4R8CA

Crystal structure of cng mimicking nak-etpp mutant in complex with rb+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
84
structure length
84
Chain Sequence
QVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
total genus 33
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r8cA00
3LDCA 4MVSA 3TCUA 3FB7C 5E1AC 1J95A 1OCRC 3K0GA 4P30A 3OUSA 1G4YB 2WLLB 3OUFA 5EC2C 1XL4A 4P2ZA 3FB8C 4PDVA 5CBFA 1QLEC 3STZC 2K1EA 3AG4C 4GX1A 4TWKA 4RAIA 5B1AC 3UM7A 5BZBA 1LNQA 4MW3A 3ABKC 3OR7C 3F7VC 3E8BA 4MVUA 3E8GA 4MW8A 3SPCA 3SYAA 1KKDA 2QTOA 4PA4A 2KB1A 3SYCA 1V55C 2WLIA 2EIKC 4XDJA 2P7TC 2AHYA 3ASOC 4R8CA 3E8FA 4XDLA 1V54C 2Q67A 3EFFK 4WFGA 4X8AA 4X89A 3AG2C 2HFEC 3E89A 2EILC 2Q6AA 3SYPA 5IY5C 3HPLC 4QNHB 2EINC 2QKSA 3IFXA 3RVZA 4X88A 1M56C 2AHZA 2ATKC 3PJSK 3LDDA 5EK0A 3E86A 4LP8A 2HJFC 2OCCC 4WFFA 4JTDB 2X6AA 4PDRA 1R3KC 2DYRC 4HZ3A 5EC1C 2BOCC 4RO2A 3IGAC 2X6BA 3TETA 1XL6A 2ZXWC 1P7BA 3JYCA 3F7YC 4EKWA 3SPIA 2A9HA 3BEHA 2ITCC 3ASNC 3R65A 3AG3C 4MTFA 3SPJA 4DXWA 3K06A 3SJQC 2W0FC 1JVMA 2WLMA 3E83A 3RBZA 2HVJC 3GB7C 4GX5A 3SYQA 5KUKA 3ABLC 1K4CC 4GX2A 2X6CA 3K04A 3RW0A 5B3SC 3T2MA 2R9RB 3LDEA 2DWDC 2IH1C 1BL8A 2HVKC 2WLNA 3X2QC 5J9PC 3ZJZA 2WLIB 2A79B 3FB5C 4GX0A 4MTOA 4MSWC 3WG7C 5CBGA 1K4DC 4H33A 4JTCB 4R6ZA 4PA6A 3UKMA 4JTAB 3ZRSA 4CBCA 4J9YB 4G27B 4MS2A 1OCZC 2EIMC 3RVYA 3T4ZA 2ITDC 2HG5C 2DYSC 2EIJC 2JK5C 3VOUA 2Y69C 4XDKA 3K03A 4MVRA 3KG2A 2A0LA 5EBWC 1R3JC 4WFHA 4BW5A 2Q69A 2BOBC 4RUFA 2H8PC 4UUJC 5EBMC 2WLLA 5CBHA 4QE7A 4LCUC 3SYOA 3LNMB 4P9PA 4ZBMA 2WLHA 4J9ZB 5KUMA 4MVZA 4P9OA 3STLC 4MTGA 4PDLA 3T4DA 3ABMC 1M57C 2IH3C 2YEVA 1OCCC 3LUTB 4PA3A 1ORQC 4MVMA 4OXSA 5B1BC 1S5HC 4H37A 4PA9A 3T1CA 4I9WA 2ZD9A 4WFEA 4PDMA 1ZWIC 4MVOA 3F5WC 3E8HA 4HYOA 4R7CA 2NLJC 3FB6C 3K0DA 3OR6C 5EBLC 3SPGA 4KFMA 4R50A 3SPHA 2Q68A 2WLJA 4LBEC 4MVQA 4RUEA 2WLKA 4G28B 4PA7A 3AG1C 4QE9A 1R3LC 1R3IC 3K08A 4F4LA 1OCOC 3OGCC 2DWEC
chains in the Genus database with same CATH superfamily
1O9GA 2ZIMA 4F6RA 4X65B 2Z3YA 4DV6B 4EFEA 2PI5A 3STZC 3NXSA 4TWKA 1OZ0A 4DV1B 3ZHVA 2JJ2G 5L3GA 3ZRXA 3ETDA 1DLBA 4CS4A 2AW9A 2P22C 1UFIA 2QTOA 2UUBB 2KKWA 3CRAA 3KCXA 1SRYA 1ZL8B 2AHYA 5C93A 1MNGA 4ICGA 4JZGA 2JGUA 2F23A 3FD9A 3RWRD 3LDDA 5A2QN 3J7AU 2UXDB 4KXRA 4DV7B 2FB5A 1Q82W 4RWUA 4F6RB 3WB0A 4OX9B 3TETA 2F1MA 1P7BA 3VQVA 3CMEV 3F7YC 2BSKB 3E83A 5KUKA 2IJKA 4KHPB 3G80A 3RW0A 1QR9A 1SS3A 2Q73A 2HVKC 1BMFG 3R66A 1EZJA 5BR8O 4JI8O 3UKMA 4GKKB 3K9AA 5KX5A 3JSLA 1F4MA 3JCZA 1VF7A 3ICXA 2NNUA 4KUMA 3T4ZA 5JQGA 2CTWA 2GBOA 4X1YA 1AILA 1I08A 2Z5UA 2Y69C 3VOUA 1NZ6A 3KG2A 2N74A 3OM3B 4WFHA 3SJAC 3K9SA 1BHBA 2QWPB 5LHHA 4ZHQA 2CTQA 4D7TA 4Z1MG 1H38A 1K5SA 1Y4MA 4X20A 1XREA 2QEXV 4CZZA 4GT1A 3RT3C 4HYOA 1RPOA 3U10A 4LBEC 3THOA 3AG2B 1SZTA 2Q7HA 1XNRB 5CA0A 2JIZG 1NH2B 3K79A 5KX5B 1R3LC 3CYOA 1M56B 3K08A 5JQGB 1VF5B 1AI4A 4X1YB 5IYCO 4JI3O 1VQNV 2CGNA 4PV1B 2VS0A 1VQ4V 2BTOA 3H1KH 2E74B 4ZHQB 1IXMA 4FLUA 4X20B 1D2DA 1LNQA 1HNXB 3M8AA 1MSWD 2YXHA 1I94B 1RP3B 2ZE6A 2CTRA 2E5LO 4I5SA 1FXKC 1GKFA 5KMGA 3UCSC 4LF5B 5CA0B 4CS3A 4D7SA 1O9HA 2ATKC 2Y0IA 2QSAA 5EK0A 2HJFC 1WLEA 1R3KC 4DV2O 3F5TA 3CCLV 1EZVH 4GUNA 4J7ZA 5K1XA 4FZ0A 3ABMB 1VQ8V 3CSXA 1RSOA 1JVMA 1XI1A 1AR5A 2YI9A 1YHQV 3T2MA 4AI8A 4CC6A 1NJIW 1IX9A 2LFSA 1PKXA 3ZJZA 2ADPA 4DR1B 1JMKC 2QWRB 4X1IA 1K4DC 5KMGB 1YJNV 1ZSPA 4K35A 3B40A 5LP6C 2EIMC 3DC5A 3BVOA 3H1JH 1KP3A 3CP1A 2UUAB 3K03A 1J5EO 1XMOB 4UUJC 3UO3A 2LFRA 4TT3G 3LNMB 3AG4B 2OIEA 2YUAA 1RSOB 1IBKO 3LUTB 3H9VA 3BCCH 2ZE8A 2IM9A 3BHPA 2EULA 2EIKB 3N27A 4DV0O 4X1IB 1FXHA 1AP5A 1KP2A 2RJZA 1WNSA 3OGCC 4DUYB 1FPOA 3P3PA 3U11A 1AR1B 1PP9H 2ADQB 1GM7A 3A0RA 2HLDG 5IYBO 2VQEO 1QR8A 1IBLO 2ODMA 2W6IG 3DGEA 1N32O 2ZDIC 3H01A 5CA1A 4DV4O 4TQDA 3E35A 1KMIZ 2F95B 2WLIA 1MA1A 4YHHO 1OCZB 4WFGA 3AK1A 4GLXA 1P49A 2ZNJA 4GYCB 1WA8A 5BR8B 1B3QA 3SDLA 4JI8B 3CRCA 3ASNB 2QM8A 4HZ3A 1A32A 4RO2A 1HNWB 1LUWA 5CB4A 2YIBD 1YVWA 3CJHA 3TJTA 5CA1B 1TGOA 3OD4A 4ASUG 3CCUV 5B3SC 2ILMA 1DF4A 2WLIB 5LGTA 1N34B 1WN7A 3OFNG 3WG7C 1ZTEA 4R6ZA 4LH7A 4WFBV 4NKGB 3OEEG 1WA8B 1AB3A 3JSNA 1M5IA 3ZMZA 5CB4B 1KYOF 4DV3O 5H2FZ 4JI5O 2Y0PA 1Q90D 1S5JA 3CJHB 4TUYA 4JI6B 4MVMA 2F4VO 4PDMA 1JCHA 2ZE7A 3CCVV 1DF5A 2Q7EA 2QGNA 2EJ7A 2XT9A 2E3CA 2E5LB 5HFMA 1SF9A 2DWEC 3B2EE 3CMAV 5LMNO 3JCUZ 4JI1O 3EHBB 1HR0B 2CK3G 3CPWU 2DMXA 5EZYA 1G4YB 3HB3B 2XNDG 1THZA 1GN4A 3APQA 4DV2B 4JAUA 3SGIA 4K8XA 4TUYB 4FLYA 4NTXA 4CC5A 4FIPC 1WP7A 3EVKA 4JI0B 1BQZA 3ASOC 4X62B 4DK0A 4LFAO 2DYRB 4X89A 4YIOA 3ZS8C 1X4TA 3IFXA 4Z2WA 1I5XA 1ZLZA 4PDRA 4PJ0Z 5EZYB 4U3FH 2H94A 2XAHA 1H2GA 4I50A 3L75H 4JI4O 2PGGA 3WFVA 1NVPB 4GX2A 4ABMA 1DGSA 4O4HA 5L3BA 4JTAB 1EFRG 1KU9A 4JYYA 4QIWF 4DR2O 1ZAUA 2N05A 2HG5C 4B7KA 2WPDG 3ETEA 1YTFD 3JALA 3C3SA 2A7WA 1M57B 2H8PC 3QVNA 5LHIA 4FFKA 2R72A 4LCUC 1TUEB 2QTSA 4I50B 2E75B 1CEZA 1AR4A 1GM8A 1WPBA 2GUZA 1IBLB 1JR9A 1EN4A 4JPRA 1E1QG 3K59A 3BAAA 4DUZO 1Q86W 4F6EA 2GV9A 4O4HB 2FKXA 3T1HO 2W0XA 4DV4B 3OTFA 1GTOA 4DR4B 4R50A 3ZRWA 1OCOC 2R9AA 3L70H 3LDCA 3QF7A 4YHHB 5LHGA 5LOVA 3KKYA 4K8ZA 3JALB 1GRJA 1ZX3A 1YZBA 3ZHSA 1YXBA 4B3SO 4PDVA 4CS2A 1QLEC 1JJ2U 4JF3A 2GUZB 2JDIG 2QJ1A 1R1BA 1KKDA 3JD1A 2EINB 1KUQA 2ZR2A 2P7TC 1N33O 2FYUH 1AI5A 2P4KA 4DR6O 3H1LH 3OTOB 1I0HA 1AVMA 1R6NA 2Y69B 3ZRWB 3KZIZ 2HEPA 1M93A 5LOVB 4FLXA 2W6JG 5EC1C 4UVCA 2BTQA 1XL6A 3EXAA 1DTOA 5B5EZ 3M7MX 4OGQB 3NR7A 4DV3B 4JI5B 4GCZA 4EEQA 3B09A 1BL8A 4UB8Z 4DK1A 1VQ7V 4GX0A 4MSWC 5CBGA 1VARA 3CCRV 3AG7A 2KSDA 5F2VO 1K97A 2JK5C 2E76B 2LP7A 1WB7A 4TOIA 1M90W 2Q5ZA 5IJ0A 2BTQB 1F23A 5LMNB 3G67A 4JI1B 2WLHA 4J9ZB 5KUMA 3E2EA 1EBOA 3N2KA 4WF9V 1QBZA 1S77D 2VQFB 1OCCC 1QVFU 1H8HG 2L6LA 1X59A 4I9WA 3Q4HA 4HBNA 1XUQA 5LP6A 1SQQH 1R3IC 2LW7A 4CH3A 1AI7A 3ZMSA 4LFAB 2JRIA 5IJ0B 3WB2A 2Q8VA 1BT8A 4I7ZB 3N2KB 5B1AC 3L72H 1UJWB 3ABKC 2B1IA 4NTYA 3F7VC 3BA9A 4JI4B 4NR1A 3E8GA 1H2NA 1JA8A 3Q4HB 4LWSA 1W0KG 2CDYA 3E8FA 5LP6B 3EFFK 3MD0A 2EIMB 3SYPA 2HFEC 5B1NA 4WCEV 1V9PA 2LO1A 3HKCA 1YSCA 3QO7A 4IL6Z 2BSKA 3JD0A 4W4KA 3ZMTA 5LMUB 4K3AA 5KHKA 5KA5A 4LFCO 4DO2A 4ZIBA 2ZDIA 5KAFZ 2Q7GA 5J2UA 3RGBA 3S3WA 2DOSA 2X6CA 5ITZA 2DWDC 2UXCO 4LWSB 1IDSA 3ZCCA 3ZRSA 4DUZB 3T1HB 2ITDC 4QPKA 3HKCB 5EYPA 3APOA 1AJNA 1HDJA 4LNUA 5AG2A 1ENVA 4J7JA 2WLLA 2QM4A 4NVPA 4U7OA 3DTUB 5HFLA 3JARA 5J2UB 4IHJA 4OXSA 4PA9A 2UXBB 1SQBH 5ITZB 4JI2O 2UU9B 3FB6C 2Y4TA 1NTMH 4H0LB 3SPGA 3JD2A 5GONA 1FFXA 4JI7O 1IZ3A 1JPXA 1N33B 2XAJA 5EYPB 2RN9A 4LNUB 4DR6B 2GTAA 4JAVA 1Q3EA 1CPYA 3LSSA 2QR4A 2WLLB 2ZE5A 3CEIA 1XL4A 4P2ZA 2F93B 1MABG 3JARB 2LGWA 4MW3A 3E22A 4IHJB 1MZFA 5KHJA 5B3SB 1I5YA 4IGGA 2XTAA 1NTZH 4YY3O 2X0LA 1KQSU 5GONB 2YS8A 2EILC 1FFXB 1KKCA 3RVZA 3RFRA 5KLVH 2YIDA 4UCRA 1BE3H 2PUSA 1I7FA 2HJDA 3G71V 2QE7G 1L8DA 3DXRA 2A9HA 4B3RO 2H3OA 5LBQA 2PF4E 3E22B 5LYJA 1AP6A 2NN4A 3X2QC 1WPXA 2EJRA 1OV9A 3ZX6A 4MTOA 4CBCA 1COWG 1GN2A 1PNMA 2DYSC 3K5LA 4RQEA 5IWAO 2QDOA 1FJGB 3LSQA 5CBHA 4QE7A 3FFQA 3ABUA 3DXRB 4MTGA 1Q7YW 4UCOA 4GZRB 1BS3A 4G2KA 5LYJB 3O65A 1NBMG 1XHZA 4YIPA 2YXYA 3ASOB 4K0KO 3AG1C 4O4IA 1OCRB 3HKDA 2D2CB 3ETGA 2BE3A 4DR7O 2Z0AA 3TCUA 2CUGA 3FKSG 3OUSA 1SQGA 3I56V 3ZBHA 3O9OA 1WAZA 2OT5A 1HW7A 2PI4A 5IJ9A 4BW9A 5L3EA 3SPCA 3K5NA 3SYCA 4R8CA 3MAQA 5BXZA 1QNMA 4O4IB 1YITV 2UXCB 1FKAO 1Z5VA 2QKSA 3HKDB 4X88A 4JV5O 1RPRA 3RYFA 4I4TA 5DM6V 5GW7A 2ZM6O 3ZEDA 4N21A 3L74H 1MZEA 2ITCC 3R65A 1YEWA 1SC5B 4MTFA 3SJQC 1S3JA 3VQWA 2P06A 2HVJC 4YXWG 4GX5A 1GH6A 5IJ9B 3ABLC 3JAMN 2A3QA 3CRQA 5E79Z 2ZINA 3FB5C 1CP9A 4H13B 4MS2A 1OCOB 1XMQO 2UXXA 1YDXA 4BW5A 2Q69A 1NR1A 4JI7B 4KL1A 3RYFB 4I4TB 1RM1C 1QLEB 2F43G 1Y66A 4ZKIA 4MVZA 4CH4A 1LR1A 2FTKA 4H37A 3GWKC 4UCTA 1MSDA 1FFTB 2YIAA 4RUEA 2WLJA 1VF6A 1GMGA 4JYAO 4LF9O 1AI6A 4BR6A 5BY1A 3CCEV 4JI3B 1BGYH 4EB6A 4NYKA 1XDCA 2P67A 3QG5A 1M9NA 1AROP 1Q8IA 2ZQMA 4L8JA 5CBFA 3RYHA 1YTFB 1QLNA 3UM7A 5JJNB 1KBHA 4Q20A 1V54B 1M1KW 1IBMO 1R6KA 1V55C 2OIGA 5H6RA 5IYZA 1Y67A 2DN9A 4AHCA 1PNLA 2OCCB 4X8AA 3FYIB 3E89A 1K9MW 4C7UA 5JVDA 4CH5A 5FLXN 3CE2A 4BIZA 5CA3A 3AG3B 3D3QA 1HWYA 2BOCC 4EB6B 1SERA 3I5DA 3D36C 3CCMV 4DV5O 3RYHB 1MMMA 3S3XA 1AJPA 3A0HZ 1S76D 4U7NA 1OCCB 1PPJH 1N0JA 3A0BZ 3ABTA 1IXBA 1NQTA 4HAMA 1K34A 2YI8A 5IYZB 4UCUA 3AK3A 4ZOLA 3SJCC 3D3IA 2RNBA 1YIJV 1BHAA 5L3DA 5JVDB 4XDKA 4QJFB 4LC1A 3ML0A 2IJIA 1J5EB 2WAMA 5K1PA 1XOUA 5L3CA 4I55A 2ZIOA 3GVMA 3ABKB 1AJQA 1IBKB 1SZXA 1QHTA 1K73W 3T1CA 4UCSA 3PN1A 1ZWIC 5LGUA 4DV0B 1XILA 1XNQO 1NKDA 3U0ZA 2LGQA 1PNKA 4UXNA 1JFFA 1Q81W 4ZOLB 4UV9A 3TGUH 4F4LA 5KHHA 3ZHUA 3QNEA 2UUCO 4MVSA 3WU2Z 2VQEB 4FK5C 3C90A 4JV5B 2XAQA 3CCJV 2Y48A 1MOFA 4I55B 1N32B 4O4JA 4MT8A 2ZM6B 4J10A 3IJ4A 4UV8A 1KD1W 1FXVA 1SQFA 2DQ3A 3I55V 4XDLA 1Q6UA 3D8CA 1JFFB 4E4EA 2QWQB 2AHZA 1K92A 2UXDO 2LQTA 2WSSG 4DV7O 1SETA 4FLVA 2B1GA 2X6BA 4FLZA 4OX9O 2JJ1G 3JYCA 1H2MA 1WJZA 4EKWA 3BEHA 3ASNC 3KCYA 2ZNIA 2P4VA 3K06A 2W0FC 3GWOA 4JYBA 4LH6A 4O4JB 4DRXA 4JYCA 2QM7A 3BPZA 2DQ0A 1TVKA 4JAAA 2R9RB 3K57A 3DC6A 4MTXA 1OJHA 5A9GA 5CN0A 5GTIZ 4UVAA 1PV0A 4FFBA 1R3JC 3UQ8A 4LF9B 3W7WA 1WP8A 2XOKG 3SYOA 1YJWV 1S72V 4FM2A 4BIOA 2DW4A 1VQMV 1FXKA 1FYJA 4DRXB 2EZOA 4IT5A 3UO2A 2XAFA 2O57A 4AQYO 2F4VB 1TVKB 1B04A 3E8HA 2KQXA 1ZUQA 2YSUB 4MVQA 5LL6Y 2EILB 1Z5WA 3OT7A 4U3JA 1GO3F 1K33A 4J80A 3OGIB 1H8EG 2WA3A 4FFBB 2VRZA 1XQ8A 3K5OA 5DECA 3ZN0A 3MDSA 1VQKV 1VQLV 1JX9A 4YJ2A 4RAIA 2HHHO 1FXKB 1HNXO 1GK9A 3ZHQA 3X2QB 3SYAA 2KG7A 1B6QA 2K9PA 1GAXA 2RCVA 2Q0AA 3LSUA 3JD3A 3HPLC 2ARHA 2DYSB 3BY6A 4U3JB 2FL4A 2JGDA 1EN5A 4WFFA 2DYRC 2GDSA 4NXMO 1L0LH 3A8TA 2ZXWC 1CXZB 2PY5A 3IAYA 2IU3A 4YJ2B 1UPGA 4DR3O 5GTHZ 5B66Z 1NT2B 1QCEA 3K04A 2KG7B 2EBOA 3CX5F 4DR1O 2PZSA 2A79B 3AG1B 2XHBA 4CH6A 1W2BU 2CTPA 3W7UA 4DR2B 4E2LA 4BWAA 2JGDB 1TUBA 1YJ9V 1SA0A 1XHXA 2HKOA 3H1HH 1Q6IA 2UUCB 4LFBO 3J81N 3G6EV 4UFZA 3FX7A 1M57C 2IH3C 3CC2V 1F4NA 1ORQC 5B1BC 3OMAB 5D5QA 1Q6HA 2RMKB 5BMVA 3P30A 4R7CA 1KECA 3HKEA 3W7XA 4KFMA 4B3MO 4QE9A 1D5AA 4DUYO 1J95A 1TUBB 4P30A 1SA0B 5TISZ 4I9QA 3OUFA 1ROPA 5JCOC 4B3SB 4J11A 2RDCA 2D3OW 5KA6A 1K8AW 4EFBA 3DSQA 1L0NH 4UB6Z 1W0JG 1N4CA 2AGAA 3ABLB 1N8RW 3OR7C 4I0XA 5C8YA 4DR5O 4LF7O 3E8BA 2JVDA 5BMVB 3HKEB 1VP7A 1VMGA 5IY5C 3OE7G 2EINC 5IT9N 1N0NA 3PJSK 5DN6G 1E1RG 4AILC 2UXNA 1RM1B 1HNWO 2Q0OC 3MHHC 1PL0A 2JEXA 2P90A 2R9IA 3CC7V 3WG7B 1HNZO 4I0XB 5H9CA 1G6UA 1SKVA 1K4CC 5C8YB 4FZ1A 1F7YA 3LDEA 2IH1C 1FS0G 5J9PC 4O2BA 1N34O 2GTSA 4TQFA 2ZR3A 4H33A 4AQYB 4J9YB 4G27B 1FD9A 1Z2GA 1BZKA 4IYIA 1QQCA 2EIJC 5DEDA 4PHZA 2A0LA 3LNNA 4OPHA 5EBMC 5IDJA 1K3EA 3D36A 3T1YO 3IC7A 4DW0A 3JATA 4P9PA 2IJJA 1NI8A 3STLC 2YIBA 5FPOA 1PD3A 1MG1A 1TA8A 2P6JA 3JAWA 4JI6O 5JH7A 1S5HC 3JD4A 1K7DA 1V55B 2HHHB 4O4LA 4B3TO 4O2BB 3IC9A 3MHSC 3SPHA 3B8MA 2WLKA 5LA6A 1IURA 4X64O 3N2GA 2OYQA 4QGPA 3CXCU 3B4SA 1VIBA 2CAZC 1HR0O 4FM0A 3FB7C 3BA8A 3QO5A 1K5QA 4LR3A 2ZCEA 1S5LZ 4B08A 3B77A 5EC2C 1YF2A 5KAIZ 3JATB 2K1EA 4NXMB 4GX1A 2LW1A 2QWNB 3L71H 3JAWB 1P4RA 1U97A 5JH7B 4MVUA 3OW2U 4PA4A 4DR3B 3CB2A 4PD4F 4JI0O 2XAGA 4O4LB 4XDJA 3VBBA 4X62O 2AZ0A 2Q67A 1GN3A 1S0VA 5JJJB 5LA6B 4YJ3A 3N2GB 3BRCA 2PYLA 5FPRA 3H1IH 3E86A 1URFA 3G4SV 4JTDB 1HP8A 2P5OA 2IU0A 4LFCB 5CMUA 3OMNB 2ETNA 1E79G 2WLMA 2XASA 3GB7C 5L3FA 2Q9LA 4LFBB 2EX3A 2IBZH 2L35A 3TK1A 1NH2D 3ZMVA 4X1KA 5LXTA 2WLNA 2PYJA 4FM1A 1B06A 3A2FA 2GHYA 2V7QG 4H44B 2RQ6A 3W7SA 4PA6A 3OAAG 4YJ3B 2OTLV 1OHHG 4B3MB 2B5UA 3ZRVA 5EBWC 1KC8W 4RUFA 2JS3A 4B7EA 5IE9A 4QPJA 2OWOA 5H5NA 4HNAA 2YEVA 1F51A 3TXSA 2ZD9A 4X1KB 4BIUA 5LXTB 4PI0A 3RYCA 2NLJC 4JZ2A 2PTMA 3K0DA 4JI2B 4DR4O 1GN6A 4DR5B 1SQXH 2Q68A 4LF7B 3CD6V 3B8NA 1DK1A 2IW5A 4TSFG 2QWOB 3M99B 4FPPA 4TV8A 3RN4A 3CHXA 5E1AC 2V1DA 3K0GA 4JASA 5JJEB 4IIJA 1EM1A 2R70A 2VWJA 4HNAB 2YEVB 4WFAV 1WB8A 4FMTA 3CRMA 3L9DA 3ZMUA 1H2KA 3OMIB 3VQXA 1HNZB 3RYCB 2M7WA 4YY3B 4Q6GA 3OTOO 1FAFA 4X66O 1VQ6V 3AG2C 2Q6AA 1P7GA 1M56C 2X7RB 1YI2V 2YC0A 4LP8A 4TV8B 3J80N 1PL4A 4IIJB 4J42A 4FLWA 3CRRA 1NS1A 1L1FA 4LF6O 3SPIA 3SPJA 1VQ9V 4B3RB 4L87A 3T1YB 3SYQA 3L73H 4XBFA 3P3NA 4ZI7A 4JTCB 2G38A 4LF4O 4W4LA 4B3TB 1Y6XA 1Y76A 4MVRA 1XBLA 5IWAB 4X64B 2V4DA 1Q5OA 5EIBD 1H2LA 1LUVA 4PDLA 3T4DA 3ABMC 1BCCH 1JQ0A 2VQFO 1VQOV 4GKJO 4DW1A 1N36O 3JAKA 1VEWA 3K3WA 1R6TA 2QA4V 3CC4V 3OR6C 5EBLC 3ZHRA 4ZI7B 4K0KB 4G28B 2YICA 2A06H 2YDEA 2YXLA 1Y76B 4J41A 2EZPA 4UCVA 4DR7B 1VQPV 3TXQA 1NR7A 4LF8O 2DE0X 5B1AB 1OCRC 4O2AA 3RYIA 2ZXWB 4NXNO 3FB8C 4FJCC 2WA4A 3AG4C 5BZBA 3SJBC 2CH7A 1D5NA 1VQ5V 2NR5A 2ZKOA 3JAKB 5IYDO 1BSMA 1RFYA 4UVBA 4MW8A 1YCIA 2KB1A 1PM9A 2JEUA 1R73A 2EIKC 5KHIA 4QNHB 1W59A 2CE4A 2M6YA 4X65O 4DV6O 3K5MA 1Y74A 2IJHA 2X6AA 3CCQV 5LMUO 5JCOA 1P84F 4O2AB 4A5UB 3RYIB 4DV1O 5JWPA 4PI2A 2Q4PA 4DYLA 3CS5A 3W7TA 2UUBO 1QU7A 2CH7B 5B1BB 3RBZA 5KHGA 5EIBC 3CCSV 4TV9A 3K58A 2DJVA 1M4UA 1OCZC 5LGNA 1XMQB 1G8MA 3FAVA 3SR2C 1Y74B 4J7KA 2BOBC 2VWKA 1GM9A 3JASA 2MW2B 4KHPO 4ZBMA 4P9OA 3OEHG 1Q43A 4PA3A 2FMLA 4GKKO 2UXBO 4MVOA 3F5WC 2UU9O 4TV9B 1KB9F 1SQVH 5IY5B 3ZIAG 1NTKH 1BQ0A 4PELA 3C3TA 3UT5A 4JYAB 3G6BA 3FAVB 2F66C 1TAEA 1XEQA 4X66B 5J2TA 4FLTA 1NVPD 3JASB 1QVGU 5H6QA 2BCCH 4NB5A 4NTWA 1T5EA 3BABA 2JS5A 1G1XB 2HR3A 4OPAA 3ZN1A 4LF6B 1JOYA 4FVMA 1XNRO 3P32A 1US6A 2N04A 3QTCA 1IBMB 4KP4A 4RQFA 2AXTZ 5FNVA 1V54C 2QKAA 4JGSA 2EIJB 3FYEB 3UT5B 5D5PA 5FL7G 2AZ2A 2B9ZA 2HP8A 2OCCC 4LF4B 2OTJV 5J2TB 1VF6C 3IGAC 3VQYA 1H2SB 2LJ2A 4DV5B 1I94O 3AG3C 4DXWA 1JJOA 4WBNA 3CWBH 4BAYA 1NU1H 1EN6A 4LF5O 1U96A 4GKJB 1N36B 3ETQA 2C2AA 1SQPH 5FNVB 2GSMB 3AEIA 3RVYA 3HKBA 1SESA 2WWWA 1FJGO 4N23A 1IVSA 4IYHA 3WB1A 4LF8B 4X9QA 2ZT9B 2Y4UA 4NXNB 3QO8A 3HR0A 2XUMA 4WBNB 4D6TH 4WFEA 2CGOA 4Z1VA 1ZL8A 1XNQB 3ZHTA 3BFRA 2UUAO 3AK2A 3CXHF 5B1OA 4PA7A 2QKCA 2OCHA 1XMOO 3HKBB 2MK3A
chains in the Genus database with same CATH topology
3LDCA 5LHGA 3CCEV 3FB7C 3QO5A 1K5QA 2P67A 2Z3YA 1M9NA 1AROP 3B77A 5EC2C 4PDVA 2ZQMA 5CBFA 1QLEC 2PI5A 1YTFB 3STZC 3NXSA 1JJ2U 2K1EA 4TWKA 4GX1A 1OZ0A 1QLNA 3UM7A 4JF3A 2JJ2G 5L3GA 2JDIG 1P4RA 4Q20A 1V54B 3ZRXA 3ETDA 4MVUA 1M1KW 1DLBA 3OW2U 1KKDA 2QTOA 4PA4A 3JD1A 2EINB 1R6KA 1V55C 5H6RA 2XAGA 2ZR2A 4XDJA 3VBBA 1SRYA 2P7TC 2AHYA 1PNLA 1AI5A 5C93A 2OCCB 2Q67A 4X8AA 1S0VA 3FYIB 1R6NA 3E89A 1K9MW 2Y69B 3ZRWB 3LDDA 3E86A 4BIZA 3G4SV 5CA3A 3AG3B 4JTDB 2W6JG 1HWYA 5EC1C 1Q82W 4UVCA 2BOCC 1SERA 2IU0A 3TETA 1XL6A 1P7BA 3CMEV 3CCMV 3F7YC 1DTOA 5CMUA 3OMNB 1AJPA 1S76D 4U7NA 1E79G 1OCCB 2WLMA 2XASA 3E83A 5KUKA 3GB7C 2IJKA 5L3FA 3ABTA 3TK1A 1NH2D 3ZMVA 4GCZA 3RW0A 1NQTA 1QR9A 4HAMA 2WLNA 1BL8A 2HVKC 1K34A 1VQ7V 1BMFG 1EZJA 4GX0A 2GHYA 2V7QG 4MSWC 5CBGA 3UKMA 3W7SA 4PA6A 3CCRV 3OAAG 3K9AA 3D3IA 1F4MA 3JCZA 2NNUA 4KUMA 3T4ZA 1YIJV 2OTLV 1K97A 1BHAA 5L3DA 2JK5C 2Z5UA 3VOUA 2Y69C 1OHHG 2LP7A 2B5UA 4XDKA 3ZRVA 4QJFB 4LC1A 1M90W 3KG2A 3ML0A 2IJIA 3OM3B 5EBWC 4WFHA 1BHBA 1KC8W 4RUFA 1F23A 5LHHA 2WAMA 4QPJA 2WLHA 4J9ZB 5KUMA 5L3CA 3E2EA 1EBOA 4Z1MG 1H38A 4WF9V 1K5SA 1QBZA 1Y4MA 1S77D 3ABKB 1AJQA 2QEXV 2YEVA 1OCCC 1QVFU 1F51A 1H8HG 1K73W 4CZZA 3T1CA 4GT1A 2ZD9A 4I9WA 1ZWIC 4BIUA 4HYOA 1RPOA 5LGUA 2NLJC 3K0DA 1NKDA 1PNKA 2Q68A 4LBEC 3CD6V 3AG2B 1SZTA 2IW5A 3B8NA 4TSFG 4UXNA 1Q81W 2JIZG 1NH2B 3K79A 4UV9A 1R3LC 3CYOA 1M56B 1R3IC 3K08A 4F4LA 1AI4A 3QNEA 5IYCO 3M99B 1AI7A 4FPPA 3ZMSA 4MVSA 1VQNV 5E1AC 2V1DA 3K0GA 4JASA 1VQ4V 4FK5C 1IXMA 2XAQA 3CCJV 2Y48A 1MOFA 5B1AC 4MT8A 1LNQA 1UJWB 3ABKC 2B1IA 2YEVB 3F7VC 4WFAV 1MSWD 4FMTA 3E8GA 4UV8A 3ZMUA 3OMIB 1KD1W 4I5SA 1FXVA 1FXKC 1W0KG 2M7WA 1GKFA 2DQ3A 3E8FA 4XDLA 3I55V 3EFFK 3MD0A 1VQ6V 2EIMB 3AG2C 2HFEC 5B1NA 3SYPA 2Q6AA 4WCEV 1YSCA 1M56C 2AHZA 2ATKC 2X7RB 1YI2V 1K92A 3QO7A 5EK0A 4LP8A 2HJFC 2WSSG 3JD0A 1WLEA 1R3KC 1SETA 3ZMTA 2B1GA 2X6BA 5KA5A 2JJ1G 3CCLV 3JYCA 4DO2A 1L1FA 4EKWA 3SPIA 2ZDIA 3BEHA 3ABMB 3ASNC 1VQ8V 3SPJA 3K06A 1VQ9V 2W0FC 3GWOA 4JYBA 1JVMA 4L87A 4JYCA 3SYQA 2QM7A 2DQ0A 1YHQV 2X6CA 3T2MA 4XBFA 1NJIW 2R9RB 2DWDC 2LFSA 1PKXA 3ZJZA 4MTXA 1K4DC 4JTCB 3ZCCA 1YJNV 3ZRSA 5CN0A 2EIMC 2ITDC 4QPKA 1KP3A 3CP1A 1AJNA 4UVAA 3K03A 4MVRA 1ENVA 1R3JC 4UUJC 2WLLA 3W7WA 2XOKG 2LFRA 4TT3G 3SYOA 3LNMB 1YJWV 1S72V 3AG4B 2DW4A 4U7OA 3DTUB 5HFLA 1VQMV 4PDLA 3T4DA 3ABMC 1JQ0A 1FXKA 1VQOV 2EZOA 3LUTB 4OXSA 2XAFA 3K3WA 4PA9A 2QA4V 2EIKB 3CC4V 3E8HA 3FB6C 3OR6C 5EBLC 3SPGA 2YSUB 4MVQA 3JD2A 2EILB 4G28B 1FXHA 1KP2A 1GO3F 1K33A 1JPXA 2XAJA 3OGCC 1H8EG 2EZPA 1VQPV 1AR1B 1NR7A 4JAVA 1GM7A 1OCRC 3A0RA 5B1AB 1CPYA 2HLDG 2ZXWB 3LSSA 5IYBO 3ZN0A 2WLLB 1QR8A 1XL4A 1VQKV 4P2ZA 1VQLV 3FB8C 4FJCC 1JX9A 2W6IG 3DGEA 3AG4C 1MABG 4RAIA 2ZDIC 5BZBA 1FXKB 3H01A 4MW3A 1VQ5V 1GK9A 5B3SB 1I5YA 5IYDO 4UVBA 4MW8A 3SYAA 3X2QB 3E35A 2KB1A 1B6QA 2JEUA 2WLIA 1R73A 2EIKC 1KQSU 2X0LA 1OCZB 3JD3A 4WFGA 2EILC 3HPLC 2DYSB 3BY6A 3RVZA 4QNHB 3ASNB 4WFFA 2IJHA 2X6AA 3CCQV 2DYRC 2QM8A 4HZ3A 4RO2A 3G71V 2QE7G 2ZXWC 2IU3A 2A9HA 3W7TA 5LBQA 5B1BB 3RBZA 1QCEA 3K04A 4ASUG 3CCUV 5B3SC 3CCSV 3X2QC 1DF4A 1WPXA 2EJRA 2EBOA 2WLIB 5LGTA 2A79B 3OFNG 3WG7C 4MTOA 3AG1B 4R6ZA 4CBCA 4WFBV 1W2BU 1OCZC 3W7UA 1COWG 5LGNA 1PNMA 2DYSC 3OEEG 4E2LA 1G8MA 4RQEA 1YJ9V 2BOBC 3LSQA 1GM9A 2HKOA 3ZMZA 5CBHA 4QE7A 3ABUA 4ZBMA 4P9OA 4MTGA 3G6EV 3OEHG 1Q7YW 1M57C 2IH3C 3CC2V 1F4NA 4PA3A 1ORQC 4MVMA 5B1BC 4G2KA 3OMAB 1NBMG 4PDMA 1JCHA 4MVOA 3F5WC 3P30A 4R7CA 3ASOB 1KECA 3W7XA 3CCVV 4KFMA 1DF5A 5IY5B 3ZIAG 3AG1C 4QE9A 1OCRB 4PELA 5HFMA 2DWEC 3ETGA 3CMAV 3TCUA 3EHBB 1J95A 2CK3G 3FKSG 4P30A 3OUSA 3CPWU 1G4YB 3I56V 1NVPD 5H6QA 3OUFA 1ROPA 1QVGU 3HB3B 2XNDG 2D3OW 5KA6A 1THZA 2OT5A 1K8AW 4JAUA 2HR3A 1W0JG 3ZN1A 3ABLB 1N8RW 3OR7C 2PI4A 5L3EA 1JOYA 3E8BA 3SPCA 4FIPC 3P32A 3SYCA 4KP4A 4RQFA 3ASOC 4R8CA 1V54C 2DYRB 4X89A 1YITV 5IY5C 3OE7G 4JGSA 2EINC 2EIJB 2QKSA 3FYEB 3IFXA 4X88A 1I5XA 3PJSK 5FL7G 5DN6G 2OCCC 1RPRA 2OTJV 1E1RG 4PDRA 2UXNA 1RM1B 3IGAC 5DM6V 5GW7A 3MHHC 2H94A 1PL0A 2XAHA 1H2GA 4N21A 2ITCC 3R65A 2JEXA 3AG3C 4MTFA 4DXWA 3SJQC 1S3JA 2P90A 3WFVA 2R9IA 1NVPB 3CC7V 3WG7B 2HVJC 4YXWG 4GX5A 5H9CA 3ABLC 4BAYA 1K4CC 4GX2A 3LDEA 2IH1C 1FS0G 5J9PC 2C2AA 3FB5C 2ZR3A 4H33A 1CP9A 2GSMB 5L3BA 4JTAB 1EFRG 4J9YB 4G27B 4QIWF 3AEIA 4MS2A 1OCOB 3RVYA 1SESA 2HG5C 2WWWA 2EIJC 2UXXA 2WPDG 3ETEA 1YTFD 2A0LA 4BW5A 4N23A 2Q69A 1NR1A 1M57B 2H8PC 5EBMC 5IDJA 1K3EA 5LHIA 3D36A 1RM1C 4LCUC 1QLEB 1TUEB 2F43G 3IC7A 4P9PA 2IJJA 1Y66A 4ZKIA 1CEZA 4MVZA 3STLC 1GM8A 1PD3A 3QO8A 1MG1A 2P6JA 2FTKA 1S5HC 3JD4A 1K7DA 4H37A 4JPRA 1V55B 1E1QG 4WFEA 1Q86W 1FFTB 3MHSC 1GTOA 4R50A 3SPHA 4RUEA 2WLJA 3B8MA 5B1OA 2WLKA 4PA7A 1GMGA 3ZRWA 3CXCU 1OCOC 1AI6A 2MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDC A;  4MVS A;  3TCU A;  3FB7 C;  5E1A C;  1J95 A;  1OCR C;  3K0G A;  4P30 A;  3OUS A;  1G4Y B;  2WLL B;  3OUF A;  5EC2 C;  1XL4 A;  4P2Z A;  3FB8 C;  4PDV A;  5CBF A;  1QLE C;  3STZ C;  2K1E A;  3AG4 C;  4GX1 A;  4TWK A;  4RAI A;  5B1A C;  3UM7 A;  5BZB A;  1LNQ A;  4MW3 A;  3ABK C;  3OR7 C;  3F7V C;  3E8B A;  4MVU A;  3E8G A;  4MW8 A;  3SPC A;  3SYA A;  1KKD A;  2QTO A;  4PA4 A;  2KB1 A;  3SYC A;  1V55 C;  2WLI A;  2EIK C;  4XDJ A;  2P7T C;  2AHY A;  3ASO C;  4R8C A;  3E8F A;  4XDL A;  1V54 C;  2Q67 A;  3EFF K;  4WFG A;  4X8A A;  4X89 A;  3AG2 C;  2HFE C;  3E89 A;  2EIL C;  2Q6A A;  3SYP A;  5IY5 C;  3HPL C;  4QNH B;  2EIN C;  2QKS A;  3IFX A;  3RVZ A;  4X88 A;  1M56 C;  2AHZ A;  2ATK C;  3PJS K;  3LDD A;  5EK0 A;  3E86 A;  4LP8 A;  2HJF C;  2OCC C;  4WFF A;  4JTD B;  2X6A A;  4PDR A;  1R3K C;  2DYR C;  4HZ3 A;  5EC1 C;  2BOC C;  4RO2 A;  3IGA C;  2X6B A;  3TET A;  1XL6 A;  2ZXW C;  1P7B A;  3JYC A;  3F7Y C;  4EKW A;  3SPI A;  2A9H A;  3BEH A;  2ITC C;  3ASN C;  3R65 A;  3AG3 C;  4MTF A;  3SPJ A;  4DXW A;  3K06 A;  3SJQ C;  2W0F C;  1JVM A;  2WLM A;  3E83 A;  3RBZ A;  2HVJ C;  3GB7 C;  4GX5 A;  3SYQ A;  5KUK A;  3ABL C;  1K4C C;  4GX2 A;  2X6C A;  3K04 A;  3RW0 A;  5B3S C;  3T2M A;  2R9R B;  3LDE A;  2DWD C;  2IH1 C;  1BL8 A;  2HVK C;  2WLN A;  3X2Q C;  5J9P C;  3ZJZ A;  2WLI B;  2A79 B;  3FB5 C;  4GX0 A;  4MTO A;  4MSW C;  3WG7 C;  5CBG A;  1K4D C;  4H33 A;  4JTC B;  4R6Z A;  4PA6 A;  3UKM A;  4JTA B;  3ZRS A;  4CBC A;  4J9Y B;  4G27 B;  4MS2 A;  1OCZ C;  2EIM C;  3RVY A;  3T4Z A;  2ITD C;  2HG5 C;  2DYS C;  2EIJ C;  2JK5 C;  3VOU A;  2Y69 C;  4XDK A;  3K03 A;  4MVR A;  3KG2 A;  2A0L A;  5EBW C;  1R3J C;  4WFH A;  4BW5 A;  2Q69 A;  2BOB C;  4RUF A;  2H8P C;  4UUJ C;  5EBM C;  2WLL A;  5CBH A;  4QE7 A;  4LCU C;  3SYO A;  3LNM B;  4P9P A;  4ZBM A;  2WLH A;  4J9Z B;  5KUM A;  4MVZ A;  4P9O A;  3STL C;  4MTG A;  4PDL A;  3T4D A;  3ABM C;  1M57 C;  2IH3 C;  2YEV A;  1OCC C;  3LUT B;  4PA3 A;  1ORQ C;  4MVM A;  4OXS A;  5B1B C;  1S5H C;  4H37 A;  4PA9 A;  3T1C A;  4I9W A;  2ZD9 A;  4WFE A;  4PDM A;  1ZWI C;  4MVO A;  3F5W C;  3E8H A;  4HYO A;  4R7C A;  2NLJ C;  3FB6 C;  3K0D A;  3OR6 C;  5EBL C;  3SPG A;  4KFM A;  4R50 A;  3SPH A;  2Q68 A;  2WLJ A;  4LBE C;  4MVQ A;  4RUE A;  2WLK A;  4G28 B;  4PA7 A;  3AG1 C;  4QE9 A;  1R3L C;  1R3I C;  3K08 A;  4F4L A;  1OCO C;  3OGC C;  2DWE C; 
#chains in the Genus database with same CATH topology
 1O9G A;  2ZIM A;  4F6R A;  4X65 B;  2Z3Y A;  4DV6 B;  4EFE A;  2PI5 A;  3STZ C;  3NXS A;  4TWK A;  1OZ0 A;  4DV1 B;  3ZHV A;  2JJ2 G;  5L3G A;  3ZRX A;  3ETD A;  1DLB A;  4CS4 A;  2AW9 A;  2P22 C;  1UFI A;  2QTO A;  2UUB B;  2KKW A;  3CRA A;  3KCX A;  1SRY A;  1ZL8 B;  2AHY A;  5C93 A;  1MNG A;  4ICG A;  4JZG A;  2JGU A;  2F23 A;  3FD9 A;  3RWR D;  3LDD A;  5A2Q N;  3J7A U;  2UXD B;  4KXR A;  4DV7 B;  2FB5 A;  1Q82 W;  4RWU A;  4F6R B;  3WB0 A;  4OX9 B;  3TET A;  2F1M A;  1P7B A;  3VQV A;  3CME V;  3F7Y C;  2BSK B;  3E83 A;  5KUK A;  2IJK A;  4KHP B;  3G80 A;  3RW0 A;  1QR9 A;  1SS3 A;  2Q73 A;  2HVK C;  1BMF G;  3R66 A;  1EZJ A;  5BR8 O;  4JI8 O;  3UKM A;  4GKK B;  3K9A A;  5KX5 A;  3JSL A;  1F4M A;  3JCZ A;  1VF7 A;  3ICX A;  2NNU A;  4KUM A;  3T4Z A;  5JQG A;  2CTW A;  2GBO A;  4X1Y A;  1AIL A;  1I08 A;  2Z5U A;  2Y69 C;  3VOU A;  1NZ6 A;  3KG2 A;  2N74 A;  3OM3 B;  4WFH A;  3SJA C;  3K9S A;  1BHB A;  2QWP B;  5LHH A;  4ZHQ A;  2CTQ A;  4D7T A;  4Z1M G;  1H38 A;  1K5S A;  1Y4M A;  4X20 A;  1XRE A;  2QEX V;  4CZZ A;  4GT1 A;  3RT3 C;  4HYO A;  1RPO A;  3U10 A;  4LBE C;  3THO A;  3AG2 B;  1SZT A;  2Q7H A;  1XNR B;  5CA0 A;  2JIZ G;  1NH2 B;  3K79 A;  5KX5 B;  1R3L C;  3CYO A;  1M56 B;  3K08 A;  5JQG B;  1VF5 B;  1AI4 A;  4X1Y B;  5IYC O;  4JI3 O;  1VQN V;  2CGN A;  4PV1 B;  2VS0 A;  1VQ4 V;  2BTO A;  3H1K H;  2E74 B;  4ZHQ B;  1IXM A;  4FLU A;  4X20 B;  1D2D A;  1LNQ A;  1HNX B;  3M8A A;  1MSW D;  2YXH A;  1I94 B;  1RP3 B;  2ZE6 A;  2CTR A;  2E5L O;  4I5S A;  1FXK C;  1GKF A;  5KMG A;  3UCS C;  4LF5 B;  5CA0 B;  4CS3 A;  4D7S A;  1O9H A;  2ATK C;  2Y0I A;  2QSA A;  5EK0 A;  2HJF C;  1WLE A;  1R3K C;  4DV2 O;  3F5T A;  3CCL V;  1EZV H;  4GUN A;  4J7Z A;  5K1X A;  4FZ0 A;  3ABM B;  1VQ8 V;  3CSX A;  1RSO A;  1JVM A;  1XI1 A;  1AR5 A;  2YI9 A;  1YHQ V;  3T2M A;  4AI8 A;  4CC6 A;  1NJI W;  1IX9 A;  2LFS A;  1PKX A;  3ZJZ A;  2ADP A;  4DR1 B;  1JMK C;  2QWR B;  4X1I A;  1K4D C;  5KMG B;  1YJN V;  1ZSP A;  4K35 A;  3B40 A;  5LP6 C;  2EIM C;  3DC5 A;  3BVO A;  3H1J H;  1KP3 A;  3CP1 A;  2UUA B;  3K03 A;  1J5E O;  1XMO B;  4UUJ C;  3UO3 A;  2LFR A;  4TT3 G;  3LNM B;  3AG4 B;  2OIE A;  2YUA A;  1RSO B;  1IBK O;  3LUT B;  3H9V A;  3BCC H;  2ZE8 A;  2IM9 A;  3BHP A;  2EUL A;  2EIK B;  3N27 A;  4DV0 O;  4X1I B;  1FXH A;  1AP5 A;  1KP2 A;  2RJZ A;  1WNS A;  3OGC C;  4DUY B;  1FPO A;  3P3P A;  3U11 A;  1AR1 B;  1PP9 H;  2ADQ B;  1GM7 A;  3A0R A;  2HLD G;  5IYB O;  2VQE O;  1QR8 A;  1IBL O;  2ODM A;  2W6I G;  3DGE A;  1N32 O;  2ZDI C;  3H01 A;  5CA1 A;  4DV4 O;  4TQD A;  3E35 A;  1KMI Z;  2F95 B;  2WLI A;  1MA1 A;  4YHH O;  1OCZ B;  4WFG A;  3AK1 A;  4GLX A;  1P49 A;  2ZNJ A;  4GYC B;  1WA8 A;  5BR8 B;  1B3Q A;  3SDL A;  4JI8 B;  3CRC A;  3ASN B;  2QM8 A;  4HZ3 A;  1A32 A;  4RO2 A;  1HNW B;  1LUW A;  5CB4 A;  2YIB D;  1YVW A;  3CJH A;  3TJT A;  5CA1 B;  1TGO A;  3OD4 A;  4ASU G;  3CCU V;  5B3S C;  2ILM A;  1DF4 A;  2WLI B;  5LGT A;  1N34 B;  1WN7 A;  3OFN G;  3WG7 C;  1ZTE A;  4R6Z A;  4LH7 A;  4WFB V;  4NKG B;  3OEE G;  1WA8 B;  1AB3 A;  3JSN A;  1M5I A;  3ZMZ A;  5CB4 B;  1KYO F;  4DV3 O;  5H2F Z;  4JI5 O;  2Y0P A;  1Q90 D;  1S5J A;  3CJH B;  4TUY A;  4JI6 B;  4MVM A;  2F4V O;  4PDM A;  1JCH A;  2ZE7 A;  3CCV V;  1DF5 A;  2Q7E A;  2QGN A;  2EJ7 A;  2XT9 A;  2E3C A;  2E5L B;  5HFM A;  1SF9 A;  2DWE C;  3B2E E;  3CMA V;  5LMN O;  3JCU Z;  4JI1 O;  3EHB B;  1HR0 B;  2CK3 G;  3CPW U;  2DMX A;  5EZY A;  1G4Y B;  3HB3 B;  2XND G;  1THZ A;  1GN4 A;  3APQ A;  4DV2 B;  4JAU A;  3SGI A;  4K8X A;  4TUY B;  4FLY A;  4NTX A;  4CC5 A;  4FIP C;  1WP7 A;  3EVK A;  4JI0 B;  1BQZ A;  3ASO C;  4X62 B;  4DK0 A;  4LFA O;  2DYR B;  4X89 A;  4YIO A;  3ZS8 C;  1X4T A;  3IFX A;  4Z2W A;  1I5X A;  1ZLZ A;  4PDR A;  4PJ0 Z;  5EZY B;  4U3F H;  2H94 A;  2XAH A;  1H2G A;  4I50 A;  3L75 H;  4JI4 O;  2PGG A;  3WFV A;  1NVP B;  4GX2 A;  4ABM A;  1DGS A;  4O4H A;  5L3B A;  4JTA B;  1EFR G;  1KU9 A;  4JYY A;  4QIW F;  4DR2 O;  1ZAU A;  2N05 A;  2HG5 C;  4B7K A;  2WPD G;  3ETE A;  1YTF D;  3JAL A;  3C3S A;  2A7W A;  1M57 B;  2H8P C;  3QVN A;  5LHI A;  4FFK A;  2R72 A;  4LCU C;  1TUE B;  2QTS A;  4I50 B;  2E75 B;  1CEZ A;  1AR4 A;  1GM8 A;  1WPB A;  2GUZ A;  1IBL B;  1JR9 A;  1EN4 A;  4JPR A;  1E1Q G;  3K59 A;  3BAA A;  4DUZ O;  1Q86 W;  4F6E A;  2GV9 A;  4O4H B;  2FKX A;  3T1H O;  2W0X A;  4DV4 B;  3OTF A;  1GTO A;  4DR4 B;  4R50 A;  3ZRW A;  1OCO C;  2R9A A;  3L70 H;  3LDC A;  3QF7 A;  4YHH B;  5LHG A;  5LOV A;  3KKY A;  4K8Z A;  3JAL B;  1GRJ A;  1ZX3 A;  1YZB A;  3ZHS A;  1YXB A;  4B3S O;  4PDV A;  4CS2 A;  1QLE C;  1JJ2 U;  4JF3 A;  2GUZ B;  2JDI G;  2QJ1 A;  1R1B A;  1KKD A;  3JD1 A;  2EIN B;  1KUQ A;  2ZR2 A;  2P7T C;  1N33 O;  2FYU H;  1AI5 A;  2P4K A;  4DR6 O;  3H1L H;  3OTO B;  1I0H A;  1AVM A;  1R6N A;  2Y69 B;  3ZRW B;  3KZI Z;  2HEP A;  1M93 A;  5LOV B;  4FLX A;  2W6J G;  5EC1 C;  4UVC A;  2BTQ A;  1XL6 A;  3EXA A;  1DTO A;  5B5E Z;  3M7M X;  4OGQ B;  3NR7 A;  4DV3 B;  4JI5 B;  4GCZ A;  4EEQ A;  3B09 A;  1BL8 A;  4UB8 Z;  4DK1 A;  1VQ7 V;  4GX0 A;  4MSW C;  5CBG A;  1VAR A;  3CCR V;  3AG7 A;  2KSD A;  5F2V O;  1K97 A;  2JK5 C;  2E76 B;  2LP7 A;  1WB7 A;  4TOI A;  1M90 W;  2Q5Z A;  5IJ0 A;  2BTQ B;  1F23 A;  5LMN B;  3G67 A;  4JI1 B;  2WLH A;  4J9Z B;  5KUM A;  3E2E A;  1EBO A;  3N2K A;  4WF9 V;  1QBZ A;  1S77 D;  2VQF B;  1OCC C;  1QVF U;  1H8H G;  2L6L A;  1X59 A;  4I9W A;  3Q4H A;  4HBN A;  1XUQ A;  5LP6 A;  1SQQ H;  1R3I C;  2LW7 A;  4CH3 A;  1AI7 A;  3ZMS A;  4LFA B;  2JRI A;  5IJ0 B;  3WB2 A;  2Q8V A;  1BT8 A;  4I7Z B;  3N2K B;  5B1A C;  3L72 H;  1UJW B;  3ABK C;  2B1I A;  4NTY A;  3F7V C;  3BA9 A;  4JI4 B;  4NR1 A;  3E8G A;  1H2N A;  1JA8 A;  3Q4H B;  4LWS A;  1W0K G;  2CDY A;  3E8F A;  5LP6 B;  3EFF K;  3MD0 A;  2EIM B;  3SYP A;  2HFE C;  5B1N A;  4WCE V;  1V9P A;  2LO1 A;  3HKC A;  1YSC A;  3QO7 A;  4IL6 Z;  2BSK A;  3JD0 A;  4W4K A;  3ZMT A;  5LMU B;  4K3A A;  5KHK A;  5KA5 A;  4LFC O;  4DO2 A;  4ZIB A;  2ZDI A;  5KAF Z;  2Q7G A;  5J2U A;  3RGB A;  3S3W A;  2DOS A;  2X6C A;  5ITZ A;  2DWD C;  2UXC O;  4LWS B;  1IDS A;  3ZCC A;  3ZRS A;  4DUZ B;  3T1H B;  2ITD C;  4QPK A;  3HKC B;  5EYP A;  3APO A;  1AJN A;  1HDJ A;  4LNU A;  5AG2 A;  1ENV A;  4J7J A;  2WLL A;  2QM4 A;  4NVP A;  4U7O A;  3DTU B;  5HFL A;  3JAR A;  5J2U B;  4IHJ A;  4OXS A;  4PA9 A;  2UXB B;  1SQB H;  5ITZ B;  4JI2 O;  2UU9 B;  3FB6 C;  2Y4T A;  1NTM H;  4H0L B;  3SPG A;  3JD2 A;  5GON A;  1FFX A;  4JI7 O;  1IZ3 A;  1JPX A;  1N33 B;  2XAJ A;  5EYP B;  2RN9 A;  4LNU B;  4DR6 B;  2GTA A;  4JAV A;  1Q3E A;  1CPY A;  3LSS A;  2QR4 A;  2WLL B;  2ZE5 A;  3CEI A;  1XL4 A;  4P2Z A;  2F93 B;  1MAB G;  3JAR B;  2LGW A;  4MW3 A;  3E22 A;  4IHJ B;  1MZF A;  5KHJ A;  5B3S B;  1I5Y A;  4IGG A;  2XTA A;  1NTZ H;  4YY3 O;  2X0L A;  1KQS U;  5GON B;  2YS8 A;  2EIL C;  1FFX B;  1KKC A;  3RVZ A;  3RFR A;  5KLV H;  2YID A;  4UCR A;  1BE3 H;  2PUS A;  1I7F A;  2HJD A;  3G71 V;  2QE7 G;  1L8D A;  3DXR A;  2A9H A;  4B3R O;  2H3O A;  5LBQ A;  2PF4 E;  3E22 B;  5LYJ A;  1AP6 A;  2NN4 A;  3X2Q C;  1WPX A;  2EJR A;  1OV9 A;  3ZX6 A;  4MTO A;  4CBC A;  1COW G;  1GN2 A;  1PNM A;  2DYS C;  3K5L A;  4RQE A;  5IWA O;  2QDO A;  1FJG B;  3LSQ A;  5CBH A;  4QE7 A;  3FFQ A;  3ABU A;  3DXR B;  4MTG A;  1Q7Y W;  4UCO A;  4GZR B;  1BS3 A;  4G2K A;  5LYJ B;  3O65 A;  1NBM G;  1XHZ A;  4YIP A;  2YXY A;  3ASO B;  4K0K O;  3AG1 C;  4O4I A;  1OCR B;  3HKD A;  2D2C B;  3ETG A;  2BE3 A;  4DR7 O;  2Z0A A;  3TCU A;  2CUG A;  3FKS G;  3OUS A;  1SQG A;  3I56 V;  3ZBH A;  3O9O A;  1WAZ A;  2OT5 A;  1HW7 A;  2PI4 A;  5IJ9 A;  4BW9 A;  5L3E A;  3SPC A;  3K5N A;  3SYC A;  4R8C A;  3MAQ A;  5BXZ A;  1QNM A;  4O4I B;  1YIT V;  2UXC B;  1FKA O;  1Z5V A;  2QKS A;  3HKD B;  4X88 A;  4JV5 O;  1RPR A;  3RYF A;  4I4T A;  5DM6 V;  5GW7 A;  2ZM6 O;  3ZED A;  4N21 A;  3L74 H;  1MZE A;  2ITC C;  3R65 A;  1YEW A;  1SC5 B;  4MTF A;  3SJQ C;  1S3J A;  3VQW A;  2P06 A;  2HVJ C;  4YXW G;  4GX5 A;  1GH6 A;  5IJ9 B;  3ABL C;  3JAM N;  2A3Q A;  3CRQ A;  5E79 Z;  2ZIN A;  3FB5 C;  1CP9 A;  4H13 B;  4MS2 A;  1OCO B;  1XMQ O;  2UXX A;  1YDX A;  4BW5 A;  2Q69 A;  1NR1 A;  4JI7 B;  4KL1 A;  3RYF B;  4I4T B;  1RM1 C;  1QLE B;  2F43 G;  1Y66 A;  4ZKI A;  4MVZ A;  4CH4 A;  1LR1 A;  2FTK A;  4H37 A;  3GWK C;  4UCT A;  1MSD A;  1FFT B;  2YIA A;  4RUE A;  2WLJ A;  1VF6 A;  1GMG A;  4JYA O;  4LF9 O;  1AI6 A;  4BR6 A;  5BY1 A;  3CCE V;  4JI3 B;  1BGY H;  4EB6 A;  4NYK A;  1XDC A;  2P67 A;  3QG5 A;  1M9N A;  1ARO P;  1Q8I A;  2ZQM A;  4L8J A;  5CBF A;  3RYH A;  1YTF B;  1QLN A;  3UM7 A;  5JJN B;  1KBH A;  4Q20 A;  1V54 B;  1M1K W;  1IBM O;  1R6K A;  1V55 C;  2OIG A;  5H6R A;  5IYZ A;  1Y67 A;  2DN9 A;  4AHC A;  1PNL A;  2OCC B;  4X8A A;  3FYI B;  3E89 A;  1K9M W;  4C7U A;  5JVD A;  4CH5 A;  5FLX N;  3CE2 A;  4BIZ A;  5CA3 A;  3AG3 B;  3D3Q A;  1HWY A;  2BOC C;  4EB6 B;  1SER A;  3I5D A;  3D36 C;  3CCM V;  4DV5 O;  3RYH B;  1MMM A;  3S3X A;  1AJP A;  3A0H Z;  1S76 D;  4U7N A;  1OCC B;  1PPJ H;  1N0J A;  3A0B Z;  3ABT A;  1IXB A;  1NQT A;  4HAM A;  1K34 A;  2YI8 A;  5IYZ B;  4UCU A;  3AK3 A;  4ZOL A;  3SJC C;  3D3I A;  2RNB A;  1YIJ V;  1BHA A;  5L3D A;  5JVD B;  4XDK A;  4QJF B;  4LC1 A;  3ML0 A;  2IJI A;  1J5E B;  2WAM A;  5K1P A;  1XOU A;  5L3C A;  4I55 A;  2ZIO A;  3GVM A;  3ABK B;  1AJQ A;  1IBK B;  1SZX A;  1QHT A;  1K73 W;  3T1C A;  4UCS A;  3PN1 A;  1ZWI C;  5LGU A;  4DV0 B;  1XIL A;  1XNQ O;  1NKD A;  3U0Z A;  2LGQ A;  1PNK A;  4UXN A;  1JFF A;  1Q81 W;  4ZOL B;  4UV9 A;  3TGU H;  4F4L A;  5KHH A;  3ZHU A;  3QNE A;  2UUC O;  4MVS A;  3WU2 Z;  2VQE B;  4FK5 C;  3C90 A;  4JV5 B;  2XAQ A;  3CCJ V;  2Y48 A;  1MOF A;  4I55 B;  1N32 B;  4O4J A;  4MT8 A;  2ZM6 B;  4J10 A;  3IJ4 A;  4UV8 A;  1KD1 W;  1FXV A;  1SQF A;  2DQ3 A;  3I55 V;  4XDL A;  1Q6U A;  3D8C A;  1JFF B;  4E4E A;  2QWQ B;  2AHZ A;  1K92 A;  2UXD O;  2LQT A;  2WSS G;  4DV7 O;  1SET A;  4FLV A;  2B1G A;  2X6B A;  4FLZ A;  4OX9 O;  2JJ1 G;  3JYC A;  1H2M A;  1WJZ A;  4EKW A;  3BEH A;  3ASN C;  3KCY A;  2ZNI A;  2P4V A;  3K06 A;  2W0F C;  3GWO A;  4JYB A;  4LH6 A;  4O4J B;  4DRX A;  4JYC A;  2QM7 A;  3BPZ A;  2DQ0 A;  1TVK A;  4JAA A;  2R9R B;  3K57 A;  3DC6 A;  4MTX A;  1OJH A;  5A9G A;  5CN0 A;  5GTI Z;  4UVA A;  1PV0 A;  4FFB A;  1R3J C;  3UQ8 A;  4LF9 B;  3W7W A;  1WP8 A;  2XOK G;  3SYO A;  1YJW V;  1S72 V;  4FM2 A;  4BIO A;  2DW4 A;  1VQM V;  1FXK A;  1FYJ A;  4DRX B;  2EZO A;  4IT5 A;  3UO2 A;  2XAF A;  2O57 A;  4AQY O;  2F4V B;  1TVK B;  1B04 A;  3E8H A;  2KQX A;  1ZUQ A;  2YSU B;  4MVQ A;  5LL6 Y;  2EIL B;  1Z5W A;  3OT7 A;  4U3J A;  1GO3 F;  1K33 A;  4J80 A;  3OGI B;  1H8E G;  2WA3 A;  4FFB B;  2VRZ A;  1XQ8 A;  3K5O A;  5DEC A;  3ZN0 A;  3MDS A;  1VQK V;  1VQL V;  1JX9 A;  4YJ2 A;  4RAI A;  2HHH O;  1FXK B;  1HNX O;  1GK9 A;  3ZHQ A;  3X2Q B;  3SYA A;  2KG7 A;  1B6Q A;  2K9P A;  1GAX A;  2RCV A;  2Q0A A;  3LSU A;  3JD3 A;  3HPL C;  2ARH A;  2DYS B;  3BY6 A;  4U3J B;  2FL4 A;  2JGD A;  1EN5 A;  4WFF A;  2DYR C;  2GDS A;  4NXM O;  1L0L H;  3A8T A;  2ZXW C;  1CXZ B;  2PY5 A;  3IAY A;  2IU3 A;  4YJ2 B;  1UPG A;  4DR3 O;  5GTH Z;  5B66 Z;  1NT2 B;  1QCE A;  3K04 A;  2KG7 B;  2EBO A;  3CX5 F;  4DR1 O;  2PZS A;  2A79 B;  3AG1 B;  2XHB A;  4CH6 A;  1W2B U;  2CTP A;  3W7U A;  4DR2 B;  4E2L A;  4BWA A;  2JGD B;  1TUB A;  1YJ9 V;  1SA0 A;  1XHX A;  2HKO A;  3H1H H;  1Q6I A;  2UUC B;  4LFB O;  3J81 N;  3G6E V;  4UFZ A;  3FX7 A;  1M57 C;  2IH3 C;  3CC2 V;  1F4N A;  1ORQ C;  5B1B C;  3OMA B;  5D5Q A;  1Q6H A;  2RMK B;  5BMV A;  3P30 A;  4R7C A;  1KEC A;  3HKE A;  3W7X A;  4KFM A;  4B3M O;  4QE9 A;  1D5A A;  4DUY O;  1J95 A;  1TUB B;  4P30 A;  1SA0 B;  5TIS Z;  4I9Q A;  3OUF A;  1ROP A;  5JCO C;  4B3S B;  4J11 A;  2RDC A;  2D3O W;  5KA6 A;  1K8A W;  4EFB A;  3DSQ A;  1L0N H;  4UB6 Z;  1W0J G;  1N4C A;  2AGA A;  3ABL B;  1N8R W;  3OR7 C;  4I0X A;  5C8Y A;  4DR5 O;  4LF7 O;  3E8B A;  2JVD A;  5BMV B;  3HKE B;  1VP7 A;  1VMG A;  5IY5 C;  3OE7 G;  2EIN C;  5IT9 N;  1N0N A;  3PJS K;  5DN6 G;  1E1R G;  4AIL C;  2UXN A;  1RM1 B;  1HNW O;  2Q0O C;  3MHH C;  1PL0 A;  2JEX A;  2P90 A;  2R9I A;  3CC7 V;  3WG7 B;  1HNZ O;  4I0X B;  5H9C A;  1G6U A;  1SKV A;  1K4C C;  5C8Y B;  4FZ1 A;  1F7Y A;  3LDE A;  2IH1 C;  1FS0 G;  5J9P C;  4O2B A;  1N34 O;  2GTS A;  4TQF A;  2ZR3 A;  4H33 A;  4AQY B;  4J9Y B;  4G27 B;  1FD9 A;  1Z2G A;  1BZK A;  4IYI A;  1QQC A;  2EIJ C;  5DED A;  4PHZ A;  2A0L A;  3LNN A;  4OPH A;  5EBM C;  5IDJ A;  1K3E A;  3D36 A;  3T1Y O;  3IC7 A;  4DW0 A;  3JAT A;  4P9P A;  2IJJ A;  1NI8 A;  3STL C;  2YIB A;  5FPO A;  1PD3 A;  1MG1 A;  1TA8 A;  2P6J A;  3JAW A;  4JI6 O;  5JH7 A;  1S5H C;  3JD4 A;  1K7D A;  1V55 B;  2HHH B;  4O4L A;  4B3T O;  4O2B B;  3IC9 A;  3MHS C;  3SPH A;  3B8M A;  2WLK A;  5LA6 A;  1IUR A;  4X64 O;  3N2G A;  2OYQ A;  4QGP A;  3CXC U;  3B4S A;  1VIB A;  2CAZ C;  1HR0 O;  4FM0 A;  3FB7 C;  3BA8 A;  3QO5 A;  1K5Q A;  4LR3 A;  2ZCE A;  1S5L Z;  4B08 A;  3B77 A;  5EC2 C;  1YF2 A;  5KAI Z;  3JAT B;  2K1E A;  4NXM B;  4GX1 A;  2LW1 A;  2QWN B;  3L71 H;  3JAW B;  1P4R A;  1U97 A;  5JH7 B;  4MVU A;  3OW2 U;  4PA4 A;  4DR3 B;  3CB2 A;  4PD4 F;  4JI0 O;  2XAG A;  4O4L B;  4XDJ A;  3VBB A;  4X62 O;  2AZ0 A;  2Q67 A;  1GN3 A;  1S0V A;  5JJJ B;  5LA6 B;  4YJ3 A;  3N2G B;  3BRC A;  2PYL A;  5FPR A;  3H1I H;  3E86 A;  1URF A;  3G4S V;  4JTD B;  1HP8 A;  2P5O A;  2IU0 A;  4LFC B;  5CMU A;  3OMN B;  2ETN A;  1E79 G;  2WLM A;  2XAS A;  3GB7 C;  5L3F A;  2Q9L A;  4LFB B;  2EX3 A;  2IBZ H;  2L35 A;  3TK1 A;  1NH2 D;  3ZMV A;  4X1K A;  5LXT A;  2WLN A;  2PYJ A;  4FM1 A;  1B06 A;  3A2F A;  2GHY A;  2V7Q G;  4H44 B;  2RQ6 A;  3W7S A;  4PA6 A;  3OAA G;  4YJ3 B;  2OTL V;  1OHH G;  4B3M B;  2B5U A;  3ZRV A;  5EBW C;  1KC8 W;  4RUF A;  2JS3 A;  4B7E A;  5IE9 A;  4QPJ A;  2OWO A;  5H5N A;  4HNA A;  2YEV A;  1F51 A;  3TXS A;  2ZD9 A;  4X1K B;  4BIU A;  5LXT B;  4PI0 A;  3RYC A;  2NLJ C;  4JZ2 A;  2PTM A;  3K0D A;  4JI2 B;  4DR4 O;  1GN6 A;  4DR5 B;  1SQX H;  2Q68 A;  4LF7 B;  3CD6 V;  3B8N A;  1DK1 A;  2IW5 A;  4TSF G;  2QWO B;  3M99 B;  4FPP A;  4TV8 A;  3RN4 A;  3CHX A;  5E1A C;  2V1D A;  3K0G A;  4JAS A;  5JJE B;  4IIJ A;  1EM1 A;  2R70 A;  2VWJ A;  4HNA B;  2YEV B;  4WFA V;  1WB8 A;  4FMT A;  3CRM A;  3L9D A;  3ZMU A;  1H2K A;  3OMI B;  3VQX A;  1HNZ B;  3RYC B;  2M7W A;  4YY3 B;  4Q6G A;  3OTO O;  1FAF A;  4X66 O;  1VQ6 V;  3AG2 C;  2Q6A A;  1P7G A;  1M56 C;  2X7R B;  1YI2 V;  2YC0 A;  4LP8 A;  4TV8 B;  3J80 N;  1PL4 A;  4IIJ B;  4J42 A;  4FLW A;  3CRR A;  1NS1 A;  1L1F A;  4LF6 O;  3SPI A;  3SPJ A;  1VQ9 V;  4B3R B;  4L87 A;  3T1Y B;  3SYQ A;  3L73 H;  4XBF A;  3P3N A;  4ZI7 A;  4JTC B;  2G38 A;  4LF4 O;  4W4L A;  4B3T B;  1Y6X A;  1Y76 A;  4MVR A;  1XBL A;  5IWA B;  4X64 B;  2V4D A;  1Q5O A;  5EIB D;  1H2L A;  1LUV A;  4PDL A;  3T4D A;  3ABM C;  1BCC H;  1JQ0 A;  2VQF O;  1VQO V;  4GKJ O;  4DW1 A;  1N36 O;  3JAK A;  1VEW A;  3K3W A;  1R6T A;  2QA4 V;  3CC4 V;  3OR6 C;  5EBL C;  3ZHR A;  4ZI7 B;  4K0K B;  4G28 B;  2YIC A;  2A06 H;  2YDE A;  2YXL A;  1Y76 B;  4J41 A;  2EZP A;  4UCV A;  4DR7 B;  1VQP V;  3TXQ A;  1NR7 A;  4LF8 O;  2DE0 X;  5B1A B;  1OCR C;  4O2A A;  3RYI A;  2ZXW B;  4NXN O;  3FB8 C;  4FJC C;  2WA4 A;  3AG4 C;  5BZB A;  3SJB C;  2CH7 A;  1D5N A;  1VQ5 V;  2NR5 A;  2ZKO A;  3JAK B;  5IYD O;  1BSM A;  1RFY A;  4UVB A;  4MW8 A;  1YCI A;  2KB1 A;  1PM9 A;  2JEU A;  1R73 A;  2EIK C;  5KHI A;  4QNH B;  1W59 A;  2CE4 A;  2M6Y A;  4X65 O;  4DV6 O;  3K5M A;  1Y74 A;  2IJH A;  2X6A A;  3CCQ V;  5LMU O;  5JCO A;  1P84 F;  4O2A B;  4A5U B;  3RYI B;  4DV1 O;  5JWP A;  4PI2 A;  2Q4P A;  4DYL A;  3CS5 A;  3W7T A;  2UUB O;  1QU7 A;  2CH7 B;  5B1B B;  3RBZ A;  5KHG A;  5EIB C;  3CCS V;  4TV9 A;  3K58 A;  2DJV A;  1M4U A;  1OCZ C;  5LGN A;  1XMQ B;  1G8M A;  3FAV A;  3SR2 C;  1Y74 B;  4J7K A;  2BOB C;  2VWK A;  1GM9 A;  3JAS A;  2MW2 B;  4KHP O;  4ZBM A;  4P9O A;  3OEH G;  1Q43 A;  4PA3 A;  2FML A;  4GKK O;  2UXB O;  4MVO A;  3F5W C;  2UU9 O;  4TV9 B;  1KB9 F;  1SQV H;  5IY5 B;  3ZIA G;  1NTK H;  1BQ0 A;  4PEL A;  3C3T A;  3UT5 A;  4JYA B;  3G6B A;  3FAV B;  2F66 C;  1TAE A;  1XEQ A;  4X66 B;  5J2T A;  4FLT A;  1NVP D;  3JAS B;  1QVG U;  5H6Q A;  2BCC H;  4NB5 A;  4NTW A;  1T5E A;  3BAB A;  2JS5 A;  1G1X B;  2HR3 A;  4OPA A;  3ZN1 A;  4LF6 B;  1JOY A;  4FVM A;  1XNR O;  3P32 A;  1US6 A;  2N04 A;  3QTC A;  1IBM B;  4KP4 A;  4RQF A;  2AXT Z;  5FNV A;  1V54 C;  2QKA A;  4JGS A;  2EIJ B;  3FYE B;  3UT5 B;  5D5P A;  5FL7 G;  2AZ2 A;  2B9Z A;  2HP8 A;  2OCC C;  4LF4 B;  2OTJ V;  5J2T B;  1VF6 C;  3IGA C;  3VQY A;  1H2S B;  2LJ2 A;  4DV5 B;  1I94 O;  3AG3 C;  4DXW A;  1JJO A;  4WBN A;  3CWB H;  4BAY A;  1NU1 H;  1EN6 A;  4LF5 O;  1U96 A;  4GKJ B;  1N36 B;  3ETQ A;  2C2A A;  1SQP H;  5FNV B;  2GSM B;  3AEI A;  3RVY A;  3HKB A;  1SES A;  2WWW A;  1FJG O;  4N23 A;  1IVS A;  4IYH A;  3WB1 A;  4LF8 B;  4X9Q A;  2ZT9 B;  2Y4U A;  4NXN B;  3QO8 A;  3HR0 A;  2XUM A;  4WBN B;  4D6T H;  4WFE A;  2CGO A;  4Z1V A;  1ZL8 A;  1XNQ B;  3ZHT A;  3BFR A;  2UUA O;  3AK2 A;  3CXH F;  5B1O A;  4PA7 A;  2QKC A;  2OCH A;  1XMO O;  3HKB B;  2MK3 A; 
#chains in the Genus database with same CATH homology
 3LDC A;  5LHG A;  3CCE V;  3FB7 C;  3QO5 A;  1K5Q A;  2P67 A;  2Z3Y A;  1M9N A;  1ARO P;  3B77 A;  5EC2 C;  4PDV A;  2ZQM A;  5CBF A;  1QLE C;  2PI5 A;  1YTF B;  3STZ C;  3NXS A;  1JJ2 U;  2K1E A;  4TWK A;  4GX1 A;  1OZ0 A;  1QLN A;  3UM7 A;  4JF3 A;  2JJ2 G;  5L3G A;  2JDI G;  1P4R A;  4Q20 A;  1V54 B;  3ZRX A;  3ETD A;  4MVU A;  1M1K W;  1DLB A;  3OW2 U;  1KKD A;  2QTO A;  4PA4 A;  3JD1 A;  2EIN B;  1R6K A;  1V55 C;  5H6R A;  2XAG A;  2ZR2 A;  4XDJ A;  3VBB A;  1SRY A;  2P7T C;  2AHY A;  1PNL A;  1AI5 A;  5C93 A;  2OCC B;  2Q67 A;  4X8A A;  1S0V A;  3FYI B;  1R6N A;  3E89 A;  1K9M W;  2Y69 B;  3ZRW B;  3LDD A;  3E86 A;  4BIZ A;  3G4S V;  5CA3 A;  3AG3 B;  4JTD B;  2W6J G;  1HWY A;  5EC1 C;  1Q82 W;  4UVC A;  2BOC C;  1SER A;  2IU0 A;  3TET A;  1XL6 A;  1P7B A;  3CME V;  3CCM V;  3F7Y C;  1DTO A;  5CMU A;  3OMN B;  1AJP A;  1S76 D;  4U7N A;  1E79 G;  1OCC B;  2WLM A;  2XAS A;  3E83 A;  5KUK A;  3GB7 C;  2IJK A;  5L3F A;  3ABT A;  3TK1 A;  1NH2 D;  3ZMV A;  4GCZ A;  3RW0 A;  1NQT A;  1QR9 A;  4HAM A;  2WLN A;  1BL8 A;  2HVK C;  1K34 A;  1VQ7 V;  1BMF G;  1EZJ A;  4GX0 A;  2GHY A;  2V7Q G;  4MSW C;  5CBG A;  3UKM A;  3W7S A;  4PA6 A;  3CCR V;  3OAA G;  3K9A A;  3D3I A;  1F4M A;  3JCZ A;  2NNU A;  4KUM A;  3T4Z A;  1YIJ V;  2OTL V;  1K97 A;  1BHA A;  5L3D A;  2JK5 C;  2Z5U A;  3VOU A;  2Y69 C;  1OHH G;  2LP7 A;  2B5U A;  4XDK A;  3ZRV A;  4QJF B;  4LC1 A;  1M90 W;  3KG2 A;  3ML0 A;  2IJI A;  3OM3 B;  5EBW C;  4WFH A;  1BHB A;  1KC8 W;  4RUF A;  1F23 A;  5LHH A;  2WAM A;  4QPJ A;  2WLH A;  4J9Z B;  5KUM A;  5L3C A;  3E2E A;  1EBO A;  4Z1M G;  1H38 A;  4WF9 V;  1K5S A;  1QBZ A;  1Y4M A;  1S77 D;  3ABK B;  1AJQ A;  2QEX V;  2YEV A;  1OCC C;  1QVF U;  1F51 A;  1H8H G;  1K73 W;  4CZZ A;  3T1C A;  4GT1 A;  2ZD9 A;  4I9W A;  1ZWI C;  4BIU A;  4HYO A;  1RPO A;  5LGU A;  2NLJ C;  3K0D A;  1NKD A;  1PNK A;  2Q68 A;  4LBE C;  3CD6 V;  3AG2 B;  1SZT A;  2IW5 A;  3B8N A;  4TSF G;  4UXN A;  1Q81 W;  2JIZ G;  1NH2 B;  3K79 A;  4UV9 A;  1R3L C;  3CYO A;  1M56 B;  1R3I C;  3K08 A;  4F4L A;  1AI4 A;  3QNE A;  5IYC O;  3M99 B;  1AI7 A;  4FPP A;  3ZMS A;  4MVS A;  1VQN V;  5E1A C;  2V1D A;  3K0G A;  4JAS A;  1VQ4 V;  4FK5 C;  1IXM A;  2XAQ A;  3CCJ V;  2Y48 A;  1MOF A;  5B1A C;  4MT8 A;  1LNQ A;  1UJW B;  3ABK C;  2B1I A;  2YEV B;  3F7V C;  4WFA V;  1MSW D;  4FMT A;  3E8G A;  4UV8 A;  3ZMU A;  3OMI B;  1KD1 W;  4I5S A;  1FXV A;  1FXK C;  1W0K G;  2M7W A;  1GKF A;  2DQ3 A;  3E8F A;  4XDL A;  3I55 V;  3EFF K;  3MD0 A;  1VQ6 V;  2EIM B;  3AG2 C;  2HFE C;  5B1N A;  3SYP A;  2Q6A A;  4WCE V;  1YSC A;  1M56 C;  2AHZ A;  2ATK C;  2X7R B;  1YI2 V;  1K92 A;  3QO7 A;  5EK0 A;  4LP8 A;  2HJF C;  2WSS G;  3JD0 A;  1WLE A;  1R3K C;  1SET A;  3ZMT A;  2B1G A;  2X6B A;  5KA5 A;  2JJ1 G;  3CCL V;  3JYC A;  4DO2 A;  1L1F A;  4EKW A;  3SPI A;  2ZDI A;  3BEH A;  3ABM B;  3ASN C;  1VQ8 V;  3SPJ A;  3K06 A;  1VQ9 V;  2W0F C;  3GWO A;  4JYB A;  1JVM A;  4L87 A;  4JYC A;  3SYQ A;  2QM7 A;  2DQ0 A;  1YHQ V;  2X6C A;  3T2M A;  4XBF A;  1NJI W;  2R9R B;  2DWD C;  2LFS A;  1PKX A;  3ZJZ A;  4MTX A;  1K4D C;  4JTC B;  3ZCC A;  1YJN V;  3ZRS A;  5CN0 A;  2EIM C;  2ITD C;  4QPK A;  1KP3 A;  3CP1 A;  1AJN A;  4UVA A;  3K03 A;  4MVR A;  1ENV A;  1R3J C;  4UUJ C;  2WLL A;  3W7W A;  2XOK G;  2LFR A;  4TT3 G;  3SYO A;  3LNM B;  1YJW V;  1S72 V;  3AG4 B;  2DW4 A;  4U7O A;  3DTU B;  5HFL A;  1VQM V;  4PDL A;  3T4D A;  3ABM C;  1JQ0 A;  1FXK A;  1VQO V;  2EZO A;  3LUT B;  4OXS A;  2XAF A;  3K3W A;  4PA9 A;  2QA4 V;  2EIK B;  3CC4 V;  3E8H A;  3FB6 C;  3OR6 C;  5EBL C;  3SPG A;  2YSU B;  4MVQ A;  3JD2 A;  2EIL B;  4G28 B;  1FXH A;  1KP2 A;  1GO3 F;  1K33 A;  1JPX A;  2XAJ A;  3OGC C;  1H8E G;  2EZP A;  1VQP V;  1AR1 B;  1NR7 A;  4JAV A;  1GM7 A;  1OCR C;  3A0R A;  5B1A B;  1CPY A;  2HLD G;  2ZXW B;  3LSS A;  5IYB O;  3ZN0 A;  2WLL B;  1QR8 A;  1XL4 A;  1VQK V;  4P2Z A;  1VQL V;  3FB8 C;  4FJC C;  1JX9 A;  2W6I G;  3DGE A;  3AG4 C;  1MAB G;  4RAI A;  2ZDI C;  5BZB A;  1FXK B;  3H01 A;  4MW3 A;  1VQ5 V;  1GK9 A;  5B3S B;  1I5Y A;  5IYD O;  4UVB A;  4MW8 A;  3SYA A;  3X2Q B;  3E35 A;  2KB1 A;  1B6Q A;  2JEU A;  2WLI A;  1R73 A;  2EIK C;  1KQS U;  2X0L A;  1OCZ B;  3JD3 A;  4WFG A;  2EIL C;  3HPL C;  2DYS B;  3BY6 A;  3RVZ A;  4QNH B;  3ASN B;  4WFF A;  2IJH A;  2X6A A;  3CCQ V;  2DYR C;  2QM8 A;  4HZ3 A;  4RO2 A;  3G71 V;  2QE7 G;  2ZXW C;  2IU3 A;  2A9H A;  3W7T A;  5LBQ A;  5B1B B;  3RBZ A;  1QCE A;  3K04 A;  4ASU G;  3CCU V;  5B3S C;  3CCS V;  3X2Q C;  1DF4 A;  1WPX A;  2EJR A;  2EBO A;  2WLI B;  5LGT A;  2A79 B;  3OFN G;  3WG7 C;  4MTO A;  3AG1 B;  4R6Z A;  4CBC A;  4WFB V;  1W2B U;  1OCZ C;  3W7U A;  1COW G;  5LGN A;  1PNM A;  2DYS C;  3OEE G;  4E2L A;  1G8M A;  4RQE A;  1YJ9 V;  2BOB C;  3LSQ A;  1GM9 A;  2HKO A;  3ZMZ A;  5CBH A;  4QE7 A;  3ABU A;  4ZBM A;  4P9O A;  4MTG A;  3G6E V;  3OEH G;  1Q7Y W;  1M57 C;  2IH3 C;  3CC2 V;  1F4N A;  4PA3 A;  1ORQ C;  4MVM A;  5B1B C;  4G2K A;  3OMA B;  1NBM G;  4PDM A;  1JCH A;  4MVO A;  3F5W C;  3P30 A;  4R7C A;  3ASO B;  1KEC A;  3W7X A;  3CCV V;  4KFM A;  1DF5 A;  5IY5 B;  3ZIA G;  3AG1 C;  4QE9 A;  1OCR B;  4PEL A;  5HFM A;  2DWE C;  3ETG A;  3CMA V;  3TCU A;  3EHB B;  1J95 A;  2CK3 G;  3FKS G;  4P30 A;  3OUS A;  3CPW U;  1G4Y B;  3I56 V;  1NVP D;  5H6Q A;  3OUF A;  1ROP A;  1QVG U;  3HB3 B;  2XND G;  2D3O W;  5KA6 A;  1THZ A;  2OT5 A;  1K8A W;  4JAU A;  2HR3 A;  1W0J G;  3ZN1 A;  3ABL B;  1N8R W;  3OR7 C;  2PI4 A;  5L3E A;  1JOY A;  3E8B A;  3SPC A;  4FIP C;  3P32 A;  3SYC A;  4KP4 A;  4RQF A;  3ASO C;  4R8C A;  1V54 C;  2DYR B;  4X89 A;  1YIT V;  5IY5 C;  3OE7 G;  4JGS A;  2EIN C;  2EIJ B;  2QKS A;  3FYE B;  3IFX A;  4X88 A;  1I5X A;  3PJS K;  5FL7 G;  5DN6 G;  2OCC C;  1RPR A;  2OTJ V;  1E1R G;  4PDR A;  2UXN A;  1RM1 B;  3IGA C;  5DM6 V;  5GW7 A;  3MHH C;  2H94 A;  1PL0 A;  2XAH A;  1H2G A;  4N21 A;  2ITC C;  3R65 A;  2JEX A;  3AG3 C;  4MTF A;  4DXW A;  3SJQ C;  1S3J A;  2P90 A;  3WFV A;  2R9I A;  1NVP B;  3CC7 V;  3WG7 B;  2HVJ C;  4YXW G;  4GX5 A;  5H9C A;  3ABL C;  4BAY A;  1K4C C;  4GX2 A;  3LDE A;  2IH1 C;  1FS0 G;  5J9P C;  2C2A A;  3FB5 C;  2ZR3 A;  4H33 A;  1CP9 A;  2GSM B;  5L3B A;  4JTA B;  1EFR G;  4J9Y B;  4G27 B;  4QIW F;  3AEI A;  4MS2 A;  1OCO B;  3RVY A;  1SES A;  2HG5 C;  2WWW A;  2EIJ C;  2UXX A;  2WPD G;  3ETE A;  1YTF D;  2A0L A;  4BW5 A;  4N23 A;  2Q69 A;  1NR1 A;  1M57 B;  2H8P C;  5EBM C;  5IDJ A;  1K3E A;  5LHI A;  3D36 A;  1RM1 C;  4LCU C;  1QLE B;  1TUE B;  2F43 G;  3IC7 A;  4P9P A;  2IJJ A;  1Y66 A;  4ZKI A;  1CEZ A;  4MVZ A;  3STL C;  1GM8 A;  1PD3 A;  3QO8 A;  1MG1 A;  2P6J A;  2FTK A;  1S5H C;  3JD4 A;  1K7D A;  4H37 A;  4JPR A;  1V55 B;  1E1Q G;  4WFE A;  1Q86 W;  1FFT B;  3MHS C;  1GTO A;  4R50 A;  3SPH A;  4RUE A;  2WLJ A;  3B8M A;  5B1O A;  2WLK A;  4PA7 A;  1GMG A;  3ZRW A;  3CXC U;  1OCO C;  1AI6 A;  2MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...