1N34O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n34O00
2LW7A 4DV2O 1IBLO 4LF7O 2VQFO 4GKJO 4LFBO 4X66O 2VQEO 4DV4O 1X59A 4OPHA 3SDLA 1I94O 5IT9N 5BXZA 4X65O 4LF6O 5FLXN 3R66A 5A2QN 1KUQA 4JI2O 3JAMN 3J81N 4JI5O 4DR1O 1XNRO 4DV5O 4DR5O 2Z0AA 4DV6O 1IBMO 4LFAO 2UUAO 2F4VO 1HNZO 3RT3C 4GKKO 1NS1A 4DR7O 5BY1A 5H5NA 2E5LO 5LL6Y 2DJVA 4A5UB 3T1HO 2DOSA 4LF4O 4DUYO 4DR2O 2FKXA 4JYAO 3J80N 3M8AA 1IBKO 4NXMO 2JRIA 4DV3O 4NXNO 5BR8O 4LFCO 1AB3A 1N34O 2UXDO 1D2DA 5LMNO 1FKAO 1R6TA 1F7YA 1XMOO 4K0KO 4B3RO 4JI4O 4LF9O 4KHPO 4OPAA 2UUBO 3T1YO 4YY3O 4X64O 4X62O 4B3TO 4JI8O 4LF8O 2AGAA 4DUZO 3J7AU 1N33O 4JI6O 1XMQO 1N32O 4OX9O 2UXBO 1G1XB 1YZBA 4JI3O 4DV7O 4DV1O 5IWAO 4DV0O 2UU9O 1HNWO 1R1BA 1XNQO 4B3MO 1J5EO 1AILA 4B3SO 1XEQA 4DR3O 2ZKOA 3O65A 4JI7O 4DR4O 2ZM6O 4JI0O 3OTOO 2UUCO 4YHHO 1HNXO 5LMUO 4JV5O 3F5TA 4DR6O 1DK1A 1N36O 2HHHO 4AQYO 1HR0O 1FJGO 4LF5O 1FYJA 4JI1O 2UXCO 2N74A 1A32A
chains in the Genus database with same CATH superfamily
3CCLV 3RWRD 4FVMA 4TV9A 1IBLO 4MTGA 3JALA 4Z1MG 3ABMB 1JOYA 3AK2A 3JAWB 5LGUA 1W0KG 3WG7B 1G6UA 5CB4A 2WLNA 1L0NH 2ZE6A 3P32A 3UO3A 4DR3B 1Y4MA 2UXNA 4XDJA 3RN4A 4JI5O 2AHZA 2QGNA 4DR1O 4JAUA 4E2LA 4X64B 4I55B 4U7NA 5DECA 1Y74A 2LGWA 3D8CA 3MD0A 3OW2U 1AJNA 4MW8A 2VQFB 2FKXA 4FK5C 4LFBB 1OZ0A 4QPJA 4FZ1A 2DYRC 1NTKH 5BR8O 2HVKC 4YJ2A 5EIBC 3RYFA 5B5EZ 4X8AA 1F7YA 1GH6A 1P4RA 3JASA 2XUMA 3N2KA 5KX5B 2A06H 2M7WA 3JCUZ 2A7WA 2Q8VA 5C93A 2DMXA 3HKBA 2LW1A 3FB7C 2ZR3A 3J7AU 2LFRA 2V7QG 1M9NA 3GB7C 4JI6O 1XHZA 1Q81W 1TUEB 1YZBA 4BW9A 1ZTEA 3CCMV 4B3SO 4G27B 3F7YC 1M93A 1ZL8A 1GM7A 2ZM6O 4CH6A 2P06A 1YJ9V 4O2AB 2IH1C 4O2BB 4JF3A 1Q6HA 1FYJA 3DXRB 1U97A 1SC5B 1A32A 3ZRVA 2IU3A 2ZE8A 4BIOA 3T1YB 5KHHA 3FAVB 2KG7A 4IGGA 1H2GA 4PDLA 2BSKB 4HNAA 3H1HH 1SKVA 5J9PC 1QHTA 2X0LA 1IBKB 3JD1A 1M5IA 5IY5B 3ZMTA 2CH7B 1R3JC 3WB1A 4QGPA 4PELA 1VF7A 1P7BA 3VOUA 3OUFA 3E2EA 1VEWA 2Z0AA 3AG1B 4YY3B 3K03A 4LFAO 1EN4A 4PDMA 1JA8A 1Q5OA 2GUZB 2ZD9A 1Q82W 1SRYA 3SYPA 1FFXB 1KKCA 3CRMA 3CC7V 4JYAO 2M6YA 5EK0A 4DK1A 3DGEA 3LDCA 1SQPH 1E79G 2ZDIA 3SR2C 2EX3A 4I9WA 5LGTA 1M90W 4K3AA 4QJFB 5CA0A 5KA5A 3E86A 4JGSA 3SYOA 3G71V 3BEHA 4B3TO 4LF8O 1N33O 2QDOA 4P2ZA 4X1KA 4FLWA 1WP7A 5EYPB 5LOVB 1Q43A 4JI7O 4JI0O 1R6NA 4D6TH 2QWQB 3CE2A 4EFBA 3W7UA 1AI5A 4DR6O 3WFVA 2ARHA 1ORQC 3AG3B 5KHJA 4PI2A 2OCHA 3FYEB 1XUQA 4O4HB 1E1QG 2AHYA 1X4TA 1M56C 3CMEV 5KHIA 4W4KA 4LBEC 4AI8A 2CGNA 4WFHA 2YXLA 4DUYB 1NVPD 1JMKC 1P49A 4OXSA 2QM8A 4X66O 4DV4O 2CTPA 4OX9B 4X65O 1L0LH 3QTCA 3SPJA 4HZ3A 1LUVA 1FXKC 3SYAA 3ABLB 3LSUA 1JJ2U 4O4IB 3CHXA 1K4DC 3JAMN 2GHYA 1AI4A 1OCCC 1QLEB 5CN0A 3ETDA 4X62B 1YJWV 5IYCO 4PV1B 4DR7O 3ZHRA 3JD0A 5LL6Y 4G2KA 1QVFU 3N2GA 4DV0B 1XREA 2L35A 3CCRV 4ZI7A 2WLLA 1QR8A 1TAEA 1NTMH 1KMIZ 1Y76B 3UCSC 1XMOO 1WA8A 4Q6GA 1IURA 5B1BB 1ZSPA 1S0VA 1N8RW 5LHHA 1VQ6V 2UUBO 2PZSA 2UXCB 4JI8B 3ZMZA 4TSFG 2AGAA 3ABUA 3TJTA 1P7GA 1XOUA 2F93B 2UU9O 3ZHUA 1XEQA 1MZFA 3FB6C 1M57C 5HFMA 2YUAA 1YI2V 1K97A 4ZBMA 3KCYA 1WPXA 3BPZA 5LA6B 3ZEDA 4FLZA 4JV5O 1TGOA 4I50A 2PUSA 4JTCB 4NTYA 4GKKB 1AJQA 3RFRA 3IC7A 3ETGA 3B77A 2EZPA 3DC6A 5CA1A 3CPWU 1WN7A 4O4JB 1S5LZ 2EJ7A 2DYRB 1IDSA 2QM7A 2CTQA 3BRCA 2WLKA 1QNMA 3HKCA 1NTZH 2WLIB 3SJAC 2E76B 2MK3A 3A8TA 4TUYA 1VQ5V 4KHPB 2JK5C 4LNUB 5KMGB 1O9HA 1RSOB 3H9VA 4MVSA 5JVDB 1YIJV 5JQGB 3RT3C 1FJGB 3ZIAG 3ZS8C 5F2VO 5BY1A 3G6BA 2HKOA 2QR4A 2KB1A 4MSWC 4B3MB 2HEPA 5LBQA 3HKEA 1H38A 3C3TA 4NXNO 2UUCB 1VQ9V 1PNLA 3X2QC 1XL4A 4TWKA 3JSLA 4B3RO 1F23A 3TGUH 4J41A 2WLJA 4DW1A 4JI1B 1VQMV 1YITV 3OR6C 1VF6A 1KYOF 4TV8B 4YIOA 2UUAB 2OTJV 2P6JA 2P5OA 3T4ZA 1JVMA 1XNQO 3ETQA 2E5LB 5L3GA 1VQKV 2YXHA 3O65A 3SYQA 1YSCA 3AK1A 2EIJC 1KQSU 4FLXA 3ASNC 1G4YB 1SA0A 5ITZA 1THZA 4X1YB 4FMTA 4LFCB 3UQ8A 1N34B 4DV5B 1BL8A 4O4JA 5LXTB 4PA3A 4DV6B 2DQ3A 4IYIA 4QE9A 2HFEC 4DV2O 3ETEA 4RUEA 2NR5A 3G80A 2ZIOA 1DF5A 4DR2B 1PM9A 2WLHA 2LO1A 4FFKA 3OD4A 3UO2A 5GONB 2DW4A 5CMUA 4MTXA 2RCVA 1FFTB 4IIJA 4I4TA 4JTAB 1KECA 2FTKA 2ZNIA 3GVMA 4X9QA 4WCEV 3MDSA 2ZCEA 2OCCB 3W7SA 4MVZA 5C8YA 1OCZB 3CC2V 1NS1A 1VQPV 3K9AA 5JCOC 5FL7G 2YEVA 2UXBB 4JI3B 3SJBC 4NVPA 1HNWB 5LGNA 4EB6A 4B7KA 5EBMC 2ZQMA 4MTOA 3VQXA 3CX5F 4FPPA 4BW5A 1KBHA 3E89A 2EIKC 4NTXA 1D5NA 4JI4O 3QVNA 2GBOA 2JGDB 2VS0A 1JQ0A 2BOCC 2PYLA 3A0HZ 3JAKA 2QWRB 1CP9A 2JS3A 4GKJB 1E1RG 1M56B 2P4VA 4FLYA 1VQ4V 4NR1A 3CCVV 4FM2A 2XAHA 4IHJB 4DR4O 4KXRA 2UXXA 1I0HA 2XASA 2JJ2G 2F4VB 2CTWA 3IAYA 2LW7A 2QJ1A 4FZ0A 2YI8A 4RUFA 2QTOA 2DN9A 3SJCC 1SESA 1X59A 3NR7A 4I0XB 1PNMA 3ASOC 2BCCH 3DTUB 3K5OA 5L3FA 2V4DA 3CD6V 2Y4UA 1KUQA 3OE7G 1GN2A 4UB8Z 1U96A 1VQ7V 2BTQA 5CBHA 2ZXWC 2DE0X 4LC1A 3FB5C 5DN6G 4N21A 1FAFA 1XL6A 3CJHB 5EIBD 3T1CA 2QA4V 4R7CA 1N32B 4UCUA 4UVCA 3RVZA 5KLVH 4FFBA 3UT5B 2JGDA 3E22A 4C7UA 2W6JG 5IYDO 1M57B 4ZHQB 1O9GA 1GN6A 4X1IA 1MSWD 3ZRWA 3SJQC 1QLNA 1NI8A 1BZKA 4WBNA 4LR3A 3RYCB 1VMGA 1VF6C 2VRZA 3E8FA 4TQFA 4X64O 1VQ8V 5KUMA 2P22C 1BQZA 3OMNB 4H13B 3TXSA 3RYIA 1GO3F 3BY6A 1IVSA 5EZYA 5B1AC 3IJ4A 1SZTA 1VARA 1SETA 3TETA 2ZKOA 2WA4A 4XDKA 4LF6B 3MHHC 1PP9H 4QPKA 4YJ3B 2OIGA 2B1GA 2ZE5A 3F5TA 4HAMA 3ML0A 2Q0AA 4UV9A 3K79A 1D5AA 2E74B 2KKWA 3HPLC 4LH7A 4GT1A 2N74A 4R6ZA 1TUBA 2CUGA 2WPDG 1S77D 4J11A 3LSSA 3BHPA 4O4LB 4N23A 2K1EA 1V55B 1JX9A 3JAWA 4OGQB 3X2QB 3CP1A 5LMNB 1GRJA 2XAJA 2ZE7A 4XBFA 1G8MA 1K5SA 4JYBA 4LF9B 3L72H 1DF4A 3STLC 1XNRO 3UM7A 2YIBA 3R65A 1OCRC 4F6RB 4LWSB 3SPIA 1IBMO 5HFLA 1HNZO 1H2SB 3ZMUA 4PA9A 1XMQB 5KHKA 1FXHA 1XHXA 3L71H 2X6BA 4I55A 1PD3A 5H6RA 3K58A 4PA4A 5LYJB 1IBKO 1F4MA 1BQ0A 4ZKIA 1AB3A 1IXBA 2EIJB 1S76D 3ASNB 3RVYA 3B4SA 2WSSG 5B3SC 2EIMB 1NU1H 5KA6A 3W7XA 3B8MA 2EINC 4DYLA 3JARB 2Y0PA 2P4KA 4KFMA 4YY3O 5KX5A 2X6AA 3OR7C 2QTSA 3OFNG 3ZMVA 1N4CA 2YDEA 5IWAO 1R1BA 3JCZA 1YF2A 1W2BU 3BA8A 2HLDG 3H1LH 1BHAA 1OHHG 3PJSK 4JYAB 2C2AA 4Z1VA 4QNHB 2Y48A 1FD9A 1RM1B 1H2NA 2XAGA 4UCRA 4B7EA 2F95B 1V54B 4O2AA 2MW2B 4O2BA 1Y67A 1PV0A 2K9PA 2Q7EA 3DXRA 2B1IA 4R8CA 1OCOC 1IX9A 2E75B 1N33B 2YICA 1IXMA 1KC8W 3FAVA 4LWSA 4NXMB 2BSKA 4P9PA 4KL1A 3OGCC 1K73W 4IT5A 3OMAB 2EIKB 2HP8A 2GSMB 1QBZA 4X20B 5B1NA 2A0LA 1YCIA 2CH7A 4DR6B 5BZBA 4QE7A 4MTFA 4PI0A 5KAFZ 5IYZB 4FM1A 4J7ZA 1Z2GA 2VWJA 2LP7A 5TISZ 4DUYO 4UVBA 1Q90D 2GUZA 2W0FC 1FFXA 3OTOB 2Q69A 4W4LA 1B6QA 2JEXA 3RGBA 1HNXB 2GDSA 1D2DA 1N36B 4AQYB 3BFRA 4ABMA 2QWOB 4LF5B 3RW0A 2YIBD 2L6LA 1NJIW 4X62O 2DYSC 5LP6B 5L3BA 1WB7A 3FD9A 1TVKB 4DV0O 2OIEA 5IDJA 1I94B 3APOA 4WFEA 2W6IG 3ASOB 1Q7YW 2WLMA 4YHHO 3OMIB 4UUJC 3E8BA 1DGSA 5L3CA 1UFIA 4CS2A 1US6A 4PJ0Z 5EYPA 5LOVA 4JI2B 2HJDA 3DC5A 1MG1A 2HR3A 2ZXWB 2UXCO 4JI8O 2KQXA 2IJJA 2IJKA 1BGYH 4YXWG 5L3EA 2FB5A 3ABMC 4O4HA 3K0DA 1MSDA 3OT7A 5L3DA 4DV3B 3E35A 5IYZA 1Z5VA 1P84F 2XT9A 4BR6A 2IM9A 3FFQA 5JJJB 3D36A 4RQEA 2PI5A 1MA1A 2P7TC 4IL6Z 4O4IA 1EN6A 3K06A 5BMVB 4DUZB 2QKAA 4GKKO 2IW5A 3JD3A 2ZT9B 2PYJA 3L74H 4CBCA 5H6QA 2QKCA 2RDCA 2PGGA 5B1AB 1IZ3A 2A3QA 4LH6A 3SPHA 2DWEC 5LHGA 5D5QA 5LP6A 2Q9LA 4UCTA 3KKYA 2HHHB 4U3JB 4KHPO 1BSMA 1K4CC 1Y76A 5D5PA 1VQOV 5KUKA 1GK9A 3JATB 5JH7B 3A2FA 4LF7B 3L70H 5CBFA 2A79B 2P90A 1XQ8A 5J2UB 1VQLV 2IH3C 1AP6A 4BIZA 4B3MO 2QWPB 4X88A 2ZDIC 3S3XA 1M1KW 3AK3A 2UUCO 3AG4C 4XDLA 4GUNA 5LMUO 4MVRA 2YXYA 1DK1A 2ZR2A 4PA7A 1SZXA 1URFA 2PTMA 1EZVH 2NLJC 5LA6A 4JI1O 4ZOLB 3Q4HB 3CCEV 4GZRB 1R3LC 4MVMA 3HB3B 1SS3A 2AZ2A 4PHZA 1YDXA 1MABG 1GN4A 2HG5C 2V1DA 5IT9N 3OM3B 3G4SV 4BWAA 4BAYA 3P3NA 1JFFB 2ZINA 1B06A 3APQA 1J95A 2XOKG 3CB2A 3ZBHA 4K0KB 1K3EA 5JWPA 2RJZA 3EFFK 2EINB 1WB8A 4DV5O 3WB0A 4UCVA 2WLIA 4HBNA 4DV6O 2ATKC 5FNVB 4GCZA 3A0BZ 1K8AW 1HW7A 1GTOA 2H94A 3AG1C 3RYHB 3OGIB 4LNUA 4RAIA 1L1FA 5KMGA 1RSOA 5H9CA 5JVDA 1MMMA 5E1AC 4DV7B 4DV1B 5JQGA 5IYBO 4DR2O 1SERA 1J5EB 2HVJC 3FYIB 3EVKA 1GMGA 4PDRA 1UJWB 3U10A 2JGUA 2QWNB 2PI4A 1FKAO 3CS5A 2PF4E 1B3QA 1RPOA 1HR0B 5J2UA 1QVGU 5JJEB 1AI7A 3D3QA 2CDYA 3FKSG 3PN1A 2P67A 5B1OA 4QIWF 1MZEA 1H2LA 1SQXH 2UXBO 1G1XB 4JI3O 1JCHA 1HNWO 2VQEB 4H44B 5IJ0B 3CMAV 3K9SA 4TV8A 3AEIA 3TCUA 4JZGA 4ICGA 1SF9A 3STZC 2LGQA 4KP4A 3WU2Z 2XHBA 4EFEA 3JALB 1FXVA 4FJCC 4DR5B 3K57A 2F43G 4X1YA 3E83A 2LQTA 1Z5WA 5CB4B 1RP3B 4GKJO 4MVUA 3ZMSA 5LXTA 3T1HB 3HKDB 4LF4B 1I7FA 1OJHA 1FXKB 4OPHA 3SDLA 5IE9A 4JZ2A 3KZIZ 2XTAA 5J2TB 1AP5A 3GWKC 3G67A 1H8HG 2UXDB 5A2QN 3D36C 3GWOA 4DR4B 5GONA 1OCCB 3B40A 1Y74B 1N0JA 2ZNJA 2ODMA 1Q8IA 3TXQA 2ILMA 3KCXA 1SQVH 2F4VO 4LP8A 1Y66A 4PD4F 1QLEC 3P30A 4MW3A 3CXCU 4UB6Z 4TQDA 2F1MA 3AG2C 1YTFB 4YJ2B 3RYFB 1VIBA 1K7DA 1YHQV 1T5EA 4K8ZA 3O9OA 3M8AA 2A9HA 1ZUQA 3N2KB 1YVWA 2GV9A 1ZX3A 2F66C 1F51A 1I5YA 1NR1A 3HKBB 3CRRA 3OEHG 4J42A 3CCJV 3ZRSA 3ZJZA 2E3CA 1SQFA 4GX0A 4FLUA 5B1BC 1EFRG 1R73A 1NVPB 4Q20A 4WFGA 1IBLB 3FB8C 3E8GA 1LR1A 2NN4A 1GM9A 1N32O 3P3PA 1H2MA 2EILC 4CS4A 2CE4A 5EC1C 2W0XA 4DR3O 1BS3A 4DK0A 1NBMG 1CEZA 1ZAUA 2Y4TA 1NZ6A 4GLXA 4JYYA 2AW9A 3HKDA 4JI5B 2H8PC 4IHJA 4DR1B 2KG7B 1FXKA 3CCUV 2N05A 1R6KA 4HNAB 4X89A 3TK1A 5J2TA 4UCSA 4RQFA 4J80A 1Q86W 3D3IA 1VQNV 2JDIG 1N0NA 2VQFO 2QEXV 4B08A 4CH3A 3L75H 4LFBO 3VQVA 4D7SA 4L87A 2BE3A 3I56V 4DRXB 1W0JG 1VP7A 4LF6O 1GM8A 2IJHA 3ZHSA 5BR8B 1S72V 4WFBV 3R66A 4H37A 2F23A 2GTSA 2IU0A 3OAAG 3J81N 4I0XA 4MT8A 2YSUB 4G28B 4JAAA 3G6EV 2Q7GA 2Q7HA 3ZRXA 4NB5A 2O57A 4JI6B 4UFZA 3CCSV 1ENVA 1Q6UA 2R72A 5H2FZ 3ABTA 2ADQB 3OEEG 3SYCA 1NH2B 3K08A 3K04A 2DOSA 2YIAA 3ICXA 2BOBC 1TA8A 4B3SB 2AZ0A 3CJHA 3J80N 2ZM6B 4NTWA 2DWDC 1PL0A 5JJNB 3U0ZA 3M7MX 3AG4B 4CC6A 5CA0B 3UT5A 5LMNO 1R6TA 1DTOA 4UVAA 2YC0A 5GTHZ 4ZHQA 4LF9O 3T1YO 3CSXA 1Q3EA 4X1KB 1XNRB 4WF9V 1XMQO 3KG2A 5EBWC 4L8JA 3RYCA 1IBMB 1HNZB 4EKWA 2HJFC 3C3SA 2YIDA 4LCUC 1SQBH 1NQTA 2ITCC 2PY5A 3BA9A 1NT2B 4RO2A 2EBOA 3IGAC 2BTOA 2QSAA 3W7TA 3U11A 3ZHTA 3LSQA 2ZIMA 4NKGB 4MVOA 1ZWIC 2Y69C 1PNKA 2OWOA 3CCQV 4I9QA 2FMLA 4DRXA 5KHGA 4YJ3A 1QQCA 4LFAB 1AJPA 1R3IC 4GX1A 3SPGA 1K5QA 3OUSA 1HWYA 1MNGA 3ZHVA 4GX5A 3JD2A 5BXZA 5IWAB 1BCCH 2XAQA 5FLXN 3K3WA 1UPGA 4O4LA 1CXZB 3I55V 1BE3H 1FS0G 4AILC 3F7VC 3VQYA 1XBLA 2EULA 4JYCA 1Y6XA 2WWWA 3QO8A 1YEWA 3N2GB 4B3TB 2OCCC 4LF8B 5EC2C 1OCZC 4ZI7B 2WLLB 2YS8A 4F6RA 4U7OA 3VQWA 2EJRA 4FLVA 1PPJH 1MOFA 1K33A 1WA8B 4NXMO 2JRIA 4JI7B 1EBOA 4WFFA 4IYHA 4JI0B 3K0GA 3LDEA 3F5WC 3NXSA 4MS2A 2WA3A 4KUMA 5LYJA 4J7KA 1YTFD 3K5MA 1F4NA 3B8NA 3LDDA 3LNNA 4I5SA 4JPRA 4MVQA 2Q0OC 3JARA 4OX9O 1KP3A 4X66B 4DV4B 4WFAV 4YIPA 3JD4A 1RPRA 5GTIZ 3VBBA 4X65B 1ZLZA 3OTOO 3QNEA 3B2EE 1KD1W 4I50B 3EHBB 1RFYA 2Z5UA 1HNXO 2RN9A 1WJZA 1AI6A 2FL4A 1PL4A 3MAQA 1N36O 3ABKC 4AQYO 4JTDB 3T4DA 4LF5O 3BCCH 4F6EA 1QR9A 2B9ZA 5CA1B 2LJ2A 4DR7B 1NR7A 3I5DA 1B04A 3LUTB 4J9YB 3H1KH 1XDCA 1H8EG 2ETNA 1I5XA 1K92A 1K34A 3AG2B 5E79Z 3HKCB 3B09A 3CWBH 1I94O 5JCOA 4TUYB 3ZX6A 4UV8A 1S5HC 4AHCA 3DSQA 1XMOB 4JI2O 2ADPA 4YHHB 4K8XA 1KP2A 2UUBB 2X7RB 4NYKA 5LHIA 2R9AA 2B5UA 4J9ZB 3HKEB 4X20A 3E8HA 2H3OA 2QE7G 5H5NA 1JPXA 3K5LA 2UU9B 2EILB 3RBZA 3QO7A 1I08A 3EXAA 3WG7C 2Q67A 4HYOA 4DV3O 2Q73A 2FYUH 3CRCA 4UCOA 4JV5B 1NH2D 2IJIA 3THOA 5DEDA 2Q68A 3CEIA 2JEUA 4OPAA 1XILA 2GTAA 4DUZO 2OTLV 3WB2A 1WPBA 5EBLC 2N04A 1AROP 3IC9A 1SA0B 1DLBA 5ITZB 1W59A 2AXTZ 1M4UA 1TVKA 1QCEA 2Q4PA 5FPOA 3S3WA 2HHHO 2RQ6A 2XNDG 2JVDA 2R9RB 1FJGO 3FX7A 2OT5A 1BT8A 5IJ9B 1JR9A 5B66Z 4LF7O 4R50A 1BMFG 2JIZG 4FIPC 4ZIBA 3C90A 3HR0A 4IIJB 4I4TB 2G38A 1GKFA 2LFSA 4JAVA 3OTFA 1WNSA 3UKMA 4NXNB 3MHSC 2JJ1G 2WAMA 3JYCA 2R70A 5C8YB 2R9IA 1V55C 1FPOA 1OCRB 1ROPA 4B3RB 1SQQH 5LMUB 2OYQA 4U3FH 2YEVB 4CZZA 2UUAO 3QO5A 1YJNV 4JASA 4EB6B 2E5LO 2DJVA 4A5UB 1V9PA 2KSDA 4F4LA 1CPYA 5BMVA 1XNQB 5K1XA 2XAFA 2IBZH 4TT3G 4PDVA 5CBGA 1GN3A 5IY5C 1AR1B 4TOIA 4LFCO 5B3SB 2X6CA 1YXBA 1N34O 4ASUG 3JAKB 4K0KO 3T2MA 1AR5A 4P9OA 2Y69B 2CTRA 4K35A 1K9MW 3K59A 3SPCA 2EIMC 2YI9A 2RMKB 4DV2B 2D3OW 3H01A 4U3JA 1HDJA 3ZCCA 1LUWA 2QKSA 3AG7A 1LNQA 3CRAA 2QM4A 4GYCB 3ZN0A 4DV7O 4DV1O 3JATA 3M99B 1SQGA 5JH7A 1J5EO 1BHBA 2CK3G 3W7WA 1HP8A 1VF5B 5IJ9A 1KKDA 2CAZC 3BVOA 1S3JA 3CC4V 3BABA 3CXHF 1XI1A 5FPRA 5A9GA 1HR0O 1COWG 4FLTA 4BIUA 1EZJA 4EEQA 1RM1C 4P30A 1NKDA 1Q6IA 1OCOB 3BAAA 1V54C 5DM6V 1S5JA 3JSNA 4ZOLA 2VQEO 2D2CB 1EN5A 3Q4HA 4CH4A 4FM0A 4J7JA 2JS5A 3LNMB 1WLEA 3IFXA 4TV9B 2BTQB 3H1IH 2VWKA 4CC5A 4GX2A 4I7ZB 4RWUA 3CYOA 2Y0IA 4JI4B 5KAIZ 1AVMA 3AG3C 5K1PA 4CH5A 1JFFA 3ZN1A 4DR5O 4FFBB 4D7TA 3H1JH 4DW0A 3E22B 4UXNA 2ITDC 3T1HO 3CRQA 4X1IB 4LF4O 4DO2A 3QF7A 5FNVA 3K5NA 3ZRWB 1L8DA 1H2KA 3RYHA 1EM1A 4WBNB 3ABLC 2DQ0A 2RNBA 1JJOA 4DXWA 2UXDO 2CGOA 4PA6A 4E4EA 2NNUA 4J10A 3ABKB 4H0LB 5GW7A 2DYSB 3RYIB 3N27A 1OV9A 5EZYB 5AG2A 1PKXA 2Z3YA 1WAZA 1R3KC 5LP6C 3JASB 3ZHQA 5CA3A 2EZOA 4H33A 1AILA 1GAXA 2Q6AA 3L9DA 3A0RA 1WP8A 1KB9F 3QG5A 1QU7A 1KU9A 3L73H 3SGIA 4CS3A 5IJ0A 4Z2WA 1AR4A 2Q5ZA 1TUBB 1ZL8B
chains in the Genus database with same CATH topology
2LW7A 4DV2O 1IBLO 4LF7O 2VQFO 4GKJO 4LFBO 4X66O 2VQEO 4DV4O 1X59A 4OPHA 3SDLA 1I94O 5IT9N 5BXZA 4X65O 4LF6O 5FLXN 3R66A 5A2QN 1KUQA 4JI2O 3JAMN 3J81N 4JI5O 4DR1O 1XNRO 4DV5O 4DR5O 2Z0AA 4DV6O 1IBMO 4LFAO 2UUAO 2F4VO 1HNZO 3RT3C 4GKKO 1NS1A 4DR7O 5BY1A 5H5NA 2E5LO 5LL6Y 2DJVA 4A5UB 3T1HO 2DOSA 4LF4O 4DUYO 4DR2O 2FKXA 4JYAO 3J80N 3M8AA 1IBKO 4NXMO 2JRIA 4DV3O 4NXNO 5BR8O 4LFCO 1AB3A 1N34O 2UXDO 1D2DA 5LMNO 1FKAO 1R6TA 1F7YA 1XMOO 4K0KO 4B3RO 4JI4O 4LF9O 4KHPO 4OPAA 2UUBO 3T1YO 4YY3O 4X64O 4X62O 4B3TO 4JI8O 4LF8O 2AGAA 4DUZO 3J7AU 1N33O 4JI6O 1XMQO 1N32O 4OX9O 2UXBO 1G1XB 1YZBA 4JI3O 4DV7O 4DV1O 5IWAO 4DV0O 2UU9O 1HNWO 1R1BA 1XNQO 4B3MO 1J5EO 1AILA 4B3SO 1XEQA 4DR3O 2ZKOA 3O65A 4JI7O 4DR4O 2ZM6O 4JI0O 3OTOO 2UUCO 4YHHO 1HNXO 5LMUO 4JV5O 3F5TA 4DR6O 1DK1A 1N36O 2HHHO 4AQYO 1HR0O 1FJGO 4LF5O 1FYJA 4JI1O 2UXCO 2N74A 1A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW7 A;  4DV2 O;  1IBL O;  4LF7 O;  2VQF O;  4GKJ O;  4LFB O;  4X66 O;  2VQE O;  4DV4 O;  1X59 A;  4OPH A;  3SDL A;  1I94 O;  5IT9 N;  5BXZ A;  4X65 O;  4LF6 O;  5FLX N;  3R66 A;  5A2Q N;  1KUQ A;  4JI2 O;  3JAM N;  3J81 N;  4JI5 O;  4DR1 O;  1XNR O;  4DV5 O;  4DR5 O;  2Z0A A;  4DV6 O;  1IBM O;  4LFA O;  2UUA O;  2F4V O;  1HNZ O;  3RT3 C;  4GKK O;  1NS1 A;  4DR7 O;  5BY1 A;  5H5N A;  2E5L O;  5LL6 Y;  2DJV A;  4A5U B;  3T1H O;  2DOS A;  4LF4 O;  4DUY O;  4DR2 O;  2FKX A;  4JYA O;  3J80 N;  3M8A A;  1IBK O;  4NXM O;  2JRI A;  4DV3 O;  4NXN O;  5BR8 O;  4LFC O;  1AB3 A;  1N34 O;  2UXD O;  1D2D A;  5LMN O;  1FKA O;  1R6T A;  1F7Y A;  1XMO O;  4K0K O;  4B3R O;  4JI4 O;  4LF9 O;  4KHP O;  4OPA A;  2UUB O;  3T1Y O;  4YY3 O;  4X64 O;  4X62 O;  4B3T O;  4JI8 O;  4LF8 O;  2AGA A;  4DUZ O;  3J7A U;  1N33 O;  4JI6 O;  1XMQ O;  1N32 O;  4OX9 O;  2UXB O;  1G1X B;  1YZB A;  4JI3 O;  4DV7 O;  4DV1 O;  5IWA O;  4DV0 O;  2UU9 O;  1HNW O;  1R1B A;  1XNQ O;  4B3M O;  1J5E O;  1AIL A;  4B3S O;  1XEQ A;  4DR3 O;  2ZKO A;  3O65 A;  4JI7 O;  4DR4 O;  2ZM6 O;  4JI0 O;  3OTO O;  2UUC O;  4YHH O;  1HNX O;  5LMU O;  4JV5 O;  3F5T A;  4DR6 O;  1DK1 A;  1N36 O;  2HHH O;  4AQY O;  1HR0 O;  1FJG O;  4LF5 O;  1FYJ A;  4JI1 O;  2UXC O;  2N74 A;  1A32 A; 
#chains in the Genus database with same CATH topology
 3CCL V;  3RWR D;  4FVM A;  4TV9 A;  1IBL O;  4MTG A;  3JAL A;  4Z1M G;  3ABM B;  1JOY A;  3AK2 A;  3JAW B;  5LGU A;  1W0K G;  3WG7 B;  1G6U A;  5CB4 A;  2WLN A;  1L0N H;  2ZE6 A;  3P32 A;  3UO3 A;  4DR3 B;  1Y4M A;  2UXN A;  4XDJ A;  3RN4 A;  4JI5 O;  2AHZ A;  2QGN A;  4DR1 O;  4JAU A;  4E2L A;  4X64 B;  4I55 B;  4U7N A;  5DEC A;  1Y74 A;  2LGW A;  3D8C A;  3MD0 A;  3OW2 U;  1AJN A;  4MW8 A;  2VQF B;  2FKX A;  4FK5 C;  4LFB B;  1OZ0 A;  4QPJ A;  4FZ1 A;  2DYR C;  1NTK H;  5BR8 O;  2HVK C;  4YJ2 A;  5EIB C;  3RYF A;  5B5E Z;  4X8A A;  1F7Y A;  1GH6 A;  1P4R A;  3JAS A;  2XUM A;  3N2K A;  5KX5 B;  2A06 H;  2M7W A;  3JCU Z;  2A7W A;  2Q8V A;  5C93 A;  2DMX A;  3HKB A;  2LW1 A;  3FB7 C;  2ZR3 A;  3J7A U;  2LFR A;  2V7Q G;  1M9N A;  3GB7 C;  4JI6 O;  1XHZ A;  1Q81 W;  1TUE B;  1YZB A;  4BW9 A;  1ZTE A;  3CCM V;  4B3S O;  4G27 B;  3F7Y C;  1M93 A;  1ZL8 A;  1GM7 A;  2ZM6 O;  4CH6 A;  2P06 A;  1YJ9 V;  4O2A B;  2IH1 C;  4O2B B;  4JF3 A;  1Q6H A;  1FYJ A;  3DXR B;  1U97 A;  1SC5 B;  1A32 A;  3ZRV A;  2IU3 A;  2ZE8 A;  4BIO A;  3T1Y B;  5KHH A;  3FAV B;  2KG7 A;  4IGG A;  1H2G A;  4PDL A;  2BSK B;  4HNA A;  3H1H H;  1SKV A;  5J9P C;  1QHT A;  2X0L A;  1IBK B;  3JD1 A;  1M5I A;  5IY5 B;  3ZMT A;  2CH7 B;  1R3J C;  3WB1 A;  4QGP A;  4PEL A;  1VF7 A;  1P7B A;  3VOU A;  3OUF A;  3E2E A;  1VEW A;  2Z0A A;  3AG1 B;  4YY3 B;  3K03 A;  4LFA O;  1EN4 A;  4PDM A;  1JA8 A;  1Q5O A;  2GUZ B;  2ZD9 A;  1Q82 W;  1SRY A;  3SYP A;  1FFX B;  1KKC A;  3CRM A;  3CC7 V;  4JYA O;  2M6Y A;  5EK0 A;  4DK1 A;  3DGE A;  3LDC A;  1SQP H;  1E79 G;  2ZDI A;  3SR2 C;  2EX3 A;  4I9W A;  5LGT A;  1M90 W;  4K3A A;  4QJF B;  5CA0 A;  5KA5 A;  3E86 A;  4JGS A;  3SYO A;  3G71 V;  3BEH A;  4B3T O;  4LF8 O;  1N33 O;  2QDO A;  4P2Z A;  4X1K A;  4FLW A;  1WP7 A;  5EYP B;  5LOV B;  1Q43 A;  4JI7 O;  4JI0 O;  1R6N A;  4D6T H;  2QWQ B;  3CE2 A;  4EFB A;  3W7U A;  1AI5 A;  4DR6 O;  3WFV A;  2ARH A;  1ORQ C;  3AG3 B;  5KHJ A;  4PI2 A;  2OCH A;  3FYE B;  1XUQ A;  4O4H B;  1E1Q G;  2AHY A;  1X4T A;  1M56 C;  3CME V;  5KHI A;  4W4K A;  4LBE C;  4AI8 A;  2CGN A;  4WFH A;  2YXL A;  4DUY B;  1NVP D;  1JMK C;  1P49 A;  4OXS A;  2QM8 A;  4X66 O;  4DV4 O;  2CTP A;  4OX9 B;  4X65 O;  1L0L H;  3QTC A;  3SPJ A;  4HZ3 A;  1LUV A;  1FXK C;  3SYA A;  3ABL B;  3LSU A;  1JJ2 U;  4O4I B;  3CHX A;  1K4D C;  3JAM N;  2GHY A;  1AI4 A;  1OCC C;  1QLE B;  5CN0 A;  3ETD A;  4X62 B;  1YJW V;  5IYC O;  4PV1 B;  4DR7 O;  3ZHR A;  3JD0 A;  5LL6 Y;  4G2K A;  1QVF U;  3N2G A;  4DV0 B;  1XRE A;  2L35 A;  3CCR V;  4ZI7 A;  2WLL A;  1QR8 A;  1TAE A;  1NTM H;  1KMI Z;  1Y76 B;  3UCS C;  1XMO O;  1WA8 A;  4Q6G A;  1IUR A;  5B1B B;  1ZSP A;  1S0V A;  1N8R W;  5LHH A;  1VQ6 V;  2UUB O;  2PZS A;  2UXC B;  4JI8 B;  3ZMZ A;  4TSF G;  2AGA A;  3ABU A;  3TJT A;  1P7G A;  1XOU A;  2F93 B;  2UU9 O;  3ZHU A;  1XEQ A;  1MZF A;  3FB6 C;  1M57 C;  5HFM A;  2YUA A;  1YI2 V;  1K97 A;  4ZBM A;  3KCY A;  1WPX A;  3BPZ A;  5LA6 B;  3ZED A;  4FLZ A;  4JV5 O;  1TGO A;  4I50 A;  2PUS A;  4JTC B;  4NTY A;  4GKK B;  1AJQ A;  3RFR A;  3IC7 A;  3ETG A;  3B77 A;  2EZP A;  3DC6 A;  5CA1 A;  3CPW U;  1WN7 A;  4O4J B;  1S5L Z;  2EJ7 A;  2DYR B;  1IDS A;  2QM7 A;  2CTQ A;  3BRC A;  2WLK A;  1QNM A;  3HKC A;  1NTZ H;  2WLI B;  3SJA C;  2E76 B;  2MK3 A;  3A8T A;  4TUY A;  1VQ5 V;  4KHP B;  2JK5 C;  4LNU B;  5KMG B;  1O9H A;  1RSO B;  3H9V A;  4MVS A;  5JVD B;  1YIJ V;  5JQG B;  3RT3 C;  1FJG B;  3ZIA G;  3ZS8 C;  5F2V O;  5BY1 A;  3G6B A;  2HKO A;  2QR4 A;  2KB1 A;  4MSW C;  4B3M B;  2HEP A;  5LBQ A;  3HKE A;  1H38 A;  3C3T A;  4NXN O;  2UUC B;  1VQ9 V;  1PNL A;  3X2Q C;  1XL4 A;  4TWK A;  3JSL A;  4B3R O;  1F23 A;  3TGU H;  4J41 A;  2WLJ A;  4DW1 A;  4JI1 B;  1VQM V;  1YIT V;  3OR6 C;  1VF6 A;  1KYO F;  4TV8 B;  4YIO A;  2UUA B;  2OTJ V;  2P6J A;  2P5O A;  3T4Z A;  1JVM A;  1XNQ O;  3ETQ A;  2E5L B;  5L3G A;  1VQK V;  2YXH A;  3O65 A;  3SYQ A;  1YSC A;  3AK1 A;  2EIJ C;  1KQS U;  4FLX A;  3ASN C;  1G4Y B;  1SA0 A;  5ITZ A;  1THZ A;  4X1Y B;  4FMT A;  4LFC B;  3UQ8 A;  1N34 B;  4DV5 B;  1BL8 A;  4O4J A;  5LXT B;  4PA3 A;  4DV6 B;  2DQ3 A;  4IYI A;  4QE9 A;  2HFE C;  4DV2 O;  3ETE A;  4RUE A;  2NR5 A;  3G80 A;  2ZIO A;  1DF5 A;  4DR2 B;  1PM9 A;  2WLH A;  2LO1 A;  4FFK A;  3OD4 A;  3UO2 A;  5GON B;  2DW4 A;  5CMU A;  4MTX A;  2RCV A;  1FFT B;  4IIJ A;  4I4T A;  4JTA B;  1KEC A;  2FTK A;  2ZNI A;  3GVM A;  4X9Q A;  4WCE V;  3MDS A;  2ZCE A;  2OCC B;  3W7S A;  4MVZ A;  5C8Y A;  1OCZ B;  3CC2 V;  1NS1 A;  1VQP V;  3K9A A;  5JCO C;  5FL7 G;  2YEV A;  2UXB B;  4JI3 B;  3SJB C;  4NVP A;  1HNW B;  5LGN A;  4EB6 A;  4B7K A;  5EBM C;  2ZQM A;  4MTO A;  3VQX A;  3CX5 F;  4FPP A;  4BW5 A;  1KBH A;  3E89 A;  2EIK C;  4NTX A;  1D5N A;  4JI4 O;  3QVN A;  2GBO A;  2JGD B;  2VS0 A;  1JQ0 A;  2BOC C;  2PYL A;  3A0H Z;  3JAK A;  2QWR B;  1CP9 A;  2JS3 A;  4GKJ B;  1E1R G;  1M56 B;  2P4V A;  4FLY A;  1VQ4 V;  4NR1 A;  3CCV V;  4FM2 A;  2XAH A;  4IHJ B;  4DR4 O;  4KXR A;  2UXX A;  1I0H A;  2XAS A;  2JJ2 G;  2F4V B;  2CTW A;  3IAY A;  2LW7 A;  2QJ1 A;  4FZ0 A;  2YI8 A;  4RUF A;  2QTO A;  2DN9 A;  3SJC C;  1SES A;  1X59 A;  3NR7 A;  4I0X B;  1PNM A;  3ASO C;  2BCC H;  3DTU B;  3K5O A;  5L3F A;  2V4D A;  3CD6 V;  2Y4U A;  1KUQ A;  3OE7 G;  1GN2 A;  4UB8 Z;  1U96 A;  1VQ7 V;  2BTQ A;  5CBH A;  2ZXW C;  2DE0 X;  4LC1 A;  3FB5 C;  5DN6 G;  4N21 A;  1FAF A;  1XL6 A;  3CJH B;  5EIB D;  3T1C A;  2QA4 V;  4R7C A;  1N32 B;  4UCU A;  4UVC A;  3RVZ A;  5KLV H;  4FFB A;  3UT5 B;  2JGD A;  3E22 A;  4C7U A;  2W6J G;  5IYD O;  1M57 B;  4ZHQ B;  1O9G A;  1GN6 A;  4X1I A;  1MSW D;  3ZRW A;  3SJQ C;  1QLN A;  1NI8 A;  1BZK A;  4WBN A;  4LR3 A;  3RYC B;  1VMG A;  1VF6 C;  2VRZ A;  3E8F A;  4TQF A;  4X64 O;  1VQ8 V;  5KUM A;  2P22 C;  1BQZ A;  3OMN B;  4H13 B;  3TXS A;  3RYI A;  1GO3 F;  3BY6 A;  1IVS A;  5EZY A;  5B1A C;  3IJ4 A;  1SZT A;  1VAR A;  1SET A;  3TET A;  2ZKO A;  2WA4 A;  4XDK A;  4LF6 B;  3MHH C;  1PP9 H;  4QPK A;  4YJ3 B;  2OIG A;  2B1G A;  2ZE5 A;  3F5T A;  4HAM A;  3ML0 A;  2Q0A A;  4UV9 A;  3K79 A;  1D5A A;  2E74 B;  2KKW A;  3HPL C;  4LH7 A;  4GT1 A;  2N74 A;  4R6Z A;  1TUB A;  2CUG A;  2WPD G;  1S77 D;  4J11 A;  3LSS A;  3BHP A;  4O4L B;  4N23 A;  2K1E A;  1V55 B;  1JX9 A;  3JAW A;  4OGQ B;  3X2Q B;  3CP1 A;  5LMN B;  1GRJ A;  2XAJ A;  2ZE7 A;  4XBF A;  1G8M A;  1K5S A;  4JYB A;  4LF9 B;  3L72 H;  1DF4 A;  3STL C;  1XNR O;  3UM7 A;  2YIB A;  3R65 A;  1OCR C;  4F6R B;  4LWS B;  3SPI A;  1IBM O;  5HFL A;  1HNZ O;  1H2S B;  3ZMU A;  4PA9 A;  1XMQ B;  5KHK A;  1FXH A;  1XHX A;  3L71 H;  2X6B A;  4I55 A;  1PD3 A;  5H6R A;  3K58 A;  4PA4 A;  5LYJ B;  1IBK O;  1F4M A;  1BQ0 A;  4ZKI A;  1AB3 A;  1IXB A;  2EIJ B;  1S76 D;  3ASN B;  3RVY A;  3B4S A;  2WSS G;  5B3S C;  2EIM B;  1NU1 H;  5KA6 A;  3W7X A;  3B8M A;  2EIN C;  4DYL A;  3JAR B;  2Y0P A;  2P4K A;  4KFM A;  4YY3 O;  5KX5 A;  2X6A A;  3OR7 C;  2QTS A;  3OFN G;  3ZMV A;  1N4C A;  2YDE A;  5IWA O;  1R1B A;  3JCZ A;  1YF2 A;  1W2B U;  3BA8 A;  2HLD G;  3H1L H;  1BHA A;  1OHH G;  3PJS K;  4JYA B;  2C2A A;  4Z1V A;  4QNH B;  2Y48 A;  1FD9 A;  1RM1 B;  1H2N A;  2XAG A;  4UCR A;  4B7E A;  2F95 B;  1V54 B;  4O2A A;  2MW2 B;  4O2B A;  1Y67 A;  1PV0 A;  2K9P A;  2Q7E A;  3DXR A;  2B1I A;  4R8C A;  1OCO C;  1IX9 A;  2E75 B;  1N33 B;  2YIC A;  1IXM A;  1KC8 W;  3FAV A;  4LWS A;  4NXM B;  2BSK A;  4P9P A;  4KL1 A;  3OGC C;  1K73 W;  4IT5 A;  3OMA B;  2EIK B;  2HP8 A;  2GSM B;  1QBZ A;  4X20 B;  5B1N A;  2A0L A;  1YCI A;  2CH7 A;  4DR6 B;  5BZB A;  4QE7 A;  4MTF A;  4PI0 A;  5KAF Z;  5IYZ B;  4FM1 A;  4J7Z A;  1Z2G A;  2VWJ A;  2LP7 A;  5TIS Z;  4DUY O;  4UVB A;  1Q90 D;  2GUZ A;  2W0F C;  1FFX A;  3OTO B;  2Q69 A;  4W4L A;  1B6Q A;  2JEX A;  3RGB A;  1HNX B;  2GDS A;  1D2D A;  1N36 B;  4AQY B;  3BFR A;  4ABM A;  2QWO B;  4LF5 B;  3RW0 A;  2YIB D;  2L6L A;  1NJI W;  4X62 O;  2DYS C;  5LP6 B;  5L3B A;  1WB7 A;  3FD9 A;  1TVK B;  4DV0 O;  2OIE A;  5IDJ A;  1I94 B;  3APO A;  4WFE A;  2W6I G;  3ASO B;  1Q7Y W;  2WLM A;  4YHH O;  3OMI B;  4UUJ C;  3E8B A;  1DGS A;  5L3C A;  1UFI A;  4CS2 A;  1US6 A;  4PJ0 Z;  5EYP A;  5LOV A;  4JI2 B;  2HJD A;  3DC5 A;  1MG1 A;  2HR3 A;  2ZXW B;  2UXC O;  4JI8 O;  2KQX A;  2IJJ A;  2IJK A;  1BGY H;  4YXW G;  5L3E A;  2FB5 A;  3ABM C;  4O4H A;  3K0D A;  1MSD A;  3OT7 A;  5L3D A;  4DV3 B;  3E35 A;  5IYZ A;  1Z5V A;  1P84 F;  2XT9 A;  4BR6 A;  2IM9 A;  3FFQ A;  5JJJ B;  3D36 A;  4RQE A;  2PI5 A;  1MA1 A;  2P7T C;  4IL6 Z;  4O4I A;  1EN6 A;  3K06 A;  5BMV B;  4DUZ B;  2QKA A;  4GKK O;  2IW5 A;  3JD3 A;  2ZT9 B;  2PYJ A;  3L74 H;  4CBC A;  5H6Q A;  2QKC A;  2RDC A;  2PGG A;  5B1A B;  1IZ3 A;  2A3Q A;  4LH6 A;  3SPH A;  2DWE C;  5LHG A;  5D5Q A;  5LP6 A;  2Q9L A;  4UCT A;  3KKY A;  2HHH B;  4U3J B;  4KHP O;  1BSM A;  1K4C C;  1Y76 A;  5D5P A;  1VQO V;  5KUK A;  1GK9 A;  3JAT B;  5JH7 B;  3A2F A;  4LF7 B;  3L70 H;  5CBF A;  2A79 B;  2P90 A;  1XQ8 A;  5J2U B;  1VQL V;  2IH3 C;  1AP6 A;  4BIZ A;  4B3M O;  2QWP B;  4X88 A;  2ZDI C;  3S3X A;  1M1K W;  3AK3 A;  2UUC O;  3AG4 C;  4XDL A;  4GUN A;  5LMU O;  4MVR A;  2YXY A;  1DK1 A;  2ZR2 A;  4PA7 A;  1SZX A;  1URF A;  2PTM A;  1EZV H;  2NLJ C;  5LA6 A;  4JI1 O;  4ZOL B;  3Q4H B;  3CCE V;  4GZR B;  1R3L C;  4MVM A;  3HB3 B;  1SS3 A;  2AZ2 A;  4PHZ A;  1YDX A;  1MAB G;  1GN4 A;  2HG5 C;  2V1D A;  5IT9 N;  3OM3 B;  3G4S V;  4BWA A;  4BAY A;  3P3N A;  1JFF B;  2ZIN A;  1B06 A;  3APQ A;  1J95 A;  2XOK G;  3CB2 A;  3ZBH A;  4K0K B;  1K3E A;  5JWP A;  2RJZ A;  3EFF K;  2EIN B;  1WB8 A;  4DV5 O;  3WB0 A;  4UCV A;  2WLI A;  4HBN A;  4DV6 O;  2ATK C;  5FNV B;  4GCZ A;  3A0B Z;  1K8A W;  1HW7 A;  1GTO A;  2H94 A;  3AG1 C;  3RYH B;  3OGI B;  4LNU A;  4RAI A;  1L1F A;  5KMG A;  1RSO A;  5H9C A;  5JVD A;  1MMM A;  5E1A C;  4DV7 B;  4DV1 B;  5JQG A;  5IYB O;  4DR2 O;  1SER A;  1J5E B;  2HVJ C;  3FYI B;  3EVK A;  1GMG A;  4PDR A;  1UJW B;  3U10 A;  2JGU A;  2QWN B;  2PI4 A;  1FKA O;  3CS5 A;  2PF4 E;  1B3Q A;  1RPO A;  1HR0 B;  5J2U A;  1QVG U;  5JJE B;  1AI7 A;  3D3Q A;  2CDY A;  3FKS G;  3PN1 A;  2P67 A;  5B1O A;  4QIW F;  1MZE A;  1H2L A;  1SQX H;  2UXB O;  1G1X B;  4JI3 O;  1JCH A;  1HNW O;  2VQE B;  4H44 B;  5IJ0 B;  3CMA V;  3K9S A;  4TV8 A;  3AEI A;  3TCU A;  4JZG A;  4ICG A;  1SF9 A;  3STZ C;  2LGQ A;  4KP4 A;  3WU2 Z;  2XHB A;  4EFE A;  3JAL B;  1FXV A;  4FJC C;  4DR5 B;  3K57 A;  2F43 G;  4X1Y A;  3E83 A;  2LQT A;  1Z5W A;  5CB4 B;  1RP3 B;  4GKJ O;  4MVU A;  3ZMS A;  5LXT A;  3T1H B;  3HKD B;  4LF4 B;  1I7F A;  1OJH A;  1FXK B;  4OPH A;  3SDL A;  5IE9 A;  4JZ2 A;  3KZI Z;  2XTA A;  5J2T B;  1AP5 A;  3GWK C;  3G67 A;  1H8H G;  2UXD B;  5A2Q N;  3D36 C;  3GWO A;  4DR4 B;  5GON A;  1OCC B;  3B40 A;  1Y74 B;  1N0J A;  2ZNJ A;  2ODM A;  1Q8I A;  3TXQ A;  2ILM A;  3KCX A;  1SQV H;  2F4V O;  4LP8 A;  1Y66 A;  4PD4 F;  1QLE C;  3P30 A;  4MW3 A;  3CXC U;  4UB6 Z;  4TQD A;  2F1M A;  3AG2 C;  1YTF B;  4YJ2 B;  3RYF B;  1VIB A;  1K7D A;  1YHQ V;  1T5E A;  4K8Z A;  3O9O A;  3M8A A;  2A9H A;  1ZUQ A;  3N2K B;  1YVW A;  2GV9 A;  1ZX3 A;  2F66 C;  1F51 A;  1I5Y A;  1NR1 A;  3HKB B;  3CRR A;  3OEH G;  4J42 A;  3CCJ V;  3ZRS A;  3ZJZ A;  2E3C A;  1SQF A;  4GX0 A;  4FLU A;  5B1B C;  1EFR G;  1R73 A;  1NVP B;  4Q20 A;  4WFG A;  1IBL B;  3FB8 C;  3E8G A;  1LR1 A;  2NN4 A;  1GM9 A;  1N32 O;  3P3P A;  1H2M A;  2EIL C;  4CS4 A;  2CE4 A;  5EC1 C;  2W0X A;  4DR3 O;  1BS3 A;  4DK0 A;  1NBM G;  1CEZ A;  1ZAU A;  2Y4T A;  1NZ6 A;  4GLX A;  4JYY A;  2AW9 A;  3HKD A;  4JI5 B;  2H8P C;  4IHJ A;  4DR1 B;  2KG7 B;  1FXK A;  3CCU V;  2N05 A;  1R6K A;  4HNA B;  4X89 A;  3TK1 A;  5J2T A;  4UCS A;  4RQF A;  4J80 A;  1Q86 W;  3D3I A;  1VQN V;  2JDI G;  1N0N A;  2VQF O;  2QEX V;  4B08 A;  4CH3 A;  3L75 H;  4LFB O;  3VQV A;  4D7S A;  4L87 A;  2BE3 A;  3I56 V;  4DRX B;  1W0J G;  1VP7 A;  4LF6 O;  1GM8 A;  2IJH A;  3ZHS A;  5BR8 B;  1S72 V;  4WFB V;  3R66 A;  4H37 A;  2F23 A;  2GTS A;  2IU0 A;  3OAA G;  3J81 N;  4I0X A;  4MT8 A;  2YSU B;  4G28 B;  4JAA A;  3G6E V;  2Q7G A;  2Q7H A;  3ZRX A;  4NB5 A;  2O57 A;  4JI6 B;  4UFZ A;  3CCS V;  1ENV A;  1Q6U A;  2R72 A;  5H2F Z;  3ABT A;  2ADQ B;  3OEE G;  3SYC A;  1NH2 B;  3K08 A;  3K04 A;  2DOS A;  2YIA A;  3ICX A;  2BOB C;  1TA8 A;  4B3S B;  2AZ0 A;  3CJH A;  3J80 N;  2ZM6 B;  4NTW A;  2DWD C;  1PL0 A;  5JJN B;  3U0Z A;  3M7M X;  3AG4 B;  4CC6 A;  5CA0 B;  3UT5 A;  5LMN O;  1R6T A;  1DTO A;  4UVA A;  2YC0 A;  5GTH Z;  4ZHQ A;  4LF9 O;  3T1Y O;  3CSX A;  1Q3E A;  4X1K B;  1XNR B;  4WF9 V;  1XMQ O;  3KG2 A;  5EBW C;  4L8J A;  3RYC A;  1IBM B;  1HNZ B;  4EKW A;  2HJF C;  3C3S A;  2YID A;  4LCU C;  1SQB H;  1NQT A;  2ITC C;  2PY5 A;  3BA9 A;  1NT2 B;  4RO2 A;  2EBO A;  3IGA C;  2BTO A;  2QSA A;  3W7T A;  3U11 A;  3ZHT A;  3LSQ A;  2ZIM A;  4NKG B;  4MVO A;  1ZWI C;  2Y69 C;  1PNK A;  2OWO A;  3CCQ V;  4I9Q A;  2FML A;  4DRX A;  5KHG A;  4YJ3 A;  1QQC A;  4LFA B;  1AJP A;  1R3I C;  4GX1 A;  3SPG A;  1K5Q A;  3OUS A;  1HWY A;  1MNG A;  3ZHV A;  4GX5 A;  3JD2 A;  5BXZ A;  5IWA B;  1BCC H;  2XAQ A;  5FLX N;  3K3W A;  1UPG A;  4O4L A;  1CXZ B;  3I55 V;  1BE3 H;  1FS0 G;  4AIL C;  3F7V C;  3VQY A;  1XBL A;  2EUL A;  4JYC A;  1Y6X A;  2WWW A;  3QO8 A;  1YEW A;  3N2G B;  4B3T B;  2OCC C;  4LF8 B;  5EC2 C;  1OCZ C;  4ZI7 B;  2WLL B;  2YS8 A;  4F6R A;  4U7O A;  3VQW A;  2EJR A;  4FLV A;  1PPJ H;  1MOF A;  1K33 A;  1WA8 B;  4NXM O;  2JRI A;  4JI7 B;  1EBO A;  4WFF A;  4IYH A;  4JI0 B;  3K0G A;  3LDE A;  3F5W C;  3NXS A;  4MS2 A;  2WA3 A;  4KUM A;  5LYJ A;  4J7K A;  1YTF D;  3K5M A;  1F4N A;  3B8N A;  3LDD A;  3LNN A;  4I5S A;  4JPR A;  4MVQ A;  2Q0O C;  3JAR A;  4OX9 O;  1KP3 A;  4X66 B;  4DV4 B;  4WFA V;  4YIP A;  3JD4 A;  1RPR A;  5GTI Z;  3VBB A;  4X65 B;  1ZLZ A;  3OTO O;  3QNE A;  3B2E E;  1KD1 W;  4I50 B;  3EHB B;  1RFY A;  2Z5U A;  1HNX O;  2RN9 A;  1WJZ A;  1AI6 A;  2FL4 A;  1PL4 A;  3MAQ A;  1N36 O;  3ABK C;  4AQY O;  4JTD B;  3T4D A;  4LF5 O;  3BCC H;  4F6E A;  1QR9 A;  2B9Z A;  5CA1 B;  2LJ2 A;  4DR7 B;  1NR7 A;  3I5D A;  1B04 A;  3LUT B;  4J9Y B;  3H1K H;  1XDC A;  1H8E G;  2ETN A;  1I5X A;  1K92 A;  1K34 A;  3AG2 B;  5E79 Z;  3HKC B;  3B09 A;  3CWB H;  1I94 O;  5JCO A;  4TUY B;  3ZX6 A;  4UV8 A;  1S5H C;  4AHC A;  3DSQ A;  1XMO B;  4JI2 O;  2ADP A;  4YHH B;  4K8X A;  1KP2 A;  2UUB B;  2X7R B;  4NYK A;  5LHI A;  2R9A A;  2B5U A;  4J9Z B;  3HKE B;  4X20 A;  3E8H A;  2H3O A;  2QE7 G;  5H5N A;  1JPX A;  3K5L A;  2UU9 B;  2EIL B;  3RBZ A;  3QO7 A;  1I08 A;  3EXA A;  3WG7 C;  2Q67 A;  4HYO A;  4DV3 O;  2Q73 A;  2FYU H;  3CRC A;  4UCO A;  4JV5 B;  1NH2 D;  2IJI A;  3THO A;  5DED A;  2Q68 A;  3CEI A;  2JEU A;  4OPA A;  1XIL A;  2GTA A;  4DUZ O;  2OTL V;  3WB2 A;  1WPB A;  5EBL C;  2N04 A;  1ARO P;  3IC9 A;  1SA0 B;  1DLB A;  5ITZ B;  1W59 A;  2AXT Z;  1M4U A;  1TVK A;  1QCE A;  2Q4P A;  5FPO A;  3S3W A;  2HHH O;  2RQ6 A;  2XND G;  2JVD A;  2R9R B;  1FJG O;  3FX7 A;  2OT5 A;  1BT8 A;  5IJ9 B;  1JR9 A;  5B66 Z;  4LF7 O;  4R50 A;  1BMF G;  2JIZ G;  4FIP C;  4ZIB A;  3C90 A;  3HR0 A;  4IIJ B;  4I4T B;  2G38 A;  1GKF A;  2LFS A;  4JAV A;  3OTF A;  1WNS A;  3UKM A;  4NXN B;  3MHS C;  2JJ1 G;  2WAM A;  3JYC A;  2R70 A;  5C8Y B;  2R9I A;  1V55 C;  1FPO A;  1OCR B;  1ROP A;  4B3R B;  1SQQ H;  5LMU B;  2OYQ A;  4U3F H;  2YEV B;  4CZZ A;  2UUA O;  3QO5 A;  1YJN V;  4JAS A;  4EB6 B;  2E5L O;  2DJV A;  4A5U B;  1V9P A;  2KSD A;  4F4L A;  1CPY A;  5BMV A;  1XNQ B;  5K1X A;  2XAF A;  2IBZ H;  4TT3 G;  4PDV A;  5CBG A;  1GN3 A;  5IY5 C;  1AR1 B;  4TOI A;  4LFC O;  5B3S B;  2X6C A;  1YXB A;  1N34 O;  4ASU G;  3JAK B;  4K0K O;  3T2M A;  1AR5 A;  4P9O A;  2Y69 B;  2CTR A;  4K35 A;  1K9M W;  3K59 A;  3SPC A;  2EIM C;  2YI9 A;  2RMK B;  4DV2 B;  2D3O W;  3H01 A;  4U3J A;  1HDJ A;  3ZCC A;  1LUW A;  2QKS A;  3AG7 A;  1LNQ A;  3CRA A;  2QM4 A;  4GYC B;  3ZN0 A;  4DV7 O;  4DV1 O;  3JAT A;  3M99 B;  1SQG A;  5JH7 A;  1J5E O;  1BHB A;  2CK3 G;  3W7W A;  1HP8 A;  1VF5 B;  5IJ9 A;  1KKD A;  2CAZ C;  3BVO A;  1S3J A;  3CC4 V;  3BAB A;  3CXH F;  1XI1 A;  5FPR A;  5A9G A;  1HR0 O;  1COW G;  4FLT A;  4BIU A;  1EZJ A;  4EEQ A;  1RM1 C;  4P30 A;  1NKD A;  1Q6I A;  1OCO B;  3BAA A;  1V54 C;  5DM6 V;  1S5J A;  3JSN A;  4ZOL A;  2VQE O;  2D2C B;  1EN5 A;  3Q4H A;  4CH4 A;  4FM0 A;  4J7J A;  2JS5 A;  3LNM B;  1WLE A;  3IFX A;  4TV9 B;  2BTQ B;  3H1I H;  2VWK A;  4CC5 A;  4GX2 A;  4I7Z B;  4RWU A;  3CYO A;  2Y0I A;  4JI4 B;  5KAI Z;  1AVM A;  3AG3 C;  5K1P A;  4CH5 A;  1JFF A;  3ZN1 A;  4DR5 O;  4FFB B;  4D7T A;  3H1J H;  4DW0 A;  3E22 B;  4UXN A;  2ITD C;  3T1H O;  3CRQ A;  4X1I B;  4LF4 O;  4DO2 A;  3QF7 A;  5FNV A;  3K5N A;  3ZRW B;  1L8D A;  1H2K A;  3RYH A;  1EM1 A;  4WBN B;  3ABL C;  2DQ0 A;  2RNB A;  1JJO A;  4DXW A;  2UXD O;  2CGO A;  4PA6 A;  4E4E A;  2NNU A;  4J10 A;  3ABK B;  4H0L B;  5GW7 A;  2DYS B;  3RYI B;  3N27 A;  1OV9 A;  5EZY B;  5AG2 A;  1PKX A;  2Z3Y A;  1WAZ A;  1R3K C;  5LP6 C;  3JAS B;  3ZHQ A;  5CA3 A;  2EZO A;  4H33 A;  1AIL A;  1GAX A;  2Q6A A;  3L9D A;  3A0R A;  1WP8 A;  1KB9 F;  3QG5 A;  1QU7 A;  1KU9 A;  3L73 H;  3SGI A;  4CS3 A;  5IJ0 A;  4Z2W A;  1AR4 A;  2Q5Z A;  1TUB B;  1ZL8 B; 
#chains in the Genus database with same CATH homology
 2LW7 A;  4DV2 O;  1IBL O;  4LF7 O;  2VQF O;  4GKJ O;  4LFB O;  4X66 O;  2VQE O;  4DV4 O;  1X59 A;  4OPH A;  3SDL A;  1I94 O;  5IT9 N;  5BXZ A;  4X65 O;  4LF6 O;  5FLX N;  3R66 A;  5A2Q N;  1KUQ A;  4JI2 O;  3JAM N;  3J81 N;  4JI5 O;  4DR1 O;  1XNR O;  4DV5 O;  4DR5 O;  2Z0A A;  4DV6 O;  1IBM O;  4LFA O;  2UUA O;  2F4V O;  1HNZ O;  3RT3 C;  4GKK O;  1NS1 A;  4DR7 O;  5BY1 A;  5H5N A;  2E5L O;  5LL6 Y;  2DJV A;  4A5U B;  3T1H O;  2DOS A;  4LF4 O;  4DUY O;  4DR2 O;  2FKX A;  4JYA O;  3J80 N;  3M8A A;  1IBK O;  4NXM O;  2JRI A;  4DV3 O;  4NXN O;  5BR8 O;  4LFC O;  1AB3 A;  1N34 O;  2UXD O;  1D2D A;  5LMN O;  1FKA O;  1R6T A;  1F7Y A;  1XMO O;  4K0K O;  4B3R O;  4JI4 O;  4LF9 O;  4KHP O;  4OPA A;  2UUB O;  3T1Y O;  4YY3 O;  4X64 O;  4X62 O;  4B3T O;  4JI8 O;  4LF8 O;  2AGA A;  4DUZ O;  3J7A U;  1N33 O;  4JI6 O;  1XMQ O;  1N32 O;  4OX9 O;  2UXB O;  1G1X B;  1YZB A;  4JI3 O;  4DV7 O;  4DV1 O;  5IWA O;  4DV0 O;  2UU9 O;  1HNW O;  1R1B A;  1XNQ O;  4B3M O;  1J5E O;  1AIL A;  4B3S O;  1XEQ A;  4DR3 O;  2ZKO A;  3O65 A;  4JI7 O;  4DR4 O;  2ZM6 O;  4JI0 O;  3OTO O;  2UUC O;  4YHH O;  1HNX O;  5LMU O;  4JV5 O;  3F5T A;  4DR6 O;  1DK1 A;  1N36 O;  2HHH O;  4AQY O;  1HR0 O;  1FJG O;  4LF5 O;  1FYJ A;  4JI1 O;  2UXC O;  2N74 A;  1A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...