3OW2U

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ow2U00
1K8AW 1KQSU 3CD6V 3CCEV 1K9MW 1Q82W 1VQ5V 3CPWU 1VQLV 4WFAV 3CCLV 3G4SV 2OTJV 1VQOV 4WCEV 1YITV 3CCJV 1NJIW 2QEXV 1VQNV 1M90W 3CC4V 3CCMV 1VQPV 3CCRV 1VQKV 1VQMV 1W2BU 1VQ8V 3I55V 1VQ4V 3CMEV 2OTLV 1M1KW 1K73W 1YJNV 3CCSV 1KC8W 4WF9V 3G71V 1YI2V 1QVGU 1JJ2U 1QVFU 4WFBV 1S72V 3CCUV 2QA4V 3CC7V 2D3OW 3OW2U 1Q81W 1KD1W 1R73A 1YIJV 1Q7YW 1VQ6V 3CCQV 3CXCU 5DM6V 3I56V 3CMAV 3G6EV 3CCVV 1VQ7V 1YHQV 1YJ9V 1YJWV 3CC2V 1N8RW 1Q86W 1VQ9V
chains in the Genus database with same CATH superfamily
2HG5C 3E83A 3VQYA 1WB7A 5JH7A 2IJHA 3JASA 3UQ8A 5EBMC 3E8BA 1XMQO 4MVSA 5KHKA 1J95A 4YJ2B 1W0KG 5H6RA 4JTCB 2QTOA 2YUAA 1FFXA 2XAHA 2F43G 2QM7A 3CP1A 3R66A 1MNGA 3T2MA 3D8CA 4JTAB 1QCEA 1EZVH 4QPKA 1HP8A 1IVSA 4FM1A 1AROP 1M1KW 3OW2U 2EBOA 1FJGO 4LC1A 4XBFA 1AI4A 1WP7A 2P06A 1M5IA 5B3SB 1XL6A 1JJOA 1OCCC 4UCVA 4LBEC 3PJSK 2XASA 1Q3EA 4JI4B 1KBHA 4WFEA 4U7OA 1URFA 1Y74A 1W2BU 1W0JG 2R9RB 2OTLV 3JARB 4KXRA 3SJBC 2OCCB 4PA6A 2WLLB 4U3JA 4O2BB 1VQ7V 2W6JG 2IU0A 2Z0AA 4MS2A 3K03A 1M57C 1PM9A 3A0HZ 1XQ8A 5JJJB 4G28B 1BCCH 2CK3G 3FAVB 1MMMA 5LXTB 3T1HB 2YEVB 1EN6A 3G80A 3CB2A 2OYQA 3RYFA 1NR7A 4JGSA 5FNVA 1R3IC 3FB6C 1SQPH 3E8GA 2F1MA 1F4NA 3RYIA 2XAFA 1BT8A 1JX9A 2ZT9B 1SS3A 2JIZG 3E22A 2DYSB 1OCOB 2LGWA 3OTOB 3B09A 3WG7B 5LMNO 3N2GB 3BA9A 2A0LA 3K5LA 5IYDO 3ABLC 5J2UA 1OCZC 3K57A 2QE7G 2KKWA 2PTMA 3B8NA 1O9GA 3DTUB 1Q7YW 1VIBA 1Y76A 2EJRA 1IBMB 3BABA 3CCLV 1XUQA 3A0RA 3ETDA 1Q90D 1IURA 1VF6A 4KUMA 3LSSA 1LR1A 1O9HA 5JQGB 5KHJA 5J2TB 1AI6A 4LFAO 3L74H 4I5SA 5B1AC 2ZE7A 2ZE8A 5KAFZ 3TXQA 1N8RW 4JI5B 1QQCA 2IBZH 5AG2A 1MA1A 4O4LA 1GN6A 5J9PC 2GBOA 2YXLA 2UXDB 5KUKA 5D5PA 2B1IA 1FD9A 3H1HH 5L3BA 4DR2B 2GUZB 1HR0B 4LF7B 1R6KA 2JJ2G 4LF4O 4DXWA 1WPBA 2DQ0A 1TVKA 5JH7B 1M56C 3JD2A 3W7WA 1VF6C 1AJNA 1LNQA 1OCCB 1V55C 4BW5A 1OCRC 3SPHA 4WBNA 1K4CC 4LF9O 3VQWA 3FB8C 3ZRVA 4LFCO 4UCUA 3ZMZA 2YXYA 4OXSA 1Q43A 1QNMA 2Q6AA 3RYCB 5L3CA 2Y69B 2UXCB 3BRCA 4DV3B 1KP3A 3LSQA 3H01A 1M57B 5EZYB 4CS3A 2ZKOA 4O4HA 1PV0A 2B9ZA 5BXZA 4JI6B 2GTAA 1ZSPA 1PNLA 1JPXA 1P4RA 2JJ1G 3W7UA 4X65O 3CRMA 1YZBA 4ABMA 4P9OA 3IC9A 1GN3A 4PDLA 3JSNA 1XNQO 3ABLB 1OCZB 3HPLC 1K73W 4NXMB 4U3JB 2WSSG 1I5YA 5KMGA 2HLDG 1SQVH 3CCQV 4TUYA 3AG3B 2A06H 1XMQB 3ETGA 4ZBMA 1K33A 3P3PA 1SQGA 1DF5A 4X1IA 1PP9H 2QKAA 3BFRA 4FZ1A 3ZHRA 1NH2B 1R6NA 3OEEG 1XOUA 3RYFB 1MABG 3WB1A 2EILC 5KUMA 4CZZA 1HDJA 5LMUB 3RYIB 3CHXA 4MT8A 2LP7A 1XMOB 2HJFC 4GX5A 1NH2D 2JEUA 5B1AB 4FLTA 4KHPB 3LNMB 2XTAA 2N04A 4W4LA 2UUCB 4DR4B 3UCSC 1E79G 4UCRA 1FJGB 1D2DA 3RVZA 4RO2A 3ZRSA 5H9CA 2FL4A 1FXKA 3QTCA 4X8AA 1SRYA 3DGEA 3OR7C 1Y76B 4IYIA 1BSMA 2CTQA 4WFGA 1QR9A 2WLMA 4JYAO 1M56B 4JI8B 2Y0IA 2Q8VA 5EIBC 1B06A 1D5AA 1WAZA 3AK3A 4JZ2A 2RN9A 4U3FH 4QE9A 1J5EO 2B1GA 2WPDG 2X6BA 3THOA 3MDSA 5B66Z 3EFFK 4O4LB 4JV5B 3E2EA 1FXKC 3G6BA 3H9VA 4IL6Z 4X64O 1WJZA 2HVKC 1M93A 3Q4HB 4WFBV 4F6EA 2QR4A 4I4TA 4FVMA 3FB5C 5IDJA 4JI0B 1TVKB 1BMFG 5B1BB 4RQFA 1Q86W 4P9PA 1GRJA 3APOA 3GVMA 4LF8O 1HNZB 3A0BZ 3ZN1A 2LGQA 1GM9A 4I7ZB 2W0FC 4JI1B 1PL0A 4H33A 2ZIOA 5LHGA 4CC6A 1NS1A 1R1BA 2DW4A 5IT9N 1K92A 1FFTB 3WU2Z 3JATA 4PI0A 3ZHUA 4O4HB 4X62O 4MW3A 3ZHVA 5B5EZ 1BQ0A 2QDOA 2EILB 2NLJC 2X6AA 1TUEB 3TK1A 2R9AA 3RVYA 5IWAB 1GTOA 4PELA 4DO2A 3CCVV 1BS3A 2A79B 2BOBC 3F5TA 1ORQC 2DWDC 4QGPA 4X1YA 2E76B 1NVPD 4H37A 5CA3A 4DUYO 4JI2O 3ZHSA 2IW5A 2Q9LA 5E1AC 5KMGB 4DV0O 3H1IH 2VWKA 3QF7A 2Q7EA 4JZGA 3K08A 2QM8A 2JEXA 3OEHG 3S3XA 4LFCB 2QWNB 1YTFD 3EXAA 4IHJA 4DK1A 4N21A 1Z5WA 3CRCA 1NTZH 2Q73A 4TOIA 3HKEA 3BEHA 3N2KA 5TISZ 1TUBA 2ZQMA 1NU1H 2JGDB 4DUZO 2AZ0A 4YJ3A 3LSUA 5IJ9A 4UCTA 1YSCA 2ZIMA 5LL6Y 1N36B 3ZMVA 1YIJV 3QNEA 5KLVH 2WLHA 2JK5C 4J11A 3J7AU 2V7QG 4LCUC 4B7EA 4P2ZA 1FXKB 1RM1B 1THZA 3OR6C 3CCRV 2ZDIA 3ZCCA 2UUBB 4IGGA 5EBLC 4R6ZA 4J9ZB 1CEZA 1XNQB 2QA4V 1XREA 4JPRA 1Q81W 3JSLA 1AP5A 4H13B 1TAEA 2GSMB 1Q5OA 2UU9O 1KYOF 2Q0OC 4YIOA 3ZS8C 2Q69A 1ZTEA 2WLNA 3B2EE 4UVAA 5HFLA 3WB2A 3CC4V 4MVUA 3RWRD 1QBZA 4BW9A 1UFIA 4TT3G 4HNAA 2Q67A 1AI7A 4YY3B 2H3OA 4PD4F 2AHYA 2JRIA 3CC7V 3CRAA 4RQEA 2ETNA 1B04A 3MHHC 2WLKA 4DV2O 4QNHB 3BHPA 3SYCA 2EIKC 1DF4A 1JCHA 4UXNA 2ZDIC 2RJZA 3SYQA 2VQEO 2XOKG 3BY6A 3VQXA 4B7KA 3F5WC 4E2LA 4DV4O 4I4TB 4K3AA 2QM4A 1VQ4V 2YDEA 3DSQA 4NTYA 3ZJZA 3UT5B 2DYRC 5CA1A 2ZXWB 4DV6O 2ADQB 3OTFA 1N0JA 4X9QA 5BR8B 5LBQA 3M8AA 3K06A 3ZMTA 1VQNV 4YHHO 4JYAB 4F6RB 2W6IG 3QO7A 1JFFA 5CBFA 3F7VC 2E74B 4W4KA 3L75H 1SQQH 2F95B 1CP9A 1YHQV 3CRQA 2VS0A 2GDSA 3JATB 5B1OA 1J5EB 4AI8A 2LW1A 1YF2A 3BVOA 3JALA 4DV7O 4CH4A 2A7WA 3CMEV 4B3RO 5KX5A 4Z1MG 2YI8A 3P30A 2UXNA 2AHZA 4QPJA 2MW2B 4FM2A 4JYCA 4P30A 1WN7A 4X1YB 1H8EG 5LA6A 2QKSA 4MW8A 3JAKB 1SERA 5JWPA 3STZC 1SZXA 3ZHTA 5BMVB 1P7GA 2K1EA 1HNWO 4RUEA 4FLWA 4I55B 5C93A 3C3SA 4IHJB 1EZJA 4IYHA 4DV1O 5C8YA 4UCOA 2EULA 4PA3A 3HKEB 3OUFA 4J10A 3EHBB 1XBLA 2XHBA 5CBGA 4FLVA 1LUVA 1TUBB 4FLZA 4MVRA 1GK9A 3AG4C 5IJ9B 1YDXA 1P7BA 2X0LA 5JVDB 1IBLB 1A32A 4B3MO 4DW0A 3OGIB 4DW1A 4UVBA 3ETQA 2V1DA 4EB6B 3LUTB 3RN4A 3FD9A 2V4DA 2EIKB 1ZUQA 5LGUA 1KMIZ 3DC6A 4LF6O 2FYUH 4JYBA 4XDJA 3WFVA 4UCSA 4JI2B 5A9GA 4DR6O 5L3FA 2DYRB 1EFRG 4LFBB 2BTQA 4X20A 1X59A 3EVKA 2XAQA 4GX0A 1Q82W 3CX5F 4HNAB 5IYZA 4JI7O 1H38A 1SESA 1CXZB 1SQBH 4K0KB 1I94B 2DWEC 1MZFA 3FYIB 4FJCC 1QR8A 2E5LO 3CCUV 4OX9B 1G8MA 2XAGA 4DR3B 4L87A 4DR5B 1N33O 2ITDC 3UO2A 3ZX6A 2ZM6O 4UV9A 3G4SV 3R65A 3BAAA 1T5EA 5EYPB 4ZHQB 4NTXA 1KKCA 5CA1B 1EN5A 1XL4A 1MG1A 2GHYA 4NB5A 4R50A 4NXNO 4H44B 3J81N 3K59A 2OWOA 5CBHA 4AQYO 3RGBA 3W7XA 3O9OA 2YIBA 2RQ6A 4BWAA 4CH5A 1Z5VA 1B6QA 1COWG 3JASB 1JFFB 3H1JH 2UU9B 3OMIB 2HP8A 3SJAC 1VQMV 1YJNV 2QWPB 4WF9V 2OCHA 3SPCA 5DECA 1NKDA 4AHCA 4J80A 2YIDA 2VRZA 2HHHO 1FFXB 1N4CA 2IU3A 4G27B 4MTXA 2EINC 3JALB 4DV2B 3MAQA 4GUNA 2EIMC 4MSWC 1PPJH 2YIAA 4MVQA 3AG4B 4EEQA 4PHZA 4LH7A 4HBNA 3ZIAG 2VQEB 4C7UA 1E1QG 4TV9A 2DOSA 4WFFA 5LA6B 3SJCC 4TQDA 1U97A 3NR7A 5CA0A 3LDCA 5IYCO 1VQ9V 4K35A 1IDSA 1K9MW 4I0XA 4DV5O 4LP8A 1V9PA 3P32A 3TETA 1N34B 1Y74B 4LR3A 2VQFO 1YCIA 4CH6A 5JCOA 4LF5O 5KAIZ 1SA0A 4FFKA 2ODMA 4YHHB 2P7TC 2KQXA 2YSUB 5C8YB 1NI8A 1SQXH 3AK1A 4GLXA 1F7YA 5ITZA 2CH7A 3FX7A 1S77D 1UPGA 3IAYA 2YXHA 4JASA 3T1YO 5L3DA 3JD3A 1GN4A 2P90A 3L73H 5FNVB 3A8TA 1ZL8A 3L71H 4PI2A 3E22B 2ARHA 3JD1A 3OT7A 1P49A 4EFEA 3J80N 4B3TO 2LFRA 2P4KA 4JF3A 4GCZA 2PGGA 2N05A 2R9IA 5JCOC 5J2UB 2AW9A 4RWUA 4JI3O 4J42A 1Q6HA 2Q7HA 3RFRA 4X1KA 5LHHA 4DR1O 1QU7A 5CN0A 4NKGB 3GWOA 1XI1A 3ZRXA 1KD1W 5HFMA 1JQ0A 3QO8A 3ZRWA 1NBMG 2QKCA 1RFYA 1HNWB 4BR6A 2CGNA 2UXBO 5LHIA 3CEIA 1F23A 4FIPC 2Y4TA 2BOCC 3TXSA 1V55B 1E1RG 1OCRB 5LGNA 5LOVA 1BE3H 1VARA 1WNSA 2ZE6A 4NTWA 1GMGA 1TGOA 1K3EA 5GONA 2IM9A 4ZOLA 2X6CA 4YIPA 4X89A 5H5NA 4B3MB 5KHIA 2JGUA 2EINB 3ABKC 2JS3A 4GX2A 2RDCA 1JMKC 3GB7C 5LYJA 1D5NA 5LMNB 1YI2V 3OD4A 3ZBHA 2ZR3A 1NTMH 4LF6B 1RSOA 4GKKO 1B3QA 2P22C 3HKBA 2KB1A 2AZ2A 3AG7A 1JOYA 4WBNB 3CCMV 2EZPA 4CBCA 5LGTA 5CB4A 2BTOA 5LP6A 1P84F 1S72V 3OM3B 3T1CA 1IXBA 1BHAA 2CE4A 2KG7A 1M4UA 4JI4O 1KQSU 2E3CA 4LFAB 4WFAV 1N33B 1Y6XA 2BCCH 3JD4A 1FS0G 5H6QA 3I55V 1VF5B 1Q6IA 2BSKA 4MTGA 4O2AA 3KCYA 5CA0B 3ABMC 5DM6V 4NR1A 3W7SA 3VQVA 1AJQA 1JVMA 4NXNB 3T1HO 1R6TA 4K8ZA 3CPWU 3ASNC 4MTOA 4LF4B 4FK5C 5LP6C 3HB3B 3FYEB 4U7NA 3RBZA 3U10A 4JAUA 3FKSG 3OTOO 3HKCA 1XNRO 4TUYB 4GKJO 2X7RB 1OHHG 4HZ3A 4LF9B 5ITZB 3MHSC 1SC5B 4X1IB 4UB6Z 4I9QA 1VQLV 2ATKC 1AJPA 2Y4UA 1KC8W 3ZHQA 3UM7A 3ABUA 3IFXA 2OIGA 4DYLA 3NXSA 5EIBD 4D7TA 1LUWA 1Z2GA 4BIOA 1K97A 5FL7G 4X65B 5JJEB 5A2QN 3ABKB 2XAJA 4PDRA 4X1KB 4LWSA 2PYLA 4DV5B 4H0LB 4Z2WA 1R3KC 3FAVA 2YEVA 1PNMA 3ZRWB 2VQFB 1EM1A 4HAMA 4LF5B 4YXWG 3RYHA 2UXDO 1H2NA 4FMTA 2WWWA 3K5MA 4DR2O 1DK1A 4BIZA 1HR0O 4FZ0A 4LF7O 5LOVB 1GAXA 1Q6UA 3ZEDA 1L0NH 5GONB 2A3QA 3U11A 2HJDA 3D3QA 4DRXA 4MVZA 4UB8Z 1YJ9V 1GO3F 3H1KH 3D3IA 5JJNB 3O65A 2NR5A 4KP4A 5LYJB 5FPRA 4DK0A 5F2VO 1KKDA 1BGYH 2Y48A 2N74A 1VQ8V 2UXCO 2IH3C 4DV3O 2ADPA 2IJKA 1RSOB 1YEWA 4JI3B 1VEWA 4FLYA 5J2TA 1VF7A 1VQ6V 3HKBB 1PNKA 3G6EV 3E89A 3ABMB 4RUFA 4DR1B 5B1NA 3OFNG 2F66C 2QWOB 2M7WA 1F51A 1PKXA 4JI6O 1EBOA 3ICXA 5CMUA 3ASNB 5CB4B 1YITV 3SPJA 5EC1C 1H2SB 2UXBB 2QWQB 2Q7GA 1PL4A 1KECA 2YC0A 1L1FA 4NYKA 3ZMUA 2FTKA 1K7DA 1CPYA 3RT3C 4NXMO 4R7CA 4B3SO 3H1LH 2DE0X 1IZ3A 4I9WA 2YS8A 1KU9A 4UFZA 2FKXA 2BSKB 4J7KA 4O2AB 1AR5A 4D6TH 2HFEC 1HW7A 2ZNIA 4EKWA 1GH6A 1AILA 2G38A 4X64B 3RYCA 2UUAO 1QHTA 2PI4A 4B08A 5LMUO 2O57A 4GKKB 1S76D 5EZYA 3UKMA 4ZIBA 1XMOO 2DMXA 3U0ZA 1FKAO 3HKCB 1R3JC 4KHPO 1H2MA 4DR4O 1GM8A 3KZIZ 4ZKIA 2UUCO 1S5HC 2PYJA 4LF8B 3CRRA 4CS2A 3IGAC 4X88A 4MVOA 1WP8A 3K0DA 2XUMA 3IJ4A 3CCJV 3N2KB 3VBBA 2ZINA 3DXRA 4X66O 4FLXA 2YICA 3K5OA 3TJTA 4YJ3B 1XDCA 1QLNA 1H2GA 4TV8A 4PV1B 4GT1A 4X62B 2Y69C 1TA8A 4JI8O 4GYCB 3M7MX 1WB8A 2FB5A 4LNUA 4CH3A 1XHXA 1HWYA 4J7JA 2MK3A 2QJ1A 1G1XB 4IIJA 1H8HG 2CDYA 4FLUA 1U96A 1YXBA 2WLJA 4LWSB 1OJHA 1VQPV 4AILC 5FLXN 3LNNA 1G4YB 5BY1A 2EZOA 3CCSV 2JDIG 1RPOA 4DUYB 4JV5O 3RYHB 1HNXO 1SKVA 4Q6GA 2D2CB 1IBKO 3G67A 3KCXA 1N0NA 4J7ZA 4DV0B 4ZI7A 3K04A 1XNRB 4GKJB 1YVWA 4TQFA 3L72H 2PF4E 3BA8A 1ZAUA 4JI0O 2CAZC 1MSDA 4TSFG 4J41A 1SQFA 4DRXB 3G71V 1H2KA 3AG3C 2Z5UA 1NZ6A 4NVPA 2ZE5A 3OMAB 4DUZB 3I5DA 4UUJC 1HNZO 2P5OA 3JCZA 3K3WA 5FPOA 1KUQA 3SR2C 2ZNJA 1SF9A 2QGNA 2HEPA 4A5UB 1I5XA 2QWRB 4JI1O 2WLIA 1AR1B 1BL8A 1KB9F 4Q20A 2CUGA 1EN4A 3JAWA 3CD6V 3K9SA 1OV9A 2DQ3A 2OTJV 2FMLA 1I08A 3HR0A 2Q68A 1VQKV 5IWAO 1JA8A 1XILA 4MVMA 1V54C 3Q4HA 1K34A 2PZSA 4EFBA 2M6YA 3CYOA 3I56V 1S5LZ 3CCEV 4JAVA 1JR9A 5GTIZ 3CJHA 3CS5A 5BZBA 5IY5C 2IJJA 1AR4A 5KX5B 4JYYA 1FXHA 1R73A 2IH1C 2RCVA 4DV4B 1L0LH 1NTKH 2B5UA 3SJQC 1S3JA 2AGAA 2K9PA 1N32O 1XEQA 4DV6B 4UVCA 3AG2C 2EIJC 1N36O 1R3LC 1Y4MA 2KSDA 3B40A 4PJ0Z 3W7TA 2ILMA 3F7YC 2WAMA 1DGSA 1QVGU 3QO5A 1QVFU 4FFBA 3B4SA 3L70H 5B1BC 4TWKA 2QTSA 3T4DA 2L35A 4DR7O 3TCUA 1UJWB 2L6LA 4KFMA 3DXRB 2UUBO 2ZCEA 4MTFA 4TV8B 4I50A 3RW0A 3X2QC 4OGQB 3A2FA 1XHZA 4B3SB 4LNUB 3STLC 4DV7B 3AG1C 3CMAV 4IIJB 3SDLA 1NR1A 4B3RB 4XDLA 4O4JA 2F4VO 2NNUA 4YY3O 3TGUH 4L8JA 2C2AA 1QLEC 4PA4A 4WCEV 2LJ2A 2UUAB 4J9YB 2IJIA 2P4VA 1PD3A 5H2FZ 1K5SA 1MZEA 3OUSA 4R8CA 2JGDA 1I0HA 2Y0PA 3WB0A 3B8MA 4K8XA 4OPAA 3CE2A 4ZI7B 2BE3A 2BTQB 4X20B 2HKOA 1BQZA 1ROPA 3K58A 3QG5A 2JVDA 3VOUA 5IYZB 3ZMSA 4QJFB 1MOFA 1VQOV 4LH6A 4DV1B 5GW7A 1Y67A 4G2KA 2F93B 3K0GA 3CXHF 3BCCH 5BR8O 1SZTA 2VWJA 4PDVA 3E35A 1WA8A 4X66B 3ETEA 4HYOA 1FPOA 1V54B 3OAAG 3HKDA 5EC2C 4JTDB 5IE9A 1SETA 3K5NA 5IJ0A 2LO1A 1H2LA 2WLIB 4KL1A 1M9NA 5IY5B 2EIMB 2E75B 1BZKA 1FYJA 3JAWB 3CXCU 4O4IA 1ZX3A 3JAMN 5D5QA 1HNXB 5KHHA 4DR6B 1RM1C 2OIEA 1IBKB 5EK0A 1X4TA 3AG2B 2EIJB 4PA9A 2Q0AA 2YIBD 3C90A 2QSAA 3AEIA 1WLEA 5EBWC 5IYBO 4JI7B 4ICGA 2CTPA 3UT5A 2CTWA 2RNBA 4ASUG 1YJWV 3D36A 1AI5A 3CJHB 2R70A 3FFQA 2Q4PA 4FM0A 2E5LB 4UV8A 3SPIA 2Z3YA 1VQ5V 5K1XA 1FXVA 2ZM6B 1AP6A 4PA7A 3X2QB 1G6UA 4F6RA 5KA5A 4TV9B 2EX3A 2WA4A 1S0VA 3ASOC 3S3WA 4JAAA 4YJ2A 4IT5A 1MSWD 3AG1B 3APQA 4I0XB 2R72A 4BIUA 1US6A 3N27A 3IC7A 1IBLO 3SYOA 2QEXV 1IXMA 3P3NA 1QLEB 4AQYB 2LQTA 3LDDA 2F23A 1SA0B 1S5JA 4FFBB 2WA3A 3C3TA 2ZXWC 1Y66A 1NVPB 2A9HA 3AK2A 5KA6A 3PN1A 3D36C 2PUSA 2HVJC 2PI5A 4GX1A 4F4LA 4FPPA 3ABTA 3B77A 1K4DC 2CH7B 2W0XA 5E79Z 3CWBH 3ML0A 3E8HA 4N23A 3CSXA 1KP2A 1NT2B 1FAFA 2XNDG 3JAKA 2HHHB 1NJIW 4I50B 3KG2A 3K9AA 1YTFB 1DLBA 3E86A 4CS4A 1ZL8B 2JS5A 3JCUZ 2P6JA 2ZD9A 4LFBO 1GKFA 5BMVA 3KKYA 5L3EA 2DN9A 1RPRA 1WPXA 1AB3A 3JARA 2D3OW 1IBMO 2PY5A 2H8PC 4I55A 4O4JB 2WLLA 3OMNB 3CC2V 2DJVA 3OGCC 1IX9A 4CC5A 1GN2A 4O2BA 5L3GA 4K0KO 1L8DA 1ZWIC 1I94O 3M99B 2HR3A 2LFSA 4OX9O 2YI9A 4DR3O 4DR5O 1N32B 4GZRB 3DC5A 3SYAA 2XT9A 2CTRA 2AXTZ 5LXTA 4BAYA 5JVDA 4JI5O 5DEDA 1AVMA 4D7SA 5KHGA 2CGOA 1K8AW 5B3SC 4EB6A 1VMGA 5K1PA 3GWKC 3OE7G 2Q5ZA 3L9DA 1W59A 1M90W 4DR7B 3N2GA 4QE7A 2GTSA 1WA8B 1BHBA 3SYPA 2OCCC 1JJ2U 3JYCA 1VP7A 2H94A 3HKDB 4ZOLB 2ZR2A 3T1YB 1RP3B 4WFHA 3UO3A 2LW7A 3E8FA 4PDMA 4OPHA 1GM7A 4E4EA 2NN4A 5IJ0B 3ZN0A 4RAIA 5DN6G 2UXXA 2F4VB 4B3TB 3K79A 2EJ7A 2OT5A 1I7FA 4QIWF 1Q8IA 4O4IB 5JQGA 1DTOA 1F4MA 4XDKA 3T4ZA 3ASOB 2DYSC 1OCOC 3JD0A 1NQTA 3WG7C 1K5QA 1ENVA 1OZ0A 2ITCC 3QVNA 3SPGA 5GTHZ 5EYPA 2P67A 4ZHQA 5LP6B 1ZLZA 3BPZA 3LDEA 2RMKB 4Z1VA 2GV9A 2KG7B 1N34O 2GUZA 3FB7C 3SGIA 3MD0A
chains in the Genus database with same CATH topology
3JCZA 3K3WA 2BOBC 2HG5C 2LFRA 1ORQC 2DWDC 3E83A 4GCZA 4JF3A 2R9IA 2IJHA 1NVPD 4H37A 5CA3A 1I5XA 2IW5A 2WLIA 5EBMC 1AR1B 3E8BA 5E1AC 4MVSA 5LHHA 1BL8A 1J95A 5CN0A 3K08A 1W0KG 2QM8A 3GWOA 3ZRXA 4Q20A 1KD1W 5HFMA 1JQ0A 3QO8A 2JEXA 5H6RA 3OEHG 3ZRWA 4JTCB 1NBMG 2QTOA 1YTFD 5LHIA 1F23A 2XAHA 4FIPC 3CD6V 2F43G 4N21A 2DQ3A 2QM7A 3CP1A 2OTJV 2BOCC 3T2MA 4JTAB 3BEHA 1QCEA 1V55B 2Q68A 4QPKA 1VQKV 1E1RG 1OCRB 5LGNA 2ZQMA 1AROP 1M1KW 1GMGA 4MVMA 1YSCA 1V54C 1K3EA 3ZMVA 3OW2U 2EBOA 1K34A 1YIJV 3QNEA 2X6CA 3CYOA 3I56V 2WLHA 2JK5C 4LC1A 4X89A 4XBFA 1AI4A 3CCEV 4JAVA 2EINB 2V7QG 4LCUC 5B3SB 1XL6A 1OCCC 3ABKC 4P2ZA 4LBEC 4GX2A 3PJSK 2XASA 1FXKB 5BZBA 5IY5C 1RM1B 3GB7C 1THZA 2IJJA 3OR6C 4WFEA 3CCRV 4U7OA 2ZDIA 1W2BU 1W0JG 2R9RB 3ZCCA 2OTLV 5EBLC 4R6ZA 1YI2V 4J9ZB 1CEZA 2OCCB 4PA6A 2WLLB 1FXHA 2QA4V 2ZR3A 4JPRA 1Q81W 1R73A 2IH1C 1VQ7V 2W6JG 2B5UA 3SJQC 1S3JA 2IU0A 2GSMB 4MS2A 3K03A 2KB1A 2Q69A 1M57C 2WLNA 4UVCA 3AG2C 4UVAA 2EIJC 5HFLA 1JOYA 1R3LC 1Y4MA 4G28B 3CC4V 4MVUA 3CCMV 2CK3G 2EZPA 4CBCA 1QBZA 4TT3G 5LGTA 2Q67A 1AI7A 2YEVB 3W7TA 3F7YC 2WAMA 1QVFU 1NR7A 3QO5A 4JGSA 1QVGU 1R3IC 3FB6C 2AHYA 5B1BC 3CC7V 3E8GA 3OM3B 3T1CA 4RQEA 1S72V 1BHAA 1F4NA 2XAFA 4TWKA 1JX9A 3MHHC 2WLKA 2JIZG 3T4DA 4QNHB 2DYSB 3TCUA 3SYCA 1OCOB 1KQSU 1UJWB 2EIKC 4KFMA 3WG7B 1DF4A 1JCHA 4WFAV 4UXNA 2A0LA 2ZDIC 3SYQA 2XOKG 5IYDO 3BY6A 3ABLC 3JD4A 3F5WC 1OCZC 1FS0G 4MTFA 5H6QA 4E2LA 3X2QC 3RW0A 3I55V 1VQ4V 2QE7G 3B8NA 3ZJZA 4MTGA 2DYRC 2ZXWB 3DTUB 1Q7YW 3STLC 3ABMC 3AG1C 3CMAV 5DM6V 3W7SA 1NR1A 4XDLA 1AJQA 1JVMA 2EJRA 5LBQA 2NNUA 3CPWU 3ASNC 3CCLV 4MTOA 2C2AA 1QLEC 3K06A 4FK5C 4PA4A 3ZMTA 3A0RA 4WCEV 1VQNV 3ETDA 4J9YB 2IJIA 4KUMA 1PD3A 2W6IG 3FYEB 3HB3B 3LSSA 1K5SA 3QO7A 5CBFA 3F7VC 4U7NA 3RBZA 4JAUA 3FKSG 3OUSA 4R8CA 1AI6A 3B8MA 2X7RB 4I5SA 1OHHG 4HZ3A 1CP9A 5B1AC 1YHQV 3MHSC 1N8RW 2HKOA 5B1OA 1ROPA 1VQLV 2ATKC 3VOUA 1VQOV 3ZMSA 4QJFB 1MOFA 5J9PC 1AJPA 5GW7A 5KUKA 2B1IA 4G2KA 3CMEV 3K0GA 5L3BA 1KC8W 1SZTA 4PDVA 3UM7A 3ABUA 3E35A 4Z1MG 3ETEA 3P30A 2UXNA 2AHZA 3IFXA 4HYOA 4QPJA 1V54B 1R6KA 2JJ2G 3OAAG 3NXSA 4JYCA 4P30A 5EC2C 4DXWA 4JTDB 1H8EG 2DQ0A 1M56C 3JD2A 2QKSA 3W7WA 4MW8A 1SETA 1AJNA 1SERA 1K97A 5FL7G 1LNQA 3STZC 1OCCB 1V55C 3ABKB 2WLIB 2XAJA 4PDRA 4BW5A 1OCRC 1M9NA 3SPHA 5IY5B 1K4CC 1R3KC 2K1EA 2EIMB 3FB8C 3ZRVA 2YEVA 3ZMZA 1PNMA 4RUEA 3ZRWB 4OXSA 5C93A 2Q6AA 4HAMA 1EZJA 5L3CA 2Y69B 4YXWG 3CXCU 1KP3A 3LSQA 4PA3A 3OUFA 2WWWA 4FMTA 3EHBB 3H01A 5CBGA 1RM1C 1M57B 5EK0A 4BIZA 3AG2B 2EIJB 4PA9A 4MVRA 1GK9A 3AG4C 1P7BA 2X0LA 3AEIA 1WLEA 5EBWC 5IYBO 1PNLA 4MVZA 1JPXA 1P4RA 2JJ1G 4UVBA 4ASUG 3W7UA 1YJ9V 1YJWV 2V1DA 1GO3F 3D36A 1AI5A 3LUTB 3D3IA 4P9OA 4UV8A 3SPIA 2Z3YA 1VQ5V 2EIKB 4KP4A 5LGUA 4PDLA 1KKDA 2Y48A 1FXVA 3ABLB 1OCZB 1VQ8V 4PA7A 3HPLC 1K73W 2IH3C 3X2QB 4XDJA 4JYBA 5KA5A 2WSSG 2IJKA 1I5YA 3WFVA 2HLDG 1S0VA 5L3FA 2DYRB 3ASOC 1VQ6V 3CCQV 3AG3B 1PNKA 1EFRG 3E89A 3ETGA 3G6EV 3ABMB 3AG1B 1MSWD 4RUFA 4ZBMA 4BIUA 5B1NA 1K33A 3OFNG 2XAQA 4GX0A 1Q82W 2M7WA 1DF5A 3IC7A 1F51A 1PKXA 3SYOA 1EBOA 5CMUA 1YITV 3ASNB 1NH2B 2QEXV 1IXMA 5EC1C 1R6NA 1QLEB 3SPJA 1H38A 3OEEG 1SESA 1MABG 3LDDA 2EILC 5KUMA 4CZZA 2DWEC 2ZXWC 1Y66A 3FYIB 4FJCC 2A9HA 1QR8A 1NVPB 5KA6A 4MT8A 1KECA 2LP7A 2HVJC 3CCUV 1G8MA 2XAGA 2PI5A 2HJFC 4GX1A 4F4LA 4GX5A 4L87A 1NH2D 2JEUA 3ABTA 4FPPA 5B1AB 3B77A 2ITDC 3LNMB 1L1FA 1K4DC 3ZMUA 2FTKA 1K7DA 3ML0A 4UV9A 3E8HA 4N23A 1E79G 1CPYA 3G4SV 1KP2A 4R7CA 2XNDG 3R65A 3RVZA 4RO2A 1NJIW 3KG2A 3ZRSA 4I9WA 5H9CA 3K9AA 1YTFB 1DLBA 3E86A 1FXKA 2P6JA 2ZD9A 1XL4A 1GKFA 1MG1A 5L3EA 2GHYA 4X8AA 2HFEC 1RPRA 1WPXA 4R50A 1SRYA 2D3OW 4EKWA 2H8PC 3DGEA 3OR7C 2WLLA 3OMNB 3CC2V 5CBHA 3OGCC 5L3GA 3W7XA 4WFGA 1QR9A 2WLMA 2PI4A 1M56B 1ZWIC 3M99B 2HR3A 1B6QA 1COWG 2LFSA 1S76D 3UKMA 3OMIB 1VQMV 1R3JC 3SYAA 1YJNV 4WF9V 4QE9A 3SPCA 4BAYA 1GM8A 4ZKIA 1S5HC 1NKDA 2B1GA 2WPDG 2X6BA 3IGAC 4X88A 3EFFK 2IU3A 4G27B 4MVOA 3K0DA 4MTXA 2EINC 5B3SC 1K8AW 3E2EA 1FXKC 3CCJV 3OE7G 3VBBA 1M90W 4QE7A 4MSWC 2EIMC 4MVQA 3AG4B 1QLNA 1BHBA 1H2GA 2HVKC 2OCCC 3SYPA 3ZIAG 1JJ2U 4GT1A 3JYCA 4WFBV 1E1QG 2H94A 2Y69C 2ZR2A 3FB5C 5IDJA 4WFHA 1BMFG 5B1BB 4WFFA 3E8FA 4RQFA 1HWYA 4PDMA 1GM7A 1Q86W 3LDCA 2MK3A 4P9PA 5IYCO 1VQ9V 3ZN0A 1K9MW 1H8HG 4LP8A 3P32A 2WLJA 3TETA 4RAIA 5DN6G 2UXXA 1VQPV 1G4YB 3ZN1A 2EZOA 3K79A 3CCSV 2OT5A 1GM9A 4QIWF 2JDIG 1RPOA 2P7TC 2W0FC 1DTOA 1F4MA 2YSUB 1PL0A 4XDKA 4H33A 3T4ZA 3ASOB 2DYSC 5LHGA 1OCOC 3JD0A 1NQTA 3WG7C 1K5QA 3K04A 1ENVA 1OZ0A 2ITCC 2DW4A 1K92A 1FFTB 1S77D 4JASA 3SPGA 4MW3A 5L3DA 3JD3A 2P67A 2P90A 4TSFG 2EILB 3G71V 2NLJC 3LDEA 2X6AA 1TUEB 3AG3C 3TK1A 2Z5UA 3RVYA 1GTOA 3JD1A 4PELA 4DO2A 3CCVV 3FB7C 3OMAB 3MD0A 4UUJC 2A79B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A W;  1KQS U;  3CD6 V;  3CCE V;  1K9M W;  1Q82 W;  1VQ5 V;  3CPW U;  1VQL V;  4WFA V;  3CCL V;  3G4S V;  2OTJ V;  1VQO V;  4WCE V;  1YIT V;  3CCJ V;  1NJI W;  2QEX V;  1VQN V;  1M90 W;  3CC4 V;  3CCM V;  1VQP V;  3CCR V;  1VQK V;  1VQM V;  1W2B U;  1VQ8 V;  3I55 V;  1VQ4 V;  3CME V;  2OTL V;  1M1K W;  1K73 W;  1YJN V;  3CCS V;  1KC8 W;  4WF9 V;  3G71 V;  1YI2 V;  1QVG U;  1JJ2 U;  1QVF U;  4WFB V;  1S72 V;  3CCU V;  2QA4 V;  3CC7 V;  2D3O W;  3OW2 U;  1Q81 W;  1KD1 W;  1R73 A;  1YIJ V;  1Q7Y W;  1VQ6 V;  3CCQ V;  3CXC U;  5DM6 V;  3I56 V;  3CMA V;  3G6E V;  3CCV V;  1VQ7 V;  1YHQ V;  1YJ9 V;  1YJW V;  3CC2 V;  1N8R W;  1Q86 W;  1VQ9 V; 
#chains in the Genus database with same CATH topology
 2HG5 C;  3E83 A;  3VQY A;  1WB7 A;  5JH7 A;  2IJH A;  3JAS A;  3UQ8 A;  5EBM C;  3E8B A;  1XMQ O;  4MVS A;  5KHK A;  1J95 A;  4YJ2 B;  1W0K G;  5H6R A;  4JTC B;  2QTO A;  2YUA A;  1FFX A;  2XAH A;  2F43 G;  2QM7 A;  3CP1 A;  3R66 A;  1MNG A;  3T2M A;  3D8C A;  4JTA B;  1QCE A;  1EZV H;  4QPK A;  1HP8 A;  1IVS A;  4FM1 A;  1ARO P;  1M1K W;  3OW2 U;  2EBO A;  1FJG O;  4LC1 A;  4XBF A;  1AI4 A;  1WP7 A;  2P06 A;  1M5I A;  5B3S B;  1XL6 A;  1JJO A;  1OCC C;  4UCV A;  4LBE C;  3PJS K;  2XAS A;  1Q3E A;  4JI4 B;  1KBH A;  4WFE A;  4U7O A;  1URF A;  1Y74 A;  1W2B U;  1W0J G;  2R9R B;  2OTL V;  3JAR B;  4KXR A;  3SJB C;  2OCC B;  4PA6 A;  2WLL B;  4U3J A;  4O2B B;  1VQ7 V;  2W6J G;  2IU0 A;  2Z0A A;  4MS2 A;  3K03 A;  1M57 C;  1PM9 A;  3A0H Z;  1XQ8 A;  5JJJ B;  4G28 B;  1BCC H;  2CK3 G;  3FAV B;  1MMM A;  5LXT B;  3T1H B;  2YEV B;  1EN6 A;  3G80 A;  3CB2 A;  2OYQ A;  3RYF A;  1NR7 A;  4JGS A;  5FNV A;  1R3I C;  3FB6 C;  1SQP H;  3E8G A;  2F1M A;  1F4N A;  3RYI A;  2XAF A;  1BT8 A;  1JX9 A;  2ZT9 B;  1SS3 A;  2JIZ G;  3E22 A;  2DYS B;  1OCO B;  2LGW A;  3OTO B;  3B09 A;  3WG7 B;  5LMN O;  3N2G B;  3BA9 A;  2A0L A;  3K5L A;  5IYD O;  3ABL C;  5J2U A;  1OCZ C;  3K57 A;  2QE7 G;  2KKW A;  2PTM A;  3B8N A;  1O9G A;  3DTU B;  1Q7Y W;  1VIB A;  1Y76 A;  2EJR A;  1IBM B;  3BAB A;  3CCL V;  1XUQ A;  3A0R A;  3ETD A;  1Q90 D;  1IUR A;  1VF6 A;  4KUM A;  3LSS A;  1LR1 A;  1O9H A;  5JQG B;  5KHJ A;  5J2T B;  1AI6 A;  4LFA O;  3L74 H;  4I5S A;  5B1A C;  2ZE7 A;  2ZE8 A;  5KAF Z;  3TXQ A;  1N8R W;  4JI5 B;  1QQC A;  2IBZ H;  5AG2 A;  1MA1 A;  4O4L A;  1GN6 A;  5J9P C;  2GBO A;  2YXL A;  2UXD B;  5KUK A;  5D5P A;  2B1I A;  1FD9 A;  3H1H H;  5L3B A;  4DR2 B;  2GUZ B;  1HR0 B;  4LF7 B;  1R6K A;  2JJ2 G;  4LF4 O;  4DXW A;  1WPB A;  2DQ0 A;  1TVK A;  5JH7 B;  1M56 C;  3JD2 A;  3W7W A;  1VF6 C;  1AJN A;  1LNQ A;  1OCC B;  1V55 C;  4BW5 A;  1OCR C;  3SPH A;  4WBN A;  1K4C C;  4LF9 O;  3VQW A;  3FB8 C;  3ZRV A;  4LFC O;  4UCU A;  3ZMZ A;  2YXY A;  4OXS A;  1Q43 A;  1QNM A;  2Q6A A;  3RYC B;  5L3C A;  2Y69 B;  2UXC B;  3BRC A;  4DV3 B;  1KP3 A;  3LSQ A;  3H01 A;  1M57 B;  5EZY B;  4CS3 A;  2ZKO A;  4O4H A;  1PV0 A;  2B9Z A;  5BXZ A;  4JI6 B;  2GTA A;  1ZSP A;  1PNL A;  1JPX A;  1P4R A;  2JJ1 G;  3W7U A;  4X65 O;  3CRM A;  1YZB A;  4ABM A;  4P9O A;  3IC9 A;  1GN3 A;  4PDL A;  3JSN A;  1XNQ O;  3ABL B;  1OCZ B;  3HPL C;  1K73 W;  4NXM B;  4U3J B;  2WSS G;  1I5Y A;  5KMG A;  2HLD G;  1SQV H;  3CCQ V;  4TUY A;  3AG3 B;  2A06 H;  1XMQ B;  3ETG A;  4ZBM A;  1K33 A;  3P3P A;  1SQG A;  1DF5 A;  4X1I A;  1PP9 H;  2QKA A;  3BFR A;  4FZ1 A;  3ZHR A;  1NH2 B;  1R6N A;  3OEE G;  1XOU A;  3RYF B;  1MAB G;  3WB1 A;  2EIL C;  5KUM A;  4CZZ A;  1HDJ A;  5LMU B;  3RYI B;  3CHX A;  4MT8 A;  2LP7 A;  1XMO B;  2HJF C;  4GX5 A;  1NH2 D;  2JEU A;  5B1A B;  4FLT A;  4KHP B;  3LNM B;  2XTA A;  2N04 A;  4W4L A;  2UUC B;  4DR4 B;  3UCS C;  1E79 G;  4UCR A;  1FJG B;  1D2D A;  3RVZ A;  4RO2 A;  3ZRS A;  5H9C A;  2FL4 A;  1FXK A;  3QTC A;  4X8A A;  1SRY A;  3DGE A;  3OR7 C;  1Y76 B;  4IYI A;  1BSM A;  2CTQ A;  4WFG A;  1QR9 A;  2WLM A;  4JYA O;  1M56 B;  4JI8 B;  2Y0I A;  2Q8V A;  5EIB C;  1B06 A;  1D5A A;  1WAZ A;  3AK3 A;  4JZ2 A;  2RN9 A;  4U3F H;  4QE9 A;  1J5E O;  2B1G A;  2WPD G;  2X6B A;  3THO A;  3MDS A;  5B66 Z;  3EFF K;  4O4L B;  4JV5 B;  3E2E A;  1FXK C;  3G6B A;  3H9V A;  4IL6 Z;  4X64 O;  1WJZ A;  2HVK C;  1M93 A;  3Q4H B;  4WFB V;  4F6E A;  2QR4 A;  4I4T A;  4FVM A;  3FB5 C;  5IDJ A;  4JI0 B;  1TVK B;  1BMF G;  5B1B B;  4RQF A;  1Q86 W;  4P9P A;  1GRJ A;  3APO A;  3GVM A;  4LF8 O;  1HNZ B;  3A0B Z;  3ZN1 A;  2LGQ A;  1GM9 A;  4I7Z B;  2W0F C;  4JI1 B;  1PL0 A;  4H33 A;  2ZIO A;  5LHG A;  4CC6 A;  1NS1 A;  1R1B A;  2DW4 A;  5IT9 N;  1K92 A;  1FFT B;  3WU2 Z;  3JAT A;  4PI0 A;  3ZHU A;  4O4H B;  4X62 O;  4MW3 A;  3ZHV A;  5B5E Z;  1BQ0 A;  2QDO A;  2EIL B;  2NLJ C;  2X6A A;  1TUE B;  3TK1 A;  2R9A A;  3RVY A;  5IWA B;  1GTO A;  4PEL A;  4DO2 A;  3CCV V;  1BS3 A;  2A79 B;  2BOB C;  3F5T A;  1ORQ C;  2DWD C;  4QGP A;  4X1Y A;  2E76 B;  1NVP D;  4H37 A;  5CA3 A;  4DUY O;  4JI2 O;  3ZHS A;  2IW5 A;  2Q9L A;  5E1A C;  5KMG B;  4DV0 O;  3H1I H;  2VWK A;  3QF7 A;  2Q7E A;  4JZG A;  3K08 A;  2QM8 A;  2JEX A;  3OEH G;  3S3X A;  4LFC B;  2QWN B;  1YTF D;  3EXA A;  4IHJ A;  4DK1 A;  4N21 A;  1Z5W A;  3CRC A;  1NTZ H;  2Q73 A;  4TOI A;  3HKE A;  3BEH A;  3N2K A;  5TIS Z;  1TUB A;  2ZQM A;  1NU1 H;  2JGD B;  4DUZ O;  2AZ0 A;  4YJ3 A;  3LSU A;  5IJ9 A;  4UCT A;  1YSC A;  2ZIM A;  5LL6 Y;  1N36 B;  3ZMV A;  1YIJ V;  3QNE A;  5KLV H;  2WLH A;  2JK5 C;  4J11 A;  3J7A U;  2V7Q G;  4LCU C;  4B7E A;  4P2Z A;  1FXK B;  1RM1 B;  1THZ A;  3OR6 C;  3CCR V;  2ZDI A;  3ZCC A;  2UUB B;  4IGG A;  5EBL C;  4R6Z A;  4J9Z B;  1CEZ A;  1XNQ B;  2QA4 V;  1XRE A;  4JPR A;  1Q81 W;  3JSL A;  1AP5 A;  4H13 B;  1TAE A;  2GSM B;  1Q5O A;  2UU9 O;  1KYO F;  2Q0O C;  4YIO A;  3ZS8 C;  2Q69 A;  1ZTE A;  2WLN A;  3B2E E;  4UVA A;  5HFL A;  3WB2 A;  3CC4 V;  4MVU A;  3RWR D;  1QBZ A;  4BW9 A;  1UFI A;  4TT3 G;  4HNA A;  2Q67 A;  1AI7 A;  4YY3 B;  2H3O A;  4PD4 F;  2AHY A;  2JRI A;  3CC7 V;  3CRA A;  4RQE A;  2ETN A;  1B04 A;  3MHH C;  2WLK A;  4DV2 O;  4QNH B;  3BHP A;  3SYC A;  2EIK C;  1DF4 A;  1JCH A;  4UXN A;  2ZDI C;  2RJZ A;  3SYQ A;  2VQE O;  2XOK G;  3BY6 A;  3VQX A;  4B7K A;  3F5W C;  4E2L A;  4DV4 O;  4I4T B;  4K3A A;  2QM4 A;  1VQ4 V;  2YDE A;  3DSQ A;  4NTY A;  3ZJZ A;  3UT5 B;  2DYR C;  5CA1 A;  2ZXW B;  4DV6 O;  2ADQ B;  3OTF A;  1N0J A;  4X9Q A;  5BR8 B;  5LBQ A;  3M8A A;  3K06 A;  3ZMT A;  1VQN V;  4YHH O;  4JYA B;  4F6R B;  2W6I G;  3QO7 A;  1JFF A;  5CBF A;  3F7V C;  2E74 B;  4W4K A;  3L75 H;  1SQQ H;  2F95 B;  1CP9 A;  1YHQ V;  3CRQ A;  2VS0 A;  2GDS A;  3JAT B;  5B1O A;  1J5E B;  4AI8 A;  2LW1 A;  1YF2 A;  3BVO A;  3JAL A;  4DV7 O;  4CH4 A;  2A7W A;  3CME V;  4B3R O;  5KX5 A;  4Z1M G;  2YI8 A;  3P30 A;  2UXN A;  2AHZ A;  4QPJ A;  2MW2 B;  4FM2 A;  4JYC A;  4P30 A;  1WN7 A;  4X1Y B;  1H8E G;  5LA6 A;  2QKS A;  4MW8 A;  3JAK B;  1SER A;  5JWP A;  3STZ C;  1SZX A;  3ZHT A;  5BMV B;  1P7G A;  2K1E A;  1HNW O;  4RUE A;  4FLW A;  4I55 B;  5C93 A;  3C3S A;  4IHJ B;  1EZJ A;  4IYH A;  4DV1 O;  5C8Y A;  4UCO A;  2EUL A;  4PA3 A;  3HKE B;  3OUF A;  4J10 A;  3EHB B;  1XBL A;  2XHB A;  5CBG A;  4FLV A;  1LUV A;  1TUB B;  4FLZ A;  4MVR A;  1GK9 A;  3AG4 C;  5IJ9 B;  1YDX A;  1P7B A;  2X0L A;  5JVD B;  1IBL B;  1A32 A;  4B3M O;  4DW0 A;  3OGI B;  4DW1 A;  4UVB A;  3ETQ A;  2V1D A;  4EB6 B;  3LUT B;  3RN4 A;  3FD9 A;  2V4D A;  2EIK B;  1ZUQ A;  5LGU A;  1KMI Z;  3DC6 A;  4LF6 O;  2FYU H;  4JYB A;  4XDJ A;  3WFV A;  4UCS A;  4JI2 B;  5A9G A;  4DR6 O;  5L3F A;  2DYR B;  1EFR G;  4LFB B;  2BTQ A;  4X20 A;  1X59 A;  3EVK A;  2XAQ A;  4GX0 A;  1Q82 W;  3CX5 F;  4HNA B;  5IYZ A;  4JI7 O;  1H38 A;  1SES A;  1CXZ B;  1SQB H;  4K0K B;  1I94 B;  2DWE C;  1MZF A;  3FYI B;  4FJC C;  1QR8 A;  2E5L O;  3CCU V;  4OX9 B;  1G8M A;  2XAG A;  4DR3 B;  4L87 A;  4DR5 B;  1N33 O;  2ITD C;  3UO2 A;  3ZX6 A;  2ZM6 O;  4UV9 A;  3G4S V;  3R65 A;  3BAA A;  1T5E A;  5EYP B;  4ZHQ B;  4NTX A;  1KKC A;  5CA1 B;  1EN5 A;  1XL4 A;  1MG1 A;  2GHY A;  4NB5 A;  4R50 A;  4NXN O;  4H44 B;  3J81 N;  3K59 A;  2OWO A;  5CBH A;  4AQY O;  3RGB A;  3W7X A;  3O9O A;  2YIB A;  2RQ6 A;  4BWA A;  4CH5 A;  1Z5V A;  1B6Q A;  1COW G;  3JAS B;  1JFF B;  3H1J H;  2UU9 B;  3OMI B;  2HP8 A;  3SJA C;  1VQM V;  1YJN V;  2QWP B;  4WF9 V;  2OCH A;  3SPC A;  5DEC A;  1NKD A;  4AHC A;  4J80 A;  2YID A;  2VRZ A;  2HHH O;  1FFX B;  1N4C A;  2IU3 A;  4G27 B;  4MTX A;  2EIN C;  3JAL B;  4DV2 B;  3MAQ A;  4GUN A;  2EIM C;  4MSW C;  1PPJ H;  2YIA A;  4MVQ A;  3AG4 B;  4EEQ A;  4PHZ A;  4LH7 A;  4HBN A;  3ZIA G;  2VQE B;  4C7U A;  1E1Q G;  4TV9 A;  2DOS A;  4WFF A;  5LA6 B;  3SJC C;  4TQD A;  1U97 A;  3NR7 A;  5CA0 A;  3LDC A;  5IYC O;  1VQ9 V;  4K35 A;  1IDS A;  1K9M W;  4I0X A;  4DV5 O;  4LP8 A;  1V9P A;  3P32 A;  3TET A;  1N34 B;  1Y74 B;  4LR3 A;  2VQF O;  1YCI A;  4CH6 A;  5JCO A;  4LF5 O;  5KAI Z;  1SA0 A;  4FFK A;  2ODM A;  4YHH B;  2P7T C;  2KQX A;  2YSU B;  5C8Y B;  1NI8 A;  1SQX H;  3AK1 A;  4GLX A;  1F7Y A;  5ITZ A;  2CH7 A;  3FX7 A;  1S77 D;  1UPG A;  3IAY A;  2YXH A;  4JAS A;  3T1Y O;  5L3D A;  3JD3 A;  1GN4 A;  2P90 A;  3L73 H;  5FNV B;  3A8T A;  1ZL8 A;  3L71 H;  4PI2 A;  3E22 B;  2ARH A;  3JD1 A;  3OT7 A;  1P49 A;  4EFE A;  3J80 N;  4B3T O;  2LFR A;  2P4K A;  4JF3 A;  4GCZ A;  2PGG A;  2N05 A;  2R9I A;  5JCO C;  5J2U B;  2AW9 A;  4RWU A;  4JI3 O;  4J42 A;  1Q6H A;  2Q7H A;  3RFR A;  4X1K A;  5LHH A;  4DR1 O;  1QU7 A;  5CN0 A;  4NKG B;  3GWO A;  1XI1 A;  3ZRX A;  1KD1 W;  5HFM A;  1JQ0 A;  3QO8 A;  3ZRW A;  1NBM G;  2QKC A;  1RFY A;  1HNW B;  4BR6 A;  2CGN A;  2UXB O;  5LHI A;  3CEI A;  1F23 A;  4FIP C;  2Y4T A;  2BOC C;  3TXS A;  1V55 B;  1E1R G;  1OCR B;  5LGN A;  5LOV A;  1BE3 H;  1VAR A;  1WNS A;  2ZE6 A;  4NTW A;  1GMG A;  1TGO A;  1K3E A;  5GON A;  2IM9 A;  4ZOL A;  2X6C A;  4YIP A;  4X89 A;  5H5N A;  4B3M B;  5KHI A;  2JGU A;  2EIN B;  3ABK C;  2JS3 A;  4GX2 A;  2RDC A;  1JMK C;  3GB7 C;  5LYJ A;  1D5N A;  5LMN B;  1YI2 V;  3OD4 A;  3ZBH A;  2ZR3 A;  1NTM H;  4LF6 B;  1RSO A;  4GKK O;  1B3Q A;  2P22 C;  3HKB A;  2KB1 A;  2AZ2 A;  3AG7 A;  1JOY A;  4WBN B;  3CCM V;  2EZP A;  4CBC A;  5LGT A;  5CB4 A;  2BTO A;  5LP6 A;  1P84 F;  1S72 V;  3OM3 B;  3T1C A;  1IXB A;  1BHA A;  2CE4 A;  2KG7 A;  1M4U A;  4JI4 O;  1KQS U;  2E3C A;  4LFA B;  4WFA V;  1N33 B;  1Y6X A;  2BCC H;  3JD4 A;  1FS0 G;  5H6Q A;  3I55 V;  1VF5 B;  1Q6I A;  2BSK A;  4MTG A;  4O2A A;  3KCY A;  5CA0 B;  3ABM C;  5DM6 V;  4NR1 A;  3W7S A;  3VQV A;  1AJQ A;  1JVM A;  4NXN B;  3T1H O;  1R6T A;  4K8Z A;  3CPW U;  3ASN C;  4MTO A;  4LF4 B;  4FK5 C;  5LP6 C;  3HB3 B;  3FYE B;  4U7N A;  3RBZ A;  3U10 A;  4JAU A;  3FKS G;  3OTO O;  3HKC A;  1XNR O;  4TUY B;  4GKJ O;  2X7R B;  1OHH G;  4HZ3 A;  4LF9 B;  5ITZ B;  3MHS C;  1SC5 B;  4X1I B;  4UB6 Z;  4I9Q A;  1VQL V;  2ATK C;  1AJP A;  2Y4U A;  1KC8 W;  3ZHQ A;  3UM7 A;  3ABU A;  3IFX A;  2OIG A;  4DYL A;  3NXS A;  5EIB D;  4D7T A;  1LUW A;  1Z2G A;  4BIO A;  1K97 A;  5FL7 G;  4X65 B;  5JJE B;  5A2Q N;  3ABK B;  2XAJ A;  4PDR A;  4X1K B;  4LWS A;  2PYL A;  4DV5 B;  4H0L B;  4Z2W A;  1R3K C;  3FAV A;  2YEV A;  1PNM A;  3ZRW B;  2VQF B;  1EM1 A;  4HAM A;  4LF5 B;  4YXW G;  3RYH A;  2UXD O;  1H2N A;  4FMT A;  2WWW A;  3K5M A;  4DR2 O;  1DK1 A;  4BIZ A;  1HR0 O;  4FZ0 A;  4LF7 O;  5LOV B;  1GAX A;  1Q6U A;  3ZED A;  1L0N H;  5GON B;  2A3Q A;  3U11 A;  2HJD A;  3D3Q A;  4DRX A;  4MVZ A;  4UB8 Z;  1YJ9 V;  1GO3 F;  3H1K H;  3D3I A;  5JJN B;  3O65 A;  2NR5 A;  4KP4 A;  5LYJ B;  5FPR A;  4DK0 A;  5F2V O;  1KKD A;  1BGY H;  2Y48 A;  2N74 A;  1VQ8 V;  2UXC O;  2IH3 C;  4DV3 O;  2ADP A;  2IJK A;  1RSO B;  1YEW A;  4JI3 B;  1VEW A;  4FLY A;  5J2T A;  1VF7 A;  1VQ6 V;  3HKB B;  1PNK A;  3G6E V;  3E89 A;  3ABM B;  4RUF A;  4DR1 B;  5B1N A;  3OFN G;  2F66 C;  2QWO B;  2M7W A;  1F51 A;  1PKX A;  4JI6 O;  1EBO A;  3ICX A;  5CMU A;  3ASN B;  5CB4 B;  1YIT V;  3SPJ A;  5EC1 C;  1H2S B;  2UXB B;  2QWQ B;  2Q7G A;  1PL4 A;  1KEC A;  2YC0 A;  1L1F A;  4NYK A;  3ZMU A;  2FTK A;  1K7D A;  1CPY A;  3RT3 C;  4NXM O;  4R7C A;  4B3S O;  3H1L H;  2DE0 X;  1IZ3 A;  4I9W A;  2YS8 A;  1KU9 A;  4UFZ A;  2FKX A;  2BSK B;  4J7K A;  4O2A B;  1AR5 A;  4D6T H;  2HFE C;  1HW7 A;  2ZNI A;  4EKW A;  1GH6 A;  1AIL A;  2G38 A;  4X64 B;  3RYC A;  2UUA O;  1QHT A;  2PI4 A;  4B08 A;  5LMU O;  2O57 A;  4GKK B;  1S76 D;  5EZY A;  3UKM A;  4ZIB A;  1XMO O;  2DMX A;  3U0Z A;  1FKA O;  3HKC B;  1R3J C;  4KHP O;  1H2M A;  4DR4 O;  1GM8 A;  3KZI Z;  4ZKI A;  2UUC O;  1S5H C;  2PYJ A;  4LF8 B;  3CRR A;  4CS2 A;  3IGA C;  4X88 A;  4MVO A;  1WP8 A;  3K0D A;  2XUM A;  3IJ4 A;  3CCJ V;  3N2K B;  3VBB A;  2ZIN A;  3DXR A;  4X66 O;  4FLX A;  2YIC A;  3K5O A;  3TJT A;  4YJ3 B;  1XDC A;  1QLN A;  1H2G A;  4TV8 A;  4PV1 B;  4GT1 A;  4X62 B;  2Y69 C;  1TA8 A;  4JI8 O;  4GYC B;  3M7M X;  1WB8 A;  2FB5 A;  4LNU A;  4CH3 A;  1XHX A;  1HWY A;  4J7J A;  2MK3 A;  2QJ1 A;  1G1X B;  4IIJ A;  1H8H G;  2CDY A;  4FLU A;  1U96 A;  1YXB A;  2WLJ A;  4LWS B;  1OJH A;  1VQP V;  4AIL C;  5FLX N;  3LNN A;  1G4Y B;  5BY1 A;  2EZO A;  3CCS V;  2JDI G;  1RPO A;  4DUY B;  4JV5 O;  3RYH B;  1HNX O;  1SKV A;  4Q6G A;  2D2C B;  1IBK O;  3G67 A;  3KCX A;  1N0N A;  4J7Z A;  4DV0 B;  4ZI7 A;  3K04 A;  1XNR B;  4GKJ B;  1YVW A;  4TQF A;  3L72 H;  2PF4 E;  3BA8 A;  1ZAU A;  4JI0 O;  2CAZ C;  1MSD A;  4TSF G;  4J41 A;  1SQF A;  4DRX B;  3G71 V;  1H2K A;  3AG3 C;  2Z5U A;  1NZ6 A;  4NVP A;  2ZE5 A;  3OMA B;  4DUZ B;  3I5D A;  4UUJ C;  1HNZ O;  2P5O A;  3JCZ A;  3K3W A;  5FPO A;  1KUQ A;  3SR2 C;  2ZNJ A;  1SF9 A;  2QGN A;  2HEP A;  4A5U B;  1I5X A;  2QWR B;  4JI1 O;  2WLI A;  1AR1 B;  1BL8 A;  1KB9 F;  4Q20 A;  2CUG A;  1EN4 A;  3JAW A;  3CD6 V;  3K9S A;  1OV9 A;  2DQ3 A;  2OTJ V;  2FML A;  1I08 A;  3HR0 A;  2Q68 A;  1VQK V;  5IWA O;  1JA8 A;  1XIL A;  4MVM A;  1V54 C;  3Q4H A;  1K34 A;  2PZS A;  4EFB A;  2M6Y A;  3CYO A;  3I56 V;  1S5L Z;  3CCE V;  4JAV A;  1JR9 A;  5GTI Z;  3CJH A;  3CS5 A;  5BZB A;  5IY5 C;  2IJJ A;  1AR4 A;  5KX5 B;  4JYY A;  1FXH A;  1R73 A;  2IH1 C;  2RCV A;  4DV4 B;  1L0L H;  1NTK H;  2B5U A;  3SJQ C;  1S3J A;  2AGA A;  2K9P A;  1N32 O;  1XEQ A;  4DV6 B;  4UVC A;  3AG2 C;  2EIJ C;  1N36 O;  1R3L C;  1Y4M A;  2KSD A;  3B40 A;  4PJ0 Z;  3W7T A;  2ILM A;  3F7Y C;  2WAM A;  1DGS A;  1QVG U;  3QO5 A;  1QVF U;  4FFB A;  3B4S A;  3L70 H;  5B1B C;  4TWK A;  2QTS A;  3T4D A;  2L35 A;  4DR7 O;  3TCU A;  1UJW B;  2L6L A;  4KFM A;  3DXR B;  2UUB O;  2ZCE A;  4MTF A;  4TV8 B;  4I50 A;  3RW0 A;  3X2Q C;  4OGQ B;  3A2F A;  1XHZ A;  4B3S B;  4LNU B;  3STL C;  4DV7 B;  3AG1 C;  3CMA V;  4IIJ B;  3SDL A;  1NR1 A;  4B3R B;  4XDL A;  4O4J A;  2F4V O;  2NNU A;  4YY3 O;  3TGU H;  4L8J A;  2C2A A;  1QLE C;  4PA4 A;  4WCE V;  2LJ2 A;  2UUA B;  4J9Y B;  2IJI A;  2P4V A;  1PD3 A;  5H2F Z;  1K5S A;  1MZE A;  3OUS A;  4R8C A;  2JGD A;  1I0H A;  2Y0P A;  3WB0 A;  3B8M A;  4K8X A;  4OPA A;  3CE2 A;  4ZI7 B;  2BE3 A;  2BTQ B;  4X20 B;  2HKO A;  1BQZ A;  1ROP A;  3K58 A;  3QG5 A;  2JVD A;  3VOU A;  5IYZ B;  3ZMS A;  4QJF B;  1MOF A;  1VQO V;  4LH6 A;  4DV1 B;  5GW7 A;  1Y67 A;  4G2K A;  2F93 B;  3K0G A;  3CXH F;  3BCC H;  5BR8 O;  1SZT A;  2VWJ A;  4PDV A;  3E35 A;  1WA8 A;  4X66 B;  3ETE A;  4HYO A;  1FPO A;  1V54 B;  3OAA G;  3HKD A;  5EC2 C;  4JTD B;  5IE9 A;  1SET A;  3K5N A;  5IJ0 A;  2LO1 A;  1H2L A;  2WLI B;  4KL1 A;  1M9N A;  5IY5 B;  2EIM B;  2E75 B;  1BZK A;  1FYJ A;  3JAW B;  3CXC U;  4O4I A;  1ZX3 A;  3JAM N;  5D5Q A;  1HNX B;  5KHH A;  4DR6 B;  1RM1 C;  2OIE A;  1IBK B;  5EK0 A;  1X4T A;  3AG2 B;  2EIJ B;  4PA9 A;  2Q0A A;  2YIB D;  3C90 A;  2QSA A;  3AEI A;  1WLE A;  5EBW C;  5IYB O;  4JI7 B;  4ICG A;  2CTP A;  3UT5 A;  2CTW A;  2RNB A;  4ASU G;  1YJW V;  3D36 A;  1AI5 A;  3CJH B;  2R70 A;  3FFQ A;  2Q4P A;  4FM0 A;  2E5L B;  4UV8 A;  3SPI A;  2Z3Y A;  1VQ5 V;  5K1X A;  1FXV A;  2ZM6 B;  1AP6 A;  4PA7 A;  3X2Q B;  1G6U A;  4F6R A;  5KA5 A;  4TV9 B;  2EX3 A;  2WA4 A;  1S0V A;  3ASO C;  3S3W A;  4JAA A;  4YJ2 A;  4IT5 A;  1MSW D;  3AG1 B;  3APQ A;  4I0X B;  2R72 A;  4BIU A;  1US6 A;  3N27 A;  3IC7 A;  1IBL O;  3SYO A;  2QEX V;  1IXM A;  3P3N A;  1QLE B;  4AQY B;  2LQT A;  3LDD A;  2F23 A;  1SA0 B;  1S5J A;  4FFB B;  2WA3 A;  3C3T A;  2ZXW C;  1Y66 A;  1NVP B;  2A9H A;  3AK2 A;  5KA6 A;  3PN1 A;  3D36 C;  2PUS A;  2HVJ C;  2PI5 A;  4GX1 A;  4F4L A;  4FPP A;  3ABT A;  3B77 A;  1K4D C;  2CH7 B;  2W0X A;  5E79 Z;  3CWB H;  3ML0 A;  3E8H A;  4N23 A;  3CSX A;  1KP2 A;  1NT2 B;  1FAF A;  2XND G;  3JAK A;  2HHH B;  1NJI W;  4I50 B;  3KG2 A;  3K9A A;  1YTF B;  1DLB A;  3E86 A;  4CS4 A;  1ZL8 B;  2JS5 A;  3JCU Z;  2P6J A;  2ZD9 A;  4LFB O;  1GKF A;  5BMV A;  3KKY A;  5L3E A;  2DN9 A;  1RPR A;  1WPX A;  1AB3 A;  3JAR A;  2D3O W;  1IBM O;  2PY5 A;  2H8P C;  4I55 A;  4O4J B;  2WLL A;  3OMN B;  3CC2 V;  2DJV A;  3OGC C;  1IX9 A;  4CC5 A;  1GN2 A;  4O2B A;  5L3G A;  4K0K O;  1L8D A;  1ZWI C;  1I94 O;  3M99 B;  2HR3 A;  2LFS A;  4OX9 O;  2YI9 A;  4DR3 O;  4DR5 O;  1N32 B;  4GZR B;  3DC5 A;  3SYA A;  2XT9 A;  2CTR A;  2AXT Z;  5LXT A;  4BAY A;  5JVD A;  4JI5 O;  5DED A;  1AVM A;  4D7S A;  5KHG A;  2CGO A;  1K8A W;  5B3S C;  4EB6 A;  1VMG A;  5K1P A;  3GWK C;  3OE7 G;  2Q5Z A;  3L9D A;  1W59 A;  1M90 W;  4DR7 B;  3N2G A;  4QE7 A;  2GTS A;  1WA8 B;  1BHB A;  3SYP A;  2OCC C;  1JJ2 U;  3JYC A;  1VP7 A;  2H94 A;  3HKD B;  4ZOL B;  2ZR2 A;  3T1Y B;  1RP3 B;  4WFH A;  3UO3 A;  2LW7 A;  3E8F A;  4PDM A;  4OPH A;  1GM7 A;  4E4E A;  2NN4 A;  5IJ0 B;  3ZN0 A;  4RAI A;  5DN6 G;  2UXX A;  2F4V B;  4B3T B;  3K79 A;  2EJ7 A;  2OT5 A;  1I7F A;  4QIW F;  1Q8I A;  4O4I B;  5JQG A;  1DTO A;  1F4M A;  4XDK A;  3T4Z A;  3ASO B;  2DYS C;  1OCO C;  3JD0 A;  1NQT A;  3WG7 C;  1K5Q A;  1ENV A;  1OZ0 A;  2ITC C;  3QVN A;  3SPG A;  5GTH Z;  5EYP A;  2P67 A;  4ZHQ A;  5LP6 B;  1ZLZ A;  3BPZ A;  3LDE A;  2RMK B;  4Z1V A;  2GV9 A;  2KG7 B;  1N34 O;  2GUZ A;  3FB7 C;  3SGI A;  3MD0 A; 
#chains in the Genus database with same CATH homology
 3JCZ A;  3K3W A;  2BOB C;  2HG5 C;  2LFR A;  1ORQ C;  2DWD C;  3E83 A;  4GCZ A;  4JF3 A;  2R9I A;  2IJH A;  1NVP D;  4H37 A;  5CA3 A;  1I5X A;  2IW5 A;  2WLI A;  5EBM C;  1AR1 B;  3E8B A;  5E1A C;  4MVS A;  5LHH A;  1BL8 A;  1J95 A;  5CN0 A;  3K08 A;  1W0K G;  2QM8 A;  3GWO A;  3ZRX A;  4Q20 A;  1KD1 W;  5HFM A;  1JQ0 A;  3QO8 A;  2JEX A;  5H6R A;  3OEH G;  3ZRW A;  4JTC B;  1NBM G;  2QTO A;  1YTF D;  5LHI A;  1F23 A;  2XAH A;  4FIP C;  3CD6 V;  2F43 G;  4N21 A;  2DQ3 A;  2QM7 A;  3CP1 A;  2OTJ V;  2BOC C;  3T2M A;  4JTA B;  3BEH A;  1QCE A;  1V55 B;  2Q68 A;  4QPK A;  1VQK V;  1E1R G;  1OCR B;  5LGN A;  2ZQM A;  1ARO P;  1M1K W;  1GMG A;  4MVM A;  1YSC A;  1V54 C;  1K3E A;  3ZMV A;  3OW2 U;  2EBO A;  1K34 A;  1YIJ V;  3QNE A;  2X6C A;  3CYO A;  3I56 V;  2WLH A;  2JK5 C;  4LC1 A;  4X89 A;  4XBF A;  1AI4 A;  3CCE V;  4JAV A;  2EIN B;  2V7Q G;  4LCU C;  5B3S B;  1XL6 A;  1OCC C;  3ABK C;  4P2Z A;  4LBE C;  4GX2 A;  3PJS K;  2XAS A;  1FXK B;  5BZB A;  5IY5 C;  1RM1 B;  3GB7 C;  1THZ A;  2IJJ A;  3OR6 C;  4WFE A;  3CCR V;  4U7O A;  2ZDI A;  1W2B U;  1W0J G;  2R9R B;  3ZCC A;  2OTL V;  5EBL C;  4R6Z A;  1YI2 V;  4J9Z B;  1CEZ A;  2OCC B;  4PA6 A;  2WLL B;  1FXH A;  2QA4 V;  2ZR3 A;  4JPR A;  1Q81 W;  1R73 A;  2IH1 C;  1VQ7 V;  2W6J G;  2B5U A;  3SJQ C;  1S3J A;  2IU0 A;  2GSM B;  4MS2 A;  3K03 A;  2KB1 A;  2Q69 A;  1M57 C;  2WLN A;  4UVC A;  3AG2 C;  4UVA A;  2EIJ C;  5HFL A;  1JOY A;  1R3L C;  1Y4M A;  4G28 B;  3CC4 V;  4MVU A;  3CCM V;  2CK3 G;  2EZP A;  4CBC A;  1QBZ A;  4TT3 G;  5LGT A;  2Q67 A;  1AI7 A;  2YEV B;  3W7T A;  3F7Y C;  2WAM A;  1QVF U;  1NR7 A;  3QO5 A;  4JGS A;  1QVG U;  1R3I C;  3FB6 C;  2AHY A;  5B1B C;  3CC7 V;  3E8G A;  3OM3 B;  3T1C A;  4RQE A;  1S72 V;  1BHA A;  1F4N A;  2XAF A;  4TWK A;  1JX9 A;  3MHH C;  2WLK A;  2JIZ G;  3T4D A;  4QNH B;  2DYS B;  3TCU A;  3SYC A;  1OCO B;  1KQS U;  1UJW B;  2EIK C;  4KFM A;  3WG7 B;  1DF4 A;  1JCH A;  4WFA V;  4UXN A;  2A0L A;  2ZDI C;  3SYQ A;  2XOK G;  5IYD O;  3BY6 A;  3ABL C;  3JD4 A;  3F5W C;  1OCZ C;  1FS0 G;  4MTF A;  5H6Q A;  4E2L A;  3X2Q C;  3RW0 A;  3I55 V;  1VQ4 V;  2QE7 G;  3B8N A;  3ZJZ A;  4MTG A;  2DYR C;  2ZXW B;  3DTU B;  1Q7Y W;  3STL C;  3ABM C;  3AG1 C;  3CMA V;  5DM6 V;  3W7S A;  1NR1 A;  4XDL A;  1AJQ A;  1JVM A;  2EJR A;  5LBQ A;  2NNU A;  3CPW U;  3ASN C;  3CCL V;  4MTO A;  2C2A A;  1QLE C;  3K06 A;  4FK5 C;  4PA4 A;  3ZMT A;  3A0R A;  4WCE V;  1VQN V;  3ETD A;  4J9Y B;  2IJI A;  4KUM A;  1PD3 A;  2W6I G;  3FYE B;  3HB3 B;  3LSS A;  1K5S A;  3QO7 A;  5CBF A;  3F7V C;  4U7N A;  3RBZ A;  4JAU A;  3FKS G;  3OUS A;  4R8C A;  1AI6 A;  3B8M A;  2X7R B;  4I5S A;  1OHH G;  4HZ3 A;  1CP9 A;  5B1A C;  1YHQ V;  3MHS C;  1N8R W;  2HKO A;  5B1O A;  1ROP A;  1VQL V;  2ATK C;  3VOU A;  1VQO V;  3ZMS A;  4QJF B;  1MOF A;  5J9P C;  1AJP A;  5GW7 A;  5KUK A;  2B1I A;  4G2K A;  3CME V;  3K0G A;  5L3B A;  1KC8 W;  1SZT A;  4PDV A;  3UM7 A;  3ABU A;  3E35 A;  4Z1M G;  3ETE A;  3P30 A;  2UXN A;  2AHZ A;  3IFX A;  4HYO A;  4QPJ A;  1V54 B;  1R6K A;  2JJ2 G;  3OAA G;  3NXS A;  4JYC A;  4P30 A;  5EC2 C;  4DXW A;  4JTD B;  1H8E G;  2DQ0 A;  1M56 C;  3JD2 A;  2QKS A;  3W7W A;  4MW8 A;  1SET A;  1AJN A;  1SER A;  1K97 A;  5FL7 G;  1LNQ A;  3STZ C;  1OCC B;  1V55 C;  3ABK B;  2WLI B;  2XAJ A;  4PDR A;  4BW5 A;  1OCR C;  1M9N A;  3SPH A;  5IY5 B;  1K4C C;  1R3K C;  2K1E A;  2EIM B;  3FB8 C;  3ZRV A;  2YEV A;  3ZMZ A;  1PNM A;  4RUE A;  3ZRW B;  4OXS A;  5C93 A;  2Q6A A;  4HAM A;  1EZJ A;  5L3C A;  2Y69 B;  4YXW G;  3CXC U;  1KP3 A;  3LSQ A;  4PA3 A;  3OUF A;  2WWW A;  4FMT A;  3EHB B;  3H01 A;  5CBG A;  1RM1 C;  1M57 B;  5EK0 A;  4BIZ A;  3AG2 B;  2EIJ B;  4PA9 A;  4MVR A;  1GK9 A;  3AG4 C;  1P7B A;  2X0L A;  3AEI A;  1WLE A;  5EBW C;  5IYB O;  1PNL A;  4MVZ A;  1JPX A;  1P4R A;  2JJ1 G;  4UVB A;  4ASU G;  3W7U A;  1YJ9 V;  1YJW V;  2V1D A;  1GO3 F;  3D36 A;  1AI5 A;  3LUT B;  3D3I A;  4P9O A;  4UV8 A;  3SPI A;  2Z3Y A;  1VQ5 V;  2EIK B;  4KP4 A;  5LGU A;  4PDL A;  1KKD A;  2Y48 A;  1FXV A;  3ABL B;  1OCZ B;  1VQ8 V;  4PA7 A;  3HPL C;  1K73 W;  2IH3 C;  3X2Q B;  4XDJ A;  4JYB A;  5KA5 A;  2WSS G;  2IJK A;  1I5Y A;  3WFV A;  2HLD G;  1S0V A;  5L3F A;  2DYR B;  3ASO C;  1VQ6 V;  3CCQ V;  3AG3 B;  1PNK A;  1EFR G;  3E89 A;  3ETG A;  3G6E V;  3ABM B;  3AG1 B;  1MSW D;  4RUF A;  4ZBM A;  4BIU A;  5B1N A;  1K33 A;  3OFN G;  2XAQ A;  4GX0 A;  1Q82 W;  2M7W A;  1DF5 A;  3IC7 A;  1F51 A;  1PKX A;  3SYO A;  1EBO A;  5CMU A;  1YIT V;  3ASN B;  1NH2 B;  2QEX V;  1IXM A;  5EC1 C;  1R6N A;  1QLE B;  3SPJ A;  1H38 A;  3OEE G;  1SES A;  1MAB G;  3LDD A;  2EIL C;  5KUM A;  4CZZ A;  2DWE C;  2ZXW C;  1Y66 A;  3FYI B;  4FJC C;  2A9H A;  1QR8 A;  1NVP B;  5KA6 A;  4MT8 A;  1KEC A;  2LP7 A;  2HVJ C;  3CCU V;  1G8M A;  2XAG A;  2PI5 A;  2HJF C;  4GX1 A;  4F4L A;  4GX5 A;  4L87 A;  1NH2 D;  2JEU A;  3ABT A;  4FPP A;  5B1A B;  3B77 A;  2ITD C;  3LNM B;  1L1F A;  1K4D C;  3ZMU A;  2FTK A;  1K7D A;  3ML0 A;  4UV9 A;  3E8H A;  4N23 A;  1E79 G;  1CPY A;  3G4S V;  1KP2 A;  4R7C A;  2XND G;  3R65 A;  3RVZ A;  4RO2 A;  1NJI W;  3KG2 A;  3ZRS A;  4I9W A;  5H9C A;  3K9A A;  1YTF B;  1DLB A;  3E86 A;  1FXK A;  2P6J A;  2ZD9 A;  1XL4 A;  1GKF A;  1MG1 A;  5L3E A;  2GHY A;  4X8A A;  2HFE C;  1RPR A;  1WPX A;  4R50 A;  1SRY A;  2D3O W;  4EKW A;  2H8P C;  3DGE A;  3OR7 C;  2WLL A;  3OMN B;  3CC2 V;  5CBH A;  3OGC C;  5L3G A;  3W7X A;  4WFG A;  1QR9 A;  2WLM A;  2PI4 A;  1M56 B;  1ZWI C;  3M99 B;  2HR3 A;  1B6Q A;  1COW G;  2LFS A;  1S76 D;  3UKM A;  3OMI B;  1VQM V;  1R3J C;  3SYA A;  1YJN V;  4WF9 V;  4QE9 A;  3SPC A;  4BAY A;  1GM8 A;  4ZKI A;  1S5H C;  1NKD A;  2B1G A;  2WPD G;  2X6B A;  3IGA C;  4X88 A;  3EFF K;  2IU3 A;  4G27 B;  4MVO A;  3K0D A;  4MTX A;  2EIN C;  5B3S C;  1K8A W;  3E2E A;  1FXK C;  3CCJ V;  3OE7 G;  3VBB A;  1M90 W;  4QE7 A;  4MSW C;  2EIM C;  4MVQ A;  3AG4 B;  1QLN A;  1BHB A;  1H2G A;  2HVK C;  2OCC C;  3SYP A;  3ZIA G;  1JJ2 U;  4GT1 A;  3JYC A;  4WFB V;  1E1Q G;  2H94 A;  2Y69 C;  2ZR2 A;  3FB5 C;  5IDJ A;  4WFH A;  1BMF G;  5B1B B;  4WFF A;  3E8F A;  4RQF A;  1HWY A;  4PDM A;  1GM7 A;  1Q86 W;  3LDC A;  2MK3 A;  4P9P A;  5IYC O;  1VQ9 V;  3ZN0 A;  1K9M W;  1H8H G;  4LP8 A;  3P32 A;  2WLJ A;  3TET A;  4RAI A;  5DN6 G;  2UXX A;  1VQP V;  1G4Y B;  3ZN1 A;  2EZO A;  3K79 A;  3CCS V;  2OT5 A;  1GM9 A;  4QIW F;  2JDI G;  1RPO A;  2P7T C;  2W0F C;  1DTO A;  1F4M A;  2YSU B;  1PL0 A;  4XDK A;  4H33 A;  3T4Z A;  3ASO B;  2DYS C;  5LHG A;  1OCO C;  3JD0 A;  1NQT A;  3WG7 C;  1K5Q A;  3K04 A;  1ENV A;  1OZ0 A;  2ITC C;  2DW4 A;  1K92 A;  1FFT B;  1S77 D;  4JAS A;  3SPG A;  4MW3 A;  5L3D A;  3JD3 A;  2P67 A;  2P90 A;  4TSF G;  2EIL B;  3G71 V;  2NLJ C;  3LDE A;  2X6A A;  1TUE B;  3AG3 C;  3TK1 A;  2Z5U A;  3RVY A;  1GTO A;  3JD1 A;  4PEL A;  4DO2 A;  3CCV V;  3FB7 C;  3OMA B;  3MD0 A;  4UUJ C;  2A79 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...