3OW2U

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ow2U00
4WFBV 3CC2V 3G71V 1KQSU 1Q7YW 1K8AW 1YIJV 1YHQV 1YJWV 1KC8W 1K73W 1KD1W 4WF9V 1N8RW 1NJIW 3CMEV 1QVGU 1K9MW 3CC4V 3I55V 3G4SV 3CCQV 1VQMV 1VQ7V 1Q82W 1VQ5V 3CD6V 1W2BU 1VQ9V 5DM6V 3CCEV 2OTLV 3CMAV 1YI2V 1Q86W 2QA4V 3OW2U 1M1KW 1VQ4V 1VQ8V 3CCSV 1VQLV 3CCJV 1VQKV 3CC7V 1VQOV 1YJNV 1VQNV 2OTJV 4WFAV 1JJ2U 3CPWU 1S72V 1R73A 3CCVV 2D3OW 3CXCU 1M90W 1Q81W 1YJ9V 1VQ6V 2QEXV 3I56V 3CCRV 3CCLV 4WCEV 3CCMV 3CCUV 1YITV 1VQPV 1QVFU 3G6EV
chains in the Genus database with same CATH superfamily
1THZA 3RYCA 2YEVA 4Q6GA 2F43G 4O4HB 1SZXA 3CCEV 3G6BA 2H8PC 2XUMA 4X20B 4U3FH 3SPJA 2PZSA 2CGOA 3T1YB 3W7UA 5IYZA 4F4LA 2WA4A 1WNSA 4J11A 3G67A 1XEQA 3B40A 3ML0A 4LC1A 1JPXA 1ZSPA 3D36C 1AR4A 4L87A 1HR0O 4BIZA 3STZC 4LFCO 1M9NA 4I0XA 3AK2A 4U3JA 1Q6HA 4LWSB 3OMAB 3JALB 4IHJB 5CA0A 1OCOB 3C3TA 3JATA 1SF9A 3CCUV 5A2QN 1TVKB 2W6JG 2R9IA 4H44B 1NTMH 1KYOF 3ZJZA 2P7TC 5LP6C 3MDSA 2Y69B 3ABKC 2OCCC 1CEZA 1AJPA 4X66B 1IXBA 5IWAO 1NR7A 3H1LH 1PL0A 4UV8A 3DTUB 1AJQA 1XNQO 3SYAA 1SQFA 3LSUA 1PM9A 2B9ZA 2VWKA 4BR6A 2HG5C 2ZXWB 2X6AA 4LF5B 1LNQA 3SJQC 1KQSU 4Z1VA 1DF4A 3FX7A 1U96A 3RYHB 5CN0A 5KHJA 1VQKV 4D7SA 4K8ZA 3APOA 2DYRC 2HJDA 3K06A 1SZTA 2BSKA 1COWG 3JD0A 4R7CA 3T4ZA 2QKAA 2YXLA 2UUCO 4OGQB 4DW1A 3LDDA 4J7KA 1QR8A 2BE3A 3TGUH 3JD4A 3ASOC 1QQCA 1V54C 5L3EA 3APQA 3AG3B 1QLEC 4IIJA 4DR5B 3HKDA 2YXHA 2P5OA 4RQFA 3E22A 3RYIA 2EIKB 4DUZO 1WP7A 2JK5C 1XOUA 1NTKH 4FLUA 3ABLC 4FZ1A 1MOFA 4MTGA 3PJSK 3CCMV 2P4VA 2N05A 2IU0A 5GONB 5IT9N 1PP9H 5E1AC 5LGTA 2UXBB 1R3JC 1ZAUA 3DC6A 1W0KG 4O4LB 3LNNA 5J2TA 2HEPA 2CE4A 3JASB 3SYPA 2UXCO 1I94O 1BMFG 3C90A 4FFKA 5BMVA 3VOUA 3R65A 1S5JA 1CXZB 1OCCB 1KKCA 2WLIA 1NTZH 5KX5B 5ITZA 4L8JA 4BIUA 2X6BA 4DR7O 1IX9A 4TUYA 5LA6B 2HR3A 3OTOO 3CRRA 3K5OA 1R6NA 2HLDG 4UCUA 3H1HH 3UT5A 4FJCC 4B3SO 1SQGA 1AR1B 2UU9B 1US6A 4NTXA 1R3IC 4JI3O 1F51A 1K5SA 3P3NA 2Z0AA 5JVDA 2W0FC 5L3DA 5CBGA 2HKOA 4G28B 3ZRSA 4I7ZB 1K73W 3RYFA 1H2LA 3OR7C 3DC5A 4K0KB 1A32A 4O4JA 1V55C 2RDCA 2Q7HA 2HHHB 1IDSA 4YJ2A 1N33O 1R3LC 3ZMZA 2D3OW 2NR5A 1Q6UA 4JI8O 3ZEDA 5H9CA 2ZE6A 5LMUO 2WLMA 3SPIA 4XBFA 2WLLA 2ADQB 1GN3A 3SR2C 2AXTZ 1QCEA 3K57A 5CB4A 3B8MA 3R66A 5LXTB 1S5HC 5IJ9A 1N4CA 1XMOB 2O57A 1XL6A 2LP7A 1LUVA 2P06A 1OCZB 4DUYO 4LF7O 4B3TB 1YZBA 4KXRA 4MVSA 3M99B 2GUZB 3K0DA 4DV5O 1GKFA 1L0LH 3SDLA 2CAZC 1K3EA 1SQQH 2DOSA 2N74A 4DV1B 2IM9A 2IU3A 2Q7GA 2WLKA 3OTFA 4UUJC 1N32O 3L71H 5EZYA 3I56V 3NR7A 1BGYH 3SYCA 2F1MA 4PDVA 1GN4A 2NLJC 3FYEB 3ZBHA 1FJGB 1NZ6A 2JGUA 4DXWA 5KHGA 4UV9A 4IYIA 1MZEA 3G80A 5TISZ 1VQ9V 1JX9A 5LGNA 1FXKC 4TOIA 4XDLA 4DR2O 2Y0IA 1YDXA 4DV7B 2Y4UA 1R6KA 3AG3C 2A79B 3TXSA 1Z2GA 3UCSC 1URFA 3K9SA 5BZBA 4KHPO 4FLTA 4DV2O 2EIMC 1FS0G 1L0NH 1Y66A 1IBKB 4FPPA 2GBOA 4UB6Z 5EBMC 3RT3C 1IBMO 3CC4V 3Q4HB 4LFBB 1VF6A 2JDIG 1HNXO 4PDMA 1VQ8V 2XAQA 2XAFA 2P90A 4NR1A 4B3MO 1N0NA 1H2GA 5KAFZ 4DR1O 1FFTB 1GN6A 2VQEO 2LO1A 4O2AA 4J7ZA 3L9DA 5BXZA 5LMNO 4H37A 4NTYA 3AG1B 4JI6O 2EJRA 4IT5A 4RUEA 4W4KA 2Q69A 1KP2A 2DN9A 3OT7A 4WFAV 2WLNA 5JJJB 3H01A 1BQ0A 4DV6O 2HP8A 4JGSA 4UB8Z 4DK0A 2JGDA 1BZKA 3K04A 1KD1W 1PPJH 5F2VO 2PY5A 2IJHA 4O4IB 1GK9A 1TA8A 4FLVA 5LP6B 4TV8A 1H8EG 4LFAO 2YI8A 3ABKB 1GN2A 1K92A 1TUBB 2OCCB 3CJHA 5LOVA 3TETA 2R70A 4OPHA 1YJ9V 4MW8A 2F23A 1PNKA 1Z5VA 5LBQA 4W4LA 3L75H 4JI4B 2QWPB 2E5LB 2MK3A 4JASA 3JSNA 1K9MW 1WN7A 2BCCH 3IJ4A 4JV5B 3A0BZ 1KKDA 4BWAA 1LR1A 1SETA 1YTFD 4FM1A 4RAIA 1QLNA 4B08A 4EEQA 3RWRD 3ETGA 5EBWC 3ABMC 5C8YB 3QNEA 1Q8IA 2ZR2A 3MHHC 1Q7YW 4JI0O 2ZM6O 2DYRB 1PKXA 4JI7O 3N2GB 3AK1A 1S3JA 4FMTA 1VQ7V 1VQ5V 4J42A 1M5IA 3DGEA 4FK5C 1MNGA 3O65A 2KKWA 5JCOA 4JI2B 3RW0A 2ZE7A 4IYHA 3CXCU 4LF6O 5FLXN 1S76D 4O4HA 3ASOB 3JAWA 4PV1B 1V54B 4FM0A 1AVMA 3K79A 4YHHO 3EVKA 4UVCA 1BQZA 1QLEB 4X88A 2GTSA 1N34B 4NXNO 1JCHA 3W7TA 2WA3A 3MD0A 3MAQA 1S72V 1NS1A 2LW1A 4TQFA 1X4TA 2K1EA 3OMNB 2RQ6A 3HPLC 3OE7G 1MA1A 3G71V 2CH7B 3ZX6A 3ABLB 3ZHRA 3TXQA 4UCRA 4LWSA 1RFYA 2IJKA 3JCUZ 1W2BU 3JALA 4IHJA 3SYQA 3VQVA 2BTQB 4J9ZB 4LCUC 1L8DA 4ICGA 1TVKA 1B6QA 4HNAB 2R9RB 4J7JA 4NKGB 5H6RA 1SS3A 1JJ2U 3OMIB 4I4TB 3BEHA 3T1YO 1JR9A 2VRZA 4UCSA 5L3FA 1JQ0A 3HKEA 3J7AU 4PA7A 5L3BA 4LP8A 1HWYA 1Y6XA 1SKVA 3OR6C 5B66Z 3OEHG 3QO7A 2FL4A 3LSSA 2PI4A 1XBLA 3CRQA 2ZE5A 1S0VA 4UVBA 5CMUA 2M7WA 1TGOA 3JAKB 3WG7C 2XNDG 2EULA 3ZMUA 4MTXA 1J95A 5KHKA 2QTSA 3L70H 1H2MA 4FLYA 2BOBC 2WAMA 4X66O 1ZWIC 1N36B 2BOCC 2XASA 4H33A 3BVOA 1KP3A 3AG1C 5KUMA 1XI1A 4JI1B 4MVQA 1V55B 3D8CA 4LF5O 2UXDB 4CH5A 1N8RW 1NJIW 3SYOA 5H5NA 2ZIOA 5GTIZ 1IVSA 1VQMV 1Y74A 1ZL8A 4O2BB 4DV0B 4J41A 1YJNV 3E83A 3QO8A 4PA4A 2V7QG 3ZMSA 1AILA 1M90W 2YICA 2AGAA 2LGWA 3ZHSA 4IL6Z 3B2EE 4GX5A 4RO2A 1NI8A 3BHPA 4G2KA 3I55V 4LNUB 2OT5A 2YIAA 3UKMA 2E3CA 3HKBB 5EC1C 2YIDA 1P49A 5GONA 3AG4C 4KL1A 2ITCC 2WLJA 1XQ8A 1SQBH 1WA8B 1K97A 4FFBA 1SRYA 3WFVA 4QE9A 3UO3A 4DR5O 1S5LZ 2NN4A 1QR9A 1ZTEA 1K4CC 4YJ3B 1Y76B 2EZOA 4EFEA 5KX5A 1G1XB 3LDCA 4J10A 4DRXA 3RBZA 2DQ0A 3JD1A 3CB2A 2ILMA 2IH3C 5FPRA 1JFFA 2OIGA 3ZRWB 1NH2D 2UXBO 4GX1A 3B09A 3ZS8C 5BR8B 3JARB 1JOYA 1HNZB 1H38A 3ZCCA 4I9WA 2YEVB 2ZNJA 2EINB 3A0RA 1XNRB 3U10A 1MSWD 4DR4B 1RSOA 3ICXA 4GKJB 2PF4E 1VIBA 1FXKB 3B8NA 3RVZA 5J2UA 5L3GA 4WBNA 2E74B 2XAGA 1EN4A 1KU9A 2YC0A 2YI9A 1FPOA 2EIMB 4ZHQB 3C3SA 4GLXA 3IAYA 3W7XA 4GCZA 3K9AA 3JD2A 3CRMA 4LH7A 3F7VC 3N2KA 4U3JB 2WWWA 3QVNA 2UU9O 1EN6A 3CC2V 1T5EA 1WJZA 5CA0B 2NNUA 3FFQA 1IXMA 5EYPB 4H0LB 1WB7A 4P9PA 4UCOA 4PA9A 4QPKA 1KMIZ 3BPZA 3OD4A 3QTCA 4K0KO 1I08A 3D3QA 4CC6A 2GUZA 2ZCEA 2CTPA 1FKAO 2HHHO 4F6EA 2DW4A 1EN5A 2Z3YA 1KBHA 3RVYA 4FM2A 4WFFA 3CHXA 5IE9A 3X2QC 1NU1H 4OX9B 4LF9B 1XDCA 4JAVA 1YTFB 3CD6V 2EBOA 1RPRA 1P84F 2YS8A 3ZMVA 4HYOA 2DWDC 1XMOO 2YIBD 4J9YB 1E1QG 1GM9A 3MHSC 1PD3A 3K5MA 3KKYA 3K08A 4B3TO 5LYJB 4EB6A 2IW5A 2RN9A 4K3AA 4JYAB 4DV3O 3SJAC 1UJWB 1H2SB 1XILA 1Q3EA 2HJFC 1XUQA 1SQXH 2BSKB 2KB1A 4DV1O 1VQNV 3FB7C 1P7GA 2ZNIA 1QBZA 1NT2B 4LH6A 2ZDIA 2PI5A 4JYCA 1DLBA 4CZZA 4CH4A 3ZRXA 1VF5B 3BA8A 3GWOA 1ORQC 1VF7A 2G38A 2AW9A 2LQTA 3ABMB 4JF3A 1R3KC 2PTMA 3CCJV 4DR3B 1FJGO 1YSCA 4X64B 3RYIB 5DECA 3OEEG 5CBHA 2AHZA 3A0HZ 2UUBB 2ZIMA 1I0HA 4PELA 1AROP 5GTHZ 3K59A 3HB3B 1YF2A 1Q82W 2XTAA 4I50A 2QE7G 1G8MA 4MT8A 1FXVA 4DV7O 1NR1A 5J2TB 1JVMA 2C2AA 2JEUA 1GRJA 2QSAA 1H2NA 5BMVB 3CE2A 4FLWA 1IBKO 1HNWB 3D36A 4I55B 1VEWA 5ITZB 5JJEB 3ZHUA 1Q5OA 2KG7A 1M4UA 1XHZA 4TUYB 1Q86W 4LFBO 1XL4A 3UQ8A 1N33B 2CTRA 3JD3A 3JYCA 4U7OA 4X1KA 1XMQO 3SPHA 4O4IA 3P3PA 1DF5A 5LP6A 3N27A 2EINC 3SGIA 3G4SV 5JVDB 4FLZA 3KZIZ 4UCVA 1W0JG 3RYFB 2Q73A 2LW7A 1VP7A 3WU2Z 2CTQA 3RGBA 4EFBA 4GKKB 4O4JB 5D5QA 2IJIA 5B1AB 3ZRVA 4YJ2B 1RPOA 5JH7B 3ABTA 3FB6C 1FFXB 4Z2WA 2WLLB 4XDJA 3L73H 3E8GA 3WG7B 5CB4B 2QR4A 1RM1C 1BL8A 3E8HA 1L1FA 2ODMA 1RP3B 2D2CB 5CBFA 3IFXA 3J80N 1NBMG 2OIEA 4X65B 3E8BA 3U11A 2XAHA 3E35A 2F95B 1SA0B 3H1IH 4JI4O 2E5LO 1IBLB 3IC7A 4MTFA 4JV5O 4F6RA 2DYSC 4MS2A 5HFMA 3EXAA 3A8TA 4UCTA 3K5LA 3K58A 3H1JH 1MG1A 3B77A 4OPAA 2UUAB 3ASNB 3DSQA 4UFZA 3W7WA 2ZD9A 4DR2B 1ZUQA 2FB5A 1F23A 1QU7A 4MVZA 3THOA 3I5DA 4BW9A 3OUFA 2RJZA 4JI2O 5JWPA 3CRAA 2OWOA 2QDOA 4DR6O 1B06A 1NH2B 3F5TA 5IY5B 3E8FA 3AG4B 5J9PC 2BTQA 3E2EA 4HNAA 4PDRA 1I5YA 1EFRG 2HVJC 3UO2A 4I4TA 4TV9B 1J5EB 4PHZA 4A5UB 3K0GA 1N34O 4LF4B 3KG2A 4DR1B 1R73A 1LUWA 1G4YB 1O9HA 3P32A 3CCLV 4YIOA 5LHGA 3OGCC 4MVRA 4LBEC 2JJ2G 1PV0A 1Y67A 5BY1A 2Q0AA 3TJTA 1QHTA 2LGQA 1Z5WA 3CS5A 4H13B 4FIPC 1K34A 2Q6AA 4G27B 4X8AA 2CK3G 4X9QA 2JEXA 4ASUG 1VMGA 4JZ2A 4D7TA 1YXBA 4X62B 2ZE8A 2P6JA 1YJWV 1MSDA 4X20A 1EZJA 2H94A 4RUFA 3NXSA 3VQWA 3W7SA 4B3RB 3OW2U 1H8HG 4TQDA 1UPGA 3JSLA 4YY3B 5B1BB 1M57C 2DWEC 4MW3A 1K8AW 4E4EA 2AZ2A 2Q4PA 1AI7A 4LF8B 3ZHQA 1XHXA 4R50A 2QWOB 2Q0OC 4C7UA 2JGDB 5DM6V 1SERA 2B5UA 2XOKG 3GWKC 1N36O 2QGNA 1AI6A 1VQLV 5CA3A 3JAMN 1H2KA 4K8XA 2IJJA 4TV8B 4JI1O 1OHHG 1AP6A 2H3OA 3T1HB 3CJHB 4FLXA 2KSDA 1WPBA 2FYUH 4DV4B 2UXDO 2GSMB 3X2QB 2GHYA 5FNVB 2VS0A 5B1AC 5IJ0B 4DV0O 2ZDIC 2B1IA 1BSMA 3WB1A 4P30A 4X1IB 5KLVH 3IGAC 3BABA 3CX5F 2R9AA 1SQVH 2L35A 5FL7G 3RYHA 2F4VB 4PD4F 4ZOLB 4DW0A 4WFHA 1GM7A 3TCUA 5IDJA 1OCRB 4NXMB 4B7KA 3L74H 1Q43A 1CP9A 2WPDG 1YI2V 3PN1A 1FXHA 1B04A 2ARHA 4N23A 3ZRWA 1SQPH 5LGUA 4X1YB 2RMKB 4XDKA 1M56C 3CWBH 3JARA 1ROPA 2M6YA 2Q67A 2Q68A 5JQGB 1YEWA 3F5WC 3QF7A 2MW2B 1DTOA 4K35A 3CMEV 4GX0A 2X7RB 1GH6A 2PYJA 3JAWB 1FXKA 3CP1A 2VQFB 2OTJV 1S77D 1GO3F 4I9QA 5C93A 3LUTB 3DXRB 5HFLA 3ASNC 1BE3H 2LFSA 4ZHQA 4IGGA 2IBZH 3FAVB 4CC5A 3M7MX 3RFRA 3VQXA 5BR8O 3OFNG 2JVDA 4PI0A 1EZVH 4KFMA 5KAIZ 3M8AA 1HNZO 1YCIA 4AQYB 1VQOV 4R6ZA 2ZT9B 3A2FA 5IY5C 1F4NA 2QWRB 2Z5UA 4JI5B 1XNRO 1JJOA 5KMGB 3U0ZA 3AEIA 4JTDB 2Y0PA 2QEXV 1VQ6V 4DR4O 5EYPA 4GKJO 3SJBC 4O4LA 3HKCB 4MVMA 3TK1A 3ZN0A 5AG2A 2P22C 3JASA 2A0LA 2FMLA 2ZKOA 3HKEB 5JJNB 4CS4A 2EILC 2R72A 1EBOA 5LHIA 2Q8VA 2F66C 3AG2C 1HW7A 3T4DA 1NQTA 5B1OA 2V4DA 3VQYA 4ZI7B 1AJNA 4CS2A 4KP4A 3CCRV 5CA1B 5LA6A 2ZQMA 3KCYA 4PDLA 3G6EV 4QGPA 1HR0B 3D3IA 1E1RG 3OGIB 4LFCB 3CXHF 4UVAA 4NTWA 1VF6C 5LHHA 3RYCB 2W6IG 3CRCA 2DE0X 5LYJA 4TWKA 1G6UA 2L6LA 2N04A 3S3WA 2XHBA 2HFEC 3CEIA 3OAAG 5IYZB 3HR0A 4OX9O 4LF9O 1YVWA 2PGGA 1O9GA 5IWAB 2V1DA 3BFRA 4BIOA 5B1BC 3ETDA 4HBNA 2OYQA 1D5AA 4I0XB 1XNQB 4YXWG 4FVMA 1Y74B 1ZL8B 1Q6IA 1NKDA 2GV9A 5LXTA 1GAXA 2Y48A 1RM1B 4JYAO 5B3SC 4GYCB 2EX3A 2AZ0A 3JATB 4Z1MG 2ETNA 1BS3A 2VWJA 4MTOA 4OXSA 2CTWA 3CCSV 2Q7EA 1FYJA 3CC7V 4KUMA 2QKSA 2JIZG 5D5PA 1F4MA 2DYSB 3GVMA 3EHBB 3LNMB 2WSSG 2KQXA 1AB3A 1AR5A 1AI5A 4FFBB 2IH1C 2OCHA 4D6TH 1AP5A 2UUCB 2RCVA 2OTLV 4CS3A 5EK0A 4DR3O 4ZBMA 1I7FA 4X64O 4I55A 4PA3A 1OCRC 3SPCA 5B5EZ 4CBCA 1D2DA 2HVKC 4DRXB 2UUBO 1YIJV 1EM1A 3ZMTA 4WF9V 1JFFB 3BA9A 1NVPD 4DUZB 4QNHB 3E86A 2W0XA 2EZPA 5JCOC 3FYIB 3K3WA 1AI4A 3OUSA 3B4SA 4JYYA 3WB2A 5FPOA 1VQPV 1ZX3A 4WFBV 1RSOB 3BCCH 4BW5A 1MZFA 2CDYA 1HNWO 4GX2A 4J80A 3LDEA 4P2ZA 2LFRA 1SC5B 3ZHTA 5J2UB 4WBNB 2QWQB 4IIJB 1M1KW 1VQ4V 3HKDB 2JS3A 2UXCB 1I94B 5JH7A 3E22B 1HP8A 1KB9F 1FFXA 1WB8A 1TAEA 1QVFU 3T2MA 4DR7B 1SESA 1BCCH 3Q4HA 2QM4A 2FTKA 5KHIA 3N2KB 2Q5ZA 4JZGA 3FB5C 3OTOB 2Q9LA 5KUKA 1OCOC 1D5NA 3CMAV 4RWUA 1FAFA 4B3SB 3UM7A 4HAMA 3CPWU 2RNBA 2Y69C 4I5SA 4GKKO 1SA0A 5EC2C 4JI3B 5B1NA 4DV3B 4JAAA 3K03A 5H2FZ 1IZ3A 2WLIB 1M57B 4DO2A 4DYLA 1DK1A 1IURA 2QM7A 2JRIA 2ZXWC 2QWNB 3ZHVA 1QNMA 4JI8B 2CGNA 3RN4A 5LMUB 1W59A 1B3QA 3UT5B 5KA6A 4GT1A 1N0JA 4JAUA 1K7DA 4X65O 1OJHA 2A3QA 4LR3A 3EFFK 4EB6B 1TUBA 1Y4MA 1IBLO 1V9PA 2UXNA 3OM3B 5K1PA 4PA6A 4X89A 3CYOA 1K33A 4DUYB 4LF7B 5IYCO 2QTOA 3K5NA 2XT9A 4MSWC 1FD9A 2CUGA 1UFIA 4DV5B 3FKSG 4TV9A 2UUAO 4TT3G 2X0LA 2ZINA 3ETEA 5C8YA 2EIJB 4JTAB 3AG7A 1N32B 5IJ9B 4MVOA 1F7YA 4PJ0Z 2ADPA 1E79G 4WCEV 3N2GA 1HDJA 2XAJA 4U7NA 4YIPA 3QG5A 2EIKC 3J81N 3WB0A 1Q90D 4ABMA 5E79Z 2P67A 3AK3A 5DN6G 3P30A 3CCQV 3T1CA 1M56B 4N21A 1WP8A 2DQ3A 1J5EO 1M93A 4I50B 1K4DC 4LF4O 2ITDC 1WAZA 2K9PA 4JPRA 5EBLC 2PYLA 1XMQB 1CPYA 1GMGA 4ZIBA 2QKCA 4NYKA 1GM8A 1R1BA 1PNLA 3ZIAG 2FKXA 2ZR3A 5EZYB 2AHYA 4HZ3A 1JA8A 3H9VA 1TUEB 1ZLZA 2BTOA 1OCCC 1PL4A 4QIWF 2ATKC 2KG7B 2CH7A 3FB8C 4KHPB 1Q81W 4DV2B 1P7BA 2YIBA 3GB7C 1JMKC 3LSQA 4GUNA 4X1KB 4X62O 4AI8A 1IBMB 5GW7A 4UXNA 2PUSA 3FD9A 4QPJA 1HNXB 3SPGA 4BAYA 4AHCA 4B3RO 4WFEA 2A06H 4B3MB 3ZN1A 5H6QA 5A9GA 2EILB 2YUAA 2VQEB 4YY3O 5LMNB 2B1GA 3AG2B 4JI6B 3S3XA 5FNVA 2DMXA 5DEDA 1KC8W 2EJ7A 5IJ0A 4ZKIA 3CSXA 1I5XA 2X6CA 4LF8O 5KA5A 3BRCA 4P9OA 5LL6Y 4X1IA 3ETQA 2QM8A 1GTOA 2JJ1G 2P4KA 1KECA 3CCVV 3JAKA 3KCXA 4ZOLA 4DV6B 1BT8A 2YXYA 4WFGA 2A9HA 3BY6A 3H1KH 1X59A 3SJCC 3T1HO 3STLC 1WPXA 4O2AB 1QVGU 2F93B 1OCZC 4DV4O 3F7YC 2E75B 1BHAA 4QE7A 4CH6A 4X1YA 1XREA 2QA4V 4LFAB 4E2LA 3QO5A 3BAAA 2E76B 3L72H 5JQGA 4F6RB 2YDEA 4JYBA 4DR6B 5L3CA 1OV9A 3IC9A 4PI2A 2JS5A 1KUQA 2DJVA 5K1XA 1VARA 4TSFG 2QJ1A 4EKWA 4FZ0A 4RQEA 2F4VO 4O2BA 4NXMO 1OZ0A 4NB5A 1PNMA 2UXXA 5EIBC 3DXRA 4Q20A 5B3SB 4GZRB 4QJFB 1U97A 2Y4TA 2GDSA 5IYDO 4AILC 3FAVA 1MMMA 4LNUA 4JI0B 1ENVA 2ZM6B 5LOVB 4JI7B 1NVPB 3O9OA 3VBBA 3HKBA 2LJ2A 1DGSA 3E89A 5IYBO 5KMGA 4R8CA 2A7WA 1BHBA 1WA8A 3HKCA 2VQFO 4LF6B 1MABG 5KHHA 3ABUA 4MVUA 1YITV 1WLEA 1K5QA 2WLHA 4YJ3A 1Y76A 1YHQV 2EIJC 5EIBD 1R6TA 4YHHB 4ZI7A 2YSUB 4NVPA 4NXNB 5CA1A 4CH3A 3JCZA 4JTCB 4AQYO 1P4RA 2GTAA 4JI5O 4DK1A 4B7EA
chains in the Genus database with same CATH topology
1THZA 5LBQA 2Y48A 1RM1B 5B3SC 3D36A 2MK3A 4JASA 2YEVA 1K9MW 1KKDA 2F43G 4Z1MG 3CCEV 2H8PC 1Q86W 4MTOA 4OXSA 1XL4A 3CCSV 1SETA 1YTFD 4RAIA 3CC7V 3SPJA 1QLNA 3JD3A 2QKSA 4KUMA 3JYCA 4U7OA 3W7UA 2JIZG 4F4LA 3ETGA 5EBWC 3ABMC 1F4MA 2DYSB 3QNEA 3SPHA 3EHBB 3LNMB 2WSSG 3ML0A 2ZR2A 3MHHC 4LC1A 1Q7YW 1JPXA 1DF5A 4L87A 2DYRB 1AI5A 4BIZA 1PKXA 2EINC 3STZC 1S3JA 4FMTA 3G4SV 1VQ7V 2IH1C 1VQ5V 1M9NA 1W0JG 2OTLV 3DGEA 4FK5C 5EK0A 4ZBMA 3RW0A 3OMAB 3CXCU 1OCOB 1OCRC 4PA3A 3SPCA 3CCUV 1S76D 2IJIA 5B1AB 4CBCA 3ZRVA 2W6JG 2R9IA 2HVKC 1RPOA 3ZJZA 2P7TC 1YIJV 2Y69B 3ABTA 3ABKC 3FB6C 3ZMTA 3ASOB 4WF9V 2OCCC 1CEZA 1AJPA 1V54B 2WLLB 4XDJA 3K79A 1NR7A 1NVPD 3E8GA 4UVCA 1PL0A 3WG7B 1QLEB 4X88A 3E86A 4QNHB 4UV8A 2EZPA 1JCHA 3W7TA 3MD0A 1RM1C 3FYIB 1BL8A 3E8HA 1L1FA 3K3WA 1S72V 1AI4A 3OUSA 3DTUB 1AJQA 2K1EA 3SYAA 5CBFA 3IFXA 3OMNB 1VQPV 3HPLC 3OE7G 4WFBV 2ZXWB 2HG5C 1NBMG 2X6AA 3G71V 1LNQA 3E8BA 3SJQC 1KQSU 2XAHA 3ABLB 3E35A 4BW5A 1DF4A 4GX2A 3IC7A 2IJKA 4MTFA 3LDEA 4P2ZA 2LFRA 1W2BU 2DYSC 4MS2A 5CN0A 3SYQA 4J9ZB 1M1KW 1VQ4V 5HFMA 4LCUC 1B6QA 1VQKV 2R9RB 5H6RA 1JJ2U 2DYRC 3OMIB 3BEHA 3K06A 5L3FA 1JQ0A 1QVFU 3T2MA 1SESA 1SZTA 4PA7A 5L3BA 1HWYA 4LP8A 1COWG 2FTKA 1MG1A 3JD0A 3B77A 3OR6C 4R7CA 3T4ZA 3FB5C 3OEHG 3ASNB 3W7WA 3QO7A 5KUKA 2ZD9A 1OCOC 3CMAV 1F23A 4MVZA 3LSSA 3LDDA 3UM7A 4HAMA 2PI4A 1QR8A 3CPWU 2Y69C 4I5SA 3OUFA 3JD4A 3ASOC 1S0VA 5EC2C 1V54C 4UVBA 5L3EA 5CMUA 1NH2B 5B1NA 2M7WA 3AG3B 5IY5B 3WG7C 2XNDG 1QLEC 3E8FA 3AG4B 5J9PC 3ZMUA 3K03A 4MTXA 1J95A 3E2EA 4RQFA 4PDRA 1I5YA 2WLIB 1EFRG 1M57B 2HVJC 2BOBC 4DO2A 2WAMA 1ZWIC 2BOCC 2XASA 2EIKB 2QM7A 4H33A 2ZXWC 2JK5C 3K0GA 1KP3A 3ABLC 3KG2A 3AG1C 1R73A 5KUMA 1MOFA 4MTGA 1G4YB 3PJSK 3P32A 3CCLV 3CCMV 2IU0A 5KA6A 4GT1A 4MVQA 1V55B 5E1AC 5LHGA 3OGCC 4JAUA 1K7DA 5LGTA 4MVRA 4LBEC 1R3JC 2JJ2G 1N8RW 3EFFK 1NJIW 3SYOA 1VQMV 1W0KG 1Y4MA 2UXNA 3OM3B 4PA6A 4X89A 3CYOA 1YJNV 3E83A 3QO8A 4PA4A 1K33A 2V7QG 3ZMSA 3SYPA 4FIPC 1BMFG 5IYCO 1K34A 2Q6AA 2QTOA 4G27B 4X8AA 3VOUA 1M90W 2CK3G 3R65A 1OCCB 2JEXA 2WLIA 4MSWC 4ASUG 4BIUA 4GX5A 2X6BA 2P6JA 3FKSG 4RO2A 1YJWV 4G2KA 3I55V 1EZJA 4TT3G 2X0LA 2HR3A 2H94A 2OT5A 4RUFA 3NXSA 3UKMA 3W7SA 3ETEA 5EC1C 1R6NA 1H8HG 2HLDG 3OW2U 2EIJB 4FJCC 4JTAB 3AG4C 4MVOA 1AR1B 5B1BB 2ITCC 2WLJA 1E79G 1R3IC 1M57C 2DWEC 4WCEV 1F51A 2XAJA 1K5SA 4U7NA 1K97A 2EIKC 1SRYA 2W0FC 4MW3A 5L3DA 2HKOA 3WFVA 5CBGA 1K8AW 4G28B 1AI7A 3ZRSA 1K73W 4QE9A 2P67A 5DN6G 4R50A 3OR7C 3P30A 1QR9A 3T1CA 3CCQV 1M56B 4N21A 1K4CC 5DM6V 2EZOA 2B5UA 2XOKG 1SERA 2DQ3A 1AI6A 1VQLV 1V55C 5CA3A 1K4DC 2ITDC 3LDCA 1R3LC 3ZMZA 4JPRA 5EBLC 3RBZA 2DQ0A 3JD1A 2D3OW 1CPYA 1GMGA 2IJJA 5H9CA 2IH3C 1OHHG 2WLMA 3SPIA 4XBFA 2WLLA 1GM8A 1PNLA 3ZRWB 1QCEA 3ZIAG 2ZR3A 1NH2D 3B8MA 2AHYA 4GX1A 4HZ3A 1TUEB 1JOYA 1S5HC 1H38A 3ZCCA 2GSMB 3X2QB 1OCCC 2GHYA 1XL6A 4I9WA 2YEVB 5B1AC 2LP7A 4QIWF 2EINB 3A0RA 2ATKC 2ZDIC 2B1IA 4P30A 1MSWD 1OCZB 3FB8C 1Q81W 3IGAC 1P7BA 4MVSA 1FXKB 3B8NA 3M99B 3GB7C 3RVZA 3LSQA 5FL7G 3K0DA 5L3GA 2XAGA 1GKFA 4WFHA 1GM7A 3TCUA 5IDJA 1OCRB 5GW7A 1K3EA 4UXNA 2EIMB 1CP9A 4QPJA 3SPGA 2WPDG 4GCZA 4BAYA 3W7XA 3K9AA 1YI2V 2IU3A 1FXHA 2WLKA 4N23A 4WFEA 3JD2A 4UUJC 3ZRWA 5LGUA 3F7VC 5H6QA 3ZN1A 2EILB 2WWWA 4XDKA 3I56V 1M56C 2B1GA 3SYCA 1ROPA 3AG2B 2Q67A 3CC2V 2Q68A 4PDVA 3F5WC 1KC8W 2NNUA 4ZKIA 1IXMA 1I5XA 2NLJC 2X6CA 1DTOA 3CMEV 3FYEB 4GX0A 4P9PA 2X7RB 4PA9A 5KA5A 4P9OA 4QPKA 2QM8A 1FXKA 1GTOA 3CP1A 2JJ1G 2OTJV 1KECA 1S77D 3CCVV 1GO3F 2DW4A 5C93A 3LUTB 2Z3YA 3RVYA 4DXWA 5HFLA 4WFGA 3ASNC 2A9HA 3BY6A 4WFFA 2LFSA 3X2QC 4UV9A 3STLC 4JAVA 1WPXA 1QVGU 1YTFB 1OCZC 3CD6V 3F7YC 1BHAA 2EBOA 3OFNG 1RPRA 4QE7A 1VQ9V 1JX9A 5LGNA 3ZMVA 1FXKC 4KFMA 4HYOA 2DWDC 2QA4V 4E2LA 4XDLA 4J9YB 3QO5A 1VQOV 4R6ZA 1E1QG 1R6KA 1GM9A 3AG3C 5IY5C 1F4NA 2A79B 3MHSC 1PD3A 2Z5UA 4JYBA 5L3CA 5BZBA 3AEIA 4JTDB 1VQ6V 2QEXV 2EIMC 3K08A 1FS0G 2IW5A 4MVMA 1Y66A 3TK1A 4FPPA 5EBMC 4TSFG 3ZN0A 4EKWA 1UJWB 4RQEA 3CC4V 2A0LA 2HJFC 1OZ0A 2EILC 2KB1A 1EBOA 1PNMA 2UXXA 2JDIG 4PDMA 5LHIA 1VQ8V 3AG2C 4Q20A 5B3SB 1VQNV 3T4DA 3FB7C 2XAQA 2XAFA 4QJFB 2P90A 1NQTA 5B1OA 1QBZA 1AJNA 1H2GA 2ZDIA 5IYDO 1FFTB 4KP4A 2PI5A 4JYCA 3CCRV 1DLBA 2ZQMA 4PDLA 3G6EV 4H37A 4CZZA 3ZRXA 1ENVA 3AG1B 3GWOA 3D3IA 1NVPB 3VBBA 1E1RG 1ORQC 2EJRA 3ABMB 3E89A 4UVAA 5IYBO 5LHHA 4RUEA 2Q69A 4R8CA 1KP2A 4JF3A 1R3KC 2W6IG 3CCJV 1BHBA 4TWKA 1YSCA 4WFAV 2WLNA 1MABG 2HFEC 3H01A 3ABUA 3OEEG 5CBHA 2AHZA 4MVUA 1YITV 3OAAG 1WLEA 4JGSA 1K5QA 4PELA 2WLHA 1AROP 1YHQV 3K04A 2EIJC 3HB3B 1KD1W 1Q82W 2IJHA 2QE7G 2V1DA 1G8MA 1GK9A 5B1BC 2YSUB 3ETDA 4MT8A 1H8EG 3JCZA 3ABKB 4JTCB 1FXVA 1P4RA 1K92A 2OCCB 1NR1A 1JVMA 3TETA 2C2AA 2JEUA 4YXWG 1YJ9V 4MW8A 1NKDA 1PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  3CC2 V;  3G71 V;  1KQS U;  1Q7Y W;  1K8A W;  1YIJ V;  1YHQ V;  1YJW V;  1KC8 W;  1K73 W;  1KD1 W;  4WF9 V;  1N8R W;  1NJI W;  3CME V;  1QVG U;  1K9M W;  3CC4 V;  3I55 V;  3G4S V;  3CCQ V;  1VQM V;  1VQ7 V;  1Q82 W;  1VQ5 V;  3CD6 V;  1W2B U;  1VQ9 V;  5DM6 V;  3CCE V;  2OTL V;  3CMA V;  1YI2 V;  1Q86 W;  2QA4 V;  3OW2 U;  1M1K W;  1VQ4 V;  1VQ8 V;  3CCS V;  1VQL V;  3CCJ V;  1VQK V;  3CC7 V;  1VQO V;  1YJN V;  1VQN V;  2OTJ V;  4WFA V;  1JJ2 U;  3CPW U;  1S72 V;  1R73 A;  3CCV V;  2D3O W;  3CXC U;  1M90 W;  1Q81 W;  1YJ9 V;  1VQ6 V;  2QEX V;  3I56 V;  3CCR V;  3CCL V;  4WCE V;  3CCM V;  3CCU V;  1YIT V;  1VQP V;  1QVF U;  3G6E V; 
#chains in the Genus database with same CATH topology
 1THZ A;  3RYC A;  2YEV A;  4Q6G A;  2F43 G;  4O4H B;  1SZX A;  3CCE V;  3G6B A;  2H8P C;  2XUM A;  4X20 B;  4U3F H;  3SPJ A;  2PZS A;  2CGO A;  3T1Y B;  3W7U A;  5IYZ A;  4F4L A;  2WA4 A;  1WNS A;  4J11 A;  3G67 A;  1XEQ A;  3B40 A;  3ML0 A;  4LC1 A;  1JPX A;  1ZSP A;  3D36 C;  1AR4 A;  4L87 A;  1HR0 O;  4BIZ A;  3STZ C;  4LFC O;  1M9N A;  4I0X A;  3AK2 A;  4U3J A;  1Q6H A;  4LWS B;  3OMA B;  3JAL B;  4IHJ B;  5CA0 A;  1OCO B;  3C3T A;  3JAT A;  1SF9 A;  3CCU V;  5A2Q N;  1TVK B;  2W6J G;  2R9I A;  4H44 B;  1NTM H;  1KYO F;  3ZJZ A;  2P7T C;  5LP6 C;  3MDS A;  2Y69 B;  3ABK C;  2OCC C;  1CEZ A;  1AJP A;  4X66 B;  1IXB A;  5IWA O;  1NR7 A;  3H1L H;  1PL0 A;  4UV8 A;  3DTU B;  1AJQ A;  1XNQ O;  3SYA A;  1SQF A;  3LSU A;  1PM9 A;  2B9Z A;  2VWK A;  4BR6 A;  2HG5 C;  2ZXW B;  2X6A A;  4LF5 B;  1LNQ A;  3SJQ C;  1KQS U;  4Z1V A;  1DF4 A;  3FX7 A;  1U96 A;  3RYH B;  5CN0 A;  5KHJ A;  1VQK V;  4D7S A;  4K8Z A;  3APO A;  2DYR C;  2HJD A;  3K06 A;  1SZT A;  2BSK A;  1COW G;  3JD0 A;  4R7C A;  3T4Z A;  2QKA A;  2YXL A;  2UUC O;  4OGQ B;  4DW1 A;  3LDD A;  4J7K A;  1QR8 A;  2BE3 A;  3TGU H;  3JD4 A;  3ASO C;  1QQC A;  1V54 C;  5L3E A;  3APQ A;  3AG3 B;  1QLE C;  4IIJ A;  4DR5 B;  3HKD A;  2YXH A;  2P5O A;  4RQF A;  3E22 A;  3RYI A;  2EIK B;  4DUZ O;  1WP7 A;  2JK5 C;  1XOU A;  1NTK H;  4FLU A;  3ABL C;  4FZ1 A;  1MOF A;  4MTG A;  3PJS K;  3CCM V;  2P4V A;  2N05 A;  2IU0 A;  5GON B;  5IT9 N;  1PP9 H;  5E1A C;  5LGT A;  2UXB B;  1R3J C;  1ZAU A;  3DC6 A;  1W0K G;  4O4L B;  3LNN A;  5J2T A;  2HEP A;  2CE4 A;  3JAS B;  3SYP A;  2UXC O;  1I94 O;  1BMF G;  3C90 A;  4FFK A;  5BMV A;  3VOU A;  3R65 A;  1S5J A;  1CXZ B;  1OCC B;  1KKC A;  2WLI A;  1NTZ H;  5KX5 B;  5ITZ A;  4L8J A;  4BIU A;  2X6B A;  4DR7 O;  1IX9 A;  4TUY A;  5LA6 B;  2HR3 A;  3OTO O;  3CRR A;  3K5O A;  1R6N A;  2HLD G;  4UCU A;  3H1H H;  3UT5 A;  4FJC C;  4B3S O;  1SQG A;  1AR1 B;  2UU9 B;  1US6 A;  4NTX A;  1R3I C;  4JI3 O;  1F51 A;  1K5S A;  3P3N A;  2Z0A A;  5JVD A;  2W0F C;  5L3D A;  5CBG A;  2HKO A;  4G28 B;  3ZRS A;  4I7Z B;  1K73 W;  3RYF A;  1H2L A;  3OR7 C;  3DC5 A;  4K0K B;  1A32 A;  4O4J A;  1V55 C;  2RDC A;  2Q7H A;  2HHH B;  1IDS A;  4YJ2 A;  1N33 O;  1R3L C;  3ZMZ A;  2D3O W;  2NR5 A;  1Q6U A;  4JI8 O;  3ZED A;  5H9C A;  2ZE6 A;  5LMU O;  2WLM A;  3SPI A;  4XBF A;  2WLL A;  2ADQ B;  1GN3 A;  3SR2 C;  2AXT Z;  1QCE A;  3K57 A;  5CB4 A;  3B8M A;  3R66 A;  5LXT B;  1S5H C;  5IJ9 A;  1N4C A;  1XMO B;  2O57 A;  1XL6 A;  2LP7 A;  1LUV A;  2P06 A;  1OCZ B;  4DUY O;  4LF7 O;  4B3T B;  1YZB A;  4KXR A;  4MVS A;  3M99 B;  2GUZ B;  3K0D A;  4DV5 O;  1GKF A;  1L0L H;  3SDL A;  2CAZ C;  1K3E A;  1SQQ H;  2DOS A;  2N74 A;  4DV1 B;  2IM9 A;  2IU3 A;  2Q7G A;  2WLK A;  3OTF A;  4UUJ C;  1N32 O;  3L71 H;  5EZY A;  3I56 V;  3NR7 A;  1BGY H;  3SYC A;  2F1M A;  4PDV A;  1GN4 A;  2NLJ C;  3FYE B;  3ZBH A;  1FJG B;  1NZ6 A;  2JGU A;  4DXW A;  5KHG A;  4UV9 A;  4IYI A;  1MZE A;  3G80 A;  5TIS Z;  1VQ9 V;  1JX9 A;  5LGN A;  1FXK C;  4TOI A;  4XDL A;  4DR2 O;  2Y0I A;  1YDX A;  4DV7 B;  2Y4U A;  1R6K A;  3AG3 C;  2A79 B;  3TXS A;  1Z2G A;  3UCS C;  1URF A;  3K9S A;  5BZB A;  4KHP O;  4FLT A;  4DV2 O;  2EIM C;  1FS0 G;  1L0N H;  1Y66 A;  1IBK B;  4FPP A;  2GBO A;  4UB6 Z;  5EBM C;  3RT3 C;  1IBM O;  3CC4 V;  3Q4H B;  4LFB B;  1VF6 A;  2JDI G;  1HNX O;  4PDM A;  1VQ8 V;  2XAQ A;  2XAF A;  2P90 A;  4NR1 A;  4B3M O;  1N0N A;  1H2G A;  5KAF Z;  4DR1 O;  1FFT B;  1GN6 A;  2VQE O;  2LO1 A;  4O2A A;  4J7Z A;  3L9D A;  5BXZ A;  5LMN O;  4H37 A;  4NTY A;  3AG1 B;  4JI6 O;  2EJR A;  4IT5 A;  4RUE A;  4W4K A;  2Q69 A;  1KP2 A;  2DN9 A;  3OT7 A;  4WFA V;  2WLN A;  5JJJ B;  3H01 A;  1BQ0 A;  4DV6 O;  2HP8 A;  4JGS A;  4UB8 Z;  4DK0 A;  2JGD A;  1BZK A;  3K04 A;  1KD1 W;  1PPJ H;  5F2V O;  2PY5 A;  2IJH A;  4O4I B;  1GK9 A;  1TA8 A;  4FLV A;  5LP6 B;  4TV8 A;  1H8E G;  4LFA O;  2YI8 A;  3ABK B;  1GN2 A;  1K92 A;  1TUB B;  2OCC B;  3CJH A;  5LOV A;  3TET A;  2R70 A;  4OPH A;  1YJ9 V;  4MW8 A;  2F23 A;  1PNK A;  1Z5V A;  5LBQ A;  4W4L A;  3L75 H;  4JI4 B;  2QWP B;  2E5L B;  2MK3 A;  4JAS A;  3JSN A;  1K9M W;  1WN7 A;  2BCC H;  3IJ4 A;  4JV5 B;  3A0B Z;  1KKD A;  4BWA A;  1LR1 A;  1SET A;  1YTF D;  4FM1 A;  4RAI A;  1QLN A;  4B08 A;  4EEQ A;  3RWR D;  3ETG A;  5EBW C;  3ABM C;  5C8Y B;  3QNE A;  1Q8I A;  2ZR2 A;  3MHH C;  1Q7Y W;  4JI0 O;  2ZM6 O;  2DYR B;  1PKX A;  4JI7 O;  3N2G B;  3AK1 A;  1S3J A;  4FMT A;  1VQ7 V;  1VQ5 V;  4J42 A;  1M5I A;  3DGE A;  4FK5 C;  1MNG A;  3O65 A;  2KKW A;  5JCO A;  4JI2 B;  3RW0 A;  2ZE7 A;  4IYH A;  3CXC U;  4LF6 O;  5FLX N;  1S76 D;  4O4H A;  3ASO B;  3JAW A;  4PV1 B;  1V54 B;  4FM0 A;  1AVM A;  3K79 A;  4YHH O;  3EVK A;  4UVC A;  1BQZ A;  1QLE B;  4X88 A;  2GTS A;  1N34 B;  4NXN O;  1JCH A;  3W7T A;  2WA3 A;  3MD0 A;  3MAQ A;  1S72 V;  1NS1 A;  2LW1 A;  4TQF A;  1X4T A;  2K1E A;  3OMN B;  2RQ6 A;  3HPL C;  3OE7 G;  1MA1 A;  3G71 V;  2CH7 B;  3ZX6 A;  3ABL B;  3ZHR A;  3TXQ A;  4UCR A;  4LWS A;  1RFY A;  2IJK A;  3JCU Z;  1W2B U;  3JAL A;  4IHJ A;  3SYQ A;  3VQV A;  2BTQ B;  4J9Z B;  4LCU C;  1L8D A;  4ICG A;  1TVK A;  1B6Q A;  4HNA B;  2R9R B;  4J7J A;  4NKG B;  5H6R A;  1SS3 A;  1JJ2 U;  3OMI B;  4I4T B;  3BEH A;  3T1Y O;  1JR9 A;  2VRZ A;  4UCS A;  5L3F A;  1JQ0 A;  3HKE A;  3J7A U;  4PA7 A;  5L3B A;  4LP8 A;  1HWY A;  1Y6X A;  1SKV A;  3OR6 C;  5B66 Z;  3OEH G;  3QO7 A;  2FL4 A;  3LSS A;  2PI4 A;  1XBL A;  3CRQ A;  2ZE5 A;  1S0V A;  4UVB A;  5CMU A;  2M7W A;  1TGO A;  3JAK B;  3WG7 C;  2XND G;  2EUL A;  3ZMU A;  4MTX A;  1J95 A;  5KHK A;  2QTS A;  3L70 H;  1H2M A;  4FLY A;  2BOB C;  2WAM A;  4X66 O;  1ZWI C;  1N36 B;  2BOC C;  2XAS A;  4H33 A;  3BVO A;  1KP3 A;  3AG1 C;  5KUM A;  1XI1 A;  4JI1 B;  4MVQ A;  1V55 B;  3D8C A;  4LF5 O;  2UXD B;  4CH5 A;  1N8R W;  1NJI W;  3SYO A;  5H5N A;  2ZIO A;  5GTI Z;  1IVS A;  1VQM V;  1Y74 A;  1ZL8 A;  4O2B B;  4DV0 B;  4J41 A;  1YJN V;  3E83 A;  3QO8 A;  4PA4 A;  2V7Q G;  3ZMS A;  1AIL A;  1M90 W;  2YIC A;  2AGA A;  2LGW A;  3ZHS A;  4IL6 Z;  3B2E E;  4GX5 A;  4RO2 A;  1NI8 A;  3BHP A;  4G2K A;  3I55 V;  4LNU B;  2OT5 A;  2YIA A;  3UKM A;  2E3C A;  3HKB B;  5EC1 C;  2YID A;  1P49 A;  5GON A;  3AG4 C;  4KL1 A;  2ITC C;  2WLJ A;  1XQ8 A;  1SQB H;  1WA8 B;  1K97 A;  4FFB A;  1SRY A;  3WFV A;  4QE9 A;  3UO3 A;  4DR5 O;  1S5L Z;  2NN4 A;  1QR9 A;  1ZTE A;  1K4C C;  4YJ3 B;  1Y76 B;  2EZO A;  4EFE A;  5KX5 A;  1G1X B;  3LDC A;  4J10 A;  4DRX A;  3RBZ A;  2DQ0 A;  3JD1 A;  3CB2 A;  2ILM A;  2IH3 C;  5FPR A;  1JFF A;  2OIG A;  3ZRW B;  1NH2 D;  2UXB O;  4GX1 A;  3B09 A;  3ZS8 C;  5BR8 B;  3JAR B;  1JOY A;  1HNZ B;  1H38 A;  3ZCC A;  4I9W A;  2YEV B;  2ZNJ A;  2EIN B;  3A0R A;  1XNR B;  3U10 A;  1MSW D;  4DR4 B;  1RSO A;  3ICX A;  4GKJ B;  2PF4 E;  1VIB A;  1FXK B;  3B8N A;  3RVZ A;  5J2U A;  5L3G A;  4WBN A;  2E74 B;  2XAG A;  1EN4 A;  1KU9 A;  2YC0 A;  2YI9 A;  1FPO A;  2EIM B;  4ZHQ B;  3C3S A;  4GLX A;  3IAY A;  3W7X A;  4GCZ A;  3K9A A;  3JD2 A;  3CRM A;  4LH7 A;  3F7V C;  3N2K A;  4U3J B;  2WWW A;  3QVN A;  2UU9 O;  1EN6 A;  3CC2 V;  1T5E A;  1WJZ A;  5CA0 B;  2NNU A;  3FFQ A;  1IXM A;  5EYP B;  4H0L B;  1WB7 A;  4P9P A;  4UCO A;  4PA9 A;  4QPK A;  1KMI Z;  3BPZ A;  3OD4 A;  3QTC A;  4K0K O;  1I08 A;  3D3Q A;  4CC6 A;  2GUZ A;  2ZCE A;  2CTP A;  1FKA O;  2HHH O;  4F6E A;  2DW4 A;  1EN5 A;  2Z3Y A;  1KBH A;  3RVY A;  4FM2 A;  4WFF A;  3CHX A;  5IE9 A;  3X2Q C;  1NU1 H;  4OX9 B;  4LF9 B;  1XDC A;  4JAV A;  1YTF B;  3CD6 V;  2EBO A;  1RPR A;  1P84 F;  2YS8 A;  3ZMV A;  4HYO A;  2DWD C;  1XMO O;  2YIB D;  4J9Y B;  1E1Q G;  1GM9 A;  3MHS C;  1PD3 A;  3K5M A;  3KKY A;  3K08 A;  4B3T O;  5LYJ B;  4EB6 A;  2IW5 A;  2RN9 A;  4K3A A;  4JYA B;  4DV3 O;  3SJA C;  1UJW B;  1H2S B;  1XIL A;  1Q3E A;  2HJF C;  1XUQ A;  1SQX H;  2BSK B;  2KB1 A;  4DV1 O;  1VQN V;  3FB7 C;  1P7G A;  2ZNI A;  1QBZ A;  1NT2 B;  4LH6 A;  2ZDI A;  2PI5 A;  4JYC A;  1DLB A;  4CZZ A;  4CH4 A;  3ZRX A;  1VF5 B;  3BA8 A;  3GWO A;  1ORQ C;  1VF7 A;  2G38 A;  2AW9 A;  2LQT A;  3ABM B;  4JF3 A;  1R3K C;  2PTM A;  3CCJ V;  4DR3 B;  1FJG O;  1YSC A;  4X64 B;  3RYI B;  5DEC A;  3OEE G;  5CBH A;  2AHZ A;  3A0H Z;  2UUB B;  2ZIM A;  1I0H A;  4PEL A;  1ARO P;  5GTH Z;  3K59 A;  3HB3 B;  1YF2 A;  1Q82 W;  2XTA A;  4I50 A;  2QE7 G;  1G8M A;  4MT8 A;  1FXV A;  4DV7 O;  1NR1 A;  5J2T B;  1JVM A;  2C2A A;  2JEU A;  1GRJ A;  2QSA A;  1H2N A;  5BMV B;  3CE2 A;  4FLW A;  1IBK O;  1HNW B;  3D36 A;  4I55 B;  1VEW A;  5ITZ B;  5JJE B;  3ZHU A;  1Q5O A;  2KG7 A;  1M4U A;  1XHZ A;  4TUY B;  1Q86 W;  4LFB O;  1XL4 A;  3UQ8 A;  1N33 B;  2CTR A;  3JD3 A;  3JYC A;  4U7O A;  4X1K A;  1XMQ O;  3SPH A;  4O4I A;  3P3P A;  1DF5 A;  5LP6 A;  3N27 A;  2EIN C;  3SGI A;  3G4S V;  5JVD B;  4FLZ A;  3KZI Z;  4UCV A;  1W0J G;  3RYF B;  2Q73 A;  2LW7 A;  1VP7 A;  3WU2 Z;  2CTQ A;  3RGB A;  4EFB A;  4GKK B;  4O4J B;  5D5Q A;  2IJI A;  5B1A B;  3ZRV A;  4YJ2 B;  1RPO A;  5JH7 B;  3ABT A;  3FB6 C;  1FFX B;  4Z2W A;  2WLL B;  4XDJ A;  3L73 H;  3E8G A;  3WG7 B;  5CB4 B;  2QR4 A;  1RM1 C;  1BL8 A;  3E8H A;  1L1F A;  2ODM A;  1RP3 B;  2D2C B;  5CBF A;  3IFX A;  3J80 N;  1NBM G;  2OIE A;  4X65 B;  3E8B A;  3U11 A;  2XAH A;  3E35 A;  2F95 B;  1SA0 B;  3H1I H;  4JI4 O;  2E5L O;  1IBL B;  3IC7 A;  4MTF A;  4JV5 O;  4F6R A;  2DYS C;  4MS2 A;  5HFM A;  3EXA A;  3A8T A;  4UCT A;  3K5L A;  3K58 A;  3H1J H;  1MG1 A;  3B77 A;  4OPA A;  2UUA B;  3ASN B;  3DSQ A;  4UFZ A;  3W7W A;  2ZD9 A;  4DR2 B;  1ZUQ A;  2FB5 A;  1F23 A;  1QU7 A;  4MVZ A;  3THO A;  3I5D A;  4BW9 A;  3OUF A;  2RJZ A;  4JI2 O;  5JWP A;  3CRA A;  2OWO A;  2QDO A;  4DR6 O;  1B06 A;  1NH2 B;  3F5T A;  5IY5 B;  3E8F A;  3AG4 B;  5J9P C;  2BTQ A;  3E2E A;  4HNA A;  4PDR A;  1I5Y A;  1EFR G;  2HVJ C;  3UO2 A;  4I4T A;  4TV9 B;  1J5E B;  4PHZ A;  4A5U B;  3K0G A;  1N34 O;  4LF4 B;  3KG2 A;  4DR1 B;  1R73 A;  1LUW A;  1G4Y B;  1O9H A;  3P32 A;  3CCL V;  4YIO A;  5LHG A;  3OGC C;  4MVR A;  4LBE C;  2JJ2 G;  1PV0 A;  1Y67 A;  5BY1 A;  2Q0A A;  3TJT A;  1QHT A;  2LGQ A;  1Z5W A;  3CS5 A;  4H13 B;  4FIP C;  1K34 A;  2Q6A A;  4G27 B;  4X8A A;  2CK3 G;  4X9Q A;  2JEX A;  4ASU G;  1VMG A;  4JZ2 A;  4D7T A;  1YXB A;  4X62 B;  2ZE8 A;  2P6J A;  1YJW V;  1MSD A;  4X20 A;  1EZJ A;  2H94 A;  4RUF A;  3NXS A;  3VQW A;  3W7S A;  4B3R B;  3OW2 U;  1H8H G;  4TQD A;  1UPG A;  3JSL A;  4YY3 B;  5B1B B;  1M57 C;  2DWE C;  4MW3 A;  1K8A W;  4E4E A;  2AZ2 A;  2Q4P A;  1AI7 A;  4LF8 B;  3ZHQ A;  1XHX A;  4R50 A;  2QWO B;  2Q0O C;  4C7U A;  2JGD B;  5DM6 V;  1SER A;  2B5U A;  2XOK G;  3GWK C;  1N36 O;  2QGN A;  1AI6 A;  1VQL V;  5CA3 A;  3JAM N;  1H2K A;  4K8X A;  2IJJ A;  4TV8 B;  4JI1 O;  1OHH G;  1AP6 A;  2H3O A;  3T1H B;  3CJH B;  4FLX A;  2KSD A;  1WPB A;  2FYU H;  4DV4 B;  2UXD O;  2GSM B;  3X2Q B;  2GHY A;  5FNV B;  2VS0 A;  5B1A C;  5IJ0 B;  4DV0 O;  2ZDI C;  2B1I A;  1BSM A;  3WB1 A;  4P30 A;  4X1I B;  5KLV H;  3IGA C;  3BAB A;  3CX5 F;  2R9A A;  1SQV H;  2L35 A;  5FL7 G;  3RYH A;  2F4V B;  4PD4 F;  4ZOL B;  4DW0 A;  4WFH A;  1GM7 A;  3TCU A;  5IDJ A;  1OCR B;  4NXM B;  4B7K A;  3L74 H;  1Q43 A;  1CP9 A;  2WPD G;  1YI2 V;  3PN1 A;  1FXH A;  1B04 A;  2ARH A;  4N23 A;  3ZRW A;  1SQP H;  5LGU A;  4X1Y B;  2RMK B;  4XDK A;  1M56 C;  3CWB H;  3JAR A;  1ROP A;  2M6Y A;  2Q67 A;  2Q68 A;  5JQG B;  1YEW A;  3F5W C;  3QF7 A;  2MW2 B;  1DTO A;  4K35 A;  3CME V;  4GX0 A;  2X7R B;  1GH6 A;  2PYJ A;  3JAW B;  1FXK A;  3CP1 A;  2VQF B;  2OTJ V;  1S77 D;  1GO3 F;  4I9Q A;  5C93 A;  3LUT B;  3DXR B;  5HFL A;  3ASN C;  1BE3 H;  2LFS A;  4ZHQ A;  4IGG A;  2IBZ H;  3FAV B;  4CC5 A;  3M7M X;  3RFR A;  3VQX A;  5BR8 O;  3OFN G;  2JVD A;  4PI0 A;  1EZV H;  4KFM A;  5KAI Z;  3M8A A;  1HNZ O;  1YCI A;  4AQY B;  1VQO V;  4R6Z A;  2ZT9 B;  3A2F A;  5IY5 C;  1F4N A;  2QWR B;  2Z5U A;  4JI5 B;  1XNR O;  1JJO A;  5KMG B;  3U0Z A;  3AEI A;  4JTD B;  2Y0P A;  2QEX V;  1VQ6 V;  4DR4 O;  5EYP A;  4GKJ O;  3SJB C;  4O4L A;  3HKC B;  4MVM A;  3TK1 A;  3ZN0 A;  5AG2 A;  2P22 C;  3JAS A;  2A0L A;  2FML A;  2ZKO A;  3HKE B;  5JJN B;  4CS4 A;  2EIL C;  2R72 A;  1EBO A;  5LHI A;  2Q8V A;  2F66 C;  3AG2 C;  1HW7 A;  3T4D A;  1NQT A;  5B1O A;  2V4D A;  3VQY A;  4ZI7 B;  1AJN A;  4CS2 A;  4KP4 A;  3CCR V;  5CA1 B;  5LA6 A;  2ZQM A;  3KCY A;  4PDL A;  3G6E V;  4QGP A;  1HR0 B;  3D3I A;  1E1R G;  3OGI B;  4LFC B;  3CXH F;  4UVA A;  4NTW A;  1VF6 C;  5LHH A;  3RYC B;  2W6I G;  3CRC A;  2DE0 X;  5LYJ A;  4TWK A;  1G6U A;  2L6L A;  2N04 A;  3S3W A;  2XHB A;  2HFE C;  3CEI A;  3OAA G;  5IYZ B;  3HR0 A;  4OX9 O;  4LF9 O;  1YVW A;  2PGG A;  1O9G A;  5IWA B;  2V1D A;  3BFR A;  4BIO A;  5B1B C;  3ETD A;  4HBN A;  2OYQ A;  1D5A A;  4I0X B;  1XNQ B;  4YXW G;  4FVM A;  1Y74 B;  1ZL8 B;  1Q6I A;  1NKD A;  2GV9 A;  5LXT A;  1GAX A;  2Y48 A;  1RM1 B;  4JYA O;  5B3S C;  4GYC B;  2EX3 A;  2AZ0 A;  3JAT B;  4Z1M G;  2ETN A;  1BS3 A;  2VWJ A;  4MTO A;  4OXS A;  2CTW A;  3CCS V;  2Q7E A;  1FYJ A;  3CC7 V;  4KUM A;  2QKS A;  2JIZ G;  5D5P A;  1F4M A;  2DYS B;  3GVM A;  3EHB B;  3LNM B;  2WSS G;  2KQX A;  1AB3 A;  1AR5 A;  1AI5 A;  4FFB B;  2IH1 C;  2OCH A;  4D6T H;  1AP5 A;  2UUC B;  2RCV A;  2OTL V;  4CS3 A;  5EK0 A;  4DR3 O;  4ZBM A;  1I7F A;  4X64 O;  4I55 A;  4PA3 A;  1OCR C;  3SPC A;  5B5E Z;  4CBC A;  1D2D A;  2HVK C;  4DRX B;  2UUB O;  1YIJ V;  1EM1 A;  3ZMT A;  4WF9 V;  1JFF B;  3BA9 A;  1NVP D;  4DUZ B;  4QNH B;  3E86 A;  2W0X A;  2EZP A;  5JCO C;  3FYI B;  3K3W A;  1AI4 A;  3OUS A;  3B4S A;  4JYY A;  3WB2 A;  5FPO A;  1VQP V;  1ZX3 A;  4WFB V;  1RSO B;  3BCC H;  4BW5 A;  1MZF A;  2CDY A;  1HNW O;  4GX2 A;  4J80 A;  3LDE A;  4P2Z A;  2LFR A;  1SC5 B;  3ZHT A;  5J2U B;  4WBN B;  2QWQ B;  4IIJ B;  1M1K W;  1VQ4 V;  3HKD B;  2JS3 A;  2UXC B;  1I94 B;  5JH7 A;  3E22 B;  1HP8 A;  1KB9 F;  1FFX A;  1WB8 A;  1TAE A;  1QVF U;  3T2M A;  4DR7 B;  1SES A;  1BCC H;  3Q4H A;  2QM4 A;  2FTK A;  5KHI A;  3N2K B;  2Q5Z A;  4JZG A;  3FB5 C;  3OTO B;  2Q9L A;  5KUK A;  1OCO C;  1D5N A;  3CMA V;  4RWU A;  1FAF A;  4B3S B;  3UM7 A;  4HAM A;  3CPW U;  2RNB A;  2Y69 C;  4I5S A;  4GKK O;  1SA0 A;  5EC2 C;  4JI3 B;  5B1N A;  4DV3 B;  4JAA A;  3K03 A;  5H2F Z;  1IZ3 A;  2WLI B;  1M57 B;  4DO2 A;  4DYL A;  1DK1 A;  1IUR A;  2QM7 A;  2JRI A;  2ZXW C;  2QWN B;  3ZHV A;  1QNM A;  4JI8 B;  2CGN A;  3RN4 A;  5LMU B;  1W59 A;  1B3Q A;  3UT5 B;  5KA6 A;  4GT1 A;  1N0J A;  4JAU A;  1K7D A;  4X65 O;  1OJH A;  2A3Q A;  4LR3 A;  3EFF K;  4EB6 B;  1TUB A;  1Y4M A;  1IBL O;  1V9P A;  2UXN A;  3OM3 B;  5K1P A;  4PA6 A;  4X89 A;  3CYO A;  1K33 A;  4DUY B;  4LF7 B;  5IYC O;  2QTO A;  3K5N A;  2XT9 A;  4MSW C;  1FD9 A;  2CUG A;  1UFI A;  4DV5 B;  3FKS G;  4TV9 A;  2UUA O;  4TT3 G;  2X0L A;  2ZIN A;  3ETE A;  5C8Y A;  2EIJ B;  4JTA B;  3AG7 A;  1N32 B;  5IJ9 B;  4MVO A;  1F7Y A;  4PJ0 Z;  2ADP A;  1E79 G;  4WCE V;  3N2G A;  1HDJ A;  2XAJ A;  4U7N A;  4YIP A;  3QG5 A;  2EIK C;  3J81 N;  3WB0 A;  1Q90 D;  4ABM A;  5E79 Z;  2P67 A;  3AK3 A;  5DN6 G;  3P30 A;  3CCQ V;  3T1C A;  1M56 B;  4N21 A;  1WP8 A;  2DQ3 A;  1J5E O;  1M93 A;  4I50 B;  1K4D C;  4LF4 O;  2ITD C;  1WAZ A;  2K9P A;  4JPR A;  5EBL C;  2PYL A;  1XMQ B;  1CPY A;  1GMG A;  4ZIB A;  2QKC A;  4NYK A;  1GM8 A;  1R1B A;  1PNL A;  3ZIA G;  2FKX A;  2ZR3 A;  5EZY B;  2AHY A;  4HZ3 A;  1JA8 A;  3H9V A;  1TUE B;  1ZLZ A;  2BTO A;  1OCC C;  1PL4 A;  4QIW F;  2ATK C;  2KG7 B;  2CH7 A;  3FB8 C;  4KHP B;  1Q81 W;  4DV2 B;  1P7B A;  2YIB A;  3GB7 C;  1JMK C;  3LSQ A;  4GUN A;  4X1K B;  4X62 O;  4AI8 A;  1IBM B;  5GW7 A;  4UXN A;  2PUS A;  3FD9 A;  4QPJ A;  1HNX B;  3SPG A;  4BAY A;  4AHC A;  4B3R O;  4WFE A;  2A06 H;  4B3M B;  3ZN1 A;  5H6Q A;  5A9G A;  2EIL B;  2YUA A;  2VQE B;  4YY3 O;  5LMN B;  2B1G A;  3AG2 B;  4JI6 B;  3S3X A;  5FNV A;  2DMX A;  5DED A;  1KC8 W;  2EJ7 A;  5IJ0 A;  4ZKI A;  3CSX A;  1I5X A;  2X6C A;  4LF8 O;  5KA5 A;  3BRC A;  4P9O A;  5LL6 Y;  4X1I A;  3ETQ A;  2QM8 A;  1GTO A;  2JJ1 G;  2P4K A;  1KEC A;  3CCV V;  3JAK A;  3KCX A;  4ZOL A;  4DV6 B;  1BT8 A;  2YXY A;  4WFG A;  2A9H A;  3BY6 A;  3H1K H;  1X59 A;  3SJC C;  3T1H O;  3STL C;  1WPX A;  4O2A B;  1QVG U;  2F93 B;  1OCZ C;  4DV4 O;  3F7Y C;  2E75 B;  1BHA A;  4QE7 A;  4CH6 A;  4X1Y A;  1XRE A;  2QA4 V;  4LFA B;  4E2L A;  3QO5 A;  3BAA A;  2E76 B;  3L72 H;  5JQG A;  4F6R B;  2YDE A;  4JYB A;  4DR6 B;  5L3C A;  1OV9 A;  3IC9 A;  4PI2 A;  2JS5 A;  1KUQ A;  2DJV A;  5K1X A;  1VAR A;  4TSF G;  2QJ1 A;  4EKW A;  4FZ0 A;  4RQE A;  2F4V O;  4O2B A;  4NXM O;  1OZ0 A;  4NB5 A;  1PNM A;  2UXX A;  5EIB C;  3DXR A;  4Q20 A;  5B3S B;  4GZR B;  4QJF B;  1U97 A;  2Y4T A;  2GDS A;  5IYD O;  4AIL C;  3FAV A;  1MMM A;  4LNU A;  4JI0 B;  1ENV A;  2ZM6 B;  5LOV B;  4JI7 B;  1NVP B;  3O9O A;  3VBB A;  3HKB A;  2LJ2 A;  1DGS A;  3E89 A;  5IYB O;  5KMG A;  4R8C A;  2A7W A;  1BHB A;  1WA8 A;  3HKC A;  2VQF O;  4LF6 B;  1MAB G;  5KHH A;  3ABU A;  4MVU A;  1YIT V;  1WLE A;  1K5Q A;  2WLH A;  4YJ3 A;  1Y76 A;  1YHQ V;  2EIJ C;  5EIB D;  1R6T A;  4YHH B;  4ZI7 A;  2YSU B;  4NVP A;  4NXN B;  5CA1 A;  4CH3 A;  3JCZ A;  4JTC B;  4AQY O;  1P4R A;  2GTA A;  4JI5 O;  4DK1 A;  4B7E A; 
#chains in the Genus database with same CATH homology
 1THZ A;  5LBQ A;  2Y48 A;  1RM1 B;  5B3S C;  3D36 A;  2MK3 A;  4JAS A;  2YEV A;  1K9M W;  1KKD A;  2F43 G;  4Z1M G;  3CCE V;  2H8P C;  1Q86 W;  4MTO A;  4OXS A;  1XL4 A;  3CCS V;  1SET A;  1YTF D;  4RAI A;  3CC7 V;  3SPJ A;  1QLN A;  3JD3 A;  2QKS A;  4KUM A;  3JYC A;  4U7O A;  3W7U A;  2JIZ G;  4F4L A;  3ETG A;  5EBW C;  3ABM C;  1F4M A;  2DYS B;  3QNE A;  3SPH A;  3EHB B;  3LNM B;  2WSS G;  3ML0 A;  2ZR2 A;  3MHH C;  4LC1 A;  1Q7Y W;  1JPX A;  1DF5 A;  4L87 A;  2DYR B;  1AI5 A;  4BIZ A;  1PKX A;  2EIN C;  3STZ C;  1S3J A;  4FMT A;  3G4S V;  1VQ7 V;  2IH1 C;  1VQ5 V;  1M9N A;  1W0J G;  2OTL V;  3DGE A;  4FK5 C;  5EK0 A;  4ZBM A;  3RW0 A;  3OMA B;  3CXC U;  1OCO B;  1OCR C;  4PA3 A;  3SPC A;  3CCU V;  1S76 D;  2IJI A;  5B1A B;  4CBC A;  3ZRV A;  2W6J G;  2R9I A;  2HVK C;  1RPO A;  3ZJZ A;  2P7T C;  1YIJ V;  2Y69 B;  3ABT A;  3ABK C;  3FB6 C;  3ZMT A;  3ASO B;  4WF9 V;  2OCC C;  1CEZ A;  1AJP A;  1V54 B;  2WLL B;  4XDJ A;  3K79 A;  1NR7 A;  1NVP D;  3E8G A;  4UVC A;  1PL0 A;  3WG7 B;  1QLE B;  4X88 A;  3E86 A;  4QNH B;  4UV8 A;  2EZP A;  1JCH A;  3W7T A;  3MD0 A;  1RM1 C;  3FYI B;  1BL8 A;  3E8H A;  1L1F A;  3K3W A;  1S72 V;  1AI4 A;  3OUS A;  3DTU B;  1AJQ A;  2K1E A;  3SYA A;  5CBF A;  3IFX A;  3OMN B;  1VQP V;  3HPL C;  3OE7 G;  4WFB V;  2ZXW B;  2HG5 C;  1NBM G;  2X6A A;  3G71 V;  1LNQ A;  3E8B A;  3SJQ C;  1KQS U;  2XAH A;  3ABL B;  3E35 A;  4BW5 A;  1DF4 A;  4GX2 A;  3IC7 A;  2IJK A;  4MTF A;  3LDE A;  4P2Z A;  2LFR A;  1W2B U;  2DYS C;  4MS2 A;  5CN0 A;  3SYQ A;  4J9Z B;  1M1K W;  1VQ4 V;  5HFM A;  4LCU C;  1B6Q A;  1VQK V;  2R9R B;  5H6R A;  1JJ2 U;  2DYR C;  3OMI B;  3BEH A;  3K06 A;  5L3F A;  1JQ0 A;  1QVF U;  3T2M A;  1SES A;  1SZT A;  4PA7 A;  5L3B A;  1HWY A;  4LP8 A;  1COW G;  2FTK A;  1MG1 A;  3JD0 A;  3B77 A;  3OR6 C;  4R7C A;  3T4Z A;  3FB5 C;  3OEH G;  3ASN B;  3W7W A;  3QO7 A;  5KUK A;  2ZD9 A;  1OCO C;  3CMA V;  1F23 A;  4MVZ A;  3LSS A;  3LDD A;  3UM7 A;  4HAM A;  2PI4 A;  1QR8 A;  3CPW U;  2Y69 C;  4I5S A;  3OUF A;  3JD4 A;  3ASO C;  1S0V A;  5EC2 C;  1V54 C;  4UVB A;  5L3E A;  5CMU A;  1NH2 B;  5B1N A;  2M7W A;  3AG3 B;  5IY5 B;  3WG7 C;  2XND G;  1QLE C;  3E8F A;  3AG4 B;  5J9P C;  3ZMU A;  3K03 A;  4MTX A;  1J95 A;  3E2E A;  4RQF A;  4PDR A;  1I5Y A;  2WLI B;  1EFR G;  1M57 B;  2HVJ C;  2BOB C;  4DO2 A;  2WAM A;  1ZWI C;  2BOC C;  2XAS A;  2EIK B;  2QM7 A;  4H33 A;  2ZXW C;  2JK5 C;  3K0G A;  1KP3 A;  3ABL C;  3KG2 A;  3AG1 C;  1R73 A;  5KUM A;  1MOF A;  4MTG A;  1G4Y B;  3PJS K;  3P32 A;  3CCL V;  3CCM V;  2IU0 A;  5KA6 A;  4GT1 A;  4MVQ A;  1V55 B;  5E1A C;  5LHG A;  3OGC C;  4JAU A;  1K7D A;  5LGT A;  4MVR A;  4LBE C;  1R3J C;  2JJ2 G;  1N8R W;  3EFF K;  1NJI W;  3SYO A;  1VQM V;  1W0K G;  1Y4M A;  2UXN A;  3OM3 B;  4PA6 A;  4X89 A;  3CYO A;  1YJN V;  3E83 A;  3QO8 A;  4PA4 A;  1K33 A;  2V7Q G;  3ZMS A;  3SYP A;  4FIP C;  1BMF G;  5IYC O;  1K34 A;  2Q6A A;  2QTO A;  4G27 B;  4X8A A;  3VOU A;  1M90 W;  2CK3 G;  3R65 A;  1OCC B;  2JEX A;  2WLI A;  4MSW C;  4ASU G;  4BIU A;  4GX5 A;  2X6B A;  2P6J A;  3FKS G;  4RO2 A;  1YJW V;  4G2K A;  3I55 V;  1EZJ A;  4TT3 G;  2X0L A;  2HR3 A;  2H94 A;  2OT5 A;  4RUF A;  3NXS A;  3UKM A;  3W7S A;  3ETE A;  5EC1 C;  1R6N A;  1H8H G;  2HLD G;  3OW2 U;  2EIJ B;  4FJC C;  4JTA B;  3AG4 C;  4MVO A;  1AR1 B;  5B1B B;  2ITC C;  2WLJ A;  1E79 G;  1R3I C;  1M57 C;  2DWE C;  4WCE V;  1F51 A;  2XAJ A;  1K5S A;  4U7N A;  1K97 A;  2EIK C;  1SRY A;  2W0F C;  4MW3 A;  5L3D A;  2HKO A;  3WFV A;  5CBG A;  1K8A W;  4G28 B;  1AI7 A;  3ZRS A;  1K73 W;  4QE9 A;  2P67 A;  5DN6 G;  4R50 A;  3OR7 C;  3P30 A;  1QR9 A;  3T1C A;  3CCQ V;  1M56 B;  4N21 A;  1K4C C;  5DM6 V;  2EZO A;  2B5U A;  2XOK G;  1SER A;  2DQ3 A;  1AI6 A;  1VQL V;  1V55 C;  5CA3 A;  1K4D C;  2ITD C;  3LDC A;  1R3L C;  3ZMZ A;  4JPR A;  5EBL C;  3RBZ A;  2DQ0 A;  3JD1 A;  2D3O W;  1CPY A;  1GMG A;  2IJJ A;  5H9C A;  2IH3 C;  1OHH G;  2WLM A;  3SPI A;  4XBF A;  2WLL A;  1GM8 A;  1PNL A;  3ZRW B;  1QCE A;  3ZIA G;  2ZR3 A;  1NH2 D;  3B8M A;  2AHY A;  4GX1 A;  4HZ3 A;  1TUE B;  1JOY A;  1S5H C;  1H38 A;  3ZCC A;  2GSM B;  3X2Q B;  1OCC C;  2GHY A;  1XL6 A;  4I9W A;  2YEV B;  5B1A C;  2LP7 A;  4QIW F;  2EIN B;  3A0R A;  2ATK C;  2ZDI C;  2B1I A;  4P30 A;  1MSW D;  1OCZ B;  3FB8 C;  1Q81 W;  3IGA C;  1P7B A;  4MVS A;  1FXK B;  3B8N A;  3M99 B;  3GB7 C;  3RVZ A;  3LSQ A;  5FL7 G;  3K0D A;  5L3G A;  2XAG A;  1GKF A;  4WFH A;  1GM7 A;  3TCU A;  5IDJ A;  1OCR B;  5GW7 A;  1K3E A;  4UXN A;  2EIM B;  1CP9 A;  4QPJ A;  3SPG A;  2WPD G;  4GCZ A;  4BAY A;  3W7X A;  3K9A A;  1YI2 V;  2IU3 A;  1FXH A;  2WLK A;  4N23 A;  4WFE A;  3JD2 A;  4UUJ C;  3ZRW A;  5LGU A;  3F7V C;  5H6Q A;  3ZN1 A;  2EIL B;  2WWW A;  4XDK A;  3I56 V;  1M56 C;  2B1G A;  3SYC A;  1ROP A;  3AG2 B;  2Q67 A;  3CC2 V;  2Q68 A;  4PDV A;  3F5W C;  1KC8 W;  2NNU A;  4ZKI A;  1IXM A;  1I5X A;  2NLJ C;  2X6C A;  1DTO A;  3CME V;  3FYE B;  4GX0 A;  4P9P A;  2X7R B;  4PA9 A;  5KA5 A;  4P9O A;  4QPK A;  2QM8 A;  1FXK A;  1GTO A;  3CP1 A;  2JJ1 G;  2OTJ V;  1KEC A;  1S77 D;  3CCV V;  1GO3 F;  2DW4 A;  5C93 A;  3LUT B;  2Z3Y A;  3RVY A;  4DXW A;  5HFL A;  4WFG A;  3ASN C;  2A9H A;  3BY6 A;  4WFF A;  2LFS A;  3X2Q C;  4UV9 A;  3STL C;  4JAV A;  1WPX A;  1QVG U;  1YTF B;  1OCZ C;  3CD6 V;  3F7Y C;  1BHA A;  2EBO A;  3OFN G;  1RPR A;  4QE7 A;  1VQ9 V;  1JX9 A;  5LGN A;  3ZMV A;  1FXK C;  4KFM A;  4HYO A;  2DWD C;  2QA4 V;  4E2L A;  4XDL A;  4J9Y B;  3QO5 A;  1VQO V;  4R6Z A;  1E1Q G;  1R6K A;  1GM9 A;  3AG3 C;  5IY5 C;  1F4N A;  2A79 B;  3MHS C;  1PD3 A;  2Z5U A;  4JYB A;  5L3C A;  5BZB A;  3AEI A;  4JTD B;  1VQ6 V;  2QEX V;  2EIM C;  3K08 A;  1FS0 G;  2IW5 A;  4MVM A;  1Y66 A;  3TK1 A;  4FPP A;  5EBM C;  4TSF G;  3ZN0 A;  4EKW A;  1UJW B;  4RQE A;  3CC4 V;  2A0L A;  2HJF C;  1OZ0 A;  2EIL C;  2KB1 A;  1EBO A;  1PNM A;  2UXX A;  2JDI G;  4PDM A;  5LHI A;  1VQ8 V;  3AG2 C;  4Q20 A;  5B3S B;  1VQN V;  3T4D A;  3FB7 C;  2XAQ A;  2XAF A;  4QJF B;  2P90 A;  1NQT A;  5B1O A;  1QBZ A;  1AJN A;  1H2G A;  2ZDI A;  5IYD O;  1FFT B;  4KP4 A;  2PI5 A;  4JYC A;  3CCR V;  1DLB A;  2ZQM A;  4PDL A;  3G6E V;  4H37 A;  4CZZ A;  3ZRX A;  1ENV A;  3AG1 B;  3GWO A;  3D3I A;  1NVP B;  3VBB A;  1E1R G;  1ORQ C;  2EJR A;  3ABM B;  3E89 A;  4UVA A;  5IYB O;  5LHH A;  4RUE A;  2Q69 A;  4R8C A;  1KP2 A;  4JF3 A;  1R3K C;  2W6I G;  3CCJ V;  1BHB A;  4TWK A;  1YSC A;  4WFA V;  2WLN A;  1MAB G;  2HFE C;  3H01 A;  3ABU A;  3OEE G;  5CBH A;  2AHZ A;  4MVU A;  1YIT V;  3OAA G;  1WLE A;  4JGS A;  1K5Q A;  4PEL A;  2WLH A;  1ARO P;  1YHQ V;  3K04 A;  2EIJ C;  3HB3 B;  1KD1 W;  1Q82 W;  2IJH A;  2QE7 G;  2V1D A;  1G8M A;  1GK9 A;  5B1B C;  2YSU B;  3ETD A;  4MT8 A;  1H8E G;  3JCZ A;  3ABK B;  4JTC B;  1FXV A;  1P4R A;  1K92 A;  2OCC B;  1NR1 A;  1JVM A;  3TET A;  2C2A A;  2JEU A;  4YXW G;  1YJ9 V;  4MW8 A;  1NKD A;  1PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...