3OW2U

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ow2U00
3CCUV 1M90W 4WCEV 1Q86W 3G4SV 2OTLV 3CXCU 1VQOV 5DM6V 3CCVV 2QA4V 1QVFU 3CD6V 1QVGU 1VQ6V 1R73A 3I55V 1VQ5V 1VQKV 1K73W 1YJWV 1VQNV 3G6EV 3CC4V 3CCEV 1K9MW 1KC8W 1VQ8V 1S72V 1NJIW 3CMEV 3CPWU 3G71V 4WFAV 3OW2U 1VQ7V 1YITV 2D3OW 1Q81W 1N8RW 3CMAV 1M1KW 2QEXV 1YI2V 3CCMV 4WFBV 1VQPV 3I56V 3CCSV 4WF9V 1YHQV 1VQMV 1Q82W 1K8AW 3CCQV 1YIJV 1KD1W 1JJ2U 3CCRV 1KQSU 1YJ9V 1VQ4V 1VQ9V 3CC2V 2OTJV 3CCJV 1YJNV 3CC7V 3CCLV 1VQLV 1W2BU 1Q7YW
chains in the Genus database with same CATH superfamily
3K08A 1JVMA 5CA1B 2BOCC 2CUGA 1N36O 1H8EG 3TXQA 1QBZA 4Z1MG 1JJOA 3TCUA 5H6QA 2LGQA 4F6EA 1EBOA 4QE7A 1A32A 4K0KB 1UFIA 5L3EA 1XMOO 2JK5C 2CTWA 3L73H 1M90W 2WA4A 5CA3A 1XQ8A 1I94B 3LDEA 2QM4A 1K9MW 2EX3A 5KUMA 1S5HC 1VQ8V 1D5NA 3ABLC 3SPJA 3JARB 4AILC 2F95B 1MSWD 5JQGB 2W0FC 1Q43A 2YXHA 4X1IB 3BVOA 2QWPB 3MHHC 3ABLB 4IIJB 4UV9A 1R1BA 1IVSA 4UCOA 2DYRB 3G71V 3L74H 1SC5B 1I08A 1GRJA 4LF9O 1N33B 2A3QA 3VOUA 4ZIBA 3CC2V 2Y69C 1H2GA 3ZMTA 2Q6AA 4X64B 4LFAO 2LQTA 2OIEA 1VQOV 4X65B 4LNUA 2QR4A 3AG3B 3F7YC 4EKWA 4R50A 4LF5O 2Q5ZA 2UXBO 1YDXA 4UVAA 3K0GA 1Y74B 1L0LH 2KSDA 3I56V 1EN4A 5GONB 1G4YB 2UUBO 5JCOA 1Q6IA 1Q7YW 4MVRA 1OZ0A 2HFEC 3JASB 3X2QB 2LFRA 1MMMA 3IC9A 1OCOB 2YIAA 3CE2A 3JAKB 1DF5A 5JVDA 3OAAG 1WP8A 1S77D 1I0HA 5L3DA 1HWYA 3SPHA 2LP7A 4FFBA 3W7TA 3Q4HA 1WPBA 4GCZA 3MAQA 1H2NA 1BQ0A 4CS4A 2PYJA 5LYJB 1VF7A 4DYLA 3CCEV 4PDLA 4X20A 3CSXA 4PI0A 3QO8A 4TV9B 2JJ2G 1LUWA 2EIKC 1MZEA 1RPRA 2IJHA 3UO3A 3UKMA 2Q73A 2JJ1G 2H3OA 4O2BA 2QJ1A 1M5IA 4FZ0A 3LSSA 4O2AA 5K1XA 5HFLA 3CXHF 3ZHRA 2RDCA 3VBBA 4YJ3B 5GTHZ 4DO2A 4LBEC 1L0NH 4I55A 5B3SC 3UO2A 1ZL8B 2EZOA 5LA6A 3JALA 2QEXV 2W0XA 1VQMV 2ZT9B 2CAZC 2XOKG 1SZXA 3KZIZ 1KU9A 2UUBB 1P7GA 1GN4A 1SS3A 3OEHG 4QJFB 5B1BB 1RSOB 1RP3B 2A0LA 1QVFU 2Y48A 3E8HA 1XI1A 3GWOA 4O4JB 1K73W 2UXBB 1EN6A 3ZHQA 1FXKB 1V55C 2IH1C 4LF5B 5LP6A 2H8PC 4MVMA 2GBOA 4X65O 1WPXA 4I9WA 4LFAB 3HKBB 3W7XA 2GUZA 4X64O 1BSMA 4NTXA 1XDCA 2OTJV 5C93A 4PD4F 3A8TA 1N33O 3FX7A 4LF9B 4OGQB 2GDSA 1GH6A 2EIJB 2XUMA 3AG4C 3RYFA 3FYEB 3RN4A 1NR1A 2ITCC 2AHZA 3SGIA 2DYRC 2MK3A 2EULA 3UM7A 1GO3F 3CPWU 1K4DC 1Q6HA 2X6AA 3WFVA 2ZR3A 1NH2D 2VS0A 4N21A 4CC5A 3LDDA 4MW8A 5KLVH 2AZ0A 5EIBC 2QSAA 1QCEA 2WA3A 2EIMB 3FB7C 4BIZA 2P4KA 1AJNA 2EZPA 3SJQC 3SJAC 3K79A 4A5UB 2ITDC 1I94O 3N27A 2CGOA 2VWKA 1LUVA 5H6RA 1XMOB 1KQSU 1XHZA 4YIOA 1VIBA 2V7QG 4K0KO 3HB3B 5LXTA 4WFGA 2CTPA 4B7KA 4ZBMA 3A0RA 3CHXA 2Q7EA 1MABG 2X6CA 4J7JA 1GN3A 4TV8B 1N36B 2CDYA 1PV0A 4WFAV 1SZTA 5IYZB 4JI2B 2Y4UA 5D5PA 2EBOA 3WB0A 4LP8A 1M56C 3ABMB 3ASOC 4JI4O 1T5EA 3K57A 3THOA 1H38A 2EINB 2WWWA 5EZYA 5IY5B 1J5EO 4LF7O 4NXNO 2DOSA 3RYIB 1AR5A 5IJ9A 4UCUA 2ZR2A 1RM1C 2R70A 1ZLZA 4P9PA 1H2MA 1KD1W 3ZHUA 2DN9A 5H9CA 5C8YA 4JYAO 1IX9A 2QWRB 5IYDO 4Q20A 1IBKB 1H2KA 4W4KA 4HNAA 3L70H 4NXMO 2F4VO 4F6RA 1NTZH 2ETNA 4W4LA 1W0JG 3T2MA 1KBHA 4X1KB 2YI9A 1SA0B 1YVWA 1E1RG 1V54C 3P3PA 2EIJC 3ML0A 1OCCC 4I50A 1VQLV 1Z2GA 3WB2A 2R9RB 1IBLO 1EZVH 4HBNA 1WA8B 1NQTA 1FS0G 2DE0X 1G8MA 1Y6XA 3ZMVA 3A2FA 1HW7A 1GM7A 3T1CA 2XAQA 4WBNB 2IH3C 3WG7B 3RBZA 2ZE6A 4GKKB 5KMGA 5J2TA 3CCLV 5J2UA 2ZDIA 3OGIB 2QA4V 1WP7A 5LP6C 2OIGA 4JTAB 3BABA 2F43G 1TGOA 3OUFA 1SETA 3ZN1A 1KECA 4ZOLA 2N05A 4NVPA 2DQ3A 4JV5B 4XBFA 5LMNB 4WFFA 3E8FA 1NTMH 4JTDB 4H44B 1I5XA 2QDOA 2AXTZ 5JH7B 4IYIA 4DV4B 3HKDB 5B5EZ 3ZRSA 2KB1A 4PELA 4DR3O 4TQDA 1TVKA 3LNNA 5KX5A 3CWBH 4F4LA 3HKCB 4RQEA 3CB2A 5DECA 1VQKV 5BR8O 5L3GA 4J11A 2YDEA 3P3NA 2LW7A 4BW9A 1XNQB 1YXBA 4MVQA 1K33A 1ZTEA 3K9AA 4JI5B 4JI1O 3CRMA 1BHBA 1F51A 5LMUB 3N2KA 3HPLC 4WCEV 2ZM6O 1NZ6A 1WB8A 1PPJH 2E74B 1YZBA 3N2GA 3AG7A 3ETEA 4LH7A 2LW1A 3STZC 1S72V 1VQ4V 4UUJC 2R9IA 3H1JH 2VQEB 2V4DA 4P30A 2KG7B 1K7DA 4BIOA 2CTQA 3ZIAG 4LFBB 2BSKB 2CK3G 2IJKA 2YIDA 3TK1A 3K5OA 1SQGA 1Q8IA 4OXSA 3K3WA 1AILA 3G4SV 1WN7A 2IW5A 5FPRA 4U3JB 3W7SA 2PI5A 1R3IC 3JD2A 1FXVA 3F5WC 2YEVA 5BMVB 2UXDO 2B1IA 1JOYA 4FPPA 1I5YA 1N32O 4MTFA 4YY3O 4JYBA 1HR0B 2XASA 3BPZA 2UUCO 1JCHA 4BR6A 5CMUA 5IYCO 1WLEA 2XAJA 2W6IG 2BE3A 3BA8A 1KC8W 2WAMA 3ETDA 3H1KH 3SJCC 3X2QC 4D7SA 3OD4A 3DXRA 3SPCA 1VQPV 1PNKA 2PYLA 1PL0A 1SQQH 1ZX3A 4JAUA 4DV7O 1JFFA 2RJZA 1S3JA 2NLJC 1VARA 1QHTA 1UPGA 4PJ0Z 4IHJB 3DC5A 4EB6B 2JEUA 3CXCU 2ZD9A 5LBQA 4DV1O 3JD1A 3WB1A 2PUSA 4MVZA 4X1YB 1XNRB 3MHSC 2AW9A 5EC1C 4B3TB 3RYHB 2Y0PA 1DF4A 5IYBO 1NI8A 1HNZB 2E5LB 2DWDC 2DJVA 1ZUQA 3QNEA 1Y67A 1Y66A 2CH7B 4JF3A 1IBMB 2EILB 3AG1C 5KHKA 5BXZA 4I0XA 5GW7A 2WLJA 4ZHQA 1XEQA 2C2AA 5E79Z 5FPOA 2BTOA 1XREA 3RYCA 5HFMA 1BS3A 1WAZA 4LC1A 4YJ2B 2JRIA 3VQYA 2NNUA 4JI7B 2HVKC 4FM2A 4G27B 5EIBD 3B8NA 4KUMA 3EVKA 2JVDA 5IDJA 4R8CA 3JAWB 1WNSA 2ZQMA 5CBFA 1N34O 1O9GA 2F23A 2JGDB 1P4RA 1K8AW 2AHYA 3MDSA 1L8DA 4P2ZA 3OMIB 4X9QA 2HEPA 2FL4A 3O9OA 3J80N 1LR1A 4DRXB 1GTOA 1FD9A 2E3CA 4LFCO 4DR4O 3AK2A 3L9DA 2W6JG 3E22B 3ASNC 4KL1A 2D3OW 1Y4MA 2P22C 3K0DA 3RVYA 4GT1A 2JS3A 1J95A 5B66Z 3ZRVA 4CS2A 1HNXB 3OMNB 2BTQA 3OR6C 3KG2A 3RGBA 5KHGA 3JAMN 4ZI7A 4E2LA 1ZWIC 1BQZA 1TAEA 1FFXA 2HHHB 5K1PA 4UB8Z 2A79B 1KB9F 1TUEB 2UXNA 1AROP 4WFHA 1XBLA 4FZ1A 5LL6Y 2M7WA 1N8RW 3ABKC 3CYOA 3M7MX 4X62B 1DTOA 4DK0A 1B6QA 3AEIA 4QE9A 4FK5C 3FAVA 2PTMA 2YIBD 2EIKB 2XAHA 3CJHA 3TGUH 3S3XA 3AG1B 4ABMA 3BHPA 1NKDA 1K34A 4TUYA 3T1HB 4GYCB 1NVPD 1EN5A 1AP6A 1DLBA 1JA8A 1M57B 2ZDIC 1AP5A 2DWEC 3FD9A 1Y76A 4XDJA 4PHZA 1SRYA 4L8JA 5AG2A 4UCVA 4H0LB 5IY5C 1F4MA 4GUNA 4LWSB 1MSDA 4FVMA 2UUAO 5H2FZ 4B3RO 4DR7B 1Q3EA 3IAYA 1WJZA 1M9NA 4JI0O 4O4LB 2AGAA 2WPDG 2ZXWB 3JATA 4Z2WA 1MZFA 2OTLV 4B3MO 5CB4A 4O4IA 1XMQO 2ZE5A 1HNWO 2Q7HA 4X89A 4LF6O 2BOBC 2ZINA 1IXMA 2YXYA 3BFRA 1OCCB 2WLIB 1TUBA 5KHHA 1L1FA 4CH3A 2LGWA 5FNVA 4K3AA 3HKEB 1U96A 5JJJB 5IJ0B 5L3CA 4B08A 2F66C 1XOUA 3J81N 1VQNV 2F1MA 1P84F 1PP9H 2X6BA 3CRAA 1Q81W 1NBMG 3LDCA 1R3KC 5KAIZ 5DEDA 3UT5B 4UCTA 4AHCA 2UU9B 2OYQA 2YC0A 3TJTA 3BRCA 4DV0O 4KXRA 2FTKA 2QM7A 4ICGA 2P6JA 3KCYA 3S3WA 1NR7A 3ZRWA 4J10A 1VEWA 2DQ0A 3G6EV 4YHHB 1EM1A 3ASOB 3NR7A 4GKJO 5LOVA 2RCVA 1IURA 4JI8O 4K35A 1SERA 2WLLB 1JJ2U 4LF4B 1RM1B 3H1IH 4I4TB 5BZBA 2B5UA 2RN9A 3K04A 4O4HB 2GSMB 5EYPA 2N04A 4C7UA 4H13B 3APOA 5CA0A 5IWAO 2K9PA 4DUZO 2OCCB 2QKSA 3CCQV 1YIJV 5ITZB 4MT8A 3OTOB 3ZEDA 4RUFA 4CC6A 5CA1A 1BT8A 4JYCA 4B7EA 2Q8VA 5B1OA 2E76B 2Q68A 1FXKC 1GK9A 3W7WA 4JI6O 4WFEA 2WLKA 4DR1B 4DV5B 4DV2B 2ZXWC 1KUQA 1JR9A 2R72A 4QPKA 4U7OA 2ZE8A 3R65A 1GN2A 1N4CA 3ZMSA 2QE7G 2K1EA 4RAIA 5FLXN 4DR6O 4JI3O 3CEIA 4OX9O 3BCCH 4DR2O 3JARA 3LUTB 1Z5WA 5JQGA 2OWOA 4JZGA 1AI5A 3OGCC 4DV3O 4QIWF 5EBMC 4EEQA 5EBLC 4X1IA 2ZNIA 4DUYO 5LHIA 4DV6B 3ICXA 4IIJA 2QTOA 5LHGA 2UXCB 1X4TA 4FLXA 1I7FA 2HJFC 1HDJA 3FYIB 1JPXA 3E83A 2VQFO 1QLNA 2OCHA 3L75H 1Z5VA 2NN4A 4FLVA 5BY1A 3PJSK 1W59A 4LNUB 4GX0A 3T1YB 1VQ6V 2PGGA 3CX5F 4PDVA 1OCZB 5JWPA 4FLWA 4JTCB 5L3BA 3D3IA 1IZ3A 3JSLA 3A0BZ 1FYJA 1Y74A 5GONA 4DR5O 4FLYA 2KKWA 1FJGO 2QKAA 1G6UA 3GWKC 3ABKB 4K8ZA 3JASA 4PDMA 5B1AB 2PI4A 3B09A 4KHPO 3IJ4A 2DYSC 2Q69A 4TT3G 4B3SB 2WLNA 3JAKA 5LGNA 4LF8B 5JVDB 3PN1A 2P7TC 4TQFA 2B1GA 4OPHA 3L71H 2HKOA 1SQBH 1MG1A 4J9YB 3CCRV 4FFBB 1Q5OA 4CH6A 3Q4HB 2Q7GA 2XTAA 1N0JA 4UCSA 5LHHA 3EXAA 1KKCA 4IGGA 5LYJA 4X66B 3FB6C 1JX9A 4QNHB 4AQYB 1ZSPA 4LR3A 2L35A 3OTFA 3I55V 1X59A 2Y0IA 4X20B 1E79G 5A9GA 4TV9A 2QWQB 4AQYO 3OT7A 4X66O 4GLXA 2JS5A 4EFEA 3CCSV 3B4SA 1QQCA 4O2BB 1QR9A 4CBCA 2Z5UA 4O2AB 1KKDA 4IT5A 3AG2B 4P9OA 4XDLA 1VF6C 4YJ3A 1EZJA 1OCOC 3OUSA 1BZKA 4LF8O 4UVCA 3OM3B 4I55B 4B3SO 2P90A 2YICA 3JD4A 1ZL8A 4JAVA 5LA6B 4LH6A 3JALB 4YIPA 3P32A 4KHPB 3JD3A 3O65A 2GTAA 4TWKA 1FJGB 3RWRD 3CRQA 3JD0A 4KP4A 2NR5A 1COWG 2ATKC 4DR5B 4FM1A 3FB8C 1BL8A 1Q86W 4NR1A 1RSOA 4BW5A 1PNMA 3CD6V 1OCZC 2MW2B 2LO1A 4O4JA 2BCCH 1FXKA 1VP7A 5LP6B 4Q6GA 4PA7A 3T1YO 4H37A 4FM0A 3U0ZA 5D5QA 3K58A 3HKBA 3LSQA 2GUZB 4UCRA 1VF6A 2JEXA 4EFBA 1CP9A 2VQFB 2RNBA 5EK0A 2JDIG 5B3SB 1QLEB 4XDKA 3RYFB 1AI6A 4QGPA 1OV9A 2UXCO 5EBWC 4MVUA 3OFNG 3K5NA 4DV6O 4JAAA 1D2DA 3E35A 4DUYB 3OR7C 3OW2U 3NXSA 4PA6A 2Z0AA 4DV3B 2PF4E 4DW0A 2ADPA 4NTWA 4BIUA 4OPAA 2B9ZA 2L6LA 2CTRA 4DR2B 4E4EA 4OX9B 1CEZA 4JI3B 4X8AA 1DK1A 4DR6B 2N74A 1U97A 1QU7A 4JI2O 4RWUA 1SQXH 4UVBA 5IE9A 3DGEA 3BEHA 2X0LA 5LXTB 2P06A 4DV2O 4DV5O 4DR1O 1YTFB 4MTOA 4DK1A 4JI6B 2DYSB 5LGTA 1FXHA 1V55B 1GMGA 2KQXA 1SF9A 2A7WA 4TV8A 4JYYA 1H2SB 1S5JA 3DC6A 1F7YA 5CN0A 3ZHVA 4IYHA 5IYZA 1PD3A 2YUAA 3OTOO 2RMKB 1W0KG 2Y4TA 3RW0A 4DUZB 5IWAB 1P7BA 5KHJA 3APQA 3K9SA 5EZYB 3RVZA 3RYIA 3W7UA 5IJ9B 4H33A 4RQFA 4MVOA 1RPOA 1H2LA 2YSUB 4LF4O 5C8YB 4MTXA 4I9QA 3P30A 1M4UA 2GTSA 4R7CA 4JI8B 1NTKH 2Q67A 4GKJB 4HNAB 5CBHA 4FFKA 4F6RB 4YHHO 2Q4PA 4JPRA 3ZHSA 2YXLA 4PI2A 4X1KA 1SA0A 1BMFG 4DV0B 4I50B 3FB5C 1BHAA 2YI8A 2UU9O 4CH5A 2Q9LA 3D36A 1BE3H 1R73A 1WA8A 3SJBC 3UCSC 1K4CC 3B2EE 2XHBA 2GV9A 1THZA 3MD0A 3D3QA 3FKSG 1H8HG 1R6KA 1N0NA 3WU2Z 3QVNA 4WBNA 1KP2A 5KMGB 1HP8A 3ZS8C 5J2TB 1AB3A 4HZ3A 5TISZ 3K03A 5J2UB 3F7VC 4J80A 4LF6B 5B1NA 1YJWV 2YIBA 1HNWB 2QWNB 3C3SA 1XMQB 1NJIW 4B3MB 3D8CA 4L87A 1AI7A 4ZOLB 4WFBV 3BY6A 1F4NA 1AJPA 1Q82W 4HAMA 1AVMA 1VQ9V 1K5SA 3VQVA 1URFA 4BAYA 4JI0B 2FMLA 5DN6G 1XL4A 3EFFK 4YXWG 3OE7G 4N23A 1KMIZ 4DR7O 1SKVA 3C90A 4B3RB 1XILA 3D36C 2UUAB 2FKXA 3M99B 5JH7A 3ZRXA 4DXWA 2AZ2A 2XT9A 3HKDA 4IL6Z 3G67A 1QR8A 2D2CB 2IU0A 3SYQA 1SQVH 1TVKB 5CBGA 5KX5B 1D5AA 3HKCA 1BGYH 3B8MA 2QGNA 4CH4A 4MTGA 2ADQB 4NTYA 3T1HO 4UXNA 3RFRA 2E75B 3CS5A 2P67A 2ZNJA 3OEEG 3SR2C 1MNGA 1ORQC 3VQXA 4AI8A 3LNMB 4PA9A 2H94A 3N2KB 2P5OA 4X62O 1PKXA 1SQPH 1R3LC 1GM9A 3N2GB 3TXSA 2ZIMA 1QNMA 3M8AA 1B06A 3LSUA 1YF2A 3QO5A 3ZMUA 1VMGA 2IJIA 1YITV 3UQ8A 2UXXA 3K59A 3GVMA 2KG7A 2HHHO 4MVSA 5IT9N 3L72H 2BSKA 2HR3A 3CCUV 4HYOA 3JCUZ 3CCVV 1AR1B 1AR4A 1NT2B 2Q0OC 4U3JA 2EINC 2HJDA 2WLMA 3EHBB 1R6TA 1KYOF 1HNXO 1PM9A 2IM9A 4PDRA 2YEVB 5BMVA 2ZE7A 1LNQA 4TOIA 1OHHG 4PV1B 1YEWA 4BWAA 3DTUB 4LFCB 3K5MA 4DR4B 2A06H 2EJ7A 2CE4A 3K06A 1Q90D 1DGSA 1AI4A 2P4VA 5FL7G 2EJRA 5B1AC 4JGSA 3DXRB 5L3FA 5JCOC 1JFFB 3SYOA 4FLTA 1GN6A 1E1QG 3E89A 3T4DA 4IHJA 1N34B 4EB6A 2Z3YA 3BA9A 2LJ2A 1S0VA 3AK1A 2GHYA 1NH2B 3SYCA 4X1YA 1JQ0A 2PZSA 3ETQA 4JI7O 3SPIA 1YTFD 1F23A 1R3JC 1YI2V 3JCZA 3RYHA 5KA6A 2M6YA 4UV8A 1CPYA 3CP1A 3R66A 5F2VO 3ETGA 1IBMO 1MOFA 1XUQA 2CH7A 1IDSA 2IJJA 3SDLA 2Q0AA 2FB5A 5EC2C 1K92A 4I0XB 4ZHQB 2E5LO 3AG2C 1HNZO 1YJ9V 3RYCB 4GX2A 3CCJV 2ILMA 4GX1A 3ZHTA 3ABTA 4B3TO 4JZ2A 4YJ2A 5KAFZ 4I7ZB 1SQFA 5J9PC 1S76D 3CC4V 2FYUH 1XNRO 3QO7A 4UB6Z 3E86A 3JAWA 4MS2A 3VQWA 3K5LA 4DV1B 1KP3A 3HR0A 5KHIA 2ZCEA 4JASA 4K8XA 2JGDA 4UFZA 4DV7B 4G28B 1ROPA 1M93A 4ZKIA 4J41A 3CRRA 4PA3A 1G1XB 4DRXA 5A2QN 1QLEC 1TA8A 3J7AU 1BCCH 5KA5A 1K5QA 3KCXA 2CGNA 2UUCB 1HR0O 3TETA 4YY3B 1YJNV 3E22A 1N32B 3B40A 2VWJA 1B04A 2UXDB 3B77A 5JJEB 3T4ZA 4J42A 3SPGA 3C3TA 2EILC 2QM8A 3JYCA 2ODMA 2WLHA 2BTQB 4R6ZA 4RO2A 5B1BC 3QG5A 4FJCC 1WB7A 1AJQA 3H1LH 4CS3A 4ZI7B 3I5DA 1GAXA 4FIPC 2G38A 4LFBO 2JIZG 1FFXB 2YS8A 2VRZA 4X88A 2HVJC 3GB7C 4NYKA 2VQEO 3RT3C 1XL6A 4J7KA 2HP8A 2DMXA 2DW4A 3IGAC 1ENVA 1FKAO 1VQ7V 3IC7A 3H1HH 4J7ZA 1FPOA 2ZM6B 3ASNB 1EFRG 4WF9V 5LMUO 4D6TH 3FAVB 4JI1B 4FLUA 1XHXA 4JI5O 3CJHB 3E2EA 3FFQA 1XNQO 5DM6V 2RQ6A 2OT5A 1QVGU 4GZRB 1FFTB 3A0HZ 4TUYB 3AG4B 4GX5A 5BR8B 5E1AC 2EIMC 3QTCA 2ARHA 4DW1A 4DR3B 4NB5A 1Y76B 4Z1VA 3OMAB 2O57A 1V9PA 2WSSG 4DV4O 3U11A 2XAGA 1OJHA 4LWSA 3ZN0A 3BAAA 3SYAA 1B3QA 1K97A 1UJWB 2F93B 2IU3A 4FMTA 2QTSA 5GTIZ 1GKFA 5LMNO 4O4LA 5LGUA 4JV5O 3JATB 4I5SA 1W2BU 2QWOB 1SESA 2X7RB 3SYPA 3ZX6A 1S5LZ 5H5NA 1US6A 4U7NA 4MW3A 5CB4B 2HG5C 4QPJA 4G2KA 4O4IB 3KKYA 2QKCA 3STLC 4KFMA 1M56B 3ABMC 2WLIA 1TUBB 2OCCC 5FNVB 4U3FH 1IXBA 2ZKOA 3CC7V 3HKEA 2Y69B 2R9AA 5IJ0A 4GKKO 1PNLA 1V54B 3E8GA 2JGUA 3ZMZA 1Q6UA 3E8BA 3G80A 1JMKC 4LCUC 3CMEV 2ZIOA 3U10A 3UT5A 3CCMV 2V1DA 1IBLB 4FLZA 1YHQV 1M57C 2LFSA 3G6BA 4CZZA 1VF5B 3WG7C 4TSFG 1R6NA 1OCRB 4J9ZB 4ASUG 3ZRWB 1GM8A 1NS1A 1RFYA 3JSNA 2F4VB 1PL4A 3ZBHA 4NXMB 3ABUA 1MA1A 3AG3C 5LOVB 3IFXA 3ZJZA 2HLDG 4MSWC 2XAFA 1IBKO 2PY5A 1ZAUA 2WLLA 5KUKA 1NU1H 4NKGB 1OCRC 1NVPB 4JYAB 2A9HA 3H01A 1FAFA 5JJNB 4I4TA 4D7TA 3QF7A 1K3EA 1CXZB 2IBZH 3CRCA 4RUEA 2XNDG 1YSCA 4O4HA 1P49A 1VQ5V 5EYPB 4LF7B 1J5EB 3AK3A 4NXNB 1YCIA 4JI4B 5CA0B 1M1KW 3CMAV 3ZCCA 3DSQA 3H9VA 3F5TA 5ITZA 1O9HA 4PA4A
chains in the Genus database with same CATH topology
3K08A 4RUFA 1JVMA 4F4LA 4JYCA 4RQEA 2BOCC 3B8MA 4MTGA 1VQKV 4UXNA 5B1OA 1H8EG 1QBZA 2Q68A 4Z1MG 1FXKC 1GK9A 3W7WA 5L3GA 2P67A 4WFEA 3TCUA 3OEEG 2WLKA 5H6QA 1ORQC 1EBOA 4QE7A 2ZXWC 1K33A 4MVQA 3K9AA 3LNMB 4QPKA 1BHBA 5L3EA 1F51A 4PA9A 2H94A 2JK5C 4U7OA 1M90W 3HPLC 4WCEV 5CA3A 3LDEA 1PKXA 1R3LC 1GM9A 3R65A 3ZMSA 2QE7G 1K9MW 2K1EA 3ETEA 4RAIA 3STZC 5KUMA 1S5HC 3QO5A 1VQ8V 1S72V 3ZMUA 1VQ4V 2IJIA 4UUJC 3ABLC 3SPJA 1YITV 2R9IA 3LUTB 2UXXA 4P30A 1MSWD 1K7DA 4MVSA 3ZIAG 2W0FC 1AI5A 2CK3G 2IJKA 3TK1A 2HR3A 3OGCC 3CCUV 4HYOA 4OXSA 4QIWF 3K3WA 3G4SV 2IW5A 5EBMC 3CCVV 1AR1B 5EBLC 5LHIA 2EINC 2WLMA 3MHHC 3EHBB 3ABLB 5LHGA 3W7SA 2QTOA 2PI5A 1R3IC 4UV9A 3JD2A 2DYRB 3G71V 1FXVA 2HJFC 4PDRA 3F5WC 3FYIB 1JPXA 3E83A 2YEVB 2YEVA 2B1IA 1JOYA 4FPPA 1I5YA 1LNQA 3VOUA 1QLNA 4MTFA 3CC2V 2Y69C 1H2GA 1OHHG 4JYBA 3ZMTA 2Q6AA 2XASA 1JCHA 3DTUB 5CMUA 5IYCO 3PJSK 1VQOV 1WLEA 4GX0A 2XAJA 2W6IG 1VQ6V 3K06A 3AG3B 3F7YC 4EKWA 4PDVA 4R50A 1OCZB 1KC8W 2WAMA 1AI4A 5FL7G 4JTCB 2EJRA 5L3BA 3D3IA 3ETDA 5B1AC 4JGSA 4UVAA 3K0GA 3X2QC 3SPCA 5L3FA 1VQPV 1PNKA 3I56V 1PL0A 4JAUA 3SYOA 1G4YB 1S3JA 2NLJC 1E1QG 3E89A 3T4DA 1Q7YW 2Z3YA 4MVRA 1OZ0A 2JEUA 3CXCU 3ABKB 2ZD9A 2HFEC 4PDMA 5B1AB 5LBQA 2PI4A 1S0VA 2GHYA 3JD1A 3SYCA 3X2QB 4MVZA 2LFRA 1NH2B 2DYSC 2Q69A 1OCOB 4TT3G 2WLNA 3MHSC 1JQ0A 5LGNA 1DF5A 2P7TC 3SPIA 1YTFD 1F23A 1R3JC 3OAAG 1YI2V 3JCZA 2B1GA 5EC1C 1S77D 5KA6A 1DF4A 5L3DA 2HKOA 1HWYA 1MG1A 3SPHA 4J9YB 2LP7A 3CCRV 4UV8A 1CPYA 3W7TA 3CP1A 5IYBO 4GCZA 5LHHA 2DWDC 3QNEA 3FB6C 1JX9A 4QNHB 3I55V 3ETGA 1Y66A 1MOFA 3CCEV 4PDLA 1E79G 4JF3A 2IJJA 2EILB 3AG1C 3QO8A 2JJ2G 5EC2C 1K92A 5GW7A 2EIKC 1RPRA 2WLJA 2IJHA 3UKMA 3CCSV 3AG2C 2C2AA 2JJ1G 4PA4A 1QR9A 4CBCA 1YJ9V 3CCJV 4GX2A 2Z5UA 3LSSA 1KKDA 4GX1A 5HFMA 3AG2B 5HFLA 4P9OA 4XDLA 3VBBA 3ABTA 4LC1A 1EZJA 2NNUA 1OCOC 4DO2A 3OUSA 2HVKC 4LBEC 4G27B 5J9PC 4UVCA 1S76D 3OM3B 3B8NA 3CC4V 4KUMA 2P90A 3QO7A 3JD4A 4JAVA 4R8CA 5B3SC 3E86A 2EZOA 5IDJA 4MS2A 2QEXV 3P32A 2ZQMA 3JD3A 1KP3A 5CBFA 4TWKA 1VQMV 3JD0A 2XOKG 4JASA 4KP4A 1COWG 2ATKC 1P4RA 1K8AW 2AHYA 3FB8C 4G28B 1BL8A 1ROPA 4P2ZA 1Q86W 3OEHG 3OMIB 5B1BB 4QJFB 4ZKIA 2A0LA 1PNMA 4BW5A 1QVFU 3CD6V 1OCZC 2Y48A 3E8HA 3GWOA 1K73W 4PA3A 1FXKA 1FXKB 1V55C 2IH1C 2H8PC 4MVMA 1QLEC 4PA7A 1GTOA 4H37A 1WPXA 5KA5A 1K5QA 4I9WA 3W7XA 3LSQA 2JEXA 3TETA 2W6JG 2OTJV 1CP9A 1YJNV 5C93A 3ASNC 2D3OW 1Y4MA 3K0DA 5EK0A 3RVYA 2EIJB 2JDIG 4GT1A 3AG4C 3B77A 1J95A 5B3SB 1QLEB 4XDKA 3T4ZA 3FYEB 1AI6A 3ZRVA 1NR1A 2ITCC 5EBWC 4MVUA 2AHZA 3SPGA 2EILC 2QM8A 3JYCA 3OFNG 3OMNB 2DYRC 2MK3A 2WLHA 3OR6C 3KG2A 4R6ZA 1GO3F 3E35A 3OR7C 1K4DC 4RO2A 3UM7A 3CPWU 3OW2U 2X6AA 5B1BC 3NXSA 4PA6A 3WFVA 4FJCC 2ZR3A 1NH2D 1AJQA 4N21A 4E2LA 1ZWIC 3LDDA 4MW8A 4FIPC 2JIZG 4BIUA 1QCEA 4X88A 2HVJC 2EIMB 3GB7C 2A79B 1XL6A 1TUEB 2UXNA 1AROP 3FB7C 4WFHA 1CEZA 4BIZA 2DW4A 3IGAC 4X8AA 1AJNA 2EZPA 1ENVA 3SJQC 2M7WA 3K79A 1VQ7V 1N8RW 3ABKC 3CYOA 3IC7A 2ITDC 3ASNB 1DTOA 1EFRG 1B6QA 4WF9V 5H6RA 3AEIA 4QE9A 4FK5C 4UVBA 1KQSU 3DGEA 2V7QG 3BEHA 2EIKB 3HB3B 2X0LA 2XAHA 4WFGA 3E2EA 4ZBMA 1YTFB 3A0RA 4MTOA 5DM6V 3AG1B 2OT5A 1QVGU 1MABG 2DYSB 5LGTA 1FXHA 1V55B 1GMGA 2X6CA 1NKDA 1FFTB 1K34A 3AG4B 4GX5A 1NVPD 4WFAV 5CN0A 5E1AC 2EIMC 1SZTA 1PD3A 1DLBA 1M57B 1W0KG 2ZDIC 2DWEC 3OMAB 3RW0A 4XDJA 1SRYA 2WSSG 2EBOA 5IY5C 1F4MA 2XAGA 4LP8A 1M56C 1P7BA 3ABMB 3ASOC 3ZN0A 3SYAA 1H38A 1K97A 2EINB 2WWWA 5IY5B 3RVZA 1UJWB 3W7UA 2IU3A 4FMTA 4H33A 2ZR2A 1RM1C 4RQFA 4MVOA 4P9PA 1RPOA 2YSUB 1KD1W 1M9NA 5H9CA 4MTXA 5LGUA 4I5SA 2WPDG 2ZXWB 3P30A 5IYDO 1W2BU 4Q20A 4R7CA 1SESA 2X7RB 3SYPA 2Q67A 2OTLV 4U7NA 4MW3A 2HG5C 4QPJA 4G2KA 5CBHA 1W0JG 4JPRA 3T2MA 4X89A 3STLC 4KFMA 1M56B 3ABMC 2BOBC 1IXMA 1OCCB 2WLIB 2WLIA 1E1RG 1V54C 1L1FA 2OCCC 1BMFG 2EIJC 3ML0A 3CC7V 2Y69B 1OCCC 3FB5C 1VQLV 1PNLA 1BHAA 1V54B 2R9RB 3E8GA 5L3CA 3ZMZA 3D36A 3E8BA 1R73A 1NQTA 1VQNV 1K4CC 4LCUC 1FS0G 1G8MA 1THZA 3MD0A 2X6BA 3FKSG 3CMEV 1Q81W 1NBMG 1H8HG 3ZMVA 1R6KA 3LDCA 1R3KC 3CCMV 2V1DA 1GM7A 3T1CA 2XAQA 1KP2A 2IH3C 3WG7B 1YHQV 1M57C 3RBZA 2LFSA 2FTKA 4CZZA 4HZ3A 3CCLV 3WG7C 2QM7A 4TSFG 1R6NA 3K03A 1OCRB 3F7VC 2P6JA 2ZDIA 4J9ZB 4ASUG 2QA4V 1NR7A 3ZRWA 3ZRWB 5B1NA 1YJWV 2DQ0A 3G6EV 4JTAB 1GM8A 3ASOB 1NJIW 2F43G 3ABUA 3OUFA 1SETA 3ZN1A 3AG3C 3IFXA 4L87A 1KECA 3ZJZA 2HLDG 1AI7A 4WFBV 4MSWC 2XAFA 3BY6A 1F4NA 1AJPA 1Q82W 1SERA 2WLLA 2WLLB 4HAMA 5KUKA 1JJ2U 1OCRC 1K5SA 2DQ3A 4XBFA 1NVPB 1VQ9V 4BAYA 1RM1B 2A9HA 3H01A 4WFFA 3E8FA 5BZBA 2B5UA 4JTDB 1K3EA 5DN6G 1XL4A 3EFFK 4YXWG 3K04A 3OE7G 4RUEA 4N23A 2XNDG 1YSCA 1I5XA 1VQ5V 2GSMB 3M99B 1M1KW 3CMAV 3ZRXA 3ZCCA 4DXWA 2OCCB 2QKSA 3CCQV 1YIJV 3ZRSA 2KB1A 4PELA 1QR8A 2IU0A 4MT8A 3SYQA 1GKFA 5CBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU V;  1M90 W;  4WCE V;  1Q86 W;  3G4S V;  2OTL V;  3CXC U;  1VQO V;  5DM6 V;  3CCV V;  2QA4 V;  1QVF U;  3CD6 V;  1QVG U;  1VQ6 V;  1R73 A;  3I55 V;  1VQ5 V;  1VQK V;  1K73 W;  1YJW V;  1VQN V;  3G6E V;  3CC4 V;  3CCE V;  1K9M W;  1KC8 W;  1VQ8 V;  1S72 V;  1NJI W;  3CME V;  3CPW U;  3G71 V;  4WFA V;  3OW2 U;  1VQ7 V;  1YIT V;  2D3O W;  1Q81 W;  1N8R W;  3CMA V;  1M1K W;  2QEX V;  1YI2 V;  3CCM V;  4WFB V;  1VQP V;  3I56 V;  3CCS V;  4WF9 V;  1YHQ V;  1VQM V;  1Q82 W;  1K8A W;  3CCQ V;  1YIJ V;  1KD1 W;  1JJ2 U;  3CCR V;  1KQS U;  1YJ9 V;  1VQ4 V;  1VQ9 V;  3CC2 V;  2OTJ V;  3CCJ V;  1YJN V;  3CC7 V;  3CCL V;  1VQL V;  1W2B U;  1Q7Y W; 
#chains in the Genus database with same CATH topology
 3K08 A;  1JVM A;  5CA1 B;  2BOC C;  2CUG A;  1N36 O;  1H8E G;  3TXQ A;  1QBZ A;  4Z1M G;  1JJO A;  3TCU A;  5H6Q A;  2LGQ A;  4F6E A;  1EBO A;  4QE7 A;  1A32 A;  4K0K B;  1UFI A;  5L3E A;  1XMO O;  2JK5 C;  2CTW A;  3L73 H;  1M90 W;  2WA4 A;  5CA3 A;  1XQ8 A;  1I94 B;  3LDE A;  2QM4 A;  1K9M W;  2EX3 A;  5KUM A;  1S5H C;  1VQ8 V;  1D5N A;  3ABL C;  3SPJ A;  3JAR B;  4AIL C;  2F95 B;  1MSW D;  5JQG B;  2W0F C;  1Q43 A;  2YXH A;  4X1I B;  3BVO A;  2QWP B;  3MHH C;  3ABL B;  4IIJ B;  4UV9 A;  1R1B A;  1IVS A;  4UCO A;  2DYR B;  3G71 V;  3L74 H;  1SC5 B;  1I08 A;  1GRJ A;  4LF9 O;  1N33 B;  2A3Q A;  3VOU A;  4ZIB A;  3CC2 V;  2Y69 C;  1H2G A;  3ZMT A;  2Q6A A;  4X64 B;  4LFA O;  2LQT A;  2OIE A;  1VQO V;  4X65 B;  4LNU A;  2QR4 A;  3AG3 B;  3F7Y C;  4EKW A;  4R50 A;  4LF5 O;  2Q5Z A;  2UXB O;  1YDX A;  4UVA A;  3K0G A;  1Y74 B;  1L0L H;  2KSD A;  3I56 V;  1EN4 A;  5GON B;  1G4Y B;  2UUB O;  5JCO A;  1Q6I A;  1Q7Y W;  4MVR A;  1OZ0 A;  2HFE C;  3JAS B;  3X2Q B;  2LFR A;  1MMM A;  3IC9 A;  1OCO B;  2YIA A;  3CE2 A;  3JAK B;  1DF5 A;  5JVD A;  3OAA G;  1WP8 A;  1S77 D;  1I0H A;  5L3D A;  1HWY A;  3SPH A;  2LP7 A;  4FFB A;  3W7T A;  3Q4H A;  1WPB A;  4GCZ A;  3MAQ A;  1H2N A;  1BQ0 A;  4CS4 A;  2PYJ A;  5LYJ B;  1VF7 A;  4DYL A;  3CCE V;  4PDL A;  4X20 A;  3CSX A;  4PI0 A;  3QO8 A;  4TV9 B;  2JJ2 G;  1LUW A;  2EIK C;  1MZE A;  1RPR A;  2IJH A;  3UO3 A;  3UKM A;  2Q73 A;  2JJ1 G;  2H3O A;  4O2B A;  2QJ1 A;  1M5I A;  4FZ0 A;  3LSS A;  4O2A A;  5K1X A;  5HFL A;  3CXH F;  3ZHR A;  2RDC A;  3VBB A;  4YJ3 B;  5GTH Z;  4DO2 A;  4LBE C;  1L0N H;  4I55 A;  5B3S C;  3UO2 A;  1ZL8 B;  2EZO A;  5LA6 A;  3JAL A;  2QEX V;  2W0X A;  1VQM V;  2ZT9 B;  2CAZ C;  2XOK G;  1SZX A;  3KZI Z;  1KU9 A;  2UUB B;  1P7G A;  1GN4 A;  1SS3 A;  3OEH G;  4QJF B;  5B1B B;  1RSO B;  1RP3 B;  2A0L A;  1QVF U;  2Y48 A;  3E8H A;  1XI1 A;  3GWO A;  4O4J B;  1K73 W;  2UXB B;  1EN6 A;  3ZHQ A;  1FXK B;  1V55 C;  2IH1 C;  4LF5 B;  5LP6 A;  2H8P C;  4MVM A;  2GBO A;  4X65 O;  1WPX A;  4I9W A;  4LFA B;  3HKB B;  3W7X A;  2GUZ A;  4X64 O;  1BSM A;  4NTX A;  1XDC A;  2OTJ V;  5C93 A;  4PD4 F;  3A8T A;  1N33 O;  3FX7 A;  4LF9 B;  4OGQ B;  2GDS A;  1GH6 A;  2EIJ B;  2XUM A;  3AG4 C;  3RYF A;  3FYE B;  3RN4 A;  1NR1 A;  2ITC C;  2AHZ A;  3SGI A;  2DYR C;  2MK3 A;  2EUL A;  3UM7 A;  1GO3 F;  3CPW U;  1K4D C;  1Q6H A;  2X6A A;  3WFV A;  2ZR3 A;  1NH2 D;  2VS0 A;  4N21 A;  4CC5 A;  3LDD A;  4MW8 A;  5KLV H;  2AZ0 A;  5EIB C;  2QSA A;  1QCE A;  2WA3 A;  2EIM B;  3FB7 C;  4BIZ A;  2P4K A;  1AJN A;  2EZP A;  3SJQ C;  3SJA C;  3K79 A;  4A5U B;  2ITD C;  1I94 O;  3N27 A;  2CGO A;  2VWK A;  1LUV A;  5H6R A;  1XMO B;  1KQS U;  1XHZ A;  4YIO A;  1VIB A;  2V7Q G;  4K0K O;  3HB3 B;  5LXT A;  4WFG A;  2CTP A;  4B7K A;  4ZBM A;  3A0R A;  3CHX A;  2Q7E A;  1MAB G;  2X6C A;  4J7J A;  1GN3 A;  4TV8 B;  1N36 B;  2CDY A;  1PV0 A;  4WFA V;  1SZT A;  5IYZ B;  4JI2 B;  2Y4U A;  5D5P A;  2EBO A;  3WB0 A;  4LP8 A;  1M56 C;  3ABM B;  3ASO C;  4JI4 O;  1T5E A;  3K57 A;  3THO A;  1H38 A;  2EIN B;  2WWW A;  5EZY A;  5IY5 B;  1J5E O;  4LF7 O;  4NXN O;  2DOS A;  3RYI B;  1AR5 A;  5IJ9 A;  4UCU A;  2ZR2 A;  1RM1 C;  2R70 A;  1ZLZ A;  4P9P A;  1H2M A;  1KD1 W;  3ZHU A;  2DN9 A;  5H9C A;  5C8Y A;  4JYA O;  1IX9 A;  2QWR B;  5IYD O;  4Q20 A;  1IBK B;  1H2K A;  4W4K A;  4HNA A;  3L70 H;  4NXM O;  2F4V O;  4F6R A;  1NTZ H;  2ETN A;  4W4L A;  1W0J G;  3T2M A;  1KBH A;  4X1K B;  2YI9 A;  1SA0 B;  1YVW A;  1E1R G;  1V54 C;  3P3P A;  2EIJ C;  3ML0 A;  1OCC C;  4I50 A;  1VQL V;  1Z2G A;  3WB2 A;  2R9R B;  1IBL O;  1EZV H;  4HBN A;  1WA8 B;  1NQT A;  1FS0 G;  2DE0 X;  1G8M A;  1Y6X A;  3ZMV A;  3A2F A;  1HW7 A;  1GM7 A;  3T1C A;  2XAQ A;  4WBN B;  2IH3 C;  3WG7 B;  3RBZ A;  2ZE6 A;  4GKK B;  5KMG A;  5J2T A;  3CCL V;  5J2U A;  2ZDI A;  3OGI B;  2QA4 V;  1WP7 A;  5LP6 C;  2OIG A;  4JTA B;  3BAB A;  2F43 G;  1TGO A;  3OUF A;  1SET A;  3ZN1 A;  1KEC A;  4ZOL A;  2N05 A;  4NVP A;  2DQ3 A;  4JV5 B;  4XBF A;  5LMN B;  4WFF A;  3E8F A;  1NTM H;  4JTD B;  4H44 B;  1I5X A;  2QDO A;  2AXT Z;  5JH7 B;  4IYI A;  4DV4 B;  3HKD B;  5B5E Z;  3ZRS A;  2KB1 A;  4PEL A;  4DR3 O;  4TQD A;  1TVK A;  3LNN A;  5KX5 A;  3CWB H;  4F4L A;  3HKC B;  4RQE A;  3CB2 A;  5DEC A;  1VQK V;  5BR8 O;  5L3G A;  4J11 A;  2YDE A;  3P3N A;  2LW7 A;  4BW9 A;  1XNQ B;  1YXB A;  4MVQ A;  1K33 A;  1ZTE A;  3K9A A;  4JI5 B;  4JI1 O;  3CRM A;  1BHB A;  1F51 A;  5LMU B;  3N2K A;  3HPL C;  4WCE V;  2ZM6 O;  1NZ6 A;  1WB8 A;  1PPJ H;  2E74 B;  1YZB A;  3N2G A;  3AG7 A;  3ETE A;  4LH7 A;  2LW1 A;  3STZ C;  1S72 V;  1VQ4 V;  4UUJ C;  2R9I A;  3H1J H;  2VQE B;  2V4D A;  4P30 A;  2KG7 B;  1K7D A;  4BIO A;  2CTQ A;  3ZIA G;  4LFB B;  2BSK B;  2CK3 G;  2IJK A;  2YID A;  3TK1 A;  3K5O A;  1SQG A;  1Q8I A;  4OXS A;  3K3W A;  1AIL A;  3G4S V;  1WN7 A;  2IW5 A;  5FPR A;  4U3J B;  3W7S A;  2PI5 A;  1R3I C;  3JD2 A;  1FXV A;  3F5W C;  2YEV A;  5BMV B;  2UXD O;  2B1I A;  1JOY A;  4FPP A;  1I5Y A;  1N32 O;  4MTF A;  4YY3 O;  4JYB A;  1HR0 B;  2XAS A;  3BPZ A;  2UUC O;  1JCH A;  4BR6 A;  5CMU A;  5IYC O;  1WLE A;  2XAJ A;  2W6I G;  2BE3 A;  3BA8 A;  1KC8 W;  2WAM A;  3ETD A;  3H1K H;  3SJC C;  3X2Q C;  4D7S A;  3OD4 A;  3DXR A;  3SPC A;  1VQP V;  1PNK A;  2PYL A;  1PL0 A;  1SQQ H;  1ZX3 A;  4JAU A;  4DV7 O;  1JFF A;  2RJZ A;  1S3J A;  2NLJ C;  1VAR A;  1QHT A;  1UPG A;  4PJ0 Z;  4IHJ B;  3DC5 A;  4EB6 B;  2JEU A;  3CXC U;  2ZD9 A;  5LBQ A;  4DV1 O;  3JD1 A;  3WB1 A;  2PUS A;  4MVZ A;  4X1Y B;  1XNR B;  3MHS C;  2AW9 A;  5EC1 C;  4B3T B;  3RYH B;  2Y0P A;  1DF4 A;  5IYB O;  1NI8 A;  1HNZ B;  2E5L B;  2DWD C;  2DJV A;  1ZUQ A;  3QNE A;  1Y67 A;  1Y66 A;  2CH7 B;  4JF3 A;  1IBM B;  2EIL B;  3AG1 C;  5KHK A;  5BXZ A;  4I0X A;  5GW7 A;  2WLJ A;  4ZHQ A;  1XEQ A;  2C2A A;  5E79 Z;  5FPO A;  2BTO A;  1XRE A;  3RYC A;  5HFM A;  1BS3 A;  1WAZ A;  4LC1 A;  4YJ2 B;  2JRI A;  3VQY A;  2NNU A;  4JI7 B;  2HVK C;  4FM2 A;  4G27 B;  5EIB D;  3B8N A;  4KUM A;  3EVK A;  2JVD A;  5IDJ A;  4R8C A;  3JAW B;  1WNS A;  2ZQM A;  5CBF A;  1N34 O;  1O9G A;  2F23 A;  2JGD B;  1P4R A;  1K8A W;  2AHY A;  3MDS A;  1L8D A;  4P2Z A;  3OMI B;  4X9Q A;  2HEP A;  2FL4 A;  3O9O A;  3J80 N;  1LR1 A;  4DRX B;  1GTO A;  1FD9 A;  2E3C A;  4LFC O;  4DR4 O;  3AK2 A;  3L9D A;  2W6J G;  3E22 B;  3ASN C;  4KL1 A;  2D3O W;  1Y4M A;  2P22 C;  3K0D A;  3RVY A;  4GT1 A;  2JS3 A;  1J95 A;  5B66 Z;  3ZRV A;  4CS2 A;  1HNX B;  3OMN B;  2BTQ A;  3OR6 C;  3KG2 A;  3RGB A;  5KHG A;  3JAM N;  4ZI7 A;  4E2L A;  1ZWI C;  1BQZ A;  1TAE A;  1FFX A;  2HHH B;  5K1P A;  4UB8 Z;  2A79 B;  1KB9 F;  1TUE B;  2UXN A;  1ARO P;  4WFH A;  1XBL A;  4FZ1 A;  5LL6 Y;  2M7W A;  1N8R W;  3ABK C;  3CYO A;  3M7M X;  4X62 B;  1DTO A;  4DK0 A;  1B6Q A;  3AEI A;  4QE9 A;  4FK5 C;  3FAV A;  2PTM A;  2YIB D;  2EIK B;  2XAH A;  3CJH A;  3TGU H;  3S3X A;  3AG1 B;  4ABM A;  3BHP A;  1NKD A;  1K34 A;  4TUY A;  3T1H B;  4GYC B;  1NVP D;  1EN5 A;  1AP6 A;  1DLB A;  1JA8 A;  1M57 B;  2ZDI C;  1AP5 A;  2DWE C;  3FD9 A;  1Y76 A;  4XDJ A;  4PHZ A;  1SRY A;  4L8J A;  5AG2 A;  4UCV A;  4H0L B;  5IY5 C;  1F4M A;  4GUN A;  4LWS B;  1MSD A;  4FVM A;  2UUA O;  5H2F Z;  4B3R O;  4DR7 B;  1Q3E A;  3IAY A;  1WJZ A;  1M9N A;  4JI0 O;  4O4L B;  2AGA A;  2WPD G;  2ZXW B;  3JAT A;  4Z2W A;  1MZF A;  2OTL V;  4B3M O;  5CB4 A;  4O4I A;  1XMQ O;  2ZE5 A;  1HNW O;  2Q7H A;  4X89 A;  4LF6 O;  2BOB C;  2ZIN A;  1IXM A;  2YXY A;  3BFR A;  1OCC B;  2WLI B;  1TUB A;  5KHH A;  1L1F A;  4CH3 A;  2LGW A;  5FNV A;  4K3A A;  3HKE B;  1U96 A;  5JJJ B;  5IJ0 B;  5L3C A;  4B08 A;  2F66 C;  1XOU A;  3J81 N;  1VQN V;  2F1M A;  1P84 F;  1PP9 H;  2X6B A;  3CRA A;  1Q81 W;  1NBM G;  3LDC A;  1R3K C;  5KAI Z;  5DED A;  3UT5 B;  4UCT A;  4AHC A;  2UU9 B;  2OYQ A;  2YC0 A;  3TJT A;  3BRC A;  4DV0 O;  4KXR A;  2FTK A;  2QM7 A;  4ICG A;  2P6J A;  3KCY A;  3S3W A;  1NR7 A;  3ZRW A;  4J10 A;  1VEW A;  2DQ0 A;  3G6E V;  4YHH B;  1EM1 A;  3ASO B;  3NR7 A;  4GKJ O;  5LOV A;  2RCV A;  1IUR A;  4JI8 O;  4K35 A;  1SER A;  2WLL B;  1JJ2 U;  4LF4 B;  1RM1 B;  3H1I H;  4I4T B;  5BZB A;  2B5U A;  2RN9 A;  3K04 A;  4O4H B;  2GSM B;  5EYP A;  2N04 A;  4C7U A;  4H13 B;  3APO A;  5CA0 A;  5IWA O;  2K9P A;  4DUZ O;  2OCC B;  2QKS A;  3CCQ V;  1YIJ V;  5ITZ B;  4MT8 A;  3OTO B;  3ZED A;  4RUF A;  4CC6 A;  5CA1 A;  1BT8 A;  4JYC A;  4B7E A;  2Q8V A;  5B1O A;  2E76 B;  2Q68 A;  1FXK C;  1GK9 A;  3W7W A;  4JI6 O;  4WFE A;  2WLK A;  4DR1 B;  4DV5 B;  4DV2 B;  2ZXW C;  1KUQ A;  1JR9 A;  2R72 A;  4QPK A;  4U7O A;  2ZE8 A;  3R65 A;  1GN2 A;  1N4C A;  3ZMS A;  2QE7 G;  2K1E A;  4RAI A;  5FLX N;  4DR6 O;  4JI3 O;  3CEI A;  4OX9 O;  3BCC H;  4DR2 O;  3JAR A;  3LUT B;  1Z5W A;  5JQG A;  2OWO A;  4JZG A;  1AI5 A;  3OGC C;  4DV3 O;  4QIW F;  5EBM C;  4EEQ A;  5EBL C;  4X1I A;  2ZNI A;  4DUY O;  5LHI A;  4DV6 B;  3ICX A;  4IIJ A;  2QTO A;  5LHG A;  2UXC B;  1X4T A;  4FLX A;  1I7F A;  2HJF C;  1HDJ A;  3FYI B;  1JPX A;  3E83 A;  2VQF O;  1QLN A;  2OCH A;  3L75 H;  1Z5V A;  2NN4 A;  4FLV A;  5BY1 A;  3PJS K;  1W59 A;  4LNU B;  4GX0 A;  3T1Y B;  1VQ6 V;  2PGG A;  3CX5 F;  4PDV A;  1OCZ B;  5JWP A;  4FLW A;  4JTC B;  5L3B A;  3D3I A;  1IZ3 A;  3JSL A;  3A0B Z;  1FYJ A;  1Y74 A;  5GON A;  4DR5 O;  4FLY A;  2KKW A;  1FJG O;  2QKA A;  1G6U A;  3GWK C;  3ABK B;  4K8Z A;  3JAS A;  4PDM A;  5B1A B;  2PI4 A;  3B09 A;  4KHP O;  3IJ4 A;  2DYS C;  2Q69 A;  4TT3 G;  4B3S B;  2WLN A;  3JAK A;  5LGN A;  4LF8 B;  5JVD B;  3PN1 A;  2P7T C;  4TQF A;  2B1G A;  4OPH A;  3L71 H;  2HKO A;  1SQB H;  1MG1 A;  4J9Y B;  3CCR V;  4FFB B;  1Q5O A;  4CH6 A;  3Q4H B;  2Q7G A;  2XTA A;  1N0J A;  4UCS A;  5LHH A;  3EXA A;  1KKC A;  4IGG A;  5LYJ A;  4X66 B;  3FB6 C;  1JX9 A;  4QNH B;  4AQY B;  1ZSP A;  4LR3 A;  2L35 A;  3OTF A;  3I55 V;  1X59 A;  2Y0I A;  4X20 B;  1E79 G;  5A9G A;  4TV9 A;  2QWQ B;  4AQY O;  3OT7 A;  4X66 O;  4GLX A;  2JS5 A;  4EFE A;  3CCS V;  3B4S A;  1QQC A;  4O2B B;  1QR9 A;  4CBC A;  2Z5U A;  4O2A B;  1KKD A;  4IT5 A;  3AG2 B;  4P9O A;  4XDL A;  1VF6 C;  4YJ3 A;  1EZJ A;  1OCO C;  3OUS A;  1BZK A;  4LF8 O;  4UVC A;  3OM3 B;  4I55 B;  4B3S O;  2P90 A;  2YIC A;  3JD4 A;  1ZL8 A;  4JAV A;  5LA6 B;  4LH6 A;  3JAL B;  4YIP A;  3P32 A;  4KHP B;  3JD3 A;  3O65 A;  2GTA A;  4TWK A;  1FJG B;  3RWR D;  3CRQ A;  3JD0 A;  4KP4 A;  2NR5 A;  1COW G;  2ATK C;  4DR5 B;  4FM1 A;  3FB8 C;  1BL8 A;  1Q86 W;  4NR1 A;  1RSO A;  4BW5 A;  1PNM A;  3CD6 V;  1OCZ C;  2MW2 B;  2LO1 A;  4O4J A;  2BCC H;  1FXK A;  1VP7 A;  5LP6 B;  4Q6G A;  4PA7 A;  3T1Y O;  4H37 A;  4FM0 A;  3U0Z A;  5D5Q A;  3K58 A;  3HKB A;  3LSQ A;  2GUZ B;  4UCR A;  1VF6 A;  2JEX A;  4EFB A;  1CP9 A;  2VQF B;  2RNB A;  5EK0 A;  2JDI G;  5B3S B;  1QLE B;  4XDK A;  3RYF B;  1AI6 A;  4QGP A;  1OV9 A;  2UXC O;  5EBW C;  4MVU A;  3OFN G;  3K5N A;  4DV6 O;  4JAA A;  1D2D A;  3E35 A;  4DUY B;  3OR7 C;  3OW2 U;  3NXS A;  4PA6 A;  2Z0A A;  4DV3 B;  2PF4 E;  4DW0 A;  2ADP A;  4NTW A;  4BIU A;  4OPA A;  2B9Z A;  2L6L A;  2CTR A;  4DR2 B;  4E4E A;  4OX9 B;  1CEZ A;  4JI3 B;  4X8A A;  1DK1 A;  4DR6 B;  2N74 A;  1U97 A;  1QU7 A;  4JI2 O;  4RWU A;  1SQX H;  4UVB A;  5IE9 A;  3DGE A;  3BEH A;  2X0L A;  5LXT B;  2P06 A;  4DV2 O;  4DV5 O;  4DR1 O;  1YTF B;  4MTO A;  4DK1 A;  4JI6 B;  2DYS B;  5LGT A;  1FXH A;  1V55 B;  1GMG A;  2KQX A;  1SF9 A;  2A7W A;  4TV8 A;  4JYY A;  1H2S B;  1S5J A;  3DC6 A;  1F7Y A;  5CN0 A;  3ZHV A;  4IYH A;  5IYZ A;  1PD3 A;  2YUA A;  3OTO O;  2RMK B;  1W0K G;  2Y4T A;  3RW0 A;  4DUZ B;  5IWA B;  1P7B A;  5KHJ A;  3APQ A;  3K9S A;  5EZY B;  3RVZ A;  3RYI A;  3W7U A;  5IJ9 B;  4H33 A;  4RQF A;  4MVO A;  1RPO A;  1H2L A;  2YSU B;  4LF4 O;  5C8Y B;  4MTX A;  4I9Q A;  3P30 A;  1M4U A;  2GTS A;  4R7C A;  4JI8 B;  1NTK H;  2Q67 A;  4GKJ B;  4HNA B;  5CBH A;  4FFK A;  4F6R B;  4YHH O;  2Q4P A;  4JPR A;  3ZHS A;  2YXL A;  4PI2 A;  4X1K A;  1SA0 A;  1BMF G;  4DV0 B;  4I50 B;  3FB5 C;  1BHA A;  2YI8 A;  2UU9 O;  4CH5 A;  2Q9L A;  3D36 A;  1BE3 H;  1R73 A;  1WA8 A;  3SJB C;  3UCS C;  1K4C C;  3B2E E;  2XHB A;  2GV9 A;  1THZ A;  3MD0 A;  3D3Q A;  3FKS G;  1H8H G;  1R6K A;  1N0N A;  3WU2 Z;  3QVN A;  4WBN A;  1KP2 A;  5KMG B;  1HP8 A;  3ZS8 C;  5J2T B;  1AB3 A;  4HZ3 A;  5TIS Z;  3K03 A;  5J2U B;  3F7V C;  4J80 A;  4LF6 B;  5B1N A;  1YJW V;  2YIB A;  1HNW B;  2QWN B;  3C3S A;  1XMQ B;  1NJI W;  4B3M B;  3D8C A;  4L87 A;  1AI7 A;  4ZOL B;  4WFB V;  3BY6 A;  1F4N A;  1AJP A;  1Q82 W;  4HAM A;  1AVM A;  1VQ9 V;  1K5S A;  3VQV A;  1URF A;  4BAY A;  4JI0 B;  2FML A;  5DN6 G;  1XL4 A;  3EFF K;  4YXW G;  3OE7 G;  4N23 A;  1KMI Z;  4DR7 O;  1SKV A;  3C90 A;  4B3R B;  1XIL A;  3D36 C;  2UUA B;  2FKX A;  3M99 B;  5JH7 A;  3ZRX A;  4DXW A;  2AZ2 A;  2XT9 A;  3HKD A;  4IL6 Z;  3G67 A;  1QR8 A;  2D2C B;  2IU0 A;  3SYQ A;  1SQV H;  1TVK B;  5CBG A;  5KX5 B;  1D5A A;  3HKC A;  1BGY H;  3B8M A;  2QGN A;  4CH4 A;  4MTG A;  2ADQ B;  4NTY A;  3T1H O;  4UXN A;  3RFR A;  2E75 B;  3CS5 A;  2P67 A;  2ZNJ A;  3OEE G;  3SR2 C;  1MNG A;  1ORQ C;  3VQX A;  4AI8 A;  3LNM B;  4PA9 A;  2H94 A;  3N2K B;  2P5O A;  4X62 O;  1PKX A;  1SQP H;  1R3L C;  1GM9 A;  3N2G B;  3TXS A;  2ZIM A;  1QNM A;  3M8A A;  1B06 A;  3LSU A;  1YF2 A;  3QO5 A;  3ZMU A;  1VMG A;  2IJI A;  1YIT V;  3UQ8 A;  2UXX A;  3K59 A;  3GVM A;  2KG7 A;  2HHH O;  4MVS A;  5IT9 N;  3L72 H;  2BSK A;  2HR3 A;  3CCU V;  4HYO A;  3JCU Z;  3CCV V;  1AR1 B;  1AR4 A;  1NT2 B;  2Q0O C;  4U3J A;  2EIN C;  2HJD A;  2WLM A;  3EHB B;  1R6T A;  1KYO F;  1HNX O;  1PM9 A;  2IM9 A;  4PDR A;  2YEV B;  5BMV A;  2ZE7 A;  1LNQ A;  4TOI A;  1OHH G;  4PV1 B;  1YEW A;  4BWA A;  3DTU B;  4LFC B;  3K5M A;  4DR4 B;  2A06 H;  2EJ7 A;  2CE4 A;  3K06 A;  1Q90 D;  1DGS A;  1AI4 A;  2P4V A;  5FL7 G;  2EJR A;  5B1A C;  4JGS A;  3DXR B;  5L3F A;  5JCO C;  1JFF B;  3SYO A;  4FLT A;  1GN6 A;  1E1Q G;  3E89 A;  3T4D A;  4IHJ A;  1N34 B;  4EB6 A;  2Z3Y A;  3BA9 A;  2LJ2 A;  1S0V A;  3AK1 A;  2GHY A;  1NH2 B;  3SYC A;  4X1Y A;  1JQ0 A;  2PZS A;  3ETQ A;  4JI7 O;  3SPI A;  1YTF D;  1F23 A;  1R3J C;  1YI2 V;  3JCZ A;  3RYH A;  5KA6 A;  2M6Y A;  4UV8 A;  1CPY A;  3CP1 A;  3R66 A;  5F2V O;  3ETG A;  1IBM O;  1MOF A;  1XUQ A;  2CH7 A;  1IDS A;  2IJJ A;  3SDL A;  2Q0A A;  2FB5 A;  5EC2 C;  1K92 A;  4I0X B;  4ZHQ B;  2E5L O;  3AG2 C;  1HNZ O;  1YJ9 V;  3RYC B;  4GX2 A;  3CCJ V;  2ILM A;  4GX1 A;  3ZHT A;  3ABT A;  4B3T O;  4JZ2 A;  4YJ2 A;  5KAF Z;  4I7Z B;  1SQF A;  5J9P C;  1S76 D;  3CC4 V;  2FYU H;  1XNR O;  3QO7 A;  4UB6 Z;  3E86 A;  3JAW A;  4MS2 A;  3VQW A;  3K5L A;  4DV1 B;  1KP3 A;  3HR0 A;  5KHI A;  2ZCE A;  4JAS A;  4K8X A;  2JGD A;  4UFZ A;  4DV7 B;  4G28 B;  1ROP A;  1M93 A;  4ZKI A;  4J41 A;  3CRR A;  4PA3 A;  1G1X B;  4DRX A;  5A2Q N;  1QLE C;  1TA8 A;  3J7A U;  1BCC H;  5KA5 A;  1K5Q A;  3KCX A;  2CGN A;  2UUC B;  1HR0 O;  3TET A;  4YY3 B;  1YJN V;  3E22 A;  1N32 B;  3B40 A;  2VWJ A;  1B04 A;  2UXD B;  3B77 A;  5JJE B;  3T4Z A;  4J42 A;  3SPG A;  3C3T A;  2EIL C;  2QM8 A;  3JYC A;  2ODM A;  2WLH A;  2BTQ B;  4R6Z A;  4RO2 A;  5B1B C;  3QG5 A;  4FJC C;  1WB7 A;  1AJQ A;  3H1L H;  4CS3 A;  4ZI7 B;  3I5D A;  1GAX A;  4FIP C;  2G38 A;  4LFB O;  2JIZ G;  1FFX B;  2YS8 A;  2VRZ A;  4X88 A;  2HVJ C;  3GB7 C;  4NYK A;  2VQE O;  3RT3 C;  1XL6 A;  4J7K A;  2HP8 A;  2DMX A;  2DW4 A;  3IGA C;  1ENV A;  1FKA O;  1VQ7 V;  3IC7 A;  3H1H H;  4J7Z A;  1FPO A;  2ZM6 B;  3ASN B;  1EFR G;  4WF9 V;  5LMU O;  4D6T H;  3FAV B;  4JI1 B;  4FLU A;  1XHX A;  4JI5 O;  3CJH B;  3E2E A;  3FFQ A;  1XNQ O;  5DM6 V;  2RQ6 A;  2OT5 A;  1QVG U;  4GZR B;  1FFT B;  3A0H Z;  4TUY B;  3AG4 B;  4GX5 A;  5BR8 B;  5E1A C;  2EIM C;  3QTC A;  2ARH A;  4DW1 A;  4DR3 B;  4NB5 A;  1Y76 B;  4Z1V A;  3OMA B;  2O57 A;  1V9P A;  2WSS G;  4DV4 O;  3U11 A;  2XAG A;  1OJH A;  4LWS A;  3ZN0 A;  3BAA A;  3SYA A;  1B3Q A;  1K97 A;  1UJW B;  2F93 B;  2IU3 A;  4FMT A;  2QTS A;  5GTI Z;  1GKF A;  5LMN O;  4O4L A;  5LGU A;  4JV5 O;  3JAT B;  4I5S A;  1W2B U;  2QWO B;  1SES A;  2X7R B;  3SYP A;  3ZX6 A;  1S5L Z;  5H5N A;  1US6 A;  4U7N A;  4MW3 A;  5CB4 B;  2HG5 C;  4QPJ A;  4G2K A;  4O4I B;  3KKY A;  2QKC A;  3STL C;  4KFM A;  1M56 B;  3ABM C;  2WLI A;  1TUB B;  2OCC C;  5FNV B;  4U3F H;  1IXB A;  2ZKO A;  3CC7 V;  3HKE A;  2Y69 B;  2R9A A;  5IJ0 A;  4GKK O;  1PNL A;  1V54 B;  3E8G A;  2JGU A;  3ZMZ A;  1Q6U A;  3E8B A;  3G80 A;  1JMK C;  4LCU C;  3CME V;  2ZIO A;  3U10 A;  3UT5 A;  3CCM V;  2V1D A;  1IBL B;  4FLZ A;  1YHQ V;  1M57 C;  2LFS A;  3G6B A;  4CZZ A;  1VF5 B;  3WG7 C;  4TSF G;  1R6N A;  1OCR B;  4J9Z B;  4ASU G;  3ZRW B;  1GM8 A;  1NS1 A;  1RFY A;  3JSN A;  2F4V B;  1PL4 A;  3ZBH A;  4NXM B;  3ABU A;  1MA1 A;  3AG3 C;  5LOV B;  3IFX A;  3ZJZ A;  2HLD G;  4MSW C;  2XAF A;  1IBK O;  2PY5 A;  1ZAU A;  2WLL A;  5KUK A;  1NU1 H;  4NKG B;  1OCR C;  1NVP B;  4JYA B;  2A9H A;  3H01 A;  1FAF A;  5JJN B;  4I4T A;  4D7T A;  3QF7 A;  1K3E A;  1CXZ B;  2IBZ H;  3CRC A;  4RUE A;  2XND G;  1YSC A;  4O4H A;  1P49 A;  1VQ5 V;  5EYP B;  4LF7 B;  1J5E B;  3AK3 A;  4NXN B;  1YCI A;  4JI4 B;  5CA0 B;  1M1K W;  3CMA V;  3ZCC A;  3DSQ A;  3H9V A;  3F5T A;  5ITZ A;  1O9H A;  4PA4 A; 
#chains in the Genus database with same CATH homology
 3K08 A;  4RUF A;  1JVM A;  4F4L A;  4JYC A;  4RQE A;  2BOC C;  3B8M A;  4MTG A;  1VQK V;  4UXN A;  5B1O A;  1H8E G;  1QBZ A;  2Q68 A;  4Z1M G;  1FXK C;  1GK9 A;  3W7W A;  5L3G A;  2P67 A;  4WFE A;  3TCU A;  3OEE G;  2WLK A;  5H6Q A;  1ORQ C;  1EBO A;  4QE7 A;  2ZXW C;  1K33 A;  4MVQ A;  3K9A A;  3LNM B;  4QPK A;  1BHB A;  5L3E A;  1F51 A;  4PA9 A;  2H94 A;  2JK5 C;  4U7O A;  1M90 W;  3HPL C;  4WCE V;  5CA3 A;  3LDE A;  1PKX A;  1R3L C;  1GM9 A;  3R65 A;  3ZMS A;  2QE7 G;  1K9M W;  2K1E A;  3ETE A;  4RAI A;  3STZ C;  5KUM A;  1S5H C;  3QO5 A;  1VQ8 V;  1S72 V;  3ZMU A;  1VQ4 V;  2IJI A;  4UUJ C;  3ABL C;  3SPJ A;  1YIT V;  2R9I A;  3LUT B;  2UXX A;  4P30 A;  1MSW D;  1K7D A;  4MVS A;  3ZIA G;  2W0F C;  1AI5 A;  2CK3 G;  2IJK A;  3TK1 A;  2HR3 A;  3OGC C;  3CCU V;  4HYO A;  4OXS A;  4QIW F;  3K3W A;  3G4S V;  2IW5 A;  5EBM C;  3CCV V;  1AR1 B;  5EBL C;  5LHI A;  2EIN C;  2WLM A;  3MHH C;  3EHB B;  3ABL B;  5LHG A;  3W7S A;  2QTO A;  2PI5 A;  1R3I C;  4UV9 A;  3JD2 A;  2DYR B;  3G71 V;  1FXV A;  2HJF C;  4PDR A;  3F5W C;  3FYI B;  1JPX A;  3E83 A;  2YEV B;  2YEV A;  2B1I A;  1JOY A;  4FPP A;  1I5Y A;  1LNQ A;  3VOU A;  1QLN A;  4MTF A;  3CC2 V;  2Y69 C;  1H2G A;  1OHH G;  4JYB A;  3ZMT A;  2Q6A A;  2XAS A;  1JCH A;  3DTU B;  5CMU A;  5IYC O;  3PJS K;  1VQO V;  1WLE A;  4GX0 A;  2XAJ A;  2W6I G;  1VQ6 V;  3K06 A;  3AG3 B;  3F7Y C;  4EKW A;  4PDV A;  4R50 A;  1OCZ B;  1KC8 W;  2WAM A;  1AI4 A;  5FL7 G;  4JTC B;  2EJR A;  5L3B A;  3D3I A;  3ETD A;  5B1A C;  4JGS A;  4UVA A;  3K0G A;  3X2Q C;  3SPC A;  5L3F A;  1VQP V;  1PNK A;  3I56 V;  1PL0 A;  4JAU A;  3SYO A;  1G4Y B;  1S3J A;  2NLJ C;  1E1Q G;  3E89 A;  3T4D A;  1Q7Y W;  2Z3Y A;  4MVR A;  1OZ0 A;  2JEU A;  3CXC U;  3ABK B;  2ZD9 A;  2HFE C;  4PDM A;  5B1A B;  5LBQ A;  2PI4 A;  1S0V A;  2GHY A;  3JD1 A;  3SYC A;  3X2Q B;  4MVZ A;  2LFR A;  1NH2 B;  2DYS C;  2Q69 A;  1OCO B;  4TT3 G;  2WLN A;  3MHS C;  1JQ0 A;  5LGN A;  1DF5 A;  2P7T C;  3SPI A;  1YTF D;  1F23 A;  1R3J C;  3OAA G;  1YI2 V;  3JCZ A;  2B1G A;  5EC1 C;  1S77 D;  5KA6 A;  1DF4 A;  5L3D A;  2HKO A;  1HWY A;  1MG1 A;  3SPH A;  4J9Y B;  2LP7 A;  3CCR V;  4UV8 A;  1CPY A;  3W7T A;  3CP1 A;  5IYB O;  4GCZ A;  5LHH A;  2DWD C;  3QNE A;  3FB6 C;  1JX9 A;  4QNH B;  3I55 V;  3ETG A;  1Y66 A;  1MOF A;  3CCE V;  4PDL A;  1E79 G;  4JF3 A;  2IJJ A;  2EIL B;  3AG1 C;  3QO8 A;  2JJ2 G;  5EC2 C;  1K92 A;  5GW7 A;  2EIK C;  1RPR A;  2WLJ A;  2IJH A;  3UKM A;  3CCS V;  3AG2 C;  2C2A A;  2JJ1 G;  4PA4 A;  1QR9 A;  4CBC A;  1YJ9 V;  3CCJ V;  4GX2 A;  2Z5U A;  3LSS A;  1KKD A;  4GX1 A;  5HFM A;  3AG2 B;  5HFL A;  4P9O A;  4XDL A;  3VBB A;  3ABT A;  4LC1 A;  1EZJ A;  2NNU A;  1OCO C;  4DO2 A;  3OUS A;  2HVK C;  4LBE C;  4G27 B;  5J9P C;  4UVC A;  1S76 D;  3OM3 B;  3B8N A;  3CC4 V;  4KUM A;  2P90 A;  3QO7 A;  3JD4 A;  4JAV A;  4R8C A;  5B3S C;  3E86 A;  2EZO A;  5IDJ A;  4MS2 A;  2QEX V;  3P32 A;  2ZQM A;  3JD3 A;  1KP3 A;  5CBF A;  4TWK A;  1VQM V;  3JD0 A;  2XOK G;  4JAS A;  4KP4 A;  1COW G;  2ATK C;  1P4R A;  1K8A W;  2AHY A;  3FB8 C;  4G28 B;  1BL8 A;  1ROP A;  4P2Z A;  1Q86 W;  3OEH G;  3OMI B;  5B1B B;  4QJF B;  4ZKI A;  2A0L A;  1PNM A;  4BW5 A;  1QVF U;  3CD6 V;  1OCZ C;  2Y48 A;  3E8H A;  3GWO A;  1K73 W;  4PA3 A;  1FXK A;  1FXK B;  1V55 C;  2IH1 C;  2H8P C;  4MVM A;  1QLE C;  4PA7 A;  1GTO A;  4H37 A;  1WPX A;  5KA5 A;  1K5Q A;  4I9W A;  3W7X A;  3LSQ A;  2JEX A;  3TET A;  2W6J G;  2OTJ V;  1CP9 A;  1YJN V;  5C93 A;  3ASN C;  2D3O W;  1Y4M A;  3K0D A;  5EK0 A;  3RVY A;  2EIJ B;  2JDI G;  4GT1 A;  3AG4 C;  3B77 A;  1J95 A;  5B3S B;  1QLE B;  4XDK A;  3T4Z A;  3FYE B;  1AI6 A;  3ZRV A;  1NR1 A;  2ITC C;  5EBW C;  4MVU A;  2AHZ A;  3SPG A;  2EIL C;  2QM8 A;  3JYC A;  3OFN G;  3OMN B;  2DYR C;  2MK3 A;  2WLH A;  3OR6 C;  3KG2 A;  4R6Z A;  1GO3 F;  3E35 A;  3OR7 C;  1K4D C;  4RO2 A;  3UM7 A;  3CPW U;  3OW2 U;  2X6A A;  5B1B C;  3NXS A;  4PA6 A;  3WFV A;  4FJC C;  2ZR3 A;  1NH2 D;  1AJQ A;  4N21 A;  4E2L A;  1ZWI C;  3LDD A;  4MW8 A;  4FIP C;  2JIZ G;  4BIU A;  1QCE A;  4X88 A;  2HVJ C;  2EIM B;  3GB7 C;  2A79 B;  1XL6 A;  1TUE B;  2UXN A;  1ARO P;  3FB7 C;  4WFH A;  1CEZ A;  4BIZ A;  2DW4 A;  3IGA C;  4X8A A;  1AJN A;  2EZP A;  1ENV A;  3SJQ C;  2M7W A;  3K79 A;  1VQ7 V;  1N8R W;  3ABK C;  3CYO A;  3IC7 A;  2ITD C;  3ASN B;  1DTO A;  1EFR G;  1B6Q A;  4WF9 V;  5H6R A;  3AEI A;  4QE9 A;  4FK5 C;  4UVB A;  1KQS U;  3DGE A;  2V7Q G;  3BEH A;  2EIK B;  3HB3 B;  2X0L A;  2XAH A;  4WFG A;  3E2E A;  4ZBM A;  1YTF B;  3A0R A;  4MTO A;  5DM6 V;  3AG1 B;  2OT5 A;  1QVG U;  1MAB G;  2DYS B;  5LGT A;  1FXH A;  1V55 B;  1GMG A;  2X6C A;  1NKD A;  1FFT B;  1K34 A;  3AG4 B;  4GX5 A;  1NVP D;  4WFA V;  5CN0 A;  5E1A C;  2EIM C;  1SZT A;  1PD3 A;  1DLB A;  1M57 B;  1W0K G;  2ZDI C;  2DWE C;  3OMA B;  3RW0 A;  4XDJ A;  1SRY A;  2WSS G;  2EBO A;  5IY5 C;  1F4M A;  2XAG A;  4LP8 A;  1M56 C;  1P7B A;  3ABM B;  3ASO C;  3ZN0 A;  3SYA A;  1H38 A;  1K97 A;  2EIN B;  2WWW A;  5IY5 B;  3RVZ A;  1UJW B;  3W7U A;  2IU3 A;  4FMT A;  4H33 A;  2ZR2 A;  1RM1 C;  4RQF A;  4MVO A;  4P9P A;  1RPO A;  2YSU B;  1KD1 W;  1M9N A;  5H9C A;  4MTX A;  5LGU A;  4I5S A;  2WPD G;  2ZXW B;  3P30 A;  5IYD O;  1W2B U;  4Q20 A;  4R7C A;  1SES A;  2X7R B;  3SYP A;  2Q67 A;  2OTL V;  4U7N A;  4MW3 A;  2HG5 C;  4QPJ A;  4G2K A;  5CBH A;  1W0J G;  4JPR A;  3T2M A;  4X89 A;  3STL C;  4KFM A;  1M56 B;  3ABM C;  2BOB C;  1IXM A;  1OCC B;  2WLI B;  2WLI A;  1E1R G;  1V54 C;  1L1F A;  2OCC C;  1BMF G;  2EIJ C;  3ML0 A;  3CC7 V;  2Y69 B;  1OCC C;  3FB5 C;  1VQL V;  1PNL A;  1BHA A;  1V54 B;  2R9R B;  3E8G A;  5L3C A;  3ZMZ A;  3D36 A;  3E8B A;  1R73 A;  1NQT A;  1VQN V;  1K4C C;  4LCU C;  1FS0 G;  1G8M A;  1THZ A;  3MD0 A;  2X6B A;  3FKS G;  3CME V;  1Q81 W;  1NBM G;  1H8H G;  3ZMV A;  1R6K A;  3LDC A;  1R3K C;  3CCM V;  2V1D A;  1GM7 A;  3T1C A;  2XAQ A;  1KP2 A;  2IH3 C;  3WG7 B;  1YHQ V;  1M57 C;  3RBZ A;  2LFS A;  2FTK A;  4CZZ A;  4HZ3 A;  3CCL V;  3WG7 C;  2QM7 A;  4TSF G;  1R6N A;  3K03 A;  1OCR B;  3F7V C;  2P6J A;  2ZDI A;  4J9Z B;  4ASU G;  2QA4 V;  1NR7 A;  3ZRW A;  3ZRW B;  5B1N A;  1YJW V;  2DQ0 A;  3G6E V;  4JTA B;  1GM8 A;  3ASO B;  1NJI W;  2F43 G;  3ABU A;  3OUF A;  1SET A;  3ZN1 A;  3AG3 C;  3IFX A;  4L87 A;  1KEC A;  3ZJZ A;  2HLD G;  1AI7 A;  4WFB V;  4MSW C;  2XAF A;  3BY6 A;  1F4N A;  1AJP A;  1Q82 W;  1SER A;  2WLL A;  2WLL B;  4HAM A;  5KUK A;  1JJ2 U;  1OCR C;  1K5S A;  2DQ3 A;  4XBF A;  1NVP B;  1VQ9 V;  4BAY A;  1RM1 B;  2A9H A;  3H01 A;  4WFF A;  3E8F A;  5BZB A;  2B5U A;  4JTD B;  1K3E A;  5DN6 G;  1XL4 A;  3EFF K;  4YXW G;  3K04 A;  3OE7 G;  4RUE A;  4N23 A;  2XND G;  1YSC A;  1I5X A;  1VQ5 V;  2GSM B;  3M99 B;  1M1K W;  3CMA V;  3ZRX A;  3ZCC A;  4DXW A;  2OCC B;  2QKS A;  3CCQ V;  1YIJ V;  3ZRS A;  2KB1 A;  4PEL A;  1QR8 A;  2IU0 A;  4MT8 A;  3SYQ A;  1GKF A;  5CBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...