3OW2U

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ow2U00
1YJNV 1YI2V 1KQSU 5DM6V 1VQPV 1Q82W 1VQ9V 1N8RW 3G4SV 1VQOV 1S72V 1M1KW 1Q7YW 1VQMV 1YJ9V 1M90W 1VQ8V 1VQ6V 1KC8W 3CXCU 1W2BU 3CCQV 1JJ2U 3CMAV 3CMEV 1YHQV 1Q86W 3CD6V 1VQ4V 1VQKV 3I56V 3CC7V 3OW2U 3CPWU 4WFBV 3CCJV 2OTJV 1K73W 3CCVV 1VQ5V 1R73A 2OTLV 2QA4V 3CCUV 1VQNV 4WFAV 1VQLV 3CCMV 4WCEV 1K9MW 2D3OW 1NJIW 3CCLV 3CCEV 2QEXV 1YJWV 3CC2V 1VQ7V 1QVGU 4WF9V 3CCRV 3CC4V 3G71V 1YITV 1Q81W 3G6EV 1K8AW 1KD1W 1QVFU 1YIJV 3I55V 3CCSV
chains in the Genus database with same CATH superfamily
2CTRA 3AG7A 3BAAA 5LHIA 2BTQA 1NTZH 2B9ZA 1S3JA 4R8CA 2JGDB 3CB2A 4B7EA 3SYAA 1UPGA 3E22A 2EULA 4YXWG 2RDCA 4LF5B 5LMNB 5L3FA 2BOBC 1GM7A 4CC6A 1JVMA 4UCUA 1VF5B 3QTCA 4JI1O 5HFMA 4I4TA 4UXNA 5B1BB 5FLXN 2QJ1A 3ZS8C 4DV6B 4OPAA 2YSUB 2NR5A 3PJSK 2JGUA 1Q5OA 1DGSA 5A2QN 3SYQA 3DC5A 1UJWB 1S5JA 5L3DA 1HR0B 4KUMA 1BQZA 1XL6A 1NBMG 2HJDA 4DV7B 2VQEB 1URFA 4DXWA 4U3JB 3G71V 5BMVB 3NR7A 4U3FH 2Y69B 2HHHB 3FB6C 4P9OA 1JFFB 4PA7A 4JYAO 1FS0G 5GTIZ 1LNQA 1NVPB 2H8PC 4LBEC 4PJ0Z 4WBNB 1N32B 2UXBO 4KHPO 4JI5O 4OX9B 1SQPH 3RYFA 1H38A 1QLEC 3JATB 4XDJA 1M93A 4W4KA 1QU7A 4H13B 3QO5A 2Z0AA 1S0VA 3T4ZA 2LO1A 5A9GA 1GKFA 1RSOB 3MD0A 1B3QA 3LNNA 5AG2A 4WFHA 2EZOA 3E8HA 1M57B 2XAJA 3CCEV 1PL4A 1H8EG 4X64B 1Y67A 2IBZH 2JVDA 4DV2O 1OCRB 4A5UB 4GZRB 3CMAV 1OCCC 3ABUA 3JCZA 4U7OA 1S76D 3RBZA 3CPWU 1AR1B 2Q67A 2ZE7A 5E1AC 3EVKA 3FD9A 3K03A 1BMFG 1FFXB 2UXCB 1AP5A 3UO2A 4XDLA 3JASA 4UVCA 4LF8B 4ZBMA 1P7BA 3B2EE 1R3LC 2OYQA 4DV4O 3T1CA 4FFBA 1M90W 2ZKOA 3QVNA 1QBZA 3F7VC 3SJBC 4LFBO 4NXMB 3FX7A 2F93B 1V54C 3CCMV 2CAZC 2EINB 4ZOLA 4BW9A 2DWDC 3HKEB 2ADQB 5LP6A 2F4VB 2EJ7A 3H9VA 1PNKA 2HR3A 3W7UA 2HVJC 4PDRA 2Q9LA 5KMGB 5JJNB 4D6TH 2QGNA 4TSFG 5KX5A 1Y4MA 3R65A 1RP3B 2Q69A 2Q5ZA 1AR5A 4D7SA 2K1EA 3CCRV 1L0LH 4JYYA 3JSLA 4R50A 4O4JA 1US6A 5IJ0A 3SPIA 3PN1A 4JZ2A 4I9QA 4CS4A 4YJ3A 2JK5C 2P4VA 3W7TA 4MVMA 3T1YO 4NKGB 1WLEA 3S3WA 5JCOA 1YDXA 3ZHQA 3JD1A 3CCLV 1FJGO 5D5PA 2AW9A 3ZCCA 3X2QB 3BPZA 1DF4A 1EN6A 2WLIB 3I5DA 2WAMA 1M56C 3LDCA 3D36A 2WLNA 2RNBA 4EEQA 2WLLB 3SYPA 1SZTA 5CBFA 2G38A 4GX0A 5LXTB 5LBQA 3TCUA 4LF4B 4GKJB 1GH6A 2LW1A 4LP8A 4AQYB 1KD1W 1XNQB 1CXZB 1YI2V 4JAUA 1VMGA 5B1BC 1M1KW 3EFFK 1SETA 5J9PC 1PNMA 4DR3B 2HEPA 3CMEV 2JS3A 3APOA 5IYZA 3SYOA 3K57A 2QKCA 4X1KA 3RYCA 3LNMB 3JD3A 5LA6B 1FPOA 5ITZB 1Q81W 4TV9B 2UXDB 4TUYA 1VQ9V 3FB5C 4B3MO 3ZBHA 2W0FC 5CA1A 1R6KA 1JJ2U 2Q7GA 3CC7V 3CP1A 1ZWIC 1PP9H 4GX2A 4Z1MG 3H1HH 2X7RB 4I0XB 1H2GA 3E2EA 5IJ9A 5KHIA 4JI7O 1ZAUA 3JD0A 4OPHA 1FD9A 3UCSC 4UVBA 4O4LB 4RWUA 4LF9B 4E2LA 1NKDA 1F23A 1K5QA 4LR3A 4YJ2A 1H2MA 3LDDA 2QTSA 5KA6A 4BAYA 5EIBC 4YHHO 1YZBA 4FLXA 1L1FA 1DF5A 4DR1B 2NN4A 2DW4A 1KP2A 4TQDA 1EZVH 1HNWB 5LOVA 4K3AA 5EZYA 3BFRA 1M4UA 4LF7O 4JI6O 2AHYA 3DSQA 3KKYA 2QTOA 2UU9B 1FXKA 1F4NA 1OCRC 4LF6O 1SA0B 3AG1B 4MT8A 4Z2WA 1S5HC 4H0LB 4MVQA 3NXSA 1FKAO 1PPJH 2VQFB 1XMQO 2PYJA 5EK0A 4O4IB 5FPRA 4E4EA 1HNXB 5KUMA 4X88A 3K58A 5CB4B 3OEHG 2R9RB 2GDSA 3G4SV 1ZL8B 3OMNB 4X1YA 3T2MA 2KKWA 2ZE5A 3O65A 4RUFA 1IZ3A 2F95B 2UXXA 1BS3A 2XAGA 1EBOA 3HKCB 1AJNA 1B04A 1V9PA 2HLDG 1UFIA 1P7GA 2EINC 5D5QA 5TISZ 4PDVA 2E5LB 3LUTB 5IWAO 2QWRB 4LFAO 4NTXA 1GO3F 2BTQB 1B6QA 1X4TA 4HYOA 3BA8A 1VQ4V 4PI0A 1J5EO 4JI4O 1BCCH 3ZRVA 3SYCA 1VQ5V 3E22B 4PELA 1RM1B 1MG1A 2EJRA 1BGYH 4AHCA 1YCIA 4NR1A 3N2KA 4DV0B 4AILC 2H3OA 3CRCA 4I4TB 2D2CB 1VQ8V 2R70A 1KBHA 2ZR2A 2ZD9A 2ZT9B 2BSKA 1IBKO 1R3JC 1COWG 1XOUA 3LSSA 3MAQA 4CH3A 1V55C 3ABKC 4DUZB 2Q7HA 2YXYA 5CA0A 3JSNA 3J7AU 3DXRA 4GUNA 3RT3C 2A0LA 3P3PA 1JR9A 3E86A 3M99B 2W6IG 5EBLC 3A0BZ 5EYPA 2BE3A 3H1LH 4H44B 1RPRA 2FB5A 3RYFB 1HP8A 4IHJA 2OCHA 1Q8IA 4MSWC 4DUYO 1I94O 5K1XA 3K3WA 1VQOV 3WG7B 3M8AA 4LH6A 1WPBA 3T1HB 1K7DA 4K0KO 5FPOA 2E3CA 5KAIZ 3ETEA 2Q4PA 5KAFZ 2AZ2A 2Z3YA 1Y6XA 3JD2A 2CGNA 4IIJA 3SPJA 2CH7A 2PZSA 4MTXA 2AXTZ 3CSXA 1W2BU 3C3SA 2GHYA 3THOA 4X66B 3IAYA 1VEWA 4B3TB 3IGAC 4FK5C 4AI8A 5JVDA 2Y0PA 4JI3B 2YUAA 5BR8B 1K8AW 3JASB 2LJ2A 2WPDG 1Q6IA 2ZDIC 3F5TA 2EILB 5JJEB 1FXHA 3HKBA 3L71H 3H01A 4QGPA 2W0XA 4EFEA 1XUQA 1I5YA 2VS0A 4FFBB 1N0JA 3K5LA 3CCJV 2CTQA 1E1RG 3HB3B 2EIJB 4YIPA 3K04A 1P49A 4B3SB 1K34A 2VRZA 1IX9A 1NH2B 4DV5B 4LFCO 3TXQA 4ZOLB 1SERA 1WP7A 1TVKA 3ABTA 3CEIA 1GN4A 3RVYA 2O57A 5LP6B 1Q3EA 4Q20A 1IBLB 4DW0A 5H9CA 4UB8Z 1R1BA 3WB2A 4FLUA 4HAMA 4DR7B 3ETDA 1K97A 5KX5B 3AG1C 1ROPA 2V4DA 3STZC 3JALA 4JV5O 5H2FZ 4DR5B 1N34O 3M7MX 2XTAA 3ZHVA 3FFQA 1XMOO 2VWKA 4EKWA 3ICXA 4O4JB 1MSWD 2PGGA 5IJ0B 1YXBA 4YJ3B 1AI6A 5LL6Y 2XAFA 3ABLB 5KUKA 4X62O 2IM9A 2VWJA 4FLTA 2WLKA 3CC2V 2A06H 1NT2B 4JPRA 1KKDA 5CBHA 4DV1B 2ZINA 4PI2A 2RJZA 4X20A 1YHQV 1VARA 1ZLZA 1IBMO 3S3XA 3VBBA 4BWAA 3F7YC 4J7KA 1MMMA 4W4LA 1JMKC 1RM1C 1N4CA 1QR8A 2IW5A 2YS8A 4YY3O 5KHGA 5KHKA 1PM9A 2KG7A 4ZKIA 1LUWA 4I55A 4JI1B 4GLXA 4DRXA 1AP6A 3CCUV 2GUZA 5IYZB 3B8NA 1BHBA 4BR6A 4X1KB 5CBGA 3RYIA 4LWSA 3RYCB 1W59A 2XAQA 2XASA 1FXVA 1SQBH 1JCHA 1FFTB 1YJ9V 2ILMA 1HWYA 3OR7C 4TUYB 1OV9A 1MNGA 2LP7A 3ETGA 3ZMSA 5CA1B 3MDSA 2QSAA 4JYAB 3ASNC 4Z1VA 2ZE8A 4C7UA 4FFKA 1JX9A 1N33O 4F6EA 1KECA 5IJ9B 3F5WC 2UXBB 1J95A 3SJAC 3FYEB 4X89A 4KHPB 4ABMA 2YXHA 1AILA 2UXCO 3ETQA 4JI5B 5IE9A 4JI8O 3ZHUA 1F4MA 4YJ2B 4KXRA 3WG7C 2RN9A 1AI4A 2QWNB 3AK2A 1DLBA 1WB8A 1YTFD 1ZX3A 5LOVB 1H2KA 4PHZA 5EZYB 3AEIA 3EXAA 1OCZC 2M6YA 2F4VO 2YEVA 1FXKB 2XT9A 4IYHA 4DV2B 5K1PA 1GN6A 4DV3O 1NTMH 4R6ZA 4D7TA 1Y76A 2A9HA 1E1QG 2IH3C 1HNZO 1GAXA 2DYSB 4JZGA 5LGNA 1K5SA 4J7JA 4X1YB 3OE7G 3U10A 5LHGA 4Q6GA 4DV4B 1K9MW 3G80A 1D5AA 4FLYA 5B1OA 4WF9V 1GRJA 2EIJC 2EIMB 1NR7A 4J9YB 2DJVA 4LFBB 2ATKC 3N27A 1SQFA 2P5OA 1R6NA 3CXCU 4PA3A 4FLWA 1I08A 4FVMA 1OJHA 1MZFA 2NNUA 3CYOA 3IFXA 1XREA 5H6QA 2Y48A 5KHHA 3E35A 4OGQB 4HBNA 3AG2C 5C8YA 2GSMB 1RFYA 2P6JA 3N2KB 3JAWA 2ZE6A 2N04A 2OWOA 4NTWA 2JS5A 1D5NA 3D3QA 4AQYO 1AROP 1BQ0A 2ARHA 4DR2O 2PUSA 4QJFB 1OZ0A 2BSKB 1EN5A 1ZUQA 3HKDA 2ZR3A 2CGOA 4MW3A 3ABLC 2ZXWB 3T1YB 1F51A 2LFSA 4J10A 3J81N 4X9QA 2Q8VA 4X65O 4O2AA 4MVZA 3CRRA 4PA9A 1VQ6V 1WN7A 3B4SA 4JI2O 1FJGB 1QR9A 5CA0B 1GK9A 4FPPA 5IY5B 4QE7A 3DXRB 5KA5A 3O9OA 2QDOA 4DK0A 3D36C 1Q43A 1N36O 2CE4A 1N0NA 4KP4A 2P90A 4GKKO 1F7YA 5EYPB 2EBOA 4PA4A 4IHJB 2Y69C 3B40A 2JRIA 4UCTA 4LNUA 1YEWA 5JH7A 3OEEG 2PYLA 2OIGA 2Q6AA 1YF2A 2X0LA 1GMGA 4WFFA 4GX5A 3ZMVA 2A7WA 1SQXH 1S5LZ 1TGOA 3QO7A 3ML0A 3K5OA 4IIJB 3TETA 4DR1O 1S72V 2ZM6O 2CH7B 1WNSA 1TUEB 3WFVA 1GN3A 1XNRO 2W6JG 1VF7A 2JEUA 1KUQA 3FAVA 1SQGA 1Y74A 4B3MB 3C3TA 4MVUA 1W0JG 3OTOO 1M57C 4B08A 4ZHQA 4DR4O 1NQTA 5JVDB 2H94A 4NYKA 2ZQMA 3DTUB 5IYBO 2YIAA 1VF6C 4JI7B 4UCRA 2PY5A 3HKBB 4X1IA 3ABMB 4GX1A 2P22C 3Q4HA 4FJCC 4UV9A 3KCXA 3GVMA 3K06A 2LGWA 3P32A 4YHHB 4JF3A 1KMIZ 1YJNV 4O2BA 1ZTEA 1WA8A 2R9AA 3OTFA 1TVKB 2DYRB 1JPXA 3I56V 1NVPD 5H6RA 3W7SA 2OTJV 3CCVV 3CJHA 3P3NA 3VQWA 1XBLA 2F66C 2JJ1G 2CUGA 2UUAO 2QM8A 4JI6B 4LF7B 4NB5A 2HP8A 1FXKC 4B3RO 4BIUA 3OD4A 4QPJA 4NXNO 1L8DA 1PKXA 5L3CA 4B7KA 4LF6B 2DMXA 2DQ0A 5J2TA 3JALB 1S77D 5B66Z 2FTKA 3WB0A 5LMUO 1XMQB 5EIBD 3B77A 2Q0OC 4F6RA 1QNMA 4PDMA 3OT7A 3WU2Z 2FL4A 4UVAA 4JTAB 1AI7A 5HFLA 3JAKA 3DGEA 2P4KA 4JTDB 2EIMC 2YIBD 3E89A 2YDEA 2UUCO 1R3KC 3LSUA 3ZN0A 5C93A 2X6CA 1HDJA 4X20B 1XHXA 3W7WA 5EC1C 2JDIG 5IWAB 1R6TA 3JAMN 4LFAB 5B1NA 3B8MA 4MW8A 1B06A 4LCUC 5JWPA 1SC5B 1J5EB 3CXHF 4JI4B 5F2VO 1KYOF 4EFBA 3OR6C 2LGQA 2M7WA 1BT8A 4WFEA 3X2QC 2KG7B 2B1GA 1U96A 4PV1B 2V7QG 3ZRWB 4I55B 4R7CA 3TGUH 5IDJA 4DRXB 3ZN1A 3AK3A 3G6BA 4DYLA 2X6AA 2GUZB 1WPXA 2ZIOA 4UCVA 1NTKH 4FLZA 1IBKB 3RYIB 4LWSB 4RO2A 2ZXWC 3D8CA 3L70H 5FNVA 2XOKG 1D2DA 3RYHA 1VP7A 4MVSA 3JCUZ 1A32A 3CCQV 2IJKA 2ODMA 3W7XA 2QE7G 3L72H 5H5NA 1WJZA 4DO2A 1XQ8A 3OUSA 3ZX6A 3OAAG 3H1IH 3MHHC 4BIOA 3BABA 5GONA 1MOFA 1BZKA 4J42A 3K79A 3CRMA 3VQVA 1K33A 2OCCB 2F1MA 2DOSA 2AZ0A 1I0HA 3K0GA 3N2GA 4J80A 4JI0O 2WLHA 4DUYB 2IJJA 1I94B 2ZDIA 3MHSC 3RWRD 2WLJA 4IGGA 5LYJA 4MTOA 1GN2A 1IDSA 2YIDA 5J2UA 3IC9A 1V54B 2UXNA 3FKSG 4DR6O 1QHTA 3STLC 3OMAB 2YXLA 1QCEA 2YEVB 4DW1A 4X8AA 3UQ8A 2AGAA 1JA8A 3BRCA 5BZBA 2UUBO 1LR1A 1XILA 3A0RA 4U7NA 3I55V 3QNEA 5DM6V 1VQPV 1BSMA 5FL7G 4RAIA 3BY6A 1Y76B 4FLVA 1XHZA 4RQEA 1FAFA 1KC8W 1IXMA 4JAVA 1Q6UA 3L74H 5LGTA 2XHBA 2DQ3A 2OTLV 2QA4V 1SQVH 4JTCB 3UT5A 1IXBA 3LSQA 2GTSA 1ZSPA 2ITCC 2DN9A 3G6EV 2ZCEA 5IT9N 4J11A 4L8JA 4LF5O 5LMNO 1SZXA 2L35A 2N05A 1JJOA 2CTWA 3A8TA 3E83A 1MABG 1PL0A 4HNAA 3QG5A 4CBCA 1OCOB 4LFCB 4H37A 4TWKA 4DV6O 2BOCC 2DYRC 3VQXA 1EZJA 3RN4A 2R72A 5EBWC 4PA6A 3OM3B 4ICGA 4JGSA 4N23A 4CZZA 1X59A 1Z2GA 1IURA 2GTAA 1GM9A 4I50A 4KFMA 1HR0O 1M56B 2EIKB 5L3GA 2IU0A 1G4YB 5EBMC 5C8YB 3FYIB 5EC2C 4DV7O 5GTHZ 3JAWB 2VQEO 4LH7A 2QKAA 5DEDA 2HG5C 4JV5B 1N34B 2HHHO 3U11A 1Z5VA 5IYDO 4P30A 1XMOB 2E75B 3HKDB 3HR0A 1CPYA 2Y4TA 4I5SA 1N32O 2CK3G 4P9PA 2QWQB 4EB6A 1Q90D 4X62B 1M9NA 1I7FA 4OX9O 1KU9A 3CX5F 4GCZA 4O2AB 3K0DA 3ZRWA 1E79G 2F43G 1OHHG 5GW7A 3LDEA 4YIOA 1BL8A 4ZI7A 2IH1C 3UO3A 4RQFA 3CRAA 3ZMUA 3SJQC 4TV8A 3JARA 3J80N 4FMTA 1IBMB 5E79Z 2X6BA 1SESA 4MTGA 1KB9F 3RGBA 1R3IC 1AVMA 2K9PA 4NTYA 1Y66A 1XEQA 5DN6G 1VQKV 1XI1A 2OIEA 4YY3B 3R66A 2Q7EA 3L75H 4X64O 4LNUB 5JH7B 3BCCH 4PDLA 2Q0AA 2LFRA 1M5IA 2HJFC 3KG2A 5KHJA 2PTMA 2E74B 4LF8O 1TUBA 2DE0X 2PI4A 5BXZA 1WP8A 3ZEDA 3FAVB 3H1JH 4UB6Z 2P67A 1Y74B 2MW2B 4QE9A 3CWBH 4RUEA 4NXMO 3QO8A 3G67A 2E76B 1AJPA 4ZHQB 3AK1A 2ZNJA 4CH5A 4O4HA 1TA8A 2XNDG 2B5UA 2OCCC 3A0HZ 1N33B 2JEXA 1ORQC 3GB7C 3ZHSA 2YI8A 3ZRSA 3K5MA 1LUVA 4X1IB 5B1AB 1K4CC 3AG3B 3E8FA 4P2ZA 1FYJA 5B3SB 4JI8B 3Q4HB 4CS3A 1SQQH 1HW7A 1NR1A 3CCSV 2Q73A 2P06A 2MK3A 1EM1A 4O2BB 1WA8B 2AHZA 3ZMTA 2EILC 3JYCA 4WFBV 3CE2A 3ASOB 3EHBB 3CJHB 2QEXV 5JQGA 1XL4A 1NZ6A 4KL1A 1GTOA 3T4DA 1G6UA 4JASA 1JOYA 5L3BA 5J2TB 2GV9A 4QIWF 4DV3B 5BY1A 1O9GA 2C2AA 3ZIAG 2EX3A 5LP6C 3DC6A 4GT1A 3UM7A 3HPLC 4UCOA 1HNZB 4F6RB 2QWOB 4WFGA 1RPOA 4GYCB 1JQ0A 3CC4V 2JJ2G 1H2NA 3E8GA 2F23A 4G2KA 1T5EA 2Q68A 2R9IA 2JGDA 3JAKB 4N21A 4MTFA 1EFRG 4LF4O 4GKJO 3VQYA 3TXSA 5CN0A 1H8HG 1XNQO 1V55B 1K73W 3ABKB 3SJCC 2WWWA 3K9SA 1OCOC 1PV0A 2N74A 3JD4A 4DR3O 1VQ7V 1Z5WA 4JYCA 5JCOC 1YSCA 3AG4B 4G28B 1H2LA 1NU1H 3TK1A 2EIKC 4J41A 3H1KH 3CD6V 4BW5A 3OW2U 2UXDO 4FZ0A 2PF4E 2XAHA 3U0ZA 4JYBA 1VIBA 4U3JA 5BMVA 3BA9A 5IYCO 2V1DA 2BTOA 4FIPC 1JFFA 3ZMZA 4DR2B 1Q82W 1NH2D 2GBOA 2IJHA 4CC5A 4WBNA 5FNVB 1SS3A 3RYHB 3K5NA 1MZEA 4QNHB 4UFZA 4X65B 4LF9O 1VQLV 1O9HA 4JI2B 5JJJB 1QVGU 3JATA 1EN4A 4UV8A 2YC0A 5GONB 3BHPA 1DTOA 1RSOA 1GM8A 1NS1A 1YVWA 1VQMV 4K35A 3K08A 1P84F 1N36B 4ASUG 4J7ZA 1HNWO 4GKKB 3N2GB 3TJTA 2PI5A 4IL6Z 3FB7C 4DK1A 2YIBA 1VF6A 2FKXA 2UU9O 3SPCA 3GWOA 3VOUA 4MS2A 1U97A 5LYJB 4FM2A 3OGIB 2ITDC 1PNLA 2VQFO 5J2UB 1HNXO 1FFXA 1ENVA 4TQFA 4XDKA 1KP3A 3D3IA 2ZM6B 1H2SB 4J9ZB 2HVKC 2XUMA 3SGIA 1XNRB 2WA3A 2FYUH 4CS2A 2B1IA 2A79B 1P4RA 3OTOB 2Z5UA 4ZIBA 4OXSA 2Y4UA 4DR4B 3QF7A 2E5LO 1SKVA 3IC7A 2LQTA 3HKEA 3E8BA 3AG3C 2IJIA 5B1AC 3UT5B 3IJ4A 2LW7A 1AJQA 1YITV 2HKOA 5B3SC 5KMGA 5DECA 1NI8A 1Q86W 1CP9A 1IVSA 2DYSC 4H33A 4IYIA 4DV0O 4HNAB 4PD4F 2ADPA 3GWKC 3ASOC 4JAAA 4TOIA 4XBFA 1YIJV 1YJWV 4I50B 3RW0A 2UUAB 4FM0A 1Q6HA 4B3RB 2HFEC 2QR4A 4NXNB 1WAZA 4QPKA 3ZHTA 2QWPB 3BEHA 3KCYA 4DUZO 1R73A 2BCCH 1SRYA 4FZ1A 1YTFB 3OFNG 5LMUB 2WLIA 2OT5A 3ZHRA 2NLJC 3WB1A 3A2FA 4F4LA 4NVPA 4EB6B 3P30A 2WLLA 1K4DC 5KLVH 1XDCA 5LXTA 3UKMA 4WCEV 1QLEB 4IT5A 4ZI7B 2UUCB 2JIZG 2RMKB 5B5EZ 3T1HO 1W0KG 4K8ZA 3L73H 4TV8B 3JARB 2IU3A 3ZJZA 2KQXA 3AG4C 2WLMA 4HZ3A 3ASNB 4TT3G 4I7ZB 2YICA 3K59A 5LA6A 3SPGA 2YI9A 4WFAV 5IY5C 4MVRA 4CH6A 5ITZA 1NJIW 4TV9A 4CH4A 5CMUA 1QLNA 1TAEA 3RVZA 2DWEC 4X66O 3SR2C 1OCCB 4B3TO 4BIZA 1KKCA 4UCSA 2L6LA 3SDLA 3ZRXA 4JI3O 5BR8O 4LC1A 1MSDA 3OUFA 4I0XA 2QKSA 1TUBB 1VQNV 1G1XB 4K8XA 3CRQA 1QQCA 2EZPA 4MVOA 2ZNIA 2QM7A 4O4LA 1QVFU 4G27B 2KB1A 2RQ6A 1OCZB 1N8RW 5L3EA 4K0KB 1I5XA 2WSSG 2A3QA 4B3SO 2RCVA 4O4HB 4DV5O 4UUJC 1MA1A 3APQA 2Y0IA 2WA4A 1IBLO 1AB3A 1BE3H 4JI0B 1KQSU 2KSDA 3RFRA 4DR7O 1K92A 1CEZA 1AR4A 1Q7YW 4FM1A 1AI5A 1K3EA 1SA0A 2CDYA 1L0NH 3K9AA 1SF9A 4DR5O 1DK1A 3OMIB 1WB7A 2D3OW 3C90A 2P7TC 4O4IA 3ABMC 3CHXA 3BVOA 5CB4A 2ETNA 5JQGB 4DR6B 1ZL8A 3OGCC 3KZIZ 5CA3A 2FMLA 1PD3A 3FB8C 5LHHA 4I9WA 3HKCA 2UUBB 1BHAA 4L87A 3B09A 3AG2B 3SPHA 2ZIMA 1THZA 4DV1O 3CS5A 3L9DA 1G8MA 2CTPA 2QM4A 5LGUA
chains in the Genus database with same CATH topology
5LHIA 3QO7A 3ML0A 3TETA 2MK3A 1S72V 1S3JA 4R8CA 1TUEB 3WFVA 2W6JG 2AHZA 3SYAA 2A0LA 3ZMTA 2JEUA 2EILC 3JYCA 4WFBV 4YXWG 3E86A 3ASOB 3EHBB 3M99B 5L3FA 2BOBC 2W6IG 5EBLC 2QEXV 1GM7A 4MVUA 1W0JG 1XL4A 1JVMA 1M57C 5HFMA 4UXNA 1RPRA 5B1BB 1GTOA 1NQTA 2YSUB 4MSWC 3T4DA 2H94A 3PJSK 4JASA 2ZQMA 3DTUB 3K3WA 5IYBO 1VQOV 3WG7B 5L3BA 1JOYA 4QIWF 3SYQA 2C2AA 1UJWB 3ZIAG 5L3DA 4KUMA 3ABMB 4GT1A 3HPLC 4GX1A 3UM7A 1K7DA 4FJCC 1XL6A 4UV9A 1NBMG 3K06A 4WFGA 3ETEA 1RPOA 1JQ0A 3CC4V 3G71V 2Z3YA 2JJ2G 4DXWA 3P32A 3E8GA 3JD2A 3SPJA 2Y69B 4G2KA 3FB6C 4JF3A 4P9OA 1YJNV 2Q68A 2R9IA 4MTXA 4N21A 4PA7A 1FS0G 4MTFA 1EFRG 1LNQA 1W2BU 1NVPB 2H8PC 2DYRB 5CN0A 1JPXA 1H8HG 4LBEC 3I56V 1NVPD 2GHYA 5H6RA 3W7SA 2OTJV 1V55B 1K73W 3CCVV 3ABKB 2WWWA 1OCOC 3IGAC 2JJ1G 4FK5C 2QM8A 1FXKC 3JD4A 1VQ7V 4BIUA 4QPJA 4JYCA 1H38A 1QLEC 1PKXA 5L3CA 1K8AW 2DQ0A 1YSCA 2WPDG 4XDJA 2ZDIC 1S77D 2EILB 3AG4B 1FXHA 3QO5A 4G28B 1S0VA 3H01A 3TK1A 2EIKC 3T4ZA 2FTKA 1GKFA 3MD0A 3CD6V 1I5YA 4BW5A 3B77A 4WFHA 3OW2U 2EZOA 3CCJV 3E8HA 1M57B 4PDMA 1E1RG 2XAHA 3HB3B 2EIJB 4JYBA 2XAJA 3K04A 4UVAA 5IYCO 2V1DA 3CCEV 4JTAB 1K34A 1AI7A 4FIPC 1H8EG 5HFLA 3ZMZA 1NH2B 3DGEA 1SERA 4JTDB 2EIMC 1NH2D 3ABTA 1Q82W 3RVYA 3E89A 1OCRB 2IJHA 1R3KC 4Q20A 3CMAV 1OCCC 5H9CA 3ZN0A 5C93A 3ABUA 3JCZA 4U7OA 2X6CA 1S76D 3RBZA 3CPWU 1AR1B 2Q67A 5E1AC 4HAMA 4QNHB 5EC1C 3W7WA 3K03A 3ETDA 1BMFG 2JDIG 1VQLV 1K97A 4XDLA 5B1NA 3AG1C 3B8MA 4MW8A 4UVCA 1ROPA 1QVGU 4LCUC 4ZBMA 3STZC 1P7BA 4UV8A 1R3LC 3OR6C 2M7WA 1DTOA 4WFEA 3T1CA 1GM8A 3X2QC 1VQMV 1M90W 4EKWA 3K08A 1MSWD 4ASUG 2B1GA 1QBZA 2V7QG 3ZRWB 1AI6A 3F7VC 4R7CA 2XAFA 5IDJA 3ABLB 5KUKA 2PI5A 1V54C 3ZN1A 3CCMV 3FB7C 2EINB 3CC2V 2X6AA 2WLKA 1WPXA 3SPCA 3GWOA 2DWDC 3VOUA 4RO2A 1PNKA 2HR3A 2ZXWC 4JPRA 2XOKG 4MS2A 3W7UA 2HVJC 1KKDA 4PDRA 5CBHA 4MVSA 2ITDC 3CCQV 2IJKA 1PNLA 1YHQV 3W7XA 4TSFG 2QE7G 1ENVA 1Y4MA 3R65A 3VBBA 4DO2A 2Q69A 3OUSA 4XDKA 3OAAG 1KP3A 3D3IA 3F7YC 2K1EA 3MHHC 4J9ZB 2HVKC 3CCRV 1MOFA 1RM1C 1QR8A 2IW5A 3K79A 4R50A 1K33A 3SPIA 2B1IA 2A79B 4ZKIA 2OCCB 2JK5C 3W7TA 1P4RA 4MVMA 2Z5UA 3K0GA 4OXSA 1WLEA 2WLHA 2IJJA 3JD1A 3CCUV 3IC7A 2ZDIA 3CCLV 3B8NA 1BHBA 3E8BA 3MHSC 5CBGA 3AG3C 2IJIA 5B1AC 3ZCCA 1AJQA 3X2QB 1YITV 2HKOA 2WLJA 1DF4A 5B3SC 2XAQA 2XASA 4MTOA 2WLIB 1FXVA 1JCHA 1FFTB 2WAMA 1YJ9V 1HWYA 3OR7C 1M56C 3LDCA 3D36A 1CP9A 1V54B 2LP7A 2WLNA 3ETGA 1Q86W 2UXNA 2DYSC 4H33A 3ZMSA 2WLLB 3SYPA 1SZTA 3FKSG 5CBFA 3STLC 3OMAB 4GX0A 1QCEA 2YEVB 3ASNC 4X8AA 3TCUA 5LBQA 3ASOC 1JX9A 4LP8A 5BZBA 1KD1W 1KECA 3A0RA 4XBFA 1YIJV 3F5WC 4U7NA 3I55V 1YJWV 1J95A 1YI2V 3FYEB 3QNEA 4X89A 5DM6V 3RW0A 4JAUA 5FL7G 1VQPV 4RAIA 3BY6A 1M1KW 5B1BC 4RQEA 3EFFK 1SETA 5J9PC 1PNMA 1KC8W 1IXMA 2HFEC 4JAVA 3CMEV 1F4MA 3WG7C 4QPKA 5LGTA 3BEHA 1AI4A 3SYOA 2DQ3A 1R73A 2OTLV 2QA4V 1SRYA 4JTCB 3LSQA 3LNMB 3JD3A 1YTFB 3OFNG 1DLBA 2WLIA 2OT5A 2ITCC 1Q81W 3G6EV 1YTFD 2NLJC 4F4LA 1VQ9V 3FB5C 2W0FC 3P30A 2WLLA 3AEIA 1R6KA 3E83A 1MABG 1JJ2U 1PL0A 1OCZC 1OCOB 4CBCA 3CC7V 1K4DC 3CP1A 1ZWIC 2YEVA 4GX2A 4H37A 4TWKA 2BOCC 2DYRC 4Z1MG 1FXKB 1EZJA 2X7RB 5EBWC 3UKMA 4WCEV 1QLEB 4PA6A 3OM3B 1H2GA 4JGSA 4N23A 2JIZG 4R6ZA 3E2EA 4CZZA 1GM9A 3JD0A 1W0KG 4KFMA 1M56B 2A9HA 2EIKB 1E1QG 5L3GA 4UVBA 2IU0A 2IU3A 1G4YB 2IH3C 4E2LA 5EBMC 2DYSB 1NKDA 1F23A 3FYIB 1K5QA 5EC2C 3ZJZA 3LDDA 5LGNA 5KA6A 1K5SA 3AG4C 2WLMA 4BAYA 2HG5C 4HZ3A 3ASNB 3OE7G 5LHGA 4TT3G 3SPGA 4WFAV 5IY5C 4P30A 5IYDO 1K9MW 4MVRA 1L1FA 1DF5A 1NJIW 2DW4A 1KP2A 5B1OA 5CMUA 4WF9V 1QLNA 2EIJC 2EIMB 1CPYA 3RVZA 1NR7A 4J9YB 2DWEC 4I5SA 2CK3G 2ATKC 4P9PA 1OCCB 4BIZA 1M9NA 1R6NA 2AHYA 4GCZA 3CXCU 4PA3A 3K0DA 3ZRWA 1E79G 2F43G 2QTOA 1FXKA 1F4NA 1OHHG 3ZRXA 1OCRC 2NNUA 4LC1A 5GW7A 3OUFA 3LDEA 3CYOA 1BL8A 2QKSA 3AG1B 4RQFA 2IH1C 3IFXA 4MT8A 1VQNV 1S5HC 5H6QA 2Y48A 4MVQA 2EZPA 3E35A 3NXSA 4MVOA 3ZMUA 3SJQC 2QM7A 5EK0A 4FMTA 3AG2C 5KUMA 4G27B 2KB1A 1QVFU 4X88A 2GSMB 3OEHG 2P6JA 2X6BA 2R9RB 1SESA 1OCZB 1N8RW 4MTGA 5L3EA 1I5XA 2WSSG 3G4SV 3OMNB 3T2MA 1R3IC 4RUFA 1Y66A 5DN6G 1VQKV 1AROP 3CCSV 4UUJC 2UXXA 2XAGA 1EBOA 4QJFB 1AJNA 1OZ0A 2ZR3A 4PDLA 4MW3A 2HLDG 3ABLC 2LFRA 2ZXWB 1F51A 2LFSA 2HJFC 2EINC 4PDVA 3LUTB 1KQSU 1K92A 3KG2A 1CEZA 4MVZA 4PA9A 1Q7YW 1VQ6V 1AI5A 1K3EA 1GO3F 1B6QA 1QR9A 1GK9A 4FPPA 5IY5B 4HYOA 1VQ4V 3K9AA 2PI4A 4QE7A 3ZRVA 5KA5A 3SYCA 1VQ5V 3OMIB 4PELA 1RM1B 2D3OW 1MG1A 2EJRA 2P7TC 3ABMC 2P67A 4QE9A 4KP4A 2P90A 4RUEA 2EBOA 3OGCC 4PA4A 3QO8A 5CA3A 1AJPA 1PD3A 3FB8C 5LHHA 1VQ8V 2Y69C 2XNDG 4I9WA 2B5UA 2OCCC 2ZR2A 2JEXA 2ZD9A 1ORQC 3GB7C 1BHAA 3OEEG 4L87A 2Q6AA 3ZRSA 2X0LA 3AG3B 1K4CC 1R3JC 1COWG 3E8FA 4P2ZA 1GMGA 3AG2B 5B1AB 3SPHA 4WFFA 1THZA 4GX5A 5B3SB 3LSSA 3ZMVA 1V55C 3ABKC 1G8MA 5LGUA 1NR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN V;  1YI2 V;  1KQS U;  5DM6 V;  1VQP V;  1Q82 W;  1VQ9 V;  1N8R W;  3G4S V;  1VQO V;  1S72 V;  1M1K W;  1Q7Y W;  1VQM V;  1YJ9 V;  1M90 W;  1VQ8 V;  1VQ6 V;  1KC8 W;  3CXC U;  1W2B U;  3CCQ V;  1JJ2 U;  3CMA V;  3CME V;  1YHQ V;  1Q86 W;  3CD6 V;  1VQ4 V;  1VQK V;  3I56 V;  3CC7 V;  3OW2 U;  3CPW U;  4WFB V;  3CCJ V;  2OTJ V;  1K73 W;  3CCV V;  1VQ5 V;  1R73 A;  2OTL V;  2QA4 V;  3CCU V;  1VQN V;  4WFA V;  1VQL V;  3CCM V;  4WCE V;  1K9M W;  2D3O W;  1NJI W;  3CCL V;  3CCE V;  2QEX V;  1YJW V;  3CC2 V;  1VQ7 V;  1QVG U;  4WF9 V;  3CCR V;  3CC4 V;  3G71 V;  1YIT V;  1Q81 W;  3G6E V;  1K8A W;  1KD1 W;  1QVF U;  1YIJ V;  3I55 V;  3CCS V; 
#chains in the Genus database with same CATH topology
 2CTR A;  3AG7 A;  3BAA A;  5LHI A;  2BTQ A;  1NTZ H;  2B9Z A;  1S3J A;  4R8C A;  2JGD B;  3CB2 A;  4B7E A;  3SYA A;  1UPG A;  3E22 A;  2EUL A;  4YXW G;  2RDC A;  4LF5 B;  5LMN B;  5L3F A;  2BOB C;  1GM7 A;  4CC6 A;  1JVM A;  4UCU A;  1VF5 B;  3QTC A;  4JI1 O;  5HFM A;  4I4T A;  4UXN A;  5B1B B;  5FLX N;  2QJ1 A;  3ZS8 C;  4DV6 B;  4OPA A;  2YSU B;  2NR5 A;  3PJS K;  2JGU A;  1Q5O A;  1DGS A;  5A2Q N;  3SYQ A;  3DC5 A;  1UJW B;  1S5J A;  5L3D A;  1HR0 B;  4KUM A;  1BQZ A;  1XL6 A;  1NBM G;  2HJD A;  4DV7 B;  2VQE B;  1URF A;  4DXW A;  4U3J B;  3G71 V;  5BMV B;  3NR7 A;  4U3F H;  2Y69 B;  2HHH B;  3FB6 C;  4P9O A;  1JFF B;  4PA7 A;  4JYA O;  1FS0 G;  5GTI Z;  1LNQ A;  1NVP B;  2H8P C;  4LBE C;  4PJ0 Z;  4WBN B;  1N32 B;  2UXB O;  4KHP O;  4JI5 O;  4OX9 B;  1SQP H;  3RYF A;  1H38 A;  1QLE C;  3JAT B;  4XDJ A;  1M93 A;  4W4K A;  1QU7 A;  4H13 B;  3QO5 A;  2Z0A A;  1S0V A;  3T4Z A;  2LO1 A;  5A9G A;  1GKF A;  1RSO B;  3MD0 A;  1B3Q A;  3LNN A;  5AG2 A;  4WFH A;  2EZO A;  3E8H A;  1M57 B;  2XAJ A;  3CCE V;  1PL4 A;  1H8E G;  4X64 B;  1Y67 A;  2IBZ H;  2JVD A;  4DV2 O;  1OCR B;  4A5U B;  4GZR B;  3CMA V;  1OCC C;  3ABU A;  3JCZ A;  4U7O A;  1S76 D;  3RBZ A;  3CPW U;  1AR1 B;  2Q67 A;  2ZE7 A;  5E1A C;  3EVK A;  3FD9 A;  3K03 A;  1BMF G;  1FFX B;  2UXC B;  1AP5 A;  3UO2 A;  4XDL A;  3JAS A;  4UVC A;  4LF8 B;  4ZBM A;  1P7B A;  3B2E E;  1R3L C;  2OYQ A;  4DV4 O;  3T1C A;  4FFB A;  1M90 W;  2ZKO A;  3QVN A;  1QBZ A;  3F7V C;  3SJB C;  4LFB O;  4NXM B;  3FX7 A;  2F93 B;  1V54 C;  3CCM V;  2CAZ C;  2EIN B;  4ZOL A;  4BW9 A;  2DWD C;  3HKE B;  2ADQ B;  5LP6 A;  2F4V B;  2EJ7 A;  3H9V A;  1PNK A;  2HR3 A;  3W7U A;  2HVJ C;  4PDR A;  2Q9L A;  5KMG B;  5JJN B;  4D6T H;  2QGN A;  4TSF G;  5KX5 A;  1Y4M A;  3R65 A;  1RP3 B;  2Q69 A;  2Q5Z A;  1AR5 A;  4D7S A;  2K1E A;  3CCR V;  1L0L H;  4JYY A;  3JSL A;  4R50 A;  4O4J A;  1US6 A;  5IJ0 A;  3SPI A;  3PN1 A;  4JZ2 A;  4I9Q A;  4CS4 A;  4YJ3 A;  2JK5 C;  2P4V A;  3W7T A;  4MVM A;  3T1Y O;  4NKG B;  1WLE A;  3S3W A;  5JCO A;  1YDX A;  3ZHQ A;  3JD1 A;  3CCL V;  1FJG O;  5D5P A;  2AW9 A;  3ZCC A;  3X2Q B;  3BPZ A;  1DF4 A;  1EN6 A;  2WLI B;  3I5D A;  2WAM A;  1M56 C;  3LDC A;  3D36 A;  2WLN A;  2RNB A;  4EEQ A;  2WLL B;  3SYP A;  1SZT A;  5CBF A;  2G38 A;  4GX0 A;  5LXT B;  5LBQ A;  3TCU A;  4LF4 B;  4GKJ B;  1GH6 A;  2LW1 A;  4LP8 A;  4AQY B;  1KD1 W;  1XNQ B;  1CXZ B;  1YI2 V;  4JAU A;  1VMG A;  5B1B C;  1M1K W;  3EFF K;  1SET A;  5J9P C;  1PNM A;  4DR3 B;  2HEP A;  3CME V;  2JS3 A;  3APO A;  5IYZ A;  3SYO A;  3K57 A;  2QKC A;  4X1K A;  3RYC A;  3LNM B;  3JD3 A;  5LA6 B;  1FPO A;  5ITZ B;  1Q81 W;  4TV9 B;  2UXD B;  4TUY A;  1VQ9 V;  3FB5 C;  4B3M O;  3ZBH A;  2W0F C;  5CA1 A;  1R6K A;  1JJ2 U;  2Q7G A;  3CC7 V;  3CP1 A;  1ZWI C;  1PP9 H;  4GX2 A;  4Z1M G;  3H1H H;  2X7R B;  4I0X B;  1H2G A;  3E2E A;  5IJ9 A;  5KHI A;  4JI7 O;  1ZAU A;  3JD0 A;  4OPH A;  1FD9 A;  3UCS C;  4UVB A;  4O4L B;  4RWU A;  4LF9 B;  4E2L A;  1NKD A;  1F23 A;  1K5Q A;  4LR3 A;  4YJ2 A;  1H2M A;  3LDD A;  2QTS A;  5KA6 A;  4BAY A;  5EIB C;  4YHH O;  1YZB A;  4FLX A;  1L1F A;  1DF5 A;  4DR1 B;  2NN4 A;  2DW4 A;  1KP2 A;  4TQD A;  1EZV H;  1HNW B;  5LOV A;  4K3A A;  5EZY A;  3BFR A;  1M4U A;  4LF7 O;  4JI6 O;  2AHY A;  3DSQ A;  3KKY A;  2QTO A;  2UU9 B;  1FXK A;  1F4N A;  1OCR C;  4LF6 O;  1SA0 B;  3AG1 B;  4MT8 A;  4Z2W A;  1S5H C;  4H0L B;  4MVQ A;  3NXS A;  1FKA O;  1PPJ H;  2VQF B;  1XMQ O;  2PYJ A;  5EK0 A;  4O4I B;  5FPR A;  4E4E A;  1HNX B;  5KUM A;  4X88 A;  3K58 A;  5CB4 B;  3OEH G;  2R9R B;  2GDS A;  3G4S V;  1ZL8 B;  3OMN B;  4X1Y A;  3T2M A;  2KKW A;  2ZE5 A;  3O65 A;  4RUF A;  1IZ3 A;  2F95 B;  2UXX A;  1BS3 A;  2XAG A;  1EBO A;  3HKC B;  1AJN A;  1B04 A;  1V9P A;  2HLD G;  1UFI A;  1P7G A;  2EIN C;  5D5Q A;  5TIS Z;  4PDV A;  2E5L B;  3LUT B;  5IWA O;  2QWR B;  4LFA O;  4NTX A;  1GO3 F;  2BTQ B;  1B6Q A;  1X4T A;  4HYO A;  3BA8 A;  1VQ4 V;  4PI0 A;  1J5E O;  4JI4 O;  1BCC H;  3ZRV A;  3SYC A;  1VQ5 V;  3E22 B;  4PEL A;  1RM1 B;  1MG1 A;  2EJR A;  1BGY H;  4AHC A;  1YCI A;  4NR1 A;  3N2K A;  4DV0 B;  4AIL C;  2H3O A;  3CRC A;  4I4T B;  2D2C B;  1VQ8 V;  2R70 A;  1KBH A;  2ZR2 A;  2ZD9 A;  2ZT9 B;  2BSK A;  1IBK O;  1R3J C;  1COW G;  1XOU A;  3LSS A;  3MAQ A;  4CH3 A;  1V55 C;  3ABK C;  4DUZ B;  2Q7H A;  2YXY A;  5CA0 A;  3JSN A;  3J7A U;  3DXR A;  4GUN A;  3RT3 C;  2A0L A;  3P3P A;  1JR9 A;  3E86 A;  3M99 B;  2W6I G;  5EBL C;  3A0B Z;  5EYP A;  2BE3 A;  3H1L H;  4H44 B;  1RPR A;  2FB5 A;  3RYF B;  1HP8 A;  4IHJ A;  2OCH A;  1Q8I A;  4MSW C;  4DUY O;  1I94 O;  5K1X A;  3K3W A;  1VQO V;  3WG7 B;  3M8A A;  4LH6 A;  1WPB A;  3T1H B;  1K7D A;  4K0K O;  5FPO A;  2E3C A;  5KAI Z;  3ETE A;  2Q4P A;  5KAF Z;  2AZ2 A;  2Z3Y A;  1Y6X A;  3JD2 A;  2CGN A;  4IIJ A;  3SPJ A;  2CH7 A;  2PZS A;  4MTX A;  2AXT Z;  3CSX A;  1W2B U;  3C3S A;  2GHY A;  3THO A;  4X66 B;  3IAY A;  1VEW A;  4B3T B;  3IGA C;  4FK5 C;  4AI8 A;  5JVD A;  2Y0P A;  4JI3 B;  2YUA A;  5BR8 B;  1K8A W;  3JAS B;  2LJ2 A;  2WPD G;  1Q6I A;  2ZDI C;  3F5T A;  2EIL B;  5JJE B;  1FXH A;  3HKB A;  3L71 H;  3H01 A;  4QGP A;  2W0X A;  4EFE A;  1XUQ A;  1I5Y A;  2VS0 A;  4FFB B;  1N0J A;  3K5L A;  3CCJ V;  2CTQ A;  1E1R G;  3HB3 B;  2EIJ B;  4YIP A;  3K04 A;  1P49 A;  4B3S B;  1K34 A;  2VRZ A;  1IX9 A;  1NH2 B;  4DV5 B;  4LFC O;  3TXQ A;  4ZOL B;  1SER A;  1WP7 A;  1TVK A;  3ABT A;  3CEI A;  1GN4 A;  3RVY A;  2O57 A;  5LP6 B;  1Q3E A;  4Q20 A;  1IBL B;  4DW0 A;  5H9C A;  4UB8 Z;  1R1B A;  3WB2 A;  4FLU A;  4HAM A;  4DR7 B;  3ETD A;  1K97 A;  5KX5 B;  3AG1 C;  1ROP A;  2V4D A;  3STZ C;  3JAL A;  4JV5 O;  5H2F Z;  4DR5 B;  1N34 O;  3M7M X;  2XTA A;  3ZHV A;  3FFQ A;  1XMO O;  2VWK A;  4EKW A;  3ICX A;  4O4J B;  1MSW D;  2PGG A;  5IJ0 B;  1YXB A;  4YJ3 B;  1AI6 A;  5LL6 Y;  2XAF A;  3ABL B;  5KUK A;  4X62 O;  2IM9 A;  2VWJ A;  4FLT A;  2WLK A;  3CC2 V;  2A06 H;  1NT2 B;  4JPR A;  1KKD A;  5CBH A;  4DV1 B;  2ZIN A;  4PI2 A;  2RJZ A;  4X20 A;  1YHQ V;  1VAR A;  1ZLZ A;  1IBM O;  3S3X A;  3VBB A;  4BWA A;  3F7Y C;  4J7K A;  1MMM A;  4W4L A;  1JMK C;  1RM1 C;  1N4C A;  1QR8 A;  2IW5 A;  2YS8 A;  4YY3 O;  5KHG A;  5KHK A;  1PM9 A;  2KG7 A;  4ZKI A;  1LUW A;  4I55 A;  4JI1 B;  4GLX A;  4DRX A;  1AP6 A;  3CCU V;  2GUZ A;  5IYZ B;  3B8N A;  1BHB A;  4BR6 A;  4X1K B;  5CBG A;  3RYI A;  4LWS A;  3RYC B;  1W59 A;  2XAQ A;  2XAS A;  1FXV A;  1SQB H;  1JCH A;  1FFT B;  1YJ9 V;  2ILM A;  1HWY A;  3OR7 C;  4TUY B;  1OV9 A;  1MNG A;  2LP7 A;  3ETG A;  3ZMS A;  5CA1 B;  3MDS A;  2QSA A;  4JYA B;  3ASN C;  4Z1V A;  2ZE8 A;  4C7U A;  4FFK A;  1JX9 A;  1N33 O;  4F6E A;  1KEC A;  5IJ9 B;  3F5W C;  2UXB B;  1J95 A;  3SJA C;  3FYE B;  4X89 A;  4KHP B;  4ABM A;  2YXH A;  1AIL A;  2UXC O;  3ETQ A;  4JI5 B;  5IE9 A;  4JI8 O;  3ZHU A;  1F4M A;  4YJ2 B;  4KXR A;  3WG7 C;  2RN9 A;  1AI4 A;  2QWN B;  3AK2 A;  1DLB A;  1WB8 A;  1YTF D;  1ZX3 A;  5LOV B;  1H2K A;  4PHZ A;  5EZY B;  3AEI A;  3EXA A;  1OCZ C;  2M6Y A;  2F4V O;  2YEV A;  1FXK B;  2XT9 A;  4IYH A;  4DV2 B;  5K1P A;  1GN6 A;  4DV3 O;  1NTM H;  4R6Z A;  4D7T A;  1Y76 A;  2A9H A;  1E1Q G;  2IH3 C;  1HNZ O;  1GAX A;  2DYS B;  4JZG A;  5LGN A;  1K5S A;  4J7J A;  4X1Y B;  3OE7 G;  3U10 A;  5LHG A;  4Q6G A;  4DV4 B;  1K9M W;  3G80 A;  1D5A A;  4FLY A;  5B1O A;  4WF9 V;  1GRJ A;  2EIJ C;  2EIM B;  1NR7 A;  4J9Y B;  2DJV A;  4LFB B;  2ATK C;  3N27 A;  1SQF A;  2P5O A;  1R6N A;  3CXC U;  4PA3 A;  4FLW A;  1I08 A;  4FVM A;  1OJH A;  1MZF A;  2NNU A;  3CYO A;  3IFX A;  1XRE A;  5H6Q A;  2Y48 A;  5KHH A;  3E35 A;  4OGQ B;  4HBN A;  3AG2 C;  5C8Y A;  2GSM B;  1RFY A;  2P6J A;  3N2K B;  3JAW A;  2ZE6 A;  2N04 A;  2OWO A;  4NTW A;  2JS5 A;  1D5N A;  3D3Q A;  4AQY O;  1ARO P;  1BQ0 A;  2ARH A;  4DR2 O;  2PUS A;  4QJF B;  1OZ0 A;  2BSK B;  1EN5 A;  1ZUQ A;  3HKD A;  2ZR3 A;  2CGO A;  4MW3 A;  3ABL C;  2ZXW B;  3T1Y B;  1F51 A;  2LFS A;  4J10 A;  3J81 N;  4X9Q A;  2Q8V A;  4X65 O;  4O2A A;  4MVZ A;  3CRR A;  4PA9 A;  1VQ6 V;  1WN7 A;  3B4S A;  4JI2 O;  1FJG B;  1QR9 A;  5CA0 B;  1GK9 A;  4FPP A;  5IY5 B;  4QE7 A;  3DXR B;  5KA5 A;  3O9O A;  2QDO A;  4DK0 A;  3D36 C;  1Q43 A;  1N36 O;  2CE4 A;  1N0N A;  4KP4 A;  2P90 A;  4GKK O;  1F7Y A;  5EYP B;  2EBO A;  4PA4 A;  4IHJ B;  2Y69 C;  3B40 A;  2JRI A;  4UCT A;  4LNU A;  1YEW A;  5JH7 A;  3OEE G;  2PYL A;  2OIG A;  2Q6A A;  1YF2 A;  2X0L A;  1GMG A;  4WFF A;  4GX5 A;  3ZMV A;  2A7W A;  1SQX H;  1S5L Z;  1TGO A;  3QO7 A;  3ML0 A;  3K5O A;  4IIJ B;  3TET A;  4DR1 O;  1S72 V;  2ZM6 O;  2CH7 B;  1WNS A;  1TUE B;  3WFV A;  1GN3 A;  1XNR O;  2W6J G;  1VF7 A;  2JEU A;  1KUQ A;  3FAV A;  1SQG A;  1Y74 A;  4B3M B;  3C3T A;  4MVU A;  1W0J G;  3OTO O;  1M57 C;  4B08 A;  4ZHQ A;  4DR4 O;  1NQT A;  5JVD B;  2H94 A;  4NYK A;  2ZQM A;  3DTU B;  5IYB O;  2YIA A;  1VF6 C;  4JI7 B;  4UCR A;  2PY5 A;  3HKB B;  4X1I A;  3ABM B;  4GX1 A;  2P22 C;  3Q4H A;  4FJC C;  4UV9 A;  3KCX A;  3GVM A;  3K06 A;  2LGW A;  3P32 A;  4YHH B;  4JF3 A;  1KMI Z;  1YJN V;  4O2B A;  1ZTE A;  1WA8 A;  2R9A A;  3OTF A;  1TVK B;  2DYR B;  1JPX A;  3I56 V;  1NVP D;  5H6R A;  3W7S A;  2OTJ V;  3CCV V;  3CJH A;  3P3N A;  3VQW A;  1XBL A;  2F66 C;  2JJ1 G;  2CUG A;  2UUA O;  2QM8 A;  4JI6 B;  4LF7 B;  4NB5 A;  2HP8 A;  1FXK C;  4B3R O;  4BIU A;  3OD4 A;  4QPJ A;  4NXN O;  1L8D A;  1PKX A;  5L3C A;  4B7K A;  4LF6 B;  2DMX A;  2DQ0 A;  5J2T A;  3JAL B;  1S77 D;  5B66 Z;  2FTK A;  3WB0 A;  5LMU O;  1XMQ B;  5EIB D;  3B77 A;  2Q0O C;  4F6R A;  1QNM A;  4PDM A;  3OT7 A;  3WU2 Z;  2FL4 A;  4UVA A;  4JTA B;  1AI7 A;  5HFL A;  3JAK A;  3DGE A;  2P4K A;  4JTD B;  2EIM C;  2YIB D;  3E89 A;  2YDE A;  2UUC O;  1R3K C;  3LSU A;  3ZN0 A;  5C93 A;  2X6C A;  1HDJ A;  4X20 B;  1XHX A;  3W7W A;  5EC1 C;  2JDI G;  5IWA B;  1R6T A;  3JAM N;  4LFA B;  5B1N A;  3B8M A;  4MW8 A;  1B06 A;  4LCU C;  5JWP A;  1SC5 B;  1J5E B;  3CXH F;  4JI4 B;  5F2V O;  1KYO F;  4EFB A;  3OR6 C;  2LGQ A;  2M7W A;  1BT8 A;  4WFE A;  3X2Q C;  2KG7 B;  2B1G A;  1U96 A;  4PV1 B;  2V7Q G;  3ZRW B;  4I55 B;  4R7C A;  3TGU H;  5IDJ A;  4DRX B;  3ZN1 A;  3AK3 A;  3G6B A;  4DYL A;  2X6A A;  2GUZ B;  1WPX A;  2ZIO A;  4UCV A;  1NTK H;  4FLZ A;  1IBK B;  3RYI B;  4LWS B;  4RO2 A;  2ZXW C;  3D8C A;  3L70 H;  5FNV A;  2XOK G;  1D2D A;  3RYH A;  1VP7 A;  4MVS A;  3JCU Z;  1A32 A;  3CCQ V;  2IJK A;  2ODM A;  3W7X A;  2QE7 G;  3L72 H;  5H5N A;  1WJZ A;  4DO2 A;  1XQ8 A;  3OUS A;  3ZX6 A;  3OAA G;  3H1I H;  3MHH C;  4BIO A;  3BAB A;  5GON A;  1MOF A;  1BZK A;  4J42 A;  3K79 A;  3CRM A;  3VQV A;  1K33 A;  2OCC B;  2F1M A;  2DOS A;  2AZ0 A;  1I0H A;  3K0G A;  3N2G A;  4J80 A;  4JI0 O;  2WLH A;  4DUY B;  2IJJ A;  1I94 B;  2ZDI A;  3MHS C;  3RWR D;  2WLJ A;  4IGG A;  5LYJ A;  4MTO A;  1GN2 A;  1IDS A;  2YID A;  5J2U A;  3IC9 A;  1V54 B;  2UXN A;  3FKS G;  4DR6 O;  1QHT A;  3STL C;  3OMA B;  2YXL A;  1QCE A;  2YEV B;  4DW1 A;  4X8A A;  3UQ8 A;  2AGA A;  1JA8 A;  3BRC A;  5BZB A;  2UUB O;  1LR1 A;  1XIL A;  3A0R A;  4U7N A;  3I55 V;  3QNE A;  5DM6 V;  1VQP V;  1BSM A;  5FL7 G;  4RAI A;  3BY6 A;  1Y76 B;  4FLV A;  1XHZ A;  4RQE A;  1FAF A;  1KC8 W;  1IXM A;  4JAV A;  1Q6U A;  3L74 H;  5LGT A;  2XHB A;  2DQ3 A;  2OTL V;  2QA4 V;  1SQV H;  4JTC B;  3UT5 A;  1IXB A;  3LSQ A;  2GTS A;  1ZSP A;  2ITC C;  2DN9 A;  3G6E V;  2ZCE A;  5IT9 N;  4J11 A;  4L8J A;  4LF5 O;  5LMN O;  1SZX A;  2L35 A;  2N05 A;  1JJO A;  2CTW A;  3A8T A;  3E83 A;  1MAB G;  1PL0 A;  4HNA A;  3QG5 A;  4CBC A;  1OCO B;  4LFC B;  4H37 A;  4TWK A;  4DV6 O;  2BOC C;  2DYR C;  3VQX A;  1EZJ A;  3RN4 A;  2R72 A;  5EBW C;  4PA6 A;  3OM3 B;  4ICG A;  4JGS A;  4N23 A;  4CZZ A;  1X59 A;  1Z2G A;  1IUR A;  2GTA A;  1GM9 A;  4I50 A;  4KFM A;  1HR0 O;  1M56 B;  2EIK B;  5L3G A;  2IU0 A;  1G4Y B;  5EBM C;  5C8Y B;  3FYI B;  5EC2 C;  4DV7 O;  5GTH Z;  3JAW B;  2VQE O;  4LH7 A;  2QKA A;  5DED A;  2HG5 C;  4JV5 B;  1N34 B;  2HHH O;  3U11 A;  1Z5V A;  5IYD O;  4P30 A;  1XMO B;  2E75 B;  3HKD B;  3HR0 A;  1CPY A;  2Y4T A;  4I5S A;  1N32 O;  2CK3 G;  4P9P A;  2QWQ B;  4EB6 A;  1Q90 D;  4X62 B;  1M9N A;  1I7F A;  4OX9 O;  1KU9 A;  3CX5 F;  4GCZ A;  4O2A B;  3K0D A;  3ZRW A;  1E79 G;  2F43 G;  1OHH G;  5GW7 A;  3LDE A;  4YIO A;  1BL8 A;  4ZI7 A;  2IH1 C;  3UO3 A;  4RQF A;  3CRA A;  3ZMU A;  3SJQ C;  4TV8 A;  3JAR A;  3J80 N;  4FMT A;  1IBM B;  5E79 Z;  2X6B A;  1SES A;  4MTG A;  1KB9 F;  3RGB A;  1R3I C;  1AVM A;  2K9P A;  4NTY A;  1Y66 A;  1XEQ A;  5DN6 G;  1VQK V;  1XI1 A;  2OIE A;  4YY3 B;  3R66 A;  2Q7E A;  3L75 H;  4X64 O;  4LNU B;  5JH7 B;  3BCC H;  4PDL A;  2Q0A A;  2LFR A;  1M5I A;  2HJF C;  3KG2 A;  5KHJ A;  2PTM A;  2E74 B;  4LF8 O;  1TUB A;  2DE0 X;  2PI4 A;  5BXZ A;  1WP8 A;  3ZED A;  3FAV B;  3H1J H;  4UB6 Z;  2P67 A;  1Y74 B;  2MW2 B;  4QE9 A;  3CWB H;  4RUE A;  4NXM O;  3QO8 A;  3G67 A;  2E76 B;  1AJP A;  4ZHQ B;  3AK1 A;  2ZNJ A;  4CH5 A;  4O4H A;  1TA8 A;  2XND G;  2B5U A;  2OCC C;  3A0H Z;  1N33 B;  2JEX A;  1ORQ C;  3GB7 C;  3ZHS A;  2YI8 A;  3ZRS A;  3K5M A;  1LUV A;  4X1I B;  5B1A B;  1K4C C;  3AG3 B;  3E8F A;  4P2Z A;  1FYJ A;  5B3S B;  4JI8 B;  3Q4H B;  4CS3 A;  1SQQ H;  1HW7 A;  1NR1 A;  3CCS V;  2Q73 A;  2P06 A;  2MK3 A;  1EM1 A;  4O2B B;  1WA8 B;  2AHZ A;  3ZMT A;  2EIL C;  3JYC A;  4WFB V;  3CE2 A;  3ASO B;  3EHB B;  3CJH B;  2QEX V;  5JQG A;  1XL4 A;  1NZ6 A;  4KL1 A;  1GTO A;  3T4D A;  1G6U A;  4JAS A;  1JOY A;  5L3B A;  5J2T B;  2GV9 A;  4QIW F;  4DV3 B;  5BY1 A;  1O9G A;  2C2A A;  3ZIA G;  2EX3 A;  5LP6 C;  3DC6 A;  4GT1 A;  3UM7 A;  3HPL C;  4UCO A;  1HNZ B;  4F6R B;  2QWO B;  4WFG A;  1RPO A;  4GYC B;  1JQ0 A;  3CC4 V;  2JJ2 G;  1H2N A;  3E8G A;  2F23 A;  4G2K A;  1T5E A;  2Q68 A;  2R9I A;  2JGD A;  3JAK B;  4N21 A;  4MTF A;  1EFR G;  4LF4 O;  4GKJ O;  3VQY A;  3TXS A;  5CN0 A;  1H8H G;  1XNQ O;  1V55 B;  1K73 W;  3ABK B;  3SJC C;  2WWW A;  3K9S A;  1OCO C;  1PV0 A;  2N74 A;  3JD4 A;  4DR3 O;  1VQ7 V;  1Z5W A;  4JYC A;  5JCO C;  1YSC A;  3AG4 B;  4G28 B;  1H2L A;  1NU1 H;  3TK1 A;  2EIK C;  4J41 A;  3H1K H;  3CD6 V;  4BW5 A;  3OW2 U;  2UXD O;  4FZ0 A;  2PF4 E;  2XAH A;  3U0Z A;  4JYB A;  1VIB A;  4U3J A;  5BMV A;  3BA9 A;  5IYC O;  2V1D A;  2BTO A;  4FIP C;  1JFF A;  3ZMZ A;  4DR2 B;  1Q82 W;  1NH2 D;  2GBO A;  2IJH A;  4CC5 A;  4WBN A;  5FNV B;  1SS3 A;  3RYH B;  3K5N A;  1MZE A;  4QNH B;  4UFZ A;  4X65 B;  4LF9 O;  1VQL V;  1O9H A;  4JI2 B;  5JJJ B;  1QVG U;  3JAT A;  1EN4 A;  4UV8 A;  2YC0 A;  5GON B;  3BHP A;  1DTO A;  1RSO A;  1GM8 A;  1NS1 A;  1YVW A;  1VQM V;  4K35 A;  3K08 A;  1P84 F;  1N36 B;  4ASU G;  4J7Z A;  1HNW O;  4GKK B;  3N2G B;  3TJT A;  2PI5 A;  4IL6 Z;  3FB7 C;  4DK1 A;  2YIB A;  1VF6 A;  2FKX A;  2UU9 O;  3SPC A;  3GWO A;  3VOU A;  4MS2 A;  1U97 A;  5LYJ B;  4FM2 A;  3OGI B;  2ITD C;  1PNL A;  2VQF O;  5J2U B;  1HNX O;  1FFX A;  1ENV A;  4TQF A;  4XDK A;  1KP3 A;  3D3I A;  2ZM6 B;  1H2S B;  4J9Z B;  2HVK C;  2XUM A;  3SGI A;  1XNR B;  2WA3 A;  2FYU H;  4CS2 A;  2B1I A;  2A79 B;  1P4R A;  3OTO B;  2Z5U A;  4ZIB A;  4OXS A;  2Y4U A;  4DR4 B;  3QF7 A;  2E5L O;  1SKV A;  3IC7 A;  2LQT A;  3HKE A;  3E8B A;  3AG3 C;  2IJI A;  5B1A C;  3UT5 B;  3IJ4 A;  2LW7 A;  1AJQ A;  1YIT V;  2HKO A;  5B3S C;  5KMG A;  5DEC A;  1NI8 A;  1Q86 W;  1CP9 A;  1IVS A;  2DYS C;  4H33 A;  4IYI A;  4DV0 O;  4HNA B;  4PD4 F;  2ADP A;  3GWK C;  3ASO C;  4JAA A;  4TOI A;  4XBF A;  1YIJ V;  1YJW V;  4I50 B;  3RW0 A;  2UUA B;  4FM0 A;  1Q6H A;  4B3R B;  2HFE C;  2QR4 A;  4NXN B;  1WAZ A;  4QPK A;  3ZHT A;  2QWP B;  3BEH A;  3KCY A;  4DUZ O;  1R73 A;  2BCC H;  1SRY A;  4FZ1 A;  1YTF B;  3OFN G;  5LMU B;  2WLI A;  2OT5 A;  3ZHR A;  2NLJ C;  3WB1 A;  3A2F A;  4F4L A;  4NVP A;  4EB6 B;  3P30 A;  2WLL A;  1K4D C;  5KLV H;  1XDC A;  5LXT A;  3UKM A;  4WCE V;  1QLE B;  4IT5 A;  4ZI7 B;  2UUC B;  2JIZ G;  2RMK B;  5B5E Z;  3T1H O;  1W0K G;  4K8Z A;  3L73 H;  4TV8 B;  3JAR B;  2IU3 A;  3ZJZ A;  2KQX A;  3AG4 C;  2WLM A;  4HZ3 A;  3ASN B;  4TT3 G;  4I7Z B;  2YIC A;  3K59 A;  5LA6 A;  3SPG A;  2YI9 A;  4WFA V;  5IY5 C;  4MVR A;  4CH6 A;  5ITZ A;  1NJI W;  4TV9 A;  4CH4 A;  5CMU A;  1QLN A;  1TAE A;  3RVZ A;  2DWE C;  4X66 O;  3SR2 C;  1OCC B;  4B3T O;  4BIZ A;  1KKC A;  4UCS A;  2L6L A;  3SDL A;  3ZRX A;  4JI3 O;  5BR8 O;  4LC1 A;  1MSD A;  3OUF A;  4I0X A;  2QKS A;  1TUB B;  1VQN V;  1G1X B;  4K8X A;  3CRQ A;  1QQC A;  2EZP A;  4MVO A;  2ZNI A;  2QM7 A;  4O4L A;  1QVF U;  4G27 B;  2KB1 A;  2RQ6 A;  1OCZ B;  1N8R W;  5L3E A;  4K0K B;  1I5X A;  2WSS G;  2A3Q A;  4B3S O;  2RCV A;  4O4H B;  4DV5 O;  4UUJ C;  1MA1 A;  3APQ A;  2Y0I A;  2WA4 A;  1IBL O;  1AB3 A;  1BE3 H;  4JI0 B;  1KQS U;  2KSD A;  3RFR A;  4DR7 O;  1K92 A;  1CEZ A;  1AR4 A;  1Q7Y W;  4FM1 A;  1AI5 A;  1K3E A;  1SA0 A;  2CDY A;  1L0N H;  3K9A A;  1SF9 A;  4DR5 O;  1DK1 A;  3OMI B;  1WB7 A;  2D3O W;  3C90 A;  2P7T C;  4O4I A;  3ABM C;  3CHX A;  3BVO A;  5CB4 A;  2ETN A;  5JQG B;  4DR6 B;  1ZL8 A;  3OGC C;  3KZI Z;  5CA3 A;  2FML A;  1PD3 A;  3FB8 C;  5LHH A;  4I9W A;  3HKC A;  2UUB B;  1BHA A;  4L87 A;  3B09 A;  3AG2 B;  3SPH A;  2ZIM A;  1THZ A;  4DV1 O;  3CS5 A;  3L9D A;  1G8M A;  2CTP A;  2QM4 A;  5LGU A; 
#chains in the Genus database with same CATH homology
 5LHI A;  3QO7 A;  3ML0 A;  3TET A;  2MK3 A;  1S72 V;  1S3J A;  4R8C A;  1TUE B;  3WFV A;  2W6J G;  2AHZ A;  3SYA A;  2A0L A;  3ZMT A;  2JEU A;  2EIL C;  3JYC A;  4WFB V;  4YXW G;  3E86 A;  3ASO B;  3EHB B;  3M99 B;  5L3F A;  2BOB C;  2W6I G;  5EBL C;  2QEX V;  1GM7 A;  4MVU A;  1W0J G;  1XL4 A;  1JVM A;  1M57 C;  5HFM A;  4UXN A;  1RPR A;  5B1B B;  1GTO A;  1NQT A;  2YSU B;  4MSW C;  3T4D A;  2H94 A;  3PJS K;  4JAS A;  2ZQM A;  3DTU B;  3K3W A;  5IYB O;  1VQO V;  3WG7 B;  5L3B A;  1JOY A;  4QIW F;  3SYQ A;  2C2A A;  1UJW B;  3ZIA G;  5L3D A;  4KUM A;  3ABM B;  4GT1 A;  3HPL C;  4GX1 A;  3UM7 A;  1K7D A;  4FJC C;  1XL6 A;  4UV9 A;  1NBM G;  3K06 A;  4WFG A;  3ETE A;  1RPO A;  1JQ0 A;  3CC4 V;  3G71 V;  2Z3Y A;  2JJ2 G;  4DXW A;  3P32 A;  3E8G A;  3JD2 A;  3SPJ A;  2Y69 B;  4G2K A;  3FB6 C;  4JF3 A;  4P9O A;  1YJN V;  2Q68 A;  2R9I A;  4MTX A;  4N21 A;  4PA7 A;  1FS0 G;  4MTF A;  1EFR G;  1LNQ A;  1W2B U;  1NVP B;  2H8P C;  2DYR B;  5CN0 A;  1JPX A;  1H8H G;  4LBE C;  3I56 V;  1NVP D;  2GHY A;  5H6R A;  3W7S A;  2OTJ V;  1V55 B;  1K73 W;  3CCV V;  3ABK B;  2WWW A;  1OCO C;  3IGA C;  2JJ1 G;  4FK5 C;  2QM8 A;  1FXK C;  3JD4 A;  1VQ7 V;  4BIU A;  4QPJ A;  4JYC A;  1H38 A;  1QLE C;  1PKX A;  5L3C A;  1K8A W;  2DQ0 A;  1YSC A;  2WPD G;  4XDJ A;  2ZDI C;  1S77 D;  2EIL B;  3AG4 B;  1FXH A;  3QO5 A;  4G28 B;  1S0V A;  3H01 A;  3TK1 A;  2EIK C;  3T4Z A;  2FTK A;  1GKF A;  3MD0 A;  3CD6 V;  1I5Y A;  4BW5 A;  3B77 A;  4WFH A;  3OW2 U;  2EZO A;  3CCJ V;  3E8H A;  1M57 B;  4PDM A;  1E1R G;  2XAH A;  3HB3 B;  2EIJ B;  4JYB A;  2XAJ A;  3K04 A;  4UVA A;  5IYC O;  2V1D A;  3CCE V;  4JTA B;  1K34 A;  1AI7 A;  4FIP C;  1H8E G;  5HFL A;  3ZMZ A;  1NH2 B;  3DGE A;  1SER A;  4JTD B;  2EIM C;  1NH2 D;  3ABT A;  1Q82 W;  3RVY A;  3E89 A;  1OCR B;  2IJH A;  1R3K C;  4Q20 A;  3CMA V;  1OCC C;  5H9C A;  3ZN0 A;  5C93 A;  3ABU A;  3JCZ A;  4U7O A;  2X6C A;  1S76 D;  3RBZ A;  3CPW U;  1AR1 B;  2Q67 A;  5E1A C;  4HAM A;  4QNH B;  5EC1 C;  3W7W A;  3K03 A;  3ETD A;  1BMF G;  2JDI G;  1VQL V;  1K97 A;  4XDL A;  5B1N A;  3AG1 C;  3B8M A;  4MW8 A;  4UVC A;  1ROP A;  1QVG U;  4LCU C;  4ZBM A;  3STZ C;  1P7B A;  4UV8 A;  1R3L C;  3OR6 C;  2M7W A;  1DTO A;  4WFE A;  3T1C A;  1GM8 A;  3X2Q C;  1VQM V;  1M90 W;  4EKW A;  3K08 A;  1MSW D;  4ASU G;  2B1G A;  1QBZ A;  2V7Q G;  3ZRW B;  1AI6 A;  3F7V C;  4R7C A;  2XAF A;  5IDJ A;  3ABL B;  5KUK A;  2PI5 A;  1V54 C;  3ZN1 A;  3CCM V;  3FB7 C;  2EIN B;  3CC2 V;  2X6A A;  2WLK A;  1WPX A;  3SPC A;  3GWO A;  2DWD C;  3VOU A;  4RO2 A;  1PNK A;  2HR3 A;  2ZXW C;  4JPR A;  2XOK G;  4MS2 A;  3W7U A;  2HVJ C;  1KKD A;  4PDR A;  5CBH A;  4MVS A;  2ITD C;  3CCQ V;  2IJK A;  1PNL A;  1YHQ V;  3W7X A;  4TSF G;  2QE7 G;  1ENV A;  1Y4M A;  3R65 A;  3VBB A;  4DO2 A;  2Q69 A;  3OUS A;  4XDK A;  3OAA G;  1KP3 A;  3D3I A;  3F7Y C;  2K1E A;  3MHH C;  4J9Z B;  2HVK C;  3CCR V;  1MOF A;  1RM1 C;  1QR8 A;  2IW5 A;  3K79 A;  4R50 A;  1K33 A;  3SPI A;  2B1I A;  2A79 B;  4ZKI A;  2OCC B;  2JK5 C;  3W7T A;  1P4R A;  4MVM A;  2Z5U A;  3K0G A;  4OXS A;  1WLE A;  2WLH A;  2IJJ A;  3JD1 A;  3CCU V;  3IC7 A;  2ZDI A;  3CCL V;  3B8N A;  1BHB A;  3E8B A;  3MHS C;  5CBG A;  3AG3 C;  2IJI A;  5B1A C;  3ZCC A;  1AJQ A;  3X2Q B;  1YIT V;  2HKO A;  2WLJ A;  1DF4 A;  5B3S C;  2XAQ A;  2XAS A;  4MTO A;  2WLI B;  1FXV A;  1JCH A;  1FFT B;  2WAM A;  1YJ9 V;  1HWY A;  3OR7 C;  1M56 C;  3LDC A;  3D36 A;  1CP9 A;  1V54 B;  2LP7 A;  2WLN A;  3ETG A;  1Q86 W;  2UXN A;  2DYS C;  4H33 A;  3ZMS A;  2WLL B;  3SYP A;  1SZT A;  3FKS G;  5CBF A;  3STL C;  3OMA B;  4GX0 A;  1QCE A;  2YEV B;  3ASN C;  4X8A A;  3TCU A;  5LBQ A;  3ASO C;  1JX9 A;  4LP8 A;  5BZB A;  1KD1 W;  1KEC A;  3A0R A;  4XBF A;  1YIJ V;  3F5W C;  4U7N A;  3I55 V;  1YJW V;  1J95 A;  1YI2 V;  3FYE B;  3QNE A;  4X89 A;  5DM6 V;  3RW0 A;  4JAU A;  5FL7 G;  1VQP V;  4RAI A;  3BY6 A;  1M1K W;  5B1B C;  4RQE A;  3EFF K;  1SET A;  5J9P C;  1PNM A;  1KC8 W;  1IXM A;  2HFE C;  4JAV A;  3CME V;  1F4M A;  3WG7 C;  4QPK A;  5LGT A;  3BEH A;  1AI4 A;  3SYO A;  2DQ3 A;  1R73 A;  2OTL V;  2QA4 V;  1SRY A;  4JTC B;  3LSQ A;  3LNM B;  3JD3 A;  1YTF B;  3OFN G;  1DLB A;  2WLI A;  2OT5 A;  2ITC C;  1Q81 W;  3G6E V;  1YTF D;  2NLJ C;  4F4L A;  1VQ9 V;  3FB5 C;  2W0F C;  3P30 A;  2WLL A;  3AEI A;  1R6K A;  3E83 A;  1MAB G;  1JJ2 U;  1PL0 A;  1OCZ C;  1OCO B;  4CBC A;  3CC7 V;  1K4D C;  3CP1 A;  1ZWI C;  2YEV A;  4GX2 A;  4H37 A;  4TWK A;  2BOC C;  2DYR C;  4Z1M G;  1FXK B;  1EZJ A;  2X7R B;  5EBW C;  3UKM A;  4WCE V;  1QLE B;  4PA6 A;  3OM3 B;  1H2G A;  4JGS A;  4N23 A;  2JIZ G;  4R6Z A;  3E2E A;  4CZZ A;  1GM9 A;  3JD0 A;  1W0K G;  4KFM A;  1M56 B;  2A9H A;  2EIK B;  1E1Q G;  5L3G A;  4UVB A;  2IU0 A;  2IU3 A;  1G4Y B;  2IH3 C;  4E2L A;  5EBM C;  2DYS B;  1NKD A;  1F23 A;  3FYI B;  1K5Q A;  5EC2 C;  3ZJZ A;  3LDD A;  5LGN A;  5KA6 A;  1K5S A;  3AG4 C;  2WLM A;  4BAY A;  2HG5 C;  4HZ3 A;  3ASN B;  3OE7 G;  5LHG A;  4TT3 G;  3SPG A;  4WFA V;  5IY5 C;  4P30 A;  5IYD O;  1K9M W;  4MVR A;  1L1F A;  1DF5 A;  1NJI W;  2DW4 A;  1KP2 A;  5B1O A;  5CMU A;  4WF9 V;  1QLN A;  2EIJ C;  2EIM B;  1CPY A;  3RVZ A;  1NR7 A;  4J9Y B;  2DWE C;  4I5S A;  2CK3 G;  2ATK C;  4P9P A;  1OCC B;  4BIZ A;  1M9N A;  1R6N A;  2AHY A;  4GCZ A;  3CXC U;  4PA3 A;  3K0D A;  3ZRW A;  1E79 G;  2F43 G;  2QTO A;  1FXK A;  1F4N A;  1OHH G;  3ZRX A;  1OCR C;  2NNU A;  4LC1 A;  5GW7 A;  3OUF A;  3LDE A;  3CYO A;  1BL8 A;  2QKS A;  3AG1 B;  4RQF A;  2IH1 C;  3IFX A;  4MT8 A;  1VQN V;  1S5H C;  5H6Q A;  2Y48 A;  4MVQ A;  2EZP A;  3E35 A;  3NXS A;  4MVO A;  3ZMU A;  3SJQ C;  2QM7 A;  5EK0 A;  4FMT A;  3AG2 C;  5KUM A;  4G27 B;  2KB1 A;  1QVF U;  4X88 A;  2GSM B;  3OEH G;  2P6J A;  2X6B A;  2R9R B;  1SES A;  1OCZ B;  1N8R W;  4MTG A;  5L3E A;  1I5X A;  2WSS G;  3G4S V;  3OMN B;  3T2M A;  1R3I C;  4RUF A;  1Y66 A;  5DN6 G;  1VQK V;  1ARO P;  3CCS V;  4UUJ C;  2UXX A;  2XAG A;  1EBO A;  4QJF B;  1AJN A;  1OZ0 A;  2ZR3 A;  4PDL A;  4MW3 A;  2HLD G;  3ABL C;  2LFR A;  2ZXW B;  1F51 A;  2LFS A;  2HJF C;  2EIN C;  4PDV A;  3LUT B;  1KQS U;  1K92 A;  3KG2 A;  1CEZ A;  4MVZ A;  4PA9 A;  1Q7Y W;  1VQ6 V;  1AI5 A;  1K3E A;  1GO3 F;  1B6Q A;  1QR9 A;  1GK9 A;  4FPP A;  5IY5 B;  4HYO A;  1VQ4 V;  3K9A A;  2PI4 A;  4QE7 A;  3ZRV A;  5KA5 A;  3SYC A;  1VQ5 V;  3OMI B;  4PEL A;  1RM1 B;  2D3O W;  1MG1 A;  2EJR A;  2P7T C;  3ABM C;  2P67 A;  4QE9 A;  4KP4 A;  2P90 A;  4RUE A;  2EBO A;  3OGC C;  4PA4 A;  3QO8 A;  5CA3 A;  1AJP A;  1PD3 A;  3FB8 C;  5LHH A;  1VQ8 V;  2Y69 C;  2XND G;  4I9W A;  2B5U A;  2OCC C;  2ZR2 A;  2JEX A;  2ZD9 A;  1ORQ C;  3GB7 C;  1BHA A;  3OEE G;  4L87 A;  2Q6A A;  3ZRS A;  2X0L A;  3AG3 B;  1K4C C;  1R3J C;  1COW G;  3E8F A;  4P2Z A;  1GMG A;  3AG2 B;  5B1A B;  3SPH A;  4WFF A;  1THZ A;  4GX5 A;  5B3S B;  3LSS A;  3ZMV A;  1V55 C;  3ABK C;  1G8M A;  5LGU A;  1NR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...