2IH1C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
100
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih1C00
4QE7A 3T2MA 2HJFC 3AG3C 2IH1C 4H37A 4MS2A 1R3IC 3STZC 2HG5C 1OCRC 3F5WC 3RVYA 4GX2A 3ASOC 3KG2A 4HYOA 3RVZA 3SPJA 1LNQA 5EBWC 5CBFA 4PDMA 4R6ZA 4MVQA 3OGCC 4MTFA 4HZ3A 2EIMC 3SJQC 3TCUA 4EKWA 3SPHA 3JYCA 1OCOC 3SYAA 2X6BA 4X8AA 4PA3A 2WLLA 5EC1C 4JTAB 1G4YB 2QTOA 4R7CA 4F4LA 4XDLA 4R50A 4H33A 5EBMC 1JVMA 2EILC 4X89A 2X6AA 4GX1A 2YEVA 3K08A 4GX5A 4ZBMA 5CBHA 2A79B 3PJSK 4MSWC 3STLC 3UKMA 2WLNA 1M56C 2ITDC 5B1BC 2BOBC 4P30A 4GX0A 2WLIA 4LBEC 3SPGA 3OUSA 3T4ZA 4G28B 1M57C 3R65A 3IGAC 5EBLC 5IY5C 2K1EA 4KFMA 4QE9A 1BL8A 4J9YB 3OR7C 4X88A 3WG7C 3K0DA 2OCCC 3F7YC 3ZJZA 1V54C 2ITCC 2Q68A 2NLJC 4WFHA 5CBGA 4MVMA 2AHYA 2WLKA 2WLHA 3AG2C 3SYPA 3FB8C 3LDDA 2Q6AA 5EC2C 4XDJA 3SYOA 3VOUA 3ABLC 2WLMA 4MVOA 5KUMA 2EIJC 1KKDA 3F7VC 2IH3C 3E8BA 3ASNC 4MTOA 2X6CA 3FB5C 4PDVA 2H8PC 4MW3A 2HFEC 2ATKC 2WLJA 2HVKC 4R8CA 4PDLA 4MVSA 4LP8A 5EK0A 4I9WA 1S5HC 1XL6A 1OCCC 2EIKC 2JK5C 3GB7C 3K03A 3LDEA 3LUTB 3SYCA 2HVJC 3AG4C 3T1CA 4QNHB 2AHZA 2Q67A 4JTCB 2DWDC 4PA9A 1R3JC 3LDCA 3IFXA 3OUFA 3OR6C 4J9ZB 2A0LA 4CBCA 2Q69A 3AG1C 3K06A 2R9RB 4TWKA 4UUJC 1K4CC 3X2QC 3ZRSA 4PDRA 3SPCA 4JTDB 3E89A 3FB6C 1V55C 2EINC 4MVRA 4MVUA 3E83A 5E1AC 3RBZA 4LCUC 1ZWIC 1R3KC 4XDKA 3K0GA 3K04A 4WFGA 4WFFA 5B3SC 2DYSC 3SYQA 1ORQC 3E8FA 2WLLB 5J9PC 3BEHA 4PA4A 4MVZA 4RO2A 1OCZC 2P7TC 3FB7C 4MW8A 4PA7A 3SPIA 1R3LC 4MTGA 5BZBA 2W0FC 3HPLC 2ZD9A 1XL4A 3ABKC 3RW0A 2KB1A 2A9HA 4P9PA 4DXWA 3E86A 2DYRC 1K4DC 3ABMC 1J95A 4PA6A 4RUFA 3UM7A 1QLEC 3LNMB 2DWEC 4P9OA 5B1AC 3EFFK 2ZXWC 2BOCC 4OXSA 2QKSA 3E8GA 4P2ZA 2Y69C 4RUEA 4WFEA 4RAIA 3T4DA 4BW5A 2WLIB 3TETA 5KUKA 4G27B 1P7BA 3E8HA
chains in the Genus database with same CATH superfamily
1FJGO 4ABMA 2XAJA 2EINB 4QE7A 4PI0A 5LOVA 3CCMV 1WN7A 1PKXA 4W4KA 2DE0X 1FS0G 2PGGA 5CA0B 1OCOC 1PV0A 2EIKB 5JJJB 4JTAB 5LMUB 2YEVB 3W7UA 5KX5A 4GYCB 4H33A 3R66A 2YEVA 1N36O 1H8EG 2UXCB 4MSWC 1V55B 3DSQA 4X62B 2R72A 3A0BZ 4G28B 4JYCA 2GTSA 3S3WA 2QWNB 2DYSB 1R6KA 1NTZH 4RWUA 1YITV 1L0NH 2E76B 5JQGB 3AG2C 4XDJA 4DV6O 3VOUA 4YY3O 3E35A 4JV5O 4NTWA 2PYLA 2RN9A 2Y69B 2LO1A 2WLJA 4LP8A 5JJNB 5KA5A 3K03A 4FZ1A 2Q67A 1GH6A 1KECA 3OT7A 4FJCC 4B7EA 4H0LB 2QDOA 1EM1A 3IJ4A 3AK3A 5JCOA 4F6RA 3RN4A 4DUYB 1GAXA 1Y74A 5BY1A 1THZA 4LFBB 2QWRB 3CS5A 3SYQA 1ORQC 4TUYA 2UUAO 1JA8A 4LF8O 3SPIA 1BMFG 2Q7GA 4MTGA 4UXNA 3UM7A 1YCIA 4DR2O 2PZSA 2QKSA 3BA9A 3MDSA 2OYQA 4QPJA 2IJJA 4JAUA 1N32B 1AI6A 3ZMZA 1OCRC 3H1KH 1IBMO 3TCUA 4LFCO 1Y66A 4B3MB 2WA4A 4J10A 4MT8A 1CP9A 5JH7B 5H5NA 2P90A 1SQGA 3MHHC 5A2QN 2Q7HA 1AI5A 1Y4MA 4GKKO 2O57A 1SF9A 4B3SO 5LL6Y 4DV2O 3A0RA 5B1AB 3SPGA 2DQ0A 2AGAA 4O4HB 2YXYA 4KFMA 2V7QG 3MHSC 1SA0B 4X65O 3OTFA 1OCZB 2OCCC 3CJHA 1IBKB 2CTQA 4O4HA 1TUBA 3JD1A 3DXRB 2HHHO 4O2AA 1NQTA 3WB1A 2W0XA 2IW5A 2X6CA 3FB5C 2H8PC 2CUGA 1K7DA 2RQ6A 2GUZA 4I5SA 2EBOA 2QM4A 1ZSPA 4L8JA 5LGNA 3CX5F 2CH7A 5LYJB 2F95B 2Q69A 1WB8A 2KG7A 1VQ6V 1MABG 4U3FH 3CCJV 5LMNO 3W7SA 4DR1B 1R3KC 2P4KA 1MZEA 3ETDA 1HP8A 3AEIA 4WFFA 1I5XA 2H3OA 3LSSA 3E22B 4J42A 4X64O 4J11A 2QA4V 1NVPB 1J95A 2CDYA 2JJ2G 5EZYB 4J7JA 4BIUA 1AJNA 4FLZA 1NU1H 1SKVA 1L0LH 5L3EA 5EZYA 3B40A 4ZOLB 3WU2Z 1R3IC 3ABLB 4ZOLA 3IAYA 4MTFA 4NVPA 1F23A 1YI2V 4I4TA 3SPHA 3SYAA 4DR7B 1F7YA 2UUCO 1N0JA 1SRYA 2QWPB 2FKXA 5EYPB 2AW9A 1WA8B 3RYIA 4K0KO 1SZTA 1RPRA 1H2MA 1RP3B 1YJNV 2ITDC 3P3NA 1NR7A 1O9GA 2WLIA 4LBEC 4LF9O 1ROPA 2LGWA 4CC6A 4B3TO 1R73A 2UU9O 1H2LA 1ENVA 5H6RA 3M8AA 2YSUB 4I50B 1YZBA 2EIJC 1VEWA 3HKEB 4FLWA 3D8CA 3T1YO 1AVMA 2YI8A 4PDVA 4DW0A 2HVKC 5A9GA 4X66O 4X1IB 2UXDO 3HKEA 1KB9F 1NKDA 4A5UB 4O4LA 2GHYA 4JTCB 1JCHA 4PA9A 5CMUA 1AI7A 4X1IA 4NKGB 3K59A 4LF4B 1K4CC 1AB3A 4YXWG 3SPCA 1K73W 1V54B 2D3OW 3L72H 4B08A 1LUWA 4LCUC 2UXNA 5IYBO 5B3SC 4UV8A 4DK1A 2P7TC 4CZZA 3SGIA 5JCOC 3APOA 3HPLC 3W7TA 4LF5B 2ZD9A 2L6LA 2ADPA 2JVDA 4O4IA 2IU3A 4AQYO 3CXCU 5TISZ 3D3IA 3AG3C 1FXKB 4K0KB 4KL1A 1GN6A 3FAVB 4MVQA 3ZHTA 4EKWA 2QM8A 1DK1A 3EXAA 2G38A 3AK2A 1X59A 3AG4B 3N27A 3H1HH 3QG5A 1PM9A 2R9AA 1K92A 4EFBA 1RM1C 1XNRB 5CBHA 2UU9B 3U0ZA 2HEPA 2A79B 3S3XA 1M1KW 3BA8A 1WB7A 2BOBC 4J7ZA 2CTPA 4DV0O 3ZHQA 1KC8W 5LA6B 3IGAC 2NN4A 3ZHRA 1JX9A 3HKCB 3OR7C 3WG7C 3ZRXA 5LHHA 1XEQA 5LA6A 5JWPA 1NVPD 5J2UA 1AR4A 3I55V 1Q81W 3CRQA 3ML0A 3T1HB 1QLEB 3BAAA 4MTXA 1EN4A 4UCSA 3BY6A 5FPOA 2ZXWB 1PNMA 1HNWO 2E75B 3LSUA 3T1CA 2P4VA 1NH2B 3OUFA 3K5OA 1EBOA 2UXBB 2IJKA 2KQXA 1Y6XA 3ZRSA 4ZKIA 2JDIG 2ZINA 1LUVA 1E1RG 1PD3A 1A32A 2DQ3A 3ZMTA 3G6EV 1BT8A 4WFGA 1EZVH 3K04A 3QO7A 4U3JB 5J9PC 5CA3A 1JFFB 2F66C 3ZHSA 3FB7C 4U3JA 4H13B 2ZIOA 2ARHA 2Z0AA 1P84F 2JRIA 4GLXA 1M5IA 5BR8B 4E2LA 1URFA 5FNVB 1XREA 1NI8A 4IHJA 1B6QA 4UCVA 3CYOA 3E8HA 2CAZC 3JD3A 4FK5C 4YJ3A 5FNVA 1XQ8A 4DV1O 4OGQB 4YHHB 1Y67A 5CBFA 1YXBA 4KHPB 4BWAA 5B66Z 1Q82W 1N4CA 1QQCA 3CCQV 2E3CA 1I08A 4LNUA 1Z5VA 3CRCA 4ZHQB 3B8MA 2ZIMA 2QEXV 1M56C 5B1BC 4JI3O 2BSKA 4DR5B 3CE2A 4G2KA 4ZHQA 3CP1A 1M57C 1Q7YW 2CTRA 2ZKOA 3L73H 2DMXA 4JI8B 3LSQA 3OEHG 4JI0B 2QKCA 1AI4A 4LF7O 4HAMA 2Q0OC 3O9OA 3ABMB 2VS0A 3SYOA 2BCCH 4MVOA 5KUMA 2LP7A 2YIAA 1VQ4V 3ASNC 5J2TB 5AG2A 4K8XA 5L3BA 2ATKC 1GN4A 4D6TH 4JI4B 1FPOA 4DV4B 4GKJO 5J2TA 2R9IA 3IFXA 4WCEV 1QU7A 1CXZB 3AG1C 4JGSA 2QGNA 3X2QC 4GUNA 4JI5O 1J5EB 3HB3B 1D2DA 2GDSA 3FYIB 5ITZA 4K35A 4MVUA 1N34O 1PL0A 4ICGA 3CD6V 4IYIA 2MW2B 1LR1A 1HNZB 2WLLB 5KMGA 4YIPA 3AK1A 3RWRD 1M93A 2P5OA 3UO3A 2EJRA 4PI2A 1TUEB 4DV1B 3TXQA 3KKYA 3ABTA 3ZRVA 4WF9V 1B04A 4NTXA 4U7NA 2DW4A 1K97A 1BCCH 2QSAA 4H37A 1FXHA 4DUZO 3ASOC 3SPJA 1VQ8V 4JI2B 1DTOA 3D36A 4N23A 1TVKA 1NH2D 1V9PA 4F4LA 1FFXB 2EILC 3JSLA 3WB0A 4ZBMA 5JVDB 1DLBA 5KAIZ 3FYEB 4LF7B 1S76D 2HKOA 1K33A 1VQOV 4LC1A 4J9YB 4DR6B 3OAAG 1NT2B 3SJCC 5LXTB 2Y4UA 5C93A 3ZIAG 2Q68A 4HNAB 1QR9A 4KUMA 3P30A 3N2GB 4JAAA 2DYRB 5CA0A 3JARB 2VQEO 4HNAA 5FLXN 1Q43A 1P49A 4QJFB 5EK0A 4I9QA 1N34B 3LDEA 4NXMB 2LJ2A 3OMNB 1US6A 1JPXA 2PY5A 3K06A 2PYJA 3VQYA 2EULA 3VQWA 1Z5WA 4EB6B 2XAHA 4K3AA 3E89A 1KBHA 4RQFA 3CC7V 3K0GA 4Z1VA 5JQGA 2W6JG 1VARA 3CWBH 5GTHZ 1CPYA 2GBOA 4DV7O 4JYBA 4PV1B 3K79A 2ADQB 4I7ZB 2YIBA 1Q6UA 2P6JA 2E5LO 4LFAO 4P2ZA 1PNLA 1OV9A 4FLTA 3B09A 4G27B 4LH7A 1MNGA 1NR1A 3UT5B 4CH6A 3ZN0A 5L3GA 4DR3B 3F5WC 4GX2A 3KG2A 4HYOA 3UT5A 1EFRG 3JAKB 5B3SB 1W0JG 1FJGB 1E1QG 3DTUB 2ODMA 4PA3A 3JAKA 1GKFA 4L87A 4WFAV 3C3TA 1D5NA 1BHAA 3HKDB 4TQDA 3CMAV 3STLC 5B1OA 4ZI7B 4P30A 1PNKA 1VP7A 4GX0A 2VQFO 2BE3A 4X20B 3AG3B 1Q90D 5D5QA 5L3CA 4B3RO 5LGTA 1N36B 4DR4O 3RGBA 4AI8A 4Q6GA 4X20A 2WLKA 3JAMN 2YUAA 5EC2C 5IE9A 3H1IH 3F7VC 2Q7EA 4FLVA 5JH7A 5CN0A 1OZ0A 4I9WA 1OCCC 4DV6B 3GB7C 5DECA 3UO2A 4YY3B 4JV5B 2HVJC 3BPZA 3TGUH 2ETNA 2A0LA 1KD1W 1G6UA 1SQPH 1MMMA 2R9RB 2N04A 2BTOA 4UVCA 1H2GA 3A2FA 1SA0A 1MSWD 2E5LB 1SESA 3RBZA 3J80N 4LFAB 5KHKA 4FLYA 3DXRA 2ZDIA 2FB5A 1HNXO 4UVAA 3OMAB 3RW0A 4JI7O 1SC5B 4YIOA 5LP6B 5IY5B 5IYZB 2UUAB 1IBLO 4P9OA 4LF8B 2JGDB 5LYJA 3CCVV 3QTCA 3U11A 2N74A 5IYZA 4N21A 3OTOO 4DR2B 3C90A 3FKSG 3ZHUA 4NYKA 1QHTA 3WFVA 1FD9A 3SR2C 5K1XA 2ZQMA 1QVFU 4X8AA 2VWKA 2ZE7A 3LNNA 1S72V 3E22A 1G4YB 2A06H 4Q20A 1IBMB 4LFCB 1VQ7V 1L8DA 1GM9A 1I94O 1IXMA 5KHJA 3L74H 2L35A 3TK1A 1BZKA 1JJ2U 2VRZA 1P7GA 3NR7A 4LR3A 1NZ6A 1QVGU 4GKKB 2YIBD 1ZX3A 3W7WA 4QE9A 5IYCO 4DV2B 1KU9A 1BL8A 4B3SB 2XT9A 4TOIA 3ABKB 1BQZA 3B2EE 1Q5OA 4X65B 1KKDA 1NJIW 5EYPA 2LFSA 3PN1A 2P22C 4AHCA 1WA8A 1R1BA 2HHHB 2EIKC 4QNHB 2DWDC 2WWWA 4PD4F 1M57B 3BFRA 1NBMG 4TWKA 3U10A 5BMVB 5FL7G 1N33O 3ETGA 1YF2A 1IX9A 1JOYA 4C7UA 1IURA 1V55C 1AJQA 2W6IG 2ZR2A 1R6NA 1IBLB 1YTFB 4BR6A 2DYSC 3RYHB 3E8FA 1MSDA 4I50A 5LMNB 2QKAA 1KYOF 4E4EA 1ZTEA 3OTOB 1FFTB 4DYLA 3CHXA 3K9AA 1WP8A 1ZL8B 4CS3A 4FLXA 3LNMB 1Y76B 1HDJA 1IXBA 4X64B 2Y69C 4JF3A 1Q6HA 1TGOA 3M7MX 2HP8A 1JJOA 4I55B 4JYAO 1N8RW 3JAWB 4DV5O 3RVYA 1U96A 1S5JA 3I56V 3OMIB 3J81N 3JYCA 3A0HZ 3CRMA 5CB4B 2YC0A 1M9NA 5E79Z 2QTOA 5HFLA 1BQ0A 5EIBD 1GM7A 5F2VO 5C8YB 2B1IA 2UUCB 2OCHA 2WLNA 3B4SA 2ILMA 3IC9A 1ZUQA 3CRRA 1KUQA 4JZGA 1VQMV 3JCUZ 2M7WA 2JS5A 1FXKA 2F4VO 2NNUA 1PP9H 2IJHA 4JI1O 2HR3A 2NLJC 3FAVA 2PI4A 4LF9B 3APQA 1YJWV 3LDDA 4B3TB 3P32A 1K5QA 1VQKV 3EHBB 4R8CA 4DV3O 2ZM6O 5DEDA 1X4TA 3LUTB 3T1YB 1WJZA 3LDCA 5H6QA 4H44B 4J7KA 2F43G 4QGPA 2DN9A 3G80A 4X66B 5LGUA 2UXDB 3BABA 1OCOB 3CMEV 3VQVA 3HKCA 3OFNG 1AR5A 1YJ9V 1AILA 3ZBHA 2YI9A 2LFRA 4JASA 1OJHA 1VIBA 1OCZC 4FPPA 5IWAO 2QM7A 4U7OA 4LF6O 1VF6A 5KA6A 2NR5A 2ZDIC 3C3SA 4EFEA 4OXSA 4WFEA 1YHQV 1XMOO 1SERA 1GO3F 4LWSB 5KUKA 4JPRA 1FAFA 3CEIA 1FYJA 3AG2B 2JEXA 4D7TA 3RVZA 4AQYB 4WBNB 2AXTZ 4NR1A 2YS8A 4TT3G 3OGCC 3KZIZ 2EIMC 3SJQC 2X6BA 2WAMA 3JSNA 2FMLA 2P06A 1JFFA 1XMQO 1K9MW 3HR0A 3JD4A 4TQFA 4NXNO 2FTKA 3PJSK 3THOA 1MA1A 4JI6O 4QPKA 4BIZA 3H01A 1YTFD 4KXRA 4OPHA 3OUSA 3O65A 4TSFG 3R65A 2QJ1A 2LW1A 1S0VA 4PJ0Z 1EZJA 1XNQO 1XUQA 3K0DA 4FFKA 4DV0B 3ZHVA 4BAYA 4O2BB 1GN2A 1K5SA 3D3QA 2AHYA 4JAVA 3JASB 3ABLC 2WLMA 3H1JH 1KKCA 1RSOB 1JR9A 2V1DA 4IYHA 3JASA 4MVSA 3UQ8A 2B9ZA 1RSOA 1P4RA 1OCRB 5KLVH 4UV9A 1HNWB 4PHZA 3IC7A 3ZN1A 2GSMB 5IYDO 2YXLA 4LF6B 3ZCCA 5GW7A 4FLUA 5E1AC 1Z2GA 4X1YB 3RYFB 1BSMA 1S3JA 1GN3A 3BEHA 4PA4A 4B7KA 2P67A 3RYFA 2F1MA 4J80A 3TXSA 1G1XB 5K1PA 4RUFA 4FMTA 1Q8IA 4ZIBA 3E8GA 2OCCB 4BW5A 1EN5A 1F4MA 3QF7A 1GMGA 4UCTA 3VBBA 2XNDG 2HG5C 3SJBC 4EEQA 3K3WA 2BTQB 5LMUO 4OX9O 4NXNB 1AROP 2YIDA 1E79G 2WLLA 2UXCO 1NTKH 4FM0A 4X62O 1XNQB 2X6AA 2WSSG 2AZ2A 4DO2A 2CGNA 4NTYA 3CC2V 2YXHA 5IT9N 2LGQA 3BRCA 3RT3C 2WPDG 5IJ0B 2OWOA 4JI3B 1YVWA 3G71V 5IJ0A 2JJ1G 2K9PA 2Z3YA 4TV8B 2HLDG 1SQBH 2ZNIA 2IH3C 2Y0PA 4MW3A 2ZNJA 1JMKC 1FFXA 1UJWB 1RFYA 4UB8Z 3SYCA 5JVDA 3AG4C 2Q4PA 1XDCA 2V4DA 3DC5A 3HKBB 1AP5A 1F4NA 4DUYO 1VF5B 4LFBO 4GKJB 5LOVB 3RFRA 2Q73A 1XHZA 3ETQA 1QBZA 3QVNA 5LXTA 1MZFA 1GK9A 4JI5B 2Q0AA 3N2GA 4UFZA 3JARA 1QNMA 1G8MA 3ZRWB 4MW8A 4PA7A 5KX5B 2XUMA 5BZBA 2KB1A 3JD0A 5JJEB 3ZRWA 1O9HA 4OX9B 1XI1A 1QLEC 1N32O 2IJIA 2ZXWC 4CH5A 1PPJH 1FXVA 1VF6C 3ZMSA 1HW7A 2XAFA 4B3MO 4EB6A 1VF7A 2IH1C 1HR0O 1VQ9V 3FX7A 1XOUA 1Q3EA 2EIJB 1WPBA 1K8AW 4R6ZA 1AR1B 1L1FA 2XTAA 4DUZB 2OTLV 1SETA 1H2KA 4R50A 4FZ0A 2CK3G 2ZT9B 2Y4TA 1I0HA 1IBKO 1NTMH 3OEEG 2F23A 2K1EA 4AILC 4X88A 4ASUG 3M99B 2ITCC 3RYCB 4F6RB 3GVMA 1ZAUA 1I7FA 1Y74B 2YDEA 1CEZA 2WLHA 4TUYB 4KP4A 1VQPV 1WNSA 3RYCA 1PL4A 3E8BA 2X7RB 1NS1A 4FM1A 3B8NA 3K57A 3DC6A 1GTOA 4UCRA 5DN6G 3HKDA 2VQEB 3CCRV 3MAQA 2AHZA 3MD0A 1AP6A 1U97A 4ZI7A 1H2SB 4DR1O 5D5PA 4X1KB 4PDRA 2Z5UA 3K9SA 1TAEA 2IM9A 2UXXA 5GTIZ 4X1KA 1RM1B 3G4SV 3ETEA 1BHBA 3DGEA 3JD2A 3CCSV 4QIWF 3BHPA 4MVZA 1R3LC 1HR0B 1XL4A 5BXZA 3OE7G 2A9HA 2A3QA 3ABMC 1K34A 2OIEA 1M4UA 5KAFZ 2DWEC 5FPRA 3WG7B 4DV7B 4RAIA 1VMGA 1YSCA 4O4JB 4DW1A 1YEWA 4DR7O 2RNBA 2LW7A 3CJHB 4UCOA 3ZS8C 1LNQA 1TUBB 4O4JA 1HWYA 4O2AB 3QO5A 1IZ3A 1I5YA 4R7CA 1SS3A 1QR8A 2Q9LA 2GUZB 3W7XA 2QWOB 5EBMC 2DOSA 3K08A 5LP6A 3GWOA 3CC4V 2CH7B 1B3QA 2JGDA 2JEUA 1B06A 1S5LZ 2KG7B 5KHGA 3AG7A 3H1LH 2VQFB 2EIMB 1YDXA 4B3RB 4DR4B 3SYPA 3CB2A 1VQLV 3D36C 3GWKC 4MTOA 1D5AA 3CCEV 1Q86W 2HFEC 3NXSA 4LF4O 1KP3A 1Q6IA 5KHIA 2QTSA 1SZXA 3F5TA 3TJTA 1BE3H 4BW9A 1T5EA 3K5NA 3K58A 4IIJB 3P3PA 1BS3A 2RJZA 2EINC 3E83A 4IIJA 2M6YA 4LF5O 4I4TB 1EN6A 2PI5A 4FFBB 2FYUH 2IU0A 1DF5A 1M56B 4IL6Z 5B1BB 2FL4A 4I0XB 4FFBA 3JCZA 3RYIB 4PA6A 2DYRC 3UCSC 2ZCEA 4CC5A 2BOCC 4I0XA 2OT5A 1HNXB 2WLIB 3QO8A 2CGOA 2Y48A 4JI7B 2PTMA 1TA8A 5BMVA 3QNEA 3T2MA 2HJFC 4MS2A 3ASNB 4CS4A 4PDMA 2ZE8A 1W0KG 1SQVH 2XOKG 4BIOA 1XNRO 3RYHA 2EZOA 3SJAC 3FFQA 5EC1C 1WP7A 2A7WA 2Q8VA 3AG1B 3X2QB 4Z2WA 1ZL8A 2CE4A 5B5EZ 3CXHF 3L71H 4GX1A 4GX5A 4FVMA 4O4LB 4TV9B 4FM2A 4XBFA 4CH4A 1Y76A 4K8ZA 2OIGA 4TV9A 1I94B 4I55A 2PUSA 3T1HO 3JAWA 4GCZA 3ABUA 3K5LA 1H8HG 3F7YC 1R6TA 5CBGA 4UVBA 1QCEA 3K5MA 4DK0A 1W2BU 3FB8C 2Q6AA 5CB4A 5GONB 4PELA 2UXBO 4O4IB 1XL6A 5C8YA 5GONA 3CCUV 1RPOA 1R3JC 2GV9A 3OR6C 2XASA 3ASOB 2ZE6A 2OTJV 4CBCA 3L75H 2Q5ZA 4Z1MG 1VQNV 3FB6C 4X9QA 4MVRA 3KCXA 1ZWIC 2RDCA 1N33B 5H2FZ 2EILB 3CPWU 1WLEA 4HBNA 5BR8O 2W0FC 1H2NA 3OD4A 3WB2A 4DXWA 3E86A 1K4DC 2RCVA 3CSXA 3EFFK 2YICA 4YHHO 2X0LA 3TETA 3BCCH 4KHPO 3ZJZA 4CH3A 1P7BA 5B1AC 3Q4HB 4YJ2B 5DM6V 3CCLV 3B77A 5KHHA 1UFIA 3Q4HA 5EIBC 5IDJA 5J2UB 4JYAB 3ZMVA 4YJ2A 3JALB 4DV5B 4D7SA 3ZEDA 5CA1B 4XDLA 4DR5O 2QR4A 3JALA 4IT5A 3CRAA 1BGYH 2WA3A 1JVMA 4X89A 1FKAO 5CA1A 1MOFA 3H9VA 1ZLZA 2B5UA 2XAQA 4JI8O 3A8TA 4JI0O 5LHIA 4DRXB 4LWSA 3T4ZA 4JYYA 4LH6A 4JZ2A 3ZMUA 5LP6C 5IY5C 3G6BA 1QLNA 5B1NA 4DRXA 2IBZH 2R70A 4RQEA 4WBNA 4WFHA 2ZR3A 5HFMA 1K3EA 3G67A 4JI4O 4DV4O 5LBQA 2F4VB 3N2KB 2QWQB 4JI1B 2EJ7A 1J5EO 3N2KA 1OHHG 3L70H 1COWG 3JATB 4J9ZB 3OGIB 4IHJB 4DV3B 1SQXH 4UUJC 2ZM6B 4GZRB 3JATA 4YJ3B 1HNZO 4JTDB 1JQ0A 5H9CA 2E74B 1S77D 4O2BA 2CTWA 1MG1A 3ICXA 2JGUA 4LNUB 4RO2A 5IJ9B 1XBLA 2F93B 2GTAA 2UUBO 3E2EA 1M90W 3ABKC 2B1GA 5IJ9A 2Y0IA 3BVOA 5IWAB 4RUEA 3T4DA 2BSKB 4FIPC 1W59A 4JI2O 5L3DA 3FD9A 4OPAA 3STZC 1KMIZ 1XMOB 1UPGA 1YIJV 5EBWC 4X1YA 4HZ3A 4UB6Z 1OCCB 3EVKA 4IGGA 4GT1A 1F51A 1WPXA 4WFBV 4W4LA 2VWJA 2LQTA 2XAGA 2JIZG 5LHGA 5L3FA 2N05A 1XMQB 3UKMA 4DR6O 1WAZA 5EBLC 2XHBA 5ITZB 3KCYA 1DGSA 4JI6B 2ZE5A 2BTQA 1V54C 1SQFA 4MVMA 3VQXA 5KMGB 2JS3A 4NXMO 2EZPA 1IDSA 3L9DA 3OW2U 2AZ0A 2H94A 1AJPA 4PDLA 4F6EA 2D2CB 2RMKB 4NB5A 3OM3B 1S5HC 2JK5C 1GM8A 1DF4A 2DJVA 1GRJA 1XHXA 2HJDA 1IVSA 2UUBB 1H38A 4CS2A 2QE7G 1FXKC 1KP2A 3SDLA 4XDKA 1TVKB 1N0NA 4TV8A 2PF4E 3J7AU 4UCUA 4J41A 4P9PA 1VQ5V 3I5DA 1SQQH 2KKWA 3ZX6A 2EX3A 2KSDA 1XILA 4DR3O 2MK3A 3HKBA 1KQSU 2C2AA
chains in the Genus database with same CATH topology
1YSCA 3JD3A 2XAJA 2EINB 4FK5C 4QE7A 1N8RW 3CCMV 3RVYA 1PKXA 1LNQA 5CBFA 3I56V 1HWYA 1FS0G 3OMIB 1Q82W 3JYCA 1OCOC 2EIKB 3QO5A 3CCQV 1M9NA 4JTAB 2YEVB 1I5YA 2QTOA 4R7CA 5HFLA 3W7UA 1QR8A 4H33A 1GM7A 3W7XA 5EBMC 3B8MA 2B1IA 2YEVA 3K08A 2QEXV 3GWOA 1H8EG 4MSWC 1V55B 2WLNA 3CC4V 1M56C 5B1BC 2JEUA 4G2KA 3CP1A 4G28B 1M57C 1Q7YW 4JYCA 2DYSB 1R6KA 1VQMV 3LSQA 3OEHG 2M7WA 1FXKA 1YITV 2EIMB 2NNUA 2IJHA 2HR3A 2NLJC 1AI4A 2PI4A 4HAMA 3ABMB 3AG2C 3SYPA 1YJWV 1VQLV 3LDDA 4XDJA 3SYOA 3VOUA 3E35A 3P32A 4MVOA 2LP7A 5KUMA 1K5QA 1VQ4V 3ASNC 2Y69B 4MTOA 3CCEV 1Q86W 1VQKV 2HFEC 5L3BA 2ATKC 3NXSA 2WLJA 3EHBB 4R8CA 4LP8A 1KP3A 5KA5A 3K03A 3LUTB 2Q67A 3LDCA 5H6QA 2R9IA 3IFXA 4WCEV 2F43G 3AG1C 4JGSA 3X2QC 1KECA 5LGUA 4FJCC 1OCOB 3CMEV 3HB3B 3OFNG 2EINC 3FYIB 4MVUA 3E83A 1YJ9V 1PL0A 3CD6V 1THZA 2PI5A 4JASA 2LFRA 3SYQA 1ORQC 2WLLB 2IU0A 1DF5A 1OCZC 4FPPA 1M56B 2QM7A 3SPIA 2EJRA 5B1BB 1BMFG 4MTGA 4U7OA 1TUEB 5KA6A 3JCZA 4PA6A 2DYRC 2ZDIC 4UXNA 3UM7A 3ABTA 3ZRVA 4WF9V 2BOCC 4OXSA 2OT5A 2QKSA 4WFEA 1YHQV 1SERA 2WLIB 1GO3F 3QO8A 5KUKA 2Y48A 4U7NA 4JPRA 3QNEA 2DW4A 1K97A 4QPJA 3T2MA 3AG2B 2HJFC 2IJJA 4JAUA 1AI6A 4H37A 2JEXA 4MS2A 3ZMZA 1FXHA 1OCRC 3ASOC 3RVZA 3SPJA 3ASNB 4PDMA 1VQ8V 4TT3G 1W0KG 3OGCC 2XOKG 2EIMC 3SJQC 1DTOA 3D36A 3TCUA 4N23A 1Y66A 2X6BA 2WAMA 1NH2D 2EZOA 5EC1C 4MT8A 1CP9A 1K9MW 4F4LA 2P90A 3MHHC 3AG1B 3X2QB 1AI5A 2EILC 3JD4A 1Y4MA 4GX1A 4ZBMA 4GX5A 1DLBA 3FYEB 2FTKA 3PJSK 4XBFA 1S76D 3A0RA 2HKOA 4QPKA 5B1AB 4BIZA 3H01A 1YTFD 3SPGA 2DQ0A 3OUSA 1K33A 4TSFG 3R65A 1VQOV 4LC1A 4KFMA 1S0VA 2V7QG 1EZJA 3MHSC 4GCZA 3ABUA 4J9YB 1H8HG 3OAAG 3K0DA 1OCZB 2OCCC 3F7YC 5C93A 3ZIAG 4BAYA 2Q68A 1K5SA 1QR9A 5CBGA 3JD1A 4UVBA 4KUMA 1QCEA 3P30A 2AHYA 1W2BU 4JAVA 2DYRB 3FB8C 2Q6AA 1NQTA 3ABLC 2WLMA 2IW5A 2X6CA 3FB5C 2H8PC 4PELA 1K7DA 2V1DA 4QJFB 4I5SA 4MVSA 5EK0A 2EBOA 1XL6A 3LDEA 3CCUV 1RPOA 1P4RA 3OMNB 1R3JC 1OCRB 5LGNA 3OR6C 2XASA 1JPXA 3ASOB 4UV9A 2OTJV 4CBCA 2Q69A 3K06A 1VQ6V 4Z1MG 3IC7A 3ZN1A 2GSMB 1MABG 5IYDO 1VQNV 2XAHA 3CCJV 3ZCCA 3E89A 3FB6C 4MVRA 5GW7A 4RQFA 5E1AC 3W7SA 3CC7V 1ZWIC 1R3KC 3ETDA 3K0GA 2EILB 1S3JA 3CPWU 3AEIA 4WFFA 1I5XA 2W6JG 1WLEA 3LSSA 3BEHA 4PA4A 2P67A 1CPYA 4JYBA 3K79A 2W0FC 4DXWA 2QA4V 3E86A 1NVPB 1K4DC 4RUFA 1J95A 2P6JA 2JJ2G 4FMTA 3EFFK 4BIUA 1AJNA 3E8GA 4P2ZA 2OCCB 4BW5A 1PNLA 2X0LA 5L3EA 3TETA 4G27B 3ZJZA 1P7BA 1NR1A 5B1AC 1F4MA 1GMGA 3VBBA 3ZN0A 5L3GA 5DM6V 1R3IC 3ABLB 3B77A 2XNDG 2HG5C 3F5WC 3CCLV 3K3WA 4GX2A 3KG2A 4HYOA 1EFRG 4MTFA 5B3SB 1W0JG 1AROP 5IDJA 1F23A 1E1QG 3ZMVA 1YI2V 3SPHA 3SYAA 3DTUB 4PA3A 1E79G 2WLLA 1SRYA 1GKFA 4L87A 4XDLA 4WFAV 1JVMA 4X89A 2X6AA 1BHAA 2WSSG 1SZTA 1MOFA 3CMAV 1RPRA 2B5UA 2XAQA 3STLC 5B1OA 1YJNV 2ITDC 4DO2A 5LHIA 1PNKA 4P30A 4GX0A 1NR7A 2WLIA 4LBEC 3T4ZA 3AG3B 3CC2V 3ZMUA 5L3CA 5LGTA 5IY5C 1QLNA 1ROPA 2WPDG 5B1NA 1R73A 4RQEA 3G71V 1ENVA 4WFHA 5H6RA 2ZR3A 5HFMA 1K3EA 2WLKA 2JJ1G 2YSUB 5EC2C 2Z3YA 5LBQA 2HLDG 2EIJC 3F7VC 2IH3C 4PDVA 4MW3A 2HVKC 5CN0A 1OZ0A 4I9WA 1UJWB 1OCCC 3SYCA 1OHHG 1NKDA 1COWG 3GB7C 2HVJC 3AG4C 2GHYA 4JTCB 1JCHA 4PA9A 5CMUA 1AI7A 4J9ZB 2A0LA 1KD1W 1F4NA 2R9RB 4UUJC 1K4CC 4UVCA 1H2GA 4YXWG 3SPCA 1K73W 4JTDB 1V54B 1JQ0A 2D3OW 5H9CA 1MSWD 1QBZA 1SESA 3RBZA 1S77D 1GK9A 4LCUC 2UXNA 5IYBO 2ZDIA 5B3SC 1MG1A 1G8MA 4RO2A 4UV8A 3ZRWB 2P7TC 4MW8A 4PA7A 4CZZA 4UVAA 5BZBA 3HPLC 3W7TA 3OMAB 1M90W 2ZD9A 3E2EA 3ABKC 3RW0A 2KB1A 2B1GA 3JD0A 3ZRWA 5IY5B 1QLEC 4P9OA 2IJIA 2ZXWC 4RUEA 3T4DA 2IU3A 1FXVA 4FIPC 3CCVV 3CXCU 4N21A 3ZMSA 5L3DA 3D3IA 3AG3C 2XAFA 3FKSG 2IH1C 3STZC 1VQ9V 1FXKB 2EIJB 1YIJV 5EBWC 3WFVA 1K8AW 4R6ZA 4MVQA 1AR1B 1L1FA 4HZ3A 4EKWA 2QM8A 2ZQMA 1OCCB 1QVFU 4X8AA 1S72V 3AG4B 2OTLV 4GT1A 1G4YB 1F51A 1SETA 1K92A 1WPXA 4WFBV 4R50A 4Q20A 1RM1C 1VQ7V 2XAGA 1GM9A 2JIZG 1IXMA 2CK3G 5CBHA 5LHGA 2A79B 5L3FA 3TK1A 3UKMA 1M1KW 1JJ2U 2BOBC 1KC8W 3OEEG 1QVGU 3IGAC 5EBLC 2K1EA 5IYCO 3W7WA 4QE9A 1JX9A 1BL8A 4X88A 3OR7C 3WG7C 3ZRXA 5LHHA 4ASUG 3M99B 1V54C 2ITCC 3ABKB 4MVMA 1NVPD 3I55V 1Q81W 1CEZA 3ML0A 2WLHA 4KP4A 1QLEB 4MTXA 2EZPA 1VQPV 3BY6A 1KKDA 2ZXWB 3E8BA 1NJIW 3OW2U 1PNMA 2X7RB 2LFSA 2H94A 1AJPA 3B8NA 4PDLA 1GTOA 3OM3B 1S5HC 5DN6G 2EIKC 2JK5C 4QNHB 3CCRV 1GM8A 3T1CA 1DF4A 1NH2B 2AHZA 3MD0A 2DWDC 3OUFA 2WWWA 1EBOA 1M57B 2IJKA 1NBMG 4TWKA 5FL7G 3ETGA 1JOYA 3ZRSA 4ZKIA 2JDIG 4PDRA 1H38A 2Z5UA 1V55C 2QE7G 1AJQA 1E1RG 1PD3A 2W6IG 2ZR2A 2DQ3A 3ZMTA 3G6EV 1FXKC 1R6NA 2UXXA 1YTFB 1KP2A 1RM1B 4XDKA 3ETEA 3G4SV 1BHBA 3DGEA 3K04A 3QO7A 4WFGA 2DYSC 5J9PC 3JD2A 3E8FA 3CCSV 4QIWF 5CA3A 4MVZA 3FB7C 1R3LC 1FFTB 1XL4A 3K9AA 3OE7G 2A9HA 4P9PA 1VQ5V 3ABMC 1K34A 3LNMB 2DWEC 3WG7B 4E2LA 2Y69C 4JF3A 4RAIA 2MK3A 1KQSU 1B6QA 3CYOA 2C2AA 3E8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QE7 A;  3T2M A;  2HJF C;  3AG3 C;  2IH1 C;  4H37 A;  4MS2 A;  1R3I C;  3STZ C;  2HG5 C;  1OCR C;  3F5W C;  3RVY A;  4GX2 A;  3ASO C;  3KG2 A;  4HYO A;  3RVZ A;  3SPJ A;  1LNQ A;  5EBW C;  5CBF A;  4PDM A;  4R6Z A;  4MVQ A;  3OGC C;  4MTF A;  4HZ3 A;  2EIM C;  3SJQ C;  3TCU A;  4EKW A;  3SPH A;  3JYC A;  1OCO C;  3SYA A;  2X6B A;  4X8A A;  4PA3 A;  2WLL A;  5EC1 C;  4JTA B;  1G4Y B;  2QTO A;  4R7C A;  4F4L A;  4XDL A;  4R50 A;  4H33 A;  5EBM C;  1JVM A;  2EIL C;  4X89 A;  2X6A A;  4GX1 A;  2YEV A;  3K08 A;  4GX5 A;  4ZBM A;  5CBH A;  2A79 B;  3PJS K;  4MSW C;  3STL C;  3UKM A;  2WLN A;  1M56 C;  2ITD C;  5B1B C;  2BOB C;  4P30 A;  4GX0 A;  2WLI A;  4LBE C;  3SPG A;  3OUS A;  3T4Z A;  4G28 B;  1M57 C;  3R65 A;  3IGA C;  5EBL C;  5IY5 C;  2K1E A;  4KFM A;  4QE9 A;  1BL8 A;  4J9Y B;  3OR7 C;  4X88 A;  3WG7 C;  3K0D A;  2OCC C;  3F7Y C;  3ZJZ A;  1V54 C;  2ITC C;  2Q68 A;  2NLJ C;  4WFH A;  5CBG A;  4MVM A;  2AHY A;  2WLK A;  2WLH A;  3AG2 C;  3SYP A;  3FB8 C;  3LDD A;  2Q6A A;  5EC2 C;  4XDJ A;  3SYO A;  3VOU A;  3ABL C;  2WLM A;  4MVO A;  5KUM A;  2EIJ C;  1KKD A;  3F7V C;  2IH3 C;  3E8B A;  3ASN C;  4MTO A;  2X6C A;  3FB5 C;  4PDV A;  2H8P C;  4MW3 A;  2HFE C;  2ATK C;  2WLJ A;  2HVK C;  4R8C A;  4PDL A;  4MVS A;  4LP8 A;  5EK0 A;  4I9W A;  1S5H C;  1XL6 A;  1OCC C;  2EIK C;  2JK5 C;  3GB7 C;  3K03 A;  3LDE A;  3LUT B;  3SYC A;  2HVJ C;  3AG4 C;  3T1C A;  4QNH B;  2AHZ A;  2Q67 A;  4JTC B;  2DWD C;  4PA9 A;  1R3J C;  3LDC A;  3IFX A;  3OUF A;  3OR6 C;  4J9Z B;  2A0L A;  4CBC A;  2Q69 A;  3AG1 C;  3K06 A;  2R9R B;  4TWK A;  4UUJ C;  1K4C C;  3X2Q C;  3ZRS A;  4PDR A;  3SPC A;  4JTD B;  3E89 A;  3FB6 C;  1V55 C;  2EIN C;  4MVR A;  4MVU A;  3E83 A;  5E1A C;  3RBZ A;  4LCU C;  1ZWI C;  1R3K C;  4XDK A;  3K0G A;  3K04 A;  4WFG A;  4WFF A;  5B3S C;  2DYS C;  3SYQ A;  1ORQ C;  3E8F A;  2WLL B;  5J9P C;  3BEH A;  4PA4 A;  4MVZ A;  4RO2 A;  1OCZ C;  2P7T C;  3FB7 C;  4MW8 A;  4PA7 A;  3SPI A;  1R3L C;  4MTG A;  5BZB A;  2W0F C;  3HPL C;  2ZD9 A;  1XL4 A;  3ABK C;  3RW0 A;  2KB1 A;  2A9H A;  4P9P A;  4DXW A;  3E86 A;  2DYR C;  1K4D C;  3ABM C;  1J95 A;  4PA6 A;  4RUF A;  3UM7 A;  1QLE C;  3LNM B;  2DWE C;  4P9O A;  5B1A C;  3EFF K;  2ZXW C;  2BOC C;  4OXS A;  2QKS A;  3E8G A;  4P2Z A;  2Y69 C;  4RUE A;  4WFE A;  4RAI A;  3T4D A;  4BW5 A;  2WLI B;  3TET A;  5KUK A;  4G27 B;  1P7B A;  3E8H A; 
#chains in the Genus database with same CATH topology
 1FJG O;  4ABM A;  2XAJ A;  2EIN B;  4QE7 A;  4PI0 A;  5LOV A;  3CCM V;  1WN7 A;  1PKX A;  4W4K A;  2DE0 X;  1FS0 G;  2PGG A;  5CA0 B;  1OCO C;  1PV0 A;  2EIK B;  5JJJ B;  4JTA B;  5LMU B;  2YEV B;  3W7U A;  5KX5 A;  4GYC B;  4H33 A;  3R66 A;  2YEV A;  1N36 O;  1H8E G;  2UXC B;  4MSW C;  1V55 B;  3DSQ A;  4X62 B;  2R72 A;  3A0B Z;  4G28 B;  4JYC A;  2GTS A;  3S3W A;  2QWN B;  2DYS B;  1R6K A;  1NTZ H;  4RWU A;  1YIT V;  1L0N H;  2E76 B;  5JQG B;  3AG2 C;  4XDJ A;  4DV6 O;  3VOU A;  4YY3 O;  3E35 A;  4JV5 O;  4NTW A;  2PYL A;  2RN9 A;  2Y69 B;  2LO1 A;  2WLJ A;  4LP8 A;  5JJN B;  5KA5 A;  3K03 A;  4FZ1 A;  2Q67 A;  1GH6 A;  1KEC A;  3OT7 A;  4FJC C;  4B7E A;  4H0L B;  2QDO A;  1EM1 A;  3IJ4 A;  3AK3 A;  5JCO A;  4F6R A;  3RN4 A;  4DUY B;  1GAX A;  1Y74 A;  5BY1 A;  1THZ A;  4LFB B;  2QWR B;  3CS5 A;  3SYQ A;  1ORQ C;  4TUY A;  2UUA O;  1JA8 A;  4LF8 O;  3SPI A;  1BMF G;  2Q7G A;  4MTG A;  4UXN A;  3UM7 A;  1YCI A;  4DR2 O;  2PZS A;  2QKS A;  3BA9 A;  3MDS A;  2OYQ A;  4QPJ A;  2IJJ A;  4JAU A;  1N32 B;  1AI6 A;  3ZMZ A;  1OCR C;  3H1K H;  1IBM O;  3TCU A;  4LFC O;  1Y66 A;  4B3M B;  2WA4 A;  4J10 A;  4MT8 A;  1CP9 A;  5JH7 B;  5H5N A;  2P90 A;  1SQG A;  3MHH C;  5A2Q N;  2Q7H A;  1AI5 A;  1Y4M A;  4GKK O;  2O57 A;  1SF9 A;  4B3S O;  5LL6 Y;  4DV2 O;  3A0R A;  5B1A B;  3SPG A;  2DQ0 A;  2AGA A;  4O4H B;  2YXY A;  4KFM A;  2V7Q G;  3MHS C;  1SA0 B;  4X65 O;  3OTF A;  1OCZ B;  2OCC C;  3CJH A;  1IBK B;  2CTQ A;  4O4H A;  1TUB A;  3JD1 A;  3DXR B;  2HHH O;  4O2A A;  1NQT A;  3WB1 A;  2W0X A;  2IW5 A;  2X6C A;  3FB5 C;  2H8P C;  2CUG A;  1K7D A;  2RQ6 A;  2GUZ A;  4I5S A;  2EBO A;  2QM4 A;  1ZSP A;  4L8J A;  5LGN A;  3CX5 F;  2CH7 A;  5LYJ B;  2F95 B;  2Q69 A;  1WB8 A;  2KG7 A;  1VQ6 V;  1MAB G;  4U3F H;  3CCJ V;  5LMN O;  3W7S A;  4DR1 B;  1R3K C;  2P4K A;  1MZE A;  3ETD A;  1HP8 A;  3AEI A;  4WFF A;  1I5X A;  2H3O A;  3LSS A;  3E22 B;  4J42 A;  4X64 O;  4J11 A;  2QA4 V;  1NVP B;  1J95 A;  2CDY A;  2JJ2 G;  5EZY B;  4J7J A;  4BIU A;  1AJN A;  4FLZ A;  1NU1 H;  1SKV A;  1L0L H;  5L3E A;  5EZY A;  3B40 A;  4ZOL B;  3WU2 Z;  1R3I C;  3ABL B;  4ZOL A;  3IAY A;  4MTF A;  4NVP A;  1F23 A;  1YI2 V;  4I4T A;  3SPH A;  3SYA A;  4DR7 B;  1F7Y A;  2UUC O;  1N0J A;  1SRY A;  2QWP B;  2FKX A;  5EYP B;  2AW9 A;  1WA8 B;  3RYI A;  4K0K O;  1SZT A;  1RPR A;  1H2M A;  1RP3 B;  1YJN V;  2ITD C;  3P3N A;  1NR7 A;  1O9G A;  2WLI A;  4LBE C;  4LF9 O;  1ROP A;  2LGW A;  4CC6 A;  4B3T O;  1R73 A;  2UU9 O;  1H2L A;  1ENV A;  5H6R A;  3M8A A;  2YSU B;  4I50 B;  1YZB A;  2EIJ C;  1VEW A;  3HKE B;  4FLW A;  3D8C A;  3T1Y O;  1AVM A;  2YI8 A;  4PDV A;  4DW0 A;  2HVK C;  5A9G A;  4X66 O;  4X1I B;  2UXD O;  3HKE A;  1KB9 F;  1NKD A;  4A5U B;  4O4L A;  2GHY A;  4JTC B;  1JCH A;  4PA9 A;  5CMU A;  1AI7 A;  4X1I A;  4NKG B;  3K59 A;  4LF4 B;  1K4C C;  1AB3 A;  4YXW G;  3SPC A;  1K73 W;  1V54 B;  2D3O W;  3L72 H;  4B08 A;  1LUW A;  4LCU C;  2UXN A;  5IYB O;  5B3S C;  4UV8 A;  4DK1 A;  2P7T C;  4CZZ A;  3SGI A;  5JCO C;  3APO A;  3HPL C;  3W7T A;  4LF5 B;  2ZD9 A;  2L6L A;  2ADP A;  2JVD A;  4O4I A;  2IU3 A;  4AQY O;  3CXC U;  5TIS Z;  3D3I A;  3AG3 C;  1FXK B;  4K0K B;  4KL1 A;  1GN6 A;  3FAV B;  4MVQ A;  3ZHT A;  4EKW A;  2QM8 A;  1DK1 A;  3EXA A;  2G38 A;  3AK2 A;  1X59 A;  3AG4 B;  3N27 A;  3H1H H;  3QG5 A;  1PM9 A;  2R9A A;  1K92 A;  4EFB A;  1RM1 C;  1XNR B;  5CBH A;  2UU9 B;  3U0Z A;  2HEP A;  2A79 B;  3S3X A;  1M1K W;  3BA8 A;  1WB7 A;  2BOB C;  4J7Z A;  2CTP A;  4DV0 O;  3ZHQ A;  1KC8 W;  5LA6 B;  3IGA C;  2NN4 A;  3ZHR A;  1JX9 A;  3HKC B;  3OR7 C;  3WG7 C;  3ZRX A;  5LHH A;  1XEQ A;  5LA6 A;  5JWP A;  1NVP D;  5J2U A;  1AR4 A;  3I55 V;  1Q81 W;  3CRQ A;  3ML0 A;  3T1H B;  1QLE B;  3BAA A;  4MTX A;  1EN4 A;  4UCS A;  3BY6 A;  5FPO A;  2ZXW B;  1PNM A;  1HNW O;  2E75 B;  3LSU A;  3T1C A;  2P4V A;  1NH2 B;  3OUF A;  3K5O A;  1EBO A;  2UXB B;  2IJK A;  2KQX A;  1Y6X A;  3ZRS A;  4ZKI A;  2JDI G;  2ZIN A;  1LUV A;  1E1R G;  1PD3 A;  1A32 A;  2DQ3 A;  3ZMT A;  3G6E V;  1BT8 A;  4WFG A;  1EZV H;  3K04 A;  3QO7 A;  4U3J B;  5J9P C;  5CA3 A;  1JFF B;  2F66 C;  3ZHS A;  3FB7 C;  4U3J A;  4H13 B;  2ZIO A;  2ARH A;  2Z0A A;  1P84 F;  2JRI A;  4GLX A;  1M5I A;  5BR8 B;  4E2L A;  1URF A;  5FNV B;  1XRE A;  1NI8 A;  4IHJ A;  1B6Q A;  4UCV A;  3CYO A;  3E8H A;  2CAZ C;  3JD3 A;  4FK5 C;  4YJ3 A;  5FNV A;  1XQ8 A;  4DV1 O;  4OGQ B;  4YHH B;  1Y67 A;  5CBF A;  1YXB A;  4KHP B;  4BWA A;  5B66 Z;  1Q82 W;  1N4C A;  1QQC A;  3CCQ V;  2E3C A;  1I08 A;  4LNU A;  1Z5V A;  3CRC A;  4ZHQ B;  3B8M A;  2ZIM A;  2QEX V;  1M56 C;  5B1B C;  4JI3 O;  2BSK A;  4DR5 B;  3CE2 A;  4G2K A;  4ZHQ A;  3CP1 A;  1M57 C;  1Q7Y W;  2CTR A;  2ZKO A;  3L73 H;  2DMX A;  4JI8 B;  3LSQ A;  3OEH G;  4JI0 B;  2QKC A;  1AI4 A;  4LF7 O;  4HAM A;  2Q0O C;  3O9O A;  3ABM B;  2VS0 A;  3SYO A;  2BCC H;  4MVO A;  5KUM A;  2LP7 A;  2YIA A;  1VQ4 V;  3ASN C;  5J2T B;  5AG2 A;  4K8X A;  5L3B A;  2ATK C;  1GN4 A;  4D6T H;  4JI4 B;  1FPO A;  4DV4 B;  4GKJ O;  5J2T A;  2R9I A;  3IFX A;  4WCE V;  1QU7 A;  1CXZ B;  3AG1 C;  4JGS A;  2QGN A;  3X2Q C;  4GUN A;  4JI5 O;  1J5E B;  3HB3 B;  1D2D A;  2GDS A;  3FYI B;  5ITZ A;  4K35 A;  4MVU A;  1N34 O;  1PL0 A;  4ICG A;  3CD6 V;  4IYI A;  2MW2 B;  1LR1 A;  1HNZ B;  2WLL B;  5KMG A;  4YIP A;  3AK1 A;  3RWR D;  1M93 A;  2P5O A;  3UO3 A;  2EJR A;  4PI2 A;  1TUE B;  4DV1 B;  3TXQ A;  3KKY A;  3ABT A;  3ZRV A;  4WF9 V;  1B04 A;  4NTX A;  4U7N A;  2DW4 A;  1K97 A;  1BCC H;  2QSA A;  4H37 A;  1FXH A;  4DUZ O;  3ASO C;  3SPJ A;  1VQ8 V;  4JI2 B;  1DTO A;  3D36 A;  4N23 A;  1TVK A;  1NH2 D;  1V9P A;  4F4L A;  1FFX B;  2EIL C;  3JSL A;  3WB0 A;  4ZBM A;  5JVD B;  1DLB A;  5KAI Z;  3FYE B;  4LF7 B;  1S76 D;  2HKO A;  1K33 A;  1VQO V;  4LC1 A;  4J9Y B;  4DR6 B;  3OAA G;  1NT2 B;  3SJC C;  5LXT B;  2Y4U A;  5C93 A;  3ZIA G;  2Q68 A;  4HNA B;  1QR9 A;  4KUM A;  3P30 A;  3N2G B;  4JAA A;  2DYR B;  5CA0 A;  3JAR B;  2VQE O;  4HNA A;  5FLX N;  1Q43 A;  1P49 A;  4QJF B;  5EK0 A;  4I9Q A;  1N34 B;  3LDE A;  4NXM B;  2LJ2 A;  3OMN B;  1US6 A;  1JPX A;  2PY5 A;  3K06 A;  2PYJ A;  3VQY A;  2EUL A;  3VQW A;  1Z5W A;  4EB6 B;  2XAH A;  4K3A A;  3E89 A;  1KBH A;  4RQF A;  3CC7 V;  3K0G A;  4Z1V A;  5JQG A;  2W6J G;  1VAR A;  3CWB H;  5GTH Z;  1CPY A;  2GBO A;  4DV7 O;  4JYB A;  4PV1 B;  3K79 A;  2ADQ B;  4I7Z B;  2YIB A;  1Q6U A;  2P6J A;  2E5L O;  4LFA O;  4P2Z A;  1PNL A;  1OV9 A;  4FLT A;  3B09 A;  4G27 B;  4LH7 A;  1MNG A;  1NR1 A;  3UT5 B;  4CH6 A;  3ZN0 A;  5L3G A;  4DR3 B;  3F5W C;  4GX2 A;  3KG2 A;  4HYO A;  3UT5 A;  1EFR G;  3JAK B;  5B3S B;  1W0J G;  1FJG B;  1E1Q G;  3DTU B;  2ODM A;  4PA3 A;  3JAK A;  1GKF A;  4L87 A;  4WFA V;  3C3T A;  1D5N A;  1BHA A;  3HKD B;  4TQD A;  3CMA V;  3STL C;  5B1O A;  4ZI7 B;  4P30 A;  1PNK A;  1VP7 A;  4GX0 A;  2VQF O;  2BE3 A;  4X20 B;  3AG3 B;  1Q90 D;  5D5Q A;  5L3C A;  4B3R O;  5LGT A;  1N36 B;  4DR4 O;  3RGB A;  4AI8 A;  4Q6G A;  4X20 A;  2WLK A;  3JAM N;  2YUA A;  5EC2 C;  5IE9 A;  3H1I H;  3F7V C;  2Q7E A;  4FLV A;  5JH7 A;  5CN0 A;  1OZ0 A;  4I9W A;  1OCC C;  4DV6 B;  3GB7 C;  5DEC A;  3UO2 A;  4YY3 B;  4JV5 B;  2HVJ C;  3BPZ A;  3TGU H;  2ETN A;  2A0L A;  1KD1 W;  1G6U A;  1SQP H;  1MMM A;  2R9R B;  2N04 A;  2BTO A;  4UVC A;  1H2G A;  3A2F A;  1SA0 A;  1MSW D;  2E5L B;  1SES A;  3RBZ A;  3J80 N;  4LFA B;  5KHK A;  4FLY A;  3DXR A;  2ZDI A;  2FB5 A;  1HNX O;  4UVA A;  3OMA B;  3RW0 A;  4JI7 O;  1SC5 B;  4YIO A;  5LP6 B;  5IY5 B;  5IYZ B;  2UUA B;  1IBL O;  4P9O A;  4LF8 B;  2JGD B;  5LYJ A;  3CCV V;  3QTC A;  3U11 A;  2N74 A;  5IYZ A;  4N21 A;  3OTO O;  4DR2 B;  3C90 A;  3FKS G;  3ZHU A;  4NYK A;  1QHT A;  3WFV A;  1FD9 A;  3SR2 C;  5K1X A;  2ZQM A;  1QVF U;  4X8A A;  2VWK A;  2ZE7 A;  3LNN A;  1S72 V;  3E22 A;  1G4Y B;  2A06 H;  4Q20 A;  1IBM B;  4LFC B;  1VQ7 V;  1L8D A;  1GM9 A;  1I94 O;  1IXM A;  5KHJ A;  3L74 H;  2L35 A;  3TK1 A;  1BZK A;  1JJ2 U;  2VRZ A;  1P7G A;  3NR7 A;  4LR3 A;  1NZ6 A;  1QVG U;  4GKK B;  2YIB D;  1ZX3 A;  3W7W A;  4QE9 A;  5IYC O;  4DV2 B;  1KU9 A;  1BL8 A;  4B3S B;  2XT9 A;  4TOI A;  3ABK B;  1BQZ A;  3B2E E;  1Q5O A;  4X65 B;  1KKD A;  1NJI W;  5EYP A;  2LFS A;  3PN1 A;  2P22 C;  4AHC A;  1WA8 A;  1R1B A;  2HHH B;  2EIK C;  4QNH B;  2DWD C;  2WWW A;  4PD4 F;  1M57 B;  3BFR A;  1NBM G;  4TWK A;  3U10 A;  5BMV B;  5FL7 G;  1N33 O;  3ETG A;  1YF2 A;  1IX9 A;  1JOY A;  4C7U A;  1IUR A;  1V55 C;  1AJQ A;  2W6I G;  2ZR2 A;  1R6N A;  1IBL B;  1YTF B;  4BR6 A;  2DYS C;  3RYH B;  3E8F A;  1MSD A;  4I50 A;  5LMN B;  2QKA A;  1KYO F;  4E4E A;  1ZTE A;  3OTO B;  1FFT B;  4DYL A;  3CHX A;  3K9A A;  1WP8 A;  1ZL8 B;  4CS3 A;  4FLX A;  3LNM B;  1Y76 B;  1HDJ A;  1IXB A;  4X64 B;  2Y69 C;  4JF3 A;  1Q6H A;  1TGO A;  3M7M X;  2HP8 A;  1JJO A;  4I55 B;  4JYA O;  1N8R W;  3JAW B;  4DV5 O;  3RVY A;  1U96 A;  1S5J A;  3I56 V;  3OMI B;  3J81 N;  3JYC A;  3A0H Z;  3CRM A;  5CB4 B;  2YC0 A;  1M9N A;  5E79 Z;  2QTO A;  5HFL A;  1BQ0 A;  5EIB D;  1GM7 A;  5F2V O;  5C8Y B;  2B1I A;  2UUC B;  2OCH A;  2WLN A;  3B4S A;  2ILM A;  3IC9 A;  1ZUQ A;  3CRR A;  1KUQ A;  4JZG A;  1VQM V;  3JCU Z;  2M7W A;  2JS5 A;  1FXK A;  2F4V O;  2NNU A;  1PP9 H;  2IJH A;  4JI1 O;  2HR3 A;  2NLJ C;  3FAV A;  2PI4 A;  4LF9 B;  3APQ A;  1YJW V;  3LDD A;  4B3T B;  3P32 A;  1K5Q A;  1VQK V;  3EHB B;  4R8C A;  4DV3 O;  2ZM6 O;  5DED A;  1X4T A;  3LUT B;  3T1Y B;  1WJZ A;  3LDC A;  5H6Q A;  4H44 B;  4J7K A;  2F43 G;  4QGP A;  2DN9 A;  3G80 A;  4X66 B;  5LGU A;  2UXD B;  3BAB A;  1OCO B;  3CME V;  3VQV A;  3HKC A;  3OFN G;  1AR5 A;  1YJ9 V;  1AIL A;  3ZBH A;  2YI9 A;  2LFR A;  4JAS A;  1OJH A;  1VIB A;  1OCZ C;  4FPP A;  5IWA O;  2QM7 A;  4U7O A;  4LF6 O;  1VF6 A;  5KA6 A;  2NR5 A;  2ZDI C;  3C3S A;  4EFE A;  4OXS A;  4WFE A;  1YHQ V;  1XMO O;  1SER A;  1GO3 F;  4LWS B;  5KUK A;  4JPR A;  1FAF A;  3CEI A;  1FYJ A;  3AG2 B;  2JEX A;  4D7T A;  3RVZ A;  4AQY B;  4WBN B;  2AXT Z;  4NR1 A;  2YS8 A;  4TT3 G;  3OGC C;  3KZI Z;  2EIM C;  3SJQ C;  2X6B A;  2WAM A;  3JSN A;  2FML A;  2P06 A;  1JFF A;  1XMQ O;  1K9M W;  3HR0 A;  3JD4 A;  4TQF A;  4NXN O;  2FTK A;  3PJS K;  3THO A;  1MA1 A;  4JI6 O;  4QPK A;  4BIZ A;  3H01 A;  1YTF D;  4KXR A;  4OPH A;  3OUS A;  3O65 A;  4TSF G;  3R65 A;  2QJ1 A;  2LW1 A;  1S0V A;  4PJ0 Z;  1EZJ A;  1XNQ O;  1XUQ A;  3K0D A;  4FFK A;  4DV0 B;  3ZHV A;  4BAY A;  4O2B B;  1GN2 A;  1K5S A;  3D3Q A;  2AHY A;  4JAV A;  3JAS B;  3ABL C;  2WLM A;  3H1J H;  1KKC A;  1RSO B;  1JR9 A;  2V1D A;  4IYH A;  3JAS A;  4MVS A;  3UQ8 A;  2B9Z A;  1RSO A;  1P4R A;  1OCR B;  5KLV H;  4UV9 A;  1HNW B;  4PHZ A;  3IC7 A;  3ZN1 A;  2GSM B;  5IYD O;  2YXL A;  4LF6 B;  3ZCC A;  5GW7 A;  4FLU A;  5E1A C;  1Z2G A;  4X1Y B;  3RYF B;  1BSM A;  1S3J A;  1GN3 A;  3BEH A;  4PA4 A;  4B7K A;  2P67 A;  3RYF A;  2F1M A;  4J80 A;  3TXS A;  1G1X B;  5K1P A;  4RUF A;  4FMT A;  1Q8I A;  4ZIB A;  3E8G A;  2OCC B;  4BW5 A;  1EN5 A;  1F4M A;  3QF7 A;  1GMG A;  4UCT A;  3VBB A;  2XND G;  2HG5 C;  3SJB C;  4EEQ A;  3K3W A;  2BTQ B;  5LMU O;  4OX9 O;  4NXN B;  1ARO P;  2YID A;  1E79 G;  2WLL A;  2UXC O;  1NTK H;  4FM0 A;  4X62 O;  1XNQ B;  2X6A A;  2WSS G;  2AZ2 A;  4DO2 A;  2CGN A;  4NTY A;  3CC2 V;  2YXH A;  5IT9 N;  2LGQ A;  3BRC A;  3RT3 C;  2WPD G;  5IJ0 B;  2OWO A;  4JI3 B;  1YVW A;  3G71 V;  5IJ0 A;  2JJ1 G;  2K9P A;  2Z3Y A;  4TV8 B;  2HLD G;  1SQB H;  2ZNI A;  2IH3 C;  2Y0P A;  4MW3 A;  2ZNJ A;  1JMK C;  1FFX A;  1UJW B;  1RFY A;  4UB8 Z;  3SYC A;  5JVD A;  3AG4 C;  2Q4P A;  1XDC A;  2V4D A;  3DC5 A;  3HKB B;  1AP5 A;  1F4N A;  4DUY O;  1VF5 B;  4LFB O;  4GKJ B;  5LOV B;  3RFR A;  2Q73 A;  1XHZ A;  3ETQ A;  1QBZ A;  3QVN A;  5LXT A;  1MZF A;  1GK9 A;  4JI5 B;  2Q0A A;  3N2G A;  4UFZ A;  3JAR A;  1QNM A;  1G8M A;  3ZRW B;  4MW8 A;  4PA7 A;  5KX5 B;  2XUM A;  5BZB A;  2KB1 A;  3JD0 A;  5JJE B;  3ZRW A;  1O9H A;  4OX9 B;  1XI1 A;  1QLE C;  1N32 O;  2IJI A;  2ZXW C;  4CH5 A;  1PPJ H;  1FXV A;  1VF6 C;  3ZMS A;  1HW7 A;  2XAF A;  4B3M O;  4EB6 A;  1VF7 A;  2IH1 C;  1HR0 O;  1VQ9 V;  3FX7 A;  1XOU A;  1Q3E A;  2EIJ B;  1WPB A;  1K8A W;  4R6Z A;  1AR1 B;  1L1F A;  2XTA A;  4DUZ B;  2OTL V;  1SET A;  1H2K A;  4R50 A;  4FZ0 A;  2CK3 G;  2ZT9 B;  2Y4T A;  1I0H A;  1IBK O;  1NTM H;  3OEE G;  2F23 A;  2K1E A;  4AIL C;  4X88 A;  4ASU G;  3M99 B;  2ITC C;  3RYC B;  4F6R B;  3GVM A;  1ZAU A;  1I7F A;  1Y74 B;  2YDE A;  1CEZ A;  2WLH A;  4TUY B;  4KP4 A;  1VQP V;  1WNS A;  3RYC A;  1PL4 A;  3E8B A;  2X7R B;  1NS1 A;  4FM1 A;  3B8N A;  3K57 A;  3DC6 A;  1GTO A;  4UCR A;  5DN6 G;  3HKD A;  2VQE B;  3CCR V;  3MAQ A;  2AHZ A;  3MD0 A;  1AP6 A;  1U97 A;  4ZI7 A;  1H2S B;  4DR1 O;  5D5P A;  4X1K B;  4PDR A;  2Z5U A;  3K9S A;  1TAE A;  2IM9 A;  2UXX A;  5GTI Z;  4X1K A;  1RM1 B;  3G4S V;  3ETE A;  1BHB A;  3DGE A;  3JD2 A;  3CCS V;  4QIW F;  3BHP A;  4MVZ A;  1R3L C;  1HR0 B;  1XL4 A;  5BXZ A;  3OE7 G;  2A9H A;  2A3Q A;  3ABM C;  1K34 A;  2OIE A;  1M4U A;  5KAF Z;  2DWE C;  5FPR A;  3WG7 B;  4DV7 B;  4RAI A;  1VMG A;  1YSC A;  4O4J B;  4DW1 A;  1YEW A;  4DR7 O;  2RNB A;  2LW7 A;  3CJH B;  4UCO A;  3ZS8 C;  1LNQ A;  1TUB B;  4O4J A;  1HWY A;  4O2A B;  3QO5 A;  1IZ3 A;  1I5Y A;  4R7C A;  1SS3 A;  1QR8 A;  2Q9L A;  2GUZ B;  3W7X A;  2QWO B;  5EBM C;  2DOS A;  3K08 A;  5LP6 A;  3GWO A;  3CC4 V;  2CH7 B;  1B3Q A;  2JGD A;  2JEU A;  1B06 A;  1S5L Z;  2KG7 B;  5KHG A;  3AG7 A;  3H1L H;  2VQF B;  2EIM B;  1YDX A;  4B3R B;  4DR4 B;  3SYP A;  3CB2 A;  1VQL V;  3D36 C;  3GWK C;  4MTO A;  1D5A A;  3CCE V;  1Q86 W;  2HFE C;  3NXS A;  4LF4 O;  1KP3 A;  1Q6I A;  5KHI A;  2QTS A;  1SZX A;  3F5T A;  3TJT A;  1BE3 H;  4BW9 A;  1T5E A;  3K5N A;  3K58 A;  4IIJ B;  3P3P A;  1BS3 A;  2RJZ A;  2EIN C;  3E83 A;  4IIJ A;  2M6Y A;  4LF5 O;  4I4T B;  1EN6 A;  2PI5 A;  4FFB B;  2FYU H;  2IU0 A;  1DF5 A;  1M56 B;  4IL6 Z;  5B1B B;  2FL4 A;  4I0X B;  4FFB A;  3JCZ A;  3RYI B;  4PA6 A;  2DYR C;  3UCS C;  2ZCE A;  4CC5 A;  2BOC C;  4I0X A;  2OT5 A;  1HNX B;  2WLI B;  3QO8 A;  2CGO A;  2Y48 A;  4JI7 B;  2PTM A;  1TA8 A;  5BMV A;  3QNE A;  3T2M A;  2HJF C;  4MS2 A;  3ASN B;  4CS4 A;  4PDM A;  2ZE8 A;  1W0K G;  1SQV H;  2XOK G;  4BIO A;  1XNR O;  3RYH A;  2EZO A;  3SJA C;  3FFQ A;  5EC1 C;  1WP7 A;  2A7W A;  2Q8V A;  3AG1 B;  3X2Q B;  4Z2W A;  1ZL8 A;  2CE4 A;  5B5E Z;  3CXH F;  3L71 H;  4GX1 A;  4GX5 A;  4FVM A;  4O4L B;  4TV9 B;  4FM2 A;  4XBF A;  4CH4 A;  1Y76 A;  4K8Z A;  2OIG A;  4TV9 A;  1I94 B;  4I55 A;  2PUS A;  3T1H O;  3JAW A;  4GCZ A;  3ABU A;  3K5L A;  1H8H G;  3F7Y C;  1R6T A;  5CBG A;  4UVB A;  1QCE A;  3K5M A;  4DK0 A;  1W2B U;  3FB8 C;  2Q6A A;  5CB4 A;  5GON B;  4PEL A;  2UXB O;  4O4I B;  1XL6 A;  5C8Y A;  5GON A;  3CCU V;  1RPO A;  1R3J C;  2GV9 A;  3OR6 C;  2XAS A;  3ASO B;  2ZE6 A;  2OTJ V;  4CBC A;  3L75 H;  2Q5Z A;  4Z1M G;  1VQN V;  3FB6 C;  4X9Q A;  4MVR A;  3KCX A;  1ZWI C;  2RDC A;  1N33 B;  5H2F Z;  2EIL B;  3CPW U;  1WLE A;  4HBN A;  5BR8 O;  2W0F C;  1H2N A;  3OD4 A;  3WB2 A;  4DXW A;  3E86 A;  1K4D C;  2RCV A;  3CSX A;  3EFF K;  2YIC A;  4YHH O;  2X0L A;  3TET A;  3BCC H;  4KHP O;  3ZJZ A;  4CH3 A;  1P7B A;  5B1A C;  3Q4H B;  4YJ2 B;  5DM6 V;  3CCL V;  3B77 A;  5KHH A;  1UFI A;  3Q4H A;  5EIB C;  5IDJ A;  5J2U B;  4JYA B;  3ZMV A;  4YJ2 A;  3JAL B;  4DV5 B;  4D7S A;  3ZED A;  5CA1 B;  4XDL A;  4DR5 O;  2QR4 A;  3JAL A;  4IT5 A;  3CRA A;  1BGY H;  2WA3 A;  1JVM A;  4X89 A;  1FKA O;  5CA1 A;  1MOF A;  3H9V A;  1ZLZ A;  2B5U A;  2XAQ A;  4JI8 O;  3A8T A;  4JI0 O;  5LHI A;  4DRX B;  4LWS A;  3T4Z A;  4JYY A;  4LH6 A;  4JZ2 A;  3ZMU A;  5LP6 C;  5IY5 C;  3G6B A;  1QLN A;  5B1N A;  4DRX A;  2IBZ H;  2R70 A;  4RQE A;  4WBN A;  4WFH A;  2ZR3 A;  5HFM A;  1K3E A;  3G67 A;  4JI4 O;  4DV4 O;  5LBQ A;  2F4V B;  3N2K B;  2QWQ B;  4JI1 B;  2EJ7 A;  1J5E O;  3N2K A;  1OHH G;  3L70 H;  1COW G;  3JAT B;  4J9Z B;  3OGI B;  4IHJ B;  4DV3 B;  1SQX H;  4UUJ C;  2ZM6 B;  4GZR B;  3JAT A;  4YJ3 B;  1HNZ O;  4JTD B;  1JQ0 A;  5H9C A;  2E74 B;  1S77 D;  4O2B A;  2CTW A;  1MG1 A;  3ICX A;  2JGU A;  4LNU B;  4RO2 A;  5IJ9 B;  1XBL A;  2F93 B;  2GTA A;  2UUB O;  3E2E A;  1M90 W;  3ABK C;  2B1G A;  5IJ9 A;  2Y0I A;  3BVO A;  5IWA B;  4RUE A;  3T4D A;  2BSK B;  4FIP C;  1W59 A;  4JI2 O;  5L3D A;  3FD9 A;  4OPA A;  3STZ C;  1KMI Z;  1XMO B;  1UPG A;  1YIJ V;  5EBW C;  4X1Y A;  4HZ3 A;  4UB6 Z;  1OCC B;  3EVK A;  4IGG A;  4GT1 A;  1F51 A;  1WPX A;  4WFB V;  4W4L A;  2VWJ A;  2LQT A;  2XAG A;  2JIZ G;  5LHG A;  5L3F A;  2N05 A;  1XMQ B;  3UKM A;  4DR6 O;  1WAZ A;  5EBL C;  2XHB A;  5ITZ B;  3KCY A;  1DGS A;  4JI6 B;  2ZE5 A;  2BTQ A;  1V54 C;  1SQF A;  4MVM A;  3VQX A;  5KMG B;  2JS3 A;  4NXM O;  2EZP A;  1IDS A;  3L9D A;  3OW2 U;  2AZ0 A;  2H94 A;  1AJP A;  4PDL A;  4F6E A;  2D2C B;  2RMK B;  4NB5 A;  3OM3 B;  1S5H C;  2JK5 C;  1GM8 A;  1DF4 A;  2DJV A;  1GRJ A;  1XHX A;  2HJD A;  1IVS A;  2UUB B;  1H38 A;  4CS2 A;  2QE7 G;  1FXK C;  1KP2 A;  3SDL A;  4XDK A;  1TVK B;  1N0N A;  4TV8 A;  2PF4 E;  3J7A U;  4UCU A;  4J41 A;  4P9P A;  1VQ5 V;  3I5D A;  1SQQ H;  2KKW A;  3ZX6 A;  2EX3 A;  2KSD A;  1XIL A;  4DR3 O;  2MK3 A;  3HKB A;  1KQS U;  2C2A A; 
#chains in the Genus database with same CATH homology
 1YSC A;  3JD3 A;  2XAJ A;  2EIN B;  4FK5 C;  4QE7 A;  1N8R W;  3CCM V;  3RVY A;  1PKX A;  1LNQ A;  5CBF A;  3I56 V;  1HWY A;  1FS0 G;  3OMI B;  1Q82 W;  3JYC A;  1OCO C;  2EIK B;  3QO5 A;  3CCQ V;  1M9N A;  4JTA B;  2YEV B;  1I5Y A;  2QTO A;  4R7C A;  5HFL A;  3W7U A;  1QR8 A;  4H33 A;  1GM7 A;  3W7X A;  5EBM C;  3B8M A;  2B1I A;  2YEV A;  3K08 A;  2QEX V;  3GWO A;  1H8E G;  4MSW C;  1V55 B;  2WLN A;  3CC4 V;  1M56 C;  5B1B C;  2JEU A;  4G2K A;  3CP1 A;  4G28 B;  1M57 C;  1Q7Y W;  4JYC A;  2DYS B;  1R6K A;  1VQM V;  3LSQ A;  3OEH G;  2M7W A;  1FXK A;  1YIT V;  2EIM B;  2NNU A;  2IJH A;  2HR3 A;  2NLJ C;  1AI4 A;  2PI4 A;  4HAM A;  3ABM B;  3AG2 C;  3SYP A;  1YJW V;  1VQL V;  3LDD A;  4XDJ A;  3SYO A;  3VOU A;  3E35 A;  3P32 A;  4MVO A;  2LP7 A;  5KUM A;  1K5Q A;  1VQ4 V;  3ASN C;  2Y69 B;  4MTO A;  3CCE V;  1Q86 W;  1VQK V;  2HFE C;  5L3B A;  2ATK C;  3NXS A;  2WLJ A;  3EHB B;  4R8C A;  4LP8 A;  1KP3 A;  5KA5 A;  3K03 A;  3LUT B;  2Q67 A;  3LDC A;  5H6Q A;  2R9I A;  3IFX A;  4WCE V;  2F43 G;  3AG1 C;  4JGS A;  3X2Q C;  1KEC A;  5LGU A;  4FJC C;  1OCO B;  3CME V;  3HB3 B;  3OFN G;  2EIN C;  3FYI B;  4MVU A;  3E83 A;  1YJ9 V;  1PL0 A;  3CD6 V;  1THZ A;  2PI5 A;  4JAS A;  2LFR A;  3SYQ A;  1ORQ C;  2WLL B;  2IU0 A;  1DF5 A;  1OCZ C;  4FPP A;  1M56 B;  2QM7 A;  3SPI A;  2EJR A;  5B1B B;  1BMF G;  4MTG A;  4U7O A;  1TUE B;  5KA6 A;  3JCZ A;  4PA6 A;  2DYR C;  2ZDI C;  4UXN A;  3UM7 A;  3ABT A;  3ZRV A;  4WF9 V;  2BOC C;  4OXS A;  2OT5 A;  2QKS A;  4WFE A;  1YHQ V;  1SER A;  2WLI B;  1GO3 F;  3QO8 A;  5KUK A;  2Y48 A;  4U7N A;  4JPR A;  3QNE A;  2DW4 A;  1K97 A;  4QPJ A;  3T2M A;  3AG2 B;  2HJF C;  2IJJ A;  4JAU A;  1AI6 A;  4H37 A;  2JEX A;  4MS2 A;  3ZMZ A;  1FXH A;  1OCR C;  3ASO C;  3RVZ A;  3SPJ A;  3ASN B;  4PDM A;  1VQ8 V;  4TT3 G;  1W0K G;  3OGC C;  2XOK G;  2EIM C;  3SJQ C;  1DTO A;  3D36 A;  3TCU A;  4N23 A;  1Y66 A;  2X6B A;  2WAM A;  1NH2 D;  2EZO A;  5EC1 C;  4MT8 A;  1CP9 A;  1K9M W;  4F4L A;  2P90 A;  3MHH C;  3AG1 B;  3X2Q B;  1AI5 A;  2EIL C;  3JD4 A;  1Y4M A;  4GX1 A;  4ZBM A;  4GX5 A;  1DLB A;  3FYE B;  2FTK A;  3PJS K;  4XBF A;  1S76 D;  3A0R A;  2HKO A;  4QPK A;  5B1A B;  4BIZ A;  3H01 A;  1YTF D;  3SPG A;  2DQ0 A;  3OUS A;  1K33 A;  4TSF G;  3R65 A;  1VQO V;  4LC1 A;  4KFM A;  1S0V A;  2V7Q G;  1EZJ A;  3MHS C;  4GCZ A;  3ABU A;  4J9Y B;  1H8H G;  3OAA G;  3K0D A;  1OCZ B;  2OCC C;  3F7Y C;  5C93 A;  3ZIA G;  4BAY A;  2Q68 A;  1K5S A;  1QR9 A;  5CBG A;  3JD1 A;  4UVB A;  4KUM A;  1QCE A;  3P30 A;  2AHY A;  1W2B U;  4JAV A;  2DYR B;  3FB8 C;  2Q6A A;  1NQT A;  3ABL C;  2WLM A;  2IW5 A;  2X6C A;  3FB5 C;  2H8P C;  4PEL A;  1K7D A;  2V1D A;  4QJF B;  4I5S A;  4MVS A;  5EK0 A;  2EBO A;  1XL6 A;  3LDE A;  3CCU V;  1RPO A;  1P4R A;  3OMN B;  1R3J C;  1OCR B;  5LGN A;  3OR6 C;  2XAS A;  1JPX A;  3ASO B;  4UV9 A;  2OTJ V;  4CBC A;  2Q69 A;  3K06 A;  1VQ6 V;  4Z1M G;  3IC7 A;  3ZN1 A;  2GSM B;  1MAB G;  5IYD O;  1VQN V;  2XAH A;  3CCJ V;  3ZCC A;  3E89 A;  3FB6 C;  4MVR A;  5GW7 A;  4RQF A;  5E1A C;  3W7S A;  3CC7 V;  1ZWI C;  1R3K C;  3ETD A;  3K0G A;  2EIL B;  1S3J A;  3CPW U;  3AEI A;  4WFF A;  1I5X A;  2W6J G;  1WLE A;  3LSS A;  3BEH A;  4PA4 A;  2P67 A;  1CPY A;  4JYB A;  3K79 A;  2W0F C;  4DXW A;  2QA4 V;  3E86 A;  1NVP B;  1K4D C;  4RUF A;  1J95 A;  2P6J A;  2JJ2 G;  4FMT A;  3EFF K;  4BIU A;  1AJN A;  3E8G A;  4P2Z A;  2OCC B;  4BW5 A;  1PNL A;  2X0L A;  5L3E A;  3TET A;  4G27 B;  3ZJZ A;  1P7B A;  1NR1 A;  5B1A C;  1F4M A;  1GMG A;  3VBB A;  3ZN0 A;  5L3G A;  5DM6 V;  1R3I C;  3ABL B;  3B77 A;  2XND G;  2HG5 C;  3F5W C;  3CCL V;  3K3W A;  4GX2 A;  3KG2 A;  4HYO A;  1EFR G;  4MTF A;  5B3S B;  1W0J G;  1ARO P;  5IDJ A;  1F23 A;  1E1Q G;  3ZMV A;  1YI2 V;  3SPH A;  3SYA A;  3DTU B;  4PA3 A;  1E79 G;  2WLL A;  1SRY A;  1GKF A;  4L87 A;  4XDL A;  4WFA V;  1JVM A;  4X89 A;  2X6A A;  1BHA A;  2WSS G;  1SZT A;  1MOF A;  3CMA V;  1RPR A;  2B5U A;  2XAQ A;  3STL C;  5B1O A;  1YJN V;  2ITD C;  4DO2 A;  5LHI A;  1PNK A;  4P30 A;  4GX0 A;  1NR7 A;  2WLI A;  4LBE C;  3T4Z A;  3AG3 B;  3CC2 V;  3ZMU A;  5L3C A;  5LGT A;  5IY5 C;  1QLN A;  1ROP A;  2WPD G;  5B1N A;  1R73 A;  4RQE A;  3G71 V;  1ENV A;  4WFH A;  5H6R A;  2ZR3 A;  5HFM A;  1K3E A;  2WLK A;  2JJ1 G;  2YSU B;  5EC2 C;  2Z3Y A;  5LBQ A;  2HLD G;  2EIJ C;  3F7V C;  2IH3 C;  4PDV A;  4MW3 A;  2HVK C;  5CN0 A;  1OZ0 A;  4I9W A;  1UJW B;  1OCC C;  3SYC A;  1OHH G;  1NKD A;  1COW G;  3GB7 C;  2HVJ C;  3AG4 C;  2GHY A;  4JTC B;  1JCH A;  4PA9 A;  5CMU A;  1AI7 A;  4J9Z B;  2A0L A;  1KD1 W;  1F4N A;  2R9R B;  4UUJ C;  1K4C C;  4UVC A;  1H2G A;  4YXW G;  3SPC A;  1K73 W;  4JTD B;  1V54 B;  1JQ0 A;  2D3O W;  5H9C A;  1MSW D;  1QBZ A;  1SES A;  3RBZ A;  1S77 D;  1GK9 A;  4LCU C;  2UXN A;  5IYB O;  2ZDI A;  5B3S C;  1MG1 A;  1G8M A;  4RO2 A;  4UV8 A;  3ZRW B;  2P7T C;  4MW8 A;  4PA7 A;  4CZZ A;  4UVA A;  5BZB A;  3HPL C;  3W7T A;  3OMA B;  1M90 W;  2ZD9 A;  3E2E A;  3ABK C;  3RW0 A;  2KB1 A;  2B1G A;  3JD0 A;  3ZRW A;  5IY5 B;  1QLE C;  4P9O A;  2IJI A;  2ZXW C;  4RUE A;  3T4D A;  2IU3 A;  1FXV A;  4FIP C;  3CCV V;  3CXC U;  4N21 A;  3ZMS A;  5L3D A;  3D3I A;  3AG3 C;  2XAF A;  3FKS G;  2IH1 C;  3STZ C;  1VQ9 V;  1FXK B;  2EIJ B;  1YIJ V;  5EBW C;  3WFV A;  1K8A W;  4R6Z A;  4MVQ A;  1AR1 B;  1L1F A;  4HZ3 A;  4EKW A;  2QM8 A;  2ZQM A;  1OCC B;  1QVF U;  4X8A A;  1S72 V;  3AG4 B;  2OTL V;  4GT1 A;  1G4Y B;  1F51 A;  1SET A;  1K92 A;  1WPX A;  4WFB V;  4R50 A;  4Q20 A;  1RM1 C;  1VQ7 V;  2XAG A;  1GM9 A;  2JIZ G;  1IXM A;  2CK3 G;  5CBH A;  5LHG A;  2A79 B;  5L3F A;  3TK1 A;  3UKM A;  1M1K W;  1JJ2 U;  2BOB C;  1KC8 W;  3OEE G;  1QVG U;  3IGA C;  5EBL C;  2K1E A;  5IYC O;  3W7W A;  4QE9 A;  1JX9 A;  1BL8 A;  4X88 A;  3OR7 C;  3WG7 C;  3ZRX A;  5LHH A;  4ASU G;  3M99 B;  1V54 C;  2ITC C;  3ABK B;  4MVM A;  1NVP D;  3I55 V;  1Q81 W;  1CEZ A;  3ML0 A;  2WLH A;  4KP4 A;  1QLE B;  4MTX A;  2EZP A;  1VQP V;  3BY6 A;  1KKD A;  2ZXW B;  3E8B A;  1NJI W;  3OW2 U;  1PNM A;  2X7R B;  2LFS A;  2H94 A;  1AJP A;  3B8N A;  4PDL A;  1GTO A;  3OM3 B;  1S5H C;  5DN6 G;  2EIK C;  2JK5 C;  4QNH B;  3CCR V;  1GM8 A;  3T1C A;  1DF4 A;  1NH2 B;  2AHZ A;  3MD0 A;  2DWD C;  3OUF A;  2WWW A;  1EBO A;  1M57 B;  2IJK A;  1NBM G;  4TWK A;  5FL7 G;  3ETG A;  1JOY A;  3ZRS A;  4ZKI A;  2JDI G;  4PDR A;  1H38 A;  2Z5U A;  1V55 C;  2QE7 G;  1AJQ A;  1E1R G;  1PD3 A;  2W6I G;  2ZR2 A;  2DQ3 A;  3ZMT A;  3G6E V;  1FXK C;  1R6N A;  2UXX A;  1YTF B;  1KP2 A;  1RM1 B;  4XDK A;  3ETE A;  3G4S V;  1BHB A;  3DGE A;  3K04 A;  3QO7 A;  4WFG A;  2DYS C;  5J9P C;  3JD2 A;  3E8F A;  3CCS V;  4QIW F;  5CA3 A;  4MVZ A;  3FB7 C;  1R3L C;  1FFT B;  1XL4 A;  3K9A A;  3OE7 G;  2A9H A;  4P9P A;  1VQ5 V;  3ABM C;  1K34 A;  3LNM B;  2DWE C;  3WG7 B;  4E2L A;  2Y69 C;  4JF3 A;  4RAI A;  2MK3 A;  1KQS U;  1B6Q A;  3CYO A;  2C2A A;  3E8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...