3OW2U

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ow2U00
1K73W 4WF9V 3CXCU 1VQ4V 1M1KW 1VQ9V 3I55V 1YJNV 1Q7YW 4WFAV 3CC7V 1QVGU 3G71V 3CC2V 1VQKV 1VQ8V 3CMEV 2OTLV 1K8AW 1VQPV 3CCSV 1KC8W 3CD6V 3CPWU 1VQ5V 3CCVV 1YHQV 1KD1W 1S72V 2QEXV 3CCJV 3CMAV 3CCQV 3CCEV 3CCUV 1N8RW 3CCMV 1R73A 1YJ9V 1VQLV 3CCLV 1VQ7V 1YI2V 3OW2U 1M90W 1YJWV 2D3OW 1K9MW 1YITV 1JJ2U 2OTJV 1VQMV 1VQOV 1Q81W 3CC4V 4WCEV 3G6EV 1YIJV 3CCRV 1NJIW 1KQSU 5DM6V 1Q86W 4WFBV 1Q82W 1QVFU 3I56V 2QA4V 1VQ6V 1VQNV 3G4SV 1W2BU
chains in the Genus database with same CATH superfamily
3P32A 2UXCB 4X8AA 4LWSA 4UCUA 3DC6A 3JAMN 3OR6C 4DV4B 3JARA 3K79A 1L1FA 3WB0A 2EINC 1AP5A 2ZQMA 4IT5A 2VS0A 2E5LB 4BWAA 1PNLA 1K9MW 5CB4A 1EFRG 3ABUA 4GKKO 2WLMA 1S5HC 2YIDA 2IH3C 5LA6B 4UV8A 5JVDB 5IYDO 3STLC 5JCOA 3CE2A 1WP8A 1GTOA 1JMKC 1OCCB 4JI1B 3E22B 1XMQO 2ZR2A 1RPRA 4LF4B 3B8NA 4LFBO 4NKGB 3CCVV 3LNNA 2OCHA 4DXWA 1BZKA 1KU9A 3D3IA 3NXSA 3SGIA 3CRQA 1NJIW 2N05A 2HKOA 3NR7A 5KX5A 4X9QA 1AI7A 2DN9A 1QVFU 2PYJA 1R6NA 3SJBC 4AILC 2EILC 4B08A 4FK5C 2YIBA 5FNVB 4JI1O 2NNUA 2IBZH 4W4LA 1N32B 3H1LH 5LOVB 1TUBA 2UXDB 5GTHZ 4O4HA 2K1EA 3WB2A 3T1HO 2ILMA 4WFAV 5CA1A 5LA6A 3KZIZ 2QE7G 3FYIB 5DEDA 5EBWC 4ZI7B 1NKDA 1Y6XA 4DV0O 3K03A 3CCQV 3F7VC 1THZA 4WFEA 1N0JA 3G80A 3L71H 1LUWA 4P2ZA 4HNAB 2EIMB 4X66B 3MDSA 5CBFA 3H01A 4MVZA 1QR9A 2KG7A 2KQXA 4O4IA 1BS3A 1R6TA 4OX9O 3SPCA 2HP8A 4TT3G 3F7YC 1SRYA 3LSSA 1SF9A 2DYSC 3ASNB 3VOUA 1RSOA 2A0LA 2OIEA 1CXZB 4UUJC 3G67A 1N0NA 1Q82W 2HJFC 1X4TA 2ADQB 3CB2A 1AI6A 2GBOA 4CH3A 4DUYB 5LOVA 3B09A 2P90A 4JI3B 4J41A 4G28B 1JOYA 4UB8Z 4CS3A 3LDEA 3RWRD 4K0KO 1ZSPA 3WG7B 3UQ8A 1XHZA 3CCLV 3GWKC 3K9SA 5EYPA 1Z5WA 3B40A 2QDOA 1KKCA 2UXXA 1H2KA 2P4VA 4MVMA 3K59A 3AEIA 2BTOA 4J80A 4DR2O 1AR5A 3ZS8C 2EX3A 4IL6Z 1HDJA 4MW3A 4MTXA 1K5SA 2ZXWB 5IJ9B 4YHHB 3TCUA 4JI0O 4UXNA 1M1KW 2ZXWC 3ASNC 1TVKA 4ZBMA 2QM7A 3E22A 1MSWD 1KC8W 5IYBO 2YI8A 3SJCC 4FLYA 1IBLB 5L3GA 1GM8A 4AQYO 2YEVB 2ZR3A 2LGWA 3W7WA 1E79G 1UFIA 3ZMTA 1E1QG 2L35A 4DR1O 4GYCB 1WB8A 4FIPC 5EBMC 2LFSA 1HW7A 1AB3A 4FVMA 1M56C 2GUZA 2QWNB 3JAWB 1G6UA 1GN3A 3T1YO 1OCOB 1OZ0A 3BHPA 1K4DC 3CS5A 2NR5A 2EIKB 4LP8A 3TXQA 5CN0A 3R65A 5B3SB 2EIKC 1WA8B 1PL0A 4OPHA 2P4KA 3AG7A 1RM1B 1NZ6A 1KYOF 1VQMV 3EHBB 1IVSA 2R9AA 2ZNJA 2W0FC 3K0DA 1R1BA 3LUTB 4MVQA 2Y69C 1FJGB 1FYJA 2DE0X 1W0KG 3UT5B 4Q6GA 2PTMA 4X62B 4YY3O 3HKBB 4I0XA 4JASA 5KX5B 2DYRC 5C93A 3T4ZA 1H2LA 1AROP 1COWG 4BW9A 2PUSA 2A06H 4TV8A 1F51A 3ASOC 3TK1A 2X6BA 1P4RA 1QLEC 1FJGO 3U0ZA 5J2TA 4CH6A 1N36O 1GN4A 3OMIB 5JJJB 2ZE8A 2ZIOA 2XHBA 5B1BC 3E35A 3OT7A 2QWOB 1S76D 4PA4A 3K06A 1T5EA 3HB3B 1AR4A 5GONB 2UUCB 1AI4A 1V9PA 1R3KC 3W7SA 4W4KA 1S5LZ 3T1YB 4B3RB 5LGUA 1PD3A 1H8EG 1YCIA 3OUFA 3RFRA 3ZMUA 1GRJA 5H2FZ 3RYIA 4O4LA 1AJPA 2YS8A 2CTPA 2GDSA 1S72V 3OUSA 1Y74B 3ABKC 1MA1A 1SESA 4UCRA 5LXTB 2E3CA 4OPAA 2IU3A 2Z0AA 3T1CA 4LFAB 4X64O 3ABKB 2Q69A 4DW0A 4TUYA 4GX0A 1B06A 1H2SB 3BEHA 3ABLB 3E8FA 4R8CA 3CCSV 4KP4A 2L6LA 5B1OA 3DC5A 1N4CA 2RNBA 3S3XA 1TUBB 1VARA 2P6JA 1I7FA 4DUZB 4DRXA 1NTZH 2YEVA 5CBGA 3AK2A 2ZM6B 1JR9A 3K5NA 2Q6AA 5D5QA 5KAFZ 5EIBC 4D6TH 3AK3A 1D5NA 4MVUA 4J9ZB 3K9AA 4I55B 4O4LB 3CRCA 3K5OA 1SERA 5JQGA 4RO2A 5BMVB 1I0HA 1FFXA 1X59A 1PPJH 2IU0A 4LF5O 2UXDO 1P84F 4QGPA 5B1NA 5CB4B 5GW7A 4B3TB 3P3PA 5JCOC 3EXAA 1XDCA 2QJ1A 5H6RA 2WLLB 3PJSK 4U3FH 5EZYB 3BAAA 2QR4A 3ZX6A 4Q20A 3C3SA 4YY3B 3ZRXA 1YDXA 4DR4O 4X1YB 1K34A 1N34B 3B8MA 4JYYA 2XASA 5LHHA 3CRMA 2GV9A 1K5QA 3KCXA 3IC9A 4UCSA 2HVJC 3CMAV 4DV7B 1VF6A 1SQGA 3IC7A 1H2GA 1XMQB 3MAQA 1N34O 1Q86W 2X0LA 4Z1VA 1J5EO 4LF6B 3LSQA 3HKEA 4P9OA 4U7OA 4LWSB 2CK3G 2JDIG 2WPDG 2DWEC 4ZHQA 2PY5A 1OCCC 5IYZB 4B3TO 4DR5O 1SQPH 5B66Z 4DUYO 3BFRA 2Q7GA 4XDKA 3TXSA 4B3SB 4U7NA 1WP7A 2R72A 4JTDB 3IGAC 2F95B 4AQYB 1TUEB 2AZ0A 3FB6C 4QE9A 5BMVA 3BA9A 2P06A 2E76B 3UCSC 1G4YB 2ZM6O 4JI0B 2GTSA 2M6YA 1BMFG 1WAZA 2ZE5A 3DGEA 3RN4A 4WCEV 3G6EV 4I9WA 2FYUH 4E4EA 4DV7O 5LMUO 2EBOA 3ETQA 4FFKA 1GN2A 4LFCB 2AW9A 3K57A 3SPGA 2ZE7A 3ZIAG 4FZ0A 4H37A 3M8AA 3C3TA 2QTOA 3E2EA 3ABMC 2WWWA 2GTAA 2A9HA 1QHTA 2R9IA 5LGTA 3F5WC 1IBMB 3CJHB 1WB7A 3LDCA 3VQVA 2YIAA 1FXKA 3HR0A 3N27A 3OTFA 2LP7A 2Q8VA 5BXZA 2F43G 2D2CB 3K0GA 4JI3O 2OWOA 3OAAG 5E79Z 4X1IA 4DV4O 1FS0G 4LBEC 4O4JA 1WN7A 2CH7B 1DF5A 1FXKC 2GUZB 1UJWB 5TISZ 4K3AA 3VQXA 2EILB 1GN6A 4CC6A 1QBZA 2CTRA 3SYQA 3JASA 4X65B 1VQPV 1BGYH 4KHPO 2Q67A 1D5AA 3QG5A 1XOUA 1Q81W 2X7RB 1I94B 1JFFB 2LW7A 1MNGA 4WFFA 2VWJA 3T2MA 2F23A 3CSXA 4D7TA 2B9ZA 3M99B 1YTFD 2DOSA 2WA3A 2JS5A 2X6AA 1BQ0A 3BRCA 3L74H 1K4CC 4BR6A 4O4JB 3X2QC 4GX5A 1O9HA 4O2BB 1FFXB 1FXVA 2OTLV 1SZTA 4HAMA 5KLVH 2ETNA 1V55B 4JGSA 2QEXV 2P67A 3JD2A 2PI5A 4B3RO 4PD4F 4I7ZB 4MSWC 4DW1A 1M90W 4NXMB 1SKVA 4GZRB 3GB7C 4IIJB 4UCOA 4TUYB 2ZNIA 4WFBV 3Q4HA 2UUCO 4DV5B 4UB6Z 5LGNA 4J11A 2B5UA 3D36C 1RFYA 1JFFA 4LF8O 1BT8A 2ODMA 1I5XA 2R70A 3OTOO 2Y0PA 1GK9A 5EIBD 3WU2Z 4MT8A 3T1HB 1JQ0A 5BR8O 4D7SA 1VQOV 2RCVA 4R7CA 1VP7A 2Y4UA 2VQFO 1M56B 3BCCH 1BHAA 1DGSA 4TV9A 3OM3B 1XNRO 4JI4B 1O9GA 3N2KA 1IBKB 2P7TC 2JEXA 3OGCC 1AP6A 1HNZB 1XMOO 2FB5A 2LFRA 2YICA 1K7DA 3BY6A 1RPOA 2EULA 1FFTB 3GWOA 1TAEA 4LF8B 1OCZC 2Q9LA 2EIJB 1YITV 3HKDA 4K35A 1M57C 1SQXH 4O4HB 1F4NA 1NTKH 4J10A 2Q68A 2QGNA 1HR0B 4RUEA 3ETDA 4FM0A 1Q7YW 4NXMO 4OXSA 3ZN0A 3K04A 1VQ8V 1ZLZA 4LFBB 1K8AW 1M4UA 1OCRC 3RYHA 3E8BA 3ABLC 3BVOA 2BCCH 4KXRA 5J2UB 4PJ0Z 4X66O 4JI5B 3FKSG 5LP6A 2QM4A 4UCTA 3OFNG 2V1DA 2VWKA 4DV1O 3DXRB 5BZBA 1IURA 3VBBA 4U3JB 2CUGA 1L0NH 3N2GB 2NLJC 1BCCH 1JA8A 2XUMA 3ZRVA 3CCMV 1IBKO 3CYOA 3KCYA 4PDVA 2WLHA 1US6A 1AILA 3B2EE 3LNMB 1MG1A 5KA6A 2HEPA 5B3SC 4I50A 5IE9A 3I5DA 1HNWO 1V54B 4X89A 5DN6G 4OX9B 1VEWA 1MZEA 1NS1A 4CBCA 1N33O 3RT3C 1YVWA 4KHPB 4GT1A 4X65O 1XNQB 1VIBA 1B6QA 2JGDB 4DV5O 1KQSU 3ZN1A 2YXHA 4B3MO 4JAVA 3L70H 3JARB 4DR2B 1G1XB 4UV9A 1AI5A 2IJJA 4XDJA 3AG2C 4O2AB 4DV6B 3WB1A 4LF4O 1W0JG 3U10A 1N8RW 3SPJA 2CE4A 2EINB 3W7XA 1PKXA 1W59A 2EJ7A 3E8GA 5L3EA 3LSUA 4PDMA 4DK1A 4WBNA 4ZIBA 4FLVA 2B1GA 5BR8B 3JALA 4CS2A 2WAMA 3ZMSA 4LR3A 1VMGA 3K08A 5H5NA 5FPRA 3ZHSA 5A2QN 4LF7O 5EC2C 4PDLA 2QKAA 3P3NA 3OR7C 4LFCO 2HG5C 4O4IB 1YIJV 1WLEA 3QO7A 2M7WA 1XILA 3I56V 4JAUA 1I94O 3E86A 2OYQA 3W7UA 4BAYA 2Z3YA 2LQTA 3CMEV 3N2KB 4R50A 4JTCB 5LHGA 1HNXO 3E83A 3FB8C 5IYCO 4TQDA 1Y67A 4N23A 2ZDIA 5J2TB 1ZWIC 4DR3B 4NXNO 4CZZA 3IJ4A 2OT5A 3CWBH 4L8JA 2Q7EA 5KA5A 4LNUA 2Q0AA 3CHXA 5C8YA 4LF9O 3K3WA 4MVRA 4CH4A 3AG3C 4AI8A 1KUQA 2FTKA 4UVBA 1WJZA 5EZYA 3CRRA 4J9YB 4F6RA 4YJ3B 4J7KA 4DV3O 1K92A 2Q7HA 2ITDC 1EZVH 3ML0A 3L73H 1RP3B 4DO2A 3THOA 3U11A 3ZBHA 1IX9A 1VF5B 5JWPA 4I55A 4DV2B 3ETGA 4C7UA 2Y48A 1GAXA 5LMNO 4RUFA 2UUBO 4NYKA 4TOIA 5LHIA 4J42A 1SA0A 4UVAA 4U3JA 3DSQA 4P9PA 4TV8B 2VQEO 1BL8A 4L87A 3OGIB 2DYSB 1HWYA 5FNVA 5HFLA 5LMUB 5KMGB 2VQEB 1Z2GA 4UCVA 2YSUB 4H13B 4A5UB 5CA3A 1LR1A 5IYZA 1XMOB 4RQFA 3RYFA 4JV5O 2PGGA 1WNSA 1XL4A 3ZRSA 3QF7A 4GKKB 5LBQA 2VQFB 3WG7C 2RDCA 5LYJB 1K73W 2QKSA 2JVDA 4PA3A 1UPGA 2H8PC 3D8CA 3O9OA 4JYBA 1VQKV 3VQYA 1NTMH 5B1AB 1PNMA 5IJ0A 2UXCO 3HKBA 4I0XB 2KSDA 2WLIB 4IHJA 2JGUA 3OMNB 3SPIA 1PV0A 1EZJA 3QO5A 2LO1A 4NTXA 4X20B 3CC4V 3N2GA 3ABMB 4TV9B 1VF7A 1SQBH 1Q3EA 2YC0A 3CXCU 5D5PA 1YZBA 2C2AA 5CA0B 4NTWA 4UFZA 3X2QB 2EZPA 3OEHG 1ROPA 4I50B 3B4SA 3RVYA 4EB6B 4CS4A 3SYOA 2K9PA 1SQFA 2AXTZ 2H3OA 4Z2WA 4B3SO 4GKJB 1FXKB 2F1MA 1YJNV 1NQTA 3J7AU 3G71V 3HPLC 2YUAA 3JD1A 2WLJA 1H2MA 4JF3A 4I5SA 1KD1W 4FZ1A 1K97A 3RYCA 2FMLA 1XNRB 1Z5VA 5IWAO 4O2AA 5J9PC 3D3QA 3F5TA 3RBZA 5IJ0B 1GH6A 3QVNA 1S3JA 3TGUH 2HJDA 2Y0IA 3IFXA 2LGQA 1F7YA 2F4VO 1A32A 3VQWA 1IZ3A 2N04A 2N74A 1HR0O 3DTUB 2XTAA 2F66C 3JD4A 4MVSA 4GUNA 1K33A 4B7KA 1S5JA 4ASUG 5L3FA 4QNHB 2HLDG 1L8DA 5JQGB 3ZMZA 2UU9B 4EFBA 4DR6B 2EIJC 1Q6IA 2A7WA 3M7MX 1MOFA 5ITZA 3DXRA 1EN6A 1ZL8B 2W0XA 3R66A 1H8HG 2P22C 1V55C 1URFA 1SETA 3H1KH 4LF5B 2Z5UA 2V4DA 1VQNV 1R6KA 1CP9A 1FD9A 5KHHA 2XAHA 3RGBA 2RJZA 2ZT9B 4J7JA 4EB6A 4PHZA 5A9GA 3CD6V 4FFBA 2UUAO 5KHGA 2E75B 1JPXA 3RW0A 3ZRWA 2Q0OC 1M9NA 1GMGA 1R3LC 1U97A 4DUZO 3MHHC 5FL7G 1YTFB 2ZIMA 2DW4A 3EVKA 4ZOLA 4QIWF 1AR1B 5KHJA 4DR7B 4JYCA 4JI6O 4JI7B 2HVKC 4O2BA 1JCHA 4X88A 4GCZA 2Q4PA 3AG4B 4CH5A 1PM9A 1ZUQA 2HR3A 1SA0B 2MK3A 1OV9A 2OTJV 1QNMA 3FYEB 3S3WA 1OCZB 2QM8A 1E1RG 1BQZA 2ZDIC 5HFMA 4IIJA 1EBOA 1NBMG 1KP2A 2FL4A 4IYIA 3T4DA 1NH2B 4JPRA 1KP3A 4I4TA 4OGQB 4JYAB 1IBLO 2ADPA 3WFVA 3SDLA 2WSSG 1S77D 1QLEB 4MTGA 2ZD9A 1M93A 2JEUA 4DK0A 2VRZA 3ZMVA 4FLUA 1R3JC 4K8ZA 1Y76A 2YXLA 3G4SV 2XOKG 3ZRWB 1EM1A 4FLZA 2ITCC 1CEZA 5FLXN 4HYOA 4J7ZA 5J2UA 5B1BB 5JH7A 3CRAA 2G38A 1IDSA 4LCUC 1JX9A 1YXBA 4JI7O 5GTIZ 3RYCB 1KECA 3JAKA 1N36B 3JD3A 2PZSA 3AG1C 1V54C 5LXTA 3ICXA 4ZHQB 4BIOA 2Q73A 3CX5F 3STZC 3SJQC 4FLXA 2YXYA 4QPJA 5JVDA 1K3EA 3JSLA 3A0HZ 4KFMA 1M57B 4UVCA 2LW1A 4EFEA 4LC1A 4QPKA 1B3QA 1LUVA 2IJKA 5DM6V 2XAFA 2HHHO 3RYIB 4FMTA 2W6IG 1YEWA 1DLBA 2ARHA 2XT9A 1Y74A 3UT5A 1ZTEA 2IW5A 1P49A 3L72H 4NVPA 5B5EZ 3K5MA 1MMMA 4WFHA 5CBHA 1YJ9V 5L3BA 4FJCC 2GSMB 4BW5A 5EYPB 1QU7A 4PELA 1Q43A 2W6JG 3G6BA 4FLTA 2QSAA 1Q90D 4YIOA 2BTQB 5L3DA 4YJ2B 4AHCA 2V7QG 2DQ3A 4NTYA 3P30A 5CMUA 3ZHTA 2XNDG 4QJFB 3OD4A 3CCRV 2JIZG 4PI2A 4DR4B 4DR5B 2AZ2A 3ZEDA 4TSFG 3FAVB 5IWAB 1FXHA 3KKYA 2IH1C 4ABMA 1DTOA 2A3QA 3CCJV 4JV5B 3L75H 1IBMO 1WPXA 1AJQA 3H1HH 1XL6A 3A2FA 2Y4TA 4XBFA 3LDDA 3ZHVA 3FB7C 3AG2B 4E2LA 4WBNB 2X6CA 3ETEA 3TJTA 3MD0A 2CGOA 3O65A 3FD9A 3CPWU 2BSKA 2PYLA 1XBLA 2DMXA 1ORQC 4JI6B 4R6ZA 2P5OA 3SR2C 4FPPA 1OJHA 3SPHA 1YJWV 2UUBB 3A0BZ 1B04A 5AG2A 4KL1A 3FFQA 3QO8A 5E1AC 1VQ9V 4G27B 2ATKC 3CEIA 1Y4MA 3RYHB 4BIUA 1NVPB 2JGDA 1OHHG 4ZOLB 2ZKOA 1XQ8A 5K1XA 4PA7A 1H38A 3J80N 4HNAA 4GKJO 3JYCA 2QTSA 2WLIA 3C90A 4X64B 4LH7A 3UO2A 2RMKB 2DQ0A 4YJ2A 2EZOA 4ICGA 4NXNB 4DR3O 1NU1H 4X1KB 1QVGU 3CC2V 3MHSC 4BIZA 2RN9A 3A8TA 3OMAB 1HNXB 1KKDA 3J81N 3Q4HB 1J5EB 4LF6O 5KHKA 1QLNA 1YI2V 1U96A 3TETA 5H9CA 1VQ6V 3ZCCA 1AVMA 3ZJZA 4HZ3A 5KHIA 3HKCA 4WFGA 5BY1A 2CTQA 1FAFA 4FFBB 4PI0A 2EJRA 3UM7A 4IGGA 1YHQV 3E89A 1R73A 3W7TA 2HHHB 5B1AC 4LFAO 1KMIZ 5LMNB 1XREA 4FM1A 3APOA 4MVOA 4DV2O 2YI9A 2O57A 4YXWG 1SS3A 1BSMA 4JTAB 2YIBD 2EIMC 1P7GA 1CPYA 1L0LH 3SJAC 4X62O 3K58A 3CP1A 1VQ7V 4YHHO 2ZE6A 1IXBA 1QCEA 1GO3F 1IXMA 4I4TB 4TQFA 4ZI7A 4FLWA 3I55V 2NN4A 2WA4A 5LP6C 2IM9A 3KG2A 1N33B 2BOBC 3L9DA 3GVMA 4EEQA 4RQEA 3QNEA 4ZKIA 4RWUA 3B77A 5LP6B 5ITZB 5KUKA 2AGAA 1XI1A 2LJ2A 4TWKA 1JVMA 4X1KA 1NR7A 4GX2A 4X20A 2Q5ZA 2JRIA 1KBHA 2UUAB 1Q5OA 3OEEG 1MABG 3IAYA 4JYAO 5CA0A 1TVKB 3OE7G 5K1PA 1D2DA 2KKWA 1G8MA 2JS3A 3SYPA 3CXHF 1P7BA 3CCEV 4Z1MG 5KMGA 3OW2U 1MZFA 3HKCB 4DV1B 2D3OW 1FPOA 3UO3A 2AHZA 3PN1A 1XHXA 1EN4A 4PV1B 4DRXB 4H33A 2JJ2G 5H6QA 3H1IH 2KB1A 3CC7V 1NI8A 2OIGA 1QQCA 1Q6UA 3JATA 4KUMA 1VQ5V 1BE3H 1WPBA 3APQA 4FM2A 4EKWA 1TGOA 3JCUZ 2BE3A 1NH2D 4B3MB 3JAKB 2QA4V 4MW8A 4NR1A 2JJ1G 4H44B 4H0LB 2ZINA 5IT9N 2CDYA 1S0VA 1XNQO 4MS2A 4JAAA 5L3CA 3BABA 5C8YB 1RSOB 4P30A 4DR1B 1SZXA 2WLLA 2F4VB 1HNZO 1AJNA 1SQQH 3SYAA 2UXBB 2AHYA 1YF2A 4PDRA 2PF4E 4DYLA 3D36A 1YSCA 2FKXA 1PP9H 1XEQA 1VQ4V 1Y66A 2H94A 4K0KB 5FPOA 3A0RA 1OCOC 1LNQA 3SYCA 1Y76B 1Q6HA 2MW2B 2B1IA 3CJHA 5GONA 3ZHUA 3RVZA 1NR1A 4XDLA 2QKCA 5JJNB 4F4LA 2UU9O 4HBNA 3AG4C 2QWRB 2GHYA 4JI8O 5JH7B 5EC1C 1M5IA 3EFFK 1F23A 1W2BU 2DYRB 5EK0A 2QWPB 2F93B 2Y69B 1KB9F 2IJIA 3H1JH 3ZHRA 1NT2B 3HKDB 4DR7O 1GKFA 3ASOB 1NVPD 1HNWB 2XAJA 1OCRB 3ABTA 3BA8A 1MSDA 5CA1B 1PNKA 4JI8B 1ZAUA 3JATB 1ENVA 4GLXA 1SQVH 4N21A 4DV0B 5LL6Y 4X1IB 2BSKB 4DV3B 4LF7B 1J95A 2CH7A 1Q8IA 3CCUV 4QE7A 1VQLV 4F6EA 1GM7A 3JD0A 4IHJB 4K8XA 2KG7B 2WLKA 1GM9A 1N32O 1JJOA 5KUMA 4JZ2A 2JK5C 1SC5B 2UXBO 4JI2B 1XUQA 1RM1C 2DWDC 5LYJA 1I5YA 3H9VA 3OTOB 2E74B 3JAWA 4DR6O 2CTWA 2CGNA 2RQ6A 2YDEA 1EN5A 5DECA 4LNUB 1F4MA 1PL4A 2WLNA 3RYFB 5IY5B 4PA6A 4JZGA 1VF6C 4YJ3A 5KAIZ 2ZCEA 4LH6A 2QWQB 2A79B 5IY5C 1FKAO 2XAGA 3AG3B 1TA8A 4GX1A 3FAVA 1DK1A 4X1YA 4JI4O 1I08A 4MTFA 3AK1A 2UXNA 4IYHA 4I9QA 5EBLC 2OCCB 4B7EA 1R3IC 1BHBA 3JSNA 5IDJA 4WF9V 3UKMA 2E5LO 2OCCC 1ZL8A 2HFEC 2CAZC 3ZHQA 3FB5C 4NB5A 4DV6O 3JASB 4LF9B 4RAIA 1WA8A 5IJ9A 3AG1B 3K5LA 1JJ2U 2R9RB 3JALB 3JCZA 3QTCA 3BPZA 3HKEB 5F2VO 4JI5O 1DF4A 1H2NA 1QR8A 4YIPA 2XAQA 2BOCC 2BTQA 3FX7A 4CC5A 4JI2O 1HP8A 4MTOA 2IJHA 1ZX3A 4F6RB 5JJEB 2PI4A 2DJVA 3E8HA 4PA9A 4G2KA
chains in the Genus database with same CATH topology
3AG2B 2XASA 5LHHA 3P32A 4E2LA 2X6CA 4X8AA 3K3WA 3ETEA 4MVRA 3AG3C 3OR6C 3MD0A 1K5QA 2FTKA 4UVBA 3K79A 1L1FA 4J9YB 3CPWU 1K92A 2EINC 2ZQMA 2ITDC 2HVJC 1ORQC 3ML0A 3CMAV 4R6ZA 4FPPA 4DO2A 3IC7A 1PNLA 1H2GA 3SPHA 1YJWV 1K9MW 1EFRG 3ABUA 2WLMA 1S5HC 1Q86W 2X0LA 3ETGA 2IH3C 2Y48A 4UV8A 3QO8A 3LSQA 4P9OA 4RUFA 4U7OA 3STLC 5IYDO 5E1AC 2CK3G 2JDIG 1GTOA 1OCCB 2WPDG 1VQ9V 4G27B 2ATKC 5LHIA 2ZR2A 1Y4MA 4BIUA 2DWEC 1RPRA 1NVPB 3B8NA 4UVAA 1OHHG 1OCCC 3CCVV 4PA7A 4P9PA 1BL8A 1H38A 4L87A 4XDKA 2DYSB 1HWYA 4DXWA 5HFLA 3D3IA 3NXSA 1NJIW 3JYCA 2WLIA 2HKOA 4U7NA 1AI7A 2DQ0A 1QVFU 4JTDB 3IGAC 2EZOA 1R6NA 2YSUB 1TUEB 2EILC 5CA3A 1QVGU 3CC2V 4FK5C 3MHSC 4RQFA 3FB6C 4QE9A 4BIZA 1XL4A 3OMAB 2NNUA 1KKDA 3ZRSA 1QLNA 1G4YB 1YI2V 1BMFG 3DGEA 5LBQA 4WCEV 3G6EV 3WG7C 3TETA 4I9WA 5H9CA 1VQ6V 3ZCCA 2EBOA 3ZJZA 4HZ3A 1K73W 2QKSA 2K1EA 4WFGA 4PA3A 3SPGA 4WFAV 2H8PC 4JYBA 3ZIAG 1VQKV 2QE7G 2EJRA 3FYIB 3UM7A 5B1AB 1PNMA 4H37A 5EBWC 1YHQV 3E89A 1NKDA 2WLIB 3K03A 3CCQV 2QTOA 3F7VC 1THZA 4WFEA 3ABMC 3E2EA 1R73A 2WWWA 3W7TA 3OMNB 3SPIA 5B1AC 2A9HA 1EZJA 3QO5A 3CC4V 2R9IA 3ABMB 4P2ZA 5LGTA 3F5WC 2EIMB 5CBFA 3H01A 4MVOA 4MVZA 1QR9A 3CXCU 3LDCA 4YXWG 2C2AA 1FXKA 4JTAB 2EIMC 3SPCA 4TT3G 3F7YC 1SRYA 3X2QB 2LP7A 2EZPA 3LSSA 3OEHG 2DYSC 2F43G 1ROPA 3ASNB 3K0GA 3VOUA 1CPYA 2A0LA 3OAAG 4UUJC 3CP1A 1FS0G 3RVYA 4LBEC 1VQ7V 1DF5A 1FXKC 1UJWB 3SYOA 1QCEA 1Q82W 1GO3F 2EILB 2HJFC 1IXMA 1FXKB 1AI6A 1QBZA 3I55V 1YJNV 1NQTA 3SYQA 3G71V 2P90A 3HPLC 4G28B 1VQPV 3KG2A 3JD1A 2BOBC 1JOYA 2WLJA 4RQEA 3QNEA 4JF3A 4I5SA 1KD1W 2Q67A 3LDEA 4ZKIA 1K97A 3B77A 3WG7B 5KUKA 5J9PC 3CCLV 3RBZA 1Q81W 2X7RB 4TWKA 1JVMA 1S3JA 1NR7A 4GX2A 4G2KA 2UXXA 4WFFA 3IFXA 3T2MA 4MVMA 3OEEG 1MABG 3M99B 3AEIA 3OE7G 1YTFD 1G8MA 3SYPA 3DTUB 1P7BA 3CCEV 4Z1MG 3JD4A 3OW2U 4MW3A 2D3OW 2X6AA 4MVSA 1K33A 4ASUG 5L3FA 4MTXA 2HLDG 4QNHB 1K5SA 2AHZA 2ZXWB 3ZMZA 1K4CC 2EIJC 4H33A 3TCUA 3X2QC 2JJ2G 4UXNA 4GX5A 1M1KW 2ZXWC 5H6QA 3ASNC 2KB1A 1MOFA 3CC7V 1FXVA 4ZBMA 2OTLV 1SZTA 2QM7A 4HAMA 1MSWD 1KC8W 1V55B 4JGSA 1VQ5V 4KUMA 5IYBO 2QEXV 2P67A 3JD2A 2PI5A 5L3GA 1H8HG 4EKWA 1GM8A 1V55C 4MSWC 1M90W 2YEVB 2ZR3A 1SETA 3GB7C 3W7WA 1NH2D 1E79G 2Z5UA 4WFBV 3ZMTA 2QA4V 1E1QG 4MW8A 2JJ1G 1VQNV 1R6KA 1CP9A 2XAHA 5LGNA 1S0VA 2B5UA 4MS2A 5L3CA 4FIPC 5EBMC 1I5XA 3CD6V 2LFSA 4P30A 2WLLA 1GK9A 1AJNA 4MT8A 1M56C 3SYAA 1JPXA 1JQ0A 2AHYA 3RW0A 3ZRWA 4PDRA 1VQOV 3D36A 1M9NA 4R7CA 1YSCA 1M56B 1GMGA 1R3LC 1OCOB 1OZ0A 1BHAA 3MHHC 5FL7G 1YTFB 1K4DC 2DW4A 3OM3B 4QIWF 1VQ4V 1Y66A 2EIKB 2H94A 4LP8A 1AR1B 5CN0A 3A0RA 1OCOC 1LNQA 2P7TC 4JYCA 3SYCA 3R65A 5B3SB 2JEXA 3OGCC 2B1IA 2HVKC 1JCHA 4X88A 2EIKC 2LFRA 1NR1A 4GCZA 3RVZA 1K7DA 3BY6A 1PL0A 1RPOA 3AG4B 4XDLA 1FFTB 3GWOA 2HR3A 1RM1B 1OCZC 4F4LA 2MK3A 2OTJV 2EIJB 1YITV 3AG4C 1VQMV 3EHBB 3FYEB 2GHYA 1M57C 2W0FC 3K0DA 1OCZB 5EC1C 2QM8A 1E1RG 3LUTB 2ZDIC 4MVQA 5HFMA 2Y69C 1F4NA 1EBOA 3EFFK 1F23A 1NBMG 1KP2A 2Q68A 2DYRB 1W0KG 1W2BU 3T4DA 5EK0A 4RUEA 3ETDA 4JASA 1Q7YW 1NH2B 4JPRA 4OXSA 1KP3A 3ZN0A 2Y69B 3K04A 1VQ8V 2IJIA 2DYRC 5C93A 3T4ZA 1K8AW 3WFVA 1OCRC 1GKFA 1AROP 3ASOB 2WSSG 1COWG 1NVPD 1S77D 1QLEB 2XAJA 3E8BA 3ABLC 1OCRB 3ABTA 4MTGA 2ZD9A 3FKSG 1F51A 2JEUA 3ASOC 3TK1A 3ZMVA 2X6BA 1P4RA 1QLEC 1R3JC 1PNKA 3G4SV 2XOKG 3ZRWB 3OMIB 1ENVA 3OFNG 2V1DA 4N21A 5BZBA 5B1BC 3E35A 2ITCC 1CEZA 3VBBA 1J95A 1S76D 4HYOA 4PA4A 3K06A 2NLJC 5B1BB 3CCUV 3HB3B 4QE7A 4LCUC 1AI4A 1JX9A 3ZRVA 3CCMV 1VQLV 1GM7A 3JD0A 1KECA 1R3KC 3CYOA 2WLKA 3W7SA 4PDVA 1GM9A 3JD3A 3AG1C 2WLHA 5KUMA 1V54C 5KA6A 3LNMB 1MG1A 2JK5C 5B3SC 5LGUA 1PD3A 1H8EG 3OUFA 3STZC 3SJQC 3ZMUA 1V54B 4X89A 1RM1C 1AJPA 2DWDC 4QPJA 5DN6G 1I5YA 1K3EA 1S72V 4CBCA 3OUSA 4KFMA 4GT1A 1M57B 3ABKC 1SESA 4UVCA 2IU3A 3T1CA 1B6QA 1KQSU 3ZN1A 4LC1A 3ABKB 1F4MA 4QPKA 5DM6V 2IJKA 2XAFA 2Q69A 2WLNA 4FMTA 4JAVA 2W6IG 5IY5B 4PA6A 1DLBA 4GX0A 4UV9A 1AI5A 2IJJA 4XDJA 3AG2C 2IW5A 2A79B 3BEHA 5IY5C 3ABLB 2XAGA 3E8FA 4R8CA 3CCSV 4KP4A 5B1OA 3AG3B 1W0JG 4GX1A 4WFHA 5CBHA 1N8RW 1YJ9V 3SPJA 5L3BA 4MTFA 4FJCC 2EINB 2GSMB 2P6JA 4BW5A 2UXNA 3W7XA 1PKXA 5L3EA 3E8GA 4PELA 2YEVA 2W6JG 5EBLC 5CBGA 2OCCB 4PDMA 1R3IC 1BHBA 2B1GA 5IDJA 4WF9V 2Q6AA 3UKMA 2WAMA 2OCCC 3ZMSA 2HFEC 3FB5C 3K08A 5L3DA 4MVUA 2V7QG 4PDLA 5EC2C 4RAIA 4J9ZB 3K9AA 2DQ3A 3P30A 3AG1B 5CMUA 3OR7C 1JJ2U 1SERA 2R9RB 2HG5C 2XNDG 3JCZA 4RO2A 4QJFB 1YIJV 3CCRV 1WLEA 2JIZG 3QO7A 2M7WA 3I56V 2IU0A 4JAUA 5B1NA 1DF4A 1QR8A 3E86A 5GW7A 3W7UA 4BAYA 2Z3YA 2XAQA 4TSFG 2BOCC 5H6RA 3CMEV 1FXHA 4R50A 2WLLB 4JTCB 5LHGA 3E83A 3PJSK 3FB8C 2IH1C 5IYCO 4MTOA 1DTOA 3CCJV 4N23A 2ZDIA 1ZWIC 2IJHA 4Q20A 1WPXA 3ZRXA 1AJQA 1XL6A 1K34A 4CZZA 2OT5A 4XBFA 3LDDA 2PI4A 3B8MA 5KA5A 3E8HA 4PA9A 3FB7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 W;  4WF9 V;  3CXC U;  1VQ4 V;  1M1K W;  1VQ9 V;  3I55 V;  1YJN V;  1Q7Y W;  4WFA V;  3CC7 V;  1QVG U;  3G71 V;  3CC2 V;  1VQK V;  1VQ8 V;  3CME V;  2OTL V;  1K8A W;  1VQP V;  3CCS V;  1KC8 W;  3CD6 V;  3CPW U;  1VQ5 V;  3CCV V;  1YHQ V;  1KD1 W;  1S72 V;  2QEX V;  3CCJ V;  3CMA V;  3CCQ V;  3CCE V;  3CCU V;  1N8R W;  3CCM V;  1R73 A;  1YJ9 V;  1VQL V;  3CCL V;  1VQ7 V;  1YI2 V;  3OW2 U;  1M90 W;  1YJW V;  2D3O W;  1K9M W;  1YIT V;  1JJ2 U;  2OTJ V;  1VQM V;  1VQO V;  1Q81 W;  3CC4 V;  4WCE V;  3G6E V;  1YIJ V;  3CCR V;  1NJI W;  1KQS U;  5DM6 V;  1Q86 W;  4WFB V;  1Q82 W;  1QVF U;  3I56 V;  2QA4 V;  1VQ6 V;  1VQN V;  3G4S V;  1W2B U; 
#chains in the Genus database with same CATH topology
 3P32 A;  2UXC B;  4X8A A;  4LWS A;  4UCU A;  3DC6 A;  3JAM N;  3OR6 C;  4DV4 B;  3JAR A;  3K79 A;  1L1F A;  3WB0 A;  2EIN C;  1AP5 A;  2ZQM A;  4IT5 A;  2VS0 A;  2E5L B;  4BWA A;  1PNL A;  1K9M W;  5CB4 A;  1EFR G;  3ABU A;  4GKK O;  2WLM A;  1S5H C;  2YID A;  2IH3 C;  5LA6 B;  4UV8 A;  5JVD B;  5IYD O;  3STL C;  5JCO A;  3CE2 A;  1WP8 A;  1GTO A;  1JMK C;  1OCC B;  4JI1 B;  3E22 B;  1XMQ O;  2ZR2 A;  1RPR A;  4LF4 B;  3B8N A;  4LFB O;  4NKG B;  3CCV V;  3LNN A;  2OCH A;  4DXW A;  1BZK A;  1KU9 A;  3D3I A;  3NXS A;  3SGI A;  3CRQ A;  1NJI W;  2N05 A;  2HKO A;  3NR7 A;  5KX5 A;  4X9Q A;  1AI7 A;  2DN9 A;  1QVF U;  2PYJ A;  1R6N A;  3SJB C;  4AIL C;  2EIL C;  4B08 A;  4FK5 C;  2YIB A;  5FNV B;  4JI1 O;  2NNU A;  2IBZ H;  4W4L A;  1N32 B;  3H1L H;  5LOV B;  1TUB A;  2UXD B;  5GTH Z;  4O4H A;  2K1E A;  3WB2 A;  3T1H O;  2ILM A;  4WFA V;  5CA1 A;  5LA6 A;  3KZI Z;  2QE7 G;  3FYI B;  5DED A;  5EBW C;  4ZI7 B;  1NKD A;  1Y6X A;  4DV0 O;  3K03 A;  3CCQ V;  3F7V C;  1THZ A;  4WFE A;  1N0J A;  3G80 A;  3L71 H;  1LUW A;  4P2Z A;  4HNA B;  2EIM B;  4X66 B;  3MDS A;  5CBF A;  3H01 A;  4MVZ A;  1QR9 A;  2KG7 A;  2KQX A;  4O4I A;  1BS3 A;  1R6T A;  4OX9 O;  3SPC A;  2HP8 A;  4TT3 G;  3F7Y C;  1SRY A;  3LSS A;  1SF9 A;  2DYS C;  3ASN B;  3VOU A;  1RSO A;  2A0L A;  2OIE A;  1CXZ B;  4UUJ C;  3G67 A;  1N0N A;  1Q82 W;  2HJF C;  1X4T A;  2ADQ B;  3CB2 A;  1AI6 A;  2GBO A;  4CH3 A;  4DUY B;  5LOV A;  3B09 A;  2P90 A;  4JI3 B;  4J41 A;  4G28 B;  1JOY A;  4UB8 Z;  4CS3 A;  3LDE A;  3RWR D;  4K0K O;  1ZSP A;  3WG7 B;  3UQ8 A;  1XHZ A;  3CCL V;  3GWK C;  3K9S A;  5EYP A;  1Z5W A;  3B40 A;  2QDO A;  1KKC A;  2UXX A;  1H2K A;  2P4V A;  4MVM A;  3K59 A;  3AEI A;  2BTO A;  4J80 A;  4DR2 O;  1AR5 A;  3ZS8 C;  2EX3 A;  4IL6 Z;  1HDJ A;  4MW3 A;  4MTX A;  1K5S A;  2ZXW B;  5IJ9 B;  4YHH B;  3TCU A;  4JI0 O;  4UXN A;  1M1K W;  2ZXW C;  3ASN C;  1TVK A;  4ZBM A;  2QM7 A;  3E22 A;  1MSW D;  1KC8 W;  5IYB O;  2YI8 A;  3SJC C;  4FLY A;  1IBL B;  5L3G A;  1GM8 A;  4AQY O;  2YEV B;  2ZR3 A;  2LGW A;  3W7W A;  1E79 G;  1UFI A;  3ZMT A;  1E1Q G;  2L35 A;  4DR1 O;  4GYC B;  1WB8 A;  4FIP C;  5EBM C;  2LFS A;  1HW7 A;  1AB3 A;  4FVM A;  1M56 C;  2GUZ A;  2QWN B;  3JAW B;  1G6U A;  1GN3 A;  3T1Y O;  1OCO B;  1OZ0 A;  3BHP A;  1K4D C;  3CS5 A;  2NR5 A;  2EIK B;  4LP8 A;  3TXQ A;  5CN0 A;  3R65 A;  5B3S B;  2EIK C;  1WA8 B;  1PL0 A;  4OPH A;  2P4K A;  3AG7 A;  1RM1 B;  1NZ6 A;  1KYO F;  1VQM V;  3EHB B;  1IVS A;  2R9A A;  2ZNJ A;  2W0F C;  3K0D A;  1R1B A;  3LUT B;  4MVQ A;  2Y69 C;  1FJG B;  1FYJ A;  2DE0 X;  1W0K G;  3UT5 B;  4Q6G A;  2PTM A;  4X62 B;  4YY3 O;  3HKB B;  4I0X A;  4JAS A;  5KX5 B;  2DYR C;  5C93 A;  3T4Z A;  1H2L A;  1ARO P;  1COW G;  4BW9 A;  2PUS A;  2A06 H;  4TV8 A;  1F51 A;  3ASO C;  3TK1 A;  2X6B A;  1P4R A;  1QLE C;  1FJG O;  3U0Z A;  5J2T A;  4CH6 A;  1N36 O;  1GN4 A;  3OMI B;  5JJJ B;  2ZE8 A;  2ZIO A;  2XHB A;  5B1B C;  3E35 A;  3OT7 A;  2QWO B;  1S76 D;  4PA4 A;  3K06 A;  1T5E A;  3HB3 B;  1AR4 A;  5GON B;  2UUC B;  1AI4 A;  1V9P A;  1R3K C;  3W7S A;  4W4K A;  1S5L Z;  3T1Y B;  4B3R B;  5LGU A;  1PD3 A;  1H8E G;  1YCI A;  3OUF A;  3RFR A;  3ZMU A;  1GRJ A;  5H2F Z;  3RYI A;  4O4L A;  1AJP A;  2YS8 A;  2CTP A;  2GDS A;  1S72 V;  3OUS A;  1Y74 B;  3ABK C;  1MA1 A;  1SES A;  4UCR A;  5LXT B;  2E3C A;  4OPA A;  2IU3 A;  2Z0A A;  3T1C A;  4LFA B;  4X64 O;  3ABK B;  2Q69 A;  4DW0 A;  4TUY A;  4GX0 A;  1B06 A;  1H2S B;  3BEH A;  3ABL B;  3E8F A;  4R8C A;  3CCS V;  4KP4 A;  2L6L A;  5B1O A;  3DC5 A;  1N4C A;  2RNB A;  3S3X A;  1TUB B;  1VAR A;  2P6J A;  1I7F A;  4DUZ B;  4DRX A;  1NTZ H;  2YEV A;  5CBG A;  3AK2 A;  2ZM6 B;  1JR9 A;  3K5N A;  2Q6A A;  5D5Q A;  5KAF Z;  5EIB C;  4D6T H;  3AK3 A;  1D5N A;  4MVU A;  4J9Z B;  3K9A A;  4I55 B;  4O4L B;  3CRC A;  3K5O A;  1SER A;  5JQG A;  4RO2 A;  5BMV B;  1I0H A;  1FFX A;  1X59 A;  1PPJ H;  2IU0 A;  4LF5 O;  2UXD O;  1P84 F;  4QGP A;  5B1N A;  5CB4 B;  5GW7 A;  4B3T B;  3P3P A;  5JCO C;  3EXA A;  1XDC A;  2QJ1 A;  5H6R A;  2WLL B;  3PJS K;  4U3F H;  5EZY B;  3BAA A;  2QR4 A;  3ZX6 A;  4Q20 A;  3C3S A;  4YY3 B;  3ZRX A;  1YDX A;  4DR4 O;  4X1Y B;  1K34 A;  1N34 B;  3B8M A;  4JYY A;  2XAS A;  5LHH A;  3CRM A;  2GV9 A;  1K5Q A;  3KCX A;  3IC9 A;  4UCS A;  2HVJ C;  3CMA V;  4DV7 B;  1VF6 A;  1SQG A;  3IC7 A;  1H2G A;  1XMQ B;  3MAQ A;  1N34 O;  1Q86 W;  2X0L A;  4Z1V A;  1J5E O;  4LF6 B;  3LSQ A;  3HKE A;  4P9O A;  4U7O A;  4LWS B;  2CK3 G;  2JDI G;  2WPD G;  2DWE C;  4ZHQ A;  2PY5 A;  1OCC C;  5IYZ B;  4B3T O;  4DR5 O;  1SQP H;  5B66 Z;  4DUY O;  3BFR A;  2Q7G A;  4XDK A;  3TXS A;  4B3S B;  4U7N A;  1WP7 A;  2R72 A;  4JTD B;  3IGA C;  2F95 B;  4AQY B;  1TUE B;  2AZ0 A;  3FB6 C;  4QE9 A;  5BMV A;  3BA9 A;  2P06 A;  2E76 B;  3UCS C;  1G4Y B;  2ZM6 O;  4JI0 B;  2GTS A;  2M6Y A;  1BMF G;  1WAZ A;  2ZE5 A;  3DGE A;  3RN4 A;  4WCE V;  3G6E V;  4I9W A;  2FYU H;  4E4E A;  4DV7 O;  5LMU O;  2EBO A;  3ETQ A;  4FFK A;  1GN2 A;  4LFC B;  2AW9 A;  3K57 A;  3SPG A;  2ZE7 A;  3ZIA G;  4FZ0 A;  4H37 A;  3M8A A;  3C3T A;  2QTO A;  3E2E A;  3ABM C;  2WWW A;  2GTA A;  2A9H A;  1QHT A;  2R9I A;  5LGT A;  3F5W C;  1IBM B;  3CJH B;  1WB7 A;  3LDC A;  3VQV A;  2YIA A;  1FXK A;  3HR0 A;  3N27 A;  3OTF A;  2LP7 A;  2Q8V A;  5BXZ A;  2F43 G;  2D2C B;  3K0G A;  4JI3 O;  2OWO A;  3OAA G;  5E79 Z;  4X1I A;  4DV4 O;  1FS0 G;  4LBE C;  4O4J A;  1WN7 A;  2CH7 B;  1DF5 A;  1FXK C;  2GUZ B;  1UJW B;  5TIS Z;  4K3A A;  3VQX A;  2EIL B;  1GN6 A;  4CC6 A;  1QBZ A;  2CTR A;  3SYQ A;  3JAS A;  4X65 B;  1VQP V;  1BGY H;  4KHP O;  2Q67 A;  1D5A A;  3QG5 A;  1XOU A;  1Q81 W;  2X7R B;  1I94 B;  1JFF B;  2LW7 A;  1MNG A;  4WFF A;  2VWJ A;  3T2M A;  2F23 A;  3CSX A;  4D7T A;  2B9Z A;  3M99 B;  1YTF D;  2DOS A;  2WA3 A;  2JS5 A;  2X6A A;  1BQ0 A;  3BRC A;  3L74 H;  1K4C C;  4BR6 A;  4O4J B;  3X2Q C;  4GX5 A;  1O9H A;  4O2B B;  1FFX B;  1FXV A;  2OTL V;  1SZT A;  4HAM A;  5KLV H;  2ETN A;  1V55 B;  4JGS A;  2QEX V;  2P67 A;  3JD2 A;  2PI5 A;  4B3R O;  4PD4 F;  4I7Z B;  4MSW C;  4DW1 A;  1M90 W;  4NXM B;  1SKV A;  4GZR B;  3GB7 C;  4IIJ B;  4UCO A;  4TUY B;  2ZNI A;  4WFB V;  3Q4H A;  2UUC O;  4DV5 B;  4UB6 Z;  5LGN A;  4J11 A;  2B5U A;  3D36 C;  1RFY A;  1JFF A;  4LF8 O;  1BT8 A;  2ODM A;  1I5X A;  2R70 A;  3OTO O;  2Y0P A;  1GK9 A;  5EIB D;  3WU2 Z;  4MT8 A;  3T1H B;  1JQ0 A;  5BR8 O;  4D7S A;  1VQO V;  2RCV A;  4R7C A;  1VP7 A;  2Y4U A;  2VQF O;  1M56 B;  3BCC H;  1BHA A;  1DGS A;  4TV9 A;  3OM3 B;  1XNR O;  4JI4 B;  1O9G A;  3N2K A;  1IBK B;  2P7T C;  2JEX A;  3OGC C;  1AP6 A;  1HNZ B;  1XMO O;  2FB5 A;  2LFR A;  2YIC A;  1K7D A;  3BY6 A;  1RPO A;  2EUL A;  1FFT B;  3GWO A;  1TAE A;  4LF8 B;  1OCZ C;  2Q9L A;  2EIJ B;  1YIT V;  3HKD A;  4K35 A;  1M57 C;  1SQX H;  4O4H B;  1F4N A;  1NTK H;  4J10 A;  2Q68 A;  2QGN A;  1HR0 B;  4RUE A;  3ETD A;  4FM0 A;  1Q7Y W;  4NXM O;  4OXS A;  3ZN0 A;  3K04 A;  1VQ8 V;  1ZLZ A;  4LFB B;  1K8A W;  1M4U A;  1OCR C;  3RYH A;  3E8B A;  3ABL C;  3BVO A;  2BCC H;  4KXR A;  5J2U B;  4PJ0 Z;  4X66 O;  4JI5 B;  3FKS G;  5LP6 A;  2QM4 A;  4UCT A;  3OFN G;  2V1D A;  2VWK A;  4DV1 O;  3DXR B;  5BZB A;  1IUR A;  3VBB A;  4U3J B;  2CUG A;  1L0N H;  3N2G B;  2NLJ C;  1BCC H;  1JA8 A;  2XUM A;  3ZRV A;  3CCM V;  1IBK O;  3CYO A;  3KCY A;  4PDV A;  2WLH A;  1US6 A;  1AIL A;  3B2E E;  3LNM B;  1MG1 A;  5KA6 A;  2HEP A;  5B3S C;  4I50 A;  5IE9 A;  3I5D A;  1HNW O;  1V54 B;  4X89 A;  5DN6 G;  4OX9 B;  1VEW A;  1MZE A;  1NS1 A;  4CBC A;  1N33 O;  3RT3 C;  1YVW A;  4KHP B;  4GT1 A;  4X65 O;  1XNQ B;  1VIB A;  1B6Q A;  2JGD B;  4DV5 O;  1KQS U;  3ZN1 A;  2YXH A;  4B3M O;  4JAV A;  3L70 H;  3JAR B;  4DR2 B;  1G1X B;  4UV9 A;  1AI5 A;  2IJJ A;  4XDJ A;  3AG2 C;  4O2A B;  4DV6 B;  3WB1 A;  4LF4 O;  1W0J G;  3U10 A;  1N8R W;  3SPJ A;  2CE4 A;  2EIN B;  3W7X A;  1PKX A;  1W59 A;  2EJ7 A;  3E8G A;  5L3E A;  3LSU A;  4PDM A;  4DK1 A;  4WBN A;  4ZIB A;  4FLV A;  2B1G A;  5BR8 B;  3JAL A;  4CS2 A;  2WAM A;  3ZMS A;  4LR3 A;  1VMG A;  3K08 A;  5H5N A;  5FPR A;  3ZHS A;  5A2Q N;  4LF7 O;  5EC2 C;  4PDL A;  2QKA A;  3P3N A;  3OR7 C;  4LFC O;  2HG5 C;  4O4I B;  1YIJ V;  1WLE A;  3QO7 A;  2M7W A;  1XIL A;  3I56 V;  4JAU A;  1I94 O;  3E86 A;  2OYQ A;  3W7U A;  4BAY A;  2Z3Y A;  2LQT A;  3CME V;  3N2K B;  4R50 A;  4JTC B;  5LHG A;  1HNX O;  3E83 A;  3FB8 C;  5IYC O;  4TQD A;  1Y67 A;  4N23 A;  2ZDI A;  5J2T B;  1ZWI C;  4DR3 B;  4NXN O;  4CZZ A;  3IJ4 A;  2OT5 A;  3CWB H;  4L8J A;  2Q7E A;  5KA5 A;  4LNU A;  2Q0A A;  3CHX A;  5C8Y A;  4LF9 O;  3K3W A;  4MVR A;  4CH4 A;  3AG3 C;  4AI8 A;  1KUQ A;  2FTK A;  4UVB A;  1WJZ A;  5EZY A;  3CRR A;  4J9Y B;  4F6R A;  4YJ3 B;  4J7K A;  4DV3 O;  1K92 A;  2Q7H A;  2ITD C;  1EZV H;  3ML0 A;  3L73 H;  1RP3 B;  4DO2 A;  3THO A;  3U11 A;  3ZBH A;  1IX9 A;  1VF5 B;  5JWP A;  4I55 A;  4DV2 B;  3ETG A;  4C7U A;  2Y48 A;  1GAX A;  5LMN O;  4RUF A;  2UUB O;  4NYK A;  4TOI A;  5LHI A;  4J42 A;  1SA0 A;  4UVA A;  4U3J A;  3DSQ A;  4P9P A;  4TV8 B;  2VQE O;  1BL8 A;  4L87 A;  3OGI B;  2DYS B;  1HWY A;  5FNV A;  5HFL A;  5LMU B;  5KMG B;  2VQE B;  1Z2G A;  4UCV A;  2YSU B;  4H13 B;  4A5U B;  5CA3 A;  1LR1 A;  5IYZ A;  1XMO B;  4RQF A;  3RYF A;  4JV5 O;  2PGG A;  1WNS A;  1XL4 A;  3ZRS A;  3QF7 A;  4GKK B;  5LBQ A;  2VQF B;  3WG7 C;  2RDC A;  5LYJ B;  1K73 W;  2QKS A;  2JVD A;  4PA3 A;  1UPG A;  2H8P C;  3D8C A;  3O9O A;  4JYB A;  1VQK V;  3VQY A;  1NTM H;  5B1A B;  1PNM A;  5IJ0 A;  2UXC O;  3HKB A;  4I0X B;  2KSD A;  2WLI B;  4IHJ A;  2JGU A;  3OMN B;  3SPI A;  1PV0 A;  1EZJ A;  3QO5 A;  2LO1 A;  4NTX A;  4X20 B;  3CC4 V;  3N2G A;  3ABM B;  4TV9 B;  1VF7 A;  1SQB H;  1Q3E A;  2YC0 A;  3CXC U;  5D5P A;  1YZB A;  2C2A A;  5CA0 B;  4NTW A;  4UFZ A;  3X2Q B;  2EZP A;  3OEH G;  1ROP A;  4I50 B;  3B4S A;  3RVY A;  4EB6 B;  4CS4 A;  3SYO A;  2K9P A;  1SQF A;  2AXT Z;  2H3O A;  4Z2W A;  4B3S O;  4GKJ B;  1FXK B;  2F1M A;  1YJN V;  1NQT A;  3J7A U;  3G71 V;  3HPL C;  2YUA A;  3JD1 A;  2WLJ A;  1H2M A;  4JF3 A;  4I5S A;  1KD1 W;  4FZ1 A;  1K97 A;  3RYC A;  2FML A;  1XNR B;  1Z5V A;  5IWA O;  4O2A A;  5J9P C;  3D3Q A;  3F5T A;  3RBZ A;  5IJ0 B;  1GH6 A;  3QVN A;  1S3J A;  3TGU H;  2HJD A;  2Y0I A;  3IFX A;  2LGQ A;  1F7Y A;  2F4V O;  1A32 A;  3VQW A;  1IZ3 A;  2N04 A;  2N74 A;  1HR0 O;  3DTU B;  2XTA A;  2F66 C;  3JD4 A;  4MVS A;  4GUN A;  1K33 A;  4B7K A;  1S5J A;  4ASU G;  5L3F A;  4QNH B;  2HLD G;  1L8D A;  5JQG B;  3ZMZ A;  2UU9 B;  4EFB A;  4DR6 B;  2EIJ C;  1Q6I A;  2A7W A;  3M7M X;  1MOF A;  5ITZ A;  3DXR A;  1EN6 A;  1ZL8 B;  2W0X A;  3R66 A;  1H8H G;  2P22 C;  1V55 C;  1URF A;  1SET A;  3H1K H;  4LF5 B;  2Z5U A;  2V4D A;  1VQN V;  1R6K A;  1CP9 A;  1FD9 A;  5KHH A;  2XAH A;  3RGB A;  2RJZ A;  2ZT9 B;  4J7J A;  4EB6 A;  4PHZ A;  5A9G A;  3CD6 V;  4FFB A;  2UUA O;  5KHG A;  2E75 B;  1JPX A;  3RW0 A;  3ZRW A;  2Q0O C;  1M9N A;  1GMG A;  1R3L C;  1U97 A;  4DUZ O;  3MHH C;  5FL7 G;  1YTF B;  2ZIM A;  2DW4 A;  3EVK A;  4ZOL A;  4QIW F;  1AR1 B;  5KHJ A;  4DR7 B;  4JYC A;  4JI6 O;  4JI7 B;  2HVK C;  4O2B A;  1JCH A;  4X88 A;  4GCZ A;  2Q4P A;  3AG4 B;  4CH5 A;  1PM9 A;  1ZUQ A;  2HR3 A;  1SA0 B;  2MK3 A;  1OV9 A;  2OTJ V;  1QNM A;  3FYE B;  3S3W A;  1OCZ B;  2QM8 A;  1E1R G;  1BQZ A;  2ZDI C;  5HFM A;  4IIJ A;  1EBO A;  1NBM G;  1KP2 A;  2FL4 A;  4IYI A;  3T4D A;  1NH2 B;  4JPR A;  1KP3 A;  4I4T A;  4OGQ B;  4JYA B;  1IBL O;  2ADP A;  3WFV A;  3SDL A;  2WSS G;  1S77 D;  1QLE B;  4MTG A;  2ZD9 A;  1M93 A;  2JEU A;  4DK0 A;  2VRZ A;  3ZMV A;  4FLU A;  1R3J C;  4K8Z A;  1Y76 A;  2YXL A;  3G4S V;  2XOK G;  3ZRW B;  1EM1 A;  4FLZ A;  2ITC C;  1CEZ A;  5FLX N;  4HYO A;  4J7Z A;  5J2U A;  5B1B B;  5JH7 A;  3CRA A;  2G38 A;  1IDS A;  4LCU C;  1JX9 A;  1YXB A;  4JI7 O;  5GTI Z;  3RYC B;  1KEC A;  3JAK A;  1N36 B;  3JD3 A;  2PZS A;  3AG1 C;  1V54 C;  5LXT A;  3ICX A;  4ZHQ B;  4BIO A;  2Q73 A;  3CX5 F;  3STZ C;  3SJQ C;  4FLX A;  2YXY A;  4QPJ A;  5JVD A;  1K3E A;  3JSL A;  3A0H Z;  4KFM A;  1M57 B;  4UVC A;  2LW1 A;  4EFE A;  4LC1 A;  4QPK A;  1B3Q A;  1LUV A;  2IJK A;  5DM6 V;  2XAF A;  2HHH O;  3RYI B;  4FMT A;  2W6I G;  1YEW A;  1DLB A;  2ARH A;  2XT9 A;  1Y74 A;  3UT5 A;  1ZTE A;  2IW5 A;  1P49 A;  3L72 H;  4NVP A;  5B5E Z;  3K5M A;  1MMM A;  4WFH A;  5CBH A;  1YJ9 V;  5L3B A;  4FJC C;  2GSM B;  4BW5 A;  5EYP B;  1QU7 A;  4PEL A;  1Q43 A;  2W6J G;  3G6B A;  4FLT A;  2QSA A;  1Q90 D;  4YIO A;  2BTQ B;  5L3D A;  4YJ2 B;  4AHC A;  2V7Q G;  2DQ3 A;  4NTY A;  3P30 A;  5CMU A;  3ZHT A;  2XND G;  4QJF B;  3OD4 A;  3CCR V;  2JIZ G;  4PI2 A;  4DR4 B;  4DR5 B;  2AZ2 A;  3ZED A;  4TSF G;  3FAV B;  5IWA B;  1FXH A;  3KKY A;  2IH1 C;  4ABM A;  1DTO A;  2A3Q A;  3CCJ V;  4JV5 B;  3L75 H;  1IBM O;  1WPX A;  1AJQ A;  3H1H H;  1XL6 A;  3A2F A;  2Y4T A;  4XBF A;  3LDD A;  3ZHV A;  3FB7 C;  3AG2 B;  4E2L A;  4WBN B;  2X6C A;  3ETE A;  3TJT A;  3MD0 A;  2CGO A;  3O65 A;  3FD9 A;  3CPW U;  2BSK A;  2PYL A;  1XBL A;  2DMX A;  1ORQ C;  4JI6 B;  4R6Z A;  2P5O A;  3SR2 C;  4FPP A;  1OJH A;  3SPH A;  1YJW V;  2UUB B;  3A0B Z;  1B04 A;  5AG2 A;  4KL1 A;  3FFQ A;  3QO8 A;  5E1A C;  1VQ9 V;  4G27 B;  2ATK C;  3CEI A;  1Y4M A;  3RYH B;  4BIU A;  1NVP B;  2JGD A;  1OHH G;  4ZOL B;  2ZKO A;  1XQ8 A;  5K1X A;  4PA7 A;  1H38 A;  3J80 N;  4HNA A;  4GKJ O;  3JYC A;  2QTS A;  2WLI A;  3C90 A;  4X64 B;  4LH7 A;  3UO2 A;  2RMK B;  2DQ0 A;  4YJ2 A;  2EZO A;  4ICG A;  4NXN B;  4DR3 O;  1NU1 H;  4X1K B;  1QVG U;  3CC2 V;  3MHS C;  4BIZ A;  2RN9 A;  3A8T A;  3OMA B;  1HNX B;  1KKD A;  3J81 N;  3Q4H B;  1J5E B;  4LF6 O;  5KHK A;  1QLN A;  1YI2 V;  1U96 A;  3TET A;  5H9C A;  1VQ6 V;  3ZCC A;  1AVM A;  3ZJZ A;  4HZ3 A;  5KHI A;  3HKC A;  4WFG A;  5BY1 A;  2CTQ A;  1FAF A;  4FFB B;  4PI0 A;  2EJR A;  3UM7 A;  4IGG A;  1YHQ V;  3E89 A;  1R73 A;  3W7T A;  2HHH B;  5B1A C;  4LFA O;  1KMI Z;  5LMN B;  1XRE A;  4FM1 A;  3APO A;  4MVO A;  4DV2 O;  2YI9 A;  2O57 A;  4YXW G;  1SS3 A;  1BSM A;  4JTA B;  2YIB D;  2EIM C;  1P7G A;  1CPY A;  1L0L H;  3SJA C;  4X62 O;  3K58 A;  3CP1 A;  1VQ7 V;  4YHH O;  2ZE6 A;  1IXB A;  1QCE A;  1GO3 F;  1IXM A;  4I4T B;  4TQF A;  4ZI7 A;  4FLW A;  3I55 V;  2NN4 A;  2WA4 A;  5LP6 C;  2IM9 A;  3KG2 A;  1N33 B;  2BOB C;  3L9D A;  3GVM A;  4EEQ A;  4RQE A;  3QNE A;  4ZKI A;  4RWU A;  3B77 A;  5LP6 B;  5ITZ B;  5KUK A;  2AGA A;  1XI1 A;  2LJ2 A;  4TWK A;  1JVM A;  4X1K A;  1NR7 A;  4GX2 A;  4X20 A;  2Q5Z A;  2JRI A;  1KBH A;  2UUA B;  1Q5O A;  3OEE G;  1MAB G;  3IAY A;  4JYA O;  5CA0 A;  1TVK B;  3OE7 G;  5K1P A;  1D2D A;  2KKW A;  1G8M A;  2JS3 A;  3SYP A;  3CXH F;  1P7B A;  3CCE V;  4Z1M G;  5KMG A;  3OW2 U;  1MZF A;  3HKC B;  4DV1 B;  2D3O W;  1FPO A;  3UO3 A;  2AHZ A;  3PN1 A;  1XHX A;  1EN4 A;  4PV1 B;  4DRX B;  4H33 A;  2JJ2 G;  5H6Q A;  3H1I H;  2KB1 A;  3CC7 V;  1NI8 A;  2OIG A;  1QQC A;  1Q6U A;  3JAT A;  4KUM A;  1VQ5 V;  1BE3 H;  1WPB A;  3APQ A;  4FM2 A;  4EKW A;  1TGO A;  3JCU Z;  2BE3 A;  1NH2 D;  4B3M B;  3JAK B;  2QA4 V;  4MW8 A;  4NR1 A;  2JJ1 G;  4H44 B;  4H0L B;  2ZIN A;  5IT9 N;  2CDY A;  1S0V A;  1XNQ O;  4MS2 A;  4JAA A;  5L3C A;  3BAB A;  5C8Y B;  1RSO B;  4P30 A;  4DR1 B;  1SZX A;  2WLL A;  2F4V B;  1HNZ O;  1AJN A;  1SQQ H;  3SYA A;  2UXB B;  2AHY A;  1YF2 A;  4PDR A;  2PF4 E;  4DYL A;  3D36 A;  1YSC A;  2FKX A;  1PP9 H;  1XEQ A;  1VQ4 V;  1Y66 A;  2H94 A;  4K0K B;  5FPO A;  3A0R A;  1OCO C;  1LNQ A;  3SYC A;  1Y76 B;  1Q6H A;  2MW2 B;  2B1I A;  3CJH A;  5GON A;  3ZHU A;  3RVZ A;  1NR1 A;  4XDL A;  2QKC A;  5JJN B;  4F4L A;  2UU9 O;  4HBN A;  3AG4 C;  2QWR B;  2GHY A;  4JI8 O;  5JH7 B;  5EC1 C;  1M5I A;  3EFF K;  1F23 A;  1W2B U;  2DYR B;  5EK0 A;  2QWP B;  2F93 B;  2Y69 B;  1KB9 F;  2IJI A;  3H1J H;  3ZHR A;  1NT2 B;  3HKD B;  4DR7 O;  1GKF A;  3ASO B;  1NVP D;  1HNW B;  2XAJ A;  1OCR B;  3ABT A;  3BA8 A;  1MSD A;  5CA1 B;  1PNK A;  4JI8 B;  1ZAU A;  3JAT B;  1ENV A;  4GLX A;  1SQV H;  4N21 A;  4DV0 B;  5LL6 Y;  4X1I B;  2BSK B;  4DV3 B;  4LF7 B;  1J95 A;  2CH7 A;  1Q8I A;  3CCU V;  4QE7 A;  1VQL V;  4F6E A;  1GM7 A;  3JD0 A;  4IHJ B;  4K8X A;  2KG7 B;  2WLK A;  1GM9 A;  1N32 O;  1JJO A;  5KUM A;  4JZ2 A;  2JK5 C;  1SC5 B;  2UXB O;  4JI2 B;  1XUQ A;  1RM1 C;  2DWD C;  5LYJ A;  1I5Y A;  3H9V A;  3OTO B;  2E74 B;  3JAW A;  4DR6 O;  2CTW A;  2CGN A;  2RQ6 A;  2YDE A;  1EN5 A;  5DEC A;  4LNU B;  1F4M A;  1PL4 A;  2WLN A;  3RYF B;  5IY5 B;  4PA6 A;  4JZG A;  1VF6 C;  4YJ3 A;  5KAI Z;  2ZCE A;  4LH6 A;  2QWQ B;  2A79 B;  5IY5 C;  1FKA O;  2XAG A;  3AG3 B;  1TA8 A;  4GX1 A;  3FAV A;  1DK1 A;  4X1Y A;  4JI4 O;  1I08 A;  4MTF A;  3AK1 A;  2UXN A;  4IYH A;  4I9Q A;  5EBL C;  2OCC B;  4B7E A;  1R3I C;  1BHB A;  3JSN A;  5IDJ A;  4WF9 V;  3UKM A;  2E5L O;  2OCC C;  1ZL8 A;  2HFE C;  2CAZ C;  3ZHQ A;  3FB5 C;  4NB5 A;  4DV6 O;  3JAS B;  4LF9 B;  4RAI A;  1WA8 A;  5IJ9 A;  3AG1 B;  3K5L A;  1JJ2 U;  2R9R B;  3JAL B;  3JCZ A;  3QTC A;  3BPZ A;  3HKE B;  5F2V O;  4JI5 O;  1DF4 A;  1H2N A;  1QR8 A;  4YIP A;  2XAQ A;  2BOC C;  2BTQ A;  3FX7 A;  4CC5 A;  4JI2 O;  1HP8 A;  4MTO A;  2IJH A;  1ZX3 A;  4F6R B;  5JJE B;  2PI4 A;  2DJV A;  3E8H A;  4PA9 A;  4G2K A; 
#chains in the Genus database with same CATH homology
 3AG2 B;  2XAS A;  5LHH A;  3P32 A;  4E2L A;  2X6C A;  4X8A A;  3K3W A;  3ETE A;  4MVR A;  3AG3 C;  3OR6 C;  3MD0 A;  1K5Q A;  2FTK A;  4UVB A;  3K79 A;  1L1F A;  4J9Y B;  3CPW U;  1K92 A;  2EIN C;  2ZQM A;  2ITD C;  2HVJ C;  1ORQ C;  3ML0 A;  3CMA V;  4R6Z A;  4FPP A;  4DO2 A;  3IC7 A;  1PNL A;  1H2G A;  3SPH A;  1YJW V;  1K9M W;  1EFR G;  3ABU A;  2WLM A;  1S5H C;  1Q86 W;  2X0L A;  3ETG A;  2IH3 C;  2Y48 A;  4UV8 A;  3QO8 A;  3LSQ A;  4P9O A;  4RUF A;  4U7O A;  3STL C;  5IYD O;  5E1A C;  2CK3 G;  2JDI G;  1GTO A;  1OCC B;  2WPD G;  1VQ9 V;  4G27 B;  2ATK C;  5LHI A;  2ZR2 A;  1Y4M A;  4BIU A;  2DWE C;  1RPR A;  1NVP B;  3B8N A;  4UVA A;  1OHH G;  1OCC C;  3CCV V;  4PA7 A;  4P9P A;  1BL8 A;  1H38 A;  4L87 A;  4XDK A;  2DYS B;  1HWY A;  4DXW A;  5HFL A;  3D3I A;  3NXS A;  1NJI W;  3JYC A;  2WLI A;  2HKO A;  4U7N A;  1AI7 A;  2DQ0 A;  1QVF U;  4JTD B;  3IGA C;  2EZO A;  1R6N A;  2YSU B;  1TUE B;  2EIL C;  5CA3 A;  1QVG U;  3CC2 V;  4FK5 C;  3MHS C;  4RQF A;  3FB6 C;  4QE9 A;  4BIZ A;  1XL4 A;  3OMA B;  2NNU A;  1KKD A;  3ZRS A;  1QLN A;  1G4Y B;  1YI2 V;  1BMF G;  3DGE A;  5LBQ A;  4WCE V;  3G6E V;  3WG7 C;  3TET A;  4I9W A;  5H9C A;  1VQ6 V;  3ZCC A;  2EBO A;  3ZJZ A;  4HZ3 A;  1K73 W;  2QKS A;  2K1E A;  4WFG A;  4PA3 A;  3SPG A;  4WFA V;  2H8P C;  4JYB A;  3ZIA G;  1VQK V;  2QE7 G;  2EJR A;  3FYI B;  3UM7 A;  5B1A B;  1PNM A;  4H37 A;  5EBW C;  1YHQ V;  3E89 A;  1NKD A;  2WLI B;  3K03 A;  3CCQ V;  2QTO A;  3F7V C;  1THZ A;  4WFE A;  3ABM C;  3E2E A;  1R73 A;  2WWW A;  3W7T A;  3OMN B;  3SPI A;  5B1A C;  2A9H A;  1EZJ A;  3QO5 A;  3CC4 V;  2R9I A;  3ABM B;  4P2Z A;  5LGT A;  3F5W C;  2EIM B;  5CBF A;  3H01 A;  4MVO A;  4MVZ A;  1QR9 A;  3CXC U;  3LDC A;  4YXW G;  2C2A A;  1FXK A;  4JTA B;  2EIM C;  3SPC A;  4TT3 G;  3F7Y C;  1SRY A;  3X2Q B;  2LP7 A;  2EZP A;  3LSS A;  3OEH G;  2DYS C;  2F43 G;  1ROP A;  3ASN B;  3K0G A;  3VOU A;  1CPY A;  2A0L A;  3OAA G;  4UUJ C;  3CP1 A;  1FS0 G;  3RVY A;  4LBE C;  1VQ7 V;  1DF5 A;  1FXK C;  1UJW B;  3SYO A;  1QCE A;  1Q82 W;  1GO3 F;  2EIL B;  2HJF C;  1IXM A;  1FXK B;  1AI6 A;  1QBZ A;  3I55 V;  1YJN V;  1NQT A;  3SYQ A;  3G71 V;  2P90 A;  3HPL C;  4G28 B;  1VQP V;  3KG2 A;  3JD1 A;  2BOB C;  1JOY A;  2WLJ A;  4RQE A;  3QNE A;  4JF3 A;  4I5S A;  1KD1 W;  2Q67 A;  3LDE A;  4ZKI A;  1K97 A;  3B77 A;  3WG7 B;  5KUK A;  5J9P C;  3CCL V;  3RBZ A;  1Q81 W;  2X7R B;  4TWK A;  1JVM A;  1S3J A;  1NR7 A;  4GX2 A;  4G2K A;  2UXX A;  4WFF A;  3IFX A;  3T2M A;  4MVM A;  3OEE G;  1MAB G;  3M99 B;  3AEI A;  3OE7 G;  1YTF D;  1G8M A;  3SYP A;  3DTU B;  1P7B A;  3CCE V;  4Z1M G;  3JD4 A;  3OW2 U;  4MW3 A;  2D3O W;  2X6A A;  4MVS A;  1K33 A;  4ASU G;  5L3F A;  4MTX A;  2HLD G;  4QNH B;  1K5S A;  2AHZ A;  2ZXW B;  3ZMZ A;  1K4C C;  2EIJ C;  4H33 A;  3TCU A;  3X2Q C;  2JJ2 G;  4UXN A;  4GX5 A;  1M1K W;  2ZXW C;  5H6Q A;  3ASN C;  2KB1 A;  1MOF A;  3CC7 V;  1FXV A;  4ZBM A;  2OTL V;  1SZT A;  2QM7 A;  4HAM A;  1MSW D;  1KC8 W;  1V55 B;  4JGS A;  1VQ5 V;  4KUM A;  5IYB O;  2QEX V;  2P67 A;  3JD2 A;  2PI5 A;  5L3G A;  1H8H G;  4EKW A;  1GM8 A;  1V55 C;  4MSW C;  1M90 W;  2YEV B;  2ZR3 A;  1SET A;  3GB7 C;  3W7W A;  1NH2 D;  1E79 G;  2Z5U A;  4WFB V;  3ZMT A;  2QA4 V;  1E1Q G;  4MW8 A;  2JJ1 G;  1VQN V;  1R6K A;  1CP9 A;  2XAH A;  5LGN A;  1S0V A;  2B5U A;  4MS2 A;  5L3C A;  4FIP C;  5EBM C;  1I5X A;  3CD6 V;  2LFS A;  4P30 A;  2WLL A;  1GK9 A;  1AJN A;  4MT8 A;  1M56 C;  3SYA A;  1JPX A;  1JQ0 A;  2AHY A;  3RW0 A;  3ZRW A;  4PDR A;  1VQO V;  3D36 A;  1M9N A;  4R7C A;  1YSC A;  1M56 B;  1GMG A;  1R3L C;  1OCO B;  1OZ0 A;  1BHA A;  3MHH C;  5FL7 G;  1YTF B;  1K4D C;  2DW4 A;  3OM3 B;  4QIW F;  1VQ4 V;  1Y66 A;  2EIK B;  2H94 A;  4LP8 A;  1AR1 B;  5CN0 A;  3A0R A;  1OCO C;  1LNQ A;  2P7T C;  4JYC A;  3SYC A;  3R65 A;  5B3S B;  2JEX A;  3OGC C;  2B1I A;  2HVK C;  1JCH A;  4X88 A;  2EIK C;  2LFR A;  1NR1 A;  4GCZ A;  3RVZ A;  1K7D A;  3BY6 A;  1PL0 A;  1RPO A;  3AG4 B;  4XDL A;  1FFT B;  3GWO A;  2HR3 A;  1RM1 B;  1OCZ C;  4F4L A;  2MK3 A;  2OTJ V;  2EIJ B;  1YIT V;  3AG4 C;  1VQM V;  3EHB B;  3FYE B;  2GHY A;  1M57 C;  2W0F C;  3K0D A;  1OCZ B;  5EC1 C;  2QM8 A;  1E1R G;  3LUT B;  2ZDI C;  4MVQ A;  5HFM A;  2Y69 C;  1F4N A;  1EBO A;  3EFF K;  1F23 A;  1NBM G;  1KP2 A;  2Q68 A;  2DYR B;  1W0K G;  1W2B U;  3T4D A;  5EK0 A;  4RUE A;  3ETD A;  4JAS A;  1Q7Y W;  1NH2 B;  4JPR A;  4OXS A;  1KP3 A;  3ZN0 A;  2Y69 B;  3K04 A;  1VQ8 V;  2IJI A;  2DYR C;  5C93 A;  3T4Z A;  1K8A W;  3WFV A;  1OCR C;  1GKF A;  1ARO P;  3ASO B;  2WSS G;  1COW G;  1NVP D;  1S77 D;  1QLE B;  2XAJ A;  3E8B A;  3ABL C;  1OCR B;  3ABT A;  4MTG A;  2ZD9 A;  3FKS G;  1F51 A;  2JEU A;  3ASO C;  3TK1 A;  3ZMV A;  2X6B A;  1P4R A;  1QLE C;  1R3J C;  1PNK A;  3G4S V;  2XOK G;  3ZRW B;  3OMI B;  1ENV A;  3OFN G;  2V1D A;  4N21 A;  5BZB A;  5B1B C;  3E35 A;  2ITC C;  1CEZ A;  3VBB A;  1J95 A;  1S76 D;  4HYO A;  4PA4 A;  3K06 A;  2NLJ C;  5B1B B;  3CCU V;  3HB3 B;  4QE7 A;  4LCU C;  1AI4 A;  1JX9 A;  3ZRV A;  3CCM V;  1VQL V;  1GM7 A;  3JD0 A;  1KEC A;  1R3K C;  3CYO A;  2WLK A;  3W7S A;  4PDV A;  1GM9 A;  3JD3 A;  3AG1 C;  2WLH A;  5KUM A;  1V54 C;  5KA6 A;  3LNM B;  1MG1 A;  2JK5 C;  5B3S C;  5LGU A;  1PD3 A;  1H8E G;  3OUF A;  3STZ C;  3SJQ C;  3ZMU A;  1V54 B;  4X89 A;  1RM1 C;  1AJP A;  2DWD C;  4QPJ A;  5DN6 G;  1I5Y A;  1K3E A;  1S72 V;  4CBC A;  3OUS A;  4KFM A;  4GT1 A;  1M57 B;  3ABK C;  1SES A;  4UVC A;  2IU3 A;  3T1C A;  1B6Q A;  1KQS U;  3ZN1 A;  4LC1 A;  3ABK B;  1F4M A;  4QPK A;  5DM6 V;  2IJK A;  2XAF A;  2Q69 A;  2WLN A;  4FMT A;  4JAV A;  2W6I G;  5IY5 B;  4PA6 A;  1DLB A;  4GX0 A;  4UV9 A;  1AI5 A;  2IJJ A;  4XDJ A;  3AG2 C;  2IW5 A;  2A79 B;  3BEH A;  5IY5 C;  3ABL B;  2XAG A;  3E8F A;  4R8C A;  3CCS V;  4KP4 A;  5B1O A;  3AG3 B;  1W0J G;  4GX1 A;  4WFH A;  5CBH A;  1N8R W;  1YJ9 V;  3SPJ A;  5L3B A;  4MTF A;  4FJC C;  2EIN B;  2GSM B;  2P6J A;  4BW5 A;  2UXN A;  3W7X A;  1PKX A;  5L3E A;  3E8G A;  4PEL A;  2YEV A;  2W6J G;  5EBL C;  5CBG A;  2OCC B;  4PDM A;  1R3I C;  1BHB A;  2B1G A;  5IDJ A;  4WF9 V;  2Q6A A;  3UKM A;  2WAM A;  2OCC C;  3ZMS A;  2HFE C;  3FB5 C;  3K08 A;  5L3D A;  4MVU A;  2V7Q G;  4PDL A;  5EC2 C;  4RAI A;  4J9Z B;  3K9A A;  2DQ3 A;  3P30 A;  3AG1 B;  5CMU A;  3OR7 C;  1JJ2 U;  1SER A;  2R9R B;  2HG5 C;  2XND G;  3JCZ A;  4RO2 A;  4QJF B;  1YIJ V;  3CCR V;  1WLE A;  2JIZ G;  3QO7 A;  2M7W A;  3I56 V;  2IU0 A;  4JAU A;  5B1N A;  1DF4 A;  1QR8 A;  3E86 A;  5GW7 A;  3W7U A;  4BAY A;  2Z3Y A;  2XAQ A;  4TSF G;  2BOC C;  5H6R A;  3CME V;  1FXH A;  4R50 A;  2WLL B;  4JTC B;  5LHG A;  3E83 A;  3PJS K;  3FB8 C;  2IH1 C;  5IYC O;  4MTO A;  1DTO A;  3CCJ V;  4N23 A;  2ZDI A;  1ZWI C;  2IJH A;  4Q20 A;  1WPX A;  3ZRX A;  1AJQ A;  1XL6 A;  1K34 A;  4CZZ A;  2OT5 A;  4XBF A;  3LDD A;  2PI4 A;  3B8M A;  5KA5 A;  3E8H A;  4PA9 A;  3FB7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...