4R8CA

Crystal structure of cng mimicking nak-etpp mutant in complex with rb+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
84
structure length
84
Chain Sequence
QVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r8cA00
4XDJA 2BOCC 2DWDC 4ZBMA 3T1CA 2WLLA 5EK0A 1M57C 4LP8A 3STLC 3SYQA 2QKSA 4MW8A 4MVUA 2HJFC 1ZWIC 3OUSA 3EFFK 4MVZA 3T4DA 2A9HA 4KFMA 3LUTB 2DYSC 5EBMC 4MTFA 1G4YB 3LDCA 3T4ZA 3ASNC 1OCOC 2HVJC 1QLEC 1OCZC 4QE7A 2EILC 1V55C 2WLMA 4QE9A 3UKMA 4LBEC 3RW0A 2Q69A 2HFEC 2W0FC 5J9PC 2H8PC 2EINC 3FB5C 2WLNA 3TCUA 3F5WC 3ASOC 3K06A 5CBGA 1K4CC 3E8HA 3AG3C 3K08A 1KKDA 5BZBA 3SPIA 5KUMA 3SPHA 2K1EA 4J9ZB 4XDKA 3AG2C 3F7VC 4PA6A 2WLIB 5E1AC 3WG7C 5EC2C 4DXWA 2ATKC 2AHZA 2OCCC 4P9PA 4WFHA 1R3KC 4MTOA 1ORQC 3BEHA 4UUJC 3IFXA 4X89A 3SYAA 3SYPA 3E8FA 5B1BC 3K0DA 3K04A 2WLLB 4PA4A 4WFGA 4TWKA 3HPLC 2ITCC 4BW5A 3FB6C 4JTAB 3E8GA 3OUFA 3JYCA 3F7YC 3RVZA 3X2QC 3RVYA 5CBFA 1JVMA 4OXSA 1P7BA 3K0GA 5EBLC 4JTCB 2NLJC 1S5HC 4RO2A 4MVSA 2X6AA 2WLHA 3AG4C 3E86A 4F4LA 5B3SC 3E89A 4RUEA 2Y69C 3OR6C 3RBZA 2EIMC 2AHYA 3OR7C 4H37A 4P2ZA 4PA7A 3SJQC 4WFEA 3OGCC 1M56C 1K4DC 2DWEC 4RUFA 4X88A 4R6ZA 4R7CA 4MS2A 2X6BA 4G27B 3SPGA 2A79B 1J95A 3GB7C 4LCUC 3KG2A 2WLKA 3E8BA 3STZC 1OCCC 2P7TC 2IH1C 3K03A 3TETA 3FB8C 4CBCA 4MSWC 2DYRC 4GX2A 4PA9A 4HYOA 2IH3C 2ZXWC 5CBHA 4GX1A 1BL8A 4HZ3A 5EBWC 1R3JC 2ITDC 4PDRA 2A0LA 3ABMC 3R65A 2EIJC 1LNQA 3LNMB 4MTGA 4P30A 4MVRA 2JK5C 4J9YB 5KUKA 3ABKC 1XL6A 3SPJA 3AG1C 2ZD9A 4JTDB 1V54C 2BOBC 2HG5C 4GX0A 4MVMA 5B1AC 2HVKC 4P9OA 4MW3A 3VOUA 3FB7C 3LDDA 4R8CA 3SPCA 4XDLA 2KB1A 2QTOA 1R3IC 1OCRC 2EIKC 4GX5A 3SYCA 4QNHB 4H33A 3IGAC 4WFFA 4R50A 4I9WA 3T2MA 1XL4A 3PJSK 4MVQA 4RAIA 4MVOA 2Q68A 3UM7A 2YEVA 2WLJA 4PA3A 4G28B 4EKWA 2WLIA 3ZJZA 4PDLA 3ZRSA 2Q67A 2R9RB 4PDVA 3E83A 3LDEA 3SYOA 5IY5C 1R3LC 4X8AA 5EC1C 2X6CA 3ABLC 2Q6AA 4PDMA
chains in the Genus database with same CATH superfamily
5LOVA 1B3QA 4MVUA 3APQA 2G38A 5B1OA 1BHBA 5B3SB 1VMGA 4CC5A 1XNRB 3LSSA 4J7ZA 4MT8A 1W2BU 1M56B 4LBEC 2Q69A 3A0HZ 1Y74B 3U10A 3TCUA 3ZIAG 3IC9A 3SPIA 4X66B 2K1EA 5LMUO 2A06H 3AG2C 3SR2C 5KHGA 1ENVA 1B04A 4O2BB 2OWOA 1MSDA 1GM9A 2M6YA 1YDXA 4H44B 3AK2A 5LP6B 5E79Z 4LR3A 3SYPA 4GLXA 1Q82W 3K0DA 4B7KA 2DN9A 3KCXA 2ODMA 4TUYB 5IYBO 1HNWB 4NB5A 4DUZB 1FPOA 5EZYA 4MVSA 2IJJA 4F4LA 2WA4A 3UQ8A 2GTSA 3ZEDA 1JCHA 4JI3B 1US6A 2JEUA 1MA1A 4RUFA 4UVAA 3JCZA 3B8NA 2Q7GA 3A8TA 3J80N 2XAFA 1XMOB 4Q6GA 5J2UB 1H2MA 1QVGU 1HR0B 3ETDA 3CD6V 2W6IG 1P84F 2GBOA 2EILB 4DR1B 1NT2B 1H2GA 3VQWA 4DR3O 4GX0A 4LF7O 4P9OA 3AG3B 4EFBA 4F6RB 3CX5F 2QM7A 4UVCA 3CS5A 4GX5A 4LNUA 3IGAC 1AR4A 3BA8A 4JI4O 4I4TA 4BIUA 2FL4A 5C8YA 4IHJB 2L6LA 2Z3YA 2E74B 5IY5C 3CP1A 5KAFZ 2X6CA 1LR1A 3H1HH 4EEQA 5LGTA 3A0RA 3B2EE 1XI1A 4I7ZB 3CMEV 1I94B 1OHHG 1KC8W 1ROPA 4KFMA 3LUTB 1CP9A 4J41A 4NTYA 5LMNO 1OCOC 2GHYA 3ZS8C 4AHCA 1U96A 2F93B 1V55C 4FLWA 3Q4HB 2PI5A 2BCCH 5CA0A 1I08A 1VQ7V 1QQCA 1PV0A 1QVFU 4DRXB 4K3AA 3SPHA 3PN1A 3F7VC 4K0KO 1JPXA 1JMKC 4FFKA 5IYDO 4X64B 4J10A 1W0JG 5B1NA 1VQ5V 4W4LA 5LOVB 2Z5UA 1KMIZ 1FS0G 1V54B 1IBMO 3JASA 2F43G 3CSXA 4PA7A 3G80A 1PNMA 1VIBA 4UB8Z 2P5OA 2LP7A 5IWAO 2QM8A 2KSDA 1XNQB 1GH6A 3U11A 3E8BA 2HHHO 3JAWA 4JYCA 1YF2A 3OMAB 3FB8C 2QR4A 4D6TH 2DYRC 4JASA 1EN5A 4CS2A 3R65A 1XNRO 3L75H 1G8MA 4LH7A 5EZYB 3FB7C 3LDDA 4JI6B 1F4NA 2Y69B 3CC4V 4B7EA 5GTHZ 4FLVA 5FPRA 2H94A 4X66O 3PJSK 2E5LB 2DE0X 1PKXA 4MTXA 1YHQV 3K3WA 1VQKV 3AK3A 5IYCO 3N27A 2GV9A 1WPBA 3ZHSA 2HJFC 1H2KA 3MHSC 1HNWO 3AG4B 1I0HA 2ZE8A 1RM1C 2UXXA 4LF6B 1G4YB 4DK0A 4DUZO 3K5NA 5IT9N 2HVJC 1QLEC 2EULA 4JF3A 4NXNB 2YI9A 2OCHA 3ZHUA 1HNXB 2EINC 2EIKB 5H5NA 1KBHA 3UT5A 4LNUB 2ZR3A 3ASOC 1CXZB 2B9ZA 4FPPA 4I4TB 1XMOO 3A2FA 1FXKC 1ZSPA 3ZHTA 3WG7C 1IXMA 1HR0O 1Q86W 1H2SB 5LYJA 1BS3A 4UUJC 4X89A 1SQGA 3B8MA 3KCYA 2P4KA 1XILA 4A5UB 4DR1O 1MG1A 2OTJV 1L8DA 3E8GA 4KHPO 4DV4B 3RVZA 4O4JA 3RVYA 1XMQB 1Z5WA 1M9NA 3CCRV 2NLJC 1SQFA 3EHBB 5KA6A 2YDEA 2ZIOA 1EM1A 4JI1B 4ZHQB 5CA0B 1BCCH 2A7WA 3IC7A 1J95A 3K5MA 5L3GA 1M57B 1SKVA 4FFBB 1JX9A 2Y0PA 1AVMA 5KHKA 2A0LA 4J80A 1MNGA 1SQBH 1D2DA 1E1QG 1QCEA 3AG1C 4PJ0Z 3JASB 1O9HA 4CS3A 3CRMA 2FTKA 2Y0IA 4X64O 1AP6A 4XDJA 2Q6AA 3T1CA 4CH5A 4LFBB 1N33B 1XOUA 2JGDA 4O2AB 4DK1A 1J5EB 2V7QG 1Q6IA 5IJ9A 3L70H 1SQXH 2ZDIA 3M7MX 4B3TB 5J9PC 3SDLA 4ZIBA 1K7DA 1HDJA 2UXDO 1VF6A 1K97A 5KAIZ 4ZOLB 2PF4E 1NH2B 1Y67A 2JVDA 1NQTA 1I5XA 1R6NA 2KG7A 1GN3A 1XNQO 1R6KA 1VF5B 1GM8A 5BR8B 2ATKC 3JALA 1SQPH 1XBLA 4IYHA 3C90A 2ZQMA 1BQZA 3D36C 2EIJB 1Z5VA 3RFRA 2DJVA 4WFGA 3JD2A 2ITCC 4K35A 4IIJA 4QJFB 3WFVA 2ZE5A 2AZ2A 4JI6O 2VWJA 1S5JA 3QNEA 2RNBA 4X1YA 2EIMC 4P2ZA 4WFEA 3GWKC 4CH4A 2E5LO 1GN2A 2Y4UA 4FLUA 1GAXA 1QLNA 2X6BA 3SPGA 4DV2B 4KP4A 3EVKA 4LF5B 2QKAA 1PL0A 4HBNA 4EB6A 3ZMVA 5LYJB 3ASNB 2E3CA 4GX1A 3JATA 4TV9A 2UUCB 4LF6O 1LNQA 4J9YB 3ABKC 4NXNO 1AI7A 4O4JB 2YC0A 4EFEA 3ZMZA 3SPCA 1TGOA 3OFNG 1DK1A 2ZKOA 1JJ2U 1IBKB 2Y4TA 2GTAA 2YEVA 2RQ6A 1SETA 4I5SA 1S5LZ 4FM1A 1NH2D 4U3FH 2AXTZ 2N05A 3FFQA 3K5OA 1SA0A 4UCUA 4DV4O 1ZL8A 1GTOA 1XMQO 3P3NA 4JAUA 2XAGA 2EZPA 4JI1O 4FLTA 4E2LA 2WLNA 2OTLV 2E75B 3CCJV 2XUMA 4YHHB 4TQDA 2R9AA 4FMTA 4CH3A 3ABMB 1SS3A 4UXNA 2WWWA 1Q7YW 1AI5A 3RGBA 4BW5A 1DF4A 3JYCA 3F7YC 5CBFA 5JJNB 3K0GA 1PP9H 2V4DA 1VEWA 4FIPC 3E89A 4JAAA 3ZMSA 3UCSC 1QBZA 5ITZA 2P90A 4U3JA 2LFRA 1OZ0A 2KG7B 5EYPA 4K8ZA 1YTFB 4JV5B 2IW5A 3DC5A 3M8AA 5KX5A 1N33O 2HLDG 3JALB 4LFBO 4PA9A 1NKDA 3ZRXA 2CGOA 3ETGA 4DR5B 1J5EO 1BQ0A 4MTGA 1K8AW 4IIJB 3R66A 3I56V 1YITV 4B3TO 1W59A 5LHGA 3J7AU 1OCRC 4X1YB 4BW9A 3NR7A 4R50A 4ZI7A 1W0KG 5LA6A 4FM0A 5BR8O 4JI0B 4PDVA 1WA8A 4X8AA 3ABLC 3WB2A 2Q4PA 3GWOA 3NXSA 4OX9B 3X2QB 4EB6B 5H6RA 2QKSA 3APOA 4FM2A 3JATB 4TV9B 4HAMA 4LF8B 2CTRA 2F66C 3H1IH 1K5QA 3UKMA 5L3CA 4DV6B 2ZT9B 3JD4A 4PD4F 3E8HA 2PZSA 4XDKA 4DV2O 2YEVB 3OW2U 2XAHA 1R1BA 4JAVA 2QDOA 3CCEV 2ETNA 4CC6A 2AHZA 1BE3H 4LF5O 3H01A 4H0LB 2QWNB 4MTOA 4O4IA 2ADQB 4J7JA 2UUCO 5B1AB 1SA0B 2QE7G 1YTFD 3HKDB 4JTAB 2R72A 3GVMA 1IDSA 5EBLC 4RO2A 1S5HC 3ZBHA 2X6AA 4Z1MG 4FLXA 4BR6A 1Q5OA 2UXNA 5B3SC 4RQFA 3BA9A 1IBKO 3BFRA 3OGCC 2HR3A 1M56C 3C3SA 3CCSV 4G27B 2CTWA 3OM3B 3TGUH 1BGYH 3TK1A 1KKCA 1MMMA 4GX2A 5JWPA 2ZXWC 1SQVH 4DW1A 5A9GA 2CH7B 5LP6C 3SJBC 4CS4A 4AI8A 5FL7G 2VQFB 1BHAA 5DECA 2HJDA 3DC6A 2RDCA 1NJIW 4WF9V 4PELA 1RPRA 1RFYA 2PUSA 2PYJA 4OPAA 3B09A 5K1XA 1YSCA 3KZIZ 1XL4A 1JA8A 2P6JA 2IJKA 5ITZB 1UJWB 4YHHO 4U3JB 3RT3C 2QA4V 4NR1A 1YJ9V 5EYPB 5B1BB 4BWAA 3SYOA 4KXRA 2IM9A 5EIBC 4Z2WA 4DO2A 3S3XA 3MDSA 4KHPB 1NI8A 4LH6A 4B3RB 2A9HA 5L3BA 5LGUA 2EILC 5GONB 1AB3A 2WLMA 4QE9A 4LF9B 2YI8A 4YJ3A 1QNMA 4TQFA 1L0NH 4FLZA 3JARA 1JJOA 1K73W 2Q0AA 2LW1A 3AG3C 4ZI7B 1Y76A 1FXKA 1EZVH 5LA6B 4LF4B 4JV5O 3ZHQA 1Q6HA 3T1HB 1WA8B 2OT5A 3E8FA 3QO8A 1L1FA 4N23A 1NTZH 4TWKA 1BMFG 4DR5O 4RQEA 4I55A 5KA5A 3C3TA 1IBLB 3CRAA 5B5EZ 3HR0A 1OCOB 3M99B 1P7BA 3OMNB 4X20A 4RUEA 3SJCC 3W7TA 1O9GA 2CTPA 3AG7A 3THOA 1H38A 2FB5A 5KHIA 4R6ZA 5H6QA 2R70A 3HKCB 4JI0O 3ZCCA 3QO5A 2W6JG 1WP8A 2QSAA 4JYBA 2IU3A 2YIAA 4CBCA 5LGNA 4MSWC 4OX9O 4O4IB 1S3JA 1FFXA 1BL8A 3E2EA 4LF8O 2K9PA 3D3QA 4JTDB 1RSOA 1V54C 2ADPA 3JD0A 2UXDB 4JYYA 4ASUG 1H2LA 4R8CA 4DV6O 3SYCA 3DXRA 4H33A 2D2CB 2VWKA 4JZ2A 4PDLA 1UPGA 4NTWA 2Q7HA 3OT7A 5FNVA 5DM6V 5HFMA 2QJ1A 1Q6UA 4GKJO 1LUVA 5JCOC 1TUEB 2P4VA 2M7WA 4X1KA 3CCUV 1F4MA 1VQ9V 3G4SV 4J9ZB 2ZINA 4PA6A 2F23A 3D36A 1PD3A 2YUAA 3SYAA 3IFXA 4J42A 3BAAA 5CA3A 1G1XB 2IJIA 5C93A 2Q5ZA 1K9MW 1EN4A 4HNAA 4G2KA 2VQFO 2FKXA 1QLEB 4JYAO 3AG4C 3TXSA 1KKDA 1TUBA 3OR7C 3CCQV 1VP7A 3OEEG 4YJ3B 3VQVA 3ASOB 1K4DC 2OIEA 5C8YB 3JARB 2JDIG 1BZKA 1Y76B 1WB7A 2UUAB 4DR6B 1URFA 1VF7A 4UCVA 1SC5B 2EJRA 4O4HA 4I50A 4B3RO 5BXZA 1KU9A 4L87A 3BABA 4GCZA 5LHIA 3LNMB 1RP3B 4I55B 3FD9A 4GKKB 4MVRA 3KKYA 4WCEV 4LF9O 1YIJV 2E76B 3CRCA 1F51A 4LWSA 1TAEA 4B3MB 4MVOA 4LF4O 1MSWD 2WLIA 4AILC 1WPXA 2YIDA 3K59A 3BHPA 3G71V 1NR7A 3T1HO 2PYLA 4GT1A 1VQNV 4JI5B 2NNUA 2BOCC 2DWDC 1GRJA 1M57C 3STLC 3H1LH 2ZIMA 3BY6A 1IX9A 3OUSA 1IBLO 1FFXB 2NR5A 2DYSC 2H3OA 1XHXA 3CJHA 4OGQB 1RSOB 4Q20A 4BIOA 5IJ0A 3WB1A 3FB5C 3DXRB 2Z0AA 1VQOV 3JAWB 2JJ1G 4DXWA 5KHHA 1FYJA 3E22A 3FAVA 3TXQA 1WLEA 1S0VA 4X65B 1N32B 3ABUA 2A3QA 1DLBA 1JVMA 1EZJA 3SJAC 3HB3B 4CZZA 3VQYA 4X1KB 1XEQA 3VBBA 3N2GA 1FAFA 4QGPA 4R7CA 4DV3B 3ETQA 2W0XA 1K92A 2C2AA 3FYEB 1XDCA 3K03A 2IH3C 1AILA 2DW4A 3ML0A 2ITDC 3H1KH 2EIJC 4HNAB 3ZHVA 1ZUQA 2BOBC 3CC7V 2HVKC 4YJ2A 1FKAO 3UT5B 1JOYA 1TUBB 1YVWA 3VQXA 3OTFA 1D5NA 1GN6A 4WBNA 5JH7A 2PI4A 1ZAUA 3UM7A 2L35A 2QWQB 4I0XA 4EKWA 3K58A 3E83A 4NXMB 5IE9A 5H2FZ 1DGSA 2ILMA 3SYQA 1SERA 1P49A 4O4HB 4MTFA 1ZX3A 3LDCA 1KD1W 3ASNC 3ABKB 3FYIB 5LHHA 4CH6A 4X1IA 2YICA 3JD3A 4C7UA 1AI6A 1FD9A 2UXCB 3F5WC 2ZM6B 4LWSB 3CCMV 3QG5A 4LC1A 3RYIA 4LFCB 1DTOA 4QPJA 1THZA 4ZKIA 5LXTA 2WLIB 2KQXA 1IURA 2UXBB 3FX7A 2UUAO 4DR6O 1XREA 3L71H 4GZRB 2XNDG 2YIBA 5K1PA 1N0NA 3JAMN 4NVPA 4GKKO 5HFLA 1VQ8V 2YXHA 1EBOA 1WAZA 1S76D 5JJEB 2CE4A 4H37A 5BMVA 1M1KW 5IJ0B 4B3MO 1Y74A 2OIGA 3CC2V 4DV1B 2IBZH 1N8RW 2ZR2A 4JI5O 1G6UA 1YJWV 4KUMA 4O2BA 3K9SA 3E22B 3FAVB 2HKOA 2JGDB 4X9QA 3CEIA 2EJ7A 5EBWC 1OCZB 3MAQA 5IJ9B 4PDRA 4UB6Z 1K34A 3ABMC 2F4VB 3EXAA 4K8XA 2BSKA 4UCSA 1AJQA 1PPJH 2YS8A 1HP8A 2P67A 4MVMA 2VS0A 1NTKH 2Q7EA 1I7FA 2ZCEA 1VQ6V 4FK5C 1R3IC 4JI7B 3T2MA 1QR8A 1K33A 2RCVA 1A32A 2ZDIC 1EN6A 4PA3A 4G28B 4YIOA 1E79G 3ZN0A 2LO1A 3ZRSA 2R9RB 4IGGA 5A2QN 2BTQA 3QF7A 2LW7A 4X65O 1N32O 5EK0A 4LP8A 3BCCH 1MZFA 3T4DA 2XOKG 4UV8A 1FJGB 3CRRA 4YJ2B 2XAQA 2B5UA 3DGEA 3BPZA 3AK1A 5CA1A 4DV3O 4WBNB 3UO3A 1OCCB 2Y48A 2EZOA 3JSNA 2QWRB 2N04A 5EC2C 3ETEA 3K79A 2OCCC 4P9PA 1VQMV 3QVNA 5D5QA 4YY3B 4Z1VA 3N2KA 4WFBV 2IJHA 1M5IA 3OUFA 2WSSG 3X2QC 1P7GA 3L72H 4X1IB 2LGQA 5CMUA 2AHYA 2F95B 5LBQA 3AEIA 3JAKA 2OYQA 3RYIB 3IAYA 2A79B 4LCUC 3GB7C 2ZNIA 5LXTB 4NXMO 4YXWG 1KB9F 2Q73A 3W7UA 3O65A 4HYOA 4B3SB 4GKJB 1ZL8B 3IJ4A 1N36B 1R3JC 1SRYA 4BAYA 4DV0B 2WPDG 3CB2A 3RYHA 5J2TA 5B1AC 3G67A 3VOUA 2UXCO 2DOSA 4XDLA 2JS5A 4YIPA 3AG2B 5KLVH 2ZM6O 2EX3A 5BMVB 1M93A 4PV1B 4LFCO 5F2VO 3J81N 3MD0A 1NU1H 1I5YA 3OAAG 3CMAV 2CGNA 2YXYA 2UXBO 3L9DA 1YZBA 4PI2A 2WA3A 3B77A 1MOFA 5AG2A 5KHJA 3RN4A 3D8CA 2ZXWB 2XHBA 4AQYB 4JYAB 2AW9A 5JCOA 2P06A 3MHHC 2BSKB 4QE7A 1YI2V 2W0FC 4ICGA 4ABMA 1WB8A 1GN4A 5CB4A 1E1RG 1PL4A 4DV1O 2B1IA 5KUMA 3ZRWA 3WB0A 2VQEB 3CCVV 5KX5B 2AZ0A 1R3KC 4DUYB 2BTQB 1S72V 5B1BC 1EFRG 2Q9LA 1KQSU 5D5PA 4DR7B 3HPLC 2GDSA 5JQGA 2F4VO 5L3EA 1JFFA 1F7YA 4JTCB 2Q0OC 1ZLZA 2X7RB 4IT5A 2YIBD 4JI7O 3CYOA 4DV5O 4X88A 1F23A 5IY5B 3G6BA 1AI4A 5CA1B 2N74A 4TV8A 1XHZA 1NVPB 3L73H 5L3DA 3STZC 2P7TC 2IH1C 3RWRD 4KL1A 4J11A 4TOIA 4JI2B 1DF5A 1WNSA 2CK3G 1X4TA 2QEXV 4HZ3A 4JI8B 4LFAB 2ZE7A 2UU9O 1V55B 3G6EV 3N2KB 4FZ1A 1WP7A 3OTOB 3T1YB 4UVBA 1IXBA 4I9QA 1CEZA 1FJGO 2HG5C 1Q3EA 1GMGA 1GK9A 5KMGA 4RAIA 4ZHQA 3JAKB 3ZJZA 2MK3A 2MW2B 1BT8A 1R3LC 5JJJB 2CUGA 2LQTA 2ARHA 1Q8IA 4FFBA 4YY3O 1YCIA 4UFZA 1FXHA 2YXLA 5EIBD 4QIWF 4U7OA 3RYHB 1WJZA 5J2TB 1UFIA 1SZXA 1XUQA 4O4LA 1H8EG 4DV7O 1KP2A 5BZBA 2AGAA 2DYRB 1L0LH 2DMXA 1YXBA 3OGIB 2JGUA 3F5TA 3ABTA 3K9AA 4WFAV 2VRZA 1ORQC 4B3SO 1MZEA 3K04A 1N36O 2JEXA 1NVPD 4DV0O 1B6QA 3ZN1A 1NZ6A 3BRCA 2JS3A 5JVDA 4O2AA 1GKFA 2P22C 1TVKA 3E86A 2Y69C 3OR6C 4UCOA 1Z2GA 2DWEC 5L3FA 5CB4B 2Q8VA 4ZOLA 1PM9A 3W7WA 3ZRWB 2XASA 2YSUB 3JD1A 1H8HG 2RJZA 3LNNA 4DR4B 4OPHA 1RM1B 4N21A 3D3IA 4PI0A 4AQYO 1S77D 2F1MA 1H2NA 4JGSA 3ZRVA 5JQGB 2EINB 2O57A 3ZMTA 1JFFB 1VQ4V 2QM4A 1HNZB 1K3EA 2NN4A 1IVSA 2EIKC 1FXKB 1QR9A 2RMKB 2LFSA 3HKBA 3WG7B 2Q68A 2VQEO 4JI3O 1AR5A 4U7NA 4TV8B 2BTOA 3LDEA 4DUYO 3HKEA 3U0ZA 2WLLA 2DQ3A 1LUWA 4DR7O 3OE7G 1ZWIC 4MVZA 2LJ2A 1VQPV 4X20B 1SF9A 2XT9A 4FZ0A 2H8PC 1K5SA 2ZNJA 1OJHA 3FKSG 5KMGB 5GW7A 5CBGA 3K08A 4D7TA 2JJ2G 2JRIA 3CRQA 4JI2O 3RYCA 1R73A 1IZ3A 4J7KA 4D7SA 4H13B 4JI8O 4LFAO 3AG1B 3OTOO 4JPRA 3FB6C 3T1YO 2DYSB 1I94O 3O9OA 4OXSA 1BSMA 1N34B 2FMLA 1OV9A 5GTIZ 4O4LB 4TSFG 3JSLA 5IYZA 4IYIA 5FNVB 1YJNV 2WLKA 4W4KA 4B08A 1KYOF 2CDYA 1XQ8A 1KUQA 2GUZA 1NTMH 3TJTA 1HW7A 2UUBB 3ZMUA 1XL6A 5JVDB 2ZD9A 1X59A 3CXCU 1TVKB 2KB1A 5LL6Y 4DR2B 2QTOA 1SZTA 1NS1A 1Q43A 4WFFA 3DSQA 1AP5A 4IL6Z 4XBFA 3ZHRA 1GO3F 1COWG 2Q67A 3CWBH 1GM7A 2EBOA 3OEHG 5FLXN 4MW8A 3EFFK 3T4ZA 4X62B 2EIMB 3UO2A 1AR1B 2HFEC 4UCTA 4TT3G 1K4CC 2ZE6A 1D5AA 4UCRA 3HKBB 1KECA 3CXHF 1ZTEA 1VARA 2QWPB 1RPOA 3LSQA 5DEDA 4DR4O 4I50B 2D3OW 3BEHA 5IDJA 3ZX6A 3HKEB 3RYFA 3SGIA 2WLLB 1NR1A 4GUNA 2JIZG 1JQ0A 2PGGA 4FJCC 5CN0A 5FPOA 1PNLA 4DW0A 3L74H 1HNZO 1AROP 2WLHA 2X0LA 1Q90D 3SJQC 1Y66A 2KKWA 1YEWA 5TISZ 2FYUH 1HNXO 1AJNA 1U97A 1AJPA 1N0JA 5LMUB 3B4SA 3TETA 1TA8A 3RYCB 1MABG 5B66Z 1N4CA 3CJHB 3JCUZ 1M4UA 3B40A 4P30A 4BIZA 4FVMA 3P3PA 3SPJA 3I5DA 3HKDA 1R6TA 2QWOB 2DQ0A 4I9WA 3LSUA 4MVQA 1B06A 2WAMA 2WLJA 2RN9A 5IYZB 5LP6A 3CE2A 3H1JH 5DN6G 1M90W 5H9CA 4RWUA 4ZBMA 2PTMA 1VQLV 2QKCA 4TUYA 2HEPA 3BVOA 2XAJA 2GUZB 4FLYA 5EBMC 1JR9A 1OCZC 2CH7A 3OD4A 1N34O 4QPKA 3S3WA 4DR3B 1SQQH 3RW0A 4LF7B 4DV5B 3QO7A 3N2GB 1FFTB 1HWYA 1Y4MA 2IU0A 3K06A 1VF6C 4JI4B 1KP3A 1Q81W 4NKGB 5J2UA 2BE3A 5E1AC 3A0BZ 4F6EA 4WFHA 3CHXA 4E4EA 3K5LA 2UU9B 1QHTA 1NBMG 4PA4A 3I55V 2UUBO 3P30A 3W7SA 1OCRB 5LMNB 4F6RA 3CCLV 3CPWU 4DR2O 3RBZA 2QGNA 1CPYA 5JH7B 1V9PA 5GONA 4PHZA 4I0XB 5BY1A 1WN7A 4NTXA 4IHJA 3ABLB 3ICXA 4MS2A 3OMIB 4K0KB 4DYLA 3KG2A 1QU7A 2CAZC 3H9VA 2PY5A 2OCCB 1T5EA 1OCCC 4UV9A 1PNKA 3WU2Z 1FXVA 2R9IA 2CTQA 5CBHA 1SESA 3RYFB 1IBMB 4X62O 2JK5C 4JZGA 5KUKA 3K57A 4NYKA 4DV7B 3DTUB 4MW3A 1P4RA 3Q4HA 3W7XA 4QNHB 4L8JA 4DRXA 3E35A 3QTCA 2GSMB 2LGWA 2XTAA 1Y6XA 3P32A 5IWAB 4GYCB 3HKCA 2HHHB 5EC1C 2QTSA 2HP8A 4PDMA 2B1GA 2V1DA
chains in the Genus database with same CATH topology
2BOCC 2DWDC 1M57C 3STLC 3BY6A 4MVUA 3OUSA 1FXHA 5B1OA 2DYSC 1BHBA 5B3SB 1GTOA 4QIWF 4U7OA 3LSSA 1W2BU 4MT8A 1M56B 4LBEC 4Q20A 2Q69A 4JAUA 2XAGA 2EZPA 4E2LA 3FB5C 2WLNA 3TCUA 1H8EG 3ZIAG 1KP2A 1VQOV 5BZBA 3SPIA 2K1EA 3AG2C 2OTLV 3CCJV 1ENVA 2JJ1G 2DYRB 4DXWA 3ABTA 3K9AA 1GM9A 4FMTA 4WFAV 1WLEA 1ORQC 3ABMB 1S0VA 3SYPA 1Q82W 4UXNA 3K0DA 3ABUA 2WWWA 1Q7YW 3K04A 2JEXA 1AI5A 1NVPD 5IYBO 1B6QA 3ZN1A 4BW5A 1DF4A 3JYCA 3F7YC 1DLBA 5CBFA 1GKFA 1JVMA 3K0GA 1EZJA 4MVSA 2IJJA 3E86A 4F4LA 4FIPC 3E89A 3HB3B 2Y69C 3OR6C 3ZMSA 4CZZA 1JCHA 1QBZA 2JEUA 2DWEC 4RUFA 3VBBA 5L3FA 4UVAA 2P90A 3B8NA 3JCZA 4R7CA 2LFRA 1OZ0A 3W7WA 3ZRWB 2XAFA 2XASA 2YSUB 1K92A 3JD1A 2C2AA 1H8HG 3FYEB 1YTFB 2IW5A 1QVGU 3K03A 2HLDG 3ETDA 4PA9A 1NKDA 4N21A 2IH3C 3D3IA 2DW4A 3ML0A 1RM1B 3CD6V 2W6IG 3ZRXA 1S77D 2EILB 2ITDC 3ETGA 2EIJC 4MTGA 1K8AW 4JGSA 3ZRVA 2EINB 3I56V 1YITV 3ZMTA 1H2GA 2BOBC 3CC7V 4GX0A 1VQ4V 2HVKC 4P9OA 3AG3B 1K3EA 2QM7A 5LHGA 4UVCA 2EIKC 1OCRC 4GX5A 1JOYA 3IGAC 1FXKB 4R50A 1QR9A 2PI4A 2LFSA 3WG7B 1W0KG 2Q68A 3UM7A 4BIUA 4EKWA 2Z3YA 4U7NA 4PDVA 3E83A 3LDEA 5IY5C 3CP1A 4X8AA 2X6CA 3ABLC 3GWOA 5LGTA 3A0RA 3NXSA 3CMEV 2WLLA 2DQ3A 1OHHG 3SYQA 3X2QB 3OE7G 5H6RA 2QKSA 1KC8W 1ZWIC 1SERA 4MVZA 1ROPA 4KFMA 1VQPV 3LUTB 4HAMA 1CP9A 4MTFA 3LDCA 1KD1W 3ASNC 1OCOC 3ABKB 2GHYA 3FYIB 5LHHA 1K5QA 1V55C 3UKMA 3JD3A 5L3CA 1AI6A 2H8PC 1K5SA 2PI5A 3JD4A 3F5WC 3FKSG 1VQ7V 5GW7A 5CBGA 3E8HA 3K08A 1QVFU 3CCMV 4LC1A 3SPHA 4XDKA 1DTOA 3F7VC 4QPJA 2YEVB 3OW2U 2XAHA 1JPXA 1THZA 2JJ2G 4ZKIA 2WLIB 4JAVA 5IYDO 3CCEV 2AHZA 3H01A 1R73A 1W0JG 4MTOA 2XNDG 5B1NA 1VQ5V 2Z5UA 3AG1B 1FS0G 1V54B 5B1AB 4JPRA 3FB6C 5HFLA 2QE7G 1YTFD 2DYSB 4JTAB 1VQ8V 1EBOA 4OXSA 2F43G 5EBLC 4RO2A 1S5HC 2X6AA 4Z1MG 2UXNA 1S76D 5B3SC 4RQFA 4H37A 4PA7A 1M1KW 1PNMA 3OGCC 2HR3A 1M56C 4TSFG 3CC2V 2LP7A 3CCSV 2QM8A 4G27B 1N8RW 3OM3B 1YJNV 2WLKA 3E8BA 2ZR2A 4JYCA 3OMAB 3TK1A 1YJWV 4KUMA 3FB8C 2HKOA 2DYRC 4GX2A 4JASA 2ZXWC 5EBWC 1OCZB 4PDRA 1K34A 3ABMC 3R65A 3ZMUA 1AJQA 5FL7G 1XL6A 2ZD9A 2P67A 1BHAA 1G8MA 4MVMA 1NJIW 3FB7C 3LDDA 4PELA 4WF9V 3CXCU 1F4NA 2Y69B 3CC4V 2KB1A 1VQ6V 1RPRA 2QTOA 1R3IC 4FK5C 1SZTA 4WFFA 1YSCA 3T2MA 1XL4A 2H94A 1QR8A 4XBFA 3PJSK 1K33A 2ZDIC 1PKXA 2P6JA 4MTXA 4PA3A 1YHQV 2IJKA 4G28B 1UJWB 1E79G 3ZN0A 3K3WA 2QA4V 3ZRSA 1GO3F 1YJ9V 1COWG 2Q67A 2R9RB 5B1BB 3SYOA 1VQKV 1GM7A 5IYCO 2EBOA 4DO2A 5EK0A 3OEHG 4LP8A 4MW8A 2HJFC 3MHSC 3EFFK 3T4DA 2A9HA 3AG4B 5L3BA 1RM1C 2UXXA 1G4YB 3T4ZA 2EIMB 5LGUA 2HVJC 1QLEC 2XOKG 4JF3A 4UV8A 2EILC 2WLMA 4QE9A 1AR1B 2HFEC 2XAQA 2EINC 4TT3G 2EIKB 1K73W 2ZR3A 3ASOC 2B5UA 1K4CC 3AG3C 3DGEA 1KECA 1OCCB 1FXKA 4FPPA 1FXKC 2Y48A 2EZOA 3WG7C 5EC2C 1RPOA 3ETEA 3K79A 3LSQA 1IXMA 2OCCC 4P9PA 1Q86W 2OT5A 2D3OW 3BEHA 4UUJC 4X89A 5IDJA 3B8MA 1VQMV 3E8FA 3QO8A 1L1FA 4N23A 2WLLB 4TWKA 1NR1A 4WFBV 1BMFG 4RQEA 5KA5A 1MG1A 2OTJV 2IJHA 2JIZG 3E8GA 3OUFA 1JQ0A 4FJCC 5CN0A 3RVZA 2WSSG 3X2QC 3RVYA 1OCOB 1PNLA 3M99B 1P7BA 3OMNB 1M9NA 3CCRV 1AROP 2NLJC 3EHBB 2WLHA 5KA6A 2X0LA 4RUEA 3W7TA 5CMUA 2AHYA 3SJQC 1Y66A 5LBQA 3AEIA 1H38A 1AJNA 4R6ZA 1AJPA 5H6QA 3ZCCA 3IC7A 2A79B 1J95A 3GB7C 4LCUC 3QO5A 5L3GA 1M57B 2W6JG 4YXWG 4JYBA 2IU3A 3TETA 4CBCA 3W7UA 5LGNA 4MSWC 1JX9A 4HYOA 1MABG 1S3JA 1BL8A 1R3JC 1SRYA 2A0LA 4BAYA 3E2EA 2WPDG 4P30A 4BIZA 1E1QG 1QCEA 3SPJA 3AG1C 4JTDB 3JD0A 1V54C 5B1AC 3VOUA 4ASUG 4R8CA 4XDLA 3SYCA 3AG2B 2DQ0A 4H33A 4I9WA 4MVQA 2WAMA 2FTKA 2WLJA 3MD0A 3CMAV 1I5YA 3OAAG 4PDLA 3B77A 4XDJA 2Q6AA 3T1CA 5DM6V 1MOFA 5DN6G 1M90W 5H9CA 5HFMA 4ZBMA 1VQLV 2ZXWB 2XAJA 5EBMC 2V7QG 3MHHC 1OCZC 4QE7A 4QPKA 1TUEB 2ZDIA 1YI2V 3RW0A 3QO7A 5J9PC 2W0FC 2M7WA 1K7DA 1FFTB 1HWYA 1Y4MA 2IU0A 1K97A 3K06A 3CCUV 1F4MA 1NH2B 1VQ9V 1E1RG 3G4SV 2B1IA 5KUMA 1NQTA 1I5XA 1R6NA 4J9ZB 3ZRWA 1KP3A 1Q81W 4PA6A 3CCVV 1R6KA 1GM8A 5E1AC 2ATKC 4WFHA 3D36A 1R3KC 1PD3A 2ZQMA 3SYAA 3IFXA 2EIJB 1S72V 5B1BC 1EFRG 5CA3A 2IJIA 5C93A 1KQSU 1NBMG 1K9MW 4PA4A 4WFGA 3JD2A 3I55V 3HPLC 2ITCC 5L3EA 3P30A 4QJFB 4G2KA 3WFVA 3W7SA 1OCRB 1QLEB 4JTCB 3CCLV 3AG4C 3CPWU 3QNEA 3RBZA 1KKDA 1CPYA 2EIMC 2X7RB 3OR7C 4P2ZA 3CCQV 3CYOA 3OEEG 4WFEA 3ASOB 1K4DC 4X88A 1F23A 2JDIG 5IY5B 1AI4A 1QLNA 3ABLB 4MS2A 2X6BA 3SPGA 3OMIB 3KG2A 1NVPB 5L3DA 3STZC 2OCCB 1OCCC 2P7TC 2IH1C 4UV9A 1PNKA 4KP4A 1PL0A 1DF5A 1FXVA 3ZMVA 2CK3G 2R9IA 5CBHA 1SESA 2EJRA 3ASNB 4GX1A 2QEXV 4HZ3A 1V55B 4L87A 5LHIA 4GCZA 3G6EV 1LNQA 3LNMB 4MVRA 2JK5C 4UVBA 4J9YB 5KUKA 3ABKC 1CEZA 1AI7A 4WCEV 2HG5C 1YIJV 3DTUB 4MW3A 1P4RA 3ZMZA 3SPCA 3W7XA 1GMGA 1GK9A 3OFNG 4QNHB 1F51A 1JJ2U 4RAIA 4MVOA 3E35A 2YEVA 2GSMB 1MSWD 2WLIA 1WPXA 3ZJZA 3P32A 2MK3A 1SETA 4I5SA 3G71V 1NR7A 1VQNV 4GT1A 1R3LC 5EC1C 4PDMA 2B1GA 2NNUA 2V1DA 1NH2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDJ A;  2BOC C;  2DWD C;  4ZBM A;  3T1C A;  2WLL A;  5EK0 A;  1M57 C;  4LP8 A;  3STL C;  3SYQ A;  2QKS A;  4MW8 A;  4MVU A;  2HJF C;  1ZWI C;  3OUS A;  3EFF K;  4MVZ A;  3T4D A;  2A9H A;  4KFM A;  3LUT B;  2DYS C;  5EBM C;  4MTF A;  1G4Y B;  3LDC A;  3T4Z A;  3ASN C;  1OCO C;  2HVJ C;  1QLE C;  1OCZ C;  4QE7 A;  2EIL C;  1V55 C;  2WLM A;  4QE9 A;  3UKM A;  4LBE C;  3RW0 A;  2Q69 A;  2HFE C;  2W0F C;  5J9P C;  2H8P C;  2EIN C;  3FB5 C;  2WLN A;  3TCU A;  3F5W C;  3ASO C;  3K06 A;  5CBG A;  1K4C C;  3E8H A;  3AG3 C;  3K08 A;  1KKD A;  5BZB A;  3SPI A;  5KUM A;  3SPH A;  2K1E A;  4J9Z B;  4XDK A;  3AG2 C;  3F7V C;  4PA6 A;  2WLI B;  5E1A C;  3WG7 C;  5EC2 C;  4DXW A;  2ATK C;  2AHZ A;  2OCC C;  4P9P A;  4WFH A;  1R3K C;  4MTO A;  1ORQ C;  3BEH A;  4UUJ C;  3IFX A;  4X89 A;  3SYA A;  3SYP A;  3E8F A;  5B1B C;  3K0D A;  3K04 A;  2WLL B;  4PA4 A;  4WFG A;  4TWK A;  3HPL C;  2ITC C;  4BW5 A;  3FB6 C;  4JTA B;  3E8G A;  3OUF A;  3JYC A;  3F7Y C;  3RVZ A;  3X2Q C;  3RVY A;  5CBF A;  1JVM A;  4OXS A;  1P7B A;  3K0G A;  5EBL C;  4JTC B;  2NLJ C;  1S5H C;  4RO2 A;  4MVS A;  2X6A A;  2WLH A;  3AG4 C;  3E86 A;  4F4L A;  5B3S C;  3E89 A;  4RUE A;  2Y69 C;  3OR6 C;  3RBZ A;  2EIM C;  2AHY A;  3OR7 C;  4H37 A;  4P2Z A;  4PA7 A;  3SJQ C;  4WFE A;  3OGC C;  1M56 C;  1K4D C;  2DWE C;  4RUF A;  4X88 A;  4R6Z A;  4R7C A;  4MS2 A;  2X6B A;  4G27 B;  3SPG A;  2A79 B;  1J95 A;  3GB7 C;  4LCU C;  3KG2 A;  2WLK A;  3E8B A;  3STZ C;  1OCC C;  2P7T C;  2IH1 C;  3K03 A;  3TET A;  3FB8 C;  4CBC A;  4MSW C;  2DYR C;  4GX2 A;  4PA9 A;  4HYO A;  2IH3 C;  2ZXW C;  5CBH A;  4GX1 A;  1BL8 A;  4HZ3 A;  5EBW C;  1R3J C;  2ITD C;  4PDR A;  2A0L A;  3ABM C;  3R65 A;  2EIJ C;  1LNQ A;  3LNM B;  4MTG A;  4P30 A;  4MVR A;  2JK5 C;  4J9Y B;  5KUK A;  3ABK C;  1XL6 A;  3SPJ A;  3AG1 C;  2ZD9 A;  4JTD B;  1V54 C;  2BOB C;  2HG5 C;  4GX0 A;  4MVM A;  5B1A C;  2HVK C;  4P9O A;  4MW3 A;  3VOU A;  3FB7 C;  3LDD A;  4R8C A;  3SPC A;  4XDL A;  2KB1 A;  2QTO A;  1R3I C;  1OCR C;  2EIK C;  4GX5 A;  3SYC A;  4QNH B;  4H33 A;  3IGA C;  4WFF A;  4R50 A;  4I9W A;  3T2M A;  1XL4 A;  3PJS K;  4MVQ A;  4RAI A;  4MVO A;  2Q68 A;  3UM7 A;  2YEV A;  2WLJ A;  4PA3 A;  4G28 B;  4EKW A;  2WLI A;  3ZJZ A;  4PDL A;  3ZRS A;  2Q67 A;  2R9R B;  4PDV A;  3E83 A;  3LDE A;  3SYO A;  5IY5 C;  1R3L C;  4X8A A;  5EC1 C;  2X6C A;  3ABL C;  2Q6A A;  4PDM A; 
#chains in the Genus database with same CATH topology
 5LOV A;  1B3Q A;  4MVU A;  3APQ A;  2G38 A;  5B1O A;  1BHB A;  5B3S B;  1VMG A;  4CC5 A;  1XNR B;  3LSS A;  4J7Z A;  4MT8 A;  1W2B U;  1M56 B;  4LBE C;  2Q69 A;  3A0H Z;  1Y74 B;  3U10 A;  3TCU A;  3ZIA G;  3IC9 A;  3SPI A;  4X66 B;  2K1E A;  5LMU O;  2A06 H;  3AG2 C;  3SR2 C;  5KHG A;  1ENV A;  1B04 A;  4O2B B;  2OWO A;  1MSD A;  1GM9 A;  2M6Y A;  1YDX A;  4H44 B;  3AK2 A;  5LP6 B;  5E79 Z;  4LR3 A;  3SYP A;  4GLX A;  1Q82 W;  3K0D A;  4B7K A;  2DN9 A;  3KCX A;  2ODM A;  4TUY B;  5IYB O;  1HNW B;  4NB5 A;  4DUZ B;  1FPO A;  5EZY A;  4MVS A;  2IJJ A;  4F4L A;  2WA4 A;  3UQ8 A;  2GTS A;  3ZED A;  1JCH A;  4JI3 B;  1US6 A;  2JEU A;  1MA1 A;  4RUF A;  4UVA A;  3JCZ A;  3B8N A;  2Q7G A;  3A8T A;  3J80 N;  2XAF A;  1XMO B;  4Q6G A;  5J2U B;  1H2M A;  1QVG U;  1HR0 B;  3ETD A;  3CD6 V;  2W6I G;  1P84 F;  2GBO A;  2EIL B;  4DR1 B;  1NT2 B;  1H2G A;  3VQW A;  4DR3 O;  4GX0 A;  4LF7 O;  4P9O A;  3AG3 B;  4EFB A;  4F6R B;  3CX5 F;  2QM7 A;  4UVC A;  3CS5 A;  4GX5 A;  4LNU A;  3IGA C;  1AR4 A;  3BA8 A;  4JI4 O;  4I4T A;  4BIU A;  2FL4 A;  5C8Y A;  4IHJ B;  2L6L A;  2Z3Y A;  2E74 B;  5IY5 C;  3CP1 A;  5KAF Z;  2X6C A;  1LR1 A;  3H1H H;  4EEQ A;  5LGT A;  3A0R A;  3B2E E;  1XI1 A;  4I7Z B;  3CME V;  1I94 B;  1OHH G;  1KC8 W;  1ROP A;  4KFM A;  3LUT B;  1CP9 A;  4J41 A;  4NTY A;  5LMN O;  1OCO C;  2GHY A;  3ZS8 C;  4AHC A;  1U96 A;  2F93 B;  1V55 C;  4FLW A;  3Q4H B;  2PI5 A;  2BCC H;  5CA0 A;  1I08 A;  1VQ7 V;  1QQC A;  1PV0 A;  1QVF U;  4DRX B;  4K3A A;  3SPH A;  3PN1 A;  3F7V C;  4K0K O;  1JPX A;  1JMK C;  4FFK A;  5IYD O;  4X64 B;  4J10 A;  1W0J G;  5B1N A;  1VQ5 V;  4W4L A;  5LOV B;  2Z5U A;  1KMI Z;  1FS0 G;  1V54 B;  1IBM O;  3JAS A;  2F43 G;  3CSX A;  4PA7 A;  3G80 A;  1PNM A;  1VIB A;  4UB8 Z;  2P5O A;  2LP7 A;  5IWA O;  2QM8 A;  2KSD A;  1XNQ B;  1GH6 A;  3U11 A;  3E8B A;  2HHH O;  3JAW A;  4JYC A;  1YF2 A;  3OMA B;  3FB8 C;  2QR4 A;  4D6T H;  2DYR C;  4JAS A;  1EN5 A;  4CS2 A;  3R65 A;  1XNR O;  3L75 H;  1G8M A;  4LH7 A;  5EZY B;  3FB7 C;  3LDD A;  4JI6 B;  1F4N A;  2Y69 B;  3CC4 V;  4B7E A;  5GTH Z;  4FLV A;  5FPR A;  2H94 A;  4X66 O;  3PJS K;  2E5L B;  2DE0 X;  1PKX A;  4MTX A;  1YHQ V;  3K3W A;  1VQK V;  3AK3 A;  5IYC O;  3N27 A;  2GV9 A;  1WPB A;  3ZHS A;  2HJF C;  1H2K A;  3MHS C;  1HNW O;  3AG4 B;  1I0H A;  2ZE8 A;  1RM1 C;  2UXX A;  4LF6 B;  1G4Y B;  4DK0 A;  4DUZ O;  3K5N A;  5IT9 N;  2HVJ C;  1QLE C;  2EUL A;  4JF3 A;  4NXN B;  2YI9 A;  2OCH A;  3ZHU A;  1HNX B;  2EIN C;  2EIK B;  5H5N A;  1KBH A;  3UT5 A;  4LNU B;  2ZR3 A;  3ASO C;  1CXZ B;  2B9Z A;  4FPP A;  4I4T B;  1XMO O;  3A2F A;  1FXK C;  1ZSP A;  3ZHT A;  3WG7 C;  1IXM A;  1HR0 O;  1Q86 W;  1H2S B;  5LYJ A;  1BS3 A;  4UUJ C;  4X89 A;  1SQG A;  3B8M A;  3KCY A;  2P4K A;  1XIL A;  4A5U B;  4DR1 O;  1MG1 A;  2OTJ V;  1L8D A;  3E8G A;  4KHP O;  4DV4 B;  3RVZ A;  4O4J A;  3RVY A;  1XMQ B;  1Z5W A;  1M9N A;  3CCR V;  2NLJ C;  1SQF A;  3EHB B;  5KA6 A;  2YDE A;  2ZIO A;  1EM1 A;  4JI1 B;  4ZHQ B;  5CA0 B;  1BCC H;  2A7W A;  3IC7 A;  1J95 A;  3K5M A;  5L3G A;  1M57 B;  1SKV A;  4FFB B;  1JX9 A;  2Y0P A;  1AVM A;  5KHK A;  2A0L A;  4J80 A;  1MNG A;  1SQB H;  1D2D A;  1E1Q G;  1QCE A;  3AG1 C;  4PJ0 Z;  3JAS B;  1O9H A;  4CS3 A;  3CRM A;  2FTK A;  2Y0I A;  4X64 O;  1AP6 A;  4XDJ A;  2Q6A A;  3T1C A;  4CH5 A;  4LFB B;  1N33 B;  1XOU A;  2JGD A;  4O2A B;  4DK1 A;  1J5E B;  2V7Q G;  1Q6I A;  5IJ9 A;  3L70 H;  1SQX H;  2ZDI A;  3M7M X;  4B3T B;  5J9P C;  3SDL A;  4ZIB A;  1K7D A;  1HDJ A;  2UXD O;  1VF6 A;  1K97 A;  5KAI Z;  4ZOL B;  2PF4 E;  1NH2 B;  1Y67 A;  2JVD A;  1NQT A;  1I5X A;  1R6N A;  2KG7 A;  1GN3 A;  1XNQ O;  1R6K A;  1VF5 B;  1GM8 A;  5BR8 B;  2ATK C;  3JAL A;  1SQP H;  1XBL A;  4IYH A;  3C90 A;  2ZQM A;  1BQZ A;  3D36 C;  2EIJ B;  1Z5V A;  3RFR A;  2DJV A;  4WFG A;  3JD2 A;  2ITC C;  4K35 A;  4IIJ A;  4QJF B;  3WFV A;  2ZE5 A;  2AZ2 A;  4JI6 O;  2VWJ A;  1S5J A;  3QNE A;  2RNB A;  4X1Y A;  2EIM C;  4P2Z A;  4WFE A;  3GWK C;  4CH4 A;  2E5L O;  1GN2 A;  2Y4U A;  4FLU A;  1GAX A;  1QLN A;  2X6B A;  3SPG A;  4DV2 B;  4KP4 A;  3EVK A;  4LF5 B;  2QKA A;  1PL0 A;  4HBN A;  4EB6 A;  3ZMV A;  5LYJ B;  3ASN B;  2E3C A;  4GX1 A;  3JAT A;  4TV9 A;  2UUC B;  4LF6 O;  1LNQ A;  4J9Y B;  3ABK C;  4NXN O;  1AI7 A;  4O4J B;  2YC0 A;  4EFE A;  3ZMZ A;  3SPC A;  1TGO A;  3OFN G;  1DK1 A;  2ZKO A;  1JJ2 U;  1IBK B;  2Y4T A;  2GTA A;  2YEV A;  2RQ6 A;  1SET A;  4I5S A;  1S5L Z;  4FM1 A;  1NH2 D;  4U3F H;  2AXT Z;  2N05 A;  3FFQ A;  3K5O A;  1SA0 A;  4UCU A;  4DV4 O;  1ZL8 A;  1GTO A;  1XMQ O;  3P3N A;  4JAU A;  2XAG A;  2EZP A;  4JI1 O;  4FLT A;  4E2L A;  2WLN A;  2OTL V;  2E75 B;  3CCJ V;  2XUM A;  4YHH B;  4TQD A;  2R9A A;  4FMT A;  4CH3 A;  3ABM B;  1SS3 A;  4UXN A;  2WWW A;  1Q7Y W;  1AI5 A;  3RGB A;  4BW5 A;  1DF4 A;  3JYC A;  3F7Y C;  5CBF A;  5JJN B;  3K0G A;  1PP9 H;  2V4D A;  1VEW A;  4FIP C;  3E89 A;  4JAA A;  3ZMS A;  3UCS C;  1QBZ A;  5ITZ A;  2P90 A;  4U3J A;  2LFR A;  1OZ0 A;  2KG7 B;  5EYP A;  4K8Z A;  1YTF B;  4JV5 B;  2IW5 A;  3DC5 A;  3M8A A;  5KX5 A;  1N33 O;  2HLD G;  3JAL B;  4LFB O;  4PA9 A;  1NKD A;  3ZRX A;  2CGO A;  3ETG A;  4DR5 B;  1J5E O;  1BQ0 A;  4MTG A;  1K8A W;  4IIJ B;  3R66 A;  3I56 V;  1YIT V;  4B3T O;  1W59 A;  5LHG A;  3J7A U;  1OCR C;  4X1Y B;  4BW9 A;  3NR7 A;  4R50 A;  4ZI7 A;  1W0K G;  5LA6 A;  4FM0 A;  5BR8 O;  4JI0 B;  4PDV A;  1WA8 A;  4X8A A;  3ABL C;  3WB2 A;  2Q4P A;  3GWO A;  3NXS A;  4OX9 B;  3X2Q B;  4EB6 B;  5H6R A;  2QKS A;  3APO A;  4FM2 A;  3JAT B;  4TV9 B;  4HAM A;  4LF8 B;  2CTR A;  2F66 C;  3H1I H;  1K5Q A;  3UKM A;  5L3C A;  4DV6 B;  2ZT9 B;  3JD4 A;  4PD4 F;  3E8H A;  2PZS A;  4XDK A;  4DV2 O;  2YEV B;  3OW2 U;  2XAH A;  1R1B A;  4JAV A;  2QDO A;  3CCE V;  2ETN A;  4CC6 A;  2AHZ A;  1BE3 H;  4LF5 O;  3H01 A;  4H0L B;  2QWN B;  4MTO A;  4O4I A;  2ADQ B;  4J7J A;  2UUC O;  5B1A B;  1SA0 B;  2QE7 G;  1YTF D;  3HKD B;  4JTA B;  2R72 A;  3GVM A;  1IDS A;  5EBL C;  4RO2 A;  1S5H C;  3ZBH A;  2X6A A;  4Z1M G;  4FLX A;  4BR6 A;  1Q5O A;  2UXN A;  5B3S C;  4RQF A;  3BA9 A;  1IBK O;  3BFR A;  3OGC C;  2HR3 A;  1M56 C;  3C3S A;  3CCS V;  4G27 B;  2CTW A;  3OM3 B;  3TGU H;  1BGY H;  3TK1 A;  1KKC A;  1MMM A;  4GX2 A;  5JWP A;  2ZXW C;  1SQV H;  4DW1 A;  5A9G A;  2CH7 B;  5LP6 C;  3SJB C;  4CS4 A;  4AI8 A;  5FL7 G;  2VQF B;  1BHA A;  5DEC A;  2HJD A;  3DC6 A;  2RDC A;  1NJI W;  4WF9 V;  4PEL A;  1RPR A;  1RFY A;  2PUS A;  2PYJ A;  4OPA A;  3B09 A;  5K1X A;  1YSC A;  3KZI Z;  1XL4 A;  1JA8 A;  2P6J A;  2IJK A;  5ITZ B;  1UJW B;  4YHH O;  4U3J B;  3RT3 C;  2QA4 V;  4NR1 A;  1YJ9 V;  5EYP B;  5B1B B;  4BWA A;  3SYO A;  4KXR A;  2IM9 A;  5EIB C;  4Z2W A;  4DO2 A;  3S3X A;  3MDS A;  4KHP B;  1NI8 A;  4LH6 A;  4B3R B;  2A9H A;  5L3B A;  5LGU A;  2EIL C;  5GON B;  1AB3 A;  2WLM A;  4QE9 A;  4LF9 B;  2YI8 A;  4YJ3 A;  1QNM A;  4TQF A;  1L0N H;  4FLZ A;  3JAR A;  1JJO A;  1K73 W;  2Q0A A;  2LW1 A;  3AG3 C;  4ZI7 B;  1Y76 A;  1FXK A;  1EZV H;  5LA6 B;  4LF4 B;  4JV5 O;  3ZHQ A;  1Q6H A;  3T1H B;  1WA8 B;  2OT5 A;  3E8F A;  3QO8 A;  1L1F A;  4N23 A;  1NTZ H;  4TWK A;  1BMF G;  4DR5 O;  4RQE A;  4I55 A;  5KA5 A;  3C3T A;  1IBL B;  3CRA A;  5B5E Z;  3HR0 A;  1OCO B;  3M99 B;  1P7B A;  3OMN B;  4X20 A;  4RUE A;  3SJC C;  3W7T A;  1O9G A;  2CTP A;  3AG7 A;  3THO A;  1H38 A;  2FB5 A;  5KHI A;  4R6Z A;  5H6Q A;  2R70 A;  3HKC B;  4JI0 O;  3ZCC A;  3QO5 A;  2W6J G;  1WP8 A;  2QSA A;  4JYB A;  2IU3 A;  2YIA A;  4CBC A;  5LGN A;  4MSW C;  4OX9 O;  4O4I B;  1S3J A;  1FFX A;  1BL8 A;  3E2E A;  4LF8 O;  2K9P A;  3D3Q A;  4JTD B;  1RSO A;  1V54 C;  2ADP A;  3JD0 A;  2UXD B;  4JYY A;  4ASU G;  1H2L A;  4R8C A;  4DV6 O;  3SYC A;  3DXR A;  4H33 A;  2D2C B;  2VWK A;  4JZ2 A;  4PDL A;  1UPG A;  4NTW A;  2Q7H A;  3OT7 A;  5FNV A;  5DM6 V;  5HFM A;  2QJ1 A;  1Q6U A;  4GKJ O;  1LUV A;  5JCO C;  1TUE B;  2P4V A;  2M7W A;  4X1K A;  3CCU V;  1F4M A;  1VQ9 V;  3G4S V;  4J9Z B;  2ZIN A;  4PA6 A;  2F23 A;  3D36 A;  1PD3 A;  2YUA A;  3SYA A;  3IFX A;  4J42 A;  3BAA A;  5CA3 A;  1G1X B;  2IJI A;  5C93 A;  2Q5Z A;  1K9M W;  1EN4 A;  4HNA A;  4G2K A;  2VQF O;  2FKX A;  1QLE B;  4JYA O;  3AG4 C;  3TXS A;  1KKD A;  1TUB A;  3OR7 C;  3CCQ V;  1VP7 A;  3OEE G;  4YJ3 B;  3VQV A;  3ASO B;  1K4D C;  2OIE A;  5C8Y B;  3JAR B;  2JDI G;  1BZK A;  1Y76 B;  1WB7 A;  2UUA B;  4DR6 B;  1URF A;  1VF7 A;  4UCV A;  1SC5 B;  2EJR A;  4O4H A;  4I50 A;  4B3R O;  5BXZ A;  1KU9 A;  4L87 A;  3BAB A;  4GCZ A;  5LHI A;  3LNM B;  1RP3 B;  4I55 B;  3FD9 A;  4GKK B;  4MVR A;  3KKY A;  4WCE V;  4LF9 O;  1YIJ V;  2E76 B;  3CRC A;  1F51 A;  4LWS A;  1TAE A;  4B3M B;  4MVO A;  4LF4 O;  1MSW D;  2WLI A;  4AIL C;  1WPX A;  2YID A;  3K59 A;  3BHP A;  3G71 V;  1NR7 A;  3T1H O;  2PYL A;  4GT1 A;  1VQN V;  4JI5 B;  2NNU A;  2BOC C;  2DWD C;  1GRJ A;  1M57 C;  3STL C;  3H1L H;  2ZIM A;  3BY6 A;  1IX9 A;  3OUS A;  1IBL O;  1FFX B;  2NR5 A;  2DYS C;  2H3O A;  1XHX A;  3CJH A;  4OGQ B;  1RSO B;  4Q20 A;  4BIO A;  5IJ0 A;  3WB1 A;  3FB5 C;  3DXR B;  2Z0A A;  1VQO V;  3JAW B;  2JJ1 G;  4DXW A;  5KHH A;  1FYJ A;  3E22 A;  3FAV A;  3TXQ A;  1WLE A;  1S0V A;  4X65 B;  1N32 B;  3ABU A;  2A3Q A;  1DLB A;  1JVM A;  1EZJ A;  3SJA C;  3HB3 B;  4CZZ A;  3VQY A;  4X1K B;  1XEQ A;  3VBB A;  3N2G A;  1FAF A;  4QGP A;  4R7C A;  4DV3 B;  3ETQ A;  2W0X A;  1K92 A;  2C2A A;  3FYE B;  1XDC A;  3K03 A;  2IH3 C;  1AIL A;  2DW4 A;  3ML0 A;  2ITD C;  3H1K H;  2EIJ C;  4HNA B;  3ZHV A;  1ZUQ A;  2BOB C;  3CC7 V;  2HVK C;  4YJ2 A;  1FKA O;  3UT5 B;  1JOY A;  1TUB B;  1YVW A;  3VQX A;  3OTF A;  1D5N A;  1GN6 A;  4WBN A;  5JH7 A;  2PI4 A;  1ZAU A;  3UM7 A;  2L35 A;  2QWQ B;  4I0X A;  4EKW A;  3K58 A;  3E83 A;  4NXM B;  5IE9 A;  5H2F Z;  1DGS A;  2ILM A;  3SYQ A;  1SER A;  1P49 A;  4O4H B;  4MTF A;  1ZX3 A;  3LDC A;  1KD1 W;  3ASN C;  3ABK B;  3FYI B;  5LHH A;  4CH6 A;  4X1I A;  2YIC A;  3JD3 A;  4C7U A;  1AI6 A;  1FD9 A;  2UXC B;  3F5W C;  2ZM6 B;  4LWS B;  3CCM V;  3QG5 A;  4LC1 A;  3RYI A;  4LFC B;  1DTO A;  4QPJ A;  1THZ A;  4ZKI A;  5LXT A;  2WLI B;  2KQX A;  1IUR A;  2UXB B;  3FX7 A;  2UUA O;  4DR6 O;  1XRE A;  3L71 H;  4GZR B;  2XND G;  2YIB A;  5K1P A;  1N0N A;  3JAM N;  4NVP A;  4GKK O;  5HFL A;  1VQ8 V;  2YXH A;  1EBO A;  1WAZ A;  1S76 D;  5JJE B;  2CE4 A;  4H37 A;  5BMV A;  1M1K W;  5IJ0 B;  4B3M O;  1Y74 A;  2OIG A;  3CC2 V;  4DV1 B;  2IBZ H;  1N8R W;  2ZR2 A;  4JI5 O;  1G6U A;  1YJW V;  4KUM A;  4O2B A;  3K9S A;  3E22 B;  3FAV B;  2HKO A;  2JGD B;  4X9Q A;  3CEI A;  2EJ7 A;  5EBW C;  1OCZ B;  3MAQ A;  5IJ9 B;  4PDR A;  4UB6 Z;  1K34 A;  3ABM C;  2F4V B;  3EXA A;  4K8X A;  2BSK A;  4UCS A;  1AJQ A;  1PPJ H;  2YS8 A;  1HP8 A;  2P67 A;  4MVM A;  2VS0 A;  1NTK H;  2Q7E A;  1I7F A;  2ZCE A;  1VQ6 V;  4FK5 C;  1R3I C;  4JI7 B;  3T2M A;  1QR8 A;  1K33 A;  2RCV A;  1A32 A;  2ZDI C;  1EN6 A;  4PA3 A;  4G28 B;  4YIO A;  1E79 G;  3ZN0 A;  2LO1 A;  3ZRS A;  2R9R B;  4IGG A;  5A2Q N;  2BTQ A;  3QF7 A;  2LW7 A;  4X65 O;  1N32 O;  5EK0 A;  4LP8 A;  3BCC H;  1MZF A;  3T4D A;  2XOK G;  4UV8 A;  1FJG B;  3CRR A;  4YJ2 B;  2XAQ A;  2B5U A;  3DGE A;  3BPZ A;  3AK1 A;  5CA1 A;  4DV3 O;  4WBN B;  3UO3 A;  1OCC B;  2Y48 A;  2EZO A;  3JSN A;  2QWR B;  2N04 A;  5EC2 C;  3ETE A;  3K79 A;  2OCC C;  4P9P A;  1VQM V;  3QVN A;  5D5Q A;  4YY3 B;  4Z1V A;  3N2K A;  4WFB V;  2IJH A;  1M5I A;  3OUF A;  2WSS G;  3X2Q C;  1P7G A;  3L72 H;  4X1I B;  2LGQ A;  5CMU A;  2AHY A;  2F95 B;  5LBQ A;  3AEI A;  3JAK A;  2OYQ A;  3RYI B;  3IAY A;  2A79 B;  4LCU C;  3GB7 C;  2ZNI A;  5LXT B;  4NXM O;  4YXW G;  1KB9 F;  2Q73 A;  3W7U A;  3O65 A;  4HYO A;  4B3S B;  4GKJ B;  1ZL8 B;  3IJ4 A;  1N36 B;  1R3J C;  1SRY A;  4BAY A;  4DV0 B;  2WPD G;  3CB2 A;  3RYH A;  5J2T A;  5B1A C;  3G67 A;  3VOU A;  2UXC O;  2DOS A;  4XDL A;  2JS5 A;  4YIP A;  3AG2 B;  5KLV H;  2ZM6 O;  2EX3 A;  5BMV B;  1M93 A;  4PV1 B;  4LFC O;  5F2V O;  3J81 N;  3MD0 A;  1NU1 H;  1I5Y A;  3OAA G;  3CMA V;  2CGN A;  2YXY A;  2UXB O;  3L9D A;  1YZB A;  4PI2 A;  2WA3 A;  3B77 A;  1MOF A;  5AG2 A;  5KHJ A;  3RN4 A;  3D8C A;  2ZXW B;  2XHB A;  4AQY B;  4JYA B;  2AW9 A;  5JCO A;  2P06 A;  3MHH C;  2BSK B;  4QE7 A;  1YI2 V;  2W0F C;  4ICG A;  4ABM A;  1WB8 A;  1GN4 A;  5CB4 A;  1E1R G;  1PL4 A;  4DV1 O;  2B1I A;  5KUM A;  3ZRW A;  3WB0 A;  2VQE B;  3CCV V;  5KX5 B;  2AZ0 A;  1R3K C;  4DUY B;  2BTQ B;  1S72 V;  5B1B C;  1EFR G;  2Q9L A;  1KQS U;  5D5P A;  4DR7 B;  3HPL C;  2GDS A;  5JQG A;  2F4V O;  5L3E A;  1JFF A;  1F7Y A;  4JTC B;  2Q0O C;  1ZLZ A;  2X7R B;  4IT5 A;  2YIB D;  4JI7 O;  3CYO A;  4DV5 O;  4X88 A;  1F23 A;  5IY5 B;  3G6B A;  1AI4 A;  5CA1 B;  2N74 A;  4TV8 A;  1XHZ A;  1NVP B;  3L73 H;  5L3D A;  3STZ C;  2P7T C;  2IH1 C;  3RWR D;  4KL1 A;  4J11 A;  4TOI A;  4JI2 B;  1DF5 A;  1WNS A;  2CK3 G;  1X4T A;  2QEX V;  4HZ3 A;  4JI8 B;  4LFA B;  2ZE7 A;  2UU9 O;  1V55 B;  3G6E V;  3N2K B;  4FZ1 A;  1WP7 A;  3OTO B;  3T1Y B;  4UVB A;  1IXB A;  4I9Q A;  1CEZ A;  1FJG O;  2HG5 C;  1Q3E A;  1GMG A;  1GK9 A;  5KMG A;  4RAI A;  4ZHQ A;  3JAK B;  3ZJZ A;  2MK3 A;  2MW2 B;  1BT8 A;  1R3L C;  5JJJ B;  2CUG A;  2LQT A;  2ARH A;  1Q8I A;  4FFB A;  4YY3 O;  1YCI A;  4UFZ A;  1FXH A;  2YXL A;  5EIB D;  4QIW F;  4U7O A;  3RYH B;  1WJZ A;  5J2T B;  1UFI A;  1SZX A;  1XUQ A;  4O4L A;  1H8E G;  4DV7 O;  1KP2 A;  5BZB A;  2AGA A;  2DYR B;  1L0L H;  2DMX A;  1YXB A;  3OGI B;  2JGU A;  3F5T A;  3ABT A;  3K9A A;  4WFA V;  2VRZ A;  1ORQ C;  4B3S O;  1MZE A;  3K04 A;  1N36 O;  2JEX A;  1NVP D;  4DV0 O;  1B6Q A;  3ZN1 A;  1NZ6 A;  3BRC A;  2JS3 A;  5JVD A;  4O2A A;  1GKF A;  2P22 C;  1TVK A;  3E86 A;  2Y69 C;  3OR6 C;  4UCO A;  1Z2G A;  2DWE C;  5L3F A;  5CB4 B;  2Q8V A;  4ZOL A;  1PM9 A;  3W7W A;  3ZRW B;  2XAS A;  2YSU B;  3JD1 A;  1H8H G;  2RJZ A;  3LNN A;  4DR4 B;  4OPH A;  1RM1 B;  4N21 A;  3D3I A;  4PI0 A;  4AQY O;  1S77 D;  2F1M A;  1H2N A;  4JGS A;  3ZRV A;  5JQG B;  2EIN B;  2O57 A;  3ZMT A;  1JFF B;  1VQ4 V;  2QM4 A;  1HNZ B;  1K3E A;  2NN4 A;  1IVS A;  2EIK C;  1FXK B;  1QR9 A;  2RMK B;  2LFS A;  3HKB A;  3WG7 B;  2Q68 A;  2VQE O;  4JI3 O;  1AR5 A;  4U7N A;  4TV8 B;  2BTO A;  3LDE A;  4DUY O;  3HKE A;  3U0Z A;  2WLL A;  2DQ3 A;  1LUW A;  4DR7 O;  3OE7 G;  1ZWI C;  4MVZ A;  2LJ2 A;  1VQP V;  4X20 B;  1SF9 A;  2XT9 A;  4FZ0 A;  2H8P C;  1K5S A;  2ZNJ A;  1OJH A;  3FKS G;  5KMG B;  5GW7 A;  5CBG A;  3K08 A;  4D7T A;  2JJ2 G;  2JRI A;  3CRQ A;  4JI2 O;  3RYC A;  1R73 A;  1IZ3 A;  4J7K A;  4D7S A;  4H13 B;  4JI8 O;  4LFA O;  3AG1 B;  3OTO O;  4JPR A;  3FB6 C;  3T1Y O;  2DYS B;  1I94 O;  3O9O A;  4OXS A;  1BSM A;  1N34 B;  2FML A;  1OV9 A;  5GTI Z;  4O4L B;  4TSF G;  3JSL A;  5IYZ A;  4IYI A;  5FNV B;  1YJN V;  2WLK A;  4W4K A;  4B08 A;  1KYO F;  2CDY A;  1XQ8 A;  1KUQ A;  2GUZ A;  1NTM H;  3TJT A;  1HW7 A;  2UUB B;  3ZMU A;  1XL6 A;  5JVD B;  2ZD9 A;  1X59 A;  3CXC U;  1TVK B;  2KB1 A;  5LL6 Y;  4DR2 B;  2QTO A;  1SZT A;  1NS1 A;  1Q43 A;  4WFF A;  3DSQ A;  1AP5 A;  4IL6 Z;  4XBF A;  3ZHR A;  1GO3 F;  1COW G;  2Q67 A;  3CWB H;  1GM7 A;  2EBO A;  3OEH G;  5FLX N;  4MW8 A;  3EFF K;  3T4Z A;  4X62 B;  2EIM B;  3UO2 A;  1AR1 B;  2HFE C;  4UCT A;  4TT3 G;  1K4C C;  2ZE6 A;  1D5A A;  4UCR A;  3HKB B;  1KEC A;  3CXH F;  1ZTE A;  1VAR A;  2QWP B;  1RPO A;  3LSQ A;  5DED A;  4DR4 O;  4I50 B;  2D3O W;  3BEH A;  5IDJ A;  3ZX6 A;  3HKE B;  3RYF A;  3SGI A;  2WLL B;  1NR1 A;  4GUN A;  2JIZ G;  1JQ0 A;  2PGG A;  4FJC C;  5CN0 A;  5FPO A;  1PNL A;  4DW0 A;  3L74 H;  1HNZ O;  1ARO P;  2WLH A;  2X0L A;  1Q90 D;  3SJQ C;  1Y66 A;  2KKW A;  1YEW A;  5TIS Z;  2FYU H;  1HNX O;  1AJN A;  1U97 A;  1AJP A;  1N0J A;  5LMU B;  3B4S A;  3TET A;  1TA8 A;  3RYC B;  1MAB G;  5B66 Z;  1N4C A;  3CJH B;  3JCU Z;  1M4U A;  3B40 A;  4P30 A;  4BIZ A;  4FVM A;  3P3P A;  3SPJ A;  3I5D A;  3HKD A;  1R6T A;  2QWO B;  2DQ0 A;  4I9W A;  3LSU A;  4MVQ A;  1B06 A;  2WAM A;  2WLJ A;  2RN9 A;  5IYZ B;  5LP6 A;  3CE2 A;  3H1J H;  5DN6 G;  1M90 W;  5H9C A;  4RWU A;  4ZBM A;  2PTM A;  1VQL V;  2QKC A;  4TUY A;  2HEP A;  3BVO A;  2XAJ A;  2GUZ B;  4FLY A;  5EBM C;  1JR9 A;  1OCZ C;  2CH7 A;  3OD4 A;  1N34 O;  4QPK A;  3S3W A;  4DR3 B;  1SQQ H;  3RW0 A;  4LF7 B;  4DV5 B;  3QO7 A;  3N2G B;  1FFT B;  1HWY A;  1Y4M A;  2IU0 A;  3K06 A;  1VF6 C;  4JI4 B;  1KP3 A;  1Q81 W;  4NKG B;  5J2U A;  2BE3 A;  5E1A C;  3A0B Z;  4F6E A;  4WFH A;  3CHX A;  4E4E A;  3K5L A;  2UU9 B;  1QHT A;  1NBM G;  4PA4 A;  3I55 V;  2UUB O;  3P30 A;  3W7S A;  1OCR B;  5LMN B;  4F6R A;  3CCL V;  3CPW U;  4DR2 O;  3RBZ A;  2QGN A;  1CPY A;  5JH7 B;  1V9P A;  5GON A;  4PHZ A;  4I0X B;  5BY1 A;  1WN7 A;  4NTX A;  4IHJ A;  3ABL B;  3ICX A;  4MS2 A;  3OMI B;  4K0K B;  4DYL A;  3KG2 A;  1QU7 A;  2CAZ C;  3H9V A;  2PY5 A;  2OCC B;  1T5E A;  1OCC C;  4UV9 A;  1PNK A;  3WU2 Z;  1FXV A;  2R9I A;  2CTQ A;  5CBH A;  1SES A;  3RYF B;  1IBM B;  4X62 O;  2JK5 C;  4JZG A;  5KUK A;  3K57 A;  4NYK A;  4DV7 B;  3DTU B;  4MW3 A;  1P4R A;  3Q4H A;  3W7X A;  4QNH B;  4L8J A;  4DRX A;  3E35 A;  3QTC A;  2GSM B;  2LGW A;  2XTA A;  1Y6X A;  3P32 A;  5IWA B;  4GYC B;  3HKC A;  2HHH B;  5EC1 C;  2QTS A;  2HP8 A;  4PDM A;  2B1G A;  2V1D A; 
#chains in the Genus database with same CATH homology
 2BOC C;  2DWD C;  1M57 C;  3STL C;  3BY6 A;  4MVU A;  3OUS A;  1FXH A;  5B1O A;  2DYS C;  1BHB A;  5B3S B;  1GTO A;  4QIW F;  4U7O A;  3LSS A;  1W2B U;  4MT8 A;  1M56 B;  4LBE C;  4Q20 A;  2Q69 A;  4JAU A;  2XAG A;  2EZP A;  4E2L A;  3FB5 C;  2WLN A;  3TCU A;  1H8E G;  3ZIA G;  1KP2 A;  1VQO V;  5BZB A;  3SPI A;  2K1E A;  3AG2 C;  2OTL V;  3CCJ V;  1ENV A;  2JJ1 G;  2DYR B;  4DXW A;  3ABT A;  3K9A A;  1GM9 A;  4FMT A;  4WFA V;  1WLE A;  1ORQ C;  3ABM B;  1S0V A;  3SYP A;  1Q82 W;  4UXN A;  3K0D A;  3ABU A;  2WWW A;  1Q7Y W;  3K04 A;  2JEX A;  1AI5 A;  1NVP D;  5IYB O;  1B6Q A;  3ZN1 A;  4BW5 A;  1DF4 A;  3JYC A;  3F7Y C;  1DLB A;  5CBF A;  1GKF A;  1JVM A;  3K0G A;  1EZJ A;  4MVS A;  2IJJ A;  3E86 A;  4F4L A;  4FIP C;  3E89 A;  3HB3 B;  2Y69 C;  3OR6 C;  3ZMS A;  4CZZ A;  1JCH A;  1QBZ A;  2JEU A;  2DWE C;  4RUF A;  3VBB A;  5L3F A;  4UVA A;  2P90 A;  3B8N A;  3JCZ A;  4R7C A;  2LFR A;  1OZ0 A;  3W7W A;  3ZRW B;  2XAF A;  2XAS A;  2YSU B;  1K92 A;  3JD1 A;  2C2A A;  1H8H G;  3FYE B;  1YTF B;  2IW5 A;  1QVG U;  3K03 A;  2HLD G;  3ETD A;  4PA9 A;  1NKD A;  4N21 A;  2IH3 C;  3D3I A;  2DW4 A;  3ML0 A;  1RM1 B;  3CD6 V;  2W6I G;  3ZRX A;  1S77 D;  2EIL B;  2ITD C;  3ETG A;  2EIJ C;  4MTG A;  1K8A W;  4JGS A;  3ZRV A;  2EIN B;  3I56 V;  1YIT V;  3ZMT A;  1H2G A;  2BOB C;  3CC7 V;  4GX0 A;  1VQ4 V;  2HVK C;  4P9O A;  3AG3 B;  1K3E A;  2QM7 A;  5LHG A;  4UVC A;  2EIK C;  1OCR C;  4GX5 A;  1JOY A;  3IGA C;  1FXK B;  4R50 A;  1QR9 A;  2PI4 A;  2LFS A;  3WG7 B;  1W0K G;  2Q68 A;  3UM7 A;  4BIU A;  4EKW A;  2Z3Y A;  4U7N A;  4PDV A;  3E83 A;  3LDE A;  5IY5 C;  3CP1 A;  4X8A A;  2X6C A;  3ABL C;  3GWO A;  5LGT A;  3A0R A;  3NXS A;  3CME V;  2WLL A;  2DQ3 A;  1OHH G;  3SYQ A;  3X2Q B;  3OE7 G;  5H6R A;  2QKS A;  1KC8 W;  1ZWI C;  1SER A;  4MVZ A;  1ROP A;  4KFM A;  1VQP V;  3LUT B;  4HAM A;  1CP9 A;  4MTF A;  3LDC A;  1KD1 W;  3ASN C;  1OCO C;  3ABK B;  2GHY A;  3FYI B;  5LHH A;  1K5Q A;  1V55 C;  3UKM A;  3JD3 A;  5L3C A;  1AI6 A;  2H8P C;  1K5S A;  2PI5 A;  3JD4 A;  3F5W C;  3FKS G;  1VQ7 V;  5GW7 A;  5CBG A;  3E8H A;  3K08 A;  1QVF U;  3CCM V;  4LC1 A;  3SPH A;  4XDK A;  1DTO A;  3F7V C;  4QPJ A;  2YEV B;  3OW2 U;  2XAH A;  1JPX A;  1THZ A;  2JJ2 G;  4ZKI A;  2WLI B;  4JAV A;  5IYD O;  3CCE V;  2AHZ A;  3H01 A;  1R73 A;  1W0J G;  4MTO A;  2XND G;  5B1N A;  1VQ5 V;  2Z5U A;  3AG1 B;  1FS0 G;  1V54 B;  5B1A B;  4JPR A;  3FB6 C;  5HFL A;  2QE7 G;  1YTF D;  2DYS B;  4JTA B;  1VQ8 V;  1EBO A;  4OXS A;  2F43 G;  5EBL C;  4RO2 A;  1S5H C;  2X6A A;  4Z1M G;  2UXN A;  1S76 D;  5B3S C;  4RQF A;  4H37 A;  4PA7 A;  1M1K W;  1PNM A;  3OGC C;  2HR3 A;  1M56 C;  4TSF G;  3CC2 V;  2LP7 A;  3CCS V;  2QM8 A;  4G27 B;  1N8R W;  3OM3 B;  1YJN V;  2WLK A;  3E8B A;  2ZR2 A;  4JYC A;  3OMA B;  3TK1 A;  1YJW V;  4KUM A;  3FB8 C;  2HKO A;  2DYR C;  4GX2 A;  4JAS A;  2ZXW C;  5EBW C;  1OCZ B;  4PDR A;  1K34 A;  3ABM C;  3R65 A;  3ZMU A;  1AJQ A;  5FL7 G;  1XL6 A;  2ZD9 A;  2P67 A;  1BHA A;  1G8M A;  4MVM A;  1NJI W;  3FB7 C;  3LDD A;  4PEL A;  4WF9 V;  3CXC U;  1F4N A;  2Y69 B;  3CC4 V;  2KB1 A;  1VQ6 V;  1RPR A;  2QTO A;  1R3I C;  4FK5 C;  1SZT A;  4WFF A;  1YSC A;  3T2M A;  1XL4 A;  2H94 A;  1QR8 A;  4XBF A;  3PJS K;  1K33 A;  2ZDI C;  1PKX A;  2P6J A;  4MTX A;  4PA3 A;  1YHQ V;  2IJK A;  4G28 B;  1UJW B;  1E79 G;  3ZN0 A;  3K3W A;  2QA4 V;  3ZRS A;  1GO3 F;  1YJ9 V;  1COW G;  2Q67 A;  2R9R B;  5B1B B;  3SYO A;  1VQK V;  1GM7 A;  5IYC O;  2EBO A;  4DO2 A;  5EK0 A;  3OEH G;  4LP8 A;  4MW8 A;  2HJF C;  3MHS C;  3EFF K;  3T4D A;  2A9H A;  3AG4 B;  5L3B A;  1RM1 C;  2UXX A;  1G4Y B;  3T4Z A;  2EIM B;  5LGU A;  2HVJ C;  1QLE C;  2XOK G;  4JF3 A;  4UV8 A;  2EIL C;  2WLM A;  4QE9 A;  1AR1 B;  2HFE C;  2XAQ A;  2EIN C;  4TT3 G;  2EIK B;  1K73 W;  2ZR3 A;  3ASO C;  2B5U A;  1K4C C;  3AG3 C;  3DGE A;  1KEC A;  1OCC B;  1FXK A;  4FPP A;  1FXK C;  2Y48 A;  2EZO A;  3WG7 C;  5EC2 C;  1RPO A;  3ETE A;  3K79 A;  3LSQ A;  1IXM A;  2OCC C;  4P9P A;  1Q86 W;  2OT5 A;  2D3O W;  3BEH A;  4UUJ C;  4X89 A;  5IDJ A;  3B8M A;  1VQM V;  3E8F A;  3QO8 A;  1L1F A;  4N23 A;  2WLL B;  4TWK A;  1NR1 A;  4WFB V;  1BMF G;  4RQE A;  5KA5 A;  1MG1 A;  2OTJ V;  2IJH A;  2JIZ G;  3E8G A;  3OUF A;  1JQ0 A;  4FJC C;  5CN0 A;  3RVZ A;  2WSS G;  3X2Q C;  3RVY A;  1OCO B;  1PNL A;  3M99 B;  1P7B A;  3OMN B;  1M9N A;  3CCR V;  1ARO P;  2NLJ C;  3EHB B;  2WLH A;  5KA6 A;  2X0L A;  4RUE A;  3W7T A;  5CMU A;  2AHY A;  3SJQ C;  1Y66 A;  5LBQ A;  3AEI A;  1H38 A;  1AJN A;  4R6Z A;  1AJP A;  5H6Q A;  3ZCC A;  3IC7 A;  2A79 B;  1J95 A;  3GB7 C;  4LCU C;  3QO5 A;  5L3G A;  1M57 B;  2W6J G;  4YXW G;  4JYB A;  2IU3 A;  3TET A;  4CBC A;  3W7U A;  5LGN A;  4MSW C;  1JX9 A;  4HYO A;  1MAB G;  1S3J A;  1BL8 A;  1R3J C;  1SRY A;  2A0L A;  4BAY A;  3E2E A;  2WPD G;  4P30 A;  4BIZ A;  1E1Q G;  1QCE A;  3SPJ A;  3AG1 C;  4JTD B;  3JD0 A;  1V54 C;  5B1A C;  3VOU A;  4ASU G;  4R8C A;  4XDL A;  3SYC A;  3AG2 B;  2DQ0 A;  4H33 A;  4I9W A;  4MVQ A;  2WAM A;  2FTK A;  2WLJ A;  3MD0 A;  3CMA V;  1I5Y A;  3OAA G;  4PDL A;  3B77 A;  4XDJ A;  2Q6A A;  3T1C A;  5DM6 V;  1MOF A;  5DN6 G;  1M90 W;  5H9C A;  5HFM A;  4ZBM A;  1VQL V;  2ZXW B;  2XAJ A;  5EBM C;  2V7Q G;  3MHH C;  1OCZ C;  4QE7 A;  4QPK A;  1TUE B;  2ZDI A;  1YI2 V;  3RW0 A;  3QO7 A;  5J9P C;  2W0F C;  2M7W A;  1K7D A;  1FFT B;  1HWY A;  1Y4M A;  2IU0 A;  1K97 A;  3K06 A;  3CCU V;  1F4M A;  1NH2 B;  1VQ9 V;  1E1R G;  3G4S V;  2B1I A;  5KUM A;  1NQT A;  1I5X A;  1R6N A;  4J9Z B;  3ZRW A;  1KP3 A;  1Q81 W;  4PA6 A;  3CCV V;  1R6K A;  1GM8 A;  5E1A C;  2ATK C;  4WFH A;  3D36 A;  1R3K C;  1PD3 A;  2ZQM A;  3SYA A;  3IFX A;  2EIJ B;  1S72 V;  5B1B C;  1EFR G;  5CA3 A;  2IJI A;  5C93 A;  1KQS U;  1NBM G;  1K9M W;  4PA4 A;  4WFG A;  3JD2 A;  3I55 V;  3HPL C;  2ITC C;  5L3E A;  3P30 A;  4QJF B;  4G2K A;  3WFV A;  3W7S A;  1OCR B;  1QLE B;  4JTC B;  3CCL V;  3AG4 C;  3CPW U;  3QNE A;  3RBZ A;  1KKD A;  1CPY A;  2EIM C;  2X7R B;  3OR7 C;  4P2Z A;  3CCQ V;  3CYO A;  3OEE G;  4WFE A;  3ASO B;  1K4D C;  4X88 A;  1F23 A;  2JDI G;  5IY5 B;  1AI4 A;  1QLN A;  3ABL B;  4MS2 A;  2X6B A;  3SPG A;  3OMI B;  3KG2 A;  1NVP B;  5L3D A;  3STZ C;  2OCC B;  1OCC C;  2P7T C;  2IH1 C;  4UV9 A;  1PNK A;  4KP4 A;  1PL0 A;  1DF5 A;  1FXV A;  3ZMV A;  2CK3 G;  2R9I A;  5CBH A;  1SES A;  2EJR A;  3ASN B;  4GX1 A;  2QEX V;  4HZ3 A;  1V55 B;  4L87 A;  5LHI A;  4GCZ A;  3G6E V;  1LNQ A;  3LNM B;  4MVR A;  2JK5 C;  4UVB A;  4J9Y B;  5KUK A;  3ABK C;  1CEZ A;  1AI7 A;  4WCE V;  2HG5 C;  1YIJ V;  3DTU B;  4MW3 A;  1P4R A;  3ZMZ A;  3SPC A;  3W7X A;  1GMG A;  1GK9 A;  3OFN G;  4QNH B;  1F51 A;  1JJ2 U;  4RAI A;  4MVO A;  3E35 A;  2YEV A;  2GSM B;  1MSW D;  2WLI A;  1WPX A;  3ZJZ A;  3P32 A;  2MK3 A;  1SET A;  4I5S A;  3G71 V;  1NR7 A;  1VQN V;  4GT1 A;  1R3L C;  5EC1 C;  4PDM A;  2B1G A;  2NNU A;  2V1D A;  1NH2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...