1PD3A

Influenza a nep m1-binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Nonstructural protein NS2
publication title Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).
pubmed doi rcsb
source organism Influenza a virus
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pd3A00
1F4MA 1RPOA 2IJHA 1F4NA 2IJKA 2IJIA 2IJJA 3K79A 1PD3A 1GTOA 1NKDA 1ROPA 1RPRA 1B6QA 1GMGA 4DO2A 2GHYA
chains in the Genus database with same CATH superfamily
4I4TA 1E1RG 4DV0B 1XHXA 4R8CA 1VQLV 1IVSA 3ZHSA 2A79B 1Q8IA 1SQVH 1GM9A 1OCRC 2QA4V 4AQYO 2UUCB 2ITCC 2Z3YA 1XBLA 3FAVA 4NXNB 2N05A 2YIBA 3CRAA 2PF4E 1OCZB 4HNAA 3U10A 1Q86W 4W4KA 4UCTA 3CCVV 4PELA 4DV6B 1IBLB 3BA8A 1BMFG 5LA6B 1J5EO 4X64O 1RFYA 1H2MA 4MVQA 4RO2A 4FFBB 2JS5A 4K8XA 2HJDA 2QDOA 3FB7C 3D36A 1IXBA 1TVKB 2CK3G 1FD9A 5EIBD 2ZE6A 5KA6A 4P9PA 2OCCB 4O4IA 1M9NA 1JJ2U 1BSMA 4IHJA 5B1BC 5LOVB 4J7ZA 3WFVA 2BOBC 4X20B 4FLYA 3JALB 3RYHA 1MMMA 1PNLA 3SPGA 2CGNA 2XTAA 3G4SV 1VMGA 5B66Z 1QLNA 4NVPA 5JJJB 1SS3A 3BCCH 2NN4A 3HKEA 3FD9A 3JD3A 4JYAB 3SJBC 4OGQB 5EIBC 1GN2A 3WG7C 1JVMA 5ITZA 1TA8A 4DR2O 2HKOA 4LH7A 5IYCO 3AK1A 3MDSA 2QTSA 4NXMB 4UFZA 1XNQB 1TAEA 2IBZH 4MVRA 4DV4B 1QVGU 2BOCC 2RQ6A 3SR2C 4F6RB 4RQFA 1B06A 2LJ2A 1AP5A 3NXSA 3CXHF 2Y4UA 2JEXA 3AG1B 3O65A 3J81N 2W0XA 3CHXA 5FPRA 4UCOA 3Q4HA 3DC6A 2DQ0A 3WB0A 2F66C 4X1IB 4BR6A 2UXBO 1GN4A 1NBMG 5B1AB 4EEQA 4RAIA 4GX0A 3B8NA 3K03A 1XMOB 1JPXA 4JI6O 2UU9B 4JAVA 1AP6A 2O57A 5DECA 5CB4B 1B04A 4RUEA 2UUAB 3QO5A 2GHYA 1NTMH 2GDSA 1S5HC 4UVAA 3CRQA 4BW9A 1IXMA 1ZL8A 2DN9A 4ZBMA 4OPHA 2P4KA 3KCYA 1YIJV 3CSXA 2RCVA 1WA8B 2IU3A 2Y69C 1HNWO 1SQGA 1GMGA 1WB8A 1N34O 4DR5B 3CE2A 1LNQA 4JV5O 1Y6XA 3UQ8A 1N33B 4CH5A 4FLTA 4HAMA 2QKAA 2ZNJA 2ZT9B 4O4JA 1JFFB 1M57B 2Q68A 4LF7O 4JASA 5C8YA 4IIJB 4G27B 1Q90D 4FZ0A 2V1DA 5JVDA 3R65A 4FFKA 1GAXA 3CPWU 4ZI7B 3CCLV 1PNKA 4TOIA 2YIAA 3C3TA 1VF7A 4PV1B 5H6QA 4I7ZB 2YUAA 3OUSA 3DTUB 3D36C 5LGTA 2V7QG 1WAZA 3ZHRA 4I4TB 5KA5A 4DUZB 4UV8A 3H1KH 1IZ3A 5LP6A 4UVBA 1HDJA 3TXSA 4WF9V 2AZ2A 1UPGA 5KUMA 2HJFC 1SF9A 4D7TA 2EINC 4DV5O 1F7YA 3CRMA 1VF5B 4X89A 2ZIOA 2JRIA 5B1OA 1PM9A 5IY5B 1NS1A 4JZ2A 4DV2B 5A2QN 4I55B 2WLKA 4FIPC 4HYOA 3H1HH 4WCEV 1CEZA 2E5LO 4ASUG 1K73W 1XMQB 1BS3A 2EBOA 5JH7A 4LF6B 5L3FA 2YI9A 1VQ9V 1K33A 4NTWA 4ZOLA 4B3MO 2OYQA 2WLHA 4FLVA 2YDEA 5BMVB 4PD4F 4FPPA 1NKDA 1K4DC 3RYHB 1RM1C 3CRRA 2QWQB 2QEXV 1JX9A 1PL4A 2M7WA 4JI2B 1ZAUA 2ETNA 1GKFA 1YVWA 5H5NA 3JASA 3CCQV 5EZYB 4RQEA 2R70A 3BA9A 3QF7A 4J42A 3HKEB 3T1YO 3IC9A 1K9MW 1OZ0A 4CS3A 2EULA 3BRCA 3CRCA 3G80A 2LFSA 5ITZB 4JI1B 3JATA 1AB3A 4GX5A 3E86A 1FXKA 2ZINA 4I0XB 4JI3O 3W7XA 5L3EA 4DR6B 1KUQA 1YITV 3A2FA 2A3QA 4JYBA 1ORQC 4HBNA 1VQPV 1V55C 2LP7A 4JI0O 2A7WA 2DJVA 2BSKB 3UT5A 2LW1A 2B9ZA 1BE3H 2ZXWB 4H44B 1VQKV 4O4HB 5GW7A 3OMIB 1ENVA 1H38A 3JCUZ 3K0DA 4YJ3A 2Q9LA 3K5OA 4UB6Z 2XAJA 4DR4B 4JAAA 2JGDB 5GONB 1FXHA 4GKJO 3BHPA 1EM1A 4J9ZB 3AK2A 3ZMSA 1RSOA 1N32O 1FFXA 1L0NH 1ZL8B 2DYRB 2EIJC 2WPDG 2QM8A 3ABUA 3LDEA 2RNBA 1QR9A 2GTAA 4Q20A 4BWAA 4QPKA 1ZX3A 5DN6G 2EIKC 5KMGA 3C3SA 2AXTZ 4I9WA 1XL6A 2ZM6O 2VQEO 1CPYA 3AG4B 3B4SA 1IBMO 4ICGA 3FB8C 2GSMB 3CCRV 3U11A 4TSFG 2EIMC 3N2KB 5EK0A 3TJTA 2VS0A 2CH7A 1XI1A 1BHBA 3L71H 3R66A 5LMUO 4X66O 2OTLV 2ARHA 4PDRA 1P84F 1SA0A 4U3JA 4P2ZA 3LUTB 2ILMA 1XQ8A 4TUYB 1D5NA 2WLIA 3VQXA 3EFFK 3ZEDA 5D5PA 4B08A 3CEIA 1QVFU 4FK5C 1GN6A 1WP8A 1T5EA 3BFRA 3IJ4A 5KAIZ 5L3DA 1MSDA 4KUMA 3T1HB 2EILB 3JAKA 1WJZA 3CJHA 4CBCA 4JI8O 4YJ2A 2JS3A 2F4VB 4XDLA 1V54C 5BR8B 3HB3B 1Y66A 1DF4A 3LNNA 1HNZO 4B3TB 1PV0A 5IYBO 2XHBA 4DV7O 1M56B 2DW4A 1NT2B 1VQ7V 5CBGA 1IBKO 2G38A 2GV9A 3E8HA 3VBBA 1M93A 3AG7A 4ZIBA 4TT3G 4L87A 3ZHUA 2A9HA 4Z1MG 3APOA 2UXDO 2W6JG 3JSNA 1KU9A 4K35A 3L70H 4EB6A 1I94O 1QNMA 4WFFA 1S72V 1SERA 1YTFD 4DW1A 3VOUA 2B5UA 4DV0O 3RWRD 4GLXA 4B3RB 3J80N 4Z2WA 1W0JG 4LF4B 3STLC 2UUCO 4D6TH 4UV9A 3JD4A 4NXNO 1Q5OA 5CA1B 2QWNB 3P30A 1JQ0A 2FYUH 2D3OW 3ZJZA 3K9AA 1GRJA 1BHAA 2L6LA 4IL6Z 3X2QC 1IX9A 2RN9A 4DV6O 1IBLO 1Z5VA 4GUNA 1YI2V 4NTYA 2LFRA 2GTSA 3CB2A 3SJAC 4WFEA 5DEDA 4KHPB 5L3BA 3RT3C 1YZBA 3H9VA 2GUZB 2IM9A 1I5YA 2IJKA 2E74B 4CH6A 4IYHA 2BTOA 4LNUB 5JCOA 4MTFA 1US6A 1XL4A 1VQ5V 3RFRA 4J9YB 3HKBB 3OW2U 2UXXA 4PDLA 1FAFA 4JGSA 1OCZC 4I50B 2WLJA 3UT5B 2P22C 2QWRB 3N27A 4DYLA 2LW7A 1BGYH 2WSSG 1VF6C 3EHBB 1H8EG 3SYQA 1QU7A 2NR5A 3BPZA 4GKKB 1NR7A 1ZTEA 2KSDA 5FPOA 4JYAO 2JVDA 3RVZA 1WPXA 3SGIA 2YEVB 2ADQB 1CP9A 4UCVA 4JYYA 5LHHA 3DXRA 3A0RA 3K79A 4FM2A 2OTJV 4X62B 4LR3A 4NXMO 1S5LZ 5EYPA 1JR9A 3BAAA 1E79G 2HP8A 3DC5A 5KHIA 4KXRA 3KCXA 2IW5A 1XNQO 2AW9A 4DV4O 4MW8A 4JPRA 3RYFA 5LL6Y 3F7VC 4WBNA 4LC1A 1BCCH 4P9OA 3JD0A 3SPHA 5IWAB 1N36B 1GTOA 2EJRA 1SQFA 1KP2A 5KX5B 1GH6A 3CCSV 4TV8A 3OTOB 3F5WC 2JIZG 1OCRB 4G2KA 4JI5B 2CUGA 3RN4A 4PHZA 1XMOO 1NQTA 4XDKA 2HEPA 2AHYA 4LF5B 3AG2C 2UU9O 5F2VO 3UO3A 3K5MA 1LUWA 1SA0B 2DYSB 2X6AA 3CCMV 3G71V 2UUAO 5CA0A 2VQFB 4OX9B 1EN6A 4PI2A 2H8PC 2P4VA 3SYPA 2ZDIC 1AR5A 1SETA 1SZTA 2WLIB 2YIDA 1F51A 3OEEG 3L73H 4IGGA 3SDLA 2B1IA 3STZC 4DR5O 1PD3A 3M7MX 3LSUA 3NR7A 3JAKB 3CJHB 1N33O 1H2NA 3RYCA 3HKDB 3L75H 1FFTB 4FM1A 4KL1A 4LWSA 2QSAA 4ZHQA 4FLWA 3AG1C 2Q6AA 5LXTA 1YJ9V 4DRXA 4YY3B 3VQYA 2YS8A 3CMAV 4O2AB 4I9QA 3SPIA 2XAFA 2AGAA 3ZBHA 1SQBH 5B1AC 4BW5A 1K5SA 3BABA 4FMTA 3DGEA 5H9CA 4E4EA 3CCUV 3JARA 4R7CA 3K04A 5IJ0A 1V9PA 4CZZA 4DR3B 4DW0A 5IYZA 3ETEA 4BIUA 1U96A 3ABKC 4NYKA 3ABMC 2VWJA 1MZEA 4XBFA 2XT9A 3TCUA 1EN4A 3MAQA 4DUZO 1YJWV 3ZIAG 2X6CA 3W7TA 1N0JA 1VQ6V 1QLEB 3ZN0A 5JCOC 5KHKA 1EZVH 2XOKG 2Q5ZA 3OGCC 3QVNA 3RBZA 1M57C 3UO2A 4X1KB 3EXAA 2QM4A 1H8HG 4DV2O 3AK3A 2R9AA 5E79Z 4TV9B 5JQGA 1GO3F 1XMQO 4H37A 2QWPB 4AI8A 3JYCA 5J9PC 2IJJA 2ZE7A 1SESA 3HPLC 3H1LH 1OCOC 4LF6O 2BE3A 3M99B 1YHQV 3RYIA 1OHHG 5TISZ 3GB7C 1Z5WA 1PL0A 4LFAB 2EX3A 3BEHA 4U3FH 1FXVA 2L35A 4O4LA 1R3JC 2GBOA 1I08A 2A06H 4WFAV 5LYJB 3TXQA 4JI2O 1Q82W 3E83A 4QPJA 2D2CB 1ZSPA 1FPOA 1S0VA 1IURA 3QG5A 2VRZA 2NNUA 1LR1A 2KKWA 3FAVB 3ZMUA 3T4DA 1SZXA 2XNDG 4AHCA 3CXCU 4JI1O 5FLXN 4HNAB 3DXRB 2Y48A 3CCJV 1D2DA 4DR1B 1NVPD 2BTQA 2ZE5A 1COWG 1JA8A 5EC2C 3ZMTA 2OT5A 4DR6O 4RUFA 2R9RB 3JAWA 4NR1A 3E8BA 1HWYA 4BIZA 2WA4A 1KB9F 3K9SA 3LDCA 1TGOA 1OCCB 4TWKA 4YHHB 5LMNB 4LFBB 1A32A 3WU2Z 4O4IB 4CC5A 2XAGA 3S3WA 4PDVA 3PJSK 4IHJB 1VQNV 1H2SB 1S3JA 1FS0G 4DUYO 3OD4A 2F43G 4DR4O 1N4CA 1MOFA 5CA0B 2EINB 1L8DA 4MVMA 2ADPA 4L8JA 2DWDC 1NH2B 4GX2A 3CC7V 2P90A 5J2TA 1BQ0A 1EN5A 4LF7B 4JI4B 3HKCA 3UKMA 2JGUA 1WNSA 2Y4TA 2HHHB 3WB2A 1ZWIC 4LWSB 3T4ZA 1KKCA 3GVMA 1BZKA 3LSSA 1PKXA 2ZQMA 4LFCB 2P67A 2KG7A 1P4RA 1KKDA 2DE0X 3A0BZ 2YXHA 1IDSA 1Y76A 3KKYA 2KB1A 3K06A 1XNRB 3W7WA 2ZXWC 1SRYA 3RGBA 4BIOA 3JCZA 2OWOA 3ZN1A 5BXZA 3MHHC 5IJ0B 3FFQA 1K7DA 5CMUA 5IYZB 3ZHTA 1NU1H 1TUBA 3K3WA 3Q4HB 5IJ9A 3SJCC 1GN3A 5KHJA 1GM8A 3D8CA 4QE9A 1G4YB 4NTXA 1EFRG 1YCIA 1YDXA 4DR7B 1LUVA 1AI5A 3E22A 3T1HO 5B3SB 1S5JA 3OMAB 4X88A 3B8MA 5IT9N 4LP8A 1K97A 4JI7B 1Q43A 3RW0A 3FB5C 4YIPA 2Q73A 4WFBV 3APQA 1EBOA 1NTKH 4I5SA 2F93B 2F4VO 5BR8O 2B1GA 2PGGA 3H1JH 2XASA 3AG4C 4B3TO 2Z5UA 2Z0AA 1MA1A 2HFEC 1FJGB 3UM7A 1K8AW 3LSQA 2Q7EA 1DF5A 3ZRXA 1Q7YW 1HR0B 5LBQA 1VF6A 3BY6A 3ASOC 3H01A 3ABLB 2HR3A 1I7FA 4MVUA 5LA6A 4O4JB 4XDJA 3OTFA 4B3RO 2EILC 4UVCA 5C8YB 4LF4O 2F23A 1TVKA 3RYIB 2UUBB 1WPBA 1YSCA 5JVDB 4B7KA 1CXZB 3QNEA 4O4LB 2CTWA 4R50A 1UJWB 3ZRWA 5LOVA 4JI3B 2DQ3A 2QTOA 1VEWA 5K1PA 1M56C 4X20A 2VWKA 1FKAO 1M5IA 4X65B 1P49A 4W4LA 4KHPO 5LP6B 1ZUQA 4DO2A 1Z2GA 3CMEV 1W0KG 2LO1A 4OXSA 4A5UB 1VIBA 3ZS8C 5E1AC 1K5QA 3L72H 2IH1C 4N23A 4LF9O 2CTRA 2Q4PA 3A0HZ 2ZDIA 4UB8Z 2JEUA 4AILC 4ZKIA 3ZMZA 4F6EA 1EZJA 2WAMA 5KHGA 5IYDO 3G6EV 1HNXB 2EJ7A 3ZX6A 1X59A 1R3KC 2DOSA 4LH6A 5JH7B 4FLXA 3PN1A 3SYAA 4GKKO 4MW3A 1V54B 2QKCA 4ZOLB 1M90W 4G28B 1WB7A 3K57A 4UXNA 4K8ZA 1R73A 4X62O 3A8TA 3RVYA 3I55V 5J2TB 4LCUC 3AG3B 2WLNA 4MTXA 1E1QG 3B40A 3JASB 2Q7HA 2WA3A 3LNMB 1W59A 1QR8A 3ETGA 1KMIZ 3B77A 4UCSA 2F1MA 5IWAO 2N74A 1N36O 2KQXA 1WA8A 3O9OA 1R1BA 2JJ1G 5LHGA 3J7AU 3ZCCA 2QR4A 3FKSG 3OTOO 1VP7A 1MNGA 1XILA 3JATB 1AJPA 4JI5O 3D3QA 4JZGA 3JD2A 1XEQA 1FXKB 3SPCA 4LF5O 2M6YA 2YI8A 2H3OA 2WWWA 3CYOA 1MG1A 4MVSA 4OX9O 1R3IC 1JFFA 1NI8A 5B1NA 1S77D 2HLDG 4IIJA 3E8GA 3THOA 3CWBH 1H2LA 1RP3B 3T1CA 4ZI7A 4YJ3B 2NLJC 3DSQA 4MSWC 4IT5A 4B3SB 3P32A 4X8AA 3ZRVA 2F95B 3ETDA 1RSOB 4UCUA 1FFXB 4J41A 4YY3O 1D5AA 1Q3EA 3CCEV 1VQMV 1B6QA 2OCCC 3ASNB 1N8RW 3W7UA 2FL4A 4K0KB 1XREA 4QJFB 3L9DA 5KMGB 3WB1A 2Q8VA 2P7TC 2DYSC 4DR3O 1RPRA 1XDCA 2P5OA 3I5DA 5FNVA 4DV3B 4MTGA 1I0HA 1JOYA 4I55A 2CH7B 2XUMA 4HZ3A 2YXYA 4YXWG 3EVKA 2UXCB 2IH3C 4U3JB 1O9GA 1Y67A 1PPJH 1L0LH 4DV1B 4C7UA 4CS4A 4PDMA 5D5QA 4DK0A 4QGPA 2LGQA 3ZRWB 3OEHG 3N2GA 1X4TA 4EFEA 5JJNB 5BMVA 1Q81W 4LF8B 2ZKOA 1JMKC 2RDCA 4JAUA 4YJ2B 4FZ1A 2PY5A 4J7JA 3KG2A 3CP1A 4IYIA 3H1IH 1P7GA 1WP7A 5B1BB 3AG2B 2R9IA 3SJQC 2CE4A 5EZYA 3I56V 3OGIB 4AQYB 3AEIA 4FM0A 4MVZA 4R6ZA 5EBWC 4JTAB 5EC1C 5KLVH 4LFAO 1Q6UA 1KYOF 1H2GA 1QLEC 1VARA 1BQZA 5C93A 5FL7G 4I0XA 1J5EB 2CTPA 4X64B 4EB6B 1G6UA 4O2BA 3IGAC 3CX5F 3WG7B 3CC2V 2Y0PA 1BL8A 3K58A 4JTCB 1VQ8V 4NB5A 3ZMVA 2HVKC 2BSKA 1TUEB 2YC0A 2ZR3A 4FLZA 3SYCA 5K1XA 4RWUA 4O4HA 2CGOA 4PA4A 3S3XA 4DR1O 2YIBD 2ZD9A 1WN7A 3FYEB 2JGDA 5GONA 2EZOA 3OE7G 3ABKB 1WLEA 3ABMB 1R6KA 1Q6IA 4DXWA 1HP8A 3U0ZA 2IU0A 2V4DA 1YEWA 4LFBO 3C90A 4YHHO 5LMNO 3HR0A 2BCCH 3CD6V 3D3IA 3K08A 3E89A 5DM6V 4UCRA 4DR2B 3E35A 4PA6A 2ZR2A 2JDIG 2Y69B 3ZRSA 1DK1A 2UXNA 1W2BU 1MZFA 3JSLA 3P3NA 3N2KA 1DLBA 4MS2A 4PJ0Z 2JJ2G 2WLLA 1Y4MA 5KUKA 4QE7A 4JI4O 4GYCB 5CN0A 1JCHA 1NH2D 1AI4A 5BY1A 1NZ6A 5IDJA 4TUYA 2PYJA 2HHHO 3E8FA 5IY5C 3K59A 1AI6A 2K1EA 5A9GA 2UXBB 1NJIW 1URFA 2R72A 1M4UA 2WLMA 2ODMA 4U7NA 3CS5A 1GK9A 1OCOB 4LFCO 2W0FC 4X1YA 4K3AA 3F5TA 5EYPB 1DGSA 4JI6B 1AJQA 1OCCC 3TK1A 4P30A 1XNRO 3VQVA 4OPAA 3K5LA 2K9PA 1AROP 3RYFB 4Q6GA 2MW2B 3ZHQA 5L3CA 3K5NA 2C2AA 4WBNB 2ITDC 1ROPA 1K4CC 2CTQA 2QE7G 1HNWB 5FNVB 1Q6HA 1N34B 2YICA 1MSWD 4TV8B 4PI0A 4JV5B 1SKVA 3GWKC 5CBFA 1N0NA 4DR7O 5H2FZ 3ETQA 2QKSA 4EKWA 3JAMN 4CH3A 4JI7O 2A0LA 3IFXA 3VQWA 2JK5C 3L74H 2ATKC 4MTOA 5EBLC 3ABTA 2PUSA 1Y74A 3OM3B 1F4MA 5LGUA 2Y0IA 4PA9A 4YIOA 1QBZA 5B5EZ 1FJGO 1AVMA 3N2GB 1AR4A 3F7YC 5CA1A 5CBHA 2ZNIA 2W6IG 3RYCB 1QQCA 1AJNA 4UUJC 2HVJC 1P7BA 1HR0O 3UCSC 4ZHQB 1ZLZA 5JJEB 2FB5A 5LXTB 4CC6A 3FYIB 4DRXB 1F4NA 3IC7A 1R3LC 2P6JA 5H6RA 3OFNG 1YF2A 1RM1B 2OIEA 5B3SC 5J2UA 1NVPB 2H94A 3JARB 4BAYA 3OT7A 2UUBO 1F23A 2GUZA 4CS2A 4ABMA 4DV5B 4KP4A 1J95A 3JD1A 2P06A 4LNUA 2DYRC 4EFBA 2PYLA 5GTIZ 3TGUH 4O2BB 2Q0AA 4J80A 3HKBA 4QNHB 2E5LB 1RPOA 4E2LA 1AI7A 2DWEC 4X65O 2FMLA 1B3QA 1XUQA 5KHHA 1OJHA 4I50A 3B09A 3LDDA 4D7SA 4MVOA 1AR1B 2E76B 4WFGA 3ABLC 2ZE8A 4B3MB 4TQDA 4DUYB 2AZ0A 3OAAG 2YEVA 1V55B 4X9QA 2RJZA 2YXLA 1YJNV 1S76D 3OR7C 3OR6C 5JQGB 3MHSC 3M8AA 3QO7A 4Z1VA 4DK1A 3K0GA 4N21A 1HNXO 4FFBA 2PI4A 2HG5C 3T1YB 4GCZA 1XOUA 5KX5A 2EIJB 2CDYA 1THZA 1R6TA 4FJCC 5LP6C 1FYJA 2QGNA 4TQFA 4PA3A 1M1KW 2EIKB 3ICXA 1JJOA 4LBEC 2RMKB 2WLLB 2IJHA 4JF3A 4J11A 2N04A 3OUFA 3JALA 3FX7A 1BT8A 4GT1A 4GZRB 2ZCEA 3ASOB 2PTMA 3W7SA 4JI0B 1L1FA 1PNMA 2EIMB 3SYOA 1KP3A 4X1YB 2BTQB 5HFMA 1NTZH 3HKDA 2IJIA 1VQOV 4GKJB 3QTCA 1DTOA 2PZSA 1N32B 1QHTA 3JAWB 2EZPA 4CH4A 5HFLA 4GX1A 4KFMA 2FKXA 4H13B 1YXBA 4O2AA 5GTHZ 3G6BA 5LGNA 3FB6C 2LGWA 3T2MA 4F6RA 3OMNB 1KBHA 2QWOB 2XAHA 3QO8A 2E3CA 3AG3C 2DMXA 4PA7A 2ZM6B 2VQEB 3E2EA 1XHZA 2ZIMA 3IAYA 4F4LA 1GM7A 1QCEA 1IBMB 5EBMC 4X1IA 1NR1A 1O9HA 2X6BA 3KZIZ 4B3SO 4FVMA 4MT8A 2LQTA 4WFHA 1Y74B 3MD0A 2X7RB 5LMUB 3SPJA 4X66B 5IE9A 5CB4A 5L3GA 4H0LB 2PI5A 1H2KA 2QM7A 3HKCB 3TETA 2Q69A 2Q7GA 4K0KO 4H33A 1FXKC 2CAZC 5LHIA 5CA3A 4NKGB 3P3PA 4DV3O 1G8MA 4X1KA 1K92A 1R6NA 4J10A 3G67A 4JYCA 1HW7A 2KG7B 5KAFZ 1AILA 5BZBA 1PP9H 1SC5B 4J7KA 1Y76B 4U7OA 4JI8B 1MABG 1K34A 3ZHVA 1SQPH 1SQQH 1U97A 2OCHA 2X0LA 2E75B 2UXCO 4TV9A 5J2UB 3ML0A 1KQSU 2Q67A 1OV9A 3X2QB 2VQFO 1I5XA 2MK3A 1SQXH 3BVOA 2QJ1A 1HNZB 4DV1O 4FLUA 1TUBB 4DV7B 1K3EA 2XAQA 5IJ9B 1VQ4V 4QIWF 1KECA 4LF9B 3B2EE 1IBKB 1UFIA 4B7EA 1G1XB 3E22B 1KC8W 3CC4V 1KD1W 3ASNC 1YTFB 4LF8O 2OIGA 2UXDB 2FTKA 5JWPA 4JTDB 2YSUB 5LYJA 5AG2A 1I94B 3GWOA 2Q0OC 2AHZA
chains in the Genus database with same CATH topology
2P90A 4KUMA 1VQLV 1E1RG 4R8CA 2A79B 2EILB 2ZD9A 1GM9A 3UKMA 1OCRC 2QA4V 3FYEB 2EZOA 4CBCA 2ITCC 2Z3YA 3OE7G 3ABKB 1WLEA 1ZWIC 3ABMB 1OCZB 3T4ZA 4XDLA 1R6KA 1V54C 4DXWA 3HB3B 1Y66A 3LSSA 1Q86W 1DF4A 1PKXA 2ZQMA 3CCVV 2IU0A 4PELA 2P67A 1KKDA 1P4RA 5IYBO 1BMFG 1M56B 2KB1A 2DW4A 3K06A 4MVQA 3W7WA 1VQ7V 2ZXWC 4RO2A 1SRYA 5CBGA 3CD6V 3D3IA 3K08A 3E89A 3JCZA 5DM6V 3E8HA 3VBBA 3ZN1A 4TT3G 4L87A 3FB7C 2A9HA 3MHHC 4Z1MG 3D36A 1K7DA 3E35A 4PA6A 2ZR2A 5CMUA 2CK3G 2JDIG 2Y69B 3ZRSA 2W6JG 5KA6A 2UXNA 4P9PA 3K3WA 1W2BU 1DLBA 4WFFA 1SERA 2OCCB 1S72V 1GM8A 4MS2A 4QE9A 1YTFD 1M9NA 1G4YB 3VOUA 1JJ2U 1EFRG 2JJ2G 2WLLA 1Y4MA 2B5UA 1AI5A 5KUKA 5B1BC 4QE7A 5B3SB 5CN0A 4X88A 3OMAB 3WFVA 3B8MA 4LP8A 1JCHA 1W0JG 1NH2D 1AI4A 3STLC 1K97A 2BOBC 5IDJA 4UV9A 3JD4A 3E8FA 5IY5C 1PNLA 3SPGA 3P30A 1JQ0A 1AI6A 2K1EA 2D3OW 3RW0A 3FB5C 3ZJZA 3K9AA 4WFBV 1EBOA 1BHAA 1NJIW 4I5SA 2B1GA 3G4SV 2WLMA 3X2QC 2XASA 4U7NA 3AG4C 1GK9A 1OCOB 1QLNA 2W0FC 2Z5UA 3TK1A 1AJQA 1OCCC 2HFEC 4P30A 1YI2V 3UM7A 2LFRA 1K8AW 3LSQA 3JD3A 1DF5A 1AROP 3ZRXA 1Q7YW 4WFEA 3WG7C 1JVMA 5L3CA 2C2AA 5L3BA 2HKOA 5IYCO 2ITDC 1ROPA 1K4CC 5LBQA 3BY6A 3ASOC 2QE7G 3H01A 3ABLB 2HR3A 4MVUA 4MVRA 1I5YA 1MSWD 2IJKA 2BOCC 1QVGU 4XDJA 5CBFA 4MTFA 4RQFA 1XL4A 3NXSA 2EILC 2QKSA 1VQ5V 4UVCA 2JEXA 4EKWA 4J9YB 3AG1B 3OW2U 1YSCA 2A0LA 3IFXA 2UXXA 3QNEA 2JK5C 4MTOA 2ATKC 5EBLC 4PDLA 2DQ0A 4JGSA 1OCZC 3ABTA 1NBMG 2WLJA 3OM3B 4R50A 5B1AB 3ZRWA 1UJWB 1F4MA 5LGUA 4RAIA 2WSSG 2DQ3A 3B8NA 3K03A 1JPXA 1QBZA 4GX0A 4PA9A 2QTOA 3EHBB 1H8EG 4JAVA 3SYQA 1M56C 1NR7A 4RUEA 3F7YC 5CBHA 3QO5A 2GHYA 3RVZA 1WPXA 2W6IG 1S5HC 2YEVB 1AJNA 4UUJC 4UVAA 1CP9A 2HVJC 1IXMA 4ZBMA 1P7BA 4DO2A 5LHHA 3CMEV 1W0KG 3A0RA 3K79A 1YIJV 4OXSA 2OTJV 2IU3A 2Y69C 3FYIB 1GMGA 1E79G 1F4NA 3IC7A 2IW5A 1R3LC 1LNQA 4MW8A 5E1AC 2P6JA 4JPRA 1K5QA 5H6RA 2IH1C 3OFNG 4N23A 3F7VC 2ZDIA 4LC1A 2JEUA 5B3SC 1RM1B 4ZKIA 4P9OA 2H94A 1NVPB 4HAMA 3JD0A 3SPHA 4BAYA 3ZMZA 1GTOA 1F23A 2EJRA 1EZJA 2WAMA 1KP2A 3CCSV 1M57B 2Q68A 3F5WC 4KP4A 2JIZG 1J95A 1OCRB 3JD1A 4G2KA 5IYDO 3G6EV 2DYRC 1NQTA 1R3KC 4JASA 4XDKA 2AHYA 3AG2C 4G27B 4QNHB 3SYAA 2DYSB 2V1DA 3CCMV 2X6AA 3R65A 4MW3A 1V54B 3G71V 1RPOA 4E2LA 1M90W 1AI7A 3CPWU 2DWEC 3CCLV 1PNKA 2H8PC 4G28B 3SYPA 2ZDIC 1SETA 1SZTA 2WLIB 3LDDA 4MVOA 1AR1B 4UXNA 4WFGA 5H6QA 1F51A 3OUSA 3DTUB 1R73A 5LGTA 3OEEG 3RVYA 2V7QG 2B1IA 3STZC 3I55V 3ABLC 4LCUC 3AG3B 2WLNA 5KA5A 1PD3A 4MTXA 4UV8A 1E1QG 3OAAG 2YEVA 1FFTB 1V55B 3LNMB 4UVBA 1QR8A 3ETGA 4WF9V 3B77A 3AG1C 5KUMA 1YJNV 2Q6AA 1S76D 2HJFC 2JJ1G 3OR7C 5LHGA 1YJ9V 3ZCCA 3OR6C 2EINC 3FKSG 3MHSC 3QO7A 3CMAV 1AJPA 4X89A 3SPIA 3K0GA 2XAFA 4N21A 5B1OA 5B1AC 4BW5A 3JD2A 1K5SA 5H9CA 4FMTA 3DGEA 2PI4A 5IY5B 1FXKB 3CCUV 3SPCA 2HG5C 4R7CA 3K04A 2WLKA 4FIPC 4HYOA 4GCZA 4WCEV 1CEZA 2WWWA 3CYOA 1MG1A 4CZZA 4MVSA 2EIJB 4ASUG 1R3IC 3ETEA 4BIUA 1K73W 3ABKC 1THZA 3ABMC 4FJCC 5B1NA 1S77D 2EBOA 4PA3A 1M1KW 2EIKB 2HLDG 4LBEC 4XBFA 3E8GA 5L3FA 1VQ9V 2WLLB 3TCUA 1K33A 2IJHA 4JF3A 1YJWV 3ZIAG 3OUFA 3T1CA 2WLHA 2NLJC 2X6CA 3W7TA 1VQ6V 4GT1A 4MSWC 1QLEB 3ASOB 3ZN0A 4FPPA 1NKDA 3W7SA 1K4DC 1RM1C 3P32A 4X8AA 1L1FA 1PNMA 3ZRVA 2QEXV 1JX9A 2EIMB 2M7WA 2XOKG 3ETDA 3SYOA 3OGCC 3RBZA 1GKFA 1M57C 3CCEV 1KP3A 3CCQV 1VQMV 5HFMA 1B6QA 2OCCC 4RQEA 3ASNB 1N8RW 3W7UA 2IJIA 1H8HG 1VQOV 4QJFB 1K9MW 1OZ0A 2P7TC 1DTOA 2DYSC 2EZPA 2LFSA 5HFLA 4GX1A 4KFMA 1RPRA 1GO3F 4H37A 3JYCA 5LGNA 3FB6C 4MTGA 4GX5A 5J9PC 2IJJA 3E86A 3T2MA 3OMNB 1SESA 3HPLC 1FXKA 1JOYA 1OCOC 2XAHA 3W7XA 3QO8A 4HZ3A 5L3EA 3M99B 1YHQV 4YXWG 3AG3C 1OHHG 1YITV 3GB7C 4PA7A 2IH3C 4JYBA 1PL0A 3E2EA 3BEHA 1FXVA 1ORQC 1VQPV 1R3JC 1GM7A 1QCEA 4F4LA 5EBMC 1V55C 2LP7A 1NR1A 2X6BA 4WFAV 4MT8A 1Q82W 4PDMA 2ZXWB 3E83A 4QPJA 1VQKV 4WFHA 5GW7A 3ZRWB 3OMIB 3MD0A 2X7RB 1ENVA 1S0VA 3SPJA 1H38A 3OEHG 3K0DA 5L3GA 2PI5A 2QM7A 3TETA 2NNUA 2XAJA 2Q69A 1Q81W 4H33A 1FXHA 1FXKC 4JAUA 3ZMUA 3ZMSA 4J9ZB 5LHIA 3T4DA 3KG2A 2XNDG 5CA3A 3CP1A 3CXCU 2DYRB 2EIJC 2WPDG 2Y48A 2QM8A 3CCJV 1G8MA 3ABUA 1K92A 1R6NA 5B1BB 3LDEA 1NVPD 3AG2B 1QR9A 2R9IA 4JYCA 3SJQC 4Q20A 3I56V 4QPKA 5BZBA 1COWG 3AEIA 5DN6G 2EIKC 4U7OA 5EC2C 3ZMTA 2OT5A 1MABG 1K34A 4MVZA 4R6ZA 4RUFA 5EBWC 2R9RB 2X0LA 3E8BA 4I9WA 1HWYA 4JTAB 1XL6A 5EC1C 3ML0A 1KQSU 2Q67A 1CPYA 3X2QB 4BIZA 3AG4B 1H2GA 1I5XA 1QLEC 2MK3A 3FB8C 2GSMB 3LDCA 3CCRV 5C93A 1OCCB 5FL7G 4TSFG 1K3EA 2EIMC 2XAQA 4TWKA 5EK0A 1VQ4V 4QIWF 1KECA 1BHBA 3IGAC 2XAGA 4PDVA 2OTLV 4PDRA 3WG7B 3CC2V 3PJSK 1BL8A 1VQNV 1KC8W 4JTCB 3CC4V 1S3JA 1FS0G 1KD1W 1VQ8V 4P2ZA 2F43G 3ASNC 3LUTB 1YTFB 3ZMVA 1MOFA 2EINB 2FTKA 4JTDB 2HVKC 2WLIA 1TUEB 4MVMA 3EFFK 2YSUB 2DWDC 1QVFU 2ZR3A 3SYCA 4FK5C 1NH2B 4GX2A 3GWOA 4PA4A 2AHZA 5L3DA 3CC7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4M A;  1RPO A;  2IJH A;  1F4N A;  2IJK A;  2IJI A;  2IJJ A;  3K79 A;  1PD3 A;  1GTO A;  1NKD A;  1ROP A;  1RPR A;  1B6Q A;  1GMG A;  4DO2 A;  2GHY A; 
#chains in the Genus database with same CATH topology
 4I4T A;  1E1R G;  4DV0 B;  1XHX A;  4R8C A;  1VQL V;  1IVS A;  3ZHS A;  2A79 B;  1Q8I A;  1SQV H;  1GM9 A;  1OCR C;  2QA4 V;  4AQY O;  2UUC B;  2ITC C;  2Z3Y A;  1XBL A;  3FAV A;  4NXN B;  2N05 A;  2YIB A;  3CRA A;  2PF4 E;  1OCZ B;  4HNA A;  3U10 A;  1Q86 W;  4W4K A;  4UCT A;  3CCV V;  4PEL A;  4DV6 B;  1IBL B;  3BA8 A;  1BMF G;  5LA6 B;  1J5E O;  4X64 O;  1RFY A;  1H2M A;  4MVQ A;  4RO2 A;  4FFB B;  2JS5 A;  4K8X A;  2HJD A;  2QDO A;  3FB7 C;  3D36 A;  1IXB A;  1TVK B;  2CK3 G;  1FD9 A;  5EIB D;  2ZE6 A;  5KA6 A;  4P9P A;  2OCC B;  4O4I A;  1M9N A;  1JJ2 U;  1BSM A;  4IHJ A;  5B1B C;  5LOV B;  4J7Z A;  3WFV A;  2BOB C;  4X20 B;  4FLY A;  3JAL B;  3RYH A;  1MMM A;  1PNL A;  3SPG A;  2CGN A;  2XTA A;  3G4S V;  1VMG A;  5B66 Z;  1QLN A;  4NVP A;  5JJJ B;  1SS3 A;  3BCC H;  2NN4 A;  3HKE A;  3FD9 A;  3JD3 A;  4JYA B;  3SJB C;  4OGQ B;  5EIB C;  1GN2 A;  3WG7 C;  1JVM A;  5ITZ A;  1TA8 A;  4DR2 O;  2HKO A;  4LH7 A;  5IYC O;  3AK1 A;  3MDS A;  2QTS A;  4NXM B;  4UFZ A;  1XNQ B;  1TAE A;  2IBZ H;  4MVR A;  4DV4 B;  1QVG U;  2BOC C;  2RQ6 A;  3SR2 C;  4F6R B;  4RQF A;  1B06 A;  2LJ2 A;  1AP5 A;  3NXS A;  3CXH F;  2Y4U A;  2JEX A;  3AG1 B;  3O65 A;  3J81 N;  2W0X A;  3CHX A;  5FPR A;  4UCO A;  3Q4H A;  3DC6 A;  2DQ0 A;  3WB0 A;  2F66 C;  4X1I B;  4BR6 A;  2UXB O;  1GN4 A;  1NBM G;  5B1A B;  4EEQ A;  4RAI A;  4GX0 A;  3B8N A;  3K03 A;  1XMO B;  1JPX A;  4JI6 O;  2UU9 B;  4JAV A;  1AP6 A;  2O57 A;  5DEC A;  5CB4 B;  1B04 A;  4RUE A;  2UUA B;  3QO5 A;  2GHY A;  1NTM H;  2GDS A;  1S5H C;  4UVA A;  3CRQ A;  4BW9 A;  1IXM A;  1ZL8 A;  2DN9 A;  4ZBM A;  4OPH A;  2P4K A;  3KCY A;  1YIJ V;  3CSX A;  2RCV A;  1WA8 B;  2IU3 A;  2Y69 C;  1HNW O;  1SQG A;  1GMG A;  1WB8 A;  1N34 O;  4DR5 B;  3CE2 A;  1LNQ A;  4JV5 O;  1Y6X A;  3UQ8 A;  1N33 B;  4CH5 A;  4FLT A;  4HAM A;  2QKA A;  2ZNJ A;  2ZT9 B;  4O4J A;  1JFF B;  1M57 B;  2Q68 A;  4LF7 O;  4JAS A;  5C8Y A;  4IIJ B;  4G27 B;  1Q90 D;  4FZ0 A;  2V1D A;  5JVD A;  3R65 A;  4FFK A;  1GAX A;  3CPW U;  4ZI7 B;  3CCL V;  1PNK A;  4TOI A;  2YIA A;  3C3T A;  1VF7 A;  4PV1 B;  5H6Q A;  4I7Z B;  2YUA A;  3OUS A;  3DTU B;  3D36 C;  5LGT A;  2V7Q G;  1WAZ A;  3ZHR A;  4I4T B;  5KA5 A;  4DUZ B;  4UV8 A;  3H1K H;  1IZ3 A;  5LP6 A;  4UVB A;  1HDJ A;  3TXS A;  4WF9 V;  2AZ2 A;  1UPG A;  5KUM A;  2HJF C;  1SF9 A;  4D7T A;  2EIN C;  4DV5 O;  1F7Y A;  3CRM A;  1VF5 B;  4X89 A;  2ZIO A;  2JRI A;  5B1O A;  1PM9 A;  5IY5 B;  1NS1 A;  4JZ2 A;  4DV2 B;  5A2Q N;  4I55 B;  2WLK A;  4FIP C;  4HYO A;  3H1H H;  4WCE V;  1CEZ A;  2E5L O;  4ASU G;  1K73 W;  1XMQ B;  1BS3 A;  2EBO A;  5JH7 A;  4LF6 B;  5L3F A;  2YI9 A;  1VQ9 V;  1K33 A;  4NTW A;  4ZOL A;  4B3M O;  2OYQ A;  2WLH A;  4FLV A;  2YDE A;  5BMV B;  4PD4 F;  4FPP A;  1NKD A;  1K4D C;  3RYH B;  1RM1 C;  3CRR A;  2QWQ B;  2QEX V;  1JX9 A;  1PL4 A;  2M7W A;  4JI2 B;  1ZAU A;  2ETN A;  1GKF A;  1YVW A;  5H5N A;  3JAS A;  3CCQ V;  5EZY B;  4RQE A;  2R70 A;  3BA9 A;  3QF7 A;  4J42 A;  3HKE B;  3T1Y O;  3IC9 A;  1K9M W;  1OZ0 A;  4CS3 A;  2EUL A;  3BRC A;  3CRC A;  3G80 A;  2LFS A;  5ITZ B;  4JI1 B;  3JAT A;  1AB3 A;  4GX5 A;  3E86 A;  1FXK A;  2ZIN A;  4I0X B;  4JI3 O;  3W7X A;  5L3E A;  4DR6 B;  1KUQ A;  1YIT V;  3A2F A;  2A3Q A;  4JYB A;  1ORQ C;  4HBN A;  1VQP V;  1V55 C;  2LP7 A;  4JI0 O;  2A7W A;  2DJV A;  2BSK B;  3UT5 A;  2LW1 A;  2B9Z A;  1BE3 H;  2ZXW B;  4H44 B;  1VQK V;  4O4H B;  5GW7 A;  3OMI B;  1ENV A;  1H38 A;  3JCU Z;  3K0D A;  4YJ3 A;  2Q9L A;  3K5O A;  4UB6 Z;  2XAJ A;  4DR4 B;  4JAA A;  2JGD B;  5GON B;  1FXH A;  4GKJ O;  3BHP A;  1EM1 A;  4J9Z B;  3AK2 A;  3ZMS A;  1RSO A;  1N32 O;  1FFX A;  1L0N H;  1ZL8 B;  2DYR B;  2EIJ C;  2WPD G;  2QM8 A;  3ABU A;  3LDE A;  2RNB A;  1QR9 A;  2GTA A;  4Q20 A;  4BWA A;  4QPK A;  1ZX3 A;  5DN6 G;  2EIK C;  5KMG A;  3C3S A;  2AXT Z;  4I9W A;  1XL6 A;  2ZM6 O;  2VQE O;  1CPY A;  3AG4 B;  3B4S A;  1IBM O;  4ICG A;  3FB8 C;  2GSM B;  3CCR V;  3U11 A;  4TSF G;  2EIM C;  3N2K B;  5EK0 A;  3TJT A;  2VS0 A;  2CH7 A;  1XI1 A;  1BHB A;  3L71 H;  3R66 A;  5LMU O;  4X66 O;  2OTL V;  2ARH A;  4PDR A;  1P84 F;  1SA0 A;  4U3J A;  4P2Z A;  3LUT B;  2ILM A;  1XQ8 A;  4TUY B;  1D5N A;  2WLI A;  3VQX A;  3EFF K;  3ZED A;  5D5P A;  4B08 A;  3CEI A;  1QVF U;  4FK5 C;  1GN6 A;  1WP8 A;  1T5E A;  3BFR A;  3IJ4 A;  5KAI Z;  5L3D A;  1MSD A;  4KUM A;  3T1H B;  2EIL B;  3JAK A;  1WJZ A;  3CJH A;  4CBC A;  4JI8 O;  4YJ2 A;  2JS3 A;  2F4V B;  4XDL A;  1V54 C;  5BR8 B;  3HB3 B;  1Y66 A;  1DF4 A;  3LNN A;  1HNZ O;  4B3T B;  1PV0 A;  5IYB O;  2XHB A;  4DV7 O;  1M56 B;  2DW4 A;  1NT2 B;  1VQ7 V;  5CBG A;  1IBK O;  2G38 A;  2GV9 A;  3E8H A;  3VBB A;  1M93 A;  3AG7 A;  4ZIB A;  4TT3 G;  4L87 A;  3ZHU A;  2A9H A;  4Z1M G;  3APO A;  2UXD O;  2W6J G;  3JSN A;  1KU9 A;  4K35 A;  3L70 H;  4EB6 A;  1I94 O;  1QNM A;  4WFF A;  1S72 V;  1SER A;  1YTF D;  4DW1 A;  3VOU A;  2B5U A;  4DV0 O;  3RWR D;  4GLX A;  4B3R B;  3J80 N;  4Z2W A;  1W0J G;  4LF4 B;  3STL C;  2UUC O;  4D6T H;  4UV9 A;  3JD4 A;  4NXN O;  1Q5O A;  5CA1 B;  2QWN B;  3P30 A;  1JQ0 A;  2FYU H;  2D3O W;  3ZJZ A;  3K9A A;  1GRJ A;  1BHA A;  2L6L A;  4IL6 Z;  3X2Q C;  1IX9 A;  2RN9 A;  4DV6 O;  1IBL O;  1Z5V A;  4GUN A;  1YI2 V;  4NTY A;  2LFR A;  2GTS A;  3CB2 A;  3SJA C;  4WFE A;  5DED A;  4KHP B;  5L3B A;  3RT3 C;  1YZB A;  3H9V A;  2GUZ B;  2IM9 A;  1I5Y A;  2IJK A;  2E74 B;  4CH6 A;  4IYH A;  2BTO A;  4LNU B;  5JCO A;  4MTF A;  1US6 A;  1XL4 A;  1VQ5 V;  3RFR A;  4J9Y B;  3HKB B;  3OW2 U;  2UXX A;  4PDL A;  1FAF A;  4JGS A;  1OCZ C;  4I50 B;  2WLJ A;  3UT5 B;  2P22 C;  2QWR B;  3N27 A;  4DYL A;  2LW7 A;  1BGY H;  2WSS G;  1VF6 C;  3EHB B;  1H8E G;  3SYQ A;  1QU7 A;  2NR5 A;  3BPZ A;  4GKK B;  1NR7 A;  1ZTE A;  2KSD A;  5FPO A;  4JYA O;  2JVD A;  3RVZ A;  1WPX A;  3SGI A;  2YEV B;  2ADQ B;  1CP9 A;  4UCV A;  4JYY A;  5LHH A;  3DXR A;  3A0R A;  3K79 A;  4FM2 A;  2OTJ V;  4X62 B;  4LR3 A;  4NXM O;  1S5L Z;  5EYP A;  1JR9 A;  3BAA A;  1E79 G;  2HP8 A;  3DC5 A;  5KHI A;  4KXR A;  3KCX A;  2IW5 A;  1XNQ O;  2AW9 A;  4DV4 O;  4MW8 A;  4JPR A;  3RYF A;  5LL6 Y;  3F7V C;  4WBN A;  4LC1 A;  1BCC H;  4P9O A;  3JD0 A;  3SPH A;  5IWA B;  1N36 B;  1GTO A;  2EJR A;  1SQF A;  1KP2 A;  5KX5 B;  1GH6 A;  3CCS V;  4TV8 A;  3OTO B;  3F5W C;  2JIZ G;  1OCR B;  4G2K A;  4JI5 B;  2CUG A;  3RN4 A;  4PHZ A;  1XMO O;  1NQT A;  4XDK A;  2HEP A;  2AHY A;  4LF5 B;  3AG2 C;  2UU9 O;  5F2V O;  3UO3 A;  3K5M A;  1LUW A;  1SA0 B;  2DYS B;  2X6A A;  3CCM V;  3G71 V;  2UUA O;  5CA0 A;  2VQF B;  4OX9 B;  1EN6 A;  4PI2 A;  2H8P C;  2P4V A;  3SYP A;  2ZDI C;  1AR5 A;  1SET A;  1SZT A;  2WLI B;  2YID A;  1F51 A;  3OEE G;  3L73 H;  4IGG A;  3SDL A;  2B1I A;  3STZ C;  4DR5 O;  1PD3 A;  3M7M X;  3LSU A;  3NR7 A;  3JAK B;  3CJH B;  1N33 O;  1H2N A;  3RYC A;  3HKD B;  3L75 H;  1FFT B;  4FM1 A;  4KL1 A;  4LWS A;  2QSA A;  4ZHQ A;  4FLW A;  3AG1 C;  2Q6A A;  5LXT A;  1YJ9 V;  4DRX A;  4YY3 B;  3VQY A;  2YS8 A;  3CMA V;  4O2A B;  4I9Q A;  3SPI A;  2XAF A;  2AGA A;  3ZBH A;  1SQB H;  5B1A C;  4BW5 A;  1K5S A;  3BAB A;  4FMT A;  3DGE A;  5H9C A;  4E4E A;  3CCU V;  3JAR A;  4R7C A;  3K04 A;  5IJ0 A;  1V9P A;  4CZZ A;  4DR3 B;  4DW0 A;  5IYZ A;  3ETE A;  4BIU A;  1U96 A;  3ABK C;  4NYK A;  3ABM C;  2VWJ A;  1MZE A;  4XBF A;  2XT9 A;  3TCU A;  1EN4 A;  3MAQ A;  4DUZ O;  1YJW V;  3ZIA G;  2X6C A;  3W7T A;  1N0J A;  1VQ6 V;  1QLE B;  3ZN0 A;  5JCO C;  5KHK A;  1EZV H;  2XOK G;  2Q5Z A;  3OGC C;  3QVN A;  3RBZ A;  1M57 C;  3UO2 A;  4X1K B;  3EXA A;  2QM4 A;  1H8H G;  4DV2 O;  3AK3 A;  2R9A A;  5E79 Z;  4TV9 B;  5JQG A;  1GO3 F;  1XMQ O;  4H37 A;  2QWP B;  4AI8 A;  3JYC A;  5J9P C;  2IJJ A;  2ZE7 A;  1SES A;  3HPL C;  3H1L H;  1OCO C;  4LF6 O;  2BE3 A;  3M99 B;  1YHQ V;  3RYI A;  1OHH G;  5TIS Z;  3GB7 C;  1Z5W A;  1PL0 A;  4LFA B;  2EX3 A;  3BEH A;  4U3F H;  1FXV A;  2L35 A;  4O4L A;  1R3J C;  2GBO A;  1I08 A;  2A06 H;  4WFA V;  5LYJ B;  3TXQ A;  4JI2 O;  1Q82 W;  3E83 A;  4QPJ A;  2D2C B;  1ZSP A;  1FPO A;  1S0V A;  1IUR A;  3QG5 A;  2VRZ A;  2NNU A;  1LR1 A;  2KKW A;  3FAV B;  3ZMU A;  3T4D A;  1SZX A;  2XND G;  4AHC A;  3CXC U;  4JI1 O;  5FLX N;  4HNA B;  3DXR B;  2Y48 A;  3CCJ V;  1D2D A;  4DR1 B;  1NVP D;  2BTQ A;  2ZE5 A;  1COW G;  1JA8 A;  5EC2 C;  3ZMT A;  2OT5 A;  4DR6 O;  4RUF A;  2R9R B;  3JAW A;  4NR1 A;  3E8B A;  1HWY A;  4BIZ A;  2WA4 A;  1KB9 F;  3K9S A;  3LDC A;  1TGO A;  1OCC B;  4TWK A;  4YHH B;  5LMN B;  4LFB B;  1A32 A;  3WU2 Z;  4O4I B;  4CC5 A;  2XAG A;  3S3W A;  4PDV A;  3PJS K;  4IHJ B;  1VQN V;  1H2S B;  1S3J A;  1FS0 G;  4DUY O;  3OD4 A;  2F43 G;  4DR4 O;  1N4C A;  1MOF A;  5CA0 B;  2EIN B;  1L8D A;  4MVM A;  2ADP A;  4L8J A;  2DWD C;  1NH2 B;  4GX2 A;  3CC7 V;  2P90 A;  5J2T A;  1BQ0 A;  1EN5 A;  4LF7 B;  4JI4 B;  3HKC A;  3UKM A;  2JGU A;  1WNS A;  2Y4T A;  2HHH B;  3WB2 A;  1ZWI C;  4LWS B;  3T4Z A;  1KKC A;  3GVM A;  1BZK A;  3LSS A;  1PKX A;  2ZQM A;  4LFC B;  2P67 A;  2KG7 A;  1P4R A;  1KKD A;  2DE0 X;  3A0B Z;  2YXH A;  1IDS A;  1Y76 A;  3KKY A;  2KB1 A;  3K06 A;  1XNR B;  3W7W A;  2ZXW C;  1SRY A;  3RGB A;  4BIO A;  3JCZ A;  2OWO A;  3ZN1 A;  5BXZ A;  3MHH C;  5IJ0 B;  3FFQ A;  1K7D A;  5CMU A;  5IYZ B;  3ZHT A;  1NU1 H;  1TUB A;  3K3W A;  3Q4H B;  5IJ9 A;  3SJC C;  1GN3 A;  5KHJ A;  1GM8 A;  3D8C A;  4QE9 A;  1G4Y B;  4NTX A;  1EFR G;  1YCI A;  1YDX A;  4DR7 B;  1LUV A;  1AI5 A;  3E22 A;  3T1H O;  5B3S B;  1S5J A;  3OMA B;  4X88 A;  3B8M A;  5IT9 N;  4LP8 A;  1K97 A;  4JI7 B;  1Q43 A;  3RW0 A;  3FB5 C;  4YIP A;  2Q73 A;  4WFB V;  3APQ A;  1EBO A;  1NTK H;  4I5S A;  2F93 B;  2F4V O;  5BR8 O;  2B1G A;  2PGG A;  3H1J H;  2XAS A;  3AG4 C;  4B3T O;  2Z5U A;  2Z0A A;  1MA1 A;  2HFE C;  1FJG B;  3UM7 A;  1K8A W;  3LSQ A;  2Q7E A;  1DF5 A;  3ZRX A;  1Q7Y W;  1HR0 B;  5LBQ A;  1VF6 A;  3BY6 A;  3ASO C;  3H01 A;  3ABL B;  2HR3 A;  1I7F A;  4MVU A;  5LA6 A;  4O4J B;  4XDJ A;  3OTF A;  4B3R O;  2EIL C;  4UVC A;  5C8Y B;  4LF4 O;  2F23 A;  1TVK A;  3RYI B;  2UUB B;  1WPB A;  1YSC A;  5JVD B;  4B7K A;  1CXZ B;  3QNE A;  4O4L B;  2CTW A;  4R50 A;  1UJW B;  3ZRW A;  5LOV A;  4JI3 B;  2DQ3 A;  2QTO A;  1VEW A;  5K1P A;  1M56 C;  4X20 A;  2VWK A;  1FKA O;  1M5I A;  4X65 B;  1P49 A;  4W4L A;  4KHP O;  5LP6 B;  1ZUQ A;  4DO2 A;  1Z2G A;  3CME V;  1W0K G;  2LO1 A;  4OXS A;  4A5U B;  1VIB A;  3ZS8 C;  5E1A C;  1K5Q A;  3L72 H;  2IH1 C;  4N23 A;  4LF9 O;  2CTR A;  2Q4P A;  3A0H Z;  2ZDI A;  4UB8 Z;  2JEU A;  4AIL C;  4ZKI A;  3ZMZ A;  4F6E A;  1EZJ A;  2WAM A;  5KHG A;  5IYD O;  3G6E V;  1HNX B;  2EJ7 A;  3ZX6 A;  1X59 A;  1R3K C;  2DOS A;  4LH6 A;  5JH7 B;  4FLX A;  3PN1 A;  3SYA A;  4GKK O;  4MW3 A;  1V54 B;  2QKC A;  4ZOL B;  1M90 W;  4G28 B;  1WB7 A;  3K57 A;  4UXN A;  4K8Z A;  1R73 A;  4X62 O;  3A8T A;  3RVY A;  3I55 V;  5J2T B;  4LCU C;  3AG3 B;  2WLN A;  4MTX A;  1E1Q G;  3B40 A;  3JAS B;  2Q7H A;  2WA3 A;  3LNM B;  1W59 A;  1QR8 A;  3ETG A;  1KMI Z;  3B77 A;  4UCS A;  2F1M A;  5IWA O;  2N74 A;  1N36 O;  2KQX A;  1WA8 A;  3O9O A;  1R1B A;  2JJ1 G;  5LHG A;  3J7A U;  3ZCC A;  2QR4 A;  3FKS G;  3OTO O;  1VP7 A;  1MNG A;  1XIL A;  3JAT B;  1AJP A;  4JI5 O;  3D3Q A;  4JZG A;  3JD2 A;  1XEQ A;  1FXK B;  3SPC A;  4LF5 O;  2M6Y A;  2YI8 A;  2H3O A;  2WWW A;  3CYO A;  1MG1 A;  4MVS A;  4OX9 O;  1R3I C;  1JFF A;  1NI8 A;  5B1N A;  1S77 D;  2HLD G;  4IIJ A;  3E8G A;  3THO A;  3CWB H;  1H2L A;  1RP3 B;  3T1C A;  4ZI7 A;  4YJ3 B;  2NLJ C;  3DSQ A;  4MSW C;  4IT5 A;  4B3S B;  3P32 A;  4X8A A;  3ZRV A;  2F95 B;  3ETD A;  1RSO B;  4UCU A;  1FFX B;  4J41 A;  4YY3 O;  1D5A A;  1Q3E A;  3CCE V;  1VQM V;  1B6Q A;  2OCC C;  3ASN B;  1N8R W;  3W7U A;  2FL4 A;  4K0K B;  1XRE A;  4QJF B;  3L9D A;  5KMG B;  3WB1 A;  2Q8V A;  2P7T C;  2DYS C;  4DR3 O;  1RPR A;  1XDC A;  2P5O A;  3I5D A;  5FNV A;  4DV3 B;  4MTG A;  1I0H A;  1JOY A;  4I55 A;  2CH7 B;  2XUM A;  4HZ3 A;  2YXY A;  4YXW G;  3EVK A;  2UXC B;  2IH3 C;  4U3J B;  1O9G A;  1Y67 A;  1PPJ H;  1L0L H;  4DV1 B;  4C7U A;  4CS4 A;  4PDM A;  5D5Q A;  4DK0 A;  4QGP A;  2LGQ A;  3ZRW B;  3OEH G;  3N2G A;  1X4T A;  4EFE A;  5JJN B;  5BMV A;  1Q81 W;  4LF8 B;  2ZKO A;  1JMK C;  2RDC A;  4JAU A;  4YJ2 B;  4FZ1 A;  2PY5 A;  4J7J A;  3KG2 A;  3CP1 A;  4IYI A;  3H1I H;  1P7G A;  1WP7 A;  5B1B B;  3AG2 B;  2R9I A;  3SJQ C;  2CE4 A;  5EZY A;  3I56 V;  3OGI B;  4AQY B;  3AEI A;  4FM0 A;  4MVZ A;  4R6Z A;  5EBW C;  4JTA B;  5EC1 C;  5KLV H;  4LFA O;  1Q6U A;  1KYO F;  1H2G A;  1QLE C;  1VAR A;  1BQZ A;  5C93 A;  5FL7 G;  4I0X A;  1J5E B;  2CTP A;  4X64 B;  4EB6 B;  1G6U A;  4O2B A;  3IGA C;  3CX5 F;  3WG7 B;  3CC2 V;  2Y0P A;  1BL8 A;  3K58 A;  4JTC B;  1VQ8 V;  4NB5 A;  3ZMV A;  2HVK C;  2BSK A;  1TUE B;  2YC0 A;  2ZR3 A;  4FLZ A;  3SYC A;  5K1X A;  4RWU A;  4O4H A;  2CGO A;  4PA4 A;  3S3X A;  4DR1 O;  2YIB D;  2ZD9 A;  1WN7 A;  3FYE B;  2JGD A;  5GON A;  2EZO A;  3OE7 G;  3ABK B;  1WLE A;  3ABM B;  1R6K A;  1Q6I A;  4DXW A;  1HP8 A;  3U0Z A;  2IU0 A;  2V4D A;  1YEW A;  4LFB O;  3C90 A;  4YHH O;  5LMN O;  3HR0 A;  2BCC H;  3CD6 V;  3D3I A;  3K08 A;  3E89 A;  5DM6 V;  4UCR A;  4DR2 B;  3E35 A;  4PA6 A;  2ZR2 A;  2JDI G;  2Y69 B;  3ZRS A;  1DK1 A;  2UXN A;  1W2B U;  1MZF A;  3JSL A;  3P3N A;  3N2K A;  1DLB A;  4MS2 A;  4PJ0 Z;  2JJ2 G;  2WLL A;  1Y4M A;  5KUK A;  4QE7 A;  4JI4 O;  4GYC B;  5CN0 A;  1JCH A;  1NH2 D;  1AI4 A;  5BY1 A;  1NZ6 A;  5IDJ A;  4TUY A;  2PYJ A;  2HHH O;  3E8F A;  5IY5 C;  3K59 A;  1AI6 A;  2K1E A;  5A9G A;  2UXB B;  1NJI W;  1URF A;  2R72 A;  1M4U A;  2WLM A;  2ODM A;  4U7N A;  3CS5 A;  1GK9 A;  1OCO B;  4LFC O;  2W0F C;  4X1Y A;  4K3A A;  3F5T A;  5EYP B;  1DGS A;  4JI6 B;  1AJQ A;  1OCC C;  3TK1 A;  4P30 A;  1XNR O;  3VQV A;  4OPA A;  3K5L A;  2K9P A;  1ARO P;  3RYF B;  4Q6G A;  2MW2 B;  3ZHQ A;  5L3C A;  3K5N A;  2C2A A;  4WBN B;  2ITD C;  1ROP A;  1K4C C;  2CTQ A;  2QE7 G;  1HNW B;  5FNV B;  1Q6H A;  1N34 B;  2YIC A;  1MSW D;  4TV8 B;  4PI0 A;  4JV5 B;  1SKV A;  3GWK C;  5CBF A;  1N0N A;  4DR7 O;  5H2F Z;  3ETQ A;  2QKS A;  4EKW A;  3JAM N;  4CH3 A;  4JI7 O;  2A0L A;  3IFX A;  3VQW A;  2JK5 C;  3L74 H;  2ATK C;  4MTO A;  5EBL C;  3ABT A;  2PUS A;  1Y74 A;  3OM3 B;  1F4M A;  5LGU A;  2Y0I A;  4PA9 A;  4YIO A;  1QBZ A;  5B5E Z;  1FJG O;  1AVM A;  3N2G B;  1AR4 A;  3F7Y C;  5CA1 A;  5CBH A;  2ZNI A;  2W6I G;  3RYC B;  1QQC A;  1AJN A;  4UUJ C;  2HVJ C;  1P7B A;  1HR0 O;  3UCS C;  4ZHQ B;  1ZLZ A;  5JJE B;  2FB5 A;  5LXT B;  4CC6 A;  3FYI B;  4DRX B;  1F4N A;  3IC7 A;  1R3L C;  2P6J A;  5H6R A;  3OFN G;  1YF2 A;  1RM1 B;  2OIE A;  5B3S C;  5J2U A;  1NVP B;  2H94 A;  3JAR B;  4BAY A;  3OT7 A;  2UUB O;  1F23 A;  2GUZ A;  4CS2 A;  4ABM A;  4DV5 B;  4KP4 A;  1J95 A;  3JD1 A;  2P06 A;  4LNU A;  2DYR C;  4EFB A;  2PYL A;  5GTI Z;  3TGU H;  4O2B B;  2Q0A A;  4J80 A;  3HKB A;  4QNH B;  2E5L B;  1RPO A;  4E2L A;  1AI7 A;  2DWE C;  4X65 O;  2FML A;  1B3Q A;  1XUQ A;  5KHH A;  1OJH A;  4I50 A;  3B09 A;  3LDD A;  4D7S A;  4MVO A;  1AR1 B;  2E76 B;  4WFG A;  3ABL C;  2ZE8 A;  4B3M B;  4TQD A;  4DUY B;  2AZ0 A;  3OAA G;  2YEV A;  1V55 B;  4X9Q A;  2RJZ A;  2YXL A;  1YJN V;  1S76 D;  3OR7 C;  3OR6 C;  5JQG B;  3MHS C;  3M8A A;  3QO7 A;  4Z1V A;  4DK1 A;  3K0G A;  4N21 A;  1HNX O;  4FFB A;  2PI4 A;  2HG5 C;  3T1Y B;  4GCZ A;  1XOU A;  5KX5 A;  2EIJ B;  2CDY A;  1THZ A;  1R6T A;  4FJC C;  5LP6 C;  1FYJ A;  2QGN A;  4TQF A;  4PA3 A;  1M1K W;  2EIK B;  3ICX A;  1JJO A;  4LBE C;  2RMK B;  2WLL B;  2IJH A;  4JF3 A;  4J11 A;  2N04 A;  3OUF A;  3JAL A;  3FX7 A;  1BT8 A;  4GT1 A;  4GZR B;  2ZCE A;  3ASO B;  2PTM A;  3W7S A;  4JI0 B;  1L1F A;  1PNM A;  2EIM B;  3SYO A;  1KP3 A;  4X1Y B;  2BTQ B;  5HFM A;  1NTZ H;  3HKD A;  2IJI A;  1VQO V;  4GKJ B;  3QTC A;  1DTO A;  2PZS A;  1N32 B;  1QHT A;  3JAW B;  2EZP A;  4CH4 A;  5HFL A;  4GX1 A;  4KFM A;  2FKX A;  4H13 B;  1YXB A;  4O2A A;  5GTH Z;  3G6B A;  5LGN A;  3FB6 C;  2LGW A;  3T2M A;  4F6R A;  3OMN B;  1KBH A;  2QWO B;  2XAH A;  3QO8 A;  2E3C A;  3AG3 C;  2DMX A;  4PA7 A;  2ZM6 B;  2VQE B;  3E2E A;  1XHZ A;  2ZIM A;  3IAY A;  4F4L A;  1GM7 A;  1QCE A;  1IBM B;  5EBM C;  4X1I A;  1NR1 A;  1O9H A;  2X6B A;  3KZI Z;  4B3S O;  4FVM A;  4MT8 A;  2LQT A;  4WFH A;  1Y74 B;  3MD0 A;  2X7R B;  5LMU B;  3SPJ A;  4X66 B;  5IE9 A;  5CB4 A;  5L3G A;  4H0L B;  2PI5 A;  1H2K A;  2QM7 A;  3HKC B;  3TET A;  2Q69 A;  2Q7G A;  4K0K O;  4H33 A;  1FXK C;  2CAZ C;  5LHI A;  5CA3 A;  4NKG B;  3P3P A;  4DV3 O;  1G8M A;  4X1K A;  1K92 A;  1R6N A;  4J10 A;  3G67 A;  4JYC A;  1HW7 A;  2KG7 B;  5KAF Z;  1AIL A;  5BZB A;  1PP9 H;  1SC5 B;  4J7K A;  1Y76 B;  4U7O A;  4JI8 B;  1MAB G;  1K34 A;  3ZHV A;  1SQP H;  1SQQ H;  1U97 A;  2OCH A;  2X0L A;  2E75 B;  2UXC O;  4TV9 A;  5J2U B;  3ML0 A;  1KQS U;  2Q67 A;  1OV9 A;  3X2Q B;  2VQF O;  1I5X A;  2MK3 A;  1SQX H;  3BVO A;  2QJ1 A;  1HNZ B;  4DV1 O;  4FLU A;  1TUB B;  4DV7 B;  1K3E A;  2XAQ A;  5IJ9 B;  1VQ4 V;  4QIW F;  1KEC A;  4LF9 B;  3B2E E;  1IBK B;  1UFI A;  4B7E A;  1G1X B;  3E22 B;  1KC8 W;  3CC4 V;  1KD1 W;  3ASN C;  1YTF B;  4LF8 O;  2OIG A;  2UXD B;  2FTK A;  5JWP A;  4JTD B;  2YSU B;  5LYJ A;  5AG2 A;  1I94 B;  3GWO A;  2Q0O C;  2AHZ A; 
#chains in the Genus database with same CATH homology
 2P90 A;  4KUM A;  1VQL V;  1E1R G;  4R8C A;  2A79 B;  2EIL B;  2ZD9 A;  1GM9 A;  3UKM A;  1OCR C;  2QA4 V;  3FYE B;  2EZO A;  4CBC A;  2ITC C;  2Z3Y A;  3OE7 G;  3ABK B;  1WLE A;  1ZWI C;  3ABM B;  1OCZ B;  3T4Z A;  4XDL A;  1R6K A;  1V54 C;  4DXW A;  3HB3 B;  1Y66 A;  3LSS A;  1Q86 W;  1DF4 A;  1PKX A;  2ZQM A;  3CCV V;  2IU0 A;  4PEL A;  2P67 A;  1KKD A;  1P4R A;  5IYB O;  1BMF G;  1M56 B;  2KB1 A;  2DW4 A;  3K06 A;  4MVQ A;  3W7W A;  1VQ7 V;  2ZXW C;  4RO2 A;  1SRY A;  5CBG A;  3CD6 V;  3D3I A;  3K08 A;  3E89 A;  3JCZ A;  5DM6 V;  3E8H A;  3VBB A;  3ZN1 A;  4TT3 G;  4L87 A;  3FB7 C;  2A9H A;  3MHH C;  4Z1M G;  3D36 A;  1K7D A;  3E35 A;  4PA6 A;  2ZR2 A;  5CMU A;  2CK3 G;  2JDI G;  2Y69 B;  3ZRS A;  2W6J G;  5KA6 A;  2UXN A;  4P9P A;  3K3W A;  1W2B U;  1DLB A;  4WFF A;  1SER A;  2OCC B;  1S72 V;  1GM8 A;  4MS2 A;  4QE9 A;  1YTF D;  1M9N A;  1G4Y B;  3VOU A;  1JJ2 U;  1EFR G;  2JJ2 G;  2WLL A;  1Y4M A;  2B5U A;  1AI5 A;  5KUK A;  5B1B C;  4QE7 A;  5B3S B;  5CN0 A;  4X88 A;  3OMA B;  3WFV A;  3B8M A;  4LP8 A;  1JCH A;  1W0J G;  1NH2 D;  1AI4 A;  3STL C;  1K97 A;  2BOB C;  5IDJ A;  4UV9 A;  3JD4 A;  3E8F A;  5IY5 C;  1PNL A;  3SPG A;  3P30 A;  1JQ0 A;  1AI6 A;  2K1E A;  2D3O W;  3RW0 A;  3FB5 C;  3ZJZ A;  3K9A A;  4WFB V;  1EBO A;  1BHA A;  1NJI W;  4I5S A;  2B1G A;  3G4S V;  2WLM A;  3X2Q C;  2XAS A;  4U7N A;  3AG4 C;  1GK9 A;  1OCO B;  1QLN A;  2W0F C;  2Z5U A;  3TK1 A;  1AJQ A;  1OCC C;  2HFE C;  4P30 A;  1YI2 V;  3UM7 A;  2LFR A;  1K8A W;  3LSQ A;  3JD3 A;  1DF5 A;  1ARO P;  3ZRX A;  1Q7Y W;  4WFE A;  3WG7 C;  1JVM A;  5L3C A;  2C2A A;  5L3B A;  2HKO A;  5IYC O;  2ITD C;  1ROP A;  1K4C C;  5LBQ A;  3BY6 A;  3ASO C;  2QE7 G;  3H01 A;  3ABL B;  2HR3 A;  4MVU A;  4MVR A;  1I5Y A;  1MSW D;  2IJK A;  2BOC C;  1QVG U;  4XDJ A;  5CBF A;  4MTF A;  4RQF A;  1XL4 A;  3NXS A;  2EIL C;  2QKS A;  1VQ5 V;  4UVC A;  2JEX A;  4EKW A;  4J9Y B;  3AG1 B;  3OW2 U;  1YSC A;  2A0L A;  3IFX A;  2UXX A;  3QNE A;  2JK5 C;  4MTO A;  2ATK C;  5EBL C;  4PDL A;  2DQ0 A;  4JGS A;  1OCZ C;  3ABT A;  1NBM G;  2WLJ A;  3OM3 B;  4R50 A;  5B1A B;  3ZRW A;  1UJW B;  1F4M A;  5LGU A;  4RAI A;  2WSS G;  2DQ3 A;  3B8N A;  3K03 A;  1JPX A;  1QBZ A;  4GX0 A;  4PA9 A;  2QTO A;  3EHB B;  1H8E G;  4JAV A;  3SYQ A;  1M56 C;  1NR7 A;  4RUE A;  3F7Y C;  5CBH A;  3QO5 A;  2GHY A;  3RVZ A;  1WPX A;  2W6I G;  1S5H C;  2YEV B;  1AJN A;  4UUJ C;  4UVA A;  1CP9 A;  2HVJ C;  1IXM A;  4ZBM A;  1P7B A;  4DO2 A;  5LHH A;  3CME V;  1W0K G;  3A0R A;  3K79 A;  1YIJ V;  4OXS A;  2OTJ V;  2IU3 A;  2Y69 C;  3FYI B;  1GMG A;  1E79 G;  1F4N A;  3IC7 A;  2IW5 A;  1R3L C;  1LNQ A;  4MW8 A;  5E1A C;  2P6J A;  4JPR A;  1K5Q A;  5H6R A;  2IH1 C;  3OFN G;  4N23 A;  3F7V C;  2ZDI A;  4LC1 A;  2JEU A;  5B3S C;  1RM1 B;  4ZKI A;  4P9O A;  2H94 A;  1NVP B;  4HAM A;  3JD0 A;  3SPH A;  4BAY A;  3ZMZ A;  1GTO A;  1F23 A;  2EJR A;  1EZJ A;  2WAM A;  1KP2 A;  3CCS V;  1M57 B;  2Q68 A;  3F5W C;  4KP4 A;  2JIZ G;  1J95 A;  1OCR B;  3JD1 A;  4G2K A;  5IYD O;  3G6E V;  2DYR C;  1NQT A;  1R3K C;  4JAS A;  4XDK A;  2AHY A;  3AG2 C;  4G27 B;  4QNH B;  3SYA A;  2DYS B;  2V1D A;  3CCM V;  2X6A A;  3R65 A;  4MW3 A;  1V54 B;  3G71 V;  1RPO A;  4E2L A;  1M90 W;  1AI7 A;  3CPW U;  2DWE C;  3CCL V;  1PNK A;  2H8P C;  4G28 B;  3SYP A;  2ZDI C;  1SET A;  1SZT A;  2WLI B;  3LDD A;  4MVO A;  1AR1 B;  4UXN A;  4WFG A;  5H6Q A;  1F51 A;  3OUS A;  3DTU B;  1R73 A;  5LGT A;  3OEE G;  3RVY A;  2V7Q G;  2B1I A;  3STZ C;  3I55 V;  3ABL C;  4LCU C;  3AG3 B;  2WLN A;  5KA5 A;  1PD3 A;  4MTX A;  4UV8 A;  1E1Q G;  3OAA G;  2YEV A;  1FFT B;  1V55 B;  3LNM B;  4UVB A;  1QR8 A;  3ETG A;  4WF9 V;  3B77 A;  3AG1 C;  5KUM A;  1YJN V;  2Q6A A;  1S76 D;  2HJF C;  2JJ1 G;  3OR7 C;  5LHG A;  1YJ9 V;  3ZCC A;  3OR6 C;  2EIN C;  3FKS G;  3MHS C;  3QO7 A;  3CMA V;  1AJP A;  4X89 A;  3SPI A;  3K0G A;  2XAF A;  4N21 A;  5B1O A;  5B1A C;  4BW5 A;  3JD2 A;  1K5S A;  5H9C A;  4FMT A;  3DGE A;  2PI4 A;  5IY5 B;  1FXK B;  3CCU V;  3SPC A;  2HG5 C;  4R7C A;  3K04 A;  2WLK A;  4FIP C;  4HYO A;  4GCZ A;  4WCE V;  1CEZ A;  2WWW A;  3CYO A;  1MG1 A;  4CZZ A;  4MVS A;  2EIJ B;  4ASU G;  1R3I C;  3ETE A;  4BIU A;  1K73 W;  3ABK C;  1THZ A;  3ABM C;  4FJC C;  5B1N A;  1S77 D;  2EBO A;  4PA3 A;  1M1K W;  2EIK B;  2HLD G;  4LBE C;  4XBF A;  3E8G A;  5L3F A;  1VQ9 V;  2WLL B;  3TCU A;  1K33 A;  2IJH A;  4JF3 A;  1YJW V;  3ZIA G;  3OUF A;  3T1C A;  2WLH A;  2NLJ C;  2X6C A;  3W7T A;  1VQ6 V;  4GT1 A;  4MSW C;  1QLE B;  3ASO B;  3ZN0 A;  4FPP A;  1NKD A;  3W7S A;  1K4D C;  1RM1 C;  3P32 A;  4X8A A;  1L1F A;  1PNM A;  3ZRV A;  2QEX V;  1JX9 A;  2EIM B;  2M7W A;  2XOK G;  3ETD A;  3SYO A;  3OGC C;  3RBZ A;  1GKF A;  1M57 C;  3CCE V;  1KP3 A;  3CCQ V;  1VQM V;  5HFM A;  1B6Q A;  2OCC C;  4RQE A;  3ASN B;  1N8R W;  3W7U A;  2IJI A;  1H8H G;  1VQO V;  4QJF B;  1K9M W;  1OZ0 A;  2P7T C;  1DTO A;  2DYS C;  2EZP A;  2LFS A;  5HFL A;  4GX1 A;  4KFM A;  1RPR A;  1GO3 F;  4H37 A;  3JYC A;  5LGN A;  3FB6 C;  4MTG A;  4GX5 A;  5J9P C;  2IJJ A;  3E86 A;  3T2M A;  3OMN B;  1SES A;  3HPL C;  1FXK A;  1JOY A;  1OCO C;  2XAH A;  3W7X A;  3QO8 A;  4HZ3 A;  5L3E A;  3M99 B;  1YHQ V;  4YXW G;  3AG3 C;  1OHH G;  1YIT V;  3GB7 C;  4PA7 A;  2IH3 C;  4JYB A;  1PL0 A;  3E2E A;  3BEH A;  1FXV A;  1ORQ C;  1VQP V;  1R3J C;  1GM7 A;  1QCE A;  4F4L A;  5EBM C;  1V55 C;  2LP7 A;  1NR1 A;  2X6B A;  4WFA V;  4MT8 A;  1Q82 W;  4PDM A;  2ZXW B;  3E83 A;  4QPJ A;  1VQK V;  4WFH A;  5GW7 A;  3ZRW B;  3OMI B;  3MD0 A;  2X7R B;  1ENV A;  1S0V A;  3SPJ A;  1H38 A;  3OEH G;  3K0D A;  5L3G A;  2PI5 A;  2QM7 A;  3TET A;  2NNU A;  2XAJ A;  2Q69 A;  1Q81 W;  4H33 A;  1FXH A;  1FXK C;  4JAU A;  3ZMU A;  3ZMS A;  4J9Z B;  5LHI A;  3T4D A;  3KG2 A;  2XND G;  5CA3 A;  3CP1 A;  3CXC U;  2DYR B;  2EIJ C;  2WPD G;  2Y48 A;  2QM8 A;  3CCJ V;  1G8M A;  3ABU A;  1K92 A;  1R6N A;  5B1B B;  3LDE A;  1NVP D;  3AG2 B;  1QR9 A;  2R9I A;  4JYC A;  3SJQ C;  4Q20 A;  3I56 V;  4QPK A;  5BZB A;  1COW G;  3AEI A;  5DN6 G;  2EIK C;  4U7O A;  5EC2 C;  3ZMT A;  2OT5 A;  1MAB G;  1K34 A;  4MVZ A;  4R6Z A;  4RUF A;  5EBW C;  2R9R B;  2X0L A;  3E8B A;  4I9W A;  1HWY A;  4JTA B;  1XL6 A;  5EC1 C;  3ML0 A;  1KQS U;  2Q67 A;  1CPY A;  3X2Q B;  4BIZ A;  3AG4 B;  1H2G A;  1I5X A;  1QLE C;  2MK3 A;  3FB8 C;  2GSM B;  3LDC A;  3CCR V;  5C93 A;  1OCC B;  5FL7 G;  4TSF G;  1K3E A;  2EIM C;  2XAQ A;  4TWK A;  5EK0 A;  1VQ4 V;  4QIW F;  1KEC A;  1BHB A;  3IGA C;  2XAG A;  4PDV A;  2OTL V;  4PDR A;  3WG7 B;  3CC2 V;  3PJS K;  1BL8 A;  1VQN V;  1KC8 W;  4JTC B;  3CC4 V;  1S3J A;  1FS0 G;  1KD1 W;  1VQ8 V;  4P2Z A;  2F43 G;  3ASN C;  3LUT B;  1YTF B;  3ZMV A;  1MOF A;  2EIN B;  2FTK A;  4JTD B;  2HVK C;  2WLI A;  1TUE B;  4MVM A;  3EFF K;  2YSU B;  2DWD C;  1QVF U;  2ZR3 A;  3SYC A;  4FK5 C;  1NH2 B;  4GX2 A;  3GWO A;  4PA4 A;  2AHZ A;  5L3D A;  3CC7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...