K06A 3ETGA 4PDVA 4FIPC 5ITZB 4QE9A 3DC5A 1VF7A 3KZIZ 1RPOA 3LDEA 1L8DA 1WA8A 2FYUH 2KB1A 2UUCB 1DLBA 2JGDB 3SPJA 2QKAA 3NXSA 2HVKC 4TOIA 5ITZA 2A79B 4JTDB 4OX9O 1P4RA 4U7NA 2Y0PA 4F4LA 1XHZA 3L70H 1G8MA 1TGOA 1R3JC 1I7FA 3U11A 1VP7A 2P7TC 3OFNG 4X64B 2JGDA 3G71V 3UKMA 1H2NA 2YXYA 3T1YB 2DYRB 4JI7O 5KHJA 3CCVV 4I9WA 4QPKA 3AG4C 3C90A 2PYLA 5JH7B 5CBFA 3F5TA 3RBZA 3AG4B 4LF6O 2LFRA 5LOVA 4N23A 5DEDA 4JI0O 4PJ0Z 2GDSA 3HR0A 3SJCC 1SQXH 5IDJA 1I94B 3HKDA 3SPIA 3OUFA 2WWWA 1Q6IA 2YICA 5L3GA 1PKXA 3J80N 3QO7A 2B5UA 4MS2A 5D5PA 1J5EB 4MVZA 4FLTA 2HLDG 1Q82W 3SJBC 4IIJA 1S5JA 4D7TA 3N2GA 1G4YB 2M6YA 2QA4V 2WLJA 4GZRB 1W0KG 3LDCA 3KCXA 4QIWF 2E3CA 2QWPB 4DR5B 4B3MO 1KP2A 1AR4A 3STLC 2Y4UA 2HJFC 2R9RB 5IY5B 2X6BA 3JAKB 4JAAA 2OIEA 1MOFA 3R66A 2UUCO 3JARB 5FNVA 1IBMB 1QR9A 2ARHA 2DQ0A 3H1LH 4JGSA 1AI7A 3JAKA 5C8YB 4GX5A 1E1RG 3K5NA 4NXMB 2LGQA 1KECA 3T1YO 1HW7A 4BW9A 2Y0IA 4UUJC 5E1AC 2OTLV 4RUEA 3SPCA 3OD4A 2P5OA 5C8YA 4FM0A 4NYKA 3ZMSA 3WG7B 2P22C 4FZ0A 4LH7A 2WLMA 1R3LC 4DV6O 1I94O 5B5EZ 5JJJB 2V1DA 3ETQA 3CP1A 1FXHA 3E35A 1OCOB 3B4SA 3DGEA 3ASOB 1QU7A 4JASA 1YIJV 1QHTA 1XHXA 3RVZA 4JPRA 5LP6B 1J5EO 1BHAA 2Y69B 4BIOA 4HYOA 1K7DA 3K9AA 2ZINA 3E22A 4L87A 3LNMB 3K59A 1HP8A 4RWUA 2ZR2A 2PYJA 2LP7A 1XL6A 4DR1B 1EZJA 4DK1A 4X89A 4EB6B 4JYYA 2E76B 4J41A 4LF9B 2GSMB 4TQDA 2AZ2A 2UXCB 2QWQB 4C7UA 1B04A 4WF9V 4CH4A 1NH2B 5CA0B 1XNQB 1HR0O 1N4CA 1GO3F 2BTOA 2IH3C 1IBMO 1F23A 3K04A 2QWNB 4LNUA 4GKKB 5LGUA 3OMAB 2WSSG 1KC8W 2XASA 5CA0A 1NKDA 2IU3A 4FMTA 1B6QA 4B7EA 2F1MA 4IYIA 3UO3A 3JD0A 1SF9A 2UXBB 2CGOA 2Q0AA 5EC2C 4WFBV 5HFLA 3SYOA 4FLXA 1GM8A 4TWKA 4UV9A 2PF4E 1R73A 4H0LB 5KX5A 3RN4A 2RN9A 1FD9A 1SKVA 1URFA 4DR1O 4PHZA 1KU9A 5EYPB 2HEPA 3ZN0A 5GW7A 3A0BZ 2AZ0A 3D3QA 2Q9LA 1VF5B 3SPHA 4LF4B 4PA9A 3L75H 1NR1A 5EYPA 3JSNA 1H8HG 2AGAA 2XOKG 4DV1O 1XNQO 5LA6B 1K33A 1SRYA 1M5IA 1JVMA 3K58A 1XMOB 4GKKO 4D6TH 4U7OA 4QE7A 2QWRB 4TV9B 5HFMA 5LA6A 2A9HA 3EVKA 2GV9A 2A06H 3JD4A 2VQFB 1ZTEA 5L3CA 4P9OA 4TV9A 3ASNB 1EFRG 1WLEA 1YZBA 2W0FC 2UXBO 5CA1B 4BAYA 3APQA 2JJ1G 2DN9A 1AI6A 2Q73A 3P32A 4PD4F 4FLUA 4Q6GA 2OTJV 3E8FA 5H2FZ 4R50A 2Y4TA 3VQXA 5KA6A 2YI8A 4WFGA 1FFXA 4LF8B 1GKFA 1RP3B 4G27B 5J9PC 3BABA 1AI5A 1KKDA 5EK0A 1Q3EA 3X2QB 4FZ1A 1QLEB 4R8CA 1SC5B 2VQEO 2UXDB 2BTQB 4WFEA 3OEHG 1NI8A 1VEWA 1AVMA 2ITDC 1Q7YW 1S5HC 3UQ8A 4Z1MG 2BTQA 3JSLA 4LF4O 4WFAV 2XAFA 4LH6A 1KD1W 1A32A 1NTKH 4P2ZA 4PDRA 4WBNB 3T1CA 5CA3A 4YJ3A 3AG1C 4D7SA 3ZMUA 4GX2A 1YSCA 2EIJC 2Q6AA 1P84F 3E8HA 5LBQA 3SYQA 5B3SB 3W7SA 2CTRA 4GKJB 4AILC 3CMEV 3VQYA 4LF5O 5IJ0B 3A2FA 4ZI7B 1MG1A 2P90A 3DSQA 3RVYA 2BSKB 3KCYA 4OPHA 5KHGA 1BSMA 1ZAUA 4FLWA 1NJIW 1ZSPA 3CCJV 1QLNA 3FAVB 3RYFB 2BSKA 2IU0A 4P9PA 3BCCH 5DM6V 5IJ9A 3OGIB 1KMIZ 4E4EA 1Q81W 1PL0A 1VQ8V 1Q6HA 2GBOA 1PL4A 1D2DA 3TETA 3FAVA 1ZWIC 4JAUA 2H3OA 4X20B 5KUMA 4LF8O 3CRAA 4YXWG 3J7AU 4HZ3A 3QNEA 1SZTA 2LFSA 4UB8Z 4MVMA 2N04A 5H5NA 3WFVA 4KXRA 4QGPA 3ZRWB 1ENVA 4G2KA 1JR9A 1YCIA 4DV2O 3W7TA 1VARA 4OXSA 2IJKA 4W4KA 4J7JA 2ZDIC 1GN2A 4PV1B 1FXKC 2JK5C 3SR2C 3ZRWA 1IBKB 1GN3A 2WLIB 4B3RB 4UCUA 5JJNB 2YDEA 2EIKC 2F23A 4EKWA 4GKJO 5IWAB 2Q67A 4TQFA 2XTAA 2OWOA 3KG2A 4Z2WA 5JJEB 4HNAB 3E86A 2ZDIA 3OW2U 2VS0A 2F4VB 2DQ3A 3T2MA 2AHYA 5IYZB 2HVJC 1VQ6V 4A5UB 2IM9A 1DF5A 5IE9A 4NB5A 4HNAA 1JOYA 2DWDC 2QWOB 1R6TA 3OE7G 5IYZA 3G4SV 2QKSA 3G80A 5LMNO 1VQLV 1FS0G 1HNWB 1FJGB 1I5XA 3CRQA 1VQ4V 1K34A 3K0DA 4X62B 1WP7A 4I55A 1Y67A 3OTFA 1DK1A 3L73H 4LF6B 4FVMA 3CCLV 1SERA 1FFTB 3SYPA 5FPOA 4TT3G 1WN7A 4PI2A 1XUQA 3WB1A 3OT7A 1XEQA 2EILC 2FL4A 3E8GA 3H9VA 3L9DA 4MVQA 2FMLA 1K97A 1PNKA 3D3IA 4MTGA 1OCZC 3N27A 1U96A 3AG7A 1GN4A 1L0NH 2AHZA 5IYBO 3TCUA 3IGAC 3ZHTA 1QVGU 3ABMC 2F66C 4DUZB 1FXVA 3TJTA 2HR3A 4B3RO 5EIBC 3ABMB 4EFBA 3U10A 4JI5O 5IWAO 3FKSG 2A0LA 2E5LB 3FB8C 4N21A 1Y6XA 2EIMC 3A0HZ 1V54C 2X7RB 1BGYH 4B3MB 3CMAV 3CCUV 1V54B 2F4VO 1S77D 4UCRA 1D5AA 1YVWA 5IYCO 1E79G 2OCCC 1N8RW 4KFMA 2AXTZ 2MK3A 1IZ3A 3MHHC 3HPLC 2WLHA 2OCCB 2ODMA 2ZIMA 1SA0A 4IL6Z 2QR4A 3TGUH 5BMVA 2ZM6B 1HNWO 4JI4B 3CEIA 5LOVB 4J7ZA 1FJGO 1M56C 2R70A 4X62O 1M56B 3HKDB 3GWOA 1RFYA 3ICXA 2Z0AA 3ML0A 1IBLO 4CS4A 4B3SB 4JI1O 4ABMA 1Y66A 3DXRB 2Q5ZA 3ZN1A 3E89A 4DV6B 3B09A 5B1OA 1UFIA 4IIJB 3N2GB 1Y76A 3DXRA 2FKXA 2CTQA 2EJ7A 4O2AA 3BVOA 1NU1H 3CCEV 5A9GA 4OPAA 5L3DA 1SQPH 3G6EV 1F4MA 1EN5A 3MAQA 4DUZO 1M57C 1IXBA 3OGCC 2Q4PA 4J7KA 4UXNA 2UUAO 4DUYB 1OZ0A 1S5LZ 2E5LO 4NTWA 5KA5A 2WA4A 3FB7C 1MSWD 5FNVB 2YXLA 3AK2A 3M7MX 1KB9F 1MSDA 4DV7B 2RCVA 4I0XB 1HR0B 3ZX6A 3BFRA 2YIBD 1Q8IA 3VBBA 1JPXA 1WB7A 2YS8A 4DRXB 3LDDA 3JALA 1VQKV 1M93A 1DTOA 4FFKA 4I0XA 2ZM6O 4JI4O 3SYAA 4I7ZB 4PDMA 3U0ZA 2DW4A 1P7BA 1US6A 1X4TA 4DRXA 1ROPA 4JZGA 4FFBA 1AB3A 4F6EA 3CHXA 1NH2D 1TUEB 2OCHA 5D5QA 4B3SO 4O4IB 2IJHA 3ZMVA 1W2BU 1H2KA 4CC6A 3OUSA 4UVAA 3HB3B 4JI8B 4GYCB 3FB5C 2WPDG 5CBGA 4O4IA 3BA9A 5BR8B 2ZCEA 3E22B 2QE7G 3RGBA 2FB5A 4NVPA 4CH5A 1MA1A 4F6RA 3N2KB 3SJQC 1NTZH 5KAIZ 1AR1B 1R3IC 4X1KA 2RDCA 5CMUA 5KAFZ 1N0JA 3F5WC 1H2MA 3FYEB 5J2UB 1NVPB 3ZHVA 1LUVA 1KKCA 4DUYO 3O65A 3N2KA 4PELA 1TVKA 2X6CA 2RJZA 5EBMC 3H1KH 3P3PA 4K0KO 5C93A 4LNUB 1TUBB 5J2UA 5GTHZ 2KQXA 4X66O 3JD2A 1XDCA 2YIAA 4DV3O 4DV1B 4DV7O 1HNXB 1LNQA 1TUBA 4X9QA 2Q0OC 2CGNA 5LL6Y 5J2TA 1Y4MA 2BOCC 1HDJA 3CYOA 2EINC 5KMGA 1R6NA 3Q4HB 4H37A 2CTPA 3RWRD 3E8BA 4DO2A 5EBLC 4RO2A 4UCTA 4O4HB 2XAQA 3ZRVA 3IC7A 1EZVH 2P4KA 3Q4HA 1I08A 1PD3A 1GM9A 1R1BA 3K9SA 4JI8O 4O4HA 1IURA 2JGUA 4IHJA 2MW2B 1WPBA 5BR8O 1MZEA 5LYJA 3SDLA 5KX5B 1K8AW 3CSXA 4TV8B 4DV4B 3CRMA 2JJ2G 2ZT9B 4PA7A 1WJZA 4JYAB 4DK0A 2OIGA 4MSWC 4X1IB 2F95B 3ABLC 2HHHB 2ZR3A 3RYHB 4TV8A 2VQEB 5L3EA 2DMXA 1YF2A 1EN4A 5B1NA 2X6AA 1EBOA 4X1IA 4B3TB 4YJ2B 3UCSC 1WNSA 1MMMA 2LJ2A 4AI8A 1YJNV 3RYHA 1GM7A 1HWYA 2VWKA 3CCQV 4DR6B 2NR5A 5A2QN 4DYLA 1IX9A 3C3SA 4YJ2A 1QVFU 2KSDA 1HNXO 1B06A
chains in the Genus database with same CATH topology
3R66A 2UUCO 5BY1A 1XEQA 4DUZO 4LF8O 4K0KO 1XNRO 3J7AU 5FLXN 4LFBO 4X66O 1HNZO 4DV3O 2UUAO 4DV7O 4KHPO 2E5LO 2JRIA 4JV5O 2UUBO 3T1YO 5H5NA 5LMUO 3OTOO 4JI6O 4OX9O 3J81N 5LL6Y 4B3RO 2DOSA 4JI5O 5IWAO 1XMOO 2LW7A 4DV2O 4DR3O 2VQEO 4LF9O 4DR2O 4JI7O 2UXCO 4DV6O 1I94O 2F4VO 3RT3C 4LF7O 1N32O 2VQFO 2ZM6O 4JI4O 3F5TA 1NS1A 4GKJO 4DV4O 4LF4O 4LF6O 1FYJA 1F7YA 1A32A 4DR5O 1R1BA 2DJVA 1N36O 1XMQO 4DR1O 4JI0O 4JI2O 4JI8O 4DR7O 4JYAO 1AILA 4DV5O 2HHHO 5BR8O 1J5EO 4LFCO 4YHHO 1AB3A 3SDLA 4B3SO 4NXNO 1HNWO 4JI3O 1FJGO 4A5UB 4B3TO 4LF5O 4DR4O 2AGAA 4DV1O 4X62O 3J80N 5IT9N 1XNQO 4NXMO 2Z0AA 4DR6O 1R6TA 1IBLO 4GKKO 4JI1O 5LMNO 1X59A 4OPHA 2N74A 3JAMN 4LFAO 3T1HO 1N33O 1DK1A 1HR0O 4X64O 1FKAO 1KUQA 4AQYO 1G1XB 1IBMO 4X65O 2UXDO 2ZKOA 2FKXA 5A2QN 5BXZA 4DV0O 4YY3O 4B3MO 3M8AA 4DUYO 1IBKO 1D2DA 1YZBA 1HNXO 3O65A 4OPAA 2UXBO 1N34O 2UU9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R66 A;  2UUC O;  5BY1 A;  1XEQ A;  4DUZ O;  4LF8 O;  4K0K O;  1XNR O;  3J7A U;  5FLX N;  4LFB O;  4X66 O;  1HNZ O;  4DV3 O;  2UUA O;  4DV7 O;  4KHP O;  2E5L O;  2JRI A;  4JV5 O;  2UUB O;  3T1Y O;  5H5N A;  5LMU O;  3OTO O;  4JI6 O;  4OX9 O;  3J81 N;  5LL6 Y;  4B3R O;  2DOS A;  4JI5 O;  5IWA O;  1XMO O;  2LW7 A;  4DV2 O;  4DR3 O;  2VQE O;  4LF9 O;  4DR2 O;  4JI7 O;  2UXC O;  4DV6 O;  1I94 O;  2F4V O;  3RT3 C;  4LF7 O;  1N32 O;  2VQF O;  2ZM6 O;  4JI4 O;  3F5T A;  1NS1 A;  4GKJ O;  4DV4 O;  4LF4 O;  4LF6 O;  1FYJ A;  1F7Y A;  1A32 A;  4DR5 O;  1R1B A;  2DJV A;  1N36 O;  1XMQ O;  4DR1 O;  4JI0 O;  4JI2 O;  4JI8 O;  4DR7 O;  4JYA O;  1AIL A;  4DV5 O;  2HHH O;  5BR8 O;  1J5E O;  4LFC O;  4YHH O;  1AB3 A;  3SDL A;  4B3S O;  4NXN O;  1HNW O;  4JI3 O;  1FJG O;  4A5U B;  4B3T O;  4LF5 O;  4DR4 O;  2AGA A;  4DV1 O;  4X62 O;  3J80 N;  5IT9 N;  1XNQ O;  4NXM O;  2Z0A A;  4DR6 O;  1R6T A;  1IBL O;  4GKK O;  4JI1 O;  5LMN O;  1X59 A;  4OPH A;  2N74 A;  3JAM N;  4LFA O;  3T1H O;  1N33 O;  1DK1 A;  1HR0 O;  4X64 O;  1FKA O;  1KUQ A;  4AQY O;  1G1X B;  1IBM O;  4X65 O;  2UXD O;  2ZKO A;  2FKX A;  5A2Q N;  5BXZ A;  4DV0 O;  4YY3 O;  4B3M O;  3M8A A;  4DUY O;  1IBK O;  1D2D A;  1YZB A;  1HNX O;  3O65 A;  4OPA A;  2UXB O;  1N34 O;  2UU9 O; 
#chains in the Genus database with same CATH topology
 4J9Z B;  3HKE B;  1DF4 A;  2QKC A;  4EFE A;  4LCU C;  2NLJ C;  5E79 Z;  1VQO V;  3CC4 V;  1BE3 H;  4KP4 A;  1GMG A;  1XBL A;  3WB0 A;  4LF5 B;  1QNM A;  4DV0 B;  4KHP O;  1F4N A;  3HKE A;  4GT1 A;  2UUB O;  1V9P A;  2LGW A;  4NTX A;  4P30 A;  2QEX V;  3BAA A;  4LFB B;  5CN0 A;  1HNZ B;  1H8E G;  4K8X A;  2BCC H;  3RYI B;  3CCS V;  3I5D A;  4B7K A;  3K5L A;  3QG5 A;  4IYH A;  1FFX B;  1AP6 A;  1CXZ B;  5GON B;  3APO A;  2JVD A;  2PTM A;  1BZK A;  3PN1 A;  3RYI A;  1H38 A;  3E2E A;  1BT8 A;  1D5N A;  3SJA C;  4DV4 O;  1K3E A;  1FYJ A;  4NTY A;  1F7Y A;  5GON A;  3K08 A;  4K35 A;  4W4L A;  5B1A C;  4JYA O;  3GB7 C;  3CJH A;  3JAW B;  3QF7 A;  2HHH O;  2HG5 C;  3B8M A;  2ADP A;  2QTO A;  3BPZ A;  4MW8 A;  1PNL A;  5LGT A;  2PUS A;  3K79 A;  4B3T O;  3JAW A;  5EZY B;  4YJ3 B;  1BCC H;  2CTW A;  4LWS A;  1OV9 A;  4DR6 O;  2WA3 A;  3L71 H;  3LSQ A;  4DV2 B;  5EZY A;  1UJW B;  3ZBH A;  2QM4 A;  2PGG A;  3BRC A;  2D2C B;  3JCU Z;  3AG1 B;  2EX3 A;  1G1X B;  4RQF A;  3JAT A;  3GVM A;  5K1X A;  2EIJ B;  2FTK A;  3EHB B;  4DV0 O;  2A3Q A;  2ITC C;  4AHC A;  1S0V A;  1QR8 A;  3H1J H;  4J80 A;  3AG3 C;  2ZNI A;  1SQQ H;  5IJ9 B;  4UCS A;  1Q5O A;  4BIZ A;  3OEE G;  2W0X A;  5FLX N;  4LFB O;  2PI4 A;  1HNZ O;  2WLN A;  3THO A;  5KHI A;  2R72 A;  3QVN A;  3T4D A;  5LMN B;  1YTF D;  1W59 A;  4J9Y B;  1P7G A;  5CBH A;  1NT2 B;  4DR3 O;  1M9N A;  3I55 V;  1MAB G;  4I5S A;  4DW0 A;  1JMK C;  2Y48 A;  4O4J B;  2BOB C;  3VQV A;  1AP5 A;  1VF6 C;  5JVD B;  1JQ0 A;  2DWE C;  3FB6 C;  2LQT A;  2IW5 A;  4H13 B;  4UVC A;  4NKG B;  4FLV A;  4O4J A;  5KLV H;  5JVD A;  4NXN O;  3AEI A;  4B08 A;  2YEV A;  4QJF B;  3QTC A;  4TUY A;  1Q6U A;  1IVS A;  1FAF A;  3EFF K;  1FXK B;  1H2L A;  1GH6 A;  4JI5 B;  3A0R A;  2EIK B;  4UV8 A;  1M1K W;  2GTS A;  4QPJ A;  4QNH B;  1FXK A;  2G38 A;  2KG7 B;  5GTI Z;  2CDY A;  4J11 A;  3H01 A;  1JA8 A;  2CE4 A;  5CB4 B;  1NR7 A;  4MTX A;  4LBE C;  3ZMT A;  2VRZ A;  4I50 B;  2RQ6 A;  3ETD A;  2B9Z A;  2KG7 A;  1XRE A;  4I55 B;  5CB4 A;  1I0H A;  1VQN V;  4CH6 A;  3CRC A;  4I50 A;  4JYB A;  4UVB A;  5H6R A;  4UCO A;  5B66 Z;  4YY3 B;  2L35 A;  3ABU A;  2ZE7 A;  1L1F A;  1ORQ C;  1IBL B;  4FM2 A;  3ZHU A;  4JI1 B;  1RSO A;  3SYC A;  1YEW A;  4YIO A;  3RYC B;  1OCR C;  4GUN A;  2PY5 A;  3AG2 C;  5H6Q A;  1OCR B;  3W7U A;  2EIL B;  2YID A;  4O4L A;  3AG2 B;  2XND G;  3RYC A;  4MT8 A;  1OCZ B;  4PA4 A;  1IDS A;  3HKC A;  3ZHQ A;  3BA8 A;  2IH1 C;  1ZUQ A;  2UUA B;  3SGI A;  1GRJ A;  1K73 W;  5IYD O;  1K4D C;  1Y74 B;  2JIZ G;  2EZP A;  2X0L A;  2Z5U A;  4JI3 O;  3B8N A;  1TAE A;  2EIM B;  5K1P A;  2PI5 A;  5LHH A;  2EJR A;  1JFF B;  2QTS A;  3G67 A;  1SA0 B;  1Y74 A;  5BMV B;  1AJQ A;  3MD0 A;  4CBC A;  1X59 A;  3FYI B;  2GUZ B;  2QM7 A;  1ZL8 A;  1JFF A;  2JS3 A;  4PA6 A;  5JCO C;  3CX5 F;  4DR4 B;  3K3W A;  4CH3 A;  2QDO A;  5JQG A;  2QGN A;  1FKA O;  1KUQ A;  4AQY O;  2UXN A;  4FLZ A;  2ZE8 A;  4JTA B;  2GUZ A;  5LGN A;  1DGS A;  2V4D A;  2YI9 A;  4YY3 O;  1NZ6 A;  3K03 A;  1N34 O;  3KKY A;  2F43 G;  2DYR C;  5JCO A;  3T1H B;  2XT9 A;  1Y76 B;  3LNN A;  4O2A B;  3ZHR A;  4X65 B;  2EBO A;  3CXC U;  1PM9 A;  2K9P A;  4J42 A;  2Q8V A;  4CS2 A;  3O9O A;  1QCE A;  3J81 N;  1XNR B;  1KP3 A;  2DYS C;  3JD3 A;  5JH7 A;  2DYS B;  3E83 A;  1NQT A;  2QJ1 A;  5LMU B;  1M57 B;  1SS3 A;  2E74 B;  4ZIB A;  5BZB A;  1KBH A;  2DE0 X;  4FJC C;  5JWP A;  2Q7H A;  1GAX A;  4K0K B;  2IJJ A;  3ZED A;  5B1B C;  3QO5 A;  4X66 B;  4DR2 B;  3JAL B;  1YJW V;  4DV3 B;  1CP9 A;  2JEU A;  1SQG A;  4YHH O;  5B1B B;  2P4V A;  4UFZ A;  4CS3 A;  3OMI B;  2YSU B;  1CEZ A;  2ZE5 A;  4MVS A;  2R9I A;  3B77 A;  2WLK A;  5IY5 C;  3JCZ A;  1NVP D;  4DR4 O;  1N36 B;  4DR7 B;  5IT9 N;  4FFB B;  2VWJ A;  1COW G;  3T4Z A;  1GK9 A;  4RUF A;  3OM3 B;  1KYO F;  2IBZ H;  1VIB A;  3K5M A;  4IT5 A;  3CPW U;  3S3W A;  4H44 B;  3TK1 A;  3T1H O;  4X64 O;  3JAR A;  4X65 O;  2ZKO A;  3CXH F;  4XDJ A;  2YUA A;  1WB8 A;  3AK1 A;  1YJ9 V;  4F6R B;  2KKW A;  1Q90 D;  3WG7 C;  2QM8 A;  2RMK B;  1TA8 A;  3JD1 A;  4X1K B;  3ZCC A;  1R3K C;  4U3J B;  1XNR O;  1K92 A;  4HAM A;  1RPR A;  1JJ2 U;  3ABT A;  3G6B A;  1H2S B;  4JTC B;  5L3F A;  1TVK B;  3CB2 A;  1OCO C;  3P3N A;  1SES A;  3ASO C;  4ICG A;  1XI1 A;  5LMU O;  2JS5 A;  4OGQ B;  2LO1 A;  4R6Z A;  4U3J A;  3NR7 A;  3BEH A;  5LP6 C;  4I4T B;  1SQV H;  4XDK A;  2Y69 C;  1H2G A;  2DOS A;  4TSF G;  4LP8 A;  2ZE6 A;  2LW7 A;  2L6L A;  3ABK C;  4DR2 O;  4FM1 A;  2Q69 A;  4I4T A;  3K5O A;  3OAA G;  5J2T B;  3ABK B;  1VQP V;  3RT3 C;  4XDL A;  3W7W A;  5LP6 A;  1THZ A;  2ZQM A;  1NS1 A;  5KMG B;  1LR1 A;  1PNM A;  2YIB A;  4DR5 O;  1N36 O;  4DR7 O;  1Z5V A;  4KHP B;  3GWK C;  2PZS A;  4X1Y B;  1B3Q A;  4MTO A;  4XBF A;  4EB6 A;  1KQS U;  5FPR A;  3H1H H;  2UUB B;  1XL4 A;  4K8Z A;  2EIN B;  1SZX A;  1XMQ B;  4IHJ B;  4X1Y A;  1O9G A;  4NXM O;  1S72 V;  5LYJ B;  4X8A A;  3F7Y C;  1XOU A;  3MDS A;  1QBZ A;  4ZBM A;  1UPG A;  5DEC A;  3VQW A;  3PJS K;  1S76 D;  3W7X A;  1G6U A;  3R65 A;  2CH7 B;  3ZMZ A;  4MTF A;  3L74 H;  4X88 A;  4ZOL B;  5KHK A;  5EBW C;  3CWB H;  1VMG A;  5LHG A;  4JAV A;  2CH7 A;  3M8A A;  3CCR V;  1Z5W A;  3ZHS A;  1BQ0 A;  5TIS Z;  1F51 A;  1NTM H;  1AJP A;  2P67 A;  4ZOL A;  1BL8 A;  1N33 B;  3ABL B;  4MVR A;  2Q7E A;  2OT5 A;  3CC2 V;  2M7W A;  4KUM A;  3WU2 Z;  3A8T A;  4WFH A;  5L3B A;  2OYQ A;  2EUL A;  5F2V O;  1M90 W;  2ADQ B;  2LW1 A;  3QO8 A;  3ZRS A;  4ZKI A;  1SQB H;  3SPG A;  1AJN A;  4JV5 B;  4LF9 O;  3CD6 V;  2B1I A;  1JCH A;  3C3T A;  4J10 A;  4HBN A;  3I56 V;  2UXC O;  2YC0 A;  1BS3 A;  2E75 B;  4I9Q A;  3L72 H;  2JDI G;  1Z2G A;  1SET A;  2XUM A;  1QQC A;  3IFX A;  1XMQ O;  2F93 B;  3DTU B;  2N05 A;  3WB2 A;  2D3O W;  5FL7 G;  4ZHQ B;  1PP9 H;  3JYC A;  1EN6 A;  4LF7 B;  4L8J A;  4K3A A;  4R7C A;  1N32 B;  3ASN C;  2GTA A;  3S3X A;  1OCC C;  3IAY A;  2JEX A;  4ZHQ A;  3CJH B;  2Z3Y A;  4JI2 B;  1OCC B;  1K4C C;  4DV5 B;  4DR3 B;  3ZIA G;  2WLL B;  3FX7 A;  1JJO A;  3BY6 A;  4PDL A;  1Q43 A;  3JAM N;  5B1A B;  3OR6 C;  4LWS B;  4YIP A;  1N33 O;  5CA1 A;  3CS5 A;  2QSA A;  2WLL A;  2Q68 A;  3P30 A;  4RAI A;  1FPO A;  3LSS A;  1VQ9 V;  3X2Q C;  4LC1 A;  4IGG A;  1QLE C;  2XAG A;  4H33 A;  1NBM G;  2WAM A;  4LFA B;  2YXH A;  3M99 B;  4NXN B;  3CCM V;  1YDX A;  3JAT B;  2CAZ C;  4E2L A;  1MZF A;  3TXQ A;  2Q7G A;  2W6I G;  3IC9 A;  4G28 B;  1K5Q A;  3AK3 A;  4JV5 O;  2C2A A;  4MW3 A;  2ZIO A;  2W6J G;  2UU9 B;  2A7W A;  2NN4 A;  1AR5 A;  1WAZ A;  1J95 A;  4EEQ A;  1K9M W;  1VQ7 V;  3LUT B;  4NR1 A;  5B3S C;  3AG3 B;  1XMO O;  4DXW A;  3OTO B;  3HKB B;  4JI6 B;  4WBN A;  2B1G A;  4U3F H;  3JAS B;  4LF7 O;  4DW1 A;  1N32 O;  2VQF O;  1E1Q G;  1WPX A;  1P49 A;  4CC5 A;  1M4U A;  1YXB A;  2UXX A;  3ETE A;  3HKB A;  1PV0 A;  4JI2 O;  2RNB A;  1PPJ H;  3ZJZ A;  2H94 A;  3RFR A;  4DV5 O;  3JAS A;  1ZLZ A;  1I5Y A;  5IJ0 A;  5DN6 G;  4ZI7 A;  2ATK C;  4CZZ A;  3FFQ A;  4BR6 A;  1RM1 C;  3CC7 V;  4BIU A;  4GX0 A;  1AI4 A;  1GTO A;  4UCV A;  1RM1 B;  2AW9 A;  5EC1 C;  3VOU A;  4FPP A;  4PI0 A;  3RYF A;  4LFC B;  2YEV B;  1SQF A;  4TUY B;  2CUG A;  1V55 C;  5LHI A;  2N74 A;  2HKO A;  1V55 B;  3MHS C;  4LFA O;  3UM7 A;  2R9A A;  4X20 A;  1VF6 A;  2EZO A;  2UXD O;  2ZXW C;  5BXZ A;  4BW5 A;  2ZXW B;  3FD9 A;  1GN6 A;  1VQM V;  4WFF A;  1ARO P;  4FK5 C;  2UU9 O;  4FLY A;  2P6J A;  3UT5 B;  3STZ C;  2ZNJ A;  4JI3 B;  3ZRX A;  2XHB A;  1YHQ V;  2O57 A;  2IJI A;  1LUW A;  4UB6 Z;  2JRI A;  3UT5 A;  2XAH A;  1EM1 A;  3OTO O;  4ASU G;  1W0J G;  4JI6 O;  3EXA A;  1YTF B;  4MVO A;  1N0N A;  3BHP A;  3UO2 A;  4BWA A;  1BMF G;  2WLI A;  1S3J A;  5EIB D;  3IJ4 A;  2CK3 G;  1R6K A;  4AQY B;  1OHH G;  3D36 C;  4GLX A;  4GCZ A;  2H8P C;  5LXT B;  3OR7 C;  1BHB A;  1MNG A;  1RSO B;  1BQZ A;  1YI2 V;  2K1E A;  4OX9 B;  3CRR A;  1CPY A;  4PA3 A;  1N34 B;  5H9C A;  1IXM A;  2XAJ A;  1OJH A;  4JZ2 A;  1WP8 A;  4Q20 A;  1XIL A;  3ZS8 C;  5LXT A;  1Q86 W;  2DJV A;  3D36 A;  4LR3 A;  1AIL A;  4JI7 B;  4O4L B;  2HJD A;  2P06 A;  3RW0 A;  3K0G A;  4LFC O;  4WCE V;  3TXS A;  4RQE A;  3HKC B;  4GX1 A;  1U97 A;  4JI0 B;  3H1I H;  2ILM A;  3OMN B;  3CE2 A;  1XQ8 A;  1T5E A;  2HP8 A;  1L0L H;  3B40 A;  4JF3 A;  4O2B B;  2BE3 A;  3K57 A;  1JX9 A;  1ZX3 A;  3F7V C;  2ZD9 A;  3D8C A;  4O2B A;  2V7Q G;  3B2E E;  1K5S A;  5KHH A;  1VQ5 V;  3LSU A;  4KL1 A;  4Z1V A;  1ZL8 B;  2NNU A;  1IBK O;  1O9H A;  3DC6 A;  2ETN A;  4MVU A;  1YIT V;  4JYC A;  5KUK A;  2GHY A;  4YHH B;  5AG2 A;  5JQG B;  2HFE C;  5BY1 A;  1WA8 B;  3K06 A;  3ETG A;  4PDV A;  4FIP C;  5ITZ B;  4QE9 A;  3DC5 A;  1VF7 A;  3KZI Z;  1RPO A;  3LDE A;  1L8D A;  1WA8 A;  2FYU H;  2KB1 A;  2UUC B;  1DLB A;  2JGD B;  3SPJ A;  2QKA A;  3NXS A;  2HVK C;  4TOI A;  5ITZ A;  2A79 B;  4JTD B;  4OX9 O;  1P4R A;  4U7N A;  2Y0P A;  4F4L A;  1XHZ A;  3L70 H;  1G8M A;  1TGO A;  1R3J C;  1I7F A;  3U11 A;  1VP7 A;  2P7T C;  3OFN G;  4X64 B;  2JGD A;  3G71 V;  3UKM A;  1H2N A;  2YXY A;  3T1Y B;  2DYR B;  4JI7 O;  5KHJ A;  3CCV V;  4I9W A;  4QPK A;  3AG4 C;  3C90 A;  2PYL A;  5JH7 B;  5CBF A;  3F5T A;  3RBZ A;  3AG4 B;  4LF6 O;  2LFR A;  5LOV A;  4N23 A;  5DED A;  4JI0 O;  4PJ0 Z;  2GDS A;  3HR0 A;  3SJC C;  1SQX H;  5IDJ A;  1I94 B;  3HKD A;  3SPI A;  3OUF A;  2WWW A;  1Q6I A;  2YIC A;  5L3G A;  1PKX A;  3J80 N;  3QO7 A;  2B5U A;  4MS2 A;  5D5P A;  1J5E B;  4MVZ A;  4FLT A;  2HLD G;  1Q82 W;  3SJB C;  4IIJ A;  1S5J A;  4D7T A;  3N2G A;  1G4Y B;  2M6Y A;  2QA4 V;  2WLJ A;  4GZR B;  1W0K G;  3LDC A;  3KCX A;  4QIW F;  2E3C A;  2QWP B;  4DR5 B;  4B3M O;  1KP2 A;  1AR4 A;  3STL C;  2Y4U A;  2HJF C;  2R9R B;  5IY5 B;  2X6B A;  3JAK B;  4JAA A;  2OIE A;  1MOF A;  3R66 A;  2UUC O;  3JAR B;  5FNV A;  1IBM B;  1QR9 A;  2ARH A;  2DQ0 A;  3H1L H;  4JGS A;  1AI7 A;  3JAK A;  5C8Y B;  4GX5 A;  1E1R G;  3K5N A;  4NXM B;  2LGQ A;  1KEC A;  3T1Y O;  1HW7 A;  4BW9 A;  2Y0I A;  4UUJ C;  5E1A C;  2OTL V;  4RUE A;  3SPC A;  3OD4 A;  2P5O A;  5C8Y A;  4FM0 A;  4NYK A;  3ZMS A;  3WG7 B;  2P22 C;  4FZ0 A;  4LH7 A;  2WLM A;  1R3L C;  4DV6 O;  1I94 O;  5B5E Z;  5JJJ B;  2V1D A;  3ETQ A;  3CP1 A;  1FXH A;  3E35 A;  1OCO B;  3B4S A;  3DGE A;  3ASO B;  1QU7 A;  4JAS A;  1YIJ V;  1QHT A;  1XHX A;  3RVZ A;  4JPR A;  5LP6 B;  1J5E O;  1BHA A;  2Y69 B;  4BIO A;  4HYO A;  1K7D A;  3K9A A;  2ZIN A;  3E22 A;  4L87 A;  3LNM B;  3K59 A;  1HP8 A;  4RWU A;  2ZR2 A;  2PYJ A;  2LP7 A;  1XL6 A;  4DR1 B;  1EZJ A;  4DK1 A;  4X89 A;  4EB6 B;  4JYY A;  2E76 B;  4J41 A;  4LF9 B;  2GSM B;  4TQD A;  2AZ2 A;  2UXC B;  2QWQ B;  4C7U A;  1B04 A;  4WF9 V;  4CH4 A;  1NH2 B;  5CA0 B;  1XNQ B;  1HR0 O;  1N4C A;  1GO3 F;  2BTO A;  2IH3 C;  1IBM O;  1F23 A;  3K04 A;  2QWN B;  4LNU A;  4GKK B;  5LGU A;  3OMA B;  2WSS G;  1KC8 W;  2XAS A;  5CA0 A;  1NKD A;  2IU3 A;  4FMT A;  1B6Q A;  4B7E A;  2F1M A;  4IYI A;  3UO3 A;  3JD0 A;  1SF9 A;  2UXB B;  2CGO A;  2Q0A A;  5EC2 C;  4WFB V;  5HFL A;  3SYO A;  4FLX A;  1GM8 A;  4TWK A;  4UV9 A;  2PF4 E;  1R73 A;  4H0L B;  5KX5 A;  3RN4 A;  2RN9 A;  1FD9 A;  1SKV A;  1URF A;  4DR1 O;  4PHZ A;  1KU9 A;  5EYP B;  2HEP A;  3ZN0 A;  5GW7 A;  3A0B Z;  2AZ0 A;  3D3Q A;  2Q9L A;  1VF5 B;  3SPH A;  4LF4 B;  4PA9 A;  3L75 H;  1NR1 A;  5EYP A;  3JSN A;  1H8H G;  2AGA A;  2XOK G;  4DV1 O;  1XNQ O;  5LA6 B;  1K33 A;  1SRY A;  1M5I A;  1JVM A;  3K58 A;  1XMO B;  4GKK O;  4D6T H;  4U7O A;  4QE7 A;  2QWR B;  4TV9 B;  5HFM A;  5LA6 A;  2A9H A;  3EVK A;  2GV9 A;  2A06 H;  3JD4 A;  2VQF B;  1ZTE A;  5L3C A;  4P9O A;  4TV9 A;  3ASN B;  1EFR G;  1WLE A;  1YZB A;  2W0F C;  2UXB O;  5CA1 B;  4BAY A;  3APQ A;  2JJ1 G;  2DN9 A;  1AI6 A;  2Q73 A;  3P32 A;  4PD4 F;  4FLU A;  4Q6G A;  2OTJ V;  3E8F A;  5H2F Z;  4R50 A;  2Y4T A;  3VQX A;  5KA6 A;  2YI8 A;  4WFG A;  1FFX A;  4LF8 B;  1GKF A;  1RP3 B;  4G27 B;  5J9P C;  3BAB A;  1AI5 A;  1KKD A;  5EK0 A;  1Q3E A;  3X2Q B;  4FZ1 A;  1QLE B;  4R8C A;  1SC5 B;  2VQE O;  2UXD B;  2BTQ B;  4WFE A;  3OEH G;  1NI8 A;  1VEW A;  1AVM A;  2ITD C;  1Q7Y W;  1S5H C;  3UQ8 A;  4Z1M G;  2BTQ A;  3JSL A;  4LF4 O;  4WFA V;  2XAF A;  4LH6 A;  1KD1 W;  1A32 A;  1NTK H;  4P2Z A;  4PDR A;  4WBN B;  3T1C A;  5CA3 A;  4YJ3 A;  3AG1 C;  4D7S A;  3ZMU A;  4GX2 A;  1YSC A;  2EIJ C;  2Q6A A;  1P84 F;  3E8H A;  5LBQ A;  3SYQ A;  5B3S B;  3W7S A;  2CTR A;  4GKJ B;  4AIL C;  3CME V;  3VQY A;  4LF5 O;  5IJ0 B;  3A2F A;  4ZI7 B;  1MG1 A;  2P90 A;  3DSQ A;  3RVY A;  2BSK B;  3KCY A;  4OPH A;  5KHG A;  1BSM A;  1ZAU A;  4FLW A;  1NJI W;  1ZSP A;  3CCJ V;  1QLN A;  3FAV B;  3RYF B;  2BSK A;  2IU0 A;  4P9P A;  3BCC H;  5DM6 V;  5IJ9 A;  3OGI B;  1KMI Z;  4E4E A;  1Q81 W;  1PL0 A;  1VQ8 V;  1Q6H A;  2GBO A;  1PL4 A;  1D2D A;  3TET A;  3FAV A;  1ZWI C;  4JAU A;  2H3O A;  4X20 B;  5KUM A;  4LF8 O;  3CRA A;  4YXW G;  3J7A U;  4HZ3 A;  3QNE A;  1SZT A;  2LFS A;  4UB8 Z;  4MVM A;  2N04 A;  5H5N A;  3WFV A;  4KXR A;  4QGP A;  3ZRW B;  1ENV A;  4G2K A;  1JR9 A;  1YCI A;  4DV2 O;  3W7T A;  1VAR A;  4OXS A;  2IJK A;  4W4K A;  4J7J A;  2ZDI C;  1GN2 A;  4PV1 B;  1FXK C;  2JK5 C;  3SR2 C;  3ZRW A;  1IBK B;  1GN3 A;  2WLI B;  4B3R B;  4UCU A;  5JJN B;  2YDE A;  2EIK C;  2F23 A;  4EKW A;  4GKJ O;  5IWA B;  2Q67 A;  4TQF A;  2XTA A;  2OWO A;  3KG2 A;  4Z2W A;  5JJE B;  4HNA B;  3E86 A;  2ZDI A;  3OW2 U;  2VS0 A;  2F4V B;  2DQ3 A;  3T2M A;  2AHY A;  5IYZ B;  2HVJ C;  1VQ6 V;  4A5U B;  2IM9 A;  1DF5 A;  5IE9 A;  4NB5 A;  4HNA A;  1JOY A;  2DWD C;  2QWO B;  1R6T A;  3OE7 G;  5IYZ A;  3G4S V;  2QKS A;  3G80 A;  5LMN O;  1VQL V;  1FS0 G;  1HNW B;  1FJG B;  1I5X A;  3CRQ A;  1VQ4 V;  1K34 A;  3K0D A;  4X62 B;  1WP7 A;  4I55 A;  1Y67 A;  3OTF A;  1DK1 A;  3L73 H;  4LF6 B;  4FVM A;  3CCL V;  1SER A;  1FFT B;  3SYP A;  5FPO A;  4TT3 G;  1WN7 A;  4PI2 A;  1XUQ A;  3WB1 A;  3OT7 A;  1XEQ A;  2EIL C;  2FL4 A;  3E8G A;  3H9V A;  3L9D A;  4MVQ A;  2FML A;  1K97 A;  1PNK A;  3D3I A;  4MTG A;  1OCZ C;  3N27 A;  1U96 A;  3AG7 A;  1GN4 A;  1L0N H;  2AHZ A;  5IYB O;  3TCU A;  3IGA C;  3ZHT A;  1QVG U;  3ABM C;  2F66 C;  4DUZ B;  1FXV A;  3TJT A;  2HR3 A;  4B3R O;  5EIB C;  3ABM B;  4EFB A;  3U10 A;  4JI5 O;  5IWA O;  3FKS G;  2A0L A;  2E5L B;  3FB8 C;  4N21 A;  1Y6X A;  2EIM C;  3A0H Z;  1V54 C;  2X7R B;  1BGY H;  4B3M B;  3CMA V;  3CCU V;  1V54 B;  2F4V O;  1S77 D;  4UCR A;  1D5A A;  1YVW A;  5IYC O;  1E79 G;  2OCC C;  1N8R W;  4KFM A;  2AXT Z;  2MK3 A;  1IZ3 A;  3MHH C;  3HPL C;  2WLH A;  2OCC B;  2ODM A;  2ZIM A;  1SA0 A;  4IL6 Z;  2QR4 A;  3TGU H;  5BMV A;  2ZM6 B;  1HNW O;  4JI4 B;  3CEI A;  5LOV B;  4J7Z A;  1FJG O;  1M56 C;  2R70 A;  4X62 O;  1M56 B;  3HKD B;  3GWO A;  1RFY A;  3ICX A;  2Z0A A;  3ML0 A;  1IBL O;  4CS4 A;  4B3S B;  4JI1 O;  4ABM A;  1Y66 A;  3DXR B;  2Q5Z A;  3ZN1 A;  3E89 A;  4DV6 B;  3B09 A;  5B1O A;  1UFI A;  4IIJ B;  3N2G B;  1Y76 A;  3DXR A;  2FKX A;  2CTQ A;  2EJ7 A;  4O2A A;  3BVO A;  1NU1 H;  3CCE V;  5A9G A;  4OPA A;  5L3D A;  1SQP H;  3G6E V;  1F4M A;  1EN5 A;  3MAQ A;  4DUZ O;  1M57 C;  1IXB A;  3OGC C;  2Q4P A;  4J7K A;  4UXN A;  2UUA O;  4DUY B;  1OZ0 A;  1S5L Z;  2E5L O;  4NTW A;  5KA5 A;  2WA4 A;  3FB7 C;  1MSW D;  5FNV B;  2YXL A;  3AK2 A;  3M7M X;  1KB9 F;  1MSD A;  4DV7 B;  2RCV A;  4I0X B;  1HR0 B;  3ZX6 A;  3BFR A;  2YIB D;  1Q8I A;  3VBB A;  1JPX A;  1WB7 A;  2YS8 A;  4DRX B;  3LDD A;  3JAL A;  1VQK V;  1M93 A;  1DTO A;  4FFK A;  4I0X A;  2ZM6 O;  4JI4 O;  3SYA A;  4I7Z B;  4PDM A;  3U0Z A;  2DW4 A;  1P7B A;  1US6 A;  1X4T A;  4DRX A;  1ROP A;  4JZG A;  4FFB A;  1AB3 A;  4F6E A;  3CHX A;  1NH2 D;  1TUE B;  2OCH A;  5D5Q A;  4B3S O;  4O4I B;  2IJH A;  3ZMV A;  1W2B U;  1H2K A;  4CC6 A;  3OUS A;  4UVA A;  3HB3 B;  4JI8 B;  4GYC B;  3FB5 C;  2WPD G;  5CBG A;  4O4I A;  3BA9 A;  5BR8 B;  2ZCE A;  3E22 B;  2QE7 G;  3RGB A;  2FB5 A;  4NVP A;  4CH5 A;  1MA1 A;  4F6R A;  3N2K B;  3SJQ C;  1NTZ H;  5KAI Z;  1AR1 B;  1R3I C;  4X1K A;  2RDC A;  5CMU A;  5KAF Z;  1N0J A;  3F5W C;  1H2M A;  3FYE B;  5J2U B;  1NVP B;  3ZHV A;  1LUV A;  1KKC A;  4DUY O;  3O65 A;  3N2K A;  4PEL A;  1TVK A;  2X6C A;  2RJZ A;  5EBM C;  3H1K H;  3P3P A;  4K0K O;  5C93 A;  4LNU B;  1TUB B;  5J2U A;  5GTH Z;  2KQX A;  4X66 O;  3JD2 A;  1XDC A;  2YIA A;  4DV3 O;  4DV1 B;  4DV7 O;  1HNX B;  1LNQ A;  1TUB A;  4X9Q A;  2Q0O C;  2CGN A;  5LL6 Y;  5J2T A;  1Y4M A;  2BOC C;  1HDJ A;  3CYO A;  2EIN C;  5KMG A;  1R6N A;  3Q4H B;  4H37 A;  2CTP A;  3RWR D;  3E8B A;  4DO2 A;  5EBL C;  4RO2 A;  4UCT A;  4O4H B;  2XAQ A;  3ZRV A;  3IC7 A;  1EZV H;  2P4K A;  3Q4H A;  1I08 A;  1PD3 A;  1GM9 A;  1R1B A;  3K9S A;  4JI8 O;  4O4H A;  1IUR A;  2JGU A;  4IHJ A;  2MW2 B;  1WPB A;  5BR8 O;  1MZE A;  5LYJ A;  3SDL A;  5KX5 B;  1K8A W;  3CSX A;  4TV8 B;  4DV4 B;  3CRM A;  2JJ2 G;  2ZT9 B;  4PA7 A;  1WJZ A;  4JYA B;  4DK0 A;  2OIG A;  4MSW C;  4X1I B;  2F95 B;  3ABL C;  2HHH B;  2ZR3 A;  3RYH B;  4TV8 A;  2VQE B;  5L3E A;  2DMX A;  1YF2 A;  1EN4 A;  5B1N A;  2X6A A;  1EBO A;  4X1I A;  4B3T B;  4YJ2 B;  3UCS C;  1WNS A;  1MMM A;  2LJ2 A;  4AI8 A;  1YJN V;  3RYH A;  1GM7 A;  1HWY A;  2VWK A;  3CCQ V;  4DR6 B;  2NR5 A;  5A2Q N;  4DYL A;  1IX9 A;  3C3S A;  4YJ2 A;  1QVF U;  2KSD A;  1HNX O;  1B06 A; 
#chains in the Genus database with same CATH homology
 3R66 A;  2UUC O;  5BY1 A;  1XEQ A;  4DUZ O;  4LF8 O;  4K0K O;  1XNR O;  3J7A U;  5FLX N;  4LFB O;  4X66 O;  1HNZ O;  4DV3 O;  2UUA O;  4DV7 O;  4KHP O;  2E5L O;  2JRI A;  4JV5 O;  2UUB O;  3T1Y O;  5H5N A;  5LMU O;  3OTO O;  4JI6 O;  4OX9 O;  3J81 N;  5LL6 Y;  4B3R O;  2DOS A;  4JI5 O;  5IWA O;  1XMO O;  2LW7 A;  4DV2 O;  4DR3 O;  2VQE O;  4LF9 O;  4DR2 O;  4JI7 O;  2UXC O;  4DV6 O;  1I94 O;  2F4V O;  3RT3 C;  4LF7 O;  1N32 O;  2VQF O;  2ZM6 O;  4JI4 O;  3F5T A;  1NS1 A;  4GKJ O;  4DV4 O;  4LF4 O;  4LF6 O;  1FYJ A;  1F7Y A;  1A32 A;  4DR5 O;  1R1B A;  2DJV A;  1N36 O;  1XMQ O;  4DR1 O;  4JI0 O;  4JI2 O;  4JI8 O;  4DR7 O;  4JYA O;  1AIL A;  4DV5 O;  2HHH O;  5BR8 O;  1J5E O;  4LFC O;  4YHH O;  1AB3 A;  3SDL A;  4B3S O;  4NXN O;  1HNW O;  4JI3 O;  1FJG O;  4A5U B;  4B3T O;  4LF5 O;  4DR4 O;  2AGA A;  4DV1 O;  4X62 O;  3J80 N;  5IT9 N;  1XNQ O;  4NXM O;  2Z0A A;  4DR6 O;  1R6T A;  1IBL O;  4GKK O;  4JI1 O;  5LMN O;  1X59 A;  4OPH A;  2N74 A;  3JAM N;  4LFA O;  3T1H O;  1N33 O;  1DK1 A;  1HR0 O;  4X64 O;  1FKA O;  1KUQ A;  4AQY O;  1G1X B;  1IBM O;  4X65 O;  2UXD O;  2ZKO A;  2FKX A;  5A2Q N;  5BXZ A;  4DV0 O;  4YY3 O;  4B3M O;  3M8A A;  4DUY O;  1IBK O;  1D2D A;  1YZB A;  1HNX O;  3O65 A;  4OPA A;  2UXB O;  1N34 O;  2UU9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...