1N34O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n34O00
4JI1O 5LMUO 1HR0O 1D2DA 5IT9N 2DOSA 1N32O 1IBKO 2LW7A 2N74A 2VQFO 4DV7O 4LF5O 4DR5O 4JI2O 1N33O 2UUCO 5IWAO 2UXCO 4A5UB 1XNRO 4OPHA 1YZBA 4LF8O 1NS1A 3RT3C 1I94O 3O65A 1DK1A 5BXZA 1F7YA 3J7AU 4NXMO 4B3TO 4JI6O 1HNWO 4DR4O 2HHHO 1FYJA 2Z0AA 5A2QN 2VQEO 2UUAO 1AILA 1G1XB 4JI0O 1HNXO 2AGAA 1A32A 4DV4O 1AB3A 4DR1O 5BY1A 4X62O 4JI4O 1R6TA 4LF4O 3T1YO 4DV6O 1R1BA 3J81N 3J80N 4K0KO 1HNZO 2ZM6O 3M8AA 4DR6O 1IBMO 4DV0O 1IBLO 2F4VO 3T1HO 4OPAA 4YY3O 3JAMN 3SDLA 2UXDO 4AQYO 1N34O 4LF7O 4X64O 4B3SO 4DUZO 2DJVA 4LFBO 4LF9O 4JI7O 4LFAO 3R66A 3OTOO 4YHHO 5FLXN 2UUBO 4GKKO 5BR8O 4LF6O 4DR2O 4JI8O 4JV5O 4DV5O 4GKJO 1FJGO 4B3MO 1XMOO 4OX9O 2ZKOA 1XNQO 4DR7O 4JYAO 4LFCO 2UXBO 4DV3O 2JRIA 4X66O 5H5NA 1J5EO 1XEQA 4DR3O 5LL6Y 1N36O 4B3RO 2FKXA 2E5LO 4JI3O 3F5TA 4DV2O 4KHPO 4DV1O 1XMQO 1FKAO 1KUQA 4DUYO 5LMNO 4X65O 2UU9O 4JI5O 1X59A 4NXNO
chains in the Genus database with same CATH superfamily
5LXTB 2EINC 3U10A 4X1KA 1GO3F 5FNVA 1DF4A 1WNSA 2ADQB 1RSOA 2WLJA 5KX5B 4B3TB 4ZI7A 2Q73A 3WB2A 3UT5B 1FXKA 1PPJH 4R8CA 1SZXA 1VQOV 2GTAA 1ENVA 4JI4B 2ATKC 4I7ZB 4ZHQA 3AG2C 1A32A 4O4IA 1K9MW 4LF6B 1R6TA 4PELA 3T4DA 2Q7EA 5D5QA 1ZL8A 5KAIZ 4U7NA 5L3FA 1S0VA 1HNZO 1N0JA 4CBCA 3BRCA 1KKCA 4FM0A 3BFRA 1FXVA 3IGAC 5JH7B 4YY3O 2UXDO 1QLEB 1WPBA 4BW5A 1CXZB 4UCOA 4QJFB 4I55B 3W7XA 3OTOO 5EYPB 3C3SA 3CHXA 2V4DA 3I5DA 5IYZB 2LFSA 1V54B 3FX7A 3FB8C 1WB8A 3SYAA 3LDCA 3EFFK 1XMOO 1Z5WA 5H2FZ 1VP7A 1SF9A 1N33B 3T4ZA 2Q7HA 2DN9A 3RVZA 1P84F 3HKBB 3K0GA 1PV0A 2VWJA 3K59A 2P5OA 2YICA 1J5EO 1VARA 5LL6Y 1N36O 1SQGA 4DV2O 2QA4V 4GT1A 1KUQA 3ZHRA 4JASA 3CMAV 1W0JG 2WA4A 1MZEA 1COWG 4LH6A 3CCUV 3ZS8C 1M90W 4LF4B 3OTFA 2EIMC 1HR0O 4LNUB 5EBMC 2X6CA 2XASA 3BAAA 3GWKC 3JAWB 5KUMA 2ZR3A 1MG1A 4I0XA 1YJ9V 4DK0A 2PYJA 5IY5B 1B06A 3HKCB 3E8HA 1QR8A 2WLLB 4OPHA 4J11A 1K33A 3C90A 3O65A 2P6JA 3OAAG 1DK1A 1I5XA 1I08A 5IJ0A 3HKEA 2X6BA 1FFXB 1RPOA 3JD3A 1AI7A 2V7QG 1YIJV 2VQEO 4TV9A 2E76B 3P32A 1YVWA 3HB3B 1V54C 4PI0A 2HEPA 3FKSG 1OCOB 1Q3EA 1XUQA 2JS3A 3KKYA 4NB5A 3ZRWB 1URFA 3T2MA 3LSSA 3STZC 3DSQA 1Q6UA 2K1EA 4FFBB 4O4LB 4P9OA 4FPPA 4AQYO 3K79A 4X64O 4N21A 1K8AW 1FXKC 4OXSA 4ICGA 5CN0A 4RUFA 5CA3A 4GKKB 1F4NA 1B6QA 3E8FA 3JAKB 1GAXA 4QIWF 1BQ0A 1M57B 1ROPA 1UJWB 3LSUA 2AZ2A 2QJ1A 5B1BB 2KSDA 4CH5A 2BOBC 4LF5B 4DR5B 5LGUA 5KMGA 1ZUQA 4KXRA 1U97A 1KBHA 3HR0A 4F6EA 3CRCA 3R65A 5LMNB 1N0NA 5IJ9A 1OCOC 4JI0B 1Y66A 2YIBD 3LNMB 1S72V 2NNUA 3CXCU 4GLXA 3T1YB 4TQDA 2GSMB 1OCZC 4WBNA 5JVDA 4WFAV 2AHYA 1PNMA 2AW9A 2ITDC 1YZBA 2OCCB 3RT3C 1JFFB 1PM9A 3ZJZA 5D5PA 4B3TO 3WB0A 5F2VO 2QM7A 4H13B 1R6KA 1SZTA 2ZCEA 2JK5C 4NTYA 1PD3A 2JGUA 2EBOA 1M57C 1EZVH 1OZ0A 4JI4O 4JTAB 4JI8B 3DGEA 3OMAB 2AZ0A 4GX0A 3ZN1A 4K0KO 3WB1A 5H6RA 2LGWA 2QTSA 4NYKA 1GN2A 2ZE6A 4JAUA 3OD4A 3JAMN 4FLXA 1W0KG 2ODMA 1EN5A 3CCLV 5CA0A 2NN4A 2BSKB 3RYFB 4B3RB 4IHJA 4KFMA 4I50B 4R50A 2IW5A 2Y4TA 1ZX3A 5IYDO 4DV5O 3RN4A 2EIKC 4DV7B 3G67A 4CS3A 2F66C 1CPYA 3FD9A 3ICXA 2O57A 2UXCB 4UCVA 1M9NA 1ZSPA 1BE3H 4DV3O 3K57A 4FLZA 5B1AB 1GN4A 4PDVA 1WAZA 3JASB 2IU3A 2B1IA 3AG1C 2EILB 2QKSA 3AG3B 3ZRXA 3HPLC 4JTCB 2DWDC 3ASOC 5CA1B 2OTJV 3A0BZ 5LYJB 3I56V 1IURA 3K58A 3JCUZ 2HHHB 4F6RB 1E1QG 3STLC 3ZMTA 1N34B 4FZ0A 3OGIB 4FK5C 1HNXB 1NVPB 1Y76A 5JJJB 2UUAO 1PL4A 1BSMA 2AGAA 4P30A 1IVSA 1J95A 3ABMC 1BS3A 3OW2U 2CTPA 1XDCA 1SKVA 2ZM6B 2YUAA 2CH7B 1Y67A 2JS5A 3CRAA 3E35A 1V9PA 4CC5A 2CGOA 2R70A 1JJ2U 3PJSK 2YIAA 2DQ0A 3BHPA 3A2FA 2UUBB 1YI2V 4NVPA 1B3QA 2IM9A 1GM7A 4EB6B 2QSAA 2WWWA 4GKKO 4JZGA 4BIZA 1VIBA 1QVGU 1YF2A 4XDKA 3H1KH 4JV5O 2YXHA 4U7OA 1O9GA 4C7UA 2QE7G 3K5NA 5LOVA 2X7RB 5KHHA 4RQEA 4OX9O 1MSWD 4YJ2A 1S5LZ 1NZ6A 2XAGA 3B09A 1TA8A 4NR1A 4PI2A 3OEHG 1R3LC 4GCZA 1KP3A 1HNWB 2QWOB 1QBZA 3L70H 4X1IA 2UU9B 3F7VC 3F5TA 1YDXA 5LMNO 4JZ2A 3ZHVA 1VF5B 5B66Z 1F4MA 2P90A 3ABKB 3AK2A 1WB7A 1FS0G 3ETDA 1RPRA 5B1NA 3JATA 3E86A 1XNRO 1XQ8A 1SQQH 1M56C 2D2CB 4J42A 3X2QB 1N8RW 3MHSC 4LP8A 2KG7A 4DV4B 4DR1B 1VF6A 3K06A 2H3OA 3RYIB 1YHQV 4LWSB 3D3QA 3SJBC 3SJAC 2PZSA 2XT9A 3N2GB 1RM1B 3J81N 4L8JA 3CJHA 4D7SA 1NR7A 1YXBA 4DUZB 5KA6A 4DYLA 5C93A 2DMXA 5C8YA 4X1YA 1THZA 2WSSG 4QNHB 5DECA 3D36C 1K7DA 5L3DA 3TGUH 2HLDG 4O4HB 2A79B 1XL4A 4DR2B 3WG7B 2PI5A 1L1FA 3OMNB 1Q43A 4CS4A 1P7BA 2EINB 1IDSA 2B5UA 1GN6A 2JVDA 2RJZA 3W7SA 5LXTA 1IBKB 3H01A 2ZKOA 5KAFZ 3L72H 2ZDIC 2CGNA 4Z2WA 5IYBO 2YS8A 3MAQA 4O2AA 2JRIA 4TSFG 1D5AA 2NR5A 2FL4A 2ADPA 2E5LO 3RYCB 2ARHA 1Q90D 3TXSA 2DYSC 2Q5ZA 4W4KA 1NI8A 5GONB 1Y74B 5ITZB 4TQFA 1NTKH 1JOYA 1MSDA 3ABUA 2Q69A 4G2KA 1WA8A 5JJNB 4PHZA 4PDRA 4W4LA 1S5HC 3U11A 4H37A 5JQGA 2F4VB 4DR4B 3A0RA 4CH3A 4O2BB 1VEWA 2RNBA 2P7TC 2HP8A 5BXZA 4ZOLA 5CBGA 2XNDG 2HHHO 4UB8Z 3ABLC 1ORQC 4TUYA 5IDJA 2VRZA 3UM7A 4YHHB 1KP2A 2ZD9A 1VQ7V 1HNXO 5E79Z 5EC2C 1KU9A 2XAJA 1MZFA 5GTHZ 2GUZA 3AK3A 1NBMG 1W59A 3K0DA 4DV0B 4GX2A 2BTQB 2ZM6O 1TGOA 1SQFA 3OM3B 4B3SB 4QE7A 5H9CA 5EC1C 3T1HO 1AP5A 3TETA 2XAQA 4I5SA 5KHJA 4FLUA 4LFAB 1Q8IA 1H8EG 3HKBA 2RN9A 4JI7O 5LP6C 1KC8W 3QVNA 3DXRB 1SESA 4KHPB 1SETA 1YJNV 2ZNIA 2WLHA 2UUBO 4B08A 1VF6C 1FJGB 1XHZA 3OEEG 2EIMB 2DE0X 4WFEA 4X20B 1R73A 3THOA 1AJPA 5EK0A 3E8GA 4LNUA 3JCZA 3CRRA 2P4VA 5BMVB 3MDSA 2JIZG 3IAYA 1EN4A 2IJIA 1JCHA 1MA1A 3ETQA 1BHAA 4JYYA 1H2MA 3ZHQA 2ZE8A 2PY5A 1FFXA 2UU9O 1M5IA 4J7KA 1VQNV 2QM4A 2VQFB 1IXBA 2EIJC 1EFRG 5LGNA 4ZIBA 2N74A 2RMKB 1L0LH 4UCSA 4WFHA 4X1KB 1IX9A 4GYCB 1Y4MA 3K03A 4BAYA 4ZI7B 3W7UA 3J7AU 4O4LA 1PP9H 4FFBA 1F7YA 1FXKB 5J2TB 3UO2A 2KKWA 4CH6A 2Z0AA 2LQTA 4PA7A 5A2QN 4UVCA 1M93A 4WFBV 5LHGA 2QKCA 2MK3A 2G38A 3IJ4A 1VQLV 2IBZH 4DV4O 1VQKV 4UV8A 4DR1O 4HAMA 4MTGA 4ZHQB 1LUWA 4O4IB 4DO2A 4DV6O 3F7YC 3P3NA 2Q4PA 1R1BA 3APOA 3J80N 1O9HA 4JTDB 4RUEA 2YDEA 1ZL8B 4HYOA 4MSWC 4B7EA 2QWNB 4DR6O 4MVSA 3SPIA 5CBFA 1NH2D 4LFBB 3SDLA 4QE9A 1JQ0A 3OFNG 4U3JA 4DUZO 1EM1A 4JGSA 3JD2A 3ASNC 4DV1B 5FLXN 1QLNA 1SQXH 1S77D 1PNLA 3AG7A 2CE4A 3FB6C 3CC7V 4DR2O 5LMUB 1OCZB 1H2SB 1JJOA 2Y0PA 1Z2GA 3OR6C 1AJNA 2YXLA 4L87A 1I5YA 1KD1W 2GV9A 4YJ3B 2IJJA 4J9ZB 3BABA 4D6TH 2Q6AA 4X88A 2QM8A 2QDOA 4NXMB 2PTMA 1HWYA 1XEQA 3VBBA 2RCVA 3CRMA 5FPRA 3TCUA 2L6LA 5J2UA 4UUJC 3OT7A 3ZMUA 3E22B 2CUGA 4GZRB 1WP7A 3L73H 3K08A 4LF8B 3KZIZ 1K4DC 4I0XB 3S3XA 1D5NA 2UUCO 3EHBB 2FB5A 4JI6B 4IIJA 1IZ3A 5A9GA 3ZBHA 4WCEV 1Q81W 3UKMA 4DR4O 1SS3A 4GX5A 5IJ0B 3CCSV 3Q4HB 2BSKA 3RYFA 1PNKA 1G1XB 4BWAA 1GM9A 4U3FH 4TV9B 4I50A 3CCVV 4ZKIA 2Q0OC 3RFRA 2A0LA 2JJ2G 2LJ2A 1TVKA 3D8CA 3SPGA 1XREA 1BQZA 5JCOA 4TV8A 2EIKB 1VMGA 3JD1A 3FAVA 2PUSA 2D3OW 3NR7A 4DV0O 1QU7A 3BY6A 2YI9A 4PD4F 1XNQB 3BPZA 4B3SO 3OMIB 5CB4B 4AI8A 4LFCB 4E4EA 4WFFA 4LFAO 5BR8B 5DM6V 1XMQB 3AG1B 3K5MA 3K3WA 4B7KA 3AK1A 4LF6O 3G80A 5HFLA 2P22C 4TT3G 2X6AA 3M99B 2DQ3A 1FJGO 2UXNA 2W0XA 5KA5A 3ASOB 1R3JC 2FYUH 3ETGA 1NH2B 2W0FC 5IWAB 2UXBB 3MHHC 4J7JA 3SYCA 3JALB 1I94B 5KMGB 1B04A 4JI3B 4MTOA 4F6RA 5H5NA 3K9SA 2IJHA 4DUYB 2FKXA 1AI4A 4YIOA 3H1HH 4JI1B 5IJ9B 3H1LH 3ABMB 1X59A 2R9AA 1EZJA 1KMIZ 2ZNJA 2P67A 2HVJC 1GKFA 2VQFO 5E1AC 2CH7A 4WBNB 3UO3A 1XI1A 1N33O 4JAVA 1DGSA 3ZIAG 2Z3YA 3QTCA 3CCEV 5J9PC 3K9AA 4J9YB 2W6JG 4BIOA 5L3CA 4PA3A 3VQYA 4DK1A 4MT8A 1QQCA 4TOIA 3CCRV 1WP8A 3KCYA 1GTOA 3ZRSA 4EKWA 5B3SB 3B77A 4EB6A 3ML0A 2A9HA 4LF4O 2JEXA 3LUTB 4P9PA 5B5EZ 2R72A 4DRXA 3FYEB 4GKJB 3CS5A 2M6YA 2Q0AA 4ABMA 4UFZA 1YITV 1YJWV 2ZINA 2ZE7A 4LF7B 3SYPA 3LDEA 2A06H 4IGGA 3B8NA 2F95B 1KECA 4PA4A 4JYAB 2JGDA 4LH7A 3ABTA 4LFBO 3CD6V 1XILA 3QO8A 3JARA 4IHJB 4X65B 2OCHA 3H1JH 3BEHA 1V55C 4NXNB 4R7CA 4IT5A 2ZXWC 5JCOC 3N2KA 2ZIOA 5CMUA 1P4RA 3ZMVA 4G27B 1P49A 1M56B 1AVMA 3D3IA 1TUBA 1LUVA 5LHIA 2ZE5A 4NTXA 5B3SC 5LHHA 3HKDB 3A8TA 4I9QA 5KLVH 3JD4A 1SA0A 2PYLA 4NTWA 4LR3A 3GWOA 5EZYA 3N2GA 2LW7A 2HKOA 1Y6XA 4LF5O 1BL8A 3BVOA 1BT8A 4DR5O 4K8XA 4D7TA 2CAZC 2YXYA 4LF8O 2E3CA 4MW8A 4DW1A 1VQ8V 4YY3B 2UXDB 1XOUA 3TXQA 4JI6O 3K04A 2EULA 4K8ZA 4JI0O 1Y76B 1AB3A 3CC4V 1NT2B 3WU2Z 1TAEA 3T1YO 1YTFD 3RW0A 1SC5B 2EZPA 4HNAA 5AG2A 5GW7A 2E74B 2A3QA 4LF9B 3KG2A 4NKGB 1R3KC 2PF4E 1J5EB 1K34A 2X0LA 3AG4C 5LA6B 5B1OA 4DV2B 2HJDA 1RFYA 3RYCA 2WAMA 2DYSB 1ZLZA 1RP3B 2KB1A 5IYCO 2R9RB 5BR8O 4JI8O 2DWEC 3L71H 1HR0B 2OIGA 5GONA 3SJCC 2YIDA 1QVFU 3NXSA 5LOVB 2B9ZA 3H9VA 2Y69C 1VQMV 4MVRA 2GBOA 2WLIA 4JAAA 4O4JB 3RVYA 1QHTA 3ZHTA 2Q7GA 4O2BA 2UXBO 4Z1VA 3ZX6A 3ABLB 3DTUB 4MTXA 4B3RO 2YEVA 4JI3O 2WLNA 2Y0IA 4X1IB 5CBHA 3GB7C 4DUYO 3C3TA 2LW1A 1N32B 1ZTEA 4QPJA 4JI1O 1D2DA 1H2GA 1NU1H 2LGQA 3QNEA 4BR6A 2WLMA 1QCEA 4DV7O 3JSNA 5KX5A 4X9QA 4J10A 3UT5A 2BTQA 4LBEC 5H6QA 2XOKG 2UXCO 1H8HG 1F23A 3JATB 3SPHA 4AQYB 2ILMA 2ZR2A 3N27A 3WFVA 4X64B 4CZZA 1FAFA 3ZCCA 5LP6B 1AILA 1SQVH 4DXWA 2H94A 2KG7B 1AR1B 3CCMV 4FFKA 4PDMA 2YSUB 1OJHA 3CSXA 4CS2A 2Y48A 1JR9A 4UVBA 1IBLB 4FJCC 5JH7A 2C2AA 2LO1A 3M8AA 3CJHB 5K1PA 2OT5A 4I55A 1H2KA 3AEIA 4F4LA 1N34O 4LF7O 2F93B 2DJVA 2JDIG 5LBQA 1VF7A 1SRYA 4X1YB 1I0HA 5EYPA 3R66A 4RAIA 4XDLA 4PA6A 3VQWA 2AHZA 3QG5A 1AR4A 1CP9A 5IYZA 1BCCH 3F5WC 3BA8A 1YTFB 4K3AA 3G6EV 2ZQMA 2EIJB 1AROP 4PV1B 1MOFA 1R6NA 5JJEB 3EVKA 3P3PA 1MNGA 3FB7C 3E83A 5GTIZ 4BIUA 3L74H 5HFMA 3CC2V 2OTLV 4I4TB 3ZN0A 5J2TA 3CP1A 4O2AB 3FYIB 4JYCA 1K5QA 4XBFA 1JVMA 1OCCC 2QWRB 1BMFG 4J7ZA 2CDYA 1FXHA 3JAWA 1US6A 4UV9A 4JI2B 2WPDG 1NQTA 2GTSA 2V1DA 3HKCA 1JPXA 4K0KB 4TWKA 2FTKA 2WLLA 1WA8B 1NS1A 2VS0A 2XUMA 1XHXA 5JQGB 3RYHB 1K5SA 2YC0A 1FFTB 2Z5UA 3ASNB 1HNWO 2DYRB 1FYJA 3UQ8A 4ZOLB 4LC1A 5EIBC 1VQ9V 2DW4A 1UFIA 2HG5C 4TUYB 3ZEDA 4N23A 1ZWIC 2E75B 1PKXA 2H8PC 4JPRA 4FLTA 2EJ7A 4DV5B 2AXTZ 2GUZB 3CPWU 4ZBMA 3E2EA 5FNVB 3ZRWA 1M1KW 3W7TA 1RSOB 4PDLA 3W7WA 3U0ZA 3OUFA 4YJ3A 3CCJV 1NTZH 4I9WA 2HJFC 2R9IA 4FLWA 4DW0A 4DV3B 2CTWA 2OYQA 4LF9O 1JMKC 1XL6A 3O9OA 2HR3A 4MVZA 3SJQC 3JAKA 4IL6Z 1JA8A 1W2BU 3SPCA 1K3EA 4FVMA 4MVUA 3E22A 3ZHUA 2W6IG 1K92A 4HBNA 4YIPA 3B2EE 3B8MA 2XTAA 2CTRA 2HVKC 1KYOF 4YXWG 2BE3A 2DYRC 1AR5A 1QLEC 5KHIA 4IYHA 1OV9A 2UUAB 3CE2A 4H0LB 3Q4HA 4UCRA 4RWUA 1E1RG 2XHBA 3G4SV 1WLEA 1HP8A 1N32O 1IBKO 4UB6Z 1SERA 1TUEB 3BA9A 1JFFA 2Q8VA 3OE7G 3T1CA 1DTOA 2Q68A 5CB4A 2F1MA 2QWPB 4X62B 3EXAA 2OWOA 4FZ1A 3VQVA 3CXHF 1GM8A 1P7GA 4PA9A 2ZT9B 1U96A 1H2NA 4JV5B 2JJ1G 1IBMB 4Q20A 1BZKA 4JF3A 4OX9B 3LSQA 5IY5C 1YSCA 4KL1A 1IBLO 2F4VO 4FLYA 1VQ5V 1OCRB 4FM2A 4FM1A 4FMTA 3HKEB 3UCSC 3JALA 4U3JB 1I7FA 1FD9A 4YHHO 3CWBH 4B3MB 1NVPD 1SQPH 1S5JA 3OUSA 2A7WA 4H33A 1L0NH 2MW2B 3B40A 3BCCH 1K97A 3SGIA 2P4KA 4DR7B 4GX1A 2EX3A 1XNRB 3CB2A 4MVQA 2QWQB 3GVMA 3JYCA 3ZMSA 2Y4UA 3RWRD 3JASA 1AI5A 4RQFA 3IFXA 2QEXV 4JI5B 1VQ6V 1EN6A 4KHPO 1FKAO 2OIEA 4ASUG 4K35A 2YI8A 5J2UB 2HFEC 4EFEA 2L35A 1ZAUA 2GDSA 5B1BC 1G4YB 5CA1A 1OCRC 5LYJA 4JI2O 1MMMA 4A5UB 1MABG 2ETNA 2RDCA 1EBOA 4UVAA 3RBZA 4IIJB 3B4SA 1L8DA 1UPGA 4AILC 2FMLA 2YIBA 3FFQA 1Q6IA 2VWKA 1V55B 3DC5A 2ITCC 3E8BA 3L9DA 5JVDB 2RQ6A 1X4TA 1TVKB 3JSLA 1JX9A 2ZXWB 3SR2C 4TV8B 4IYIA 3FAVB 2IU0A 5IE9A 2OCCC 1YEWA 1Z5VA 1HDJA 2KQXA 5KHGA 1K73W 3CRQA 1F51A 4QPKA 3SYOA 2E5LB 1H2LA 2WLKA 3RGBA 4MTFA 2EZOA 4UCTA 3HKDA 4UCUA 4X89A 4MVOA 1Q5OA 5BZBA 3TJTA 4MS2A 1GN3A 3FB5C 4X66B 4G28B 4DR3B 4GUNA 5CA0B 3OGCC 3D36A 3ZRVA 1LNQA 1DLBA 3G6BA 4DV1O 1AI6A 1NKDA 3H1IH 1AP6A 3G71V 3APQA 1LR1A 5EBLC 2LP7A 5LMUO 5IT9N 2DOSA 1OHHG 2BTOA 3L75H 4FIPC 5K1XA 2ZIMA 2ZDIA 3T1HB 1NR1A 3LDDA 4QGPA 1HW7A 3DC6A 4NXMO 1PL0A 4E2LA 3AG4B 4JI7B 4J80A 4P2ZA 3RYIA 3CCQV 4PJ0Z 3QO5A 4LWSA 5B1AC 5LA6A 3PN1A 4BW9A 3CMEV 1NJIW 4X62O 3IC9A 2N05A 2P06A 3CX5F 1HNZB 2EILC 4FLVA 3P30A 2BCCH 2IJKA 3AG3C 3OR7C 4RO2A 4DRXB 5L3EA 2Y69B 1IBMO 1NTMH 3I55V 1KQSU 4LCUC 4OPAA 3ZMZA 5EBWC 4O4JA 4R6ZA 3OTOB 4O4HA 5JWPA 2XAFA 1AJQA 3CEIA 4MW3A 5FPOA 3MD0A 2JGDB 5EIBD 4MVMA 1G6UA 1VQ4V 3JARB 2EJRA 1KKDA 1CEZA 1XMOB 4EEQA 2QKAA 1GMGA 4B3MO 3LNNA 1Q7YW 3JD0A 2PGGA 1K4CC 3N2KB 2QR4A 2Q67A 1N36B 1BGYH 1XNQO 2F23A 4DR7O 4Z1MG 4LFCO 1TUBB 5LP6A 1WN7A 1YCIA 1XMQO 3ZHSA 4H44B 5LGTA 4JI5O 1Y74A 5L3GA 5ITZA 1QNMA 2K9PA 4DV6B 1SA0B 1VQPV 2Q9LA 5DEDA 2GHYA 5EZYB 1G8MA 4KUMA 1IXMA 2NLJC 4XDJA 1BHBA 5IWAO 4YJ2B 4DR6B 4AHCA 1I94O 5L3BA 4OGQB 1S3JA 5KUKA 1H38A 1Q6HA 2VQEB 4KP4A 3K5OA 4Q6GA 3SYQA 1KB9F 5BY1A 5FL7G 1T5EA 1M4UA 2PI4A 2M7WA 3VQXA 1SQBH 1GH6A 3ABKC 2QGNA 4HNAB 2QTOA 2BOCC 2IH3C 1FPOA 4HZ3A 3QO7A 5DN6G 2IH1C 1S76D 3E89A 1QR9A 3X2QC 3DXRA 3IC7A 2WA3A 1R3IC 4X8AA 4I4TA 3A0HZ 1OCCB 1WJZA 2F43G 4J41A 3K5LA 2XAHA 1DF5A 3SPJA 2CK3G 4CH4A 4X20A 3VOUA 2JEUA 2LFRA 3AG2B 4WF9V 4GKJO 1N4CA 2UXXA 1RM1C 5BMVA 1Q86W 1GRJA 3QF7A 4JYBA 2UUCB 2B1GA 2N04A 1GK9A 1E79G 5C8YB 3CYOA 5TISZ 3ETEA 4WFGA 4EFBA 2WLIB 4JYAO 4X66O 3KCXA 3RYHA 1Q82W 4DR3O 4UXNA 3TK1A 1WPXA 2CTQA 3S3WA 5KHKA 2YEVB 1XBLA 3WG7C 4X65O 4CC6A 3M7MX 4NXNO
chains in the Genus database with same CATH topology
4JI1O 5LMUO 1HR0O 1D2DA 5IT9N 2DOSA 1N32O 1IBKO 2LW7A 2N74A 2VQFO 4DV7O 4LF5O 4DR5O 4JI2O 1N33O 2UUCO 5IWAO 2UXCO 4A5UB 1XNRO 4OPHA 1YZBA 4LF8O 1NS1A 3RT3C 1I94O 3O65A 1DK1A 5BXZA 1F7YA 3J7AU 4NXMO 4B3TO 4JI6O 1HNWO 4DR4O 2HHHO 1FYJA 2Z0AA 5A2QN 2VQEO 2UUAO 1AILA 1G1XB 4JI0O 1HNXO 2AGAA 1A32A 4DV4O 1AB3A 4DR1O 5BY1A 4X62O 4JI4O 1R6TA 4LF4O 3T1YO 4DV6O 1R1BA 3J81N 3J80N 4K0KO 1HNZO 2ZM6O 3M8AA 4DR6O 1IBMO 4DV0O 1IBLO 2F4VO 3T1HO 4OPAA 4YY3O 3JAMN 3SDLA 2UXDO 4AQYO 1N34O 4LF7O 4X64O 4B3SO 4DUZO 2DJVA 4LFBO 4LF9O 4JI7O 4LFAO 3R66A 3OTOO 4YHHO 5FLXN 2UUBO 4GKKO 5BR8O 4LF6O 4DR2O 4JI8O 4JV5O 4DV5O 4GKJO 1FJGO 4B3MO 1XMOO 4OX9O 2ZKOA 1XNQO 4DR7O 4JYAO 4LFCO 2UXBO 4DV3O 2JRIA 4X66O 5H5NA 1J5EO 1XEQA 4DR3O 5LL6Y 1N36O 4B3RO 2FKXA 2E5LO 4JI3O 3F5TA 4DV2O 4KHPO 4DV1O 1XMQO 1FKAO 1KUQA 4DUYO 5LMNO 4X65O 2UU9O 4JI5O 1X59A 4NXNO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 O;  5LMU O;  1HR0 O;  1D2D A;  5IT9 N;  2DOS A;  1N32 O;  1IBK O;  2LW7 A;  2N74 A;  2VQF O;  4DV7 O;  4LF5 O;  4DR5 O;  4JI2 O;  1N33 O;  2UUC O;  5IWA O;  2UXC O;  4A5U B;  1XNR O;  4OPH A;  1YZB A;  4LF8 O;  1NS1 A;  3RT3 C;  1I94 O;  3O65 A;  1DK1 A;  5BXZ A;  1F7Y A;  3J7A U;  4NXM O;  4B3T O;  4JI6 O;  1HNW O;  4DR4 O;  2HHH O;  1FYJ A;  2Z0A A;  5A2Q N;  2VQE O;  2UUA O;  1AIL A;  1G1X B;  4JI0 O;  1HNX O;  2AGA A;  1A32 A;  4DV4 O;  1AB3 A;  4DR1 O;  5BY1 A;  4X62 O;  4JI4 O;  1R6T A;  4LF4 O;  3T1Y O;  4DV6 O;  1R1B A;  3J81 N;  3J80 N;  4K0K O;  1HNZ O;  2ZM6 O;  3M8A A;  4DR6 O;  1IBM O;  4DV0 O;  1IBL O;  2F4V O;  3T1H O;  4OPA A;  4YY3 O;  3JAM N;  3SDL A;  2UXD O;  4AQY O;  1N34 O;  4LF7 O;  4X64 O;  4B3S O;  4DUZ O;  2DJV A;  4LFB O;  4LF9 O;  4JI7 O;  4LFA O;  3R66 A;  3OTO O;  4YHH O;  5FLX N;  2UUB O;  4GKK O;  5BR8 O;  4LF6 O;  4DR2 O;  4JI8 O;  4JV5 O;  4DV5 O;  4GKJ O;  1FJG O;  4B3M O;  1XMO O;  4OX9 O;  2ZKO A;  1XNQ O;  4DR7 O;  4JYA O;  4LFC O;  2UXB O;  4DV3 O;  2JRI A;  4X66 O;  5H5N A;  1J5E O;  1XEQ A;  4DR3 O;  5LL6 Y;  1N36 O;  4B3R O;  2FKX A;  2E5L O;  4JI3 O;  3F5T A;  4DV2 O;  4KHP O;  4DV1 O;  1XMQ O;  1FKA O;  1KUQ A;  4DUY O;  5LMN O;  4X65 O;  2UU9 O;  4JI5 O;  1X59 A;  4NXN O; 
#chains in the Genus database with same CATH topology
 5LXT B;  2EIN C;  3U10 A;  4X1K A;  1GO3 F;  5FNV A;  1DF4 A;  1WNS A;  2ADQ B;  1RSO A;  2WLJ A;  5KX5 B;  4B3T B;  4ZI7 A;  2Q73 A;  3WB2 A;  3UT5 B;  1FXK A;  1PPJ H;  4R8C A;  1SZX A;  1VQO V;  2GTA A;  1ENV A;  4JI4 B;  2ATK C;  4I7Z B;  4ZHQ A;  3AG2 C;  1A32 A;  4O4I A;  1K9M W;  4LF6 B;  1R6T A;  4PEL A;  3T4D A;  2Q7E A;  5D5Q A;  1ZL8 A;  5KAI Z;  4U7N A;  5L3F A;  1S0V A;  1HNZ O;  1N0J A;  4CBC A;  3BRC A;  1KKC A;  4FM0 A;  3BFR A;  1FXV A;  3IGA C;  5JH7 B;  4YY3 O;  2UXD O;  1QLE B;  1WPB A;  4BW5 A;  1CXZ B;  4UCO A;  4QJF B;  4I55 B;  3W7X A;  3OTO O;  5EYP B;  3C3S A;  3CHX A;  2V4D A;  3I5D A;  5IYZ B;  2LFS A;  1V54 B;  3FX7 A;  3FB8 C;  1WB8 A;  3SYA A;  3LDC A;  3EFF K;  1XMO O;  1Z5W A;  5H2F Z;  1VP7 A;  1SF9 A;  1N33 B;  3T4Z A;  2Q7H A;  2DN9 A;  3RVZ A;  1P84 F;  3HKB B;  3K0G A;  1PV0 A;  2VWJ A;  3K59 A;  2P5O A;  2YIC A;  1J5E O;  1VAR A;  5LL6 Y;  1N36 O;  1SQG A;  4DV2 O;  2QA4 V;  4GT1 A;  1KUQ A;  3ZHR A;  4JAS A;  3CMA V;  1W0J G;  2WA4 A;  1MZE A;  1COW G;  4LH6 A;  3CCU V;  3ZS8 C;  1M90 W;  4LF4 B;  3OTF A;  2EIM C;  1HR0 O;  4LNU B;  5EBM C;  2X6C A;  2XAS A;  3BAA A;  3GWK C;  3JAW B;  5KUM A;  2ZR3 A;  1MG1 A;  4I0X A;  1YJ9 V;  4DK0 A;  2PYJ A;  5IY5 B;  1B06 A;  3HKC B;  3E8H A;  1QR8 A;  2WLL B;  4OPH A;  4J11 A;  1K33 A;  3C90 A;  3O65 A;  2P6J A;  3OAA G;  1DK1 A;  1I5X A;  1I08 A;  5IJ0 A;  3HKE A;  2X6B A;  1FFX B;  1RPO A;  3JD3 A;  1AI7 A;  2V7Q G;  1YIJ V;  2VQE O;  4TV9 A;  2E76 B;  3P32 A;  1YVW A;  3HB3 B;  1V54 C;  4PI0 A;  2HEP A;  3FKS G;  1OCO B;  1Q3E A;  1XUQ A;  2JS3 A;  3KKY A;  4NB5 A;  3ZRW B;  1URF A;  3T2M A;  3LSS A;  3STZ C;  3DSQ A;  1Q6U A;  2K1E A;  4FFB B;  4O4L B;  4P9O A;  4FPP A;  4AQY O;  3K79 A;  4X64 O;  4N21 A;  1K8A W;  1FXK C;  4OXS A;  4ICG A;  5CN0 A;  4RUF A;  5CA3 A;  4GKK B;  1F4N A;  1B6Q A;  3E8F A;  3JAK B;  1GAX A;  4QIW F;  1BQ0 A;  1M57 B;  1ROP A;  1UJW B;  3LSU A;  2AZ2 A;  2QJ1 A;  5B1B B;  2KSD A;  4CH5 A;  2BOB C;  4LF5 B;  4DR5 B;  5LGU A;  5KMG A;  1ZUQ A;  4KXR A;  1U97 A;  1KBH A;  3HR0 A;  4F6E A;  3CRC A;  3R65 A;  5LMN B;  1N0N A;  5IJ9 A;  1OCO C;  4JI0 B;  1Y66 A;  2YIB D;  3LNM B;  1S72 V;  2NNU A;  3CXC U;  4GLX A;  3T1Y B;  4TQD A;  2GSM B;  1OCZ C;  4WBN A;  5JVD A;  4WFA V;  2AHY A;  1PNM A;  2AW9 A;  2ITD C;  1YZB A;  2OCC B;  3RT3 C;  1JFF B;  1PM9 A;  3ZJZ A;  5D5P A;  4B3T O;  3WB0 A;  5F2V O;  2QM7 A;  4H13 B;  1R6K A;  1SZT A;  2ZCE A;  2JK5 C;  4NTY A;  1PD3 A;  2JGU A;  2EBO A;  1M57 C;  1EZV H;  1OZ0 A;  4JI4 O;  4JTA B;  4JI8 B;  3DGE A;  3OMA B;  2AZ0 A;  4GX0 A;  3ZN1 A;  4K0K O;  3WB1 A;  5H6R A;  2LGW A;  2QTS A;  4NYK A;  1GN2 A;  2ZE6 A;  4JAU A;  3OD4 A;  3JAM N;  4FLX A;  1W0K G;  2ODM A;  1EN5 A;  3CCL V;  5CA0 A;  2NN4 A;  2BSK B;  3RYF B;  4B3R B;  4IHJ A;  4KFM A;  4I50 B;  4R50 A;  2IW5 A;  2Y4T A;  1ZX3 A;  5IYD O;  4DV5 O;  3RN4 A;  2EIK C;  4DV7 B;  3G67 A;  4CS3 A;  2F66 C;  1CPY A;  3FD9 A;  3ICX A;  2O57 A;  2UXC B;  4UCV A;  1M9N A;  1ZSP A;  1BE3 H;  4DV3 O;  3K57 A;  4FLZ A;  5B1A B;  1GN4 A;  4PDV A;  1WAZ A;  3JAS B;  2IU3 A;  2B1I A;  3AG1 C;  2EIL B;  2QKS A;  3AG3 B;  3ZRX A;  3HPL C;  4JTC B;  2DWD C;  3ASO C;  5CA1 B;  2OTJ V;  3A0B Z;  5LYJ B;  3I56 V;  1IUR A;  3K58 A;  3JCU Z;  2HHH B;  4F6R B;  1E1Q G;  3STL C;  3ZMT A;  1N34 B;  4FZ0 A;  3OGI B;  4FK5 C;  1HNX B;  1NVP B;  1Y76 A;  5JJJ B;  2UUA O;  1PL4 A;  1BSM A;  2AGA A;  4P30 A;  1IVS A;  1J95 A;  3ABM C;  1BS3 A;  3OW2 U;  2CTP A;  1XDC A;  1SKV A;  2ZM6 B;  2YUA A;  2CH7 B;  1Y67 A;  2JS5 A;  3CRA A;  3E35 A;  1V9P A;  4CC5 A;  2CGO A;  2R70 A;  1JJ2 U;  3PJS K;  2YIA A;  2DQ0 A;  3BHP A;  3A2F A;  2UUB B;  1YI2 V;  4NVP A;  1B3Q A;  2IM9 A;  1GM7 A;  4EB6 B;  2QSA A;  2WWW A;  4GKK O;  4JZG A;  4BIZ A;  1VIB A;  1QVG U;  1YF2 A;  4XDK A;  3H1K H;  4JV5 O;  2YXH A;  4U7O A;  1O9G A;  4C7U A;  2QE7 G;  3K5N A;  5LOV A;  2X7R B;  5KHH A;  4RQE A;  4OX9 O;  1MSW D;  4YJ2 A;  1S5L Z;  1NZ6 A;  2XAG A;  3B09 A;  1TA8 A;  4NR1 A;  4PI2 A;  3OEH G;  1R3L C;  4GCZ A;  1KP3 A;  1HNW B;  2QWO B;  1QBZ A;  3L70 H;  4X1I A;  2UU9 B;  3F7V C;  3F5T A;  1YDX A;  5LMN O;  4JZ2 A;  3ZHV A;  1VF5 B;  5B66 Z;  1F4M A;  2P90 A;  3ABK B;  3AK2 A;  1WB7 A;  1FS0 G;  3ETD A;  1RPR A;  5B1N A;  3JAT A;  3E86 A;  1XNR O;  1XQ8 A;  1SQQ H;  1M56 C;  2D2C B;  4J42 A;  3X2Q B;  1N8R W;  3MHS C;  4LP8 A;  2KG7 A;  4DV4 B;  4DR1 B;  1VF6 A;  3K06 A;  2H3O A;  3RYI B;  1YHQ V;  4LWS B;  3D3Q A;  3SJB C;  3SJA C;  2PZS A;  2XT9 A;  3N2G B;  1RM1 B;  3J81 N;  4L8J A;  3CJH A;  4D7S A;  1NR7 A;  1YXB A;  4DUZ B;  5KA6 A;  4DYL A;  5C93 A;  2DMX A;  5C8Y A;  4X1Y A;  1THZ A;  2WSS G;  4QNH B;  5DEC A;  3D36 C;  1K7D A;  5L3D A;  3TGU H;  2HLD G;  4O4H B;  2A79 B;  1XL4 A;  4DR2 B;  3WG7 B;  2PI5 A;  1L1F A;  3OMN B;  1Q43 A;  4CS4 A;  1P7B A;  2EIN B;  1IDS A;  2B5U A;  1GN6 A;  2JVD A;  2RJZ A;  3W7S A;  5LXT A;  1IBK B;  3H01 A;  2ZKO A;  5KAF Z;  3L72 H;  2ZDI C;  2CGN A;  4Z2W A;  5IYB O;  2YS8 A;  3MAQ A;  4O2A A;  2JRI A;  4TSF G;  1D5A A;  2NR5 A;  2FL4 A;  2ADP A;  2E5L O;  3RYC B;  2ARH A;  1Q90 D;  3TXS A;  2DYS C;  2Q5Z A;  4W4K A;  1NI8 A;  5GON B;  1Y74 B;  5ITZ B;  4TQF A;  1NTK H;  1JOY A;  1MSD A;  3ABU A;  2Q69 A;  4G2K A;  1WA8 A;  5JJN B;  4PHZ A;  4PDR A;  4W4L A;  1S5H C;  3U11 A;  4H37 A;  5JQG A;  2F4V B;  4DR4 B;  3A0R A;  4CH3 A;  4O2B B;  1VEW A;  2RNB A;  2P7T C;  2HP8 A;  5BXZ A;  4ZOL A;  5CBG A;  2XND G;  2HHH O;  4UB8 Z;  3ABL C;  1ORQ C;  4TUY A;  5IDJ A;  2VRZ A;  3UM7 A;  4YHH B;  1KP2 A;  2ZD9 A;  1VQ7 V;  1HNX O;  5E79 Z;  5EC2 C;  1KU9 A;  2XAJ A;  1MZF A;  5GTH Z;  2GUZ A;  3AK3 A;  1NBM G;  1W59 A;  3K0D A;  4DV0 B;  4GX2 A;  2BTQ B;  2ZM6 O;  1TGO A;  1SQF A;  3OM3 B;  4B3S B;  4QE7 A;  5H9C A;  5EC1 C;  3T1H O;  1AP5 A;  3TET A;  2XAQ A;  4I5S A;  5KHJ A;  4FLU A;  4LFA B;  1Q8I A;  1H8E G;  3HKB A;  2RN9 A;  4JI7 O;  5LP6 C;  1KC8 W;  3QVN A;  3DXR B;  1SES A;  4KHP B;  1SET A;  1YJN V;  2ZNI A;  2WLH A;  2UUB O;  4B08 A;  1VF6 C;  1FJG B;  1XHZ A;  3OEE G;  2EIM B;  2DE0 X;  4WFE A;  4X20 B;  1R73 A;  3THO A;  1AJP A;  5EK0 A;  3E8G A;  4LNU A;  3JCZ A;  3CRR A;  2P4V A;  5BMV B;  3MDS A;  2JIZ G;  3IAY A;  1EN4 A;  2IJI A;  1JCH A;  1MA1 A;  3ETQ A;  1BHA A;  4JYY A;  1H2M A;  3ZHQ A;  2ZE8 A;  2PY5 A;  1FFX A;  2UU9 O;  1M5I A;  4J7K A;  1VQN V;  2QM4 A;  2VQF B;  1IXB A;  2EIJ C;  1EFR G;  5LGN A;  4ZIB A;  2N74 A;  2RMK B;  1L0L H;  4UCS A;  4WFH A;  4X1K B;  1IX9 A;  4GYC B;  1Y4M A;  3K03 A;  4BAY A;  4ZI7 B;  3W7U A;  3J7A U;  4O4L A;  1PP9 H;  4FFB A;  1F7Y A;  1FXK B;  5J2T B;  3UO2 A;  2KKW A;  4CH6 A;  2Z0A A;  2LQT A;  4PA7 A;  5A2Q N;  4UVC A;  1M93 A;  4WFB V;  5LHG A;  2QKC A;  2MK3 A;  2G38 A;  3IJ4 A;  1VQL V;  2IBZ H;  4DV4 O;  1VQK V;  4UV8 A;  4DR1 O;  4HAM A;  4MTG A;  4ZHQ B;  1LUW A;  4O4I B;  4DO2 A;  4DV6 O;  3F7Y C;  3P3N A;  2Q4P A;  1R1B A;  3APO A;  3J80 N;  1O9H A;  4JTD B;  4RUE A;  2YDE A;  1ZL8 B;  4HYO A;  4MSW C;  4B7E A;  2QWN B;  4DR6 O;  4MVS A;  3SPI A;  5CBF A;  1NH2 D;  4LFB B;  3SDL A;  4QE9 A;  1JQ0 A;  3OFN G;  4U3J A;  4DUZ O;  1EM1 A;  4JGS A;  3JD2 A;  3ASN C;  4DV1 B;  5FLX N;  1QLN A;  1SQX H;  1S77 D;  1PNL A;  3AG7 A;  2CE4 A;  3FB6 C;  3CC7 V;  4DR2 O;  5LMU B;  1OCZ B;  1H2S B;  1JJO A;  2Y0P A;  1Z2G A;  3OR6 C;  1AJN A;  2YXL A;  4L87 A;  1I5Y A;  1KD1 W;  2GV9 A;  4YJ3 B;  2IJJ A;  4J9Z B;  3BAB A;  4D6T H;  2Q6A A;  4X88 A;  2QM8 A;  2QDO A;  4NXM B;  2PTM A;  1HWY A;  1XEQ A;  3VBB A;  2RCV A;  3CRM A;  5FPR A;  3TCU A;  2L6L A;  5J2U A;  4UUJ C;  3OT7 A;  3ZMU A;  3E22 B;  2CUG A;  4GZR B;  1WP7 A;  3L73 H;  3K08 A;  4LF8 B;  3KZI Z;  1K4D C;  4I0X B;  3S3X A;  1D5N A;  2UUC O;  3EHB B;  2FB5 A;  4JI6 B;  4IIJ A;  1IZ3 A;  5A9G A;  3ZBH A;  4WCE V;  1Q81 W;  3UKM A;  4DR4 O;  1SS3 A;  4GX5 A;  5IJ0 B;  3CCS V;  3Q4H B;  2BSK A;  3RYF A;  1PNK A;  1G1X B;  4BWA A;  1GM9 A;  4U3F H;  4TV9 B;  4I50 A;  3CCV V;  4ZKI A;  2Q0O C;  3RFR A;  2A0L A;  2JJ2 G;  2LJ2 A;  1TVK A;  3D8C A;  3SPG A;  1XRE A;  1BQZ A;  5JCO A;  4TV8 A;  2EIK B;  1VMG A;  3JD1 A;  3FAV A;  2PUS A;  2D3O W;  3NR7 A;  4DV0 O;  1QU7 A;  3BY6 A;  2YI9 A;  4PD4 F;  1XNQ B;  3BPZ A;  4B3S O;  3OMI B;  5CB4 B;  4AI8 A;  4LFC B;  4E4E A;  4WFF A;  4LFA O;  5BR8 B;  5DM6 V;  1XMQ B;  3AG1 B;  3K5M A;  3K3W A;  4B7K A;  3AK1 A;  4LF6 O;  3G80 A;  5HFL A;  2P22 C;  4TT3 G;  2X6A A;  3M99 B;  2DQ3 A;  1FJG O;  2UXN A;  2W0X A;  5KA5 A;  3ASO B;  1R3J C;  2FYU H;  3ETG A;  1NH2 B;  2W0F C;  5IWA B;  2UXB B;  3MHH C;  4J7J A;  3SYC A;  3JAL B;  1I94 B;  5KMG B;  1B04 A;  4JI3 B;  4MTO A;  4F6R A;  5H5N A;  3K9S A;  2IJH A;  4DUY B;  2FKX A;  1AI4 A;  4YIO A;  3H1H H;  4JI1 B;  5IJ9 B;  3H1L H;  3ABM B;  1X59 A;  2R9A A;  1EZJ A;  1KMI Z;  2ZNJ A;  2P67 A;  2HVJ C;  1GKF A;  2VQF O;  5E1A C;  2CH7 A;  4WBN B;  3UO3 A;  1XI1 A;  1N33 O;  4JAV A;  1DGS A;  3ZIA G;  2Z3Y A;  3QTC A;  3CCE V;  5J9P C;  3K9A A;  4J9Y B;  2W6J G;  4BIO A;  5L3C A;  4PA3 A;  3VQY A;  4DK1 A;  4MT8 A;  1QQC A;  4TOI A;  3CCR V;  1WP8 A;  3KCY A;  1GTO A;  3ZRS A;  4EKW A;  5B3S B;  3B77 A;  4EB6 A;  3ML0 A;  2A9H A;  4LF4 O;  2JEX A;  3LUT B;  4P9P A;  5B5E Z;  2R72 A;  4DRX A;  3FYE B;  4GKJ B;  3CS5 A;  2M6Y A;  2Q0A A;  4ABM A;  4UFZ A;  1YIT V;  1YJW V;  2ZIN A;  2ZE7 A;  4LF7 B;  3SYP A;  3LDE A;  2A06 H;  4IGG A;  3B8N A;  2F95 B;  1KEC A;  4PA4 A;  4JYA B;  2JGD A;  4LH7 A;  3ABT A;  4LFB O;  3CD6 V;  1XIL A;  3QO8 A;  3JAR A;  4IHJ B;  4X65 B;  2OCH A;  3H1J H;  3BEH A;  1V55 C;  4NXN B;  4R7C A;  4IT5 A;  2ZXW C;  5JCO C;  3N2K A;  2ZIO A;  5CMU A;  1P4R A;  3ZMV A;  4G27 B;  1P49 A;  1M56 B;  1AVM A;  3D3I A;  1TUB A;  1LUV A;  5LHI A;  2ZE5 A;  4NTX A;  5B3S C;  5LHH A;  3HKD B;  3A8T A;  4I9Q A;  5KLV H;  3JD4 A;  1SA0 A;  2PYL A;  4NTW A;  4LR3 A;  3GWO A;  5EZY A;  3N2G A;  2LW7 A;  2HKO A;  1Y6X A;  4LF5 O;  1BL8 A;  3BVO A;  1BT8 A;  4DR5 O;  4K8X A;  4D7T A;  2CAZ C;  2YXY A;  4LF8 O;  2E3C A;  4MW8 A;  4DW1 A;  1VQ8 V;  4YY3 B;  2UXD B;  1XOU A;  3TXQ A;  4JI6 O;  3K04 A;  2EUL A;  4K8Z A;  4JI0 O;  1Y76 B;  1AB3 A;  3CC4 V;  1NT2 B;  3WU2 Z;  1TAE A;  3T1Y O;  1YTF D;  3RW0 A;  1SC5 B;  2EZP A;  4HNA A;  5AG2 A;  5GW7 A;  2E74 B;  2A3Q A;  4LF9 B;  3KG2 A;  4NKG B;  1R3K C;  2PF4 E;  1J5E B;  1K34 A;  2X0L A;  3AG4 C;  5LA6 B;  5B1O A;  4DV2 B;  2HJD A;  1RFY A;  3RYC A;  2WAM A;  2DYS B;  1ZLZ A;  1RP3 B;  2KB1 A;  5IYC O;  2R9R B;  5BR8 O;  4JI8 O;  2DWE C;  3L71 H;  1HR0 B;  2OIG A;  5GON A;  3SJC C;  2YID A;  1QVF U;  3NXS A;  5LOV B;  2B9Z A;  3H9V A;  2Y69 C;  1VQM V;  4MVR A;  2GBO A;  2WLI A;  4JAA A;  4O4J B;  3RVY A;  1QHT A;  3ZHT A;  2Q7G A;  4O2B A;  2UXB O;  4Z1V A;  3ZX6 A;  3ABL B;  3DTU B;  4MTX A;  4B3R O;  2YEV A;  4JI3 O;  2WLN A;  2Y0I A;  4X1I B;  5CBH A;  3GB7 C;  4DUY O;  3C3T A;  2LW1 A;  1N32 B;  1ZTE A;  4QPJ A;  4JI1 O;  1D2D A;  1H2G A;  1NU1 H;  2LGQ A;  3QNE A;  4BR6 A;  2WLM A;  1QCE A;  4DV7 O;  3JSN A;  5KX5 A;  4X9Q A;  4J10 A;  3UT5 A;  2BTQ A;  4LBE C;  5H6Q A;  2XOK G;  2UXC O;  1H8H G;  1F23 A;  3JAT B;  3SPH A;  4AQY B;  2ILM A;  2ZR2 A;  3N27 A;  3WFV A;  4X64 B;  4CZZ A;  1FAF A;  3ZCC A;  5LP6 B;  1AIL A;  1SQV H;  4DXW A;  2H94 A;  2KG7 B;  1AR1 B;  3CCM V;  4FFK A;  4PDM A;  2YSU B;  1OJH A;  3CSX A;  4CS2 A;  2Y48 A;  1JR9 A;  4UVB A;  1IBL B;  4FJC C;  5JH7 A;  2C2A A;  2LO1 A;  3M8A A;  3CJH B;  5K1P A;  2OT5 A;  4I55 A;  1H2K A;  3AEI A;  4F4L A;  1N34 O;  4LF7 O;  2F93 B;  2DJV A;  2JDI G;  5LBQ A;  1VF7 A;  1SRY A;  4X1Y B;  1I0H A;  5EYP A;  3R66 A;  4RAI A;  4XDL A;  4PA6 A;  3VQW A;  2AHZ A;  3QG5 A;  1AR4 A;  1CP9 A;  5IYZ A;  1BCC H;  3F5W C;  3BA8 A;  1YTF B;  4K3A A;  3G6E V;  2ZQM A;  2EIJ B;  1ARO P;  4PV1 B;  1MOF A;  1R6N A;  5JJE B;  3EVK A;  3P3P A;  1MNG A;  3FB7 C;  3E83 A;  5GTI Z;  4BIU A;  3L74 H;  5HFM A;  3CC2 V;  2OTL V;  4I4T B;  3ZN0 A;  5J2T A;  3CP1 A;  4O2A B;  3FYI B;  4JYC A;  1K5Q A;  4XBF A;  1JVM A;  1OCC C;  2QWR B;  1BMF G;  4J7Z A;  2CDY A;  1FXH A;  3JAW A;  1US6 A;  4UV9 A;  4JI2 B;  2WPD G;  1NQT A;  2GTS A;  2V1D A;  3HKC A;  1JPX A;  4K0K B;  4TWK A;  2FTK A;  2WLL A;  1WA8 B;  1NS1 A;  2VS0 A;  2XUM A;  1XHX A;  5JQG B;  3RYH B;  1K5S A;  2YC0 A;  1FFT B;  2Z5U A;  3ASN B;  1HNW O;  2DYR B;  1FYJ A;  3UQ8 A;  4ZOL B;  4LC1 A;  5EIB C;  1VQ9 V;  2DW4 A;  1UFI A;  2HG5 C;  4TUY B;  3ZED A;  4N23 A;  1ZWI C;  2E75 B;  1PKX A;  2H8P C;  4JPR A;  4FLT A;  2EJ7 A;  4DV5 B;  2AXT Z;  2GUZ B;  3CPW U;  4ZBM A;  3E2E A;  5FNV B;  3ZRW A;  1M1K W;  3W7T A;  1RSO B;  4PDL A;  3W7W A;  3U0Z A;  3OUF A;  4YJ3 A;  3CCJ V;  1NTZ H;  4I9W A;  2HJF C;  2R9I A;  4FLW A;  4DW0 A;  4DV3 B;  2CTW A;  2OYQ A;  4LF9 O;  1JMK C;  1XL6 A;  3O9O A;  2HR3 A;  4MVZ A;  3SJQ C;  3JAK A;  4IL6 Z;  1JA8 A;  1W2B U;  3SPC A;  1K3E A;  4FVM A;  4MVU A;  3E22 A;  3ZHU A;  2W6I G;  1K92 A;  4HBN A;  4YIP A;  3B2E E;  3B8M A;  2XTA A;  2CTR A;  2HVK C;  1KYO F;  4YXW G;  2BE3 A;  2DYR C;  1AR5 A;  1QLE C;  5KHI A;  4IYH A;  1OV9 A;  2UUA B;  3CE2 A;  4H0L B;  3Q4H A;  4UCR A;  4RWU A;  1E1R G;  2XHB A;  3G4S V;  1WLE A;  1HP8 A;  1N32 O;  1IBK O;  4UB6 Z;  1SER A;  1TUE B;  3BA9 A;  1JFF A;  2Q8V A;  3OE7 G;  3T1C A;  1DTO A;  2Q68 A;  5CB4 A;  2F1M A;  2QWP B;  4X62 B;  3EXA A;  2OWO A;  4FZ1 A;  3VQV A;  3CXH F;  1GM8 A;  1P7G A;  4PA9 A;  2ZT9 B;  1U96 A;  1H2N A;  4JV5 B;  2JJ1 G;  1IBM B;  4Q20 A;  1BZK A;  4JF3 A;  4OX9 B;  3LSQ A;  5IY5 C;  1YSC A;  4KL1 A;  1IBL O;  2F4V O;  4FLY A;  1VQ5 V;  1OCR B;  4FM2 A;  4FM1 A;  4FMT A;  3HKE B;  3UCS C;  3JAL A;  4U3J B;  1I7F A;  1FD9 A;  4YHH O;  3CWB H;  4B3M B;  1NVP D;  1SQP H;  1S5J A;  3OUS A;  2A7W A;  4H33 A;  1L0N H;  2MW2 B;  3B40 A;  3BCC H;  1K97 A;  3SGI A;  2P4K A;  4DR7 B;  4GX1 A;  2EX3 A;  1XNR B;  3CB2 A;  4MVQ A;  2QWQ B;  3GVM A;  3JYC A;  3ZMS A;  2Y4U A;  3RWR D;  3JAS A;  1AI5 A;  4RQF A;  3IFX A;  2QEX V;  4JI5 B;  1VQ6 V;  1EN6 A;  4KHP O;  1FKA O;  2OIE A;  4ASU G;  4K35 A;  2YI8 A;  5J2U B;  2HFE C;  4EFE A;  2L35 A;  1ZAU A;  2GDS A;  5B1B C;  1G4Y B;  5CA1 A;  1OCR C;  5LYJ A;  4JI2 O;  1MMM A;  4A5U B;  1MAB G;  2ETN A;  2RDC A;  1EBO A;  4UVA A;  3RBZ A;  4IIJ B;  3B4S A;  1L8D A;  1UPG A;  4AIL C;  2FML A;  2YIB A;  3FFQ A;  1Q6I A;  2VWK A;  1V55 B;  3DC5 A;  2ITC C;  3E8B A;  3L9D A;  5JVD B;  2RQ6 A;  1X4T A;  1TVK B;  3JSL A;  1JX9 A;  2ZXW B;  3SR2 C;  4TV8 B;  4IYI A;  3FAV B;  2IU0 A;  5IE9 A;  2OCC C;  1YEW A;  1Z5V A;  1HDJ A;  2KQX A;  5KHG A;  1K73 W;  3CRQ A;  1F51 A;  4QPK A;  3SYO A;  2E5L B;  1H2L A;  2WLK A;  3RGB A;  4MTF A;  2EZO A;  4UCT A;  3HKD A;  4UCU A;  4X89 A;  4MVO A;  1Q5O A;  5BZB A;  3TJT A;  4MS2 A;  1GN3 A;  3FB5 C;  4X66 B;  4G28 B;  4DR3 B;  4GUN A;  5CA0 B;  3OGC C;  3D36 A;  3ZRV A;  1LNQ A;  1DLB A;  3G6B A;  4DV1 O;  1AI6 A;  1NKD A;  3H1I H;  1AP6 A;  3G71 V;  3APQ A;  1LR1 A;  5EBL C;  2LP7 A;  5LMU O;  5IT9 N;  2DOS A;  1OHH G;  2BTO A;  3L75 H;  4FIP C;  5K1X A;  2ZIM A;  2ZDI A;  3T1H B;  1NR1 A;  3LDD A;  4QGP A;  1HW7 A;  3DC6 A;  4NXM O;  1PL0 A;  4E2L A;  3AG4 B;  4JI7 B;  4J80 A;  4P2Z A;  3RYI A;  3CCQ V;  4PJ0 Z;  3QO5 A;  4LWS A;  5B1A C;  5LA6 A;  3PN1 A;  4BW9 A;  3CME V;  1NJI W;  4X62 O;  3IC9 A;  2N05 A;  2P06 A;  3CX5 F;  1HNZ B;  2EIL C;  4FLV A;  3P30 A;  2BCC H;  2IJK A;  3AG3 C;  3OR7 C;  4RO2 A;  4DRX B;  5L3E A;  2Y69 B;  1IBM O;  1NTM H;  3I55 V;  1KQS U;  4LCU C;  4OPA A;  3ZMZ A;  5EBW C;  4O4J A;  4R6Z A;  3OTO B;  4O4H A;  5JWP A;  2XAF A;  1AJQ A;  3CEI A;  4MW3 A;  5FPO A;  3MD0 A;  2JGD B;  5EIB D;  4MVM A;  1G6U A;  1VQ4 V;  3JAR B;  2EJR A;  1KKD A;  1CEZ A;  1XMO B;  4EEQ A;  2QKA A;  1GMG A;  4B3M O;  3LNN A;  1Q7Y W;  3JD0 A;  2PGG A;  1K4C C;  3N2K B;  2QR4 A;  2Q67 A;  1N36 B;  1BGY H;  1XNQ O;  2F23 A;  4DR7 O;  4Z1M G;  4LFC O;  1TUB B;  5LP6 A;  1WN7 A;  1YCI A;  1XMQ O;  3ZHS A;  4H44 B;  5LGT A;  4JI5 O;  1Y74 A;  5L3G A;  5ITZ A;  1QNM A;  2K9P A;  4DV6 B;  1SA0 B;  1VQP V;  2Q9L A;  5DED A;  2GHY A;  5EZY B;  1G8M A;  4KUM A;  1IXM A;  2NLJ C;  4XDJ A;  1BHB A;  5IWA O;  4YJ2 B;  4DR6 B;  4AHC A;  1I94 O;  5L3B A;  4OGQ B;  1S3J A;  5KUK A;  1H38 A;  1Q6H A;  2VQE B;  4KP4 A;  3K5O A;  4Q6G A;  3SYQ A;  1KB9 F;  5BY1 A;  5FL7 G;  1T5E A;  1M4U A;  2PI4 A;  2M7W A;  3VQX A;  1SQB H;  1GH6 A;  3ABK C;  2QGN A;  4HNA B;  2QTO A;  2BOC C;  2IH3 C;  1FPO A;  4HZ3 A;  3QO7 A;  5DN6 G;  2IH1 C;  1S76 D;  3E89 A;  1QR9 A;  3X2Q C;  3DXR A;  3IC7 A;  2WA3 A;  1R3I C;  4X8A A;  4I4T A;  3A0H Z;  1OCC B;  1WJZ A;  2F43 G;  4J41 A;  3K5L A;  2XAH A;  1DF5 A;  3SPJ A;  2CK3 G;  4CH4 A;  4X20 A;  3VOU A;  2JEU A;  2LFR A;  3AG2 B;  4WF9 V;  4GKJ O;  1N4C A;  2UXX A;  1RM1 C;  5BMV A;  1Q86 W;  1GRJ A;  3QF7 A;  4JYB A;  2UUC B;  2B1G A;  2N04 A;  1GK9 A;  1E79 G;  5C8Y B;  3CYO A;  5TIS Z;  3ETE A;  4WFG A;  4EFB A;  2WLI B;  4JYA O;  4X66 O;  3KCX A;  3RYH A;  1Q82 W;  4DR3 O;  4UXN A;  3TK1 A;  1WPX A;  2CTQ A;  3S3W A;  5KHK A;  2YEV B;  1XBL A;  3WG7 C;  4X65 O;  4CC6 A;  3M7M X;  4NXN O; 
#chains in the Genus database with same CATH homology
 4JI1 O;  5LMU O;  1HR0 O;  1D2D A;  5IT9 N;  2DOS A;  1N32 O;  1IBK O;  2LW7 A;  2N74 A;  2VQF O;  4DV7 O;  4LF5 O;  4DR5 O;  4JI2 O;  1N33 O;  2UUC O;  5IWA O;  2UXC O;  4A5U B;  1XNR O;  4OPH A;  1YZB A;  4LF8 O;  1NS1 A;  3RT3 C;  1I94 O;  3O65 A;  1DK1 A;  5BXZ A;  1F7Y A;  3J7A U;  4NXM O;  4B3T O;  4JI6 O;  1HNW O;  4DR4 O;  2HHH O;  1FYJ A;  2Z0A A;  5A2Q N;  2VQE O;  2UUA O;  1AIL A;  1G1X B;  4JI0 O;  1HNX O;  2AGA A;  1A32 A;  4DV4 O;  1AB3 A;  4DR1 O;  5BY1 A;  4X62 O;  4JI4 O;  1R6T A;  4LF4 O;  3T1Y O;  4DV6 O;  1R1B A;  3J81 N;  3J80 N;  4K0K O;  1HNZ O;  2ZM6 O;  3M8A A;  4DR6 O;  1IBM O;  4DV0 O;  1IBL O;  2F4V O;  3T1H O;  4OPA A;  4YY3 O;  3JAM N;  3SDL A;  2UXD O;  4AQY O;  1N34 O;  4LF7 O;  4X64 O;  4B3S O;  4DUZ O;  2DJV A;  4LFB O;  4LF9 O;  4JI7 O;  4LFA O;  3R66 A;  3OTO O;  4YHH O;  5FLX N;  2UUB O;  4GKK O;  5BR8 O;  4LF6 O;  4DR2 O;  4JI8 O;  4JV5 O;  4DV5 O;  4GKJ O;  1FJG O;  4B3M O;  1XMO O;  4OX9 O;  2ZKO A;  1XNQ O;  4DR7 O;  4JYA O;  4LFC O;  2UXB O;  4DV3 O;  2JRI A;  4X66 O;  5H5N A;  1J5E O;  1XEQ A;  4DR3 O;  5LL6 Y;  1N36 O;  4B3R O;  2FKX A;  2E5L O;  4JI3 O;  3F5T A;  4DV2 O;  4KHP O;  4DV1 O;  1XMQ O;  1FKA O;  1KUQ A;  4DUY O;  5LMN O;  4X65 O;  2UU9 O;  4JI5 O;  1X59 A;  4NXN O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...