2IH1C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
100
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih1C00
4G27B 3RVYA 3HPLC 2EINC 5B3SC 2ATKC 1OCOC 1M57C 3JYCA 3ABMC 3E89A 3F5WC 2WLIB 2IH3C 3IGAC 3IFXA 1BL8A 1LNQA 4J9YB 3K03A 4XDKA 2IH1C 4PA9A 4JTDB 1G4YB 4GX5A 4WFGA 3AG2C 3SPCA 2BOCC 3PJSK 4PA6A 2Q67A 3K08A 2Q68A 2HFEC 3K0GA 3LDDA 5CBFA 2YEVA 3AG4C 3E8FA 4OXSA 5BZBA 2Q6AA 3LNMB 1JVMA 4MS2A 4PA3A 4WFFA 3TCUA 2WLMA 2DYSC 2R9RB 4MVSA 4GX0A 3OGCC 3VOUA 2AHZA 3E8BA 3SYCA 3SYQA 1QLEC 3FB8C 2WLHA 4ZBMA 2WLNA 2EIJC 4X89A 2EIKC 4H37A 4UUJC 3T4DA 4QE7A 1R3JC 2QKSA 4HZ3A 4P30A 3T2MA 5CBGA 4GX2A 4MTFA 2X6AA 2Y69C 4DXWA 2WLKA 3SYAA 1ORQC 4QE9A 4MVUA 1OCZC 4PA4A 2WLLA 4MTGA 2A0LA 3X2QC 4LCUC 4MW3A 3LUTB 2W0FC 3K04A 3RW0A 3SPGA 4RUFA 3E86A 4KFMA 3T1CA 4PDVA 3FB7C 2P7TC 1P7BA 4JTCB 2WLLB 4MVRA 5KUKA 5J9PC 4MVMA 3SYPA 3BEHA 4GX1A 3R65A 3OR6C 3RVZA 3LDCA 4MVZA 3TETA 4MVQA 2AHYA 2ZXWC 2X6CA 5EC2C 1M56C 3SPHA 3ZRSA 1V55C 2ITDC 2K1EA 1OCRC 2OCCC 3F7VC 4PA7A 2A9HA 4RO2A 3F7YC 4P9PA 4LP8A 3UKMA 3WG7C 4CBCA 2DYRC 5EBLC 3AG3C 4F4LA 3AG1C 5KUMA 3UM7A 5EBMC 3ASOC 4P9OA 2KB1A 3OUSA 4WFEA 5CBHA 5EBWC 4HYOA 5E1AC 2HG5C 3ASNC 3K0DA 4XDJA 3RBZA 3SJQC 2QTOA 4X88A 4R6ZA 4TWKA 1K4CC 4X8AA 3STLC 2JK5C 4EKWA 3OUFA 5IY5C 4MTOA 4JTAB 4R50A 4R7CA 5B1AC 2Q69A 4H33A 4P2ZA 4QNHB 1KKDA 5B1BC 4PDLA 4PDRA 1J95A 5EC1C 3LDEA 4MVOA 4PDMA 2WLJA 1OCCC 3E83A 5EK0A 4XDLA 1K4DC 1XL4A 3ABKC 4R8CA 1V54C 1R3KC 3ABLC 1S5HC 1R3IC 2NLJC 4WFHA 2DWEC 4I9WA 2EIMC 1XL6A 3E8GA 2ITCC 2A79B 2HJFC 3E8HA 3OR7C 4G28B 3STZC 2DWDC 3ZJZA 3T4ZA 3K06A 4J9ZB 4RUEA 2HVJC 2ZD9A 3SYOA 3SPJA 2BOBC 3GB7C 2X6BA 1R3LC 2H8PC 3FB5C 2EILC 3EFFK 3SPIA 4MW8A 1ZWIC 2WLIA 4MSWC 4RAIA 4BW5A 2HVKC 3FB6C 4LBEC 3KG2A
chains in the Genus database with same CATH superfamily
4QPJA 2ATKC 2E5LO 4KHPB 1YSCA 3E35A 1I5XA 2IH3C 2MW2B 2RCVA 5CB4A 3B4SA 3OD4A 4PHZA 4DUYO 4WFGA 4CH5A 1YJ9V 2VWKA 3ZRWB 1Q8IA 2UXBB 2ARHA 4PA3A 1L0NH 5JCOA 1AR1B 5KHHA 4Z1VA 3QF7A 4B3TB 3P30A 2ZM6O 1R6KA 4H13B 1R6TA 2DOSA 4QE9A 1N34B 2ZCEA 1EN6A 5B3SB 2OIGA 3K5NA 3ABMB 3B2EE 5J9PC 3SYPA 3M7MX 4DV2B 3UT5A 1H2GA 2ADPA 5IYZB 2F66C 1OCRC 1GTOA 4LP8A 2PUSA 1W0KG 2DQ0A 2CUGA 1D5AA 1QVGU 1F7YA 2FMLA 2DE0X 3ZHSA 1QLEB 1SA0B 4IYIA 2JEXA 3K0DA 1IBMO 3G67A 2Q0AA 4B3SO 1K4CC 4O4LA 1D2DA 1XMOB 4R50A 1JFFA 1EM1A 4J7JA 1WLEA 1KU9A 4PDRA 3E2EA 3RYIA 4BR6A 3CP1A 1K4DC 1XL4A 4CS3A 4NVPA 5JQGA 2IJJA 4LF4B 1IDSA 2P22C 4J41A 1TUBB 2GV9A 4TQFA 5HFLA 3ABKB 1TUEB 4LFAO 5BMVA 2XAFA 2PYJA 1PKXA 4F6RB 1BL8A 1NTZH 1KP2A 4O4IA 1XREA 1HNZO 1N0NA 2Q67A 3K08A 1K92A 1OZ0A 1B04A 1P84F 2UUBB 3BPZA 1HR0O 3JALA 3ABLB 2CH7A 3F5TA 4UFZA 2FB5A 3ZMSA 4DR6O 3MAQA 4GLXA 4NXMB 1QCEA 4JV5O 2O57A 4AI8A 2E5LB 5JJEB 1NBMG 3SJCC 2X6AA 5D5QA 3VQYA 2D2CB 1S76D 4DUYB 4DV4B 1J5EO 2XUMA 3OMAB 2C2AA 2F1MA 4FVMA 2WSSG 4KUMA 2UXNA 1M9NA 1S3JA 4AHCA 1M93A 3F7VC 3DXRA 1NH2D 1Q3EA 2A9HA 2ZM6B 3L73H 1TA8A 1WA8B 3LSSA 1DF4A 4HNAB 1YIJV 2CGNA 4Q20A 3QO8A 3RBZA 1K8AW 1M5IA 5TISZ 4X8AA 5A9GA 5IY5C 1K7DA 5B1BC 3N2GB 2UXDO 4JI7B 3KZIZ 4I7ZB 3CCSV 3CCLV 3T1HO 1AJPA 1OCCB 3NR7A 3ZMVA 4DRXA 3FYIB 1IBMB 1RFYA 4X1KA 2HVKC 4B3SB 1HNXO 1MG1A 3GWOA 3ASOB 3JALB 2ZE8A 3H1LH 1FFTB 2KG7B 1YTFD 5LP6B 1GO3F 4GX5A 4IYHA 2ZNIA 5B1AB 3ZMUA 1FAFA 2HFEC 4EB6B 4B7KA 2JS3A 3W7SA 1KYOF 2EIMB 2YEVB 4LFAB 2XAQA 3SYQA 3WB0A 4WCEV 3FB8C 4B3MO 2EIJC 4O2BB 4LF6O 4DR2B 2EILB 5KHGA 4GX2A 5IYCO 1YJNV 4RQFA 3OFNG 1HNZB 2QKAA 2WWWA 5FPRA 2XTAA 1OCOB 1YZBA 2EULA 4PI2A 2DW4A 1F4NA 2BTQA 3BCCH 3CCVV 3L71H 1VF6C 4YHHO 1HR0B 3PN1A 1VF6A 2P67A 4LFCO 1AI7A 4FIPC 4DR6B 4JV5B 1BT8A 3HKCA 4JI2O 1FXKC 2GTSA 4JAUA 3AEIA 4N23A 5A2QN 3OUSA 4LH7A 1J5EB 4XDJA 3RFRA 4FLVA 4K35A 3U10A 4QNHB 4AQYO 4P2ZA 4DRXB 5CA1A 1Q82W 5KMGA 4DUZO 2L35A 4B7EA 5CMUA 4J7ZA 4J9ZB 2FKXA 3GB7C 2OIEA 2H8PC 3FB5C 1JOYA 3WG7B 3BHPA 1CP9A 1EN4A 3A0HZ 1ZUQA 3HPLC 4IT5A 1IBLO 3E22B 1MSDA 3IGAC 4IHJA 4J9YB 1ZSPA 2IH1C 4PA9A 5BY1A 3Q4HA 3AG2C 2UXDB 1XQ8A 2E75B 4GT1A 1WB8A 1XUQA 4MS2A 1P4RA 2WLMA 5EZYB 1JR9A 1V54B 2F4VO 4ZIBA 4NTWA 1N36O 5LYJA 1G8MA 2QKSA 2VQFO 1SQVH 1OHHG 2WLKA 3SYAA 1ORQC 1FFXA 1OCZC 1MNGA 2EINB 2PY5A 3RYCB 1XHXA 4X1IA 5KUKA 5J2UB 3QNEA 3T1YO 1MZFA 2F23A 3ZCCA 3JATA 4DR1O 1TVKB 1FPOA 2CDYA 1R73A 4B3MB 3H9VA 5CA1B 4X66O 3W7UA 5IDJA 4FPPA 1OJHA 1TGOA 4LFBO 5KUMA 4TOIA 4U3JB 2Q7EA 4D6TH 5GW7A 3DC6A 4WFEA 5CBHA 2HG5C 3ASNC 3RYHA 2AZ0A 4FFBA 3D8CA 4R6ZA 3OUFA 4YHHB 2B1GA 3APOA 4O2AB 4JI8O 1PL0A 1PM9A 4LFCB 1IBKO 4JI2B 2CAZC 2NN4A 5CA0A 4CH4A 3E8HA 2OCHA 3H1KH 3K06A 3BA9A 1AJQA 2P90A 1YDXA 3SPIA 3OTOO 1KUQA 3FB6C 4J7KA 2HJDA 4AQYB 4JZGA 1I94O 2JRIA 4YXWG 3LNNA 4KXRA 4JI4B 3KCYA 3JD1A 5JVDB 3CRRA 4DUZB 3RYFA 1XNRO 1QR9A 2Y0PA 5CBFA 4LR3A 3AG4C 1XBLA 1VMGA 1NTMH 5H6RA 3B8MA 3CYOA 1UJWB 3VOUA 2YXHA 1RM1B 4ZBMA 4DK1A 1Q6IA 2EIKC 4UUJC 1IBLB 2HHHO 1OV9A 1WP8A 2QM8A 1N34O 2DN9A 4MW3A 3CJHA 2CTQA 4PI0A 2Q5ZA 4LF5O 3BEHA 4DV2O 2F4VB 3LDCA 2VWJA 5IYDO 5KAFZ 2ITDC 3MDSA 3P3NA 2VQFB 4LF7O 2DYRC 2H3OA 4WBNB 5KAIZ 1VQ9V 4P9OA 2KB1A 5FNVA 2M6YA 2Z5UA 2QWQB 1VQLV 2IJIA 1BSMA 3ETDA 4L87A 4MTOA 3T1YB 1NJIW 4DO2A 1J95A 5K1XA 2B9ZA 4DR1B 1Y4MA 5EYPB 1NQTA 1S5HC 3FAVB 3OEEG 1KC8W 4JGSA 2RNBA 3W7WA 4X66B 2V4DA 3RGBA 4LFBB 1JA8A 1YEWA 2Q4PA 2ZXWB 4RUEA 1M56B 2QDOA 1NS1A 2OCCB 3BABA 4H44B 4MW8A 4JI6B 4LNUA 5B66Z 1XMQO 1Y76A 5B3SC 1HP8A 4J10A 1XILA 5LA6A 3JYCA 3ABMC 3E89A 4O4JB 2XASA 3K58A 2FYUH 3ICXA 4JI8B 2EBOA 4D7TA 5IE9A 1NT2B 2LP7A 1RPRA 2BSKB 4LH6A 1IBKB 2ZIOA 3CCQV 4LWSA 2RN9A 4CZZA 1UFIA 1AP6A 2LFRA 4GKKO 1GRJA 1JVMA 1P7GA 2R9RB 2W6IG 3L74H 2Q7HA 1WB7A 3OTOB 4JAVA 5JH7A 3TGUH 1VP7A 1QLEC 3VQXA 4H37A 4WF9V 1I94B 3JAWB 2CGOA 5CBGA 5L3EA 4DV4O 3OE7G 4JI0O 3ZEDA 1WN7A 1XNRB 4FZ1A 3CXCU 4MVRA 3HKEB 2DQ3A 2F93B 4I50A 4DV5B 2YXLA 2AHYA 2X0LA 3JAKB 4GZRB 2ZNJA 2AGAA 4JF3A 2HHHB 4DR5O 4OX9O 4N21A 3G80A 5JWPA 4YJ2A 5C8YA 1L8DA 1FS0G 3L72H 3JASA 4ICGA 2QE7G 3SGIA 5FPOA 1PPJH 1H2KA 5LOVB 2Q73A 2E3CA 3OEHG 4DV6O 1AROP 4FMTA 1M1KW 4LF5B 3ZHUA 4PD4F 3K57A 4LNUB 3ZN0A 5F2VO 2LW1A 1PNKA 3ABLC 3TK1A 3BVOA 4JI7O 1IX9A 3OT7A 4ABMA 4ZHQB 1K34A 4LF7B 3STZC 1E1RG 4CC6A 1GN6A 2HVJC 5L3DA 2AXTZ 1HWYA 1B6QA 4NKGB 4NYKA 2YIDA 3EHBB 2IJKA 3CMAV 4DV1O 5JH7B 1U97A 3OMIB 3SJAC 1GN2A 2GUZA 1CXZB 2OYQA 2QM4A 1KMIZ 1Q90D 5CB4B 5BR8O 1WJZA 1Q6HA 2Q0OC 4FK5C 4UB8Z 1GM8A 5ITZA 1SQFA 1XMQB 3ZHVA 2YICA 4I55A 3T4DA 4DK0A 4DR2O 2ZQMA 3T2MA 3FX7A 3K5MA 2P6JA 5CN0A 1SQQH 3QTCA 1E1QG 4MTGA 2A0LA 1KECA 3SPGA 1M57B 3TXQA 2VRZA 4YJ3A 1Q6UA 4GKKB 2YIBD 3UO2A 1SQBH 2X6CA 2AW9A 1KQSU 4JI5O 1NR1A 3LSUA 2V1DA 1KB9F 3UT5B 1BMFG 3OAAG 3A0RA 3ASOC 4NTYA 2QEXV 3CCRV 1YI2V 1BZKA 4JI3O 3FKSG 4JI0B 1OCRB 4RWUA 3QVNA 5LP6C 3WU2Z 4EKWA 3L9DA 2P06A 3ZHTA 4JTAB 3TXSA 5B1AC 3UO3A 3X2QB 5HFMA 3LDEA 4CS2A 1HNWB 3AK2A 4O4LB 4A5UB 1JFFB 2HLDG 2Z0AA 4WFHA 5IJ0A 1X59A 2EIMC 3A0BZ 4DR5B 4OX9B 3RYIB 3ZHQA 1H2NA 4X1YA 2GUZB 5JQGB 2EILC 1SZTA 1O9HA 3SR2C 3KG2A 4DV6B 1RSOA 1DLBA 4EEQA 1PNLA 1OCOC 4TUYA 4UCOA 5BMVB 4U3FH 3ZN1A 3CCJV 3KCXA 4I55B 4OPHA 2BOCC 2R70A 4WFBV 1S72V 4MTXA 4O4IB 4ZKIA 1ENVA 4MVSA 4GX0A 1G6UA 3VQVA 2QA4V 2PTMA 1AI4A 4IIJA 2PZSA 2IU0A 3HKDA 2AHZA 1US6A 2YI8A 3BRCA 4X89A 1IZ3A 4K8ZA 1R3JC 2CH7B 4UVCA 1ROPA 4ZI7A 2RQ6A 3THOA 4DV1B 1PL4A 2ZINA 3FYEB 1SQXH 1AVMA 2LGWA 1YJWV 3ETEA 1VARA 1FKAO 1YXBA 3LUTB 4TV9A 5BR8B 2OT5A 3OR6C 3CCEV 2G38A 3OW2U 4OGQB 5GONA 3AK1A 4PA7A 1WPXA 2XAJA 2W0XA 3WG7C 1M4UA 2YS8A 4CBCA 1N33O 1URFA 3DXRB 3BFRA 4HBNA 3S3XA 4I0XA 5E1AC 2CTPA 2ODMA 5LGUA 1ZL8A 4R7CA 1E79G 5KHKA 4ASUG 1HW7A 4JZ2A 4ZOLA 3CMEV 3E83A 1JCHA 1V54C 1SQPH 1W2BU 1WAZA 4JI5B 4B3RO 5IY5B 3M99B 1Y6XA 4TUYB 1FXKA 4UVBA 3SDLA 4D7SA 1L0LH 5KA6A 1VF7A 2XOKG 4JI3B 4FFKA 1AB3A 4TWKA 3O65A 4NR1A 4G27B 1L1FA 2EINC 3CPWU 1PNMA 1NH2B 2ZE6A 4X1KB 4I4TA 1KD1W 3HKDB 4JI4O 4XDKA 1BE3H 2PI4A 5LMUO 4LC1A 3SJBC 1N0JA 5IJ9A 5KX5A 1VQMV 1LR1A 3JAMN 4Z1MG 3CCMV 2W6JG 1NVPD 1K5QA 5J2TA 2Y4TA 3U11A 3MD0A 4MT8A 2ADQB 4DW1A 4PJ0Z 4BIOA 3D36C 4LF9O 1VQPV 2WLLA 2EIJB 2JGDA 4KFMA 1P7BA 4JTCB 4IGGA 3CB2A 4HAMA 4I0XB 3W7XA 4GX1A 5DEDA 2BTQB 3SPHA 2XHBA 1VQNV 2OTJV 5EIBC 2R72A 3S3WA 3EVKA 1BQ0A 4U7OA 2Z3YA 4BW9A 2MK3A 3HKCB 2PYLA 4DR7O 5EBWC 1LUVA 3CHXA 1FXKB 1KP3A 1Z2GA 5L3CA 1S0VA 1AR5A 2HR3A 3P3PA 3STLC 2WAMA 3CX5F 4EFBA 4RQEA 4Q6GA 3I56V 1Q81W 3HKBA 2ZIMA 4PDMA 3CC7V 1VQKV 3D3IA 2UXCB 3NXSA 3E8GA 4FJCC 4G28B 4X64O 1RM1C 1N33B 4FLXA 5KMGB 1JPXA 3SYOA 3SPJA 1R1BA 3IJ4A 4JI6O 2WLIA 4TQDA 4LBEC 3AG1B 3RVYA 2JGUA 3WB1A 3CE2A 1N32O 3L75H 4BWAA 2E74B 2N74A 1H2LA 4C7UA 3JARA 1XOUA 4U7NA 2R9AA 2EJRA 4B3RB 2RDCA 3PJSK 4PA6A 1VF5B 4IHJB 2Y4UA 4DV0B 3DC5A 3Q4HB 5BZBA 4WFFA 3OTFA 2KKWA 3BY6A 3K5LA 1T5EA 4P30A 5LHIA 2A06H 2ZT9B 2XAGA 5LYJB 1VQ5V 2JEUA 1XHZA 2QSAA 5LMUB 3LSQA 3ZMTA 2W0FC 1FD9A 3RW0A 2OWOA 4FLTA 3AK3A 1ZAUA 3FB7C 1FFXB 4O4HA 3R66A 2E76B 4DV5O 2GTAA 1X4TA 4BIZA 2QWRB 1COWG 3IAYA 2ZXWC 2IBZH 1M56C 4AILC 4X1IB 3J7AU 2OCCC 2K1EA 2DYSB 3K59A 4I5SA 3JATB 4LF9B 3B40A 1JMKC 3L70H 3G6BA 1Q86W 4UVAA 3RYHB 4FFBB 1S5JA 3ZRXA 2R9IA 2PF4E 2ZDIC 3UCSC 4H0LB 3N2KA 4B08A 2ZE7A 1QHTA 1SS3A 3CS5A 1XL6A 4J80A 4W4KA 2DWDC 2BTOA 3ZJZA 3T4ZA 4DR7B 5CA0B 1K33A 4GUNA 2X6BA 3CRQA 4TSFG 5FL7G 3H1HH 2B1IA 5D5PA 1Y74A 3ZRWA 1FYJA 4DW0A 3P32A 4X64B 3TJTA 4OXSA 2DMXA 5KHIA 2UU9O 3RYFB 4PV1B 2EX3A 3QO5A 3RWRD 3AG4B 1Q43A 4O4HB 2FTKA 4YIOA 5FLXN 1GN3A 1IXMA 1N32B 1BCCH 4QPKA 1FJGO 4L8JA 1SKVA 1RP3B 3QO7A 1W59A 5LGTA 3CSXA 3DGEA 3K9AA 2GHYA 1ZLZA 5IYZA 5H2FZ 2LJ2A 3CJHB 5IYBO 2YUAA 1XNQO 2P4VA 2VQEO 2GDSA 3JD0A 4CH3A 4RO2A 1N8RW 3UKMA 1Q5OA 4G2KA 1MA1A 1DGSA 1QNMA 5JJNB 1M90W 4UCTA 3CD6V 3ZS8C 1SERA 1HDJA 1O9GA 3SJQC 2P4KA 5LMNO 5DM6V 2L6LA 2Y69B 5FNVB 1KKDA 4QGPA 5DECA 4FLWA 3EXAA 1HNWO 5H9CA 1V9PA 3ZHRA 4K0KO 1TUBA 3ABKC 2EZOA 3ETQA 1R3IC 3B09A 2DWEC 2B5UA 4DR3B 3OR7C 1IVSA 1Y74B 3WB2A 5JCOC 1XI1A 1V55B 2PGGA 3OMNB 2WPDG 4KL1A 1H2SB 4F6RA 2RJZA 3K5OA 3B77A 3AG3B 4TT3G 1SQGA 2UUCO 2Q7GA 1M57C 3F5WC 3DSQA 2PI5A 4UCVA 1G1XB 5H6QA 1Y76B 3C3TA 4JTDB 1G4YB 5LA6B 4JYAO 1IURA 2QJ1A 2QWPB 1BQZA 3BAAA 2Q6AA 1YHQV 5LHHA 1K73W 2CK3G 4LWSB 4OPAA 1TAEA 2XT9A 1CPYA 3A2FA 1VIBA 4QE7A 2P5OA 1R6NA 1W0JG 3H1IH 1ZX3A 1PD3A 4MTFA 4DXWA 3W7TA 4PA4A 2CE4A 3X2QC 1AI6A 2FL4A 1EZJA 2BCCH 2QWOB 1EFRG 4GCZA 4MVMA 1WNSA 2UU9B 3R65A 2F95B 1WA8A 3JSLA 2F43G 4TV8A 1K97A 2ZR2A 4JYBA 4HNAA 4I50B 1Q7YW 2IJHA 3UM7A 1JJ2U 1FJGB 1KBHA 3H1JH 4UB6Z 4HYOA 2QM7A 4YJ2B 5C8YB 1NTKH 2IU3A 1GN4A 2GSMB 3A8TA 3JASB 3N2GA 4FLUA 4K8XA 4BAYA 3J81N 2A7WA 1H8HG 2Q8VA 2JJ1G 2WLJA 1OCCC 1QLNA 4JASA 2LQTA 5LHGA 1XNQB 2VQEB 5KHJA 4FM0A 2ITCC 3APQA 1AILA 4YY3O 2EJ7A 1MMMA 3GVMA 2K9PA 1R3LC 1WPBA 2NR5A 5IWAB 5LMNB 5L3BA 2KG7A 5LP6A 3IC9A 4K0KB 4UCRA 4LF8O 5JJJB 1JQ0A 2YIBA 4EB6A 2N04A 5H5NA 5LL6Y 2YEVA 3ABUA 3CRAA 4UV9A 2JJ2G 2QTSA 4O2BA 2IM9A 3ML0A 4JPRA 3ZMZA 1EZVH 3E8BA 1WP7A 2UXXA 1H8EG 3VBBA 2UUCB 2V7QG 4W4LA 1EN5A 1GKFA 4TV8B 4DV7O 5ITZB 1F4MA 1F51A 3HB3B 4UCUA 4LCUC 4JYAB 4X65O 2M7WA 4PDVA 2P7TC 5IT9N 2UUAO 3M8AA 1SETA 2CTRA 1THZA 4YJ3B 3ZX6A 3TETA 3ZRSA 1VQOV 2VS0A 1VQ6V 2ETNA 3CRMA 3J80N 4UCSA 1EBOA 2EZPA 2OTLV 4GKJO 4NB5A 1U96A 1N4CA 1XDCA 1YCIA 4PDLA 1MOFA 3GWKC 2UXCO 1R3KC 2D3OW 2NLJC 4FM2A 4I9WA 1AI5A 2QKCA 2HJFC 2H94A 1SRYA 5LXTA 1SESA 3ZRVA 5IJ0B 3E22A 2HEPA 4F6EA 3N27A 5GTIZ 1Z5WA 2KSDA 3QG5A 4X1YB 2YDEA 1LNQA 3K03A 3CXHF 4J11A 1RSOB 3JD3A 1GMGA 4FM1A 5EZYA 1GM7A 4DV0O 1Y66A 5B1BB 2Q68A 1VQ4V 4K3AA 4QIWF 4YY3B 1NZ6A 2Q9LA 2DJVA 5AG2A 3OGCC 3OM3B 1BHAA 4DV3O 3SYCA 2LW7A 4WFAV 2WLNA 3ZIAG 4HZ3A 4IIJB 5KLVH 3JCZA 3RYCA 1FXVA 4LF8B 1PP9H 4YIPA 5J2UA 4GYCB 3K04A 4ZI7B 1DF5A 1SZXA 2JDIG 5LGNA 4DR4O 1AP5A 1TVKA 1YF2A 1F23A 5EIBD 2QWNB 1P49A 4TV9B 4MVZA 4MVQA 2ZE5A 4U3JA 3K3WA 4P9PA 3WFVA 3D36A 4F4LA 3AG1C 3G6EV 5GONB 4DV7B 3ETGA 1K3EA 4Z2WA 1SC5B 4O2AA 4X65B 3C90A 2QTOA 3U0ZA 1GM9A 3O9OA 5LXTB 2UUAB 4H33A 5EC1C 4MVOA 1ZL8B 4XDLA 1YTFB 1K9MW 4X62O 3G71V 3KKYA 4ZOLB 5LBQA 3T1HB 2HP8A 1JX9A 4CH6A 2LO1A 5B1OA 4GKJB 3CC2V 1HNXB 5JVDA 4CS4A 5KA5A 3HR0A 1QVFU 1I08A 1NU1H 3IFXA 1A32A 3FD9A 5BXZA 4X20A 1Z5VA 4I4TB 2NNUA 4NTXA 2N05A 3ABTA 3LDDA 3VQWA 3E8FA 3TCUA 4J42A 2DYSC 1UPGA 4UXNA 1B06A 2X7RB 2IW5A 5IJ9B 3CCUV 5KX5B 2WLHA 2QR4A 5C93A 1ZTEA 4BIUA 4JAAA 1K5SA 4LF6B 4E4EA 1SF9A 4UV8A 5J2TB 4NXNO 1PV0A 3JSNA 5B1NA 3C3SA 3IC7A 1I7FA 4KP4A 4RUFA 1MZEA 5B5EZ 3E86A 2ZR3A 2WLLB 1BGYH 2QGNA 2XAHA 3JD2A 2JGDB 3AG2B 5EC2C 2KQXA 3UQ8A 1GH6A 4JI1O 4WBNA 4DV3B 4E2LA 2ILMA 2Y48A 3F7YC 5EBLC 2GBOA 3D3QA 1AJNA 3FFQA 4X9QA 1NVPB 2YSUB 4FLYA 2HKOA 1MSWD 4DR4B 5EYPA 4KHPO 1OCZB 3FAVA 2JVDA 1H38A 4JYYA 3K79A 1MABG 1Y67A 5EK0A 4R8CA 3MHSC 1H2MA 4DR3O 3JCUZ 3I5DA 5DN6G 2UXBO 3HKBB 1CEZA 4X20B 2BOBC 2JIZG 1GK9A 4O4JA 1ZWIC 4RAIA 4B3TO 1IXBA 3RN4A 2BSKA 4FLZA 3CWBH 1JJOA 3ASNB 2WLIB 2AZ2A 3BA8A 2ZDIA 3SPCA 3JD4A 4X62B 3K0GA 4XBFA 1VEWA 1GAXA 3LNMB 3JARB 3RT3C 2WA3A 1NR7A 3JAWA 5GTHZ 2YXYA 1D5NA 5CA3A 1DK1A 1VQ7V 2XNDG 4PELA 1N36B 5L3GA 1YITV 3MHHC 1B3QA 1VQ8V 1QR8A 2Y69C 4MVUA 2A3QA 3HKEA 2LFSA 3CRCA 5L3FA 2WA4A 3T1CA 1RPOA 4JYCA 1XEQA 3AG7A 3JAKA 1XMOO 3RVZA 1QQCA 3K9SA 1NKDA 1V55C 3B8NA 2YIAA 2YC0A 5LOVA 5E79Z 4LF4O 3CEIA 3AG3C 1AR4A 4NXNB 1S5LZ 5EBMC 1BS3A 1QU7A 3ZBHA 2LGQA 2EIKB 4EFEA 3H01A 2BE3A 4X88A 4FZ0A 2JK5C 4CC5A 2Q69A 2ZKOA 2CTWA 4ZHQA 3I55V 1NI8A 4JI1B 2Y0IA 2YI9A 1QBZA 1SA0A 5K1PA 1S77D 1I5YA 1FXHA 3OGIB 1YVWA 2A79B 1DTOA 4IL6Z 2JS5A 1I0HA 2RMKB 2UUBO 3N2KB 4DYLA 2ZD9A 4QJFB 1BHBA 5IWAO 1LUWA 3G4SV 3EFFK 1KKCA 3DTUB 4I9QA 4BW5A 4MSWC 4NXMO 2DYRB 3CC4V
chains in the Genus database with same CATH topology
4G27B 1L1FA 2EINC 4QPJA 2ATKC 3CPWU 1YSCA 3E35A 1PNMA 1I5XA 1NH2B 1KD1W 2IH3C 4YXWG 4XDKA 2PI4A 3JD1A 1JQ0A 4WFGA 4LC1A 1YJ9V 3ZRWB 1QR9A 5CBFA 2YEVA 3AG4C 3ABUA 4PA3A 4UV9A 2JJ2G 1VQMV 3ML0A 4Z1MG 4JPRA 5H6RA 3CCMV 2W6JG 3B8MA 3CYOA 1AR1B 1NVPD 1UJWB 3VOUA 3ZMZA 3E8BA 1K5QA 1RM1B 4ZBMA 2UXXA 3MD0A 4MT8A 3P30A 2EIKC 1H8EG 4UUJC 3VBBA 2V7QG 2QM8A 1R6KA 1GKFA 1F4MA 4QE9A 1VQPV 1F51A 2WLLA 3HB3B 4LCUC 5B3SB 2EIJB 4MW3A 2M7WA 3ABMB 4KFMA 4PDVA 2P7TC 1P7BA 4JTCB 4HAMA 5J9PC 3SYPA 3BEHA 3W7XA 4GX1A 1SETA 1THZA 3LDCA 3TETA 3SPHA 3ZRSA 1VQOV 1H2GA 1VQNV 5IYDO 1VQ6V 2OTJV 2ITDC 1OCRC 1GTOA 4LP8A 1W0KG 2DYRC 2DQ0A 4U7OA 2Z3YA 2MK3A 1QVGU 1VQ9V 1EBOA 1QLEB 2EZPA 2KB1A 4P9OA 5EBWC 2Z5UA 2JEXA 3K0DA 1VQLV 2OTLV 1FXKB 1KP3A 2IJIA 5L3CA 1S0VA 3ETDA 1K4CC 2HR3A 3STLC 4L87A 4MTOA 4R50A 2WAMA 1WLEA 4RQEA 3I56V 4PDLA 4PDRA 4DO2A 1J95A 1Q81W 1NJIW 1MOFA 3E2EA 4PDMA 3CP1A 1Y4MA 3CC7V 1K4DC 1XL4A 1NQTA 1VQKV 1R3KC 3D3IA 1S5HC 2D3OW 2NLJC 4I9WA 3NXSA 3OEEG 1KC8W 1AI5A 2IJJA 3E8GA 4JGSA 4FJCC 2HJFC 2H94A 4G28B 3W7WA 1RM1C 1SRYA 2ZXWB 1SESA 1JPXA 4RUEA 1M56B 3SYOA 3SPJA 3ZRVA 5HFLA 3ABKB 2OCCB 1TUEB 4MW8A 2WLIA 2XAFA 4LBEC 3AG1B 3RVYA 5B3SC 3JYCA 3ABMC 3E89A 2XASA 1PKXA 1BL8A 1LNQA 2EBOA 3K03A 1KP2A 3JD3A 2LP7A 1RPRA 1GMGA 4U7NA 2EJRA 3CCQV 3PJSK 4PA6A 2Q67A 1GM7A 1Y66A 3K08A 2Q68A 5B1BB 4CZZA 1VQ4V 1K92A 2LFRA 4QIWF 1OZ0A 5BZBA 4WFFA 1JVMA 2R9RB 2W6IG 3ABLB 3OGCC 3BY6A 3OM3B 3ZMSA 1BHAA 4JAVA 3SYCA 1QCEA 1QLEC 4WFAV 2WLNA 4H37A 3ZIAG 4WF9V 4HZ3A 4P30A 5CBGA 5LHIA 1NBMG 2X6AA 5L3EA 3JCZA 2XAGA 1S76D 1FXVA 1VQ5V 2JEUA 3OE7G 3LSQA 3OMAB 3ZMTA 2C2AA 2W0FC 3K04A 3RW0A 1DF5A 2JDIG 3CXCU 5LGNA 3FB7C 2WSSG 4KUMA 1F23A 2UXNA 1M9NA 4MVRA 2DQ3A 1S3JA 4BIZA 1COWG 4MVZA 4MVQA 2AHYA 2ZXWC 2X0LA 1M56C 2OCCC 2K1EA 3F7VC 3K3WA 1NH2D 2A9HA 4JF3A 4P9PA 2DYSB 4I5SA 4N21A 3WFVA 3D36A 3LSSA 4F4LA 3AG1C 3G6EV 3ETGA 1FS0G 1DF4A 1K3EA 1YIJV 2QE7G 4Q20A 3QO8A 3RBZA 1K8AW 2QTOA 1GM9A 3OEHG 4X8AA 5IY5C 1AROP 4FMTA 1M1KW 4H33A 1Q86W 1K7DA 4UVAA 5B1BC 5EC1C 4MVOA 3ZRXA 2R9IA 3ZN0A 2ZDIC 4XDLA 1YTFB 1PNKA 3ABLC 1K9MW 3TK1A 3G71V 1XL6A 1K34A 3STZC 1E1RG 2DWDC 5LBQA 3ZJZA 3CCSV 3T4ZA 3CCLV 2HVJC 5L3DA 1AJPA 1JX9A 1OCCB 1K33A 3ZMVA 1HWYA 2X6BA 1B6QA 3FYIB 4TSFG 5FL7G 2HVKC 5B1OA 3CC2V 1MG1A 3GWOA 3ASOB 2B1IA 3EHBB 2IJKA 5KA5A 3CMAV 1QVFU 3IFXA 1FFTB 3ZRWA 1YTFD 3OMIB 1GO3F 4GX5A 5B1AB 3ZMUA 2NNUA 3ABTA 2HFEC 3P32A 3LDDA 3E8FA 4OXSA 3TCUA 2DYSC 4UXNA 2X7RB 3W7SA 4FK5C 2IW5A 2EIMB 2YEVB 3CCUV 2XAQA 3SYQA 4WCEV 3FB8C 2WLHA 1GM8A 3QO5A 5C93A 2EIJC 3AG4B 2FTKA 3T4DA 4BIUA 1K5SA 2ZQMA 3T2MA 1IXMA 2EILB 2P6JA 4GX2A 4QPKA 5IYCO 4UV8A 5CN0A 1YJNV 4RQFA 5B1NA 1E1QG 4MTGA 3OFNG 2A0LA 1KECA 3IC7A 2WWWA 3QO7A 4KP4A 3SPGA 1OCOB 1M57B 4RUFA 3E86A 5LGTA 3DGEA 2DW4A 3K9AA 1F4NA 2ZR3A 2GHYA 2WLLB 3CCVV 2XAHA 3JD2A 3AG2B 5IYBO 2P67A 1AI7A 4FIPC 5EC2C 2X6CA 4E2LA 2Y48A 1KQSU 1NR1A 1FXKC 3JD0A 4JAUA 4RO2A 1N8RW 3F7YC 3UKMA 2V1DA 3AEIA 4G2KA 4N23A 5EBLC 1BMFG 3OAAG 3A0RA 1M90W 3ASOC 2QEXV 3CD6V 3CCRV 1YI2V 3OUSA 1AJNA 3FKSG 1SERA 1OCRB 4XDJA 3SJQC 5DM6V 1NVPB 2YSUB 2HKOA 2Y69B 4EKWA 1MSWD 4JTAB 5B1AC 4QNHB 1KKDA 4P2ZA 1OCZB 3X2QB 1H38A 5HFMA 5H9CA 3LDEA 3K79A 1MABG 1Q82W 5EK0A 3ABKC 4R8CA 3MHSC 2EZOA 2HLDG 4WFHA 1R3IC 2DWEC 2B5UA 2EIMC 5DN6G 3OR7C 5CMUA 1CEZA 4J9ZB 1V55B 2BOBC 3GB7C 2JIZG 3OMNB 2WPDG 2H8PC 3FB5C 1JOYA 1GK9A 2EILC 3WG7B 1ZWIC 4RAIA 1CP9A 1SZTA 3B77A 3AG3B 3KG2A 4TT3G 1DLBA 3HPLC 1PNLA 1OCOC 1M57C 3F5WC 2PI5A 3ASNB 2WLIB 3IGAC 4J9YB 2IH1C 4PA9A 5H6QA 4JTDB 3ZN1A 1G4YB 2ZDIA 3CCJV 3AG2C 3SPCA 2BOCC 3JD4A 4WFBV 1S72V 3K0GA 4MTXA 4XBFA 4GT1A 4ZKIA 2Q6AA 3LNMB 1YHQV 4MS2A 5LHHA 1P4RA 1ENVA 2WLMA 1K73W 2CK3G 4MVSA 1V54B 4GX0A 2QA4V 1NR7A 1AI4A 2IU0A 2AHZA 5CA3A 1VQ7V 2XNDG 4PELA 4X89A 1G8MA 5L3GA 1CPYA 4QE7A 1R3JC 2QKSA 3MHHC 4UVCA 1YITV 1VQ8V 1R6NA 1ROPA 1W0JG 1PD3A 1QR8A 4MTFA 2Y69C 4DXWA 1OHHG 2WLKA 3FYEB 3SYAA 1ORQC 3W7TA 4MVUA 1OCZC 4PA4A 1YJWV 3ETEA 3X2QC 2EINB 2LFSA 1AI6A 3LUTB 5L3FA 3T1CA 1RPOA 1EZJA 4JYCA 5KUKA 1EFRG 4GCZA 4MVMA 2OT5A 3QNEA 3R65A 3OR6C 3CCEV 3RVZA 3ZCCA 3OW2U 1NKDA 2F43G 1K97A 1V55C 3B8NA 2ZR2A 1R73A 4JYBA 4PA7A 1WPXA 2XAJA 3WG7C 1Q7YW 4CBCA 3W7UA 5IDJA 4FPPA 2IJHA 3AG3C 5KUMA 3UM7A 1JJ2U 5EBMC 5GW7A 4WFEA 5CBHA 4HYOA 5E1AC 2HG5C 3ASNC 2QM7A 2EIKB 3H01A 4X88A 2IU3A 5LGUA 4R6ZA 2GSMB 2JK5C 3OUFA 4R7CA 1E79G 2Q69A 2B1GA 4BAYA 4ASUG 1H8HG 3I55V 1PL0A 3CMEV 2JJ1G 2WLJA 1OCCC 3E83A 1JCHA 1QLNA 4JASA 5LHGA 1V54C 1W2BU 1QBZA 1S77D 5IY5B 1I5YA 3M99B 1FXHA 1FXKA 4UVBA 2ITCC 2A79B 3E8HA 1DTOA 5KA6A 3K06A 2ZD9A 1AJQA 4QJFB 1BHBA 2XOKG 2P90A 1R3LC 3SPIA 3EFFK 3G4SV 3DTUB 4BW5A 4MSWC 5L3BA 2DYRB 3CC4V 3FB6C 4TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G27 B;  3RVY A;  3HPL C;  2EIN C;  5B3S C;  2ATK C;  1OCO C;  1M57 C;  3JYC A;  3ABM C;  3E89 A;  3F5W C;  2WLI B;  2IH3 C;  3IGA C;  3IFX A;  1BL8 A;  1LNQ A;  4J9Y B;  3K03 A;  4XDK A;  2IH1 C;  4PA9 A;  4JTD B;  1G4Y B;  4GX5 A;  4WFG A;  3AG2 C;  3SPC A;  2BOC C;  3PJS K;  4PA6 A;  2Q67 A;  3K08 A;  2Q68 A;  2HFE C;  3K0G A;  3LDD A;  5CBF A;  2YEV A;  3AG4 C;  3E8F A;  4OXS A;  5BZB A;  2Q6A A;  3LNM B;  1JVM A;  4MS2 A;  4PA3 A;  4WFF A;  3TCU A;  2WLM A;  2DYS C;  2R9R B;  4MVS A;  4GX0 A;  3OGC C;  3VOU A;  2AHZ A;  3E8B A;  3SYC A;  3SYQ A;  1QLE C;  3FB8 C;  2WLH A;  4ZBM A;  2WLN A;  2EIJ C;  4X89 A;  2EIK C;  4H37 A;  4UUJ C;  3T4D A;  4QE7 A;  1R3J C;  2QKS A;  4HZ3 A;  4P30 A;  3T2M A;  5CBG A;  4GX2 A;  4MTF A;  2X6A A;  2Y69 C;  4DXW A;  2WLK A;  3SYA A;  1ORQ C;  4QE9 A;  4MVU A;  1OCZ C;  4PA4 A;  2WLL A;  4MTG A;  2A0L A;  3X2Q C;  4LCU C;  4MW3 A;  3LUT B;  2W0F C;  3K04 A;  3RW0 A;  3SPG A;  4RUF A;  3E86 A;  4KFM A;  3T1C A;  4PDV A;  3FB7 C;  2P7T C;  1P7B A;  4JTC B;  2WLL B;  4MVR A;  5KUK A;  5J9P C;  4MVM A;  3SYP A;  3BEH A;  4GX1 A;  3R65 A;  3OR6 C;  3RVZ A;  3LDC A;  4MVZ A;  3TET A;  4MVQ A;  2AHY A;  2ZXW C;  2X6C A;  5EC2 C;  1M56 C;  3SPH A;  3ZRS A;  1V55 C;  2ITD C;  2K1E A;  1OCR C;  2OCC C;  3F7V C;  4PA7 A;  2A9H A;  4RO2 A;  3F7Y C;  4P9P A;  4LP8 A;  3UKM A;  3WG7 C;  4CBC A;  2DYR C;  5EBL C;  3AG3 C;  4F4L A;  3AG1 C;  5KUM A;  3UM7 A;  5EBM C;  3ASO C;  4P9O A;  2KB1 A;  3OUS A;  4WFE A;  5CBH A;  5EBW C;  4HYO A;  5E1A C;  2HG5 C;  3ASN C;  3K0D A;  4XDJ A;  3RBZ A;  3SJQ C;  2QTO A;  4X88 A;  4R6Z A;  4TWK A;  1K4C C;  4X8A A;  3STL C;  2JK5 C;  4EKW A;  3OUF A;  5IY5 C;  4MTO A;  4JTA B;  4R50 A;  4R7C A;  5B1A C;  2Q69 A;  4H33 A;  4P2Z A;  4QNH B;  1KKD A;  5B1B C;  4PDL A;  4PDR A;  1J95 A;  5EC1 C;  3LDE A;  4MVO A;  4PDM A;  2WLJ A;  1OCC C;  3E83 A;  5EK0 A;  4XDL A;  1K4D C;  1XL4 A;  3ABK C;  4R8C A;  1V54 C;  1R3K C;  3ABL C;  1S5H C;  1R3I C;  2NLJ C;  4WFH A;  2DWE C;  4I9W A;  2EIM C;  1XL6 A;  3E8G A;  2ITC C;  2A79 B;  2HJF C;  3E8H A;  3OR7 C;  4G28 B;  3STZ C;  2DWD C;  3ZJZ A;  3T4Z A;  3K06 A;  4J9Z B;  4RUE A;  2HVJ C;  2ZD9 A;  3SYO A;  3SPJ A;  2BOB C;  3GB7 C;  2X6B A;  1R3L C;  2H8P C;  3FB5 C;  2EIL C;  3EFF K;  3SPI A;  4MW8 A;  1ZWI C;  2WLI A;  4MSW C;  4RAI A;  4BW5 A;  2HVK C;  3FB6 C;  4LBE C;  3KG2 A; 
#chains in the Genus database with same CATH topology
 4QPJ A;  2ATK C;  2E5L O;  4KHP B;  1YSC A;  3E35 A;  1I5X A;  2IH3 C;  2MW2 B;  2RCV A;  5CB4 A;  3B4S A;  3OD4 A;  4PHZ A;  4DUY O;  4WFG A;  4CH5 A;  1YJ9 V;  2VWK A;  3ZRW B;  1Q8I A;  2UXB B;  2ARH A;  4PA3 A;  1L0N H;  5JCO A;  1AR1 B;  5KHH A;  4Z1V A;  3QF7 A;  4B3T B;  3P30 A;  2ZM6 O;  1R6K A;  4H13 B;  1R6T A;  2DOS A;  4QE9 A;  1N34 B;  2ZCE A;  1EN6 A;  5B3S B;  2OIG A;  3K5N A;  3ABM B;  3B2E E;  5J9P C;  3SYP A;  3M7M X;  4DV2 B;  3UT5 A;  1H2G A;  2ADP A;  5IYZ B;  2F66 C;  1OCR C;  1GTO A;  4LP8 A;  2PUS A;  1W0K G;  2DQ0 A;  2CUG A;  1D5A A;  1QVG U;  1F7Y A;  2FML A;  2DE0 X;  3ZHS A;  1QLE B;  1SA0 B;  4IYI A;  2JEX A;  3K0D A;  1IBM O;  3G67 A;  2Q0A A;  4B3S O;  1K4C C;  4O4L A;  1D2D A;  1XMO B;  4R50 A;  1JFF A;  1EM1 A;  4J7J A;  1WLE A;  1KU9 A;  4PDR A;  3E2E A;  3RYI A;  4BR6 A;  3CP1 A;  1K4D C;  1XL4 A;  4CS3 A;  4NVP A;  5JQG A;  2IJJ A;  4LF4 B;  1IDS A;  2P22 C;  4J41 A;  1TUB B;  2GV9 A;  4TQF A;  5HFL A;  3ABK B;  1TUE B;  4LFA O;  5BMV A;  2XAF A;  2PYJ A;  1PKX A;  4F6R B;  1BL8 A;  1NTZ H;  1KP2 A;  4O4I A;  1XRE A;  1HNZ O;  1N0N A;  2Q67 A;  3K08 A;  1K92 A;  1OZ0 A;  1B04 A;  1P84 F;  2UUB B;  3BPZ A;  1HR0 O;  3JAL A;  3ABL B;  2CH7 A;  3F5T A;  4UFZ A;  2FB5 A;  3ZMS A;  4DR6 O;  3MAQ A;  4GLX A;  4NXM B;  1QCE A;  4JV5 O;  2O57 A;  4AI8 A;  2E5L B;  5JJE B;  1NBM G;  3SJC C;  2X6A A;  5D5Q A;  3VQY A;  2D2C B;  1S76 D;  4DUY B;  4DV4 B;  1J5E O;  2XUM A;  3OMA B;  2C2A A;  2F1M A;  4FVM A;  2WSS G;  4KUM A;  2UXN A;  1M9N A;  1S3J A;  4AHC A;  1M93 A;  3F7V C;  3DXR A;  1NH2 D;  1Q3E A;  2A9H A;  2ZM6 B;  3L73 H;  1TA8 A;  1WA8 B;  3LSS A;  1DF4 A;  4HNA B;  1YIJ V;  2CGN A;  4Q20 A;  3QO8 A;  3RBZ A;  1K8A W;  1M5I A;  5TIS Z;  4X8A A;  5A9G A;  5IY5 C;  1K7D A;  5B1B C;  3N2G B;  2UXD O;  4JI7 B;  3KZI Z;  4I7Z B;  3CCS V;  3CCL V;  3T1H O;  1AJP A;  1OCC B;  3NR7 A;  3ZMV A;  4DRX A;  3FYI B;  1IBM B;  1RFY A;  4X1K A;  2HVK C;  4B3S B;  1HNX O;  1MG1 A;  3GWO A;  3ASO B;  3JAL B;  2ZE8 A;  3H1L H;  1FFT B;  2KG7 B;  1YTF D;  5LP6 B;  1GO3 F;  4GX5 A;  4IYH A;  2ZNI A;  5B1A B;  3ZMU A;  1FAF A;  2HFE C;  4EB6 B;  4B7K A;  2JS3 A;  3W7S A;  1KYO F;  2EIM B;  2YEV B;  4LFA B;  2XAQ A;  3SYQ A;  3WB0 A;  4WCE V;  3FB8 C;  4B3M O;  2EIJ C;  4O2B B;  4LF6 O;  4DR2 B;  2EIL B;  5KHG A;  4GX2 A;  5IYC O;  1YJN V;  4RQF A;  3OFN G;  1HNZ B;  2QKA A;  2WWW A;  5FPR A;  2XTA A;  1OCO B;  1YZB A;  2EUL A;  4PI2 A;  2DW4 A;  1F4N A;  2BTQ A;  3BCC H;  3CCV V;  3L71 H;  1VF6 C;  4YHH O;  1HR0 B;  3PN1 A;  1VF6 A;  2P67 A;  4LFC O;  1AI7 A;  4FIP C;  4DR6 B;  4JV5 B;  1BT8 A;  3HKC A;  4JI2 O;  1FXK C;  2GTS A;  4JAU A;  3AEI A;  4N23 A;  5A2Q N;  3OUS A;  4LH7 A;  1J5E B;  4XDJ A;  3RFR A;  4FLV A;  4K35 A;  3U10 A;  4QNH B;  4AQY O;  4P2Z A;  4DRX B;  5CA1 A;  1Q82 W;  5KMG A;  4DUZ O;  2L35 A;  4B7E A;  5CMU A;  4J7Z A;  4J9Z B;  2FKX A;  3GB7 C;  2OIE A;  2H8P C;  3FB5 C;  1JOY A;  3WG7 B;  3BHP A;  1CP9 A;  1EN4 A;  3A0H Z;  1ZUQ A;  3HPL C;  4IT5 A;  1IBL O;  3E22 B;  1MSD A;  3IGA C;  4IHJ A;  4J9Y B;  1ZSP A;  2IH1 C;  4PA9 A;  5BY1 A;  3Q4H A;  3AG2 C;  2UXD B;  1XQ8 A;  2E75 B;  4GT1 A;  1WB8 A;  1XUQ A;  4MS2 A;  1P4R A;  2WLM A;  5EZY B;  1JR9 A;  1V54 B;  2F4V O;  4ZIB A;  4NTW A;  1N36 O;  5LYJ A;  1G8M A;  2QKS A;  2VQF O;  1SQV H;  1OHH G;  2WLK A;  3SYA A;  1ORQ C;  1FFX A;  1OCZ C;  1MNG A;  2EIN B;  2PY5 A;  3RYC B;  1XHX A;  4X1I A;  5KUK A;  5J2U B;  3QNE A;  3T1Y O;  1MZF A;  2F23 A;  3ZCC A;  3JAT A;  4DR1 O;  1TVK B;  1FPO A;  2CDY A;  1R73 A;  4B3M B;  3H9V A;  5CA1 B;  4X66 O;  3W7U A;  5IDJ A;  4FPP A;  1OJH A;  1TGO A;  4LFB O;  5KUM A;  4TOI A;  4U3J B;  2Q7E A;  4D6T H;  5GW7 A;  3DC6 A;  4WFE A;  5CBH A;  2HG5 C;  3ASN C;  3RYH A;  2AZ0 A;  4FFB A;  3D8C A;  4R6Z A;  3OUF A;  4YHH B;  2B1G A;  3APO A;  4O2A B;  4JI8 O;  1PL0 A;  1PM9 A;  4LFC B;  1IBK O;  4JI2 B;  2CAZ C;  2NN4 A;  5CA0 A;  4CH4 A;  3E8H A;  2OCH A;  3H1K H;  3K06 A;  3BA9 A;  1AJQ A;  2P90 A;  1YDX A;  3SPI A;  3OTO O;  1KUQ A;  3FB6 C;  4J7K A;  2HJD A;  4AQY B;  4JZG A;  1I94 O;  2JRI A;  4YXW G;  3LNN A;  4KXR A;  4JI4 B;  3KCY A;  3JD1 A;  5JVD B;  3CRR A;  4DUZ B;  3RYF A;  1XNR O;  1QR9 A;  2Y0P A;  5CBF A;  4LR3 A;  3AG4 C;  1XBL A;  1VMG A;  1NTM H;  5H6R A;  3B8M A;  3CYO A;  1UJW B;  3VOU A;  2YXH A;  1RM1 B;  4ZBM A;  4DK1 A;  1Q6I A;  2EIK C;  4UUJ C;  1IBL B;  2HHH O;  1OV9 A;  1WP8 A;  2QM8 A;  1N34 O;  2DN9 A;  4MW3 A;  3CJH A;  2CTQ A;  4PI0 A;  2Q5Z A;  4LF5 O;  3BEH A;  4DV2 O;  2F4V B;  3LDC A;  2VWJ A;  5IYD O;  5KAF Z;  2ITD C;  3MDS A;  3P3N A;  2VQF B;  4LF7 O;  2DYR C;  2H3O A;  4WBN B;  5KAI Z;  1VQ9 V;  4P9O A;  2KB1 A;  5FNV A;  2M6Y A;  2Z5U A;  2QWQ B;  1VQL V;  2IJI A;  1BSM A;  3ETD A;  4L87 A;  4MTO A;  3T1Y B;  1NJI W;  4DO2 A;  1J95 A;  5K1X A;  2B9Z A;  4DR1 B;  1Y4M A;  5EYP B;  1NQT A;  1S5H C;  3FAV B;  3OEE G;  1KC8 W;  4JGS A;  2RNB A;  3W7W A;  4X66 B;  2V4D A;  3RGB A;  4LFB B;  1JA8 A;  1YEW A;  2Q4P A;  2ZXW B;  4RUE A;  1M56 B;  2QDO A;  1NS1 A;  2OCC B;  3BAB A;  4H44 B;  4MW8 A;  4JI6 B;  4LNU A;  5B66 Z;  1XMQ O;  1Y76 A;  5B3S C;  1HP8 A;  4J10 A;  1XIL A;  5LA6 A;  3JYC A;  3ABM C;  3E89 A;  4O4J B;  2XAS A;  3K58 A;  2FYU H;  3ICX A;  4JI8 B;  2EBO A;  4D7T A;  5IE9 A;  1NT2 B;  2LP7 A;  1RPR A;  2BSK B;  4LH6 A;  1IBK B;  2ZIO A;  3CCQ V;  4LWS A;  2RN9 A;  4CZZ A;  1UFI A;  1AP6 A;  2LFR A;  4GKK O;  1GRJ A;  1JVM A;  1P7G A;  2R9R B;  2W6I G;  3L74 H;  2Q7H A;  1WB7 A;  3OTO B;  4JAV A;  5JH7 A;  3TGU H;  1VP7 A;  1QLE C;  3VQX A;  4H37 A;  4WF9 V;  1I94 B;  3JAW B;  2CGO A;  5CBG A;  5L3E A;  4DV4 O;  3OE7 G;  4JI0 O;  3ZED A;  1WN7 A;  1XNR B;  4FZ1 A;  3CXC U;  4MVR A;  3HKE B;  2DQ3 A;  2F93 B;  4I50 A;  4DV5 B;  2YXL A;  2AHY A;  2X0L A;  3JAK B;  4GZR B;  2ZNJ A;  2AGA A;  4JF3 A;  2HHH B;  4DR5 O;  4OX9 O;  4N21 A;  3G80 A;  5JWP A;  4YJ2 A;  5C8Y A;  1L8D A;  1FS0 G;  3L72 H;  3JAS A;  4ICG A;  2QE7 G;  3SGI A;  5FPO A;  1PPJ H;  1H2K A;  5LOV B;  2Q73 A;  2E3C A;  3OEH G;  4DV6 O;  1ARO P;  4FMT A;  1M1K W;  4LF5 B;  3ZHU A;  4PD4 F;  3K57 A;  4LNU B;  3ZN0 A;  5F2V O;  2LW1 A;  1PNK A;  3ABL C;  3TK1 A;  3BVO A;  4JI7 O;  1IX9 A;  3OT7 A;  4ABM A;  4ZHQ B;  1K34 A;  4LF7 B;  3STZ C;  1E1R G;  4CC6 A;  1GN6 A;  2HVJ C;  5L3D A;  2AXT Z;  1HWY A;  1B6Q A;  4NKG B;  4NYK A;  2YID A;  3EHB B;  2IJK A;  3CMA V;  4DV1 O;  5JH7 B;  1U97 A;  3OMI B;  3SJA C;  1GN2 A;  2GUZ A;  1CXZ B;  2OYQ A;  2QM4 A;  1KMI Z;  1Q90 D;  5CB4 B;  5BR8 O;  1WJZ A;  1Q6H A;  2Q0O C;  4FK5 C;  4UB8 Z;  1GM8 A;  5ITZ A;  1SQF A;  1XMQ B;  3ZHV A;  2YIC A;  4I55 A;  3T4D A;  4DK0 A;  4DR2 O;  2ZQM A;  3T2M A;  3FX7 A;  3K5M A;  2P6J A;  5CN0 A;  1SQQ H;  3QTC A;  1E1Q G;  4MTG A;  2A0L A;  1KEC A;  3SPG A;  1M57 B;  3TXQ A;  2VRZ A;  4YJ3 A;  1Q6U A;  4GKK B;  2YIB D;  3UO2 A;  1SQB H;  2X6C A;  2AW9 A;  1KQS U;  4JI5 O;  1NR1 A;  3LSU A;  2V1D A;  1KB9 F;  3UT5 B;  1BMF G;  3OAA G;  3A0R A;  3ASO C;  4NTY A;  2QEX V;  3CCR V;  1YI2 V;  1BZK A;  4JI3 O;  3FKS G;  4JI0 B;  1OCR B;  4RWU A;  3QVN A;  5LP6 C;  3WU2 Z;  4EKW A;  3L9D A;  2P06 A;  3ZHT A;  4JTA B;  3TXS A;  5B1A C;  3UO3 A;  3X2Q B;  5HFM A;  3LDE A;  4CS2 A;  1HNW B;  3AK2 A;  4O4L B;  4A5U B;  1JFF B;  2HLD G;  2Z0A A;  4WFH A;  5IJ0 A;  1X59 A;  2EIM C;  3A0B Z;  4DR5 B;  4OX9 B;  3RYI B;  3ZHQ A;  1H2N A;  4X1Y A;  2GUZ B;  5JQG B;  2EIL C;  1SZT A;  1O9H A;  3SR2 C;  3KG2 A;  4DV6 B;  1RSO A;  1DLB A;  4EEQ A;  1PNL A;  1OCO C;  4TUY A;  4UCO A;  5BMV B;  4U3F H;  3ZN1 A;  3CCJ V;  3KCX A;  4I55 B;  4OPH A;  2BOC C;  2R70 A;  4WFB V;  1S72 V;  4MTX A;  4O4I B;  4ZKI A;  1ENV A;  4MVS A;  4GX0 A;  1G6U A;  3VQV A;  2QA4 V;  2PTM A;  1AI4 A;  4IIJ A;  2PZS A;  2IU0 A;  3HKD A;  2AHZ A;  1US6 A;  2YI8 A;  3BRC A;  4X89 A;  1IZ3 A;  4K8Z A;  1R3J C;  2CH7 B;  4UVC A;  1ROP A;  4ZI7 A;  2RQ6 A;  3THO A;  4DV1 B;  1PL4 A;  2ZIN A;  3FYE B;  1SQX H;  1AVM A;  2LGW A;  1YJW V;  3ETE A;  1VAR A;  1FKA O;  1YXB A;  3LUT B;  4TV9 A;  5BR8 B;  2OT5 A;  3OR6 C;  3CCE V;  2G38 A;  3OW2 U;  4OGQ B;  5GON A;  3AK1 A;  4PA7 A;  1WPX A;  2XAJ A;  2W0X A;  3WG7 C;  1M4U A;  2YS8 A;  4CBC A;  1N33 O;  1URF A;  3DXR B;  3BFR A;  4HBN A;  3S3X A;  4I0X A;  5E1A C;  2CTP A;  2ODM A;  5LGU A;  1ZL8 A;  4R7C A;  1E79 G;  5KHK A;  4ASU G;  1HW7 A;  4JZ2 A;  4ZOL A;  3CME V;  3E83 A;  1JCH A;  1V54 C;  1SQP H;  1W2B U;  1WAZ A;  4JI5 B;  4B3R O;  5IY5 B;  3M99 B;  1Y6X A;  4TUY B;  1FXK A;  4UVB A;  3SDL A;  4D7S A;  1L0L H;  5KA6 A;  1VF7 A;  2XOK G;  4JI3 B;  4FFK A;  1AB3 A;  4TWK A;  3O65 A;  4NR1 A;  4G27 B;  1L1F A;  2EIN C;  3CPW U;  1PNM A;  1NH2 B;  2ZE6 A;  4X1K B;  4I4T A;  1KD1 W;  3HKD B;  4JI4 O;  4XDK A;  1BE3 H;  2PI4 A;  5LMU O;  4LC1 A;  3SJB C;  1N0J A;  5IJ9 A;  5KX5 A;  1VQM V;  1LR1 A;  3JAM N;  4Z1M G;  3CCM V;  2W6J G;  1NVP D;  1K5Q A;  5J2T A;  2Y4T A;  3U11 A;  3MD0 A;  4MT8 A;  2ADQ B;  4DW1 A;  4PJ0 Z;  4BIO A;  3D36 C;  4LF9 O;  1VQP V;  2WLL A;  2EIJ B;  2JGD A;  4KFM A;  1P7B A;  4JTC B;  4IGG A;  3CB2 A;  4HAM A;  4I0X B;  3W7X A;  4GX1 A;  5DED A;  2BTQ B;  3SPH A;  2XHB A;  1VQN V;  2OTJ V;  5EIB C;  2R72 A;  3S3W A;  3EVK A;  1BQ0 A;  4U7O A;  2Z3Y A;  4BW9 A;  2MK3 A;  3HKC B;  2PYL A;  4DR7 O;  5EBW C;  1LUV A;  3CHX A;  1FXK B;  1KP3 A;  1Z2G A;  5L3C A;  1S0V A;  1AR5 A;  2HR3 A;  3P3P A;  3STL C;  2WAM A;  3CX5 F;  4EFB A;  4RQE A;  4Q6G A;  3I56 V;  1Q81 W;  3HKB A;  2ZIM A;  4PDM A;  3CC7 V;  1VQK V;  3D3I A;  2UXC B;  3NXS A;  3E8G A;  4FJC C;  4G28 B;  4X64 O;  1RM1 C;  1N33 B;  4FLX A;  5KMG B;  1JPX A;  3SYO A;  3SPJ A;  1R1B A;  3IJ4 A;  4JI6 O;  2WLI A;  4TQD A;  4LBE C;  3AG1 B;  3RVY A;  2JGU A;  3WB1 A;  3CE2 A;  1N32 O;  3L75 H;  4BWA A;  2E74 B;  2N74 A;  1H2L A;  4C7U A;  3JAR A;  1XOU A;  4U7N A;  2R9A A;  2EJR A;  4B3R B;  2RDC A;  3PJS K;  4PA6 A;  1VF5 B;  4IHJ B;  2Y4U A;  4DV0 B;  3DC5 A;  3Q4H B;  5BZB A;  4WFF A;  3OTF A;  2KKW A;  3BY6 A;  3K5L A;  1T5E A;  4P30 A;  5LHI A;  2A06 H;  2ZT9 B;  2XAG A;  5LYJ B;  1VQ5 V;  2JEU A;  1XHZ A;  2QSA A;  5LMU B;  3LSQ A;  3ZMT A;  2W0F C;  1FD9 A;  3RW0 A;  2OWO A;  4FLT A;  3AK3 A;  1ZAU A;  3FB7 C;  1FFX B;  4O4H A;  3R66 A;  2E76 B;  4DV5 O;  2GTA A;  1X4T A;  4BIZ A;  2QWR B;  1COW G;  3IAY A;  2ZXW C;  2IBZ H;  1M56 C;  4AIL C;  4X1I B;  3J7A U;  2OCC C;  2K1E A;  2DYS B;  3K59 A;  4I5S A;  3JAT B;  4LF9 B;  3B40 A;  1JMK C;  3L70 H;  3G6B A;  1Q86 W;  4UVA A;  3RYH B;  4FFB B;  1S5J A;  3ZRX A;  2R9I A;  2PF4 E;  2ZDI C;  3UCS C;  4H0L B;  3N2K A;  4B08 A;  2ZE7 A;  1QHT A;  1SS3 A;  3CS5 A;  1XL6 A;  4J80 A;  4W4K A;  2DWD C;  2BTO A;  3ZJZ A;  3T4Z A;  4DR7 B;  5CA0 B;  1K33 A;  4GUN A;  2X6B A;  3CRQ A;  4TSF G;  5FL7 G;  3H1H H;  2B1I A;  5D5P A;  1Y74 A;  3ZRW A;  1FYJ A;  4DW0 A;  3P32 A;  4X64 B;  3TJT A;  4OXS A;  2DMX A;  5KHI A;  2UU9 O;  3RYF B;  4PV1 B;  2EX3 A;  3QO5 A;  3RWR D;  3AG4 B;  1Q43 A;  4O4H B;  2FTK A;  4YIO A;  5FLX N;  1GN3 A;  1IXM A;  1N32 B;  1BCC H;  4QPK A;  1FJG O;  4L8J A;  1SKV A;  1RP3 B;  3QO7 A;  1W59 A;  5LGT A;  3CSX A;  3DGE A;  3K9A A;  2GHY A;  1ZLZ A;  5IYZ A;  5H2F Z;  2LJ2 A;  3CJH B;  5IYB O;  2YUA A;  1XNQ O;  2P4V A;  2VQE O;  2GDS A;  3JD0 A;  4CH3 A;  4RO2 A;  1N8R W;  3UKM A;  1Q5O A;  4G2K A;  1MA1 A;  1DGS A;  1QNM A;  5JJN B;  1M90 W;  4UCT A;  3CD6 V;  3ZS8 C;  1SER A;  1HDJ A;  1O9G A;  3SJQ C;  2P4K A;  5LMN O;  5DM6 V;  2L6L A;  2Y69 B;  5FNV B;  1KKD A;  4QGP A;  5DEC A;  4FLW A;  3EXA A;  1HNW O;  5H9C A;  1V9P A;  3ZHR A;  4K0K O;  1TUB A;  3ABK C;  2EZO A;  3ETQ A;  1R3I C;  3B09 A;  2DWE C;  2B5U A;  4DR3 B;  3OR7 C;  1IVS A;  1Y74 B;  3WB2 A;  5JCO C;  1XI1 A;  1V55 B;  2PGG A;  3OMN B;  2WPD G;  4KL1 A;  1H2S B;  4F6R A;  2RJZ A;  3K5O A;  3B77 A;  3AG3 B;  4TT3 G;  1SQG A;  2UUC O;  2Q7G A;  1M57 C;  3F5W C;  3DSQ A;  2PI5 A;  4UCV A;  1G1X B;  5H6Q A;  1Y76 B;  3C3T A;  4JTD B;  1G4Y B;  5LA6 B;  4JYA O;  1IUR A;  2QJ1 A;  2QWP B;  1BQZ A;  3BAA A;  2Q6A A;  1YHQ V;  5LHH A;  1K73 W;  2CK3 G;  4LWS B;  4OPA A;  1TAE A;  2XT9 A;  1CPY A;  3A2F A;  1VIB A;  4QE7 A;  2P5O A;  1R6N A;  1W0J G;  3H1I H;  1ZX3 A;  1PD3 A;  4MTF A;  4DXW A;  3W7T A;  4PA4 A;  2CE4 A;  3X2Q C;  1AI6 A;  2FL4 A;  1EZJ A;  2BCC H;  2QWO B;  1EFR G;  4GCZ A;  4MVM A;  1WNS A;  2UU9 B;  3R65 A;  2F95 B;  1WA8 A;  3JSL A;  2F43 G;  4TV8 A;  1K97 A;  2ZR2 A;  4JYB A;  4HNA A;  4I50 B;  1Q7Y W;  2IJH A;  3UM7 A;  1JJ2 U;  1FJG B;  1KBH A;  3H1J H;  4UB6 Z;  4HYO A;  2QM7 A;  4YJ2 B;  5C8Y B;  1NTK H;  2IU3 A;  1GN4 A;  2GSM B;  3A8T A;  3JAS B;  3N2G A;  4FLU A;  4K8X A;  4BAY A;  3J81 N;  2A7W A;  1H8H G;  2Q8V A;  2JJ1 G;  2WLJ A;  1OCC C;  1QLN A;  4JAS A;  2LQT A;  5LHG A;  1XNQ B;  2VQE B;  5KHJ A;  4FM0 A;  2ITC C;  3APQ A;  1AIL A;  4YY3 O;  2EJ7 A;  1MMM A;  3GVM A;  2K9P A;  1R3L C;  1WPB A;  2NR5 A;  5IWA B;  5LMN B;  5L3B A;  2KG7 A;  5LP6 A;  3IC9 A;  4K0K B;  4UCR A;  4LF8 O;  5JJJ B;  1JQ0 A;  2YIB A;  4EB6 A;  2N04 A;  5H5N A;  5LL6 Y;  2YEV A;  3ABU A;  3CRA A;  4UV9 A;  2JJ2 G;  2QTS A;  4O2B A;  2IM9 A;  3ML0 A;  4JPR A;  3ZMZ A;  1EZV H;  3E8B A;  1WP7 A;  2UXX A;  1H8E G;  3VBB A;  2UUC B;  2V7Q G;  4W4L A;  1EN5 A;  1GKF A;  4TV8 B;  4DV7 O;  5ITZ B;  1F4M A;  1F51 A;  3HB3 B;  4UCU A;  4LCU C;  4JYA B;  4X65 O;  2M7W A;  4PDV A;  2P7T C;  5IT9 N;  2UUA O;  3M8A A;  1SET A;  2CTR A;  1THZ A;  4YJ3 B;  3ZX6 A;  3TET A;  3ZRS A;  1VQO V;  2VS0 A;  1VQ6 V;  2ETN A;  3CRM A;  3J80 N;  4UCS A;  1EBO A;  2EZP A;  2OTL V;  4GKJ O;  4NB5 A;  1U96 A;  1N4C A;  1XDC A;  1YCI A;  4PDL A;  1MOF A;  3GWK C;  2UXC O;  1R3K C;  2D3O W;  2NLJ C;  4FM2 A;  4I9W A;  1AI5 A;  2QKC A;  2HJF C;  2H94 A;  1SRY A;  5LXT A;  1SES A;  3ZRV A;  5IJ0 B;  3E22 A;  2HEP A;  4F6E A;  3N27 A;  5GTI Z;  1Z5W A;  2KSD A;  3QG5 A;  4X1Y B;  2YDE A;  1LNQ A;  3K03 A;  3CXH F;  4J11 A;  1RSO B;  3JD3 A;  1GMG A;  4FM1 A;  5EZY A;  1GM7 A;  4DV0 O;  1Y66 A;  5B1B B;  2Q68 A;  1VQ4 V;  4K3A A;  4QIW F;  4YY3 B;  1NZ6 A;  2Q9L A;  2DJV A;  5AG2 A;  3OGC C;  3OM3 B;  1BHA A;  4DV3 O;  3SYC A;  2LW7 A;  4WFA V;  2WLN A;  3ZIA G;  4HZ3 A;  4IIJ B;  5KLV H;  3JCZ A;  3RYC A;  1FXV A;  4LF8 B;  1PP9 H;  4YIP A;  5J2U A;  4GYC B;  3K04 A;  4ZI7 B;  1DF5 A;  1SZX A;  2JDI G;  5LGN A;  4DR4 O;  1AP5 A;  1TVK A;  1YF2 A;  1F23 A;  5EIB D;  2QWN B;  1P49 A;  4TV9 B;  4MVZ A;  4MVQ A;  2ZE5 A;  4U3J A;  3K3W A;  4P9P A;  3WFV A;  3D36 A;  4F4L A;  3AG1 C;  3G6E V;  5GON B;  4DV7 B;  3ETG A;  1K3E A;  4Z2W A;  1SC5 B;  4O2A A;  4X65 B;  3C90 A;  2QTO A;  3U0Z A;  1GM9 A;  3O9O A;  5LXT B;  2UUA B;  4H33 A;  5EC1 C;  4MVO A;  1ZL8 B;  4XDL A;  1YTF B;  1K9M W;  4X62 O;  3G71 V;  3KKY A;  4ZOL B;  5LBQ A;  3T1H B;  2HP8 A;  1JX9 A;  4CH6 A;  2LO1 A;  5B1O A;  4GKJ B;  3CC2 V;  1HNX B;  5JVD A;  4CS4 A;  5KA5 A;  3HR0 A;  1QVF U;  1I08 A;  1NU1 H;  3IFX A;  1A32 A;  3FD9 A;  5BXZ A;  4X20 A;  1Z5V A;  4I4T B;  2NNU A;  4NTX A;  2N05 A;  3ABT A;  3LDD A;  3VQW A;  3E8F A;  3TCU A;  4J42 A;  2DYS C;  1UPG A;  4UXN A;  1B06 A;  2X7R B;  2IW5 A;  5IJ9 B;  3CCU V;  5KX5 B;  2WLH A;  2QR4 A;  5C93 A;  1ZTE A;  4BIU A;  4JAA A;  1K5S A;  4LF6 B;  4E4E A;  1SF9 A;  4UV8 A;  5J2T B;  4NXN O;  1PV0 A;  3JSN A;  5B1N A;  3C3S A;  3IC7 A;  1I7F A;  4KP4 A;  4RUF A;  1MZE A;  5B5E Z;  3E86 A;  2ZR3 A;  2WLL B;  1BGY H;  2QGN A;  2XAH A;  3JD2 A;  2JGD B;  3AG2 B;  5EC2 C;  2KQX A;  3UQ8 A;  1GH6 A;  4JI1 O;  4WBN A;  4DV3 B;  4E2L A;  2ILM A;  2Y48 A;  3F7Y C;  5EBL C;  2GBO A;  3D3Q A;  1AJN A;  3FFQ A;  4X9Q A;  1NVP B;  2YSU B;  4FLY A;  2HKO A;  1MSW D;  4DR4 B;  5EYP A;  4KHP O;  1OCZ B;  3FAV A;  2JVD A;  1H38 A;  4JYY A;  3K79 A;  1MAB G;  1Y67 A;  5EK0 A;  4R8C A;  3MHS C;  1H2M A;  4DR3 O;  3JCU Z;  3I5D A;  5DN6 G;  2UXB O;  3HKB B;  1CEZ A;  4X20 B;  2BOB C;  2JIZ G;  1GK9 A;  4O4J A;  1ZWI C;  4RAI A;  4B3T O;  1IXB A;  3RN4 A;  2BSK A;  4FLZ A;  3CWB H;  1JJO A;  3ASN B;  2WLI B;  2AZ2 A;  3BA8 A;  2ZDI A;  3SPC A;  3JD4 A;  4X62 B;  3K0G A;  4XBF A;  1VEW A;  1GAX A;  3LNM B;  3JAR B;  3RT3 C;  2WA3 A;  1NR7 A;  3JAW A;  5GTH Z;  2YXY A;  1D5N A;  5CA3 A;  1DK1 A;  1VQ7 V;  2XND G;  4PEL A;  1N36 B;  5L3G A;  1YIT V;  3MHH C;  1B3Q A;  1VQ8 V;  1QR8 A;  2Y69 C;  4MVU A;  2A3Q A;  3HKE A;  2LFS A;  3CRC A;  5L3F A;  2WA4 A;  3T1C A;  1RPO A;  4JYC A;  1XEQ A;  3AG7 A;  3JAK A;  1XMO O;  3RVZ A;  1QQC A;  3K9S A;  1NKD A;  1V55 C;  3B8N A;  2YIA A;  2YC0 A;  5LOV A;  5E79 Z;  4LF4 O;  3CEI A;  3AG3 C;  1AR4 A;  4NXN B;  1S5L Z;  5EBM C;  1BS3 A;  1QU7 A;  3ZBH A;  2LGQ A;  2EIK B;  4EFE A;  3H01 A;  2BE3 A;  4X88 A;  4FZ0 A;  2JK5 C;  4CC5 A;  2Q69 A;  2ZKO A;  2CTW A;  4ZHQ A;  3I55 V;  1NI8 A;  4JI1 B;  2Y0I A;  2YI9 A;  1QBZ A;  1SA0 A;  5K1P A;  1S77 D;  1I5Y A;  1FXH A;  3OGI B;  1YVW A;  2A79 B;  1DTO A;  4IL6 Z;  2JS5 A;  1I0H A;  2RMK B;  2UUB O;  3N2K B;  4DYL A;  2ZD9 A;  4QJF B;  1BHB A;  5IWA O;  1LUW A;  3G4S V;  3EFF K;  1KKC A;  3DTU B;  4I9Q A;  4BW5 A;  4MSW C;  4NXM O;  2DYR B;  3CC4 V; 
#chains in the Genus database with same CATH homology
 4G27 B;  1L1F A;  2EIN C;  4QPJ A;  2ATK C;  3CPW U;  1YSC A;  3E35 A;  1PNM A;  1I5X A;  1NH2 B;  1KD1 W;  2IH3 C;  4YXW G;  4XDK A;  2PI4 A;  3JD1 A;  1JQ0 A;  4WFG A;  4LC1 A;  1YJ9 V;  3ZRW B;  1QR9 A;  5CBF A;  2YEV A;  3AG4 C;  3ABU A;  4PA3 A;  4UV9 A;  2JJ2 G;  1VQM V;  3ML0 A;  4Z1M G;  4JPR A;  5H6R A;  3CCM V;  2W6J G;  3B8M A;  3CYO A;  1AR1 B;  1NVP D;  1UJW B;  3VOU A;  3ZMZ A;  3E8B A;  1K5Q A;  1RM1 B;  4ZBM A;  2UXX A;  3MD0 A;  4MT8 A;  3P30 A;  2EIK C;  1H8E G;  4UUJ C;  3VBB A;  2V7Q G;  2QM8 A;  1R6K A;  1GKF A;  1F4M A;  4QE9 A;  1VQP V;  1F51 A;  2WLL A;  3HB3 B;  4LCU C;  5B3S B;  2EIJ B;  4MW3 A;  2M7W A;  3ABM B;  4KFM A;  4PDV A;  2P7T C;  1P7B A;  4JTC B;  4HAM A;  5J9P C;  3SYP A;  3BEH A;  3W7X A;  4GX1 A;  1SET A;  1THZ A;  3LDC A;  3TET A;  3SPH A;  3ZRS A;  1VQO V;  1H2G A;  1VQN V;  5IYD O;  1VQ6 V;  2OTJ V;  2ITD C;  1OCR C;  1GTO A;  4LP8 A;  1W0K G;  2DYR C;  2DQ0 A;  4U7O A;  2Z3Y A;  2MK3 A;  1QVG U;  1VQ9 V;  1EBO A;  1QLE B;  2EZP A;  2KB1 A;  4P9O A;  5EBW C;  2Z5U A;  2JEX A;  3K0D A;  1VQL V;  2OTL V;  1FXK B;  1KP3 A;  2IJI A;  5L3C A;  1S0V A;  3ETD A;  1K4C C;  2HR3 A;  3STL C;  4L87 A;  4MTO A;  4R50 A;  2WAM A;  1WLE A;  4RQE A;  3I56 V;  4PDL A;  4PDR A;  4DO2 A;  1J95 A;  1Q81 W;  1NJI W;  1MOF A;  3E2E A;  4PDM A;  3CP1 A;  1Y4M A;  3CC7 V;  1K4D C;  1XL4 A;  1NQT A;  1VQK V;  1R3K C;  3D3I A;  1S5H C;  2D3O W;  2NLJ C;  4I9W A;  3NXS A;  3OEE G;  1KC8 W;  1AI5 A;  2IJJ A;  3E8G A;  4JGS A;  4FJC C;  2HJF C;  2H94 A;  4G28 B;  3W7W A;  1RM1 C;  1SRY A;  2ZXW B;  1SES A;  1JPX A;  4RUE A;  1M56 B;  3SYO A;  3SPJ A;  3ZRV A;  5HFL A;  3ABK B;  2OCC B;  1TUE B;  4MW8 A;  2WLI A;  2XAF A;  4LBE C;  3AG1 B;  3RVY A;  5B3S C;  3JYC A;  3ABM C;  3E89 A;  2XAS A;  1PKX A;  1BL8 A;  1LNQ A;  2EBO A;  3K03 A;  1KP2 A;  3JD3 A;  2LP7 A;  1RPR A;  1GMG A;  4U7N A;  2EJR A;  3CCQ V;  3PJS K;  4PA6 A;  2Q67 A;  1GM7 A;  1Y66 A;  3K08 A;  2Q68 A;  5B1B B;  4CZZ A;  1VQ4 V;  1K92 A;  2LFR A;  4QIW F;  1OZ0 A;  5BZB A;  4WFF A;  1JVM A;  2R9R B;  2W6I G;  3ABL B;  3OGC C;  3BY6 A;  3OM3 B;  3ZMS A;  1BHA A;  4JAV A;  3SYC A;  1QCE A;  1QLE C;  4WFA V;  2WLN A;  4H37 A;  3ZIA G;  4WF9 V;  4HZ3 A;  4P30 A;  5CBG A;  5LHI A;  1NBM G;  2X6A A;  5L3E A;  3JCZ A;  2XAG A;  1S76 D;  1FXV A;  1VQ5 V;  2JEU A;  3OE7 G;  3LSQ A;  3OMA B;  3ZMT A;  2C2A A;  2W0F C;  3K04 A;  3RW0 A;  1DF5 A;  2JDI G;  3CXC U;  5LGN A;  3FB7 C;  2WSS G;  4KUM A;  1F23 A;  2UXN A;  1M9N A;  4MVR A;  2DQ3 A;  1S3J A;  4BIZ A;  1COW G;  4MVZ A;  4MVQ A;  2AHY A;  2ZXW C;  2X0L A;  1M56 C;  2OCC C;  2K1E A;  3F7V C;  3K3W A;  1NH2 D;  2A9H A;  4JF3 A;  4P9P A;  2DYS B;  4I5S A;  4N21 A;  3WFV A;  3D36 A;  3LSS A;  4F4L A;  3AG1 C;  3G6E V;  3ETG A;  1FS0 G;  1DF4 A;  1K3E A;  1YIJ V;  2QE7 G;  4Q20 A;  3QO8 A;  3RBZ A;  1K8A W;  2QTO A;  1GM9 A;  3OEH G;  4X8A A;  5IY5 C;  1ARO P;  4FMT A;  1M1K W;  4H33 A;  1Q86 W;  1K7D A;  4UVA A;  5B1B C;  5EC1 C;  4MVO A;  3ZRX A;  2R9I A;  3ZN0 A;  2ZDI C;  4XDL A;  1YTF B;  1PNK A;  3ABL C;  1K9M W;  3TK1 A;  3G71 V;  1XL6 A;  1K34 A;  3STZ C;  1E1R G;  2DWD C;  5LBQ A;  3ZJZ A;  3CCS V;  3T4Z A;  3CCL V;  2HVJ C;  5L3D A;  1AJP A;  1JX9 A;  1OCC B;  1K33 A;  3ZMV A;  1HWY A;  2X6B A;  1B6Q A;  3FYI B;  4TSF G;  5FL7 G;  2HVK C;  5B1O A;  3CC2 V;  1MG1 A;  3GWO A;  3ASO B;  2B1I A;  3EHB B;  2IJK A;  5KA5 A;  3CMA V;  1QVF U;  3IFX A;  1FFT B;  3ZRW A;  1YTF D;  3OMI B;  1GO3 F;  4GX5 A;  5B1A B;  3ZMU A;  2NNU A;  3ABT A;  2HFE C;  3P32 A;  3LDD A;  3E8F A;  4OXS A;  3TCU A;  2DYS C;  4UXN A;  2X7R B;  3W7S A;  4FK5 C;  2IW5 A;  2EIM B;  2YEV B;  3CCU V;  2XAQ A;  3SYQ A;  4WCE V;  3FB8 C;  2WLH A;  1GM8 A;  3QO5 A;  5C93 A;  2EIJ C;  3AG4 B;  2FTK A;  3T4D A;  4BIU A;  1K5S A;  2ZQM A;  3T2M A;  1IXM A;  2EIL B;  2P6J A;  4GX2 A;  4QPK A;  5IYC O;  4UV8 A;  5CN0 A;  1YJN V;  4RQF A;  5B1N A;  1E1Q G;  4MTG A;  3OFN G;  2A0L A;  1KEC A;  3IC7 A;  2WWW A;  3QO7 A;  4KP4 A;  3SPG A;  1OCO B;  1M57 B;  4RUF A;  3E86 A;  5LGT A;  3DGE A;  2DW4 A;  3K9A A;  1F4N A;  2ZR3 A;  2GHY A;  2WLL B;  3CCV V;  2XAH A;  3JD2 A;  3AG2 B;  5IYB O;  2P67 A;  1AI7 A;  4FIP C;  5EC2 C;  2X6C A;  4E2L A;  2Y48 A;  1KQS U;  1NR1 A;  1FXK C;  3JD0 A;  4JAU A;  4RO2 A;  1N8R W;  3F7Y C;  3UKM A;  2V1D A;  3AEI A;  4G2K A;  4N23 A;  5EBL C;  1BMF G;  3OAA G;  3A0R A;  1M90 W;  3ASO C;  2QEX V;  3CD6 V;  3CCR V;  1YI2 V;  3OUS A;  1AJN A;  3FKS G;  1SER A;  1OCR B;  4XDJ A;  3SJQ C;  5DM6 V;  1NVP B;  2YSU B;  2HKO A;  2Y69 B;  4EKW A;  1MSW D;  4JTA B;  5B1A C;  4QNH B;  1KKD A;  4P2Z A;  1OCZ B;  3X2Q B;  1H38 A;  5HFM A;  5H9C A;  3LDE A;  3K79 A;  1MAB G;  1Q82 W;  5EK0 A;  3ABK C;  4R8C A;  3MHS C;  2EZO A;  2HLD G;  4WFH A;  1R3I C;  2DWE C;  2B5U A;  2EIM C;  5DN6 G;  3OR7 C;  5CMU A;  1CEZ A;  4J9Z B;  1V55 B;  2BOB C;  3GB7 C;  2JIZ G;  3OMN B;  2WPD G;  2H8P C;  3FB5 C;  1JOY A;  1GK9 A;  2EIL C;  3WG7 B;  1ZWI C;  4RAI A;  1CP9 A;  1SZT A;  3B77 A;  3AG3 B;  3KG2 A;  4TT3 G;  1DLB A;  3HPL C;  1PNL A;  1OCO C;  1M57 C;  3F5W C;  2PI5 A;  3ASN B;  2WLI B;  3IGA C;  4J9Y B;  2IH1 C;  4PA9 A;  5H6Q A;  4JTD B;  3ZN1 A;  1G4Y B;  2ZDI A;  3CCJ V;  3AG2 C;  3SPC A;  2BOC C;  3JD4 A;  4WFB V;  1S72 V;  3K0G A;  4MTX A;  4XBF A;  4GT1 A;  4ZKI A;  2Q6A A;  3LNM B;  1YHQ V;  4MS2 A;  5LHH A;  1P4R A;  1ENV A;  2WLM A;  1K73 W;  2CK3 G;  4MVS A;  1V54 B;  4GX0 A;  2QA4 V;  1NR7 A;  1AI4 A;  2IU0 A;  2AHZ A;  5CA3 A;  1VQ7 V;  2XND G;  4PEL A;  4X89 A;  1G8M A;  5L3G A;  1CPY A;  4QE7 A;  1R3J C;  2QKS A;  3MHH C;  4UVC A;  1YIT V;  1VQ8 V;  1R6N A;  1ROP A;  1W0J G;  1PD3 A;  1QR8 A;  4MTF A;  2Y69 C;  4DXW A;  1OHH G;  2WLK A;  3FYE B;  3SYA A;  1ORQ C;  3W7T A;  4MVU A;  1OCZ C;  4PA4 A;  1YJW V;  3ETE A;  3X2Q C;  2EIN B;  2LFS A;  1AI6 A;  3LUT B;  5L3F A;  3T1C A;  1RPO A;  1EZJ A;  4JYC A;  5KUK A;  1EFR G;  4GCZ A;  4MVM A;  2OT5 A;  3QNE A;  3R65 A;  3OR6 C;  3CCE V;  3RVZ A;  3ZCC A;  3OW2 U;  1NKD A;  2F43 G;  1K97 A;  1V55 C;  3B8N A;  2ZR2 A;  1R73 A;  4JYB A;  4PA7 A;  1WPX A;  2XAJ A;  3WG7 C;  1Q7Y W;  4CBC A;  3W7U A;  5IDJ A;  4FPP A;  2IJH A;  3AG3 C;  5KUM A;  3UM7 A;  1JJ2 U;  5EBM C;  5GW7 A;  4WFE A;  5CBH A;  4HYO A;  5E1A C;  2HG5 C;  3ASN C;  2QM7 A;  2EIK B;  3H01 A;  4X88 A;  2IU3 A;  5LGU A;  4R6Z A;  2GSM B;  2JK5 C;  3OUF A;  4R7C A;  1E79 G;  2Q69 A;  2B1G A;  4BAY A;  4ASU G;  1H8H G;  3I55 V;  1PL0 A;  3CME V;  2JJ1 G;  2WLJ A;  1OCC C;  3E83 A;  1JCH A;  1QLN A;  4JAS A;  5LHG A;  1V54 C;  1W2B U;  1QBZ A;  1S77 D;  5IY5 B;  1I5Y A;  3M99 B;  1FXH A;  1FXK A;  4UVB A;  2ITC C;  2A79 B;  3E8H A;  1DTO A;  5KA6 A;  3K06 A;  2ZD9 A;  1AJQ A;  4QJF B;  1BHB A;  2XOK G;  2P90 A;  1R3L C;  3SPI A;  3EFF K;  3G4S V;  3DTU B;  4BW5 A;  4MSW C;  5L3B A;  2DYR B;  3CC4 V;  3FB6 C;  4TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...