2IH1C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
100
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih1C00
3SYOA 2WLNA 4R8CA 2HJFC 2WLIA 3AG1C 4MTOA 2DWDC 4JTCB 3UKMA 3E83A 2P7TC 1M57C 3E8FA 4J9YB 4MSWC 4PA3A 3OGCC 4GX5A 2HFEC 3RVZA 2X6AA 3IGAC 4ZBMA 3SYCA 3T4ZA 1OCZC 4LP8A 4R7CA 2X6CA 2AHYA 3VOUA 4DXWA 3AG2C 1OCCC 4HZ3A 4PA9A 3STLC 3ZJZA 4RUEA 3AG4C 1P7BA 4MS2A 4X8AA 3ABMC 2QTOA 3SPIA 3R65A 3AG3C 3ASOC 1XL4A 4PDMA 4CBCA 3LDEA 5B3SC 1R3LC 2HG5C 5IY5C 3RBZA 3T1CA 5B1BC 2DWEC 2WLMA 4GX0A 1JVMA 4MVSA 3RW0A 4QNHB 1V54C 4PA7A 3F7VC 4MVRA 2K1EA 3K06A 3TETA 4QE7A 5CBGA 3GB7C 4XDKA 4P2ZA 3FB7C 5EK0A 2WLIB 2IH1C 3E89A 5CBHA 2WLLB 3X2QC 1K4DC 1ORQC 4MW3A 3LNMB 4XDLA 3SPCA 4MVQA 2QKSA 4JTAB 4RAIA 5EBWC 4WFFA 4WFGA 5EC2C 3E86A 3ABLC 4LBEC 3HPLC 3OUFA 1XL6A 2ITDC 2WLKA 2R9RB 2EIMC 2AHZA 3K0GA 4P9OA 4TWKA 3ZRSA 1R3IC 3F5WC 5J9PC 3FB8C 4R50A 5KUKA 1LNQA 3E8HA 3K04A 4H33A 1M56C 4MW8A 2YEVA 3SPGA 4RO2A 4I9WA 1BL8A 2H8PC 1OCRC 3OR6C 3SJQC 3LUTB 2ATKC 2OCCC 4MVUA 1G4YB 4MTFA 4RUFA 2A79B 4X89A 3TCUA 2Q6AA 2HVKC 3UM7A 1R3KC 4G27B 1J95A 2KB1A 3IFXA 4GX2A 3FB6C 4HYOA 1ZWIC 4GX1A 5EBMC 1KKDA 2ZXWC 3K03A 4P30A 3EFFK 4LCUC 3SPJA 2WLJA 3STZC 4PDLA 3RVYA 3LDCA 4EKWA 2Q67A 4JTDB 3E8GA 2W0FC 5CBFA 3K08A 4MTGA 3F7YC 4UUJC 4MVOA 3K0DA 4MVZA 2EIKC 3PJSK 2DYSC 4H37A 4WFHA 2DYRC 4P9PA 5EBLC 2WLLA 2JK5C 2IH3C 2ZD9A 1R3JC 1S5HC 4QE9A 4BW5A 2A9HA 3FB5C 2NLJC 1K4CC 2EILC 4PDVA 2BOCC 4G28B 5KUMA 5BZBA 2A0LA 2EINC 2Q69A 2HVJC 1QLEC 3LDDA 3E8BA 3OUSA 4KFMA 3SYAA 4MVMA 1V55C 2WLHA 2Q68A 3SYQA 5B1AC 2EIJC 3BEHA 3T2MA 3JYCA 4WFEA 3OR7C 3ABKC 3ASNC 4X88A 4R6ZA 4PA4A 4J9ZB 5E1AC 2X6BA 1OCOC 3T4DA 2ITCC 4F4LA 2Y69C 3WG7C 4XDJA 2BOBC 3KG2A 4PDRA 5EC1C 3SPHA 4PA6A 3SYPA 4OXSA
chains in the Genus database with same CATH superfamily
3SYOA 1B3QA 4TV9A 2HJFC 1JFFA 1I5YA 2DMXA 3T4ZA 3RVZA 4FK5C 3IGAC 5BR8B 3F5TA 3AG4B 3GWOA 3JALA 3AG4C 5KAFZ 1XEQA 3OW2U 2UUAB 1GKFA 4RQFA 4HAMA 1AR4A 4IGGA 4ZOLB 5B1BC 1HNWO 1K33A 1VF6C 1PKXA 4MVRA 2A3QA 3K06A 3TETA 1FPOA 2YXHA 2OT5A 1ORQC 4O4HA 1I5XA 3ZN1A 4DV7B 3N2GA 4YY3O 3ZEDA 2GUZB 3C3SA 4NXNB 5D5PA 4JI7O 1H2LA 1NBMG 5KAIZ 4J80A 4FZ0A 1XNRB 5JCOA 2LW7A 2F95B 1EFRG 4IL6Z 5ITZB 4GKJO 2YEVA 2Q6AA 1Q90D 1DLBA 5B1AB 2ETNA 1SQQH 2IU0A 1K8AW 1XMOO 2WLJA 3RT3C 4PDLA 1VEWA 4LF4O 3TGUH 3K5OA 1SC5B 4NTWA 3K08A 3CP1A 2GHYA 3B8MA 1KC8W 2R70A 1WLEA 2HR3A 4OX9B 4L8JA 4DYLA 2P22C 3H1JH 1FJGB 5C8YB 3DXRA 5KX5A 4JI4O 2FB5A 2JEUA 5K1PA 4PA4A 4DV6B 3BHPA 4F4LA 4U3JA 2PYLA 4K3AA 2ADPA 2YICA 3CCUV 4XBFA 3JSLA 1VF5B 1OCZB 4PA3A 4DV3B 2D2CB 2YIBA 2HFEC 1OCZC 4LF8B 3CXCU 1KUQA 1H2MA 2JJ2G 2XAQA 4WF9V 1NR7A 1XL4A 3CC4V 1BCCH 4MVSA 2FKXA 2QM4A 1EM1A 1G8MA 3KCYA 1AR1B 2ZKOA 2MW2B 4JI1O 5JJJB 3CPWU 5CBHA 3G4SV 3CC2V 5LGTA 3O65A 4JI6B 1ZL8A 2XAFA 4LBEC 2ITDC 2P4KA 3ZRSA 1AI5A 5LP6A 3BRCA 2UXDB 3DC6A 4F6RA 4X1IB 4A5UB 3A0RA 1US6A 4AI8A 1WNSA 1JR9A 4U3FH 1XDCA 4DUZO 1S5LZ 3OD4A 2H94A 2RNBA 3STZC 2Y69B 1XQ8A 4LF6B 2B1GA 2DYSB 4JI0O 4B3RB 4TUYA 2DYSC 3GWKC 1ZAUA 4W4LA 3OFNG 2ODMA 3HR0A 1VQ6V 2Q69A 4X1KB 3FAVB 1K5QA 4DRXA 2WLHA 2RJZA 3K79A 1R73A 5KLVH 3BY6A 1IBMO 2PI5A 1TVKA 1VQLV 3OEEG 4XDJA 1JPXA 4WFBV 2V7QG 1HW7A 2BE3A 3B40A 2P7TC 2JGDB 3P3NA 1IX9A 5CA0B 3SYCA 4UVCA 1M93A 4X20A 3CC7V 2ZNJA 3FYIB 2GTSA 2P6JA 1HNWB 1R3LC 3VQYA 1K3EA 5H2FZ 2QEXV 1SESA 1N32O 3JAMN 4FLVA 1VQOV 2YXYA 3BCCH 3QO8A 1PL0A 4EEQA 2YXLA 4TSFG 1F4MA 2Z5UA 2NN4A 4YY3B 4NR1A 1MG1A 1O9GA 5IYCO 1HR0O 4JI7B 5LYJA 1SETA 3ABLC 1QCEA 2EX3A 2XASA 4GKJB 1L1FA 4LF5O 2DW4A 1M56C 4FFBA 3SPGA 2CH7A 3LUTB 1GRJA 4X66O 2KB1A 4O4JA 5IE9A 1XMOB 3S3WA 4FLXA 4LF4B 2KQXA 1PNMA 1NI8A 3NXSA 2JS3A 4EB6B 2ZE7A 4H44B 4MTGA 4ZI7A 4MVZA 2P67A 4JI8O 5FNVB 3SJBC 1VQNV 2HEPA 4FLWA 2LO1A 4FZ1A 2A9HA 3FB5C 4I7ZB 3E35A 4LC1A 2QWOB 4JI4B 1IBKO 5D5QA 2Q68A 3ASNB 3T2MA 4N23A 4CS2A 3ASNC 4LNUA 5IDJA 2UUBO 1SQGA 1MA1A 5H6RA 4LFBO 3ZMUA 1AVMA 4TOIA 3RYFA 2DWDC 2OIEA 3E8FA 4DXWA 1K9MW 3IJ4A 2IJHA 3G6BA 1UPGA 4NB5A 1Y76B 4B7KA 3TK1A 2VS0A 5E79Z 3CCLV 4IYHA 3MDSA 5KHIA 2KSDA 5IWAO 3H01A 4PA7A 3VQVA 2R9IA 4JI1B 1IVSA 4K0KO 1RM1B 1OHHG 2X7RB 1ZTEA 2V4DA 1L0NH 1CXZB 4XDLA 3QTCA 1K5SA 2D3OW 1Q81W 2PY5A 1R3IC 1FKAO 3RYIA 2OCHA 2RCVA 4MW8A 4O4LA 2OCCB 2UU9B 1WB8A 2ATKC 2OCCC 3CRCA 4X89A 3Q4HB 4UCVA 2RN9A 4DUZB 1NQTA 2E74B 4JI0B 2NR5A 2W0FC 1I94O 2RDCA 2IH3C 1NKDA 2PYJA 2BOCC 1YZBA 3LDDA 3B4SA 4QPKA 1PL4A 2RQ6A 1S5JA 3DC5A 3D36A 1YTFB 1IBMB 1UFIA 3JYCA 4R6ZA 4MTXA 1JQ0A 3CXHF 3OMNB 2XOKG 3OTFA 4E4EA 1KQSU 5LL6Y 3ICXA 3L72H 1Q43A 5JH7A 1M57C 4H0LB 1P7GA 2LP7A 4ZBMA 5JJEB 3OT7A 1KMIZ 3ETEA 4FM2A 2F4VO 2QTOA 2EJ7A 4CBCA 5CA1A 3BVOA 1P49A 4B3TB 3VQWA 4QNHB 1M90W 3CRRA 4QE7A 4G2KA 1FYJA 4TV9B 1HR0B 1AB3A 2JJ1G 1JFFB 5J2UB 2XNDG 3OMAB 4LF8O 4RAIA 4UV8A 1QU7A 3JALB 4LF5B 4KP4A 1Z2GA 4JYYA 1LNQA 2F1MA 5GTIZ 3BAAA 1GN4A 4X66B 4MVUA 2A79B 3TCUA 3D3IA 5JVDA 1GN2A 1GO3F 3ZMTA 4AHCA 1R3KC 1A32A 1WP8A 1SA0A 4GX2A 3L71H 3K03A 4LCUC 1OCOB 1FXVA 1PM9A 4O4HB 3IC9A 3N2GB 3CCMV 2VQEO 4JI8B 4EFEA 1Y74A 4HBNA 3CSXA 1GAXA 5L3CA 1R3JC 4QE9A 4ZIBA 5JCOC 4UCSA 5KHJA 2HVJC 2YEVB 4FM1A 1IBKB 4OPHA 3OUSA 1W0JG 3UO3A 1FFXA 3OR7C 3BA8A 4QIWF 4LFBB 3KZIZ 4LF9O 3WG7C 4LF6O 3KG2A 5JJNB 1FXHA 1K73W 2EULA 3WU2Z 4O2AA 4J9YB 3QO7A 4B08A 1KP3A 3OM3B 3AG2B 4FFKA 3AG2C 2DQ0A 4PA9A 4O2BA 1MABG 5LA6A 3QVNA 2ZE5A 4CC6A 1NZ6A 3R65A 5EYPA 1TA8A 3H1HH 3DXRB 3TXSA 2HG5C 2YI9A 3DSQA 5KX5B 2CDYA 5IWAB 1JVMA 5KA6A 1V54B 3RN4A 1SS3A 4K0KB 1V54C 4U3JB 2K1EA 3HKBA 1BT8A 5H6QA 3RYCA 1VF7A 1JMKC 3AEIA 3ZHQA 2Y48A 3A0HZ 2HJDA 1JCHA 5JQGA 4WFFA 1L8DA 1SQBH 2Q0AA 3JSNA 3JD3A 3K0GA 4J10A 2ZINA 3I56V 4DO2A 2QA4V 3B77A 3D8CA 2W6JG 1NT2B 2ILMA 5A2QN 2XAJA 4JGSA 2YI8A 2P06A 1V55B 4I50A 4FLZA 1N0JA 1H2SB 4DR3B 4K35A 5GW7A 5EIBC 1DTOA 3ML0A 3ZHTA 2Q67A 3G6EV 1I94B 1ZL8B 5EZYA 5BXZA 2WLLA 3G71V 5LP6B 3CYOA 1Z5VA 5LP6C 4F6RB 2Q8VA 2YSUB 1DF4A 1XMQO 4FLYA 5B1AC 5IYDO 4QGPA 4YJ3A 1DK1A 5E1AC 2FTKA 1ZUQA 3HKEA 1Q8IA 2OWOA 2XAHA 3AK1A 4NXMO 4JAUA 4I5SA 2A7WA 4JYBA 3U10A 1L0LH 3I55V 4JTCB 1QHTA 4MSWC 2LFSA 1WP7A 4GZRB 2QDOA 1N36O 2F4VB 1Q3EA 3IAYA 4MS2A 4JYCA 2O57A 1SKVA 3ABTA 4NVPA 2QGNA 2F93B 4JAVA 3W7WA 4DRXB 2IJJA 3ZHRA 2F43G 3JD0A 2YIBD 4L87A 2Q4PA 1TVKB 1VQ9V 3APOA 3CRMA 1MSWD 2ZCEA 3CRQA 1HWYA 3FB7C 4JAAA 3QO5A 4WFAV 4MVQA 5EBWC 4UV9A 4X20B 4H13B 3E86A 3HPLC 2QE7G 2DOSA 3H9VA 5LMNB 2AHZA 1BMFG 2PUSA 3ZRVA 5EIBD 2FMLA 5AG2A 4J7JA 4CH3A 4ZHQA 3DGEA 3F5WC 5L3EA 4R50A 2K9PA 2WA3A 5IYBO 3SJQC 3SJCC 4DR5O 2OTJV 2HVKC 1SRYA 1T5EA 1QNMA 2KKWA 1SZTA 4GX1A 2NNUA 2VQEB 3LDCA 1IXMA 3N2KA 3B2EE 5LYJB 5CBFA 1GN6A 4YJ2A 3ETQA 2PTMA 5BMVA 1S0VA 1MNGA 1QR9A 1JJ2U 4W4KA 2UU9O 4FFBB 1PPJH 3J81N 2UXBO 4NTYA 2E75B 1EZJA 4LF9B 2FYUH 4O4JB 1BE3H 2ITCC 2Y69C 2OIGA 3FKSG 3A8TA 4I4TA 1AI6A 1FS0G 3W7SA 3J7AU 2GBOA 4ZI7B 3P32A 4CZZA 1RSOA 3H1IH 4X62O 3M99B 2IJIA 2RMKB 5TISZ 4HZ3A 5LGNA 2FL4A 1P7BA 3UCSC 5IYZA 4B3SO 4I55A 1XOUA 2HKOA 5HFLA 3T1CA 2LQTA 2ADQB 2ZE6A 2QWNB 4UCRA 4LNUB 3ZCCA 2LJ2A 1VQPV 4JZGA 5C8YA 3JARA 5CBGA 1CEZA 1WPBA 2BCCH 3RYFB 2HHHO 1K4DC 4BWAA 1HNZO 4DR7B 2M7WA 5IT9N 4TQDA 4WFGA 1NR1A 3OUFA 2WLKA 1R6NA 2BSKA 1P84F 1FXKA 2GSMB 5GTHZ 4JI3O 2ZR2A 5J9PC 5LHIA 5KUKA 2G38A 3B8NA 2AW9A 4B3TO 1D2DA 3SDLA 2OYQA 5KMGA 4G27B 1J95A 1G6UA 1S72V 3L73H 5EBMC 3MHHC 3U11A 2LGQA 3I5DA 3AG7A 1H2NA 1OZ0A 4DW0A 3SGIA 3F7YC 1PD3A 3PJSK 1AI4A 1YXBA 2AGAA 5DN6G 3ETDA 2JK5C 2B1IA 2XUMA 2NLJC 3FX7A 4PDVA 2E3CA 4O4LB 4ASUG 1XMQB 5KA5A 3T1HO 3M7MX 4DV5O 4Z2WA 1EN4A 4NXMB 2PZSA 2X6BA 3K9SA 1WA8A 3CHXA 3AG1B 2IJKA 4OXSA 3SYPA 4BIZA 4I0XA 3AG1C 4DW1A 2JS5A 1TUEB 1N36B 1OV9A 4E2LA 1AROP 1B06A 4R7CA 1M1KW 2X6CA 1WB7A 2P5OA 3J80N 5A9GA 3E22A 2Y0PA 4IHJA 4ABMA 2A06H 3RBZA 3SJAC 2DWEC 2WLMA 4HNAA 5FL7G 1FAFA 4DK1A 3ZRWA 3CJHA 1RFYA 5IJ0A 3FAVA 2UXXA 3K5NA 1HNXO 4FMTA 2GV9A 4P2ZA 2DE0X 2JIZG 4PHZA 5JH7B 2VRZA 5L3FA 5CA3A 4JTAB 2CE4A 1E1QG 1Y4MA 1F23A 5LXTA 4FLUA 1N33O 4FJCC 1W59A 5CA1B 4C7UA 4RO2A 2H8PC 4DR5B 1EZVH 1E79G 5LOVA 5HFMA 1RM1C 1O9HA 4RWUA 2ZXWB 2WWWA 5B5EZ 4X64O 2L35A 2ZXWC 4UVAA 1VQ5V 1N4CA 3RVYA 3SR2C 4EKWA 4JTDB 2PF4E 2CGNA 2HP8A 4U7OA 1AJPA 4DV2O 2ZDIA 5EBLC 1ZLZA 5BZBA 1R6KA 5H5NA 2UXBB 1DGSA 3WB2A 1K7DA 3OE7G 1MMMA 5JVDB 1SA0B 4DR3O 1RP3B 1WPXA 4B3MO 1FD9A 1N34O 4AILC 4KHPO 4CH4A 4O4IA 4PA6A 1S76D 1S77D 3UKMA 4X62B 1Y74B 3KKYA 3ZJZA 3O9OA 4DR6O 4X8AA 4B3SB 4K8ZA 5B3SB 3JATA 1XHXA 3ZIAG 5B3SC 3C3TA 1FFXB 2CTWA 3D3QA 3HKDA 4K8XA 1F4NA 4FLTA 3OTOB 2HHHB 5IJ9A 2XTAA 3IC7A 3E89A 1HNZB 2BTQA 5LHGA 3BFRA 4NKGB 2QKSA 4CH6A 2QR4A 3UT5A 4O2BB 3FD9A 5LA6B 4JI3B 2QM7A 5EYPB 3G80A 2L6LA 4JPRA 1OCRB 1B6QA 1OCRC 3CCQV 1BQZA 4MTFA 3R66A 5CB4A 2JRIA 1COWG 3EHBB 1VMGA 1Y76A 4YIOA 4BAYA 2MK3A 3HKBB 4TV8A 3IFXA 3RYCB 4DV0O 2Q5ZA 1Q7YW 1AJNA 4FIPC 1H2GA 1BSMA 3K9AA 3LSQA 4TT3G 3G67A 2Z0AA 3ABUA 4CC5A 4GLXA 5JQGB 3MHSC 5LMNO 5LMUO 1F7YA 4QPJA 4GT1A 4IIJA 1TGOA 2UXCB 1NTKH 3RYHA 2LFRA 4X1YA 1X59A 1WN7A 4BIUA 4GCZA 3E8BA 2Y4UA 3T1HB 3SYAA 4DV5B 4MVMA 2EIJB 2ZM6O 2EIJC 1LR1A 3BEHA 1WJZA 4I50B 1MOFA 1OCOC 1YHQV 1JJOA 5FPRA 4CS3A 4DR4O 4MTOA 2CTPA 4LWSA 2B9ZA 2W6IG 5EZYB 1M5IA 3ABMB 4WBNA 4OGQB 3ABMC 1YI2V 4B7EA 2IU3A 5C93A 2W0XA 2N74A 3CE2A 1KP2A 1S3JA 3JD4A 4YJ3B 2EJRA 4ZKIA 4UVBA 1HNXB 1YSCA 1TUBA 3HKEB 3W7XA 2DJVA 3BABA 3B09A 2Q7HA 4MW3A 3SPCA 4X65O 4DUYO 2EIMB 1GK9A 1E1RG 1N33B 1XL6A 2KG7A 2EIMC 1G1XB 3JAWA 2XAGA 2ZNIA 2M6YA 3CD6V 5FPOA 2UUCO 3K04A 4JI2B 3OGIB 3QG5A 2Q73A 4YHHB 1SQFA 1THZA 2Q7GA 4YXWG 3UM7A 5KHKA 1SQXH 4X64B 1AI7A 4DV4O 1BGYH 3SPJA 3ZHUA 3HB3B 3JAKA 4DR7O 5J2TA 1JA8A 3W7UA 4DV2B 5LBQA 5J2UA 4ZHQB 1S5HC 1Q6IA 1EBOA 3C90A 1PP9H 3WFVA 1V55C 1VQMV 2Q7EA 5B1BB 4KL1A 4B3MB 3HKCA 1Q6UA 1N34B 4KHPB 2ZE8A 3T4DA 1X4TA 2Z3YA 4CS4A 1Y66A 3EXAA 5L3GA 5EC1C 2HLDG 1XI1A 3MAQA 3N2KB 2WLIA 3JASA 4YJ2B 2LGWA 3E83A 1GM9A 4MT8A 3FFQA 5BMVB 2ZIMA 2QTSA 1IDSA 1BS3A 4DR6B 3VOUA 3STLC 4RUEA 1F51A 2F23A 1GTOA 1SQVH 2PI4A 3UO2A 3RW0A 3L70H 2IW5A 3AK3A 2JEXA 2ZQMA 4I4TB 4TUYB 3X2QB 3OAAG 3CCRV 4YIPA 4JF3A 1N8RW 3X2QC 1MZFA 1YDXA 3ZBHA 1RSOB 3QNEA 4UB8Z 4DK0A 3U0ZA 1FFTB 4GUNA 2ARHA 5IYZB 4D6TH 1BHAA 1R1BA 4I55B 3CMEV 1AP6A 1MSDA 1KKCA 1N0NA 2CAZC 4F6EA 1G4YB 4DV0B 3JARB 4J7ZA 5GONA 3T1YO 2YIAA 1H38A 3EFFK 1YVWA 1WAZA 1IURA 5LMUB 3K58A 1D5AA 1PNKA 4UCUA 2EIKB 4FVMA 2EIKC 4DV1O 4P9PA 5K1XA 2BSKB 1FXKB 5KUMA 1FXKC 2A0LA 1IZ3A 2ZM6B 4KFMA 4D7TA 3K59A 5KMGB 1VF6A 4ZOLA 2H3OA 5CMUA 2QSAA 4WFEA 3ZMSA 4X88A 1KU9A 4DR4B 1KECA 4PDRA 1VARA 3CCJV 1RPRA 1VQKV 3CMAV 4JYAO 1ROPA 2YUAA 1SERA 2JVDA 1W2BU 2X6AA 4NTXA 2LW1A 2GUZA 4LP8A 2CH7B 4GYCB 1XBLA 3SPIA 3OEHG 4DR2O 4RQEA 3P30A 5ITZA 4I9QA 1B04A 4BIOA 4JI5B 1NS1A 3AK2A 3CWBH 3L74H 5CN0A 1I7FA 1VP7A 1WA8B 2VQFO 4XDKA 4I0XB 5EK0A 1H2KA 4X65B 4DUYB 1NTMH 1NH2B 2CK3G 4PI0A 3E2EA 1NJIW 2PGGA 3K57A 4KUMA 1Q86W 3ZMVA 5DEDA 2UUCB 2DQ3A 3E22B 3WB0A 4IHJB 2CUGA 4HNAB 4JZ2A 3ZRWB 5B1OA 1JX9A 3CJHB 5IJ0B 2N04A 3UQ8A 3OTOO 4DV4B 4KXRA 3W7TA 3VBBA 2E5LO 2CTQA 2QWPB 1W0KG 4H37A 4WFHA 3ZMZA 3EVKA 1AR5A 1PNLA 5LXTB 2EILB 1GH6A 3CRAA 3APQA 2EINB 4AQYO 2EBOA 2EILC 1QLEB 3CCEV 2EINC 1Q82W 4FM0A 4JV5O 1U96A 1QLEC 2AZ0A 4WCEV 2CGOA 2OTLV 4J41A 5LOVB 4U7NA 3L75H 3RFRA 1GM8A 4J9ZB 1Q5OA 2EZOA 2DN9A 1HDJA 1CPYA 4CH5A 2QM8A 2WLNA 2X0LA 1H8EG 3OGCC 4GX5A 4TQFA 3RYIB 2UXCO 1Q6HA 2YS8A 1OCCB 4GKKO 2AHYA 3K5LA 2ZDIC 1OCCC 3ABLB 4BW9A 3ASOB 1VQ7V 3ASOC 1QR8A 2WA4A 4BR6A 4LFAO 1SF9A 3LDEA 3GVMA 4X1IA 1M56B 1NH2D 3CS5A 1NU1H 4LF7O 1I08A 5LGUA 1GMGA 4O4IB 4D7SA 3LSUA 1J5EO 3LNMB 4LH6A 1XNQO 5EC2C 3MD0A 3P3PA 4Q20A 4P9OA 4TWKA 4UXNA 3H1LH 1QVFU 2XT9A 3TJTA 3ZHVA 1Y6XA 2WPDG 2QKCA 3JATB 3D36C 5JWPA 4X1KA 3OR6C 1VQ4V 4DR1O 3HKDB 3T1YB 4J42A 1QLNA 4PD4F 1IBLO 3H1KH 2AXTZ 4PJ0Z 5IJ9B 2BTQB 2GTAA 2Y0IA 4JASA 1TAEA 2IBZH 1NTZH 1CP9A 1DF5A 1YITV 4DV1B 1Z5WA 2DYRB 4MVOA 1GM7A 2JGDA 3UT5B 5CA0A 2DYRC 1XILA 2ZD9A 4LFCO 4BW5A 3ZN0A 3THOA 1YIJV 4JI2O 1YCIA 4YHHO 2CTRA 3K3WA 5CB4B 3JD2A 1XREA 3N27A 4TV8B 2QWRB 5KHHA 3FYEB 1YJNV 4JYAB 3JCZA 1YEWA 1M9NA 2N05A 3NR7A 4R8CA 1XHZA 3BPZA 1VIBA 5L3DA 3ZX6A 2Y4TA 1HP8A 2C2AA 2JGUA 3CCSV 4FPPA 4IIJB 5BR8O 3RYHB 1LUVA 3QF7A 3AG3B 4X1YB 4DR2B 1EN6A 2B5UA 3AG3C 1P4RA 2UUAO 1QVGU 4GX0A 2E76B 2Q0OC 3VQXA 4OPAA 2JDIG 4LR3A 3DTUB 2VQFB 5DECA 1NVPB 2UXNA 4J11A 1K92A 2IH1C 4LWSB 1JOYA 3JCUZ 3OMIB 4J7KA 3CCVV 4EB6A 4DV7O 4WBNB 2R9RB 1AILA 5FNVA 4NXNO 1MZEA 4EFBA 1XNRO 3FB8C 1QBZA 3E8HA 4PI2A 1K34A 4H33A 1IXBA 4I9WA 1BL8A 3S3XA 2BTOA 3CX5F 4RUFA 1TUBB 3L9DA 1AP5A 1K97A 2QWQB 2R9AA 3FB6C 4HYOA 1ZWIC 4O2AB 2E5LB 4P30A 1KD1W 1R6TA 1GN3A 4Q6GA 3JD1A 2VWKA 4UUJC 2IM9A 2KG7B 3CB2A 3K0DA 5H9CA 1LUWA 3JAWB 2VWJA 1M57B 4AQYB 1SQPH 2P90A 3A0BZ 2YC0A 5B1NA 4JV5B 4G28B 4QJFB 3WB1A 1UJWB 1YJ9V 3ZRXA 2F66C 4X9QA 4OX9O 2YDEA 1FJGO 3ZHSA 3SYQA 5B66Z 1ZSPA 1RPOA 3CEIA 1N32B 4UCTA 4DV6O 2BOBC 2EZPA 2ZT9B 3JAKB 4N21A 5J2TB 5FLXN 2P4VA 4GKKB 2R72A 1VQ8V 4IT5A 4DV3O 2YIDA 3ETGA 1NVPD 2QKAA 4LFAB 3K5MA 1ENVA 5IY5B 1KYOF 4PDMA 5IY5C 1PV0A 1U97A 4LF7B 3HKCB 4IYIA 3Q4HA 1BHBA 3F7VC 1XUQA 4UB6Z 1J5EB 3GB7C 1OJHA 5L3BA 2WLIB 3JASB 2WLLB 1XNQB 1SZXA 2ZIOA 2WSSG 1QQCA 3BA9A 4ICGA 3KCXA 5KHGA 4JI6O 1KB9F 3M8AA 3TXQA 1YTFD 1EN5A 4JI5O 1BZKA 4DR1B 1YJWV 2V1DA 2UXDO 3RGBA 4UCOA 2GDSA 3RWRD 3A2FA 1H8HG 1IBLB 5LHHA 1ZX3A 1KKDA 2UUBB 2XHBA 3WG7B 5BY1A 4UFZA 4LH7A 3E8GA 2Q9LA 1Y67A 4LFCB 5DM6V 1BQ0A 4B3RO 4PV1B 1AJQA 4NYKA 1I0HA 1K4CC 4PELA 3LSSA 4Z1MG 1M4UA 4Z1VA 2QJ1A 1V9PA 3ABKB 1D5NA 2ZR3A 5GONB 3ABKC 3PN1A 2AZ2A 5F2VO 1KBHA 3ZS8C 2WAMA 3LNNA 3SPHA 1URFA 1YF2A
chains in the Genus database with same CATH topology
3SYOA 2HJFC 3AG1C 1I5YA 1TUEB 1M57C 1SERA 3T4ZA 4E2LA 1W2BU 3RVZA 2X6AA 3IGAC 2LP7A 4FK5C 4ZBMA 1AROP 4LP8A 4R7CA 1M1KW 2X6CA 3AG4B 3ETEA 3GWOA 3AG4C 2QTOA 3OW2U 3SPIA 3OEHG 1GKFA 4RQFA 4CBCA 4RQEA 4HAMA 3P30A 3RBZA 5B1BC 2DWEC 2WLMA 5FL7G 1K33A 3ZRWA 4QNHB 1M90W 1PKXA 4MVRA 2UXXA 3K06A 3TETA 4QE7A 4G2KA 4FMTA 5CN0A 4XDKA 4P2ZA 5EK0A 2JIZG 2JJ1G 2OT5A 1ORQC 1I5XA 2XNDG 3OMAB 3ZN1A 5L3FA 5CA3A 4JTAB 4RAIA 1NH2B 2CK3G 1E1QG 1Y4MA 3E2EA 4UV8A 1NJIW 1NBMG 1F23A 4KUMA 1Q86W 3ZMVA 4FJCC 4KP4A 2DQ3A 1EFRG 1LNQA 2YEVA 4RO2A 2H8PC 4MVUA 5B1OA 3ZRWB 1JX9A 2A79B 3TCUA 3D3IA 1GO3F 2Q6AA 3ZMTA 1E79G 1R3KC 5HFMA 1RM1C 1DLBA 4GX2A 5B1AB 2ZXWB 2WWWA 3W7TA 1K8AW 2IU0A 2ZXWC 3K03A 4UVAA 1VQ5V 3VBBA 4LCUC 1OCOB 2WLJA 1FXVA 4PDLA 3RVYA 4EKWA 4JTDB 3CCMV 3K08A 3CP1A 4U7OA 1W0KG 2GHYA 1AJPA 3B8MA 4H37A 4WFHA 3ZMZA 1PNLA 2ZDIA 5EBLC 5L3CA 1KC8W 2EILB 1R3JC 4QE9A 1WLEA 2EINB 2EBOA 2EILC 1QLEB 2HR3A 5BZBA 3CCEV 2EINC 1Q82W 1R6KA 2HVJC 2YEVB 1QLEC 3OUSA 1K7DA 4WCEV 3OE7G 2OTLV 1W0JG 4U7NA 1GM8A 2JEUA 3OR7C 4PA4A 4J9ZB 4QIWF 1WPXA 4F4LA 2EZOA 3WG7C 3KG2A 3CCUV 1CPYA 4PA6A 4XBFA 1S76D 2QM8A 2WLNA 1FXHA 1K73W 1S77D 3UKMA 1OCZB 2X0LA 1H8EG 3QO7A 4J9YB 1KP3A 3OGCC 2HFEC 3OM3B 4GX5A 3ZJZA 3AG2B 1OCZC 3CXCU 1OCCB 2AHYA 3AG2C 2JJ2G 2ZDIC 2DQ0A 1OCCC 4PA9A 2XAQA 3ABLB 1MABG 1NR7A 3ASOB 4X8AA 4WF9V 1VQ7V 3R65A 5B3SB 3ASOC 1XL4A 1QR8A 3LDEA 3ZIAG 5B3SC 2HG5C 3CC4V 1JVMA 1M56B 4MVSA 5KA6A 1V54B 1NH2D 1V54C 1F4NA 1G8MA 2K1EA 1AR1B 5H6QA 5LGUA 1GMGA 3AEIA 3CPWU 2Y48A 3IC7A 3E89A 5CBHA 5LHGA 3G4SV 3LNMB 3CC2V 1JCHA 5LGTA 2QKSA 4WFFA 5EC2C 3MD0A 2XAFA 4LBEC 2ITDC 4Q20A 3JD3A 3K0GA 4P9OA 4TWKA 4UXNA 3ZRSA 1QVFU 2QM7A 1AI5A 3I56V 4DO2A 2QA4V 2WPDG 3B77A 4JPRA 2W6JG 1OCRB 1B6QA 3OR6C 2XAJA 1OCRC 4JGSA 3CCQV 3A0RA 4MTFA 1VQ4V 1COWG 3EHBB 4BAYA 1QLNA 1V55B 2MK3A 3IFXA 1Q7YW 1AJNA 4FIPC 5GW7A 1DTOA 1H2GA 2H94A 3STZC 3ML0A 4JASA 2Y69B 3K9AA 3LSQA 2Q67A 3G6EV 4TT3G 2B1GA 1CP9A 1DF5A 1YITV 3ABUA 2DYSB 3MHSC 2DYRB 4MVOA 4GT1A 1GM7A 4QPJA 4PA3A 2DYSC 2DYRC 3OFNG 2WLLA 3G71V 2ZD9A 1VQ6V 4BW5A 2LFRA 3ZN0A 3CYOA 1YIJV 2Q69A 4BIUA 4GCZA 3E8BA 3K3WA 1K5QA 2YSUB 3SYAA 1DF4A 4MVMA 2EIJB 2WLHA 3JD2A 3K79A 5B1AC 2EIJC 5IYDO 3BEHA 1R73A 3BY6A 5E1AC 2PI5A 1MOFA 2FTKA 3FYEB 1OCOC 1VQLV 1YHQV 2XAHA 3OEEG 4XDJA 1YJNV 4JAUA 3JCZA 1JPXA 1M9NA 4I5SA 2V7QG 4JYBA 4WFBV 4R8CA 3I55V 4MTOA 4JTCB 5L3DA 2LFSA 2P7TC 4MSWC 2C2AA 2W6IG 3CCSV 4FPPA 3SYCA 4UVCA 3CC7V 3ABMB 3AG3B 4MS2A 3ABMC 1YI2V 4JYCA 2B5UA 3ABTA 3FYIB 3AG3C 2IU3A 4JAVA 2P6JA 5C93A 3W7WA 1KP2A 1R3LC 2IJJA 2F43G 1P4RA 1K3EA 3JD0A 1QVGU 4L87A 2QEXV 1S3JA 4GX0A 1SESA 3JD4A 2EJRA 4ZKIA 4UVBA 1VQOV 1YSCA 2JDIG 3W7XA 1VQ9V 3QO8A 3DTUB 1PL0A 1NVPB 1MSWD 2UXNA 1HWYA 4TSFG 1K92A 1F4MA 2Z5UA 3FB7C 2IH1C 3QO5A 1JOYA 1MG1A 4MW3A 5IYCO 3OMIB 3SPCA 4WFAV 4MVQA 5EBWC 3CCVV 4UV9A 1SETA 2EIMB 3E86A 3ABLC 1GK9A 1E1RG 3HPLC 1XL6A 2QE7G 1QCEA 2EIMC 2AHZA 2R9RB 1BMFG 2XAGA 3ZRVA 2XASA 3DGEA 3F5WC 1L1FA 5L3EA 3FB8C 4R50A 2DW4A 1QBZA 3CD6V 3E8HA 3K04A 1K34A 1M56C 4H33A 3SPGA 5IYBO 4I9WA 1BL8A 3SJQC 3LUTB 4RUFA 1THZA 4YXWG 3UM7A 2HVKC 1SRYA 2OTJV 1K97A 2KB1A 1AI7A 3FB6C 4HYOA 1SZTA 1ZWIC 2NNUA 4GX1A 4P30A 1KD1W 3SPJA 3HB3B 3LDCA 1IXMA 1PNMA 3NXSA 3JD1A 5CBFA 3W7UA 4MTGA 4UUJC 3K0DA 2P67A 4MVZA 5H9CA 5LBQA 1S0VA 1M57B 1VQNV 2P90A 1S5HC 5B1NA 1QR9A 2A9HA 3FB5C 1JJ2U 3E35A 4G28B 1EBOA 4QJFB 1UJWB 1YJ9V 3ZRXA 4LC1A 3WFVA 1V55C 1EZJA 2Q68A 3ASNB 1VQMV 3SYQA 3T2MA 4N23A 5B1BB 3ASNC 1RPOA 5IDJA 3T4DA 2ITCC 2Z3YA 2Y69C 1Y66A 5H6RA 2BOBC 2EZPA 5L3GA 5EC1C 2HLDG 3FKSG 4N21A 3ZMUA 1AI6A 1FS0G 2WLIA 3W7SA 2DWDC 3E83A 3E8FA 1GM9A 3P32A 4MT8A 4CZZA 1VQ8V 3M99B 2IJIA 3ETGA 3VOUA 4DXWA 1K9MW 4HZ3A 5LGNA 2IJHA 3STLC 4RUEA 1F51A 1NVPD 1P7BA 1ENVA 5IY5B 3TK1A 1GTOA 4PDMA 2HKOA 5IY5C 5HFLA 3CCLV 3T1CA 3SYPA 2PI4A 3RW0A 3ZCCA 3H01A 2IW5A 4PA7A 1VQPV 1BHBA 3F7VC 2JEXA 2R9IA 2ZQMA 5CBGA 1OHHG 1RM1B 1CEZA 3GB7C 2X7RB 3X2QB 5L3BA 3OAAG 2WLIB 3CCRV 4JF3A 1N8RW 2WLLB 3X2QC 1K4DC 4XDLA 1K5SA 2WSSG 2M7WA 2D3OW 3QNEA 4WFGA 1NR1A 3OUFA 1Q81W 2WLKA 1FFTB 1R6NA 1YTFD 1R3IC 1FXKA 2GSMB 1BHAA 2ZR2A 5J9PC 5LHIA 3CMEV 5KUKA 3B8NA 4MW8A 2OCCB 1YJWV 2V1DA 2ATKC 2OCCC 1G4YB 4X89A 1H8HG 4G27B 5LHHA 1NQTA 1J95A 1S72V 1H38A 5EBMC 1KKDA 3MHHC 3EFFK 3WG7B 1OZ0A 3E8GA 1PNKA 2W0FC 2EIKB 4OXSA 3F7YC 1PD3A 2EIKC 3PJSK 1AI4A 5DM6V 5DN6G 4P9PA 3ETDA 2JK5C 1AJQA 2B1IA 1FXKB 2IH3C 1NKDA 2NLJC 1K4CC 4PDVA 4PELA 1FXKC 2BOCC 3LSSA 5KUMA 2A0LA 4ASUG 3LDDA 4Z1MG 4QPKA 4KFMA 5KA5A 3D36A 3ABKB 1YTFB 5CMUA 2ZR3A 3JYCA 4WFEA 3ABKC 3ZMSA 4X88A 4R6ZA 4MTXA 2X6BA 1JQ0A 3OMNB 1KECA 4PDRA 2XOKG 2WAMA 1RPRA 3SPHA 3CCJV 1VQKV 3AG1B 3CMAV 2IJKA 1ROPA 1KQSU 4BIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYO A;  2WLN A;  4R8C A;  2HJF C;  2WLI A;  3AG1 C;  4MTO A;  2DWD C;  4JTC B;  3UKM A;  3E83 A;  2P7T C;  1M57 C;  3E8F A;  4J9Y B;  4MSW C;  4PA3 A;  3OGC C;  4GX5 A;  2HFE C;  3RVZ A;  2X6A A;  3IGA C;  4ZBM A;  3SYC A;  3T4Z A;  1OCZ C;  4LP8 A;  4R7C A;  2X6C A;  2AHY A;  3VOU A;  4DXW A;  3AG2 C;  1OCC C;  4HZ3 A;  4PA9 A;  3STL C;  3ZJZ A;  4RUE A;  3AG4 C;  1P7B A;  4MS2 A;  4X8A A;  3ABM C;  2QTO A;  3SPI A;  3R65 A;  3AG3 C;  3ASO C;  1XL4 A;  4PDM A;  4CBC A;  3LDE A;  5B3S C;  1R3L C;  2HG5 C;  5IY5 C;  3RBZ A;  3T1C A;  5B1B C;  2DWE C;  2WLM A;  4GX0 A;  1JVM A;  4MVS A;  3RW0 A;  4QNH B;  1V54 C;  4PA7 A;  3F7V C;  4MVR A;  2K1E A;  3K06 A;  3TET A;  4QE7 A;  5CBG A;  3GB7 C;  4XDK A;  4P2Z A;  3FB7 C;  5EK0 A;  2WLI B;  2IH1 C;  3E89 A;  5CBH A;  2WLL B;  3X2Q C;  1K4D C;  1ORQ C;  4MW3 A;  3LNM B;  4XDL A;  3SPC A;  4MVQ A;  2QKS A;  4JTA B;  4RAI A;  5EBW C;  4WFF A;  4WFG A;  5EC2 C;  3E86 A;  3ABL C;  4LBE C;  3HPL C;  3OUF A;  1XL6 A;  2ITD C;  2WLK A;  2R9R B;  2EIM C;  2AHZ A;  3K0G A;  4P9O A;  4TWK A;  3ZRS A;  1R3I C;  3F5W C;  5J9P C;  3FB8 C;  4R50 A;  5KUK A;  1LNQ A;  3E8H A;  3K04 A;  4H33 A;  1M56 C;  4MW8 A;  2YEV A;  3SPG A;  4RO2 A;  4I9W A;  1BL8 A;  2H8P C;  1OCR C;  3OR6 C;  3SJQ C;  3LUT B;  2ATK C;  2OCC C;  4MVU A;  1G4Y B;  4MTF A;  4RUF A;  2A79 B;  4X89 A;  3TCU A;  2Q6A A;  2HVK C;  3UM7 A;  1R3K C;  4G27 B;  1J95 A;  2KB1 A;  3IFX A;  4GX2 A;  3FB6 C;  4HYO A;  1ZWI C;  4GX1 A;  5EBM C;  1KKD A;  2ZXW C;  3K03 A;  4P30 A;  3EFF K;  4LCU C;  3SPJ A;  2WLJ A;  3STZ C;  4PDL A;  3RVY A;  3LDC A;  4EKW A;  2Q67 A;  4JTD B;  3E8G A;  2W0F C;  5CBF A;  3K08 A;  4MTG A;  3F7Y C;  4UUJ C;  4MVO A;  3K0D A;  4MVZ A;  2EIK C;  3PJS K;  2DYS C;  4H37 A;  4WFH A;  2DYR C;  4P9P A;  5EBL C;  2WLL A;  2JK5 C;  2IH3 C;  2ZD9 A;  1R3J C;  1S5H C;  4QE9 A;  4BW5 A;  2A9H A;  3FB5 C;  2NLJ C;  1K4C C;  2EIL C;  4PDV A;  2BOC C;  4G28 B;  5KUM A;  5BZB A;  2A0L A;  2EIN C;  2Q69 A;  2HVJ C;  1QLE C;  3LDD A;  3E8B A;  3OUS A;  4KFM A;  3SYA A;  4MVM A;  1V55 C;  2WLH A;  2Q68 A;  3SYQ A;  5B1A C;  2EIJ C;  3BEH A;  3T2M A;  3JYC A;  4WFE A;  3OR7 C;  3ABK C;  3ASN C;  4X88 A;  4R6Z A;  4PA4 A;  4J9Z B;  5E1A C;  2X6B A;  1OCO C;  3T4D A;  2ITC C;  4F4L A;  2Y69 C;  3WG7 C;  4XDJ A;  2BOB C;  3KG2 A;  4PDR A;  5EC1 C;  3SPH A;  4PA6 A;  3SYP A;  4OXS A; 
#chains in the Genus database with same CATH topology
 3SYO A;  1B3Q A;  4TV9 A;  2HJF C;  1JFF A;  1I5Y A;  2DMX A;  3T4Z A;  3RVZ A;  4FK5 C;  3IGA C;  5BR8 B;  3F5T A;  3AG4 B;  3GWO A;  3JAL A;  3AG4 C;  5KAF Z;  1XEQ A;  3OW2 U;  2UUA B;  1GKF A;  4RQF A;  4HAM A;  1AR4 A;  4IGG A;  4ZOL B;  5B1B C;  1HNW O;  1K33 A;  1VF6 C;  1PKX A;  4MVR A;  2A3Q A;  3K06 A;  3TET A;  1FPO A;  2YXH A;  2OT5 A;  1ORQ C;  4O4H A;  1I5X A;  3ZN1 A;  4DV7 B;  3N2G A;  4YY3 O;  3ZED A;  2GUZ B;  3C3S A;  4NXN B;  5D5P A;  4JI7 O;  1H2L A;  1NBM G;  5KAI Z;  4J80 A;  4FZ0 A;  1XNR B;  5JCO A;  2LW7 A;  2F95 B;  1EFR G;  4IL6 Z;  5ITZ B;  4GKJ O;  2YEV A;  2Q6A A;  1Q90 D;  1DLB A;  5B1A B;  2ETN A;  1SQQ H;  2IU0 A;  1K8A W;  1XMO O;  2WLJ A;  3RT3 C;  4PDL A;  1VEW A;  4LF4 O;  3TGU H;  3K5O A;  1SC5 B;  4NTW A;  3K08 A;  3CP1 A;  2GHY A;  3B8M A;  1KC8 W;  2R70 A;  1WLE A;  2HR3 A;  4OX9 B;  4L8J A;  4DYL A;  2P22 C;  3H1J H;  1FJG B;  5C8Y B;  3DXR A;  5KX5 A;  4JI4 O;  2FB5 A;  2JEU A;  5K1P A;  4PA4 A;  4DV6 B;  3BHP A;  4F4L A;  4U3J A;  2PYL A;  4K3A A;  2ADP A;  2YIC A;  3CCU V;  4XBF A;  3JSL A;  1VF5 B;  1OCZ B;  4PA3 A;  4DV3 B;  2D2C B;  2YIB A;  2HFE C;  1OCZ C;  4LF8 B;  3CXC U;  1KUQ A;  1H2M A;  2JJ2 G;  2XAQ A;  4WF9 V;  1NR7 A;  1XL4 A;  3CC4 V;  1BCC H;  4MVS A;  2FKX A;  2QM4 A;  1EM1 A;  1G8M A;  3KCY A;  1AR1 B;  2ZKO A;  2MW2 B;  4JI1 O;  5JJJ B;  3CPW U;  5CBH A;  3G4S V;  3CC2 V;  5LGT A;  3O65 A;  4JI6 B;  1ZL8 A;  2XAF A;  4LBE C;  2ITD C;  2P4K A;  3ZRS A;  1AI5 A;  5LP6 A;  3BRC A;  2UXD B;  3DC6 A;  4F6R A;  4X1I B;  4A5U B;  3A0R A;  1US6 A;  4AI8 A;  1WNS A;  1JR9 A;  4U3F H;  1XDC A;  4DUZ O;  1S5L Z;  3OD4 A;  2H94 A;  2RNB A;  3STZ C;  2Y69 B;  1XQ8 A;  4LF6 B;  2B1G A;  2DYS B;  4JI0 O;  4B3R B;  4TUY A;  2DYS C;  3GWK C;  1ZAU A;  4W4L A;  3OFN G;  2ODM A;  3HR0 A;  1VQ6 V;  2Q69 A;  4X1K B;  3FAV B;  1K5Q A;  4DRX A;  2WLH A;  2RJZ A;  3K79 A;  1R73 A;  5KLV H;  3BY6 A;  1IBM O;  2PI5 A;  1TVK A;  1VQL V;  3OEE G;  4XDJ A;  1JPX A;  4WFB V;  2V7Q G;  1HW7 A;  2BE3 A;  3B40 A;  2P7T C;  2JGD B;  3P3N A;  1IX9 A;  5CA0 B;  3SYC A;  4UVC A;  1M93 A;  4X20 A;  3CC7 V;  2ZNJ A;  3FYI B;  2GTS A;  2P6J A;  1HNW B;  1R3L C;  3VQY A;  1K3E A;  5H2F Z;  2QEX V;  1SES A;  1N32 O;  3JAM N;  4FLV A;  1VQO V;  2YXY A;  3BCC H;  3QO8 A;  1PL0 A;  4EEQ A;  2YXL A;  4TSF G;  1F4M A;  2Z5U A;  2NN4 A;  4YY3 B;  4NR1 A;  1MG1 A;  1O9G A;  5IYC O;  1HR0 O;  4JI7 B;  5LYJ A;  1SET A;  3ABL C;  1QCE A;  2EX3 A;  2XAS A;  4GKJ B;  1L1F A;  4LF5 O;  2DW4 A;  1M56 C;  4FFB A;  3SPG A;  2CH7 A;  3LUT B;  1GRJ A;  4X66 O;  2KB1 A;  4O4J A;  5IE9 A;  1XMO B;  3S3W A;  4FLX A;  4LF4 B;  2KQX A;  1PNM A;  1NI8 A;  3NXS A;  2JS3 A;  4EB6 B;  2ZE7 A;  4H44 B;  4MTG A;  4ZI7 A;  4MVZ A;  2P67 A;  4JI8 O;  5FNV B;  3SJB C;  1VQN V;  2HEP A;  4FLW A;  2LO1 A;  4FZ1 A;  2A9H A;  3FB5 C;  4I7Z B;  3E35 A;  4LC1 A;  2QWO B;  4JI4 B;  1IBK O;  5D5Q A;  2Q68 A;  3ASN B;  3T2M A;  4N23 A;  4CS2 A;  3ASN C;  4LNU A;  5IDJ A;  2UUB O;  1SQG A;  1MA1 A;  5H6R A;  4LFB O;  3ZMU A;  1AVM A;  4TOI A;  3RYF A;  2DWD C;  2OIE A;  3E8F A;  4DXW A;  1K9M W;  3IJ4 A;  2IJH A;  3G6B A;  1UPG A;  4NB5 A;  1Y76 B;  4B7K A;  3TK1 A;  2VS0 A;  5E79 Z;  3CCL V;  4IYH A;  3MDS A;  5KHI A;  2KSD A;  5IWA O;  3H01 A;  4PA7 A;  3VQV A;  2R9I A;  4JI1 B;  1IVS A;  4K0K O;  1RM1 B;  1OHH G;  2X7R B;  1ZTE A;  2V4D A;  1L0N H;  1CXZ B;  4XDL A;  3QTC A;  1K5S A;  2D3O W;  1Q81 W;  2PY5 A;  1R3I C;  1FKA O;  3RYI A;  2OCH A;  2RCV A;  4MW8 A;  4O4L A;  2OCC B;  2UU9 B;  1WB8 A;  2ATK C;  2OCC C;  3CRC A;  4X89 A;  3Q4H B;  4UCV A;  2RN9 A;  4DUZ B;  1NQT A;  2E74 B;  4JI0 B;  2NR5 A;  2W0F C;  1I94 O;  2RDC A;  2IH3 C;  1NKD A;  2PYJ A;  2BOC C;  1YZB A;  3LDD A;  3B4S A;  4QPK A;  1PL4 A;  2RQ6 A;  1S5J A;  3DC5 A;  3D36 A;  1YTF B;  1IBM B;  1UFI A;  3JYC A;  4R6Z A;  4MTX A;  1JQ0 A;  3CXH F;  3OMN B;  2XOK G;  3OTF A;  4E4E A;  1KQS U;  5LL6 Y;  3ICX A;  3L72 H;  1Q43 A;  5JH7 A;  1M57 C;  4H0L B;  1P7G A;  2LP7 A;  4ZBM A;  5JJE B;  3OT7 A;  1KMI Z;  3ETE A;  4FM2 A;  2F4V O;  2QTO A;  2EJ7 A;  4CBC A;  5CA1 A;  3BVO A;  1P49 A;  4B3T B;  3VQW A;  4QNH B;  1M90 W;  3CRR A;  4QE7 A;  4G2K A;  1FYJ A;  4TV9 B;  1HR0 B;  1AB3 A;  2JJ1 G;  1JFF B;  5J2U B;  2XND G;  3OMA B;  4LF8 O;  4RAI A;  4UV8 A;  1QU7 A;  3JAL B;  4LF5 B;  4KP4 A;  1Z2G A;  4JYY A;  1LNQ A;  2F1M A;  5GTI Z;  3BAA A;  1GN4 A;  4X66 B;  4MVU A;  2A79 B;  3TCU A;  3D3I A;  5JVD A;  1GN2 A;  1GO3 F;  3ZMT A;  4AHC A;  1R3K C;  1A32 A;  1WP8 A;  1SA0 A;  4GX2 A;  3L71 H;  3K03 A;  4LCU C;  1OCO B;  1FXV A;  1PM9 A;  4O4H B;  3IC9 A;  3N2G B;  3CCM V;  2VQE O;  4JI8 B;  4EFE A;  1Y74 A;  4HBN A;  3CSX A;  1GAX A;  5L3C A;  1R3J C;  4QE9 A;  4ZIB A;  5JCO C;  4UCS A;  5KHJ A;  2HVJ C;  2YEV B;  4FM1 A;  1IBK B;  4OPH A;  3OUS A;  1W0J G;  3UO3 A;  1FFX A;  3OR7 C;  3BA8 A;  4QIW F;  4LFB B;  3KZI Z;  4LF9 O;  3WG7 C;  4LF6 O;  3KG2 A;  5JJN B;  1FXH A;  1K73 W;  2EUL A;  3WU2 Z;  4O2A A;  4J9Y B;  3QO7 A;  4B08 A;  1KP3 A;  3OM3 B;  3AG2 B;  4FFK A;  3AG2 C;  2DQ0 A;  4PA9 A;  4O2B A;  1MAB G;  5LA6 A;  3QVN A;  2ZE5 A;  4CC6 A;  1NZ6 A;  3R65 A;  5EYP A;  1TA8 A;  3H1H H;  3DXR B;  3TXS A;  2HG5 C;  2YI9 A;  3DSQ A;  5KX5 B;  2CDY A;  5IWA B;  1JVM A;  5KA6 A;  1V54 B;  3RN4 A;  1SS3 A;  4K0K B;  1V54 C;  4U3J B;  2K1E A;  3HKB A;  1BT8 A;  5H6Q A;  3RYC A;  1VF7 A;  1JMK C;  3AEI A;  3ZHQ A;  2Y48 A;  3A0H Z;  2HJD A;  1JCH A;  5JQG A;  4WFF A;  1L8D A;  1SQB H;  2Q0A A;  3JSN A;  3JD3 A;  3K0G A;  4J10 A;  2ZIN A;  3I56 V;  4DO2 A;  2QA4 V;  3B77 A;  3D8C A;  2W6J G;  1NT2 B;  2ILM A;  5A2Q N;  2XAJ A;  4JGS A;  2YI8 A;  2P06 A;  1V55 B;  4I50 A;  4FLZ A;  1N0J A;  1H2S B;  4DR3 B;  4K35 A;  5GW7 A;  5EIB C;  1DTO A;  3ML0 A;  3ZHT A;  2Q67 A;  3G6E V;  1I94 B;  1ZL8 B;  5EZY A;  5BXZ A;  2WLL A;  3G71 V;  5LP6 B;  3CYO A;  1Z5V A;  5LP6 C;  4F6R B;  2Q8V A;  2YSU B;  1DF4 A;  1XMQ O;  4FLY A;  5B1A C;  5IYD O;  4QGP A;  4YJ3 A;  1DK1 A;  5E1A C;  2FTK A;  1ZUQ A;  3HKE A;  1Q8I A;  2OWO A;  2XAH A;  3AK1 A;  4NXM O;  4JAU A;  4I5S A;  2A7W A;  4JYB A;  3U10 A;  1L0L H;  3I55 V;  4JTC B;  1QHT A;  4MSW C;  2LFS A;  1WP7 A;  4GZR B;  2QDO A;  1N36 O;  2F4V B;  1Q3E A;  3IAY A;  4MS2 A;  4JYC A;  2O57 A;  1SKV A;  3ABT A;  4NVP A;  2QGN A;  2F93 B;  4JAV A;  3W7W A;  4DRX B;  2IJJ A;  3ZHR A;  2F43 G;  3JD0 A;  2YIB D;  4L87 A;  2Q4P A;  1TVK B;  1VQ9 V;  3APO A;  3CRM A;  1MSW D;  2ZCE A;  3CRQ A;  1HWY A;  3FB7 C;  4JAA A;  3QO5 A;  4WFA V;  4MVQ A;  5EBW C;  4UV9 A;  4X20 B;  4H13 B;  3E86 A;  3HPL C;  2QE7 G;  2DOS A;  3H9V A;  5LMN B;  2AHZ A;  1BMF G;  2PUS A;  3ZRV A;  5EIB D;  2FML A;  5AG2 A;  4J7J A;  4CH3 A;  4ZHQ A;  3DGE A;  3F5W C;  5L3E A;  4R50 A;  2K9P A;  2WA3 A;  5IYB O;  3SJQ C;  3SJC C;  4DR5 O;  2OTJ V;  2HVK C;  1SRY A;  1T5E A;  1QNM A;  2KKW A;  1SZT A;  4GX1 A;  2NNU A;  2VQE B;  3LDC A;  1IXM A;  3N2K A;  3B2E E;  5LYJ B;  5CBF A;  1GN6 A;  4YJ2 A;  3ETQ A;  2PTM A;  5BMV A;  1S0V A;  1MNG A;  1QR9 A;  1JJ2 U;  4W4K A;  2UU9 O;  4FFB B;  1PPJ H;  3J81 N;  2UXB O;  4NTY A;  2E75 B;  1EZJ A;  4LF9 B;  2FYU H;  4O4J B;  1BE3 H;  2ITC C;  2Y69 C;  2OIG A;  3FKS G;  3A8T A;  4I4T A;  1AI6 A;  1FS0 G;  3W7S A;  3J7A U;  2GBO A;  4ZI7 B;  3P32 A;  4CZZ A;  1RSO A;  3H1I H;  4X62 O;  3M99 B;  2IJI A;  2RMK B;  5TIS Z;  4HZ3 A;  5LGN A;  2FL4 A;  1P7B A;  3UCS C;  5IYZ A;  4B3S O;  4I55 A;  1XOU A;  2HKO A;  5HFL A;  3T1C A;  2LQT A;  2ADQ B;  2ZE6 A;  2QWN B;  4UCR A;  4LNU B;  3ZCC A;  2LJ2 A;  1VQP V;  4JZG A;  5C8Y A;  3JAR A;  5CBG A;  1CEZ A;  1WPB A;  2BCC H;  3RYF B;  2HHH O;  1K4D C;  4BWA A;  1HNZ O;  4DR7 B;  2M7W A;  5IT9 N;  4TQD A;  4WFG A;  1NR1 A;  3OUF A;  2WLK A;  1R6N A;  2BSK A;  1P84 F;  1FXK A;  2GSM B;  5GTH Z;  4JI3 O;  2ZR2 A;  5J9P C;  5LHI A;  5KUK A;  2G38 A;  3B8N A;  2AW9 A;  4B3T O;  1D2D A;  3SDL A;  2OYQ A;  5KMG A;  4G27 B;  1J95 A;  1G6U A;  1S72 V;  3L73 H;  5EBM C;  3MHH C;  3U11 A;  2LGQ A;  3I5D A;  3AG7 A;  1H2N A;  1OZ0 A;  4DW0 A;  3SGI A;  3F7Y C;  1PD3 A;  3PJS K;  1AI4 A;  1YXB A;  2AGA A;  5DN6 G;  3ETD A;  2JK5 C;  2B1I A;  2XUM A;  2NLJ C;  3FX7 A;  4PDV A;  2E3C A;  4O4L B;  4ASU G;  1XMQ B;  5KA5 A;  3T1H O;  3M7M X;  4DV5 O;  4Z2W A;  1EN4 A;  4NXM B;  2PZS A;  2X6B A;  3K9S A;  1WA8 A;  3CHX A;  3AG1 B;  2IJK A;  4OXS A;  3SYP A;  4BIZ A;  4I0X A;  3AG1 C;  4DW1 A;  2JS5 A;  1TUE B;  1N36 B;  1OV9 A;  4E2L A;  1ARO P;  1B06 A;  4R7C A;  1M1K W;  2X6C A;  1WB7 A;  2P5O A;  3J80 N;  5A9G A;  3E22 A;  2Y0P A;  4IHJ A;  4ABM A;  2A06 H;  3RBZ A;  3SJA C;  2DWE C;  2WLM A;  4HNA A;  5FL7 G;  1FAF A;  4DK1 A;  3ZRW A;  3CJH A;  1RFY A;  5IJ0 A;  3FAV A;  2UXX A;  3K5N A;  1HNX O;  4FMT A;  2GV9 A;  4P2Z A;  2DE0 X;  2JIZ G;  4PHZ A;  5JH7 B;  2VRZ A;  5L3F A;  5CA3 A;  4JTA B;  2CE4 A;  1E1Q G;  1Y4M A;  1F23 A;  5LXT A;  4FLU A;  1N33 O;  4FJC C;  1W59 A;  5CA1 B;  4C7U A;  4RO2 A;  2H8P C;  4DR5 B;  1EZV H;  1E79 G;  5LOV A;  5HFM A;  1RM1 C;  1O9H A;  4RWU A;  2ZXW B;  2WWW A;  5B5E Z;  4X64 O;  2L35 A;  2ZXW C;  4UVA A;  1VQ5 V;  1N4C A;  3RVY A;  3SR2 C;  4EKW A;  4JTD B;  2PF4 E;  2CGN A;  2HP8 A;  4U7O A;  1AJP A;  4DV2 O;  2ZDI A;  5EBL C;  1ZLZ A;  5BZB A;  1R6K A;  5H5N A;  2UXB B;  1DGS A;  3WB2 A;  1K7D A;  3OE7 G;  1MMM A;  5JVD B;  1SA0 B;  4DR3 O;  1RP3 B;  1WPX A;  4B3M O;  1FD9 A;  1N34 O;  4AIL C;  4KHP O;  4CH4 A;  4O4I A;  4PA6 A;  1S76 D;  1S77 D;  3UKM A;  4X62 B;  1Y74 B;  3KKY A;  3ZJZ A;  3O9O A;  4DR6 O;  4X8A A;  4B3S B;  4K8Z A;  5B3S B;  3JAT A;  1XHX A;  3ZIA G;  5B3S C;  3C3T A;  1FFX B;  2CTW A;  3D3Q A;  3HKD A;  4K8X A;  1F4N A;  4FLT A;  3OTO B;  2HHH B;  5IJ9 A;  2XTA A;  3IC7 A;  3E89 A;  1HNZ B;  2BTQ A;  5LHG A;  3BFR A;  4NKG B;  2QKS A;  4CH6 A;  2QR4 A;  3UT5 A;  4O2B B;  3FD9 A;  5LA6 B;  4JI3 B;  2QM7 A;  5EYP B;  3G80 A;  2L6L A;  4JPR A;  1OCR B;  1B6Q A;  1OCR C;  3CCQ V;  1BQZ A;  4MTF A;  3R66 A;  5CB4 A;  2JRI A;  1COW G;  3EHB B;  1VMG A;  1Y76 A;  4YIO A;  4BAY A;  2MK3 A;  3HKB B;  4TV8 A;  3IFX A;  3RYC B;  4DV0 O;  2Q5Z A;  1Q7Y W;  1AJN A;  4FIP C;  1H2G A;  1BSM A;  3K9A A;  3LSQ A;  4TT3 G;  3G67 A;  2Z0A A;  3ABU A;  4CC5 A;  4GLX A;  5JQG B;  3MHS C;  5LMN O;  5LMU O;  1F7Y A;  4QPJ A;  4GT1 A;  4IIJ A;  1TGO A;  2UXC B;  1NTK H;  3RYH A;  2LFR A;  4X1Y A;  1X59 A;  1WN7 A;  4BIU A;  4GCZ A;  3E8B A;  2Y4U A;  3T1H B;  3SYA A;  4DV5 B;  4MVM A;  2EIJ B;  2ZM6 O;  2EIJ C;  1LR1 A;  3BEH A;  1WJZ A;  4I50 B;  1MOF A;  1OCO C;  1YHQ V;  1JJO A;  5FPR A;  4CS3 A;  4DR4 O;  4MTO A;  2CTP A;  4LWS A;  2B9Z A;  2W6I G;  5EZY B;  1M5I A;  3ABM B;  4WBN A;  4OGQ B;  3ABM C;  1YI2 V;  4B7E A;  2IU3 A;  5C93 A;  2W0X A;  2N74 A;  3CE2 A;  1KP2 A;  1S3J A;  3JD4 A;  4YJ3 B;  2EJR A;  4ZKI A;  4UVB A;  1HNX B;  1YSC A;  1TUB A;  3HKE B;  3W7X A;  2DJV A;  3BAB A;  3B09 A;  2Q7H A;  4MW3 A;  3SPC A;  4X65 O;  4DUY O;  2EIM B;  1GK9 A;  1E1R G;  1N33 B;  1XL6 A;  2KG7 A;  2EIM C;  1G1X B;  3JAW A;  2XAG A;  2ZNI A;  2M6Y A;  3CD6 V;  5FPO A;  2UUC O;  3K04 A;  4JI2 B;  3OGI B;  3QG5 A;  2Q73 A;  4YHH B;  1SQF A;  1THZ A;  2Q7G A;  4YXW G;  3UM7 A;  5KHK A;  1SQX H;  4X64 B;  1AI7 A;  4DV4 O;  1BGY H;  3SPJ A;  3ZHU A;  3HB3 B;  3JAK A;  4DR7 O;  5J2T A;  1JA8 A;  3W7U A;  4DV2 B;  5LBQ A;  5J2U A;  4ZHQ B;  1S5H C;  1Q6I A;  1EBO A;  3C90 A;  1PP9 H;  3WFV A;  1V55 C;  1VQM V;  2Q7E A;  5B1B B;  4KL1 A;  4B3M B;  3HKC A;  1Q6U A;  1N34 B;  4KHP B;  2ZE8 A;  3T4D A;  1X4T A;  2Z3Y A;  4CS4 A;  1Y66 A;  3EXA A;  5L3G A;  5EC1 C;  2HLD G;  1XI1 A;  3MAQ A;  3N2K B;  2WLI A;  3JAS A;  4YJ2 B;  2LGW A;  3E83 A;  1GM9 A;  4MT8 A;  3FFQ A;  5BMV B;  2ZIM A;  2QTS A;  1IDS A;  1BS3 A;  4DR6 B;  3VOU A;  3STL C;  4RUE A;  1F51 A;  2F23 A;  1GTO A;  1SQV H;  2PI4 A;  3UO2 A;  3RW0 A;  3L70 H;  2IW5 A;  3AK3 A;  2JEX A;  2ZQM A;  4I4T B;  4TUY B;  3X2Q B;  3OAA G;  3CCR V;  4YIP A;  4JF3 A;  1N8R W;  3X2Q C;  1MZF A;  1YDX A;  3ZBH A;  1RSO B;  3QNE A;  4UB8 Z;  4DK0 A;  3U0Z A;  1FFT B;  4GUN A;  2ARH A;  5IYZ B;  4D6T H;  1BHA A;  1R1B A;  4I55 B;  3CME V;  1AP6 A;  1MSD A;  1KKC A;  1N0N A;  2CAZ C;  4F6E A;  1G4Y B;  4DV0 B;  3JAR B;  4J7Z A;  5GON A;  3T1Y O;  2YIA A;  1H38 A;  3EFF K;  1YVW A;  1WAZ A;  1IUR A;  5LMU B;  3K58 A;  1D5A A;  1PNK A;  4UCU A;  2EIK B;  4FVM A;  2EIK C;  4DV1 O;  4P9P A;  5K1X A;  2BSK B;  1FXK B;  5KUM A;  1FXK C;  2A0L A;  1IZ3 A;  2ZM6 B;  4KFM A;  4D7T A;  3K59 A;  5KMG B;  1VF6 A;  4ZOL A;  2H3O A;  5CMU A;  2QSA A;  4WFE A;  3ZMS A;  4X88 A;  1KU9 A;  4DR4 B;  1KEC A;  4PDR A;  1VAR A;  3CCJ V;  1RPR A;  1VQK V;  3CMA V;  4JYA O;  1ROP A;  2YUA A;  1SER A;  2JVD A;  1W2B U;  2X6A A;  4NTX A;  2LW1 A;  2GUZ A;  4LP8 A;  2CH7 B;  4GYC B;  1XBL A;  3SPI A;  3OEH G;  4DR2 O;  4RQE A;  3P30 A;  5ITZ A;  4I9Q A;  1B04 A;  4BIO A;  4JI5 B;  1NS1 A;  3AK2 A;  3CWB H;  3L74 H;  5CN0 A;  1I7F A;  1VP7 A;  1WA8 B;  2VQF O;  4XDK A;  4I0X B;  5EK0 A;  1H2K A;  4X65 B;  4DUY B;  1NTM H;  1NH2 B;  2CK3 G;  4PI0 A;  3E2E A;  1NJI W;  2PGG A;  3K57 A;  4KUM A;  1Q86 W;  3ZMV A;  5DED A;  2UUC B;  2DQ3 A;  3E22 B;  3WB0 A;  4IHJ B;  2CUG A;  4HNA B;  4JZ2 A;  3ZRW B;  5B1O A;  1JX9 A;  3CJH B;  5IJ0 B;  2N04 A;  3UQ8 A;  3OTO O;  4DV4 B;  4KXR A;  3W7T A;  3VBB A;  2E5L O;  2CTQ A;  2QWP B;  1W0K G;  4H37 A;  4WFH A;  3ZMZ A;  3EVK A;  1AR5 A;  1PNL A;  5LXT B;  2EIL B;  1GH6 A;  3CRA A;  3APQ A;  2EIN B;  4AQY O;  2EBO A;  2EIL C;  1QLE B;  3CCE V;  2EIN C;  1Q82 W;  4FM0 A;  4JV5 O;  1U96 A;  1QLE C;  2AZ0 A;  4WCE V;  2CGO A;  2OTL V;  4J41 A;  5LOV B;  4U7N A;  3L75 H;  3RFR A;  1GM8 A;  4J9Z B;  1Q5O A;  2EZO A;  2DN9 A;  1HDJ A;  1CPY A;  4CH5 A;  2QM8 A;  2WLN A;  2X0L A;  1H8E G;  3OGC C;  4GX5 A;  4TQF A;  3RYI B;  2UXC O;  1Q6H A;  2YS8 A;  1OCC B;  4GKK O;  2AHY A;  3K5L A;  2ZDI C;  1OCC C;  3ABL B;  4BW9 A;  3ASO B;  1VQ7 V;  3ASO C;  1QR8 A;  2WA4 A;  4BR6 A;  4LFA O;  1SF9 A;  3LDE A;  3GVM A;  4X1I A;  1M56 B;  1NH2 D;  3CS5 A;  1NU1 H;  4LF7 O;  1I08 A;  5LGU A;  1GMG A;  4O4I B;  4D7S A;  3LSU A;  1J5E O;  3LNM B;  4LH6 A;  1XNQ O;  5EC2 C;  3MD0 A;  3P3P A;  4Q20 A;  4P9O A;  4TWK A;  4UXN A;  3H1L H;  1QVF U;  2XT9 A;  3TJT A;  3ZHV A;  1Y6X A;  2WPD G;  2QKC A;  3JAT B;  3D36 C;  5JWP A;  4X1K A;  3OR6 C;  1VQ4 V;  4DR1 O;  3HKD B;  3T1Y B;  4J42 A;  1QLN A;  4PD4 F;  1IBL O;  3H1K H;  2AXT Z;  4PJ0 Z;  5IJ9 B;  2BTQ B;  2GTA A;  2Y0I A;  4JAS A;  1TAE A;  2IBZ H;  1NTZ H;  1CP9 A;  1DF5 A;  1YIT V;  4DV1 B;  1Z5W A;  2DYR B;  4MVO A;  1GM7 A;  2JGD A;  3UT5 B;  5CA0 A;  2DYR C;  1XIL A;  2ZD9 A;  4LFC O;  4BW5 A;  3ZN0 A;  3THO A;  1YIJ V;  4JI2 O;  1YCI A;  4YHH O;  2CTR A;  3K3W A;  5CB4 B;  3JD2 A;  1XRE A;  3N27 A;  4TV8 B;  2QWR B;  5KHH A;  3FYE B;  1YJN V;  4JYA B;  3JCZ A;  1YEW A;  1M9N A;  2N05 A;  3NR7 A;  4R8C A;  1XHZ A;  3BPZ A;  1VIB A;  5L3D A;  3ZX6 A;  2Y4T A;  1HP8 A;  2C2A A;  2JGU A;  3CCS V;  4FPP A;  4IIJ B;  5BR8 O;  3RYH B;  1LUV A;  3QF7 A;  3AG3 B;  4X1Y B;  4DR2 B;  1EN6 A;  2B5U A;  3AG3 C;  1P4R A;  2UUA O;  1QVG U;  4GX0 A;  2E76 B;  2Q0O C;  3VQX A;  4OPA A;  2JDI G;  4LR3 A;  3DTU B;  2VQF B;  5DEC A;  1NVP B;  2UXN A;  4J11 A;  1K92 A;  2IH1 C;  4LWS B;  1JOY A;  3JCU Z;  3OMI B;  4J7K A;  3CCV V;  4EB6 A;  4DV7 O;  4WBN B;  2R9R B;  1AIL A;  5FNV A;  4NXN O;  1MZE A;  4EFB A;  1XNR O;  3FB8 C;  1QBZ A;  3E8H A;  4PI2 A;  1K34 A;  4H33 A;  1IXB A;  4I9W A;  1BL8 A;  3S3X A;  2BTO A;  3CX5 F;  4RUF A;  1TUB B;  3L9D A;  1AP5 A;  1K97 A;  2QWQ B;  2R9A A;  3FB6 C;  4HYO A;  1ZWI C;  4O2A B;  2E5L B;  4P30 A;  1KD1 W;  1R6T A;  1GN3 A;  4Q6G A;  3JD1 A;  2VWK A;  4UUJ C;  2IM9 A;  2KG7 B;  3CB2 A;  3K0D A;  5H9C A;  1LUW A;  3JAW B;  2VWJ A;  1M57 B;  4AQY B;  1SQP H;  2P90 A;  3A0B Z;  2YC0 A;  5B1N A;  4JV5 B;  4G28 B;  4QJF B;  3WB1 A;  1UJW B;  1YJ9 V;  3ZRX A;  2F66 C;  4X9Q A;  4OX9 O;  2YDE A;  1FJG O;  3ZHS A;  3SYQ A;  5B66 Z;  1ZSP A;  1RPO A;  3CEI A;  1N32 B;  4UCT A;  4DV6 O;  2BOB C;  2EZP A;  2ZT9 B;  3JAK B;  4N21 A;  5J2T B;  5FLX N;  2P4V A;  4GKK B;  2R72 A;  1VQ8 V;  4IT5 A;  4DV3 O;  2YID A;  3ETG A;  1NVP D;  2QKA A;  4LFA B;  3K5M A;  1ENV A;  5IY5 B;  1KYO F;  4PDM A;  5IY5 C;  1PV0 A;  1U97 A;  4LF7 B;  3HKC B;  4IYI A;  3Q4H A;  1BHB A;  3F7V C;  1XUQ A;  4UB6 Z;  1J5E B;  3GB7 C;  1OJH A;  5L3B A;  2WLI B;  3JAS B;  2WLL B;  1XNQ B;  1SZX A;  2ZIO A;  2WSS G;  1QQC A;  3BA9 A;  4ICG A;  3KCX A;  5KHG A;  4JI6 O;  1KB9 F;  3M8A A;  3TXQ A;  1YTF D;  1EN5 A;  4JI5 O;  1BZK A;  4DR1 B;  1YJW V;  2V1D A;  2UXD O;  3RGB A;  4UCO A;  2GDS A;  3RWR D;  3A2F A;  1H8H G;  1IBL B;  5LHH A;  1ZX3 A;  1KKD A;  2UUB B;  2XHB A;  3WG7 B;  5BY1 A;  4UFZ A;  4LH7 A;  3E8G A;  2Q9L A;  1Y67 A;  4LFC B;  5DM6 V;  1BQ0 A;  4B3R O;  4PV1 B;  1AJQ A;  4NYK A;  1I0H A;  1K4C C;  4PEL A;  3LSS A;  4Z1M G;  1M4U A;  4Z1V A;  2QJ1 A;  1V9P A;  3ABK B;  1D5N A;  2ZR3 A;  5GON B;  3ABK C;  3PN1 A;  2AZ2 A;  5F2V O;  1KBH A;  3ZS8 C;  2WAM A;  3LNN A;  3SPH A;  1URF A;  1YF2 A; 
#chains in the Genus database with same CATH homology
 3SYO A;  2HJF C;  3AG1 C;  1I5Y A;  1TUE B;  1M57 C;  1SER A;  3T4Z A;  4E2L A;  1W2B U;  3RVZ A;  2X6A A;  3IGA C;  2LP7 A;  4FK5 C;  4ZBM A;  1ARO P;  4LP8 A;  4R7C A;  1M1K W;  2X6C A;  3AG4 B;  3ETE A;  3GWO A;  3AG4 C;  2QTO A;  3OW2 U;  3SPI A;  3OEH G;  1GKF A;  4RQF A;  4CBC A;  4RQE A;  4HAM A;  3P30 A;  3RBZ A;  5B1B C;  2DWE C;  2WLM A;  5FL7 G;  1K33 A;  3ZRW A;  4QNH B;  1M90 W;  1PKX A;  4MVR A;  2UXX A;  3K06 A;  3TET A;  4QE7 A;  4G2K A;  4FMT A;  5CN0 A;  4XDK A;  4P2Z A;  5EK0 A;  2JIZ G;  2JJ1 G;  2OT5 A;  1ORQ C;  1I5X A;  2XND G;  3OMA B;  3ZN1 A;  5L3F A;  5CA3 A;  4JTA B;  4RAI A;  1NH2 B;  2CK3 G;  1E1Q G;  1Y4M A;  3E2E A;  4UV8 A;  1NJI W;  1NBM G;  1F23 A;  4KUM A;  1Q86 W;  3ZMV A;  4FJC C;  4KP4 A;  2DQ3 A;  1EFR G;  1LNQ A;  2YEV A;  4RO2 A;  2H8P C;  4MVU A;  5B1O A;  3ZRW B;  1JX9 A;  2A79 B;  3TCU A;  3D3I A;  1GO3 F;  2Q6A A;  3ZMT A;  1E79 G;  1R3K C;  5HFM A;  1RM1 C;  1DLB A;  4GX2 A;  5B1A B;  2ZXW B;  2WWW A;  3W7T A;  1K8A W;  2IU0 A;  2ZXW C;  3K03 A;  4UVA A;  1VQ5 V;  3VBB A;  4LCU C;  1OCO B;  2WLJ A;  1FXV A;  4PDL A;  3RVY A;  4EKW A;  4JTD B;  3CCM V;  3K08 A;  3CP1 A;  4U7O A;  1W0K G;  2GHY A;  1AJP A;  3B8M A;  4H37 A;  4WFH A;  3ZMZ A;  1PNL A;  2ZDI A;  5EBL C;  5L3C A;  1KC8 W;  2EIL B;  1R3J C;  4QE9 A;  1WLE A;  2EIN B;  2EBO A;  2EIL C;  1QLE B;  2HR3 A;  5BZB A;  3CCE V;  2EIN C;  1Q82 W;  1R6K A;  2HVJ C;  2YEV B;  1QLE C;  3OUS A;  1K7D A;  4WCE V;  3OE7 G;  2OTL V;  1W0J G;  4U7N A;  1GM8 A;  2JEU A;  3OR7 C;  4PA4 A;  4J9Z B;  4QIW F;  1WPX A;  4F4L A;  2EZO A;  3WG7 C;  3KG2 A;  3CCU V;  1CPY A;  4PA6 A;  4XBF A;  1S76 D;  2QM8 A;  2WLN A;  1FXH A;  1K73 W;  1S77 D;  3UKM A;  1OCZ B;  2X0L A;  1H8E G;  3QO7 A;  4J9Y B;  1KP3 A;  3OGC C;  2HFE C;  3OM3 B;  4GX5 A;  3ZJZ A;  3AG2 B;  1OCZ C;  3CXC U;  1OCC B;  2AHY A;  3AG2 C;  2JJ2 G;  2ZDI C;  2DQ0 A;  1OCC C;  4PA9 A;  2XAQ A;  3ABL B;  1MAB G;  1NR7 A;  3ASO B;  4X8A A;  4WF9 V;  1VQ7 V;  3R65 A;  5B3S B;  3ASO C;  1XL4 A;  1QR8 A;  3LDE A;  3ZIA G;  5B3S C;  2HG5 C;  3CC4 V;  1JVM A;  1M56 B;  4MVS A;  5KA6 A;  1V54 B;  1NH2 D;  1V54 C;  1F4N A;  1G8M A;  2K1E A;  1AR1 B;  5H6Q A;  5LGU A;  1GMG A;  3AEI A;  3CPW U;  2Y48 A;  3IC7 A;  3E89 A;  5CBH A;  5LHG A;  3G4S V;  3LNM B;  3CC2 V;  1JCH A;  5LGT A;  2QKS A;  4WFF A;  5EC2 C;  3MD0 A;  2XAF A;  4LBE C;  2ITD C;  4Q20 A;  3JD3 A;  3K0G A;  4P9O A;  4TWK A;  4UXN A;  3ZRS A;  1QVF U;  2QM7 A;  1AI5 A;  3I56 V;  4DO2 A;  2QA4 V;  2WPD G;  3B77 A;  4JPR A;  2W6J G;  1OCR B;  1B6Q A;  3OR6 C;  2XAJ A;  1OCR C;  4JGS A;  3CCQ V;  3A0R A;  4MTF A;  1VQ4 V;  1COW G;  3EHB B;  4BAY A;  1QLN A;  1V55 B;  2MK3 A;  3IFX A;  1Q7Y W;  1AJN A;  4FIP C;  5GW7 A;  1DTO A;  1H2G A;  2H94 A;  3STZ C;  3ML0 A;  4JAS A;  2Y69 B;  3K9A A;  3LSQ A;  2Q67 A;  3G6E V;  4TT3 G;  2B1G A;  1CP9 A;  1DF5 A;  1YIT V;  3ABU A;  2DYS B;  3MHS C;  2DYR B;  4MVO A;  4GT1 A;  1GM7 A;  4QPJ A;  4PA3 A;  2DYS C;  2DYR C;  3OFN G;  2WLL A;  3G71 V;  2ZD9 A;  1VQ6 V;  4BW5 A;  2LFR A;  3ZN0 A;  3CYO A;  1YIJ V;  2Q69 A;  4BIU A;  4GCZ A;  3E8B A;  3K3W A;  1K5Q A;  2YSU B;  3SYA A;  1DF4 A;  4MVM A;  2EIJ B;  2WLH A;  3JD2 A;  3K79 A;  5B1A C;  2EIJ C;  5IYD O;  3BEH A;  1R73 A;  3BY6 A;  5E1A C;  2PI5 A;  1MOF A;  2FTK A;  3FYE B;  1OCO C;  1VQL V;  1YHQ V;  2XAH A;  3OEE G;  4XDJ A;  1YJN V;  4JAU A;  3JCZ A;  1JPX A;  1M9N A;  4I5S A;  2V7Q G;  4JYB A;  4WFB V;  4R8C A;  3I55 V;  4MTO A;  4JTC B;  5L3D A;  2LFS A;  2P7T C;  4MSW C;  2C2A A;  2W6I G;  3CCS V;  4FPP A;  3SYC A;  4UVC A;  3CC7 V;  3ABM B;  3AG3 B;  4MS2 A;  3ABM C;  1YI2 V;  4JYC A;  2B5U A;  3ABT A;  3FYI B;  3AG3 C;  2IU3 A;  4JAV A;  2P6J A;  5C93 A;  3W7W A;  1KP2 A;  1R3L C;  2IJJ A;  2F43 G;  1P4R A;  1K3E A;  3JD0 A;  1QVG U;  4L87 A;  2QEX V;  1S3J A;  4GX0 A;  1SES A;  3JD4 A;  2EJR A;  4ZKI A;  4UVB A;  1VQO V;  1YSC A;  2JDI G;  3W7X A;  1VQ9 V;  3QO8 A;  3DTU B;  1PL0 A;  1NVP B;  1MSW D;  2UXN A;  1HWY A;  4TSF G;  1K92 A;  1F4M A;  2Z5U A;  3FB7 C;  2IH1 C;  3QO5 A;  1JOY A;  1MG1 A;  4MW3 A;  5IYC O;  3OMI B;  3SPC A;  4WFA V;  4MVQ A;  5EBW C;  3CCV V;  4UV9 A;  1SET A;  2EIM B;  3E86 A;  3ABL C;  1GK9 A;  1E1R G;  3HPL C;  1XL6 A;  2QE7 G;  1QCE A;  2EIM C;  2AHZ A;  2R9R B;  1BMF G;  2XAG A;  3ZRV A;  2XAS A;  3DGE A;  3F5W C;  1L1F A;  5L3E A;  3FB8 C;  4R50 A;  2DW4 A;  1QBZ A;  3CD6 V;  3E8H A;  3K04 A;  1K34 A;  1M56 C;  4H33 A;  3SPG A;  5IYB O;  4I9W A;  1BL8 A;  3SJQ C;  3LUT B;  4RUF A;  1THZ A;  4YXW G;  3UM7 A;  2HVK C;  1SRY A;  2OTJ V;  1K97 A;  2KB1 A;  1AI7 A;  3FB6 C;  4HYO A;  1SZT A;  1ZWI C;  2NNU A;  4GX1 A;  4P30 A;  1KD1 W;  3SPJ A;  3HB3 B;  3LDC A;  1IXM A;  1PNM A;  3NXS A;  3JD1 A;  5CBF A;  3W7U A;  4MTG A;  4UUJ C;  3K0D A;  2P67 A;  4MVZ A;  5H9C A;  5LBQ A;  1S0V A;  1M57 B;  1VQN V;  2P90 A;  1S5H C;  5B1N A;  1QR9 A;  2A9H A;  3FB5 C;  1JJ2 U;  3E35 A;  4G28 B;  1EBO A;  4QJF B;  1UJW B;  1YJ9 V;  3ZRX A;  4LC1 A;  3WFV A;  1V55 C;  1EZJ A;  2Q68 A;  3ASN B;  1VQM V;  3SYQ A;  3T2M A;  4N23 A;  5B1B B;  3ASN C;  1RPO A;  5IDJ A;  3T4D A;  2ITC C;  2Z3Y A;  2Y69 C;  1Y66 A;  5H6R A;  2BOB C;  2EZP A;  5L3G A;  5EC1 C;  2HLD G;  3FKS G;  4N21 A;  3ZMU A;  1AI6 A;  1FS0 G;  2WLI A;  3W7S A;  2DWD C;  3E83 A;  3E8F A;  1GM9 A;  3P32 A;  4MT8 A;  4CZZ A;  1VQ8 V;  3M99 B;  2IJI A;  3ETG A;  3VOU A;  4DXW A;  1K9M W;  4HZ3 A;  5LGN A;  2IJH A;  3STL C;  4RUE A;  1F51 A;  1NVP D;  1P7B A;  1ENV A;  5IY5 B;  3TK1 A;  1GTO A;  4PDM A;  2HKO A;  5IY5 C;  5HFL A;  3CCL V;  3T1C A;  3SYP A;  2PI4 A;  3RW0 A;  3ZCC A;  3H01 A;  2IW5 A;  4PA7 A;  1VQP V;  1BHB A;  3F7V C;  2JEX A;  2R9I A;  2ZQM A;  5CBG A;  1OHH G;  1RM1 B;  1CEZ A;  3GB7 C;  2X7R B;  3X2Q B;  5L3B A;  3OAA G;  2WLI B;  3CCR V;  4JF3 A;  1N8R W;  2WLL B;  3X2Q C;  1K4D C;  4XDL A;  1K5S A;  2WSS G;  2M7W A;  2D3O W;  3QNE A;  4WFG A;  1NR1 A;  3OUF A;  1Q81 W;  2WLK A;  1FFT B;  1R6N A;  1YTF D;  1R3I C;  1FXK A;  2GSM B;  1BHA A;  2ZR2 A;  5J9P C;  5LHI A;  3CME V;  5KUK A;  3B8N A;  4MW8 A;  2OCC B;  1YJW V;  2V1D A;  2ATK C;  2OCC C;  1G4Y B;  4X89 A;  1H8H G;  4G27 B;  5LHH A;  1NQT A;  1J95 A;  1S72 V;  1H38 A;  5EBM C;  1KKD A;  3MHH C;  3EFF K;  3WG7 B;  1OZ0 A;  3E8G A;  1PNK A;  2W0F C;  2EIK B;  4OXS A;  3F7Y C;  1PD3 A;  2EIK C;  3PJS K;  1AI4 A;  5DM6 V;  5DN6 G;  4P9P A;  3ETD A;  2JK5 C;  1AJQ A;  2B1I A;  1FXK B;  2IH3 C;  1NKD A;  2NLJ C;  1K4C C;  4PDV A;  4PEL A;  1FXK C;  2BOC C;  3LSS A;  5KUM A;  2A0L A;  4ASU G;  3LDD A;  4Z1M G;  4QPK A;  4KFM A;  5KA5 A;  3D36 A;  3ABK B;  1YTF B;  5CMU A;  2ZR3 A;  3JYC A;  4WFE A;  3ABK C;  3ZMS A;  4X88 A;  4R6Z A;  4MTX A;  2X6B A;  1JQ0 A;  3OMN B;  1KEC A;  4PDR A;  2XOK G;  2WAM A;  1RPR A;  3SPH A;  3CCJ V;  1VQK V;  3AG1 B;  3CMA V;  2IJK A;  1ROP A;  1KQS U;  4BIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...