2IH1C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
100
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 39
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih1C00
4GX5A 3E83A 1XL4A 1S5HC 4PDRA 5EC2C 1K4CC 3WG7C 2WLLA 2QTOA 4G28B 2X6BA 5BZBA 3X2QC 4PDMA 3SPIA 4PDVA 5KUKA 3K03A 3F7VC 5E1AC 3R65A 2KB1A 3K04A 1ORQC 2Q67A 3UM7A 3FB8C 4TWKA 2ATKC 1OCRC 3ASNC 2ITCC 4MTFA 2IH3C 3FB6C 3KG2A 3RBZA 4ZBMA 3SPHA 2A0LA 3F7YC 3K0DA 3AG1C 2ITDC 4MVRA 2DWEC 4MVUA 4CBCA 1OCCC 4PA3A 4MVQA 2BOCC 4RUEA 2NLJC 2BOBC 5KUMA 1K4DC 1LNQA 3FB7C 4MW3A 2Q69A 2HG5C 4MVMA 2IH1C 3SYOA 2EIKC 3PJSK 4RO2A 3RW0A 4PDLA 4WFEA 5CBHA 3T2MA 3F5WC 4JTCB 3GB7C 4P9PA 2YEVA 3OUSA 4PA6A 2H8PC 2ZXWC 4WFFA 4R8CA 4R7CA 1R3KC 5EBMC 1XL6A 3RVZA 4PA4A 3E89A 3OR7C 4GX1A 4P30A 3T4ZA 2K1EA 3SPCA 3AG2C 2QKSA 3FB5C 4KFMA 3ZJZA 3JYCA 4F4LA 2DWDC 4MVOA 2ZD9A 3STLC 3ABLC 2W0FC 3ABKC 4X88A 3STZC 5CBFA 1BL8A 1J95A 1V54C 1OCZC 2Q68A 4MTGA 3TCUA 5B1AC 2EILC 1M57C 2AHZA 3LDEA 3E8BA 4R50A 4X89A 1R3LC 2EIMC 1KKDA 4MS2A 3BEHA 5EBLC 2X6CA 3T4DA 5EK0A 4H37A 4XDKA 4MVSA 4UUJC 4X8AA 3RVYA 3ASOC 2WLIB 2JK5C 3K0GA 4J9ZB 5B1BC 3SYQA 2DYRC 4DXWA 3TETA 1JVMA 2HJFC 3AG3C 5EC1C 4EKWA 4JTAB 3K06A 4LCUC 4LP8A 3SYAA 2WLJA 3LUTB 2WLNA 3SPJA 2R9RB 4LBEC 3HPLC 2OCCC 3E8GA 2HVJC 4MW8A 1G4YB 3VOUA 4BW5A 4MVZA 2Q6AA 3OGCC 4G27B 4MSWC 1V55C 3E86A 4HZ3A 3SJQC 1OCOC 2WLIA 3OR6C 2A9HA 3IGAC 2HFEC 3E8HA 5EBWC 5J9PC 1M56C 4XDLA 4QE7A 2HVKC 2WLHA 2WLKA 3LNMB 1ZWIC 3ABMC 4GX2A 4GX0A 2EIJC 2WLLB 3LDDA 4JTDB 4PA7A 4QE9A 2A79B 4RAIA 1R3JC 4QNHB 4MTOA 1QLEC 4P9OA 5CBGA 3K08A 3UKMA 4H33A 3T1CA 4XDJA 2EINC 3E8FA 4I9WA 2WLMA 4WFHA 4HYOA 3SPGA 3SYCA 3OUFA 4OXSA 4J9YB 2AHYA 4P2ZA 2Y69C 4R6ZA 4RUFA 4WFGA 1R3IC 3AG4C 2P7TC 3LDCA 5IY5C 1P7BA 3IFXA 3SYPA 5B3SC 3ZRSA 2X6AA 3EFFK 2DYSC 4PA9A
chains in the Genus database with same CATH superfamily
4DV4O 2JIZG 1IBMO 2C2AA 4NTWA 1FXKB 2NR5A 3SJCC 1SQQH 5F2VO 3CP1A 3HKCA 2GDSA 3D36C 4CS4A 3W7UA 2CH7A 4DV0O 3IAYA 2QWRB 2UUAO 3A0RA 3F5TA 3L9DA 5FL7G 4TQDA 1GRJA 1D2DA 2MK3A 3U0ZA 5CBHA 1SQFA 1VQ6V 2H8PC 3AG4B 2ZXWC 3J80N 3RYCA 1EBOA 4P30A 3SR2C 3SPCA 1XI1A 2OT5A 4DK0A 2AZ0A 3JYCA 3STZC 2ZD9A 3JSLA 3CC7V 4CH4A 1MSDA 3MHSC 4UCOA 1FXKA 4TQFA 5BMVB 1D5AA 3D3QA 3ASOC 3QVNA 5LGUA 2F95B 2IBZH 1SERA 3AG3C 2GSMB 2FTKA 1E79G 3O9OA 2YIBD 1IZ3A 5B1NA 3UCSC 4FIPC 3L71H 2Z0AA 3CD6V 2QSAA 2ZXWB 3E86A 3TK1A 4DV6B 1AP6A 1MG1A 3GVMA 5CA0B 2ZNJA 2FL4A 4YHHO 2RQ6A 3TXQA 1LR1A 2CTRA 4UCSA 4B3SO 1SC5B 4I50B 2WPDG 2EIJC 3HKEB 3JASB 3O65A 2YEVB 3K08A 4PI0A 3NXSA 2ADQB 3S3WA 4CS2A 1XOUA 3KCXA 4GT1A 1NH2D 1Q3EA 4J11A 4DR7B 3LDCA 3SYPA 1RP3B 3VQWA 2OTJV 3CE2A 2BSKB 4NXNO 2X6BA 4ASUG 3BAAA 2RNBA 1XREA 1QBZA 5KUKA 1QQCA 4FMTA 3OTOO 5D5QA 4LFCB 4X66O 4E4EA 4N21A 1I7FA 4B7EA 2LW1A 3SPHA 1QVFU 2QGNA 1N32B 1L0NH 5KLVH 2JGUA 3MDSA 4MVQA 5CA0A 2EIJB 2CGOA 1KECA 1CXZB 2YIAA 4I50A 4B3MO 2ZIOA 4JAUA 4K0KB 3RYIB 3HKEA 2LFSA 2YEVA 2R9AA 2P4KA 3H01A 4WFFA 2QM7A 2R9IA 1XNQB 1XNRO 4FLTA 3CMAV 3OT7A 1YZBA 3BABA 4U3FH 5LOVB 3T1YB 2KQXA 4DV3B 4YY3B 1R6TA 1NTZH 2DWDC 5LHHA 3ABLC 4I0XB 1H2KA 3E8BA 2BSKA 1S5LZ 1VQMV 1SKVA 4TUYA 2BE3A 5B66Z 2HHHB 2XAJA 3ZHTA 4Z2WA 4EKWA 5GTIZ 3K5NA 2FKXA 3SPJA 2JEUA 4LBEC 4ICGA 5LHIA 1QLNA 1HDJA 1BGYH 1N4CA 1NTKH 3RYFB 5KA5A 1HW7A 4WFAV 3CEIA 1EZVH 3IGAC 5JJEB 4DR4O 2AZ2A 3ABLB 5J2TB 4JI4O 3L72H 4PA7A 4QE9A 2A79B 3D8CA 1HNZB 1K5SA 4JYCA 1GN4A 4JI5O 1TUBB 4NYKA 4DV5B 1KBHA 2AHYA 1NBMG 1R3IC 4DW1A 1HR0O 1VQPV 4JAAA 3ZN0A 5KHKA 4JI2O 1S77D 4IGGA 4Z1MG 2NNUA 3FKSG 1B3QA 5IJ0B 1Z2GA 4PDMA 5HFMA 3AG7A 3QNEA 3R65A 1BHBA 2UUBO 4NR1A 2RDCA 3RYFA 4C7UA 4KL1A 1LUVA 4I7ZB 3HKDB 1JA8A 1WP8A 2LJ2A 2K1EA 1L8DA 1TUBA 4FLZA 2EJ7A 1MSWD 4JZ2A 3STLC 5A2QN 1LUWA 2PI4A 4JI1B 2DQ0A 2BTQB 3EHBB 5IJ9B 4MVSA 2WLIB 4AHCA 3K0GA 4UVAA 3I56V 3B4SA 4DV4B 3IJ4A 4RWUA 2WLJA 5IYDO 3G6BA 1TAEA 1VARA 3E35A 2AW9A 3BA9A 4X65O 4GLXA 3APOA 2JJ1G 3JD3A 3W7WA 1GK9A 4EB6A 3HKDA 2QKAA 2UUAB 1Q6HA 2HFEC 3G4SV 4O2AB 1VF5B 1WPXA 1IBKO 1KU9A 2UU9O 4GX0A 5KHHA 4PJ0Z 1KMIZ 1JJ2U 2QA4V 3N2GA 4J42A 4TOIA 2XOKG 1VQ7V 5IJ9A 3DTUB 4D7TA 2DYSC 3H1IH 3ETEA 4UB8Z 1BHAA 2DJVA 4X64O 2WLLA 2QTOA 1G6UA 2G38A 4PDVA 3K03A 1A32A 3K04A 4J7KA 1VF6C 2WAMA 1F4NA 1SF9A 2A0LA 3K0DA 1GM9A 4JI8B 1E1RG 4RUEA 1H38A 2IJKA 2VWJA 1BSMA 2FMLA 4O2AA 2M6YA 1RSOB 3AK2A 4RO2A 1HNWB 1XMQO 3F5WC 2YXLA 4E2LA 4FM0A 4R8CA 1NU1H 3HR0A 2E3CA 3RVZA 3RYHB 4YHHB 2DYSB 3ZCCA 4B3SB 4DV1O 1BMFG 1QHTA 1J95A 2Z3YA 5KX5B 3GWOA 1OCZC 4MTGA 3CRRA 1FFXB 3LDEA 1YTFB 1YF2A 4O4IB 3T4DA 3FYEB 2ZKOA 3B8NA 4JYBA 1BQZA 2ZE5A 3H1KH 5FPRA 5JH7B 5HFLA 2H3OA 4A5UB 4WF9V 4XBFA 4PD4F 1G1XB 3GWKC 4J10A 3OTOB 2Y0IA 4X66B 4LF8O 1RSOA 3FD9A 1BQ0A 1Y66A 1NT2B 2OCCB 4LFCO 2CE4A 1K73W 2HKOA 1US6A 2HVKC 4GKKO 1AR4A 2WLHA 4X1IA 4CH5A 3RYHA 1F4MA 2F23A 1OCZB 4YXWG 4DYLA 5ITZB 5JCOC 1WA8B 4NVPA 4B3MB 4QPJA 4EEQA 5GW7A 1XNRB 1M9NA 1CP9A 1RPRA 3RGBA 1QR9A 1Q43A 1KP2A 1YITV 1KP3A 4LR3A 1YJ9V 2B1GA 4QJFB 2EBOA 2CUGA 1JJOA 2VQEO 3P3NA 5BZBA 3ZRWB 4OPAA 5JH7A 3CHXA 3CRCA 3UM7A 1FPOA 4MTFA 1DTOA 1JCHA 2ZR3A 4LH6A 4X1KB 4MVUA 3CSXA 2EX3A 3MAQA 3OMIB 5KUMA 1OCRB 2E75B 4MVMA 1SRYA 3AG1B 5LA6B 4PDLA 4WFEA 3RW0A 5ITZA 3GB7C 1M93A 3OMAB 2KKWA 2ZCEA 5EBMC 2XAFA 4ABMA 2XASA 4B3RO 2W0FC 2Q73A 3ABKC 4LFBB 5J2UB 1YI2V 1VP7A 5IYBO 5EYPB 2HEPA 3RFRA 4DUZO 1HR0B 1N34O 3KZIZ 1AILA 3CC2V 4JI2B 5GONB 4LP8A 1FAFA 4X1KA 3A8TA 5E79Z 5JCOA 4I55A 3UO2A 5KHJA 2UUBB 1GN2A 5LA6A 4JASA 4HNAA 1YTFD 1P4RA 3ABKB 2UXCB 1XBLA 2CDYA 3JATB 4I4TB 1KC8W 5IYCO 2WA3A 1NH2B 3HKCB 4YIPA 2JS5A 4YJ2A 4HYOA 2CH7B 3OEHG 2CTQA 4UV9A 1FXKC 4DV2O 4WFGA 5EYPA 2X6AA 2JDIG 1R73A 4IT5A 2VQFO 2OIEA 5BY1A 3K58A 4O4HA 3JAWA 2EULA 2ODMA 3SPIA 2WWWA 4JI0O 3FB8C 3FFQA 4PI2A 4TWKA 4FLWA 3ASNC 3OFNG 4Q6GA 5CMUA 2GUZA 2OCHA 4NTXA 4MVRA 4K3AA 3I55V 4MW3A 3ZHQA 1SESA 4X65B 3JATA 4I4TA 1AR5A 4UXNA 4PA6A 1R3KC 1ZLZA 3WB1A 3AG2C 1QNMA 1S5JA 2Q7EA 1IBKB 1B6QA 1MMMA 2Q7GA 2UU9B 3ZIAG 2Q68A 4GKJB 3BCCH 3WB2A 4MS2A 3ASNB 1PNMA 1T5EA 2Q4PA 2QM4A 3RVYA 4YIOA 5B1BC 1K33A 2IU3A 3L70H 3L75H 5CN0A 1N36O 2NN4A 2P5OA 1RPOA 4X64B 1SQBH 2WLNA 3M8AA 2VS0A 1TUEB 1V55C 3SJQC 2LFRA 2ILMA 3AG2B 3CWBH 5J9PC 4CH6A 1Q5OA 1SS3A 4QGPA 4OGQB 4UV8A 4JTDB 1L0LH 4JI8O 2B1IA 1GH6A 4W4KA 1XMQB 4F6EA 4D7SA 5B1BB 4Z1VA 4BAYA 1HNWO 3AEIA 5IY5C 2V1DA 2E76B 1P7BA 3B8MA 4OX9O 5H5NA 4DV1B 5KHGA 3W7XA 1K4CC 4G28B 1ENVA 2B5UA 2PTMA 5E1AC 5LP6B 1V55B 1EN6A 2ITCC 1CPYA 3DGEA 4ZBMA 1R6KA 5K1XA 1N0NA 1WP7A 3FB7C 4JAVA 1VQ4V 1VQOV 3SJAC 3JD4A 1O9HA 2OIGA 4LF8B 4I9QA 5IY5B 4TUYB 3E89A 1JFFA 3R66A 3FB5C 1VQ9V 1S72V 4ZKIA 4GKKB 1YVWA 2BTOA 4BWAA 2ZE7A 1N33O 2O57A 3OGIB 4RQFA 2Y4UA 5EIBD 3CRMA 4JF3A 2Y48A 1KKCA 3WB0A 1KQSU 1Z5VA 2AGAA 3OMNB 1AJQA 1V9PA 1IXBA 5LP6A 3SYQA 1AR1B 1NZ6A 2HJFC 5KHIA 1ZAUA 2VQEB 5B1OA 4DV7B 1AI6A 4G27B 3H1JH 2QWQB 4AI8A 2Q5ZA 1WJZA 2A9HA 5CB4A 4LC1A 4TV8B 2YI9A 3K5LA 1ZWIC 1OCOB 1BZKA 1HWYA 1THZA 3CCSV 3CCVV 5CBGA 4LF7O 3U11A 1D5NA 3NR7A 1NI8A 2DN9A 4JI7O 2Y4TA 1SQPH 2P06A 2QWPB 4I5SA 4EFEA 3EFFK 1YXBA 5LL6Y 3ZHSA 4JI3B 1O9GA 4B3RB 4Q20A 2GTSA 2V4DA 3X2QC 1MNGA 3APQA 4LFBO 2Q67A 3G71V 3JD0A 4DUZB 1FKAO 3FB6C 3B09A 3F7YC 1DK1A 1N34B 2UXBB 4JYYA 4PA3A 1R1BA 1KB9F 4TV8A 1Y6XA 2B9ZA 2W6IG 3W7TA 3C90A 2PY5A 3FAVA 1W59A 4HAMA 3CCUV 3ABUA 3B77A 1IVSA 1I94B 4FFBA 1KYOF 3CXHF 4QPKA 1EM1A 3X2QB 3TCUA 2UXDO 2UXCO 4PHZA 3LSUA 2N04A 4KXRA 4EB6B 4XDKA 5L3BA 4DV2B 5FNVB 3TETA 5L3DA 2PYJA 4OPHA 1PD3A 2VQFB 2YSUB 1H8EG 4WFBV 4ZIBA 2ZDIA 1EZJA 1JR9A 4O4JB 4JI0B 2PYLA 3N2GB 4HZ3A 3OM3B 4LF4O 2UXNA 4WBNA 3ZMVA 1F7YA 2JS3A 2V7QG 4IYHA 3ABMC 1AI4A 2WLLB 2XTAA 4DRXA 1AP5A 1GMGA 1Y76A 4H33A 4XDJA 4DR3O 5IYZA 2KG7B 1AROP 3JAKB 1FXVA 3ZHVA 4YJ3B 2LO1A 5FNVA 1XL4A 4IL6Z 2EJRA 2A7WA 1K7DA 1WPBA 1K5QA 3CCRV 4FLXA 4GKJO 2IH3C 4BIOA 5H9CA 4O4JA 4X62O 2ITDC 2DWEC 5A9GA 1N36B 3ABMB 2N74A 3K3WA 1S76D 3CCJV 3ETDA 1VQLV 2JRIA 1PV0A 4PA4A 4DR1O 5JJNB 5B5EZ 2KG7A 2ZIMA 4FM2A 3JAKA 4MVOA 1IURA 4X88A 1GM8A 4YJ3A 3BEHA 1RM1C 3BFRA 4LFAO 3N2KA 2EZPA 4J9ZB 4KP4A 4OX9B 5EC1C 2K9PA 4JTAB 1IXMA 4X1IB 5JVDB 2OCCC 2HVJC 3QO7A 1JPXA 3C3SA 2Q6AA 1Q6IA 2QDOA 3QF7A 2E5LB 2F1MA 3EXAA 1K92A 1EN4A 2IJJA 1DF4A 3THOA 4MTOA 1AVMA 1Y74A 2RN9A 1RM1B 4LF9O 4W4LA 4R6ZA 4DUYO 1SA0B 1H8HG 1MZEA 3I5DA 3IFXA 2P67A 3CB2A 3ZMZA 5KA6A 1N33B 3P3PA 3PN1A 2ZR2A 3AK3A 5JVDA 1OCRC 1Q90D 2KSDA 4H44B 4AQYB 3AG1C 5LBQA 3CXCU 3K5MA 4PV1B 3OAAG 4FLVA 5IE9A 1K4DC 4BIUA 3BPZA 2QWNB 2ZE8A 2P22C 5JQGA 1PL4A 2IH1C 3ETGA 3PJSK 1IX9A 1Q6UA 4H13B 2RJZA 1XQ8A 4P9PA 4HBNA 3T4ZA 4DV7O 3E22A 3SGIA 5LMNO 3JCUZ 1NVPD 1SA0A 2PUSA 4FPPA 1V54C 5B1AC 4FM1A 4ZOLA 4LF7B 5H6QA 4I55B 1MABG 3FX7A 1K8AW 2P6JA 4JI7B 2JK5C 4DXWA 4BR6A 4K8ZA 2F93B 4HNAB 3P30A 1MA1A 4JI6O 1IBLO 1ZL8B 2Y0PA 3E8GA 4GCZA 4MW8A 4TT3G 1I0HA 4JI3O 1W0KG 2W6JG 4YJ2B 3K59A 1Y4MA 1FYJA 4UVBA 3E8HA 4CC5A 4XDLA 3OW2U 2YS8A 4QE7A 3L74H 3A0HZ 1V54B 4GX2A 4U7NA 5B1AB 2DW4A 2UXBO 1URFA 2GTAA 4KUMA 4O4HB 3JAWB 3K79A 2Q9LA 1GN3A 3OUFA 4X1YA 4UCVA 2GUZB 3VQVA 4PELA 2LW7A 1GO3F 3T1HB 3QO8A 4PA9A 3E83A 1XDCA 1S5HC 1OV9A 2OYQA 5EIBC 2UXDB 5JJJB 1NJIW 4GUNA 2DMXA 5LGNA 4UCTA 2CTPA 1ZL8A 2KB1A 1ORQC 1I94O 5IWAO 1UFIA 5AG2A 4UFZA 4J41A 4JGSA 2YXYA 1Q81W 1AJPA 1YIJV 4ZI7A 2NLJC 4FVMA 2BOBC 1VEWA 3ICXA 1SQXH 2ZINA 1X4TA 1XHZA 3T2MA 2M7WA 5L3EA 2EZOA 1Z5WA 4LF4B 4GX1A 5BR8O 3L73H 4K8XA 4CS3A 2X0LA 4F4LA 1Q86W 2XHBA 5LMUO 2X7RB 4X89A 2EIMC 4DR3B 4J7ZA 3BRCA 1P84F 2QJ1A 1B06A 1HP8A 2Q8VA 3U10A 3W7SA 3ETQA 3JARA 1H2LA 2P4VA 3K06A 2A3QA 1X59A 3HPLC 3ZBHA 3EVKA 4DR2O 4MVZA 4MSWC 4X62B 1VQ8V 1E1QG 4UVCA 2IW5A 3UT5B 3MHHC 5D5PA 3LDDA 3J7AU 4GYCB 3LNNA 2EIMB 3SDLA 1L1FA 4FLYA 4OXSA 4J9YB 2HLDG 1WN7A 4RUFA 1JX9A 4DR1B 1QR8A 5LP6C 2JVDA 1GKFA 4DR5B 2YI8A 1FFTB 2H94A 5EC2C 2QWOB 3H1LH 3QO5A 2Q0AA 4LFAB 2YIDA 1PP9H 1H2SB 4DR6O 3KG2A 4U3JB 3RBZA 2GBOA 1K97A 3ZMUA 1JFFB 3CC4V 4FK5C 3G6EV 3JD1A 3QG5A 3CRQA 3CCEV 2ZT9B 1FJGO 1XHXA 4JYAO 3UT5A 1WNSA 3CYOA 1H2NA 5CA3A 3IC7A 4J80A 1XL6A 3OR7C 2QR4A 1KUQA 4NTYA 3OE7G 2QKSA 5DEDA 2XAHA 4MT8A 2E5LO 4F6RB 3K57A 2YDEA 5FPOA 1WB8A 3ABTA 1PNLA 3D3IA 2DQ3A 3CCLV 2PGGA 1NQTA 5K1PA 4LF9B 4N23A 1VIBA 4FZ1A 2GV9A 4DUYB 1AI5A 2LQTA 2XUMA 4DW0A 5CB4B 4NB5A 4U3JA 3CX5F 2W0XA 2XT9A 3JALB 4JPRA 4TSFG 3DC6A 4FLUA 3D36A 3ASOB 5L3CA 4TV9B 5DM6V 2PF4E 5C8YB 1GN6A 2ZM6O 5BMVA 3AG3B 4UCRA 1OCOC 2CTWA 2YICA 3UO3A 4AQYO 4B3TO 1SZXA 1QLEC 4F6RA 1QCEA 1GTOA 3LSQA 4P2ZA 2Y69C 2P7TC 1M90W 2DOSA 5LMNB 4PDRA 3RT3C 3WG7C 3JASA 3ZN1A 1I5XA 3JALA 3BA8A 4UCUA 2ZDIC 4AILC 3ZX6A 2ATKC 4TV9A 1XUQA 3FAVB 1K3EA 5C8YA 1GM7A 1OZ0A 4CBCA 3ZMTA 4BW9A 4JI6B 1IBLB 1XEQA 1LNQA 3KCYA 4FFBB 1QLEB 1Q82W 2Q69A 3BY6A 4UB6Z 2P90A 4JTCB 4KHPO 2Y69B 5KAFZ 1J5EO 3S3XA 3N27A 3RN4A 1AB3A 3ML0A 1YSCA 5LYJB 1XILA 4NXMO 3RWRD 1PPJH 3WG7B 1NTMH 1MZFA 2CK3G 2R72A 3CS5A 2DE0X 1B04A 3RYIA 4JV5O 2X6CA 1N0JA 3JSNA 1XMOO 4L87A 5GTHZ 4IIJB 4X8AA 3K5OA 2F4VO 4WBNB 5LOVA 3J81N 2HP8A 4I0XA 2QM8A 1UJWB 2D3OW 2QKCA 2R9RB 3T1HO 4DRXB 1UPGA 3OTFA 3VOUA 3ZHRA 2ZQMA 5CA1B 2HR3A 5IWAB 1Y76B 3OGCC 1P49A 4MTXA 5IYZB 3C3TA 1ZSPA 3AK1A 3DC5A 3A0BZ 4U7OA 1VF7A 1HNXO 1I5YA 5EBWC 2E74B 2CGNA 5JWPA 3CJHB 4ZHQB 3G80A 3LNMB 2CAZC 4LWSB 5LYJA 4DK1A 2UUCB 3CMEV 1JMKC 3IC9A 3T1CA 2EINC 3E8FA 2ETNA 3QTCA 1I08A 4IHJB 1PKXA 3TXSA 1JQ0A 4LF5O 5BR8B 1OHHG 2GHYA 4IIJA 1VMGA 2N05A 3UKMA 3JAMN 2Q0OC 5BXZA 4LH7A 5J2TA 1SZTA 5LMUB 2XNDG 3CRAA 3ZEDA 4LF6O 1PNKA 3OEEG 5CA1A 3VBBA 1GAXA 3MD0A 1W2BU 1FXHA 1Q7YW 1K9MW 3CJHA 5EZYB 4ZHQA 2HG5C 5IJ0A 5C93A 4DR2B 2EINB 1YCIA 4LWSA 3HKBB 3OUSA 3N2KB 4FJCC 1ROPA 2D2CB 2YXHA 3SYAA 1NVPB 4JZGA 3CCMV 1Q8IA 1IBMB 3H1HH 3M7MX 4IHJA 4CZZA 4KFMA 5L3GA 3ZJZA 1BL8A 4DV0B 1BCCH 2EILC 3ZRXA 4FZ0A 3E2EA 1R3LC 5LHGA 5DECA 2LP7A 3Q4HB 1R6NA 2UXXA 1U96A 1JVMA 3VQYA 4BIZA 1NKDA 1YJNV 3KKYA 1DF5A 2FYUH 2BTQA 4DR5O 1G4YB 3ZS8C 2ZNIA 4NKGB 2IU0A 1Y74B 4BW5A 3M99B 5EZYA 1TA8A 4DR6B 1M4UA 1SQVH 2WLIA 3OR6C 1U97A 3HKBA 5L3FA 2PI5A 1KD1W 2A06H 1FJGB 2PZSA 2EILB 4RAIA 4JYAB 4CH3A 5KAIZ 2WLMA 4K35A 3SPGA 1M1KW 2RMKB 2XAQA 1QVGU 1ZTEA 3Q4HA 2WSSG 5LXTB 3ZRSA 1NR1A 1SQGA 1COWG 4WCEV 3BHPA 4GX5A 2ZE6A 1K34A 3TGUH 1BS3A 1WLEA 2AXTZ 5FLXN 5JQGB 3CCQV 2LGWA 1M5IA 4GZRB 4DV6O 1YHQV 1PM9A 2WA4A 3LSSA 3E22B 1YEWA 1OCCC 2BOCC 2HJDA 3TJTA 4X20B 1VQKV 3SYOA 2EIKC 1TVKB 4ZOLB 2ZM6B 3WFVA 1VQ5V 5H6RA 1AJNA 2YC0A 1EFRG 2R70A 4DR7O 4NXNB 4EFBA 5DN6G 2XAGA 4DO2A 2IM9A 5LXTA 2L35A 4B3TB 4B08A 1M57C 2AHZA 4R50A 2OWOA 3CPWU 5EBLC 3BVOA 5EK0A 1DGSA 4O4LB 5KMGB 3A2FA 2DYRC 1N32O 1BE3H 2LGQA 2Z5UA 1OCCB 4LCUC 2VRZA 3G67A 1P7GA 5KX5A 2F66C 1FFXA 2EIKB 1YDXA 1VF6A 4K0KO 4O4IA 4FFKA 4LNUB 4X20A 2Q7HA 2OTLV 2JGDB 1TVKA 4X1YB 2ADPA 1XNQO 1TGOA 1M56C 1F23A 3SJBC 1G8MA 3T1YO 4DV3O 4J7JA 4YY3O 2WLKA 2VWKA 3ZMSA 3B40A 1M57B 1RFYA 5IDJA 1FD9A 2L6LA 4P9OA 1JOYA 1WB7A 2QEXV 3SYCA 4KHPB 4D6TH 1J5EB 1BT8A 2DYRB 5B3SC 3K9AA 2HHHO 4O4LA 4NXMB 5KMGA 4QIWF 4ZI7B 2YUAA 1PL0A 3ZRVA 1S3JA 1WA8A 1QU7A 3F7VC 4JV5B 1N8RW 1XMOB 4DR4B 1IDSA 2MW2B 2F4VB 1M56B 1ZX3A 4JI4B 4LNUA 5TISZ 2JGDA 1AI7A 3H9VA 4X9QA 4L8JA 2ARHA 4JI5B 3ZRWA 1HNZO 3JD2A 3DSQA 4DV5O 4R7CA 2IJIA 5B3SB 3ZHUA 1HNXB 3DXRB 3JCZA 3JARB 3K9SA 5IT9N 2IJHA 1FS0G 5CBFA 1VQNV 3HB3B 1F51A 4O2BB 3WU2Z 2QE7G 2F43G 1KKDA 2UUCO 4H0LB 4H37A 4UUJC 3B2EE 1H2MA 4LF5B 1NS1A 1ZUQA 1DLBA 4CC6A 4B7KA 3VQXA 3FYIB 3LUTB 5J2UA 4IYIA 3P32A 2QTSA 1MOFA 2FB5A 2BCCH 1W0JG 4LF6B 4G2KA 3OD4A 2YIBA 1CEZA 1S0VA 1NR7A 5GONA 5H2FZ 3DXRA 1EN5A 4QNHB 1Y67A 1WAZA 1H2GA 4JI1O 1R3JC 1YJWV 3RYCB 1SETA 2JEXA 4I9WA 4WFHA 4O2BA 4RQEA 1OJHA 2RCVA 3UQ8A 3AG4C 5LGTA 2JJ2G
chains in the Genus database with same CATH topology
1QR9A 1KP2A 1YITV 1XL4A 4PDRA 1KP3A 2JIZG 1YJ9V 2B1GA 2EJRA 3WG7C 2C2AA 2EBOA 4QJFB 1FXKB 1K7DA 3ZN1A 5BZBA 1I5XA 3ZRWB 3CP1A 1K5QA 3CCRV 2ZDIC 3UM7A 3W7UA 2ATKC 4MTFA 1DTOA 1JCHA 2IH3C 2ZR3A 5H9CA 1K3EA 3A0RA 1GM7A 2ITDC 2DWEC 1OZ0A 4MVUA 5FL7G 4CBCA 3ZMTA 3ABMB 3OMIB 5KUMA 3K3WA 1OCRB 1LNQA 1QLEB 1Q82W 2Q69A 1S76D 3BY6A 4MVMA 2MK3A 3CCJV 1SRYA 3AG1B 3ETDA 4PDLA 4WFEA 3RW0A 5CBHA 1VQLV 2P90A 4JTCB 3GB7C 2Y69B 3OMAB 1VQ6V 2H8PC 3AG4B 2ZXWC 5EBMC 1EBOA 4PA4A 2XAFA 4P30A 3ML0A 3SPCA 2OT5A 1YSCA 2XASA 3WG7B 3JYCA 4MVOA 3STZC 2ZD9A 2W0FC 3ABKC 1GM8A 4X88A 3CC7V 1YI2V 2CK3G 3MHSC 5IYBO 1FXKA 3BEHA 1RM1C 2X6CA 4L87A 4X8AA 3ASOC 2EZPA 4J9ZB 4KP4A 5LGUA 1SERA 3AG3C 5EC1C 4JTAB 2GSMB 3CC2V 2FTKA 1IXMA 1E79G 4LP8A 2QM8A 1UJWB 2D3OW 2R9RB 5B1NA 2OCCC 2HVJC 4FIPC 3VOUA 3QO7A 2ZQMA 1JPXA 2HR3A 3CD6V 2Q6AA 3OGCC 2ZXWB 3E86A 3TK1A 1MG1A 4MTXA 4U7OA 1I5YA 4JASA 5EBWC 1K92A 1YTFD 1P4RA 3ABKB 3LNMB 2WPDG 1KC8W 2EIJC 2IJJA 5IYCO 1DF4A 3CMEV 2YEVB 4MTOA 1NH2B 3K08A 1RM1B 3T1CA 2EINC 3E8FA 3NXSA 4HYOA 3OEHG 1NH2D 4GT1A 1FXKC 4UV9A 1PKXA 4R6ZA 4WFGA 1H8HG 1JQ0A 3LDCA 3SYPA 3IFXA 1OHHG 2GHYA 2P67A 2X6AA 2JDIG 1R73A 3UKMA 2OTJV 3ZMZA 1SZTA 5KA6A 2X6BA 4ASUG 2XNDG 1QBZA 3SPIA 5KUKA 2WWWA 2ZR2A 4FMTA 3FB8C 4N21A 4TWKA 1OCRC 3ASNC 3OFNG 1PNKA 3OEEG 5CMUA 3SPHA 3VBBA 1QVFU 4MVRA 3AG1C 5LBQA 3CXCU 3MD0A 4MVQA 3OAAG 1W2BU 1FXHA 2EIJB 1Q7YW 3I55V 1K4DC 4MW3A 4BIUA 1KECA 1K9MW 2HG5C 5C93A 1SESA 2IH1C 2EINB 3ETGA 3PJSK 4JAUA 4UXNA 4P9PA 2LFSA 2YEVA 3OUSA 4PA6A 3H01A 4FJCC 1ROPA 2QM7A 1R3KC 2R9IA 4WFFA 3SYAA 3T4ZA 3CCMV 1NVPB 3CMAV 3AG2C 4CZZA 4KFMA 5L3GA 1NVPD 1B6QA 3ZJZA 4FPPA 2DWDC 5LHHA 3ABLC 1BL8A 1V54C 3ZIAG 2Q68A 5B1AC 2EILC 3ZRXA 3E8BA 3E2EA 1R3LC 1VQMV 4MS2A 5LHGA 5H6QA 1MABG 3ASNB 1PNMA 2LP7A 1K8AW 2P6JA 3RVYA 1R6NA 2JK5C 5B1BC 4DXWA 1K33A 2IU3A 2UXXA 2XAJA 1JVMA 5CN0A 4BIZA 1NKDA 3P30A 4EKWA 1YJNV 1RPOA 1DF5A 2WLNA 3SPJA 2JEUA 4LBEC 3E8GA 4GCZA 4MW8A 4TT3G 1G4YB 5LHIA 1W0KG 2IU0A 1QLNA 4BW5A 3M99B 2W6JG 1TUEB 1V55C 3SJQC 2WLIA 2LFRA 3OR6C 5KA5A 4WFAV 3AG2B 1Y4MA 3IGAC 4UVBA 3E8HA 5J9PC 5L3FA 4XDLA 3OW2U 4QE7A 3ABLB 2PI5A 1KD1W 1V54B 4GX2A 4U7NA 2DW4A 4JTDB 4PA7A 2EILB 4RAIA 4QE9A 2A79B 4UV8A 4KUMA 5B1AB 1K5SA 3K79A 4JYCA 2B1IA 2WLMA 3SPGA 3OUFA 5B1BB 2AHYA 1NBMG 4BAYA 1R3IC 1QVGU 2XAQA 1M1KW 3AEIA 5IY5C 2V1DA 4PELA 1VQPV 1P7BA 3ZN0A 2WSSG 3ZRSA 1GO3F 1NR1A 3B8MA 1COWG 3QO8A 4PA9A 4WCEV 4GX5A 3E83A 1S77D 1K34A 1S5HC 3W7XA 1K4CC 4G28B 4Z1MG 1ENVA 2NNUA 1NJIW 3FKSG 1WLEA 2B5UA 3CCQV 4PDMA 5HFMA 5LGNA 3QNEA 5E1AC 3R65A 1V55B 2KB1A 1ORQC 1BHBA 1YHQV 2ITCC 1CPYA 3DGEA 4ZBMA 1R6KA 4JGSA 3LSSA 1AJPA 1Q81W 1YIJV 1OCCC 2BOCC 2NLJC 2BOBC 3FB7C 4JAVA 1VQ4V 1VQKV 3SYOA 1VQOV 2EIKC 3JD4A 3T2MA 2M7WA 5L3EA 3WFVA 1VQ5V 5H6RA 2EZOA 5IY5B 1AJNA 3E89A 4GX1A 1EFRG 2K1EA 2X0LA 3FB5C 1VQ9V 1S72V 1MSWD 4ZKIA 5DN6G 2XAGA 4F4LA 3STLC 4DO2A 2PI4A 1Q86W 4RQFA 1M57C 2AHZA 2DQ0A 2X7RB 4R50A 4X89A 2EIMC 4JF3A 2Y48A 3EHBB 3CPWU 5EBLC 1KQSU 3OMNB 1AJQA 5EK0A 4MVSA 1AR1B 2WLIB 3SYQA 3K0GA 4UVAA 2DYRC 2Z5UA 1OCCB 3W7SA 3I56V 2HJFC 3K06A 4LCUC 2WLJA 5IYDO 3HPLC 3E35A 2EIKB 5B1OA 4MVZA 1AI6A 4G27B 2JJ1G 3JD3A 4MSWC 3W7WA 1GK9A 2OTLV 2A9HA 1VQ8V 2HFEC 3G4SV 1E1QG 1M56C 4UVCA 1F23A 4LC1A 2IW5A 1G8MA 1WPXA 2WLKA 3MHHC 3ZMSA 1ZWIC 4GX0A 3LDDA 1OCOB 1M57B 5IDJA 1HWYA 1THZA 2EIMB 3CCSV 4P9OA 3CCVV 5CBGA 1JJ2U 2QA4V 1JOYA 2QEXV 3SYCA 1L1FA 4OXSA 4J9YB 2HLDG 2DYRB 4RUFA 1JX9A 2XOKG 1QR8A 1VQ7V 5B3SC 3K9AA 4I5SA 3DTUB 1GKFA 3EFFK 2DYSC 4QIWF 3ETEA 1PL0A 1FFTB 2H94A 5EC2C 1BHAA 2WLLA 3ZRVA 2QTOA 1S3JA 4Q20A 3X2QC 4PDVA 3K03A 3F7VC 3QO5A 3K04A 2Q67A 3G71V 1N8RW 2WAMA 3JD0A 3KG2A 1F4NA 3FB6C 3RBZA 1M56B 2A0LA 1K97A 3F7YC 3K0DA 3ZMUA 3CC4V 4FK5C 3G6EV 1AI7A 3JD1A 1GM9A 4PA3A 1E1RG 4RUEA 3CCEV 1H38A 2IJKA 3ZRWA 3CYOA 3JD2A 2W6IG 4RO2A 3F5WC 3W7TA 5CA3A 3IC7A 4E2LA 4R8CA 4R7CA 3RVZA 1XL6A 2IJIA 3OR7C 4HAMA 5B3SB 3JCZA 2DYSB 3OE7G 3CCUV 2QKSA 3ABUA 3B77A 2XAHA 4MT8A 3ZCCA 1BMFG 2IJHA 1FS0G 5CBFA 1VQNV 1J95A 2Z3YA 3HB3B 3GWOA 4QPKA 3X2QB 1OCZC 3ABTA 4MTGA 3TCUA 1F51A 1PNLA 3D3IA 2DQ3A 3LDEA 2QE7G 1YTFB 3CCLV 2F43G 1NQTA 1KKDA 3T4DA 3FYEB 4H37A 4N23A 4XDKA 5L3BA 4UUJC 3B8NA 4JYBA 1AI5A 5L3DA 3TETA 1DLBA 1PD3A 3FYIB 2YSUB 4JPRA 4TSFG 1H8EG 5HFLA 3LUTB 4WFBV 3D36A 3P32A 4XBFA 1MOFA 3ASOB 5L3CA 4WF9V 2ZDIA 5DM6V 1EZJA 3AG3B 4HZ3A 1W0JG 3OM3B 1OCOC 4G2KA 2UXNA 3ZMVA 1Y66A 2OCCB 1CEZA 1S0VA 1K73W 2HKOA 1NR7A 2HVKC 2V7QG 2WLHA 1F4MA 3ABMC 1OCZB 1AI4A 4QNHB 2WLLB 4YXWG 1H2GA 1R3JC 1YJWV 1QLEC 1GMGA 1QCEA 4QPJA 4H33A 1SETA 2JEXA 4XDJA 4I9WA 4WFHA 5GW7A 1GTOA 4RQEA 3LSQA 4P2ZA 2Y69C 1M9NA 3AG4C 1AROP 1CP9A 1RPRA 1FXVA 2P7TC 1M90W 5LGTA 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX5 A;  3E83 A;  1XL4 A;  1S5H C;  4PDR A;  5EC2 C;  1K4C C;  3WG7 C;  2WLL A;  2QTO A;  4G28 B;  2X6B A;  5BZB A;  3X2Q C;  4PDM A;  3SPI A;  4PDV A;  5KUK A;  3K03 A;  3F7V C;  5E1A C;  3R65 A;  2KB1 A;  3K04 A;  1ORQ C;  2Q67 A;  3UM7 A;  3FB8 C;  4TWK A;  2ATK C;  1OCR C;  3ASN C;  2ITC C;  4MTF A;  2IH3 C;  3FB6 C;  3KG2 A;  3RBZ A;  4ZBM A;  3SPH A;  2A0L A;  3F7Y C;  3K0D A;  3AG1 C;  2ITD C;  4MVR A;  2DWE C;  4MVU A;  4CBC A;  1OCC C;  4PA3 A;  4MVQ A;  2BOC C;  4RUE A;  2NLJ C;  2BOB C;  5KUM A;  1K4D C;  1LNQ A;  3FB7 C;  4MW3 A;  2Q69 A;  2HG5 C;  4MVM A;  2IH1 C;  3SYO A;  2EIK C;  3PJS K;  4RO2 A;  3RW0 A;  4PDL A;  4WFE A;  5CBH A;  3T2M A;  3F5W C;  4JTC B;  3GB7 C;  4P9P A;  2YEV A;  3OUS A;  4PA6 A;  2H8P C;  2ZXW C;  4WFF A;  4R8C A;  4R7C A;  1R3K C;  5EBM C;  1XL6 A;  3RVZ A;  4PA4 A;  3E89 A;  3OR7 C;  4GX1 A;  4P30 A;  3T4Z A;  2K1E A;  3SPC A;  3AG2 C;  2QKS A;  3FB5 C;  4KFM A;  3ZJZ A;  3JYC A;  4F4L A;  2DWD C;  4MVO A;  2ZD9 A;  3STL C;  3ABL C;  2W0F C;  3ABK C;  4X88 A;  3STZ C;  5CBF A;  1BL8 A;  1J95 A;  1V54 C;  1OCZ C;  2Q68 A;  4MTG A;  3TCU A;  5B1A C;  2EIL C;  1M57 C;  2AHZ A;  3LDE A;  3E8B A;  4R50 A;  4X89 A;  1R3L C;  2EIM C;  1KKD A;  4MS2 A;  3BEH A;  5EBL C;  2X6C A;  3T4D A;  5EK0 A;  4H37 A;  4XDK A;  4MVS A;  4UUJ C;  4X8A A;  3RVY A;  3ASO C;  2WLI B;  2JK5 C;  3K0G A;  4J9Z B;  5B1B C;  3SYQ A;  2DYR C;  4DXW A;  3TET A;  1JVM A;  2HJF C;  3AG3 C;  5EC1 C;  4EKW A;  4JTA B;  3K06 A;  4LCU C;  4LP8 A;  3SYA A;  2WLJ A;  3LUT B;  2WLN A;  3SPJ A;  2R9R B;  4LBE C;  3HPL C;  2OCC C;  3E8G A;  2HVJ C;  4MW8 A;  1G4Y B;  3VOU A;  4BW5 A;  4MVZ A;  2Q6A A;  3OGC C;  4G27 B;  4MSW C;  1V55 C;  3E86 A;  4HZ3 A;  3SJQ C;  1OCO C;  2WLI A;  3OR6 C;  2A9H A;  3IGA C;  2HFE C;  3E8H A;  5EBW C;  5J9P C;  1M56 C;  4XDL A;  4QE7 A;  2HVK C;  2WLH A;  2WLK A;  3LNM B;  1ZWI C;  3ABM C;  4GX2 A;  4GX0 A;  2EIJ C;  2WLL B;  3LDD A;  4JTD B;  4PA7 A;  4QE9 A;  2A79 B;  4RAI A;  1R3J C;  4QNH B;  4MTO A;  1QLE C;  4P9O A;  5CBG A;  3K08 A;  3UKM A;  4H33 A;  3T1C A;  4XDJ A;  2EIN C;  3E8F A;  4I9W A;  2WLM A;  4WFH A;  4HYO A;  3SPG A;  3SYC A;  3OUF A;  4OXS A;  4J9Y B;  2AHY A;  4P2Z A;  2Y69 C;  4R6Z A;  4RUF A;  4WFG A;  1R3I C;  3AG4 C;  2P7T C;  3LDC A;  5IY5 C;  1P7B A;  3IFX A;  3SYP A;  5B3S C;  3ZRS A;  2X6A A;  3EFF K;  2DYS C;  4PA9 A; 
#chains in the Genus database with same CATH topology
 4DV4 O;  2JIZ G;  1IBM O;  2C2A A;  4NTW A;  1FXK B;  2NR5 A;  3SJC C;  1SQQ H;  5F2V O;  3CP1 A;  3HKC A;  2GDS A;  3D36 C;  4CS4 A;  3W7U A;  2CH7 A;  4DV0 O;  3IAY A;  2QWR B;  2UUA O;  3A0R A;  3F5T A;  3L9D A;  5FL7 G;  4TQD A;  1GRJ A;  1D2D A;  2MK3 A;  3U0Z A;  5CBH A;  1SQF A;  1VQ6 V;  2H8P C;  3AG4 B;  2ZXW C;  3J80 N;  3RYC A;  1EBO A;  4P30 A;  3SR2 C;  3SPC A;  1XI1 A;  2OT5 A;  4DK0 A;  2AZ0 A;  3JYC A;  3STZ C;  2ZD9 A;  3JSL A;  3CC7 V;  4CH4 A;  1MSD A;  3MHS C;  4UCO A;  1FXK A;  4TQF A;  5BMV B;  1D5A A;  3D3Q A;  3ASO C;  3QVN A;  5LGU A;  2F95 B;  2IBZ H;  1SER A;  3AG3 C;  2GSM B;  2FTK A;  1E79 G;  3O9O A;  2YIB D;  1IZ3 A;  5B1N A;  3UCS C;  4FIP C;  3L71 H;  2Z0A A;  3CD6 V;  2QSA A;  2ZXW B;  3E86 A;  3TK1 A;  4DV6 B;  1AP6 A;  1MG1 A;  3GVM A;  5CA0 B;  2ZNJ A;  2FL4 A;  4YHH O;  2RQ6 A;  3TXQ A;  1LR1 A;  2CTR A;  4UCS A;  4B3S O;  1SC5 B;  4I50 B;  2WPD G;  2EIJ C;  3HKE B;  3JAS B;  3O65 A;  2YEV B;  3K08 A;  4PI0 A;  3NXS A;  2ADQ B;  3S3W A;  4CS2 A;  1XOU A;  3KCX A;  4GT1 A;  1NH2 D;  1Q3E A;  4J11 A;  4DR7 B;  3LDC A;  3SYP A;  1RP3 B;  3VQW A;  2OTJ V;  3CE2 A;  2BSK B;  4NXN O;  2X6B A;  4ASU G;  3BAA A;  2RNB A;  1XRE A;  1QBZ A;  5KUK A;  1QQC A;  4FMT A;  3OTO O;  5D5Q A;  4LFC B;  4X66 O;  4E4E A;  4N21 A;  1I7F A;  4B7E A;  2LW1 A;  3SPH A;  1QVF U;  2QGN A;  1N32 B;  1L0N H;  5KLV H;  2JGU A;  3MDS A;  4MVQ A;  5CA0 A;  2EIJ B;  2CGO A;  1KEC A;  1CXZ B;  2YIA A;  4I50 A;  4B3M O;  2ZIO A;  4JAU A;  4K0K B;  3RYI B;  3HKE A;  2LFS A;  2YEV A;  2R9A A;  2P4K A;  3H01 A;  4WFF A;  2QM7 A;  2R9I A;  1XNQ B;  1XNR O;  4FLT A;  3CMA V;  3OT7 A;  1YZB A;  3BAB A;  4U3F H;  5LOV B;  3T1Y B;  2KQX A;  4DV3 B;  4YY3 B;  1R6T A;  1NTZ H;  2DWD C;  5LHH A;  3ABL C;  4I0X B;  1H2K A;  3E8B A;  2BSK A;  1S5L Z;  1VQM V;  1SKV A;  4TUY A;  2BE3 A;  5B66 Z;  2HHH B;  2XAJ A;  3ZHT A;  4Z2W A;  4EKW A;  5GTI Z;  3K5N A;  2FKX A;  3SPJ A;  2JEU A;  4LBE C;  4ICG A;  5LHI A;  1QLN A;  1HDJ A;  1BGY H;  1N4C A;  1NTK H;  3RYF B;  5KA5 A;  1HW7 A;  4WFA V;  3CEI A;  1EZV H;  3IGA C;  5JJE B;  4DR4 O;  2AZ2 A;  3ABL B;  5J2T B;  4JI4 O;  3L72 H;  4PA7 A;  4QE9 A;  2A79 B;  3D8C A;  1HNZ B;  1K5S A;  4JYC A;  1GN4 A;  4JI5 O;  1TUB B;  4NYK A;  4DV5 B;  1KBH A;  2AHY A;  1NBM G;  1R3I C;  4DW1 A;  1HR0 O;  1VQP V;  4JAA A;  3ZN0 A;  5KHK A;  4JI2 O;  1S77 D;  4IGG A;  4Z1M G;  2NNU A;  3FKS G;  1B3Q A;  5IJ0 B;  1Z2G A;  4PDM A;  5HFM A;  3AG7 A;  3QNE A;  3R65 A;  1BHB A;  2UUB O;  4NR1 A;  2RDC A;  3RYF A;  4C7U A;  4KL1 A;  1LUV A;  4I7Z B;  3HKD B;  1JA8 A;  1WP8 A;  2LJ2 A;  2K1E A;  1L8D A;  1TUB A;  4FLZ A;  2EJ7 A;  1MSW D;  4JZ2 A;  3STL C;  5A2Q N;  1LUW A;  2PI4 A;  4JI1 B;  2DQ0 A;  2BTQ B;  3EHB B;  5IJ9 B;  4MVS A;  2WLI B;  4AHC A;  3K0G A;  4UVA A;  3I56 V;  3B4S A;  4DV4 B;  3IJ4 A;  4RWU A;  2WLJ A;  5IYD O;  3G6B A;  1TAE A;  1VAR A;  3E35 A;  2AW9 A;  3BA9 A;  4X65 O;  4GLX A;  3APO A;  2JJ1 G;  3JD3 A;  3W7W A;  1GK9 A;  4EB6 A;  3HKD A;  2QKA A;  2UUA B;  1Q6H A;  2HFE C;  3G4S V;  4O2A B;  1VF5 B;  1WPX A;  1IBK O;  1KU9 A;  2UU9 O;  4GX0 A;  5KHH A;  4PJ0 Z;  1KMI Z;  1JJ2 U;  2QA4 V;  3N2G A;  4J42 A;  4TOI A;  2XOK G;  1VQ7 V;  5IJ9 A;  3DTU B;  4D7T A;  2DYS C;  3H1I H;  3ETE A;  4UB8 Z;  1BHA A;  2DJV A;  4X64 O;  2WLL A;  2QTO A;  1G6U A;  2G38 A;  4PDV A;  3K03 A;  1A32 A;  3K04 A;  4J7K A;  1VF6 C;  2WAM A;  1F4N A;  1SF9 A;  2A0L A;  3K0D A;  1GM9 A;  4JI8 B;  1E1R G;  4RUE A;  1H38 A;  2IJK A;  2VWJ A;  1BSM A;  2FML A;  4O2A A;  2M6Y A;  1RSO B;  3AK2 A;  4RO2 A;  1HNW B;  1XMQ O;  3F5W C;  2YXL A;  4E2L A;  4FM0 A;  4R8C A;  1NU1 H;  3HR0 A;  2E3C A;  3RVZ A;  3RYH B;  4YHH B;  2DYS B;  3ZCC A;  4B3S B;  4DV1 O;  1BMF G;  1QHT A;  1J95 A;  2Z3Y A;  5KX5 B;  3GWO A;  1OCZ C;  4MTG A;  3CRR A;  1FFX B;  3LDE A;  1YTF B;  1YF2 A;  4O4I B;  3T4D A;  3FYE B;  2ZKO A;  3B8N A;  4JYB A;  1BQZ A;  2ZE5 A;  3H1K H;  5FPR A;  5JH7 B;  5HFL A;  2H3O A;  4A5U B;  4WF9 V;  4XBF A;  4PD4 F;  1G1X B;  3GWK C;  4J10 A;  3OTO B;  2Y0I A;  4X66 B;  4LF8 O;  1RSO A;  3FD9 A;  1BQ0 A;  1Y66 A;  1NT2 B;  2OCC B;  4LFC O;  2CE4 A;  1K73 W;  2HKO A;  1US6 A;  2HVK C;  4GKK O;  1AR4 A;  2WLH A;  4X1I A;  4CH5 A;  3RYH A;  1F4M A;  2F23 A;  1OCZ B;  4YXW G;  4DYL A;  5ITZ B;  5JCO C;  1WA8 B;  4NVP A;  4B3M B;  4QPJ A;  4EEQ A;  5GW7 A;  1XNR B;  1M9N A;  1CP9 A;  1RPR A;  3RGB A;  1QR9 A;  1Q43 A;  1KP2 A;  1YIT V;  1KP3 A;  4LR3 A;  1YJ9 V;  2B1G A;  4QJF B;  2EBO A;  2CUG A;  1JJO A;  2VQE O;  3P3N A;  5BZB A;  3ZRW B;  4OPA A;  5JH7 A;  3CHX A;  3CRC A;  3UM7 A;  1FPO A;  4MTF A;  1DTO A;  1JCH A;  2ZR3 A;  4LH6 A;  4X1K B;  4MVU A;  3CSX A;  2EX3 A;  3MAQ A;  3OMI B;  5KUM A;  1OCR B;  2E75 B;  4MVM A;  1SRY A;  3AG1 B;  5LA6 B;  4PDL A;  4WFE A;  3RW0 A;  5ITZ A;  3GB7 C;  1M93 A;  3OMA B;  2KKW A;  2ZCE A;  5EBM C;  2XAF A;  4ABM A;  2XAS A;  4B3R O;  2W0F C;  2Q73 A;  3ABK C;  4LFB B;  5J2U B;  1YI2 V;  1VP7 A;  5IYB O;  5EYP B;  2HEP A;  3RFR A;  4DUZ O;  1HR0 B;  1N34 O;  3KZI Z;  1AIL A;  3CC2 V;  4JI2 B;  5GON B;  4LP8 A;  1FAF A;  4X1K A;  3A8T A;  5E79 Z;  5JCO A;  4I55 A;  3UO2 A;  5KHJ A;  2UUB B;  1GN2 A;  5LA6 A;  4JAS A;  4HNA A;  1YTF D;  1P4R A;  3ABK B;  2UXC B;  1XBL A;  2CDY A;  3JAT B;  4I4T B;  1KC8 W;  5IYC O;  2WA3 A;  1NH2 B;  3HKC B;  4YIP A;  2JS5 A;  4YJ2 A;  4HYO A;  2CH7 B;  3OEH G;  2CTQ A;  4UV9 A;  1FXK C;  4DV2 O;  4WFG A;  5EYP A;  2X6A A;  2JDI G;  1R73 A;  4IT5 A;  2VQF O;  2OIE A;  5BY1 A;  3K58 A;  4O4H A;  3JAW A;  2EUL A;  2ODM A;  3SPI A;  2WWW A;  4JI0 O;  3FB8 C;  3FFQ A;  4PI2 A;  4TWK A;  4FLW A;  3ASN C;  3OFN G;  4Q6G A;  5CMU A;  2GUZ A;  2OCH A;  4NTX A;  4MVR A;  4K3A A;  3I55 V;  4MW3 A;  3ZHQ A;  1SES A;  4X65 B;  3JAT A;  4I4T A;  1AR5 A;  4UXN A;  4PA6 A;  1R3K C;  1ZLZ A;  3WB1 A;  3AG2 C;  1QNM A;  1S5J A;  2Q7E A;  1IBK B;  1B6Q A;  1MMM A;  2Q7G A;  2UU9 B;  3ZIA G;  2Q68 A;  4GKJ B;  3BCC H;  3WB2 A;  4MS2 A;  3ASN B;  1PNM A;  1T5E A;  2Q4P A;  2QM4 A;  3RVY A;  4YIO A;  5B1B C;  1K33 A;  2IU3 A;  3L70 H;  3L75 H;  5CN0 A;  1N36 O;  2NN4 A;  2P5O A;  1RPO A;  4X64 B;  1SQB H;  2WLN A;  3M8A A;  2VS0 A;  1TUE B;  1V55 C;  3SJQ C;  2LFR A;  2ILM A;  3AG2 B;  3CWB H;  5J9P C;  4CH6 A;  1Q5O A;  1SS3 A;  4QGP A;  4OGQ B;  4UV8 A;  4JTD B;  1L0L H;  4JI8 O;  2B1I A;  1GH6 A;  4W4K A;  1XMQ B;  4F6E A;  4D7S A;  5B1B B;  4Z1V A;  4BAY A;  1HNW O;  3AEI A;  5IY5 C;  2V1D A;  2E76 B;  1P7B A;  3B8M A;  4OX9 O;  5H5N A;  4DV1 B;  5KHG A;  3W7X A;  1K4C C;  4G28 B;  1ENV A;  2B5U A;  2PTM A;  5E1A C;  5LP6 B;  1V55 B;  1EN6 A;  2ITC C;  1CPY A;  3DGE A;  4ZBM A;  1R6K A;  5K1X A;  1N0N A;  1WP7 A;  3FB7 C;  4JAV A;  1VQ4 V;  1VQO V;  3SJA C;  3JD4 A;  1O9H A;  2OIG A;  4LF8 B;  4I9Q A;  5IY5 B;  4TUY B;  3E89 A;  1JFF A;  3R66 A;  3FB5 C;  1VQ9 V;  1S72 V;  4ZKI A;  4GKK B;  1YVW A;  2BTO A;  4BWA A;  2ZE7 A;  1N33 O;  2O57 A;  3OGI B;  4RQF A;  2Y4U A;  5EIB D;  3CRM A;  4JF3 A;  2Y48 A;  1KKC A;  3WB0 A;  1KQS U;  1Z5V A;  2AGA A;  3OMN B;  1AJQ A;  1V9P A;  1IXB A;  5LP6 A;  3SYQ A;  1AR1 B;  1NZ6 A;  2HJF C;  5KHI A;  1ZAU A;  2VQE B;  5B1O A;  4DV7 B;  1AI6 A;  4G27 B;  3H1J H;  2QWQ B;  4AI8 A;  2Q5Z A;  1WJZ A;  2A9H A;  5CB4 A;  4LC1 A;  4TV8 B;  2YI9 A;  3K5L A;  1ZWI C;  1OCO B;  1BZK A;  1HWY A;  1THZ A;  3CCS V;  3CCV V;  5CBG A;  4LF7 O;  3U11 A;  1D5N A;  3NR7 A;  1NI8 A;  2DN9 A;  4JI7 O;  2Y4T A;  1SQP H;  2P06 A;  2QWP B;  4I5S A;  4EFE A;  3EFF K;  1YXB A;  5LL6 Y;  3ZHS A;  4JI3 B;  1O9G A;  4B3R B;  4Q20 A;  2GTS A;  2V4D A;  3X2Q C;  1MNG A;  3APQ A;  4LFB O;  2Q67 A;  3G71 V;  3JD0 A;  4DUZ B;  1FKA O;  3FB6 C;  3B09 A;  3F7Y C;  1DK1 A;  1N34 B;  2UXB B;  4JYY A;  4PA3 A;  1R1B A;  1KB9 F;  4TV8 A;  1Y6X A;  2B9Z A;  2W6I G;  3W7T A;  3C90 A;  2PY5 A;  3FAV A;  1W59 A;  4HAM A;  3CCU V;  3ABU A;  3B77 A;  1IVS A;  1I94 B;  4FFB A;  1KYO F;  3CXH F;  4QPK A;  1EM1 A;  3X2Q B;  3TCU A;  2UXD O;  2UXC O;  4PHZ A;  3LSU A;  2N04 A;  4KXR A;  4EB6 B;  4XDK A;  5L3B A;  4DV2 B;  5FNV B;  3TET A;  5L3D A;  2PYJ A;  4OPH A;  1PD3 A;  2VQF B;  2YSU B;  1H8E G;  4WFB V;  4ZIB A;  2ZDI A;  1EZJ A;  1JR9 A;  4O4J B;  4JI0 B;  2PYL A;  3N2G B;  4HZ3 A;  3OM3 B;  4LF4 O;  2UXN A;  4WBN A;  3ZMV A;  1F7Y A;  2JS3 A;  2V7Q G;  4IYH A;  3ABM C;  1AI4 A;  2WLL B;  2XTA A;  4DRX A;  1AP5 A;  1GMG A;  1Y76 A;  4H33 A;  4XDJ A;  4DR3 O;  5IYZ A;  2KG7 B;  1ARO P;  3JAK B;  1FXV A;  3ZHV A;  4YJ3 B;  2LO1 A;  5FNV A;  1XL4 A;  4IL6 Z;  2EJR A;  2A7W A;  1K7D A;  1WPB A;  1K5Q A;  3CCR V;  4FLX A;  4GKJ O;  2IH3 C;  4BIO A;  5H9C A;  4O4J A;  4X62 O;  2ITD C;  2DWE C;  5A9G A;  1N36 B;  3ABM B;  2N74 A;  3K3W A;  1S76 D;  3CCJ V;  3ETD A;  1VQL V;  2JRI A;  1PV0 A;  4PA4 A;  4DR1 O;  5JJN B;  5B5E Z;  2KG7 A;  2ZIM A;  4FM2 A;  3JAK A;  4MVO A;  1IUR A;  4X88 A;  1GM8 A;  4YJ3 A;  3BEH A;  1RM1 C;  3BFR A;  4LFA O;  3N2K A;  2EZP A;  4J9Z B;  4KP4 A;  4OX9 B;  5EC1 C;  2K9P A;  4JTA B;  1IXM A;  4X1I B;  5JVD B;  2OCC C;  2HVJ C;  3QO7 A;  1JPX A;  3C3S A;  2Q6A A;  1Q6I A;  2QDO A;  3QF7 A;  2E5L B;  2F1M A;  3EXA A;  1K92 A;  1EN4 A;  2IJJ A;  1DF4 A;  3THO A;  4MTO A;  1AVM A;  1Y74 A;  2RN9 A;  1RM1 B;  4LF9 O;  4W4L A;  4R6Z A;  4DUY O;  1SA0 B;  1H8H G;  1MZE A;  3I5D A;  3IFX A;  2P67 A;  3CB2 A;  3ZMZ A;  5KA6 A;  1N33 B;  3P3P A;  3PN1 A;  2ZR2 A;  3AK3 A;  5JVD A;  1OCR C;  1Q90 D;  2KSD A;  4H44 B;  4AQY B;  3AG1 C;  5LBQ A;  3CXC U;  3K5M A;  4PV1 B;  3OAA G;  4FLV A;  5IE9 A;  1K4D C;  4BIU A;  3BPZ A;  2QWN B;  2ZE8 A;  2P22 C;  5JQG A;  1PL4 A;  2IH1 C;  3ETG A;  3PJS K;  1IX9 A;  1Q6U A;  4H13 B;  2RJZ A;  1XQ8 A;  4P9P A;  4HBN A;  3T4Z A;  4DV7 O;  3E22 A;  3SGI A;  5LMN O;  3JCU Z;  1NVP D;  1SA0 A;  2PUS A;  4FPP A;  1V54 C;  5B1A C;  4FM1 A;  4ZOL A;  4LF7 B;  5H6Q A;  4I55 B;  1MAB G;  3FX7 A;  1K8A W;  2P6J A;  4JI7 B;  2JK5 C;  4DXW A;  4BR6 A;  4K8Z A;  2F93 B;  4HNA B;  3P30 A;  1MA1 A;  4JI6 O;  1IBL O;  1ZL8 B;  2Y0P A;  3E8G A;  4GCZ A;  4MW8 A;  4TT3 G;  1I0H A;  4JI3 O;  1W0K G;  2W6J G;  4YJ2 B;  3K59 A;  1Y4M A;  1FYJ A;  4UVB A;  3E8H A;  4CC5 A;  4XDL A;  3OW2 U;  2YS8 A;  4QE7 A;  3L74 H;  3A0H Z;  1V54 B;  4GX2 A;  4U7N A;  5B1A B;  2DW4 A;  2UXB O;  1URF A;  2GTA A;  4KUM A;  4O4H B;  3JAW B;  3K79 A;  2Q9L A;  1GN3 A;  3OUF A;  4X1Y A;  4UCV A;  2GUZ B;  3VQV A;  4PEL A;  2LW7 A;  1GO3 F;  3T1H B;  3QO8 A;  4PA9 A;  3E83 A;  1XDC A;  1S5H C;  1OV9 A;  2OYQ A;  5EIB C;  2UXD B;  5JJJ B;  1NJI W;  4GUN A;  2DMX A;  5LGN A;  4UCT A;  2CTP A;  1ZL8 A;  2KB1 A;  1ORQ C;  1I94 O;  5IWA O;  1UFI A;  5AG2 A;  4UFZ A;  4J41 A;  4JGS A;  2YXY A;  1Q81 W;  1AJP A;  1YIJ V;  4ZI7 A;  2NLJ C;  4FVM A;  2BOB C;  1VEW A;  3ICX A;  1SQX H;  2ZIN A;  1X4T A;  1XHZ A;  3T2M A;  2M7W A;  5L3E A;  2EZO A;  1Z5W A;  4LF4 B;  4GX1 A;  5BR8 O;  3L73 H;  4K8X A;  4CS3 A;  2X0L A;  4F4L A;  1Q86 W;  2XHB A;  5LMU O;  2X7R B;  4X89 A;  2EIM C;  4DR3 B;  4J7Z A;  3BRC A;  1P84 F;  2QJ1 A;  1B06 A;  1HP8 A;  2Q8V A;  3U10 A;  3W7S A;  3ETQ A;  3JAR A;  1H2L A;  2P4V A;  3K06 A;  2A3Q A;  1X59 A;  3HPL C;  3ZBH A;  3EVK A;  4DR2 O;  4MVZ A;  4MSW C;  4X62 B;  1VQ8 V;  1E1Q G;  4UVC A;  2IW5 A;  3UT5 B;  3MHH C;  5D5P A;  3LDD A;  3J7A U;  4GYC B;  3LNN A;  2EIM B;  3SDL A;  1L1F A;  4FLY A;  4OXS A;  4J9Y B;  2HLD G;  1WN7 A;  4RUF A;  1JX9 A;  4DR1 B;  1QR8 A;  5LP6 C;  2JVD A;  1GKF A;  4DR5 B;  2YI8 A;  1FFT B;  2H94 A;  5EC2 C;  2QWO B;  3H1L H;  3QO5 A;  2Q0A A;  4LFA B;  2YID A;  1PP9 H;  1H2S B;  4DR6 O;  3KG2 A;  4U3J B;  3RBZ A;  2GBO A;  1K97 A;  3ZMU A;  1JFF B;  3CC4 V;  4FK5 C;  3G6E V;  3JD1 A;  3QG5 A;  3CRQ A;  3CCE V;  2ZT9 B;  1FJG O;  1XHX A;  4JYA O;  3UT5 A;  1WNS A;  3CYO A;  1H2N A;  5CA3 A;  3IC7 A;  4J80 A;  1XL6 A;  3OR7 C;  2QR4 A;  1KUQ A;  4NTY A;  3OE7 G;  2QKS A;  5DED A;  2XAH A;  4MT8 A;  2E5L O;  4F6R B;  3K57 A;  2YDE A;  5FPO A;  1WB8 A;  3ABT A;  1PNL A;  3D3I A;  2DQ3 A;  3CCL V;  2PGG A;  1NQT A;  5K1P A;  4LF9 B;  4N23 A;  1VIB A;  4FZ1 A;  2GV9 A;  4DUY B;  1AI5 A;  2LQT A;  2XUM A;  4DW0 A;  5CB4 B;  4NB5 A;  4U3J A;  3CX5 F;  2W0X A;  2XT9 A;  3JAL B;  4JPR A;  4TSF G;  3DC6 A;  4FLU A;  3D36 A;  3ASO B;  5L3C A;  4TV9 B;  5DM6 V;  2PF4 E;  5C8Y B;  1GN6 A;  2ZM6 O;  5BMV A;  3AG3 B;  4UCR A;  1OCO C;  2CTW A;  2YIC A;  3UO3 A;  4AQY O;  4B3T O;  1SZX A;  1QLE C;  4F6R A;  1QCE A;  1GTO A;  3LSQ A;  4P2Z A;  2Y69 C;  2P7T C;  1M90 W;  2DOS A;  5LMN B;  4PDR A;  3RT3 C;  3WG7 C;  3JAS A;  3ZN1 A;  1I5X A;  3JAL A;  3BA8 A;  4UCU A;  2ZDI C;  4AIL C;  3ZX6 A;  2ATK C;  4TV9 A;  1XUQ A;  3FAV B;  1K3E A;  5C8Y A;  1GM7 A;  1OZ0 A;  4CBC A;  3ZMT A;  4BW9 A;  4JI6 B;  1IBL B;  1XEQ A;  1LNQ A;  3KCY A;  4FFB B;  1QLE B;  1Q82 W;  2Q69 A;  3BY6 A;  4UB6 Z;  2P90 A;  4JTC B;  4KHP O;  2Y69 B;  5KAF Z;  1J5E O;  3S3X A;  3N27 A;  3RN4 A;  1AB3 A;  3ML0 A;  1YSC A;  5LYJ B;  1XIL A;  4NXM O;  3RWR D;  1PPJ H;  3WG7 B;  1NTM H;  1MZF A;  2CK3 G;  2R72 A;  3CS5 A;  2DE0 X;  1B04 A;  3RYI A;  4JV5 O;  2X6C A;  1N0J A;  3JSN A;  1XMO O;  4L87 A;  5GTH Z;  4IIJ B;  4X8A A;  3K5O A;  2F4V O;  4WBN B;  5LOV A;  3J81 N;  2HP8 A;  4I0X A;  2QM8 A;  1UJW B;  2D3O W;  2QKC A;  2R9R B;  3T1H O;  4DRX B;  1UPG A;  3OTF A;  3VOU A;  3ZHR A;  2ZQM A;  5CA1 B;  2HR3 A;  5IWA B;  1Y76 B;  3OGC C;  1P49 A;  4MTX A;  5IYZ B;  3C3T A;  1ZSP A;  3AK1 A;  3DC5 A;  3A0B Z;  4U7O A;  1VF7 A;  1HNX O;  1I5Y A;  5EBW C;  2E74 B;  2CGN A;  5JWP A;  3CJH B;  4ZHQ B;  3G80 A;  3LNM B;  2CAZ C;  4LWS B;  5LYJ A;  4DK1 A;  2UUC B;  3CME V;  1JMK C;  3IC9 A;  3T1C A;  2EIN C;  3E8F A;  2ETN A;  3QTC A;  1I08 A;  4IHJ B;  1PKX A;  3TXS A;  1JQ0 A;  4LF5 O;  5BR8 B;  1OHH G;  2GHY A;  4IIJ A;  1VMG A;  2N05 A;  3UKM A;  3JAM N;  2Q0O C;  5BXZ A;  4LH7 A;  5J2T A;  1SZT A;  5LMU B;  2XND G;  3CRA A;  3ZED A;  4LF6 O;  1PNK A;  3OEE G;  5CA1 A;  3VBB A;  1GAX A;  3MD0 A;  1W2B U;  1FXH A;  1Q7Y W;  1K9M W;  3CJH A;  5EZY B;  4ZHQ A;  2HG5 C;  5IJ0 A;  5C93 A;  4DR2 B;  2EIN B;  1YCI A;  4LWS A;  3HKB B;  3OUS A;  3N2K B;  4FJC C;  1ROP A;  2D2C B;  2YXH A;  3SYA A;  1NVP B;  4JZG A;  3CCM V;  1Q8I A;  1IBM B;  3H1H H;  3M7M X;  4IHJ A;  4CZZ A;  4KFM A;  5L3G A;  3ZJZ A;  1BL8 A;  4DV0 B;  1BCC H;  2EIL C;  3ZRX A;  4FZ0 A;  3E2E A;  1R3L C;  5LHG A;  5DEC A;  2LP7 A;  3Q4H B;  1R6N A;  2UXX A;  1U96 A;  1JVM A;  3VQY A;  4BIZ A;  1NKD A;  1YJN V;  3KKY A;  1DF5 A;  2FYU H;  2BTQ A;  4DR5 O;  1G4Y B;  3ZS8 C;  2ZNI A;  4NKG B;  2IU0 A;  1Y74 B;  4BW5 A;  3M99 B;  5EZY A;  1TA8 A;  4DR6 B;  1M4U A;  1SQV H;  2WLI A;  3OR6 C;  1U97 A;  3HKB A;  5L3F A;  2PI5 A;  1KD1 W;  2A06 H;  1FJG B;  2PZS A;  2EIL B;  4RAI A;  4JYA B;  4CH3 A;  5KAI Z;  2WLM A;  4K35 A;  3SPG A;  1M1K W;  2RMK B;  2XAQ A;  1QVG U;  1ZTE A;  3Q4H A;  2WSS G;  5LXT B;  3ZRS A;  1NR1 A;  1SQG A;  1COW G;  4WCE V;  3BHP A;  4GX5 A;  2ZE6 A;  1K34 A;  3TGU H;  1BS3 A;  1WLE A;  2AXT Z;  5FLX N;  5JQG B;  3CCQ V;  2LGW A;  1M5I A;  4GZR B;  4DV6 O;  1YHQ V;  1PM9 A;  2WA4 A;  3LSS A;  3E22 B;  1YEW A;  1OCC C;  2BOC C;  2HJD A;  3TJT A;  4X20 B;  1VQK V;  3SYO A;  2EIK C;  1TVK B;  4ZOL B;  2ZM6 B;  3WFV A;  1VQ5 V;  5H6R A;  1AJN A;  2YC0 A;  1EFR G;  2R70 A;  4DR7 O;  4NXN B;  4EFB A;  5DN6 G;  2XAG A;  4DO2 A;  2IM9 A;  5LXT A;  2L35 A;  4B3T B;  4B08 A;  1M57 C;  2AHZ A;  4R50 A;  2OWO A;  3CPW U;  5EBL C;  3BVO A;  5EK0 A;  1DGS A;  4O4L B;  5KMG B;  3A2F A;  2DYR C;  1N32 O;  1BE3 H;  2LGQ A;  2Z5U A;  1OCC B;  4LCU C;  2VRZ A;  3G67 A;  1P7G A;  5KX5 A;  2F66 C;  1FFX A;  2EIK B;  1YDX A;  1VF6 A;  4K0K O;  4O4I A;  4FFK A;  4LNU B;  4X20 A;  2Q7H A;  2OTL V;  2JGD B;  1TVK A;  4X1Y B;  2ADP A;  1XNQ O;  1TGO A;  1M56 C;  1F23 A;  3SJB C;  1G8M A;  3T1Y O;  4DV3 O;  4J7J A;  4YY3 O;  2WLK A;  2VWK A;  3ZMS A;  3B40 A;  1M57 B;  1RFY A;  5IDJ A;  1FD9 A;  2L6L A;  4P9O A;  1JOY A;  1WB7 A;  2QEX V;  3SYC A;  4KHP B;  4D6T H;  1J5E B;  1BT8 A;  2DYR B;  5B3S C;  3K9A A;  2HHH O;  4O4L A;  4NXM B;  5KMG A;  4QIW F;  4ZI7 B;  2YUA A;  1PL0 A;  3ZRV A;  1S3J A;  1WA8 A;  1QU7 A;  3F7V C;  4JV5 B;  1N8R W;  1XMO B;  4DR4 B;  1IDS A;  2MW2 B;  2F4V B;  1M56 B;  1ZX3 A;  4JI4 B;  4LNU A;  5TIS Z;  2JGD A;  1AI7 A;  3H9V A;  4X9Q A;  4L8J A;  2ARH A;  4JI5 B;  3ZRW A;  1HNZ O;  3JD2 A;  3DSQ A;  4DV5 O;  4R7C A;  2IJI A;  5B3S B;  3ZHU A;  1HNX B;  3DXR B;  3JCZ A;  3JAR B;  3K9S A;  5IT9 N;  2IJH A;  1FS0 G;  5CBF A;  1VQN V;  3HB3 B;  1F51 A;  4O2B B;  3WU2 Z;  2QE7 G;  2F43 G;  1KKD A;  2UUC O;  4H0L B;  4H37 A;  4UUJ C;  3B2E E;  1H2M A;  4LF5 B;  1NS1 A;  1ZUQ A;  1DLB A;  4CC6 A;  4B7K A;  3VQX A;  3FYI B;  3LUT B;  5J2U A;  4IYI A;  3P32 A;  2QTS A;  1MOF A;  2FB5 A;  2BCC H;  1W0J G;  4LF6 B;  4G2K A;  3OD4 A;  2YIB A;  1CEZ A;  1S0V A;  1NR7 A;  5GON A;  5H2F Z;  3DXR A;  1EN5 A;  4QNH B;  1Y67 A;  1WAZ A;  1H2G A;  4JI1 O;  1R3J C;  1YJW V;  3RYC B;  1SET A;  2JEX A;  4I9W A;  4WFH A;  4O2B A;  4RQE A;  1OJH A;  2RCV A;  3UQ8 A;  3AG4 C;  5LGT A;  2JJ2 G; 
#chains in the Genus database with same CATH homology
 1QR9 A;  1KP2 A;  1YIT V;  1XL4 A;  4PDR A;  1KP3 A;  2JIZ G;  1YJ9 V;  2B1G A;  2EJR A;  3WG7 C;  2C2A A;  2EBO A;  4QJF B;  1FXK B;  1K7D A;  3ZN1 A;  5BZB A;  1I5X A;  3ZRW B;  3CP1 A;  1K5Q A;  3CCR V;  2ZDI C;  3UM7 A;  3W7U A;  2ATK C;  4MTF A;  1DTO A;  1JCH A;  2IH3 C;  2ZR3 A;  5H9C A;  1K3E A;  3A0R A;  1GM7 A;  2ITD C;  2DWE C;  1OZ0 A;  4MVU A;  5FL7 G;  4CBC A;  3ZMT A;  3ABM B;  3OMI B;  5KUM A;  3K3W A;  1OCR B;  1LNQ A;  1QLE B;  1Q82 W;  2Q69 A;  1S76 D;  3BY6 A;  4MVM A;  2MK3 A;  3CCJ V;  1SRY A;  3AG1 B;  3ETD A;  4PDL A;  4WFE A;  3RW0 A;  5CBH A;  1VQL V;  2P90 A;  4JTC B;  3GB7 C;  2Y69 B;  3OMA B;  1VQ6 V;  2H8P C;  3AG4 B;  2ZXW C;  5EBM C;  1EBO A;  4PA4 A;  2XAF A;  4P30 A;  3ML0 A;  3SPC A;  2OT5 A;  1YSC A;  2XAS A;  3WG7 B;  3JYC A;  4MVO A;  3STZ C;  2ZD9 A;  2W0F C;  3ABK C;  1GM8 A;  4X88 A;  3CC7 V;  1YI2 V;  2CK3 G;  3MHS C;  5IYB O;  1FXK A;  3BEH A;  1RM1 C;  2X6C A;  4L87 A;  4X8A A;  3ASO C;  2EZP A;  4J9Z B;  4KP4 A;  5LGU A;  1SER A;  3AG3 C;  5EC1 C;  4JTA B;  2GSM B;  3CC2 V;  2FTK A;  1IXM A;  1E79 G;  4LP8 A;  2QM8 A;  1UJW B;  2D3O W;  2R9R B;  5B1N A;  2OCC C;  2HVJ C;  4FIP C;  3VOU A;  3QO7 A;  2ZQM A;  1JPX A;  2HR3 A;  3CD6 V;  2Q6A A;  3OGC C;  2ZXW B;  3E86 A;  3TK1 A;  1MG1 A;  4MTX A;  4U7O A;  1I5Y A;  4JAS A;  5EBW C;  1K92 A;  1YTF D;  1P4R A;  3ABK B;  3LNM B;  2WPD G;  1KC8 W;  2EIJ C;  2IJJ A;  5IYC O;  1DF4 A;  3CME V;  2YEV B;  4MTO A;  1NH2 B;  3K08 A;  1RM1 B;  3T1C A;  2EIN C;  3E8F A;  3NXS A;  4HYO A;  3OEH G;  1NH2 D;  4GT1 A;  1FXK C;  4UV9 A;  1PKX A;  4R6Z A;  4WFG A;  1H8H G;  1JQ0 A;  3LDC A;  3SYP A;  3IFX A;  1OHH G;  2GHY A;  2P67 A;  2X6A A;  2JDI G;  1R73 A;  3UKM A;  2OTJ V;  3ZMZ A;  1SZT A;  5KA6 A;  2X6B A;  4ASU G;  2XND G;  1QBZ A;  3SPI A;  5KUK A;  2WWW A;  2ZR2 A;  4FMT A;  3FB8 C;  4N21 A;  4TWK A;  1OCR C;  3ASN C;  3OFN G;  1PNK A;  3OEE G;  5CMU A;  3SPH A;  3VBB A;  1QVF U;  4MVR A;  3AG1 C;  5LBQ A;  3CXC U;  3MD0 A;  4MVQ A;  3OAA G;  1W2B U;  1FXH A;  2EIJ B;  1Q7Y W;  3I55 V;  1K4D C;  4MW3 A;  4BIU A;  1KEC A;  1K9M W;  2HG5 C;  5C93 A;  1SES A;  2IH1 C;  2EIN B;  3ETG A;  3PJS K;  4JAU A;  4UXN A;  4P9P A;  2LFS A;  2YEV A;  3OUS A;  4PA6 A;  3H01 A;  4FJC C;  1ROP A;  2QM7 A;  1R3K C;  2R9I A;  4WFF A;  3SYA A;  3T4Z A;  3CCM V;  1NVP B;  3CMA V;  3AG2 C;  4CZZ A;  4KFM A;  5L3G A;  1NVP D;  1B6Q A;  3ZJZ A;  4FPP A;  2DWD C;  5LHH A;  3ABL C;  1BL8 A;  1V54 C;  3ZIA G;  2Q68 A;  5B1A C;  2EIL C;  3ZRX A;  3E8B A;  3E2E A;  1R3L C;  1VQM V;  4MS2 A;  5LHG A;  5H6Q A;  1MAB G;  3ASN B;  1PNM A;  2LP7 A;  1K8A W;  2P6J A;  3RVY A;  1R6N A;  2JK5 C;  5B1B C;  4DXW A;  1K33 A;  2IU3 A;  2UXX A;  2XAJ A;  1JVM A;  5CN0 A;  4BIZ A;  1NKD A;  3P30 A;  4EKW A;  1YJN V;  1RPO A;  1DF5 A;  2WLN A;  3SPJ A;  2JEU A;  4LBE C;  3E8G A;  4GCZ A;  4MW8 A;  4TT3 G;  1G4Y B;  5LHI A;  1W0K G;  2IU0 A;  1QLN A;  4BW5 A;  3M99 B;  2W6J G;  1TUE B;  1V55 C;  3SJQ C;  2WLI A;  2LFR A;  3OR6 C;  5KA5 A;  4WFA V;  3AG2 B;  1Y4M A;  3IGA C;  4UVB A;  3E8H A;  5J9P C;  5L3F A;  4XDL A;  3OW2 U;  4QE7 A;  3ABL B;  2PI5 A;  1KD1 W;  1V54 B;  4GX2 A;  4U7N A;  2DW4 A;  4JTD B;  4PA7 A;  2EIL B;  4RAI A;  4QE9 A;  2A79 B;  4UV8 A;  4KUM A;  5B1A B;  1K5S A;  3K79 A;  4JYC A;  2B1I A;  2WLM A;  3SPG A;  3OUF A;  5B1B B;  2AHY A;  1NBM G;  4BAY A;  1R3I C;  1QVG U;  2XAQ A;  1M1K W;  3AEI A;  5IY5 C;  2V1D A;  4PEL A;  1VQP V;  1P7B A;  3ZN0 A;  2WSS G;  3ZRS A;  1GO3 F;  1NR1 A;  3B8M A;  1COW G;  3QO8 A;  4PA9 A;  4WCE V;  4GX5 A;  3E83 A;  1S77 D;  1K34 A;  1S5H C;  3W7X A;  1K4C C;  4G28 B;  4Z1M G;  1ENV A;  2NNU A;  1NJI W;  3FKS G;  1WLE A;  2B5U A;  3CCQ V;  4PDM A;  5HFM A;  5LGN A;  3QNE A;  5E1A C;  3R65 A;  1V55 B;  2KB1 A;  1ORQ C;  1BHB A;  1YHQ V;  2ITC C;  1CPY A;  3DGE A;  4ZBM A;  1R6K A;  4JGS A;  3LSS A;  1AJP A;  1Q81 W;  1YIJ V;  1OCC C;  2BOC C;  2NLJ C;  2BOB C;  3FB7 C;  4JAV A;  1VQ4 V;  1VQK V;  3SYO A;  1VQO V;  2EIK C;  3JD4 A;  3T2M A;  2M7W A;  5L3E A;  3WFV A;  1VQ5 V;  5H6R A;  2EZO A;  5IY5 B;  1AJN A;  3E89 A;  4GX1 A;  1EFR G;  2K1E A;  2X0L A;  3FB5 C;  1VQ9 V;  1S72 V;  1MSW D;  4ZKI A;  5DN6 G;  2XAG A;  4F4L A;  3STL C;  4DO2 A;  2PI4 A;  1Q86 W;  4RQF A;  1M57 C;  2AHZ A;  2DQ0 A;  2X7R B;  4R50 A;  4X89 A;  2EIM C;  4JF3 A;  2Y48 A;  3EHB B;  3CPW U;  5EBL C;  1KQS U;  3OMN B;  1AJQ A;  5EK0 A;  4MVS A;  1AR1 B;  2WLI B;  3SYQ A;  3K0G A;  4UVA A;  2DYR C;  2Z5U A;  1OCC B;  3W7S A;  3I56 V;  2HJF C;  3K06 A;  4LCU C;  2WLJ A;  5IYD O;  3HPL C;  3E35 A;  2EIK B;  5B1O A;  4MVZ A;  1AI6 A;  4G27 B;  2JJ1 G;  3JD3 A;  4MSW C;  3W7W A;  1GK9 A;  2OTL V;  2A9H A;  1VQ8 V;  2HFE C;  3G4S V;  1E1Q G;  1M56 C;  4UVC A;  1F23 A;  4LC1 A;  2IW5 A;  1G8M A;  1WPX A;  2WLK A;  3MHH C;  3ZMS A;  1ZWI C;  4GX0 A;  3LDD A;  1OCO B;  1M57 B;  5IDJ A;  1HWY A;  1THZ A;  2EIM B;  3CCS V;  4P9O A;  3CCV V;  5CBG A;  1JJ2 U;  2QA4 V;  1JOY A;  2QEX V;  3SYC A;  1L1F A;  4OXS A;  4J9Y B;  2HLD G;  2DYR B;  4RUF A;  1JX9 A;  2XOK G;  1QR8 A;  1VQ7 V;  5B3S C;  3K9A A;  4I5S A;  3DTU B;  1GKF A;  3EFF K;  2DYS C;  4QIW F;  3ETE A;  1PL0 A;  1FFT B;  2H94 A;  5EC2 C;  1BHA A;  2WLL A;  3ZRV A;  2QTO A;  1S3J A;  4Q20 A;  3X2Q C;  4PDV A;  3K03 A;  3F7V C;  3QO5 A;  3K04 A;  2Q67 A;  3G71 V;  1N8R W;  2WAM A;  3JD0 A;  3KG2 A;  1F4N A;  3FB6 C;  3RBZ A;  1M56 B;  2A0L A;  1K97 A;  3F7Y C;  3K0D A;  3ZMU A;  3CC4 V;  4FK5 C;  3G6E V;  1AI7 A;  3JD1 A;  1GM9 A;  4PA3 A;  1E1R G;  4RUE A;  3CCE V;  1H38 A;  2IJK A;  3ZRW A;  3CYO A;  3JD2 A;  2W6I G;  4RO2 A;  3F5W C;  3W7T A;  5CA3 A;  3IC7 A;  4E2L A;  4R8C A;  4R7C A;  3RVZ A;  1XL6 A;  2IJI A;  3OR7 C;  4HAM A;  5B3S B;  3JCZ A;  2DYS B;  3OE7 G;  3CCU V;  2QKS A;  3ABU A;  3B77 A;  2XAH A;  4MT8 A;  3ZCC A;  1BMF G;  2IJH A;  1FS0 G;  5CBF A;  1VQN V;  1J95 A;  2Z3Y A;  3HB3 B;  3GWO A;  4QPK A;  3X2Q B;  1OCZ C;  3ABT A;  4MTG A;  3TCU A;  1F51 A;  1PNL A;  3D3I A;  2DQ3 A;  3LDE A;  2QE7 G;  1YTF B;  3CCL V;  2F43 G;  1NQT A;  1KKD A;  3T4D A;  3FYE B;  4H37 A;  4N23 A;  4XDK A;  5L3B A;  4UUJ C;  3B8N A;  4JYB A;  1AI5 A;  5L3D A;  3TET A;  1DLB A;  1PD3 A;  3FYI B;  2YSU B;  4JPR A;  4TSF G;  1H8E G;  5HFL A;  3LUT B;  4WFB V;  3D36 A;  3P32 A;  4XBF A;  1MOF A;  3ASO B;  5L3C A;  4WF9 V;  2ZDI A;  5DM6 V;  1EZJ A;  3AG3 B;  4HZ3 A;  1W0J G;  3OM3 B;  1OCO C;  4G2K A;  2UXN A;  3ZMV A;  1Y66 A;  2OCC B;  1CEZ A;  1S0V A;  1K73 W;  2HKO A;  1NR7 A;  2HVK C;  2V7Q G;  2WLH A;  1F4M A;  3ABM C;  1OCZ B;  1AI4 A;  4QNH B;  2WLL B;  4YXW G;  1H2G A;  1R3J C;  1YJW V;  1QLE C;  1GMG A;  1QCE A;  4QPJ A;  4H33 A;  1SET A;  2JEX A;  4XDJ A;  4I9W A;  4WFH A;  5GW7 A;  1GTO A;  4RQE A;  3LSQ A;  4P2Z A;  2Y69 C;  1M9N A;  3AG4 C;  1ARO P;  1CP9 A;  1RPR A;  1FXV A;  2P7T C;  1M90 W;  5LGT A;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...