1PD3A

Influenza a nep m1-binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural protein NS2
molecule tags Unknown function
source organism Influenza a virus
publication title Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).
pubmed doi rcsb
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pd3A00
2IJHA 2IJJA 1B6QA 1GMGA 1RPOA 2IJKA 1F4MA 3K79A 1F4NA 1NKDA 1PD3A 2GHYA 1RPRA 1GTOA 2IJIA 4DO2A 1ROPA
chains in the Genus database with same CATH superfamily
4FM0A 3SR2C 4PDLA 2JGDB 1G4YB 2RN9A 3STZC 4BR6A 4I9QA 4K0KO 4JAAA 3OEEG 4R7CA 4DR1O 2ZR3A 2LGQA 2WA4A 2E5LO 4RAIA 1FFXA 2BTOA 1L0LH 3AG2B 4X65O 3G71V 4PDMA 3E83A 4JASA 4IIJA 2OIEA 5B1BB 2DN9A 3ETQA 4K35A 4MVRA 2ZM6O 1GM9A 5CA0B 4LC1A 4FM1A 4XBFA 2OT5A 1Y74B 2PYLA 2JIZG 3N27A 4J9YB 2QM8A 3JD2A 3T1HO 4JZGA 3SJBC 1AI4A 1JVMA 1KP3A 3AK1A 2YICA 5GTHZ 2VQFB 2MK3A 3ZMVA 2D2CB 2IU0A 3C3TA 4GKKB 4QGPA 4GKJO 1Q7YW 2BSKA 2PUSA 4O2AA 4BWAA 2LO1A 5JJNB 5BR8B 2ZCEA 1ZL8A 4ABMA 1GRJA 1Y4MA 2Q0OC 1AB3A 1OZ0A 3HKBA 3CJHA 2K1EA 1XEQA 1W2BU 1OCZB 4NXNB 4UB6Z 5H6RA 3ZRVA 4AHCA 4CS3A 1D2DA 5H6QA 2ZE6A 3UO3A 1XREA 3QO7A 2E76B 2JGUA 1XILA 4FLYA 3E2EA 2UUBB 1I94O 1QCEA 4B3SB 3ZMZA 4DV4O 2PI4A 2UXCB 3FKSG 1JJOA 4F6EA 4MSWC 3FB8C 3U11A 3HKCA 3CS5A 2ZXWB 4YY3O 2W0FC 4YJ3A 2IH1C 1AJNA 2KG7B 4QPKA 1EN4A 5C8YB 3O9OA 5IJ0B 2JEXA 1HNZO 3E35A 3ML0A 3OM3B 4B3TB 3X2QB 5KAFZ 4B3MB 2ZKOA 3ABTA 5JCOA 1H2NA 3OTFA 1VQ6V 1PNMA 3BAAA 3BA9A 1S0VA 3JASB 1IZ3A 2Y4UA 4HBNA 1QVFU 1YITV 1LUVA 4KXRA 2RJZA 2IW5A 4DRXB 3CMEV 2B9ZA 1WNSA 5B5EZ 3MHHC 2X6BA 5J2TA 2A06H 2GTAA 1NH2D 1SQXH 3APOA 1XDCA 3CE2A 4ZI7A 1Y76A 1WPXA 4O4HB 5C93A 2QGNA 4LFAO 3ABKC 2HG5C 4I50A 1XNRB 3B8MA 1P4RA 2DOSA 1GN2A 5LMNO 4J7ZA 2VRZA 2XASA 4U7OA 4FJCC 1JMKC 3AG4C 5LHHA 1FPOA 2PI5A 4LR3A 4DR3B 1YJWV 3NXSA 2Y0PA 3O65A 2WWWA 4FZ1A 1KUQA 4KFMA 5FL7G 5DM6V 3CCJV 1E1QG 1MA1A 1F4MA 2P67A 1PD3A 3CMAV 4DR5B 1I5YA 1M57C 4Z1VA 1OCCB 1MMMA 3OFNG 2H8PC 4MTGA 4WCEV 2KB1A 4IGGA 3T2MA 2F4VO 1GM8A 4P9PA 5LMUB 2R9IA 4DR4B 1IBMO 1K34A 2CTPA 4I7ZB 1Q6IA 1US6A 3SYQA 3JYCA 4NTYA 2CDYA 1IBLB 1NQTA 4GZRB 1IXMA 4JPRA 2M7WA 4PDVA 2AHYA 2QM7A 5TISZ 3RW0A 1HNWB 3J7AU 2EINB 2WLIB 1NTKH 2ADQB 2HJDA 2WLKA 5IDJA 1QLEB 3ZMSA 4DUYO 3WU2Z 4JI4B 2Q73A 4HNAA 4B3MO 4YHHB 3K0GA 3CEIA 2V1DA 3RFRA 2HVKC 2E3CA 4UXNA 2QDOA 4X1KA 4TUYB 4X1IB 4TOIA 4JI5O 3FAVA 4U3JB 3TK1A 4LFCB 3T4DA 2IU3A 1I5XA 1VQ5V 3UO2A 2OCCC 1NZ6A 1YF2A 3ASOB 4IYIA 3SPHA 4L87A 1AP6A 1XBLA 3OUSA 2C2AA 3OMIB 2Q7HA 2QWNB 1FXHA 4FFBA 3D36C 2LP7A 3ZRWA 3WG7C 3OMAB 1J5EO 5FNVA 1URFA 3K0DA 1I08A 5FPOA 1FD9A 2YXHA 3VQWA 4EFEA 3AG7A 5GTIZ 1YIJV 2X6CA 4PA6A 5JJEB 1SQBH 3G67A 4OGQB 1UJWB 4GLXA 3WB0A 4WFHA 2VQFO 1M9NA 2DYRC 3K79A 1ZWIC 2IJKA 3ZHUA 1N33O 1S76D 4J41A 2UUAO 2RNBA 4UFZA 2R9AA 4PHZA 2ZDIA 5J2UB 2Q9LA 1EM1A 3OT7A 3HKDB 4O2BB 1RP3B 1VQOV 4X64O 3HKEB 1SA0A 2VS0A 4AQYB 4WBNB 3JD4A 2KG7A 1OCRC 4Z2WA 2G38A 3HB3B 1KQSU 1BMFG 3I5DA 3K5MA 1W0KG 3WG7B 2BCCH 1QNMA 1R6KA 3SJAC 4CH4A 3JD1A 2P06A 4O4HA 4XDKA 1FYJA 1K92A 1PV0A 3ZMUA 4X1YA 5LMNB 3BPZA 3FB6C 1KECA 5HFMA 1H2MA 4YY3B 1X59A 3CSXA 2YIAA 2PF4E 1NBMG 3ASOC 2MW2B 5KX5A 2OCCB 2Y69C 4LF9B 2W0XA 4DK1A 1NVPB 1B04A 2B5UA 2DWEC 3SPJA 2UXBB 3J80N 2QWQB 4X8AA 4N23A 2BE3A 4PA7A 4IHJA 3D3QA 4JYAB 5IYDO 4OPAA 1R6TA 2ZQMA 2FTKA 4PELA 3H1IH 3JSLA 1QLEC 1ZUQA 4UUJC 5CA0A 3B09A 2EILB 1K73W 4O4JA 1COWG 1SKVA 4X66B 4UCUA 2P7TC 2ZNIA 2RDCA 5LGUA 5LXTB 2FMLA 5BZBA 2VQEB 3ABLC 1WB7A 3CC2V 5BY1A 4JI6O 1U96A 4B7EA 1T5EA 1IVSA 1AR4A 4BW5A 5FLXN 1J5EB 1AJPA 5KHIA 3DGEA 5HFLA 3D3IA 2RMKB 4JAVA 3A0BZ 1NJIW 4MW8A 4BIOA 4J80A 4DV0B 3QO8A 1GTOA 4I9WA 4I50B 4X64B 3RYHB 4X65B 4NXMO 4B7KA 4LWSA 4UCOA 1N34O 2JRIA 1XI1A 2JVDA 5B66Z 2LGWA 2UUAB 2GBOA 2EULA 1AI5A 3AG4B 3ZHRA 2R70A 4UCVA 2OTLV 2WLHA 1K33A 1NKDA 5LHIA 1JFFA 1F7YA 4AILC 3IGAC 4JAUA 3KKYA 4CZZA 1MOFA 4CH6A 3UM7A 2F1MA 1NH2B 2PYJA 3K59A 4B08A 2ATKC 3OGCC 4DV2O 3D8CA 1ORQC 4ZOLB 3OR6C 5L3FA 1WA8A 1ZSPA 3K58A 1XMQB 1SZTA 3KCYA 1ZTEA 4K8XA 2A7WA 2AZ2A 2OYQA 1W0JG 3VOUA 3DC6A 1FKAO 3K03A 4H0LB 4IL6Z 2OCHA 4LF9O 3IFXA 1TVKA 3CCQV 3B77A 3JCZA 1VF6C 2ZT9B 1K97A 4O4JB 4QJFB 4DR6O 4OPHA 1FJGB 4JI5B 2P4VA 2Q6AA 3WFVA 1JCHA 5BXZA 3X2QC 1FFXB 1WB8A 4MVQA 3QG5A 1YEWA 1VARA 1P49A 1D5NA 2KSDA 2YS8A 3SPGA 5LYJB 3A8TA 2Q7GA 2ZXWC 2JGDA 1HR0O 3QTCA 2LW1A 1QBZA 2QKSA 5E79Z 5ITZA 4DUZB 1PNLA 3RYCA 3CCRV 2IBZH 4I5SA 1G6UA 4A5UB 3JAMN 2W6IG 1GN6A 3BA8A 1NI8A 5JQGB 3H01A 3RYFA 1HNXO 2WLNA 5JVDB 1N32B 3I55V 1V55C 2CK3G 4CC6A 3JALA 1WPBA 3L9DA 1VEWA 4LFBO 1SQGA 4LF6B 4EB6A 2OIGA 4PI2A 1UFIA 2FKXA 1XMOB 4FVMA 3ZRXA 4JYCA 4BW9A 2HVJC 4LFCO 1AR1B 4JYAO 1B3QA 3DTUB 4FIPC 5JWPA 3CPWU 1G8MA 2WAMA 3RWRD 1J95A 2YIDA 3CCLV 3ETGA 1TUBB 2V7QG 4PV1B 2UUBO 2DQ0A 1QLNA 2NR5A 3ZHSA 5LBQA 3CB2A 2HHHB 1KD1W 3FFQA 3IJ4A 4LF4B 1IURA 3J81N 5B1BC 4ZKIA 4D7TA 4JI6B 4JYBA 3A0RA 5DN6G 1YSCA 3AG2C 4MT8A 5EYPB 5L3GA 1GN3A 5L3CA 2AGAA 1KB9F 1VQLV 2VQEO 3U0ZA 2QTOA 4LNUB 3W7SA 1XHZA 1SETA 1YVWA 4J7JA 4DUYB 4JI8O 1Q3EA 3B2EE 1N34B 3B40A 3OEHG 1SQQH 1WAZA 4O4IB 1BT8A 3TCUA 1TUBA 4EEQA 4P9OA 4N21A 3RYIB 1AJQA 4EFBA 3HR0A 3R65A 2WLJA 2RCVA 1ROPA 3PJSK 4JTAB 5CMUA 3L70H 1VIBA 1YDXA 1SESA 4DR7B 5LP6C 3U10A 4Z1MG 4F6RA 3E8FA 3E89A 3OW2U 4LF6O 3W7UA 2NN4A 4DV7B 1SA0B 3CRAA 3ZHQA 3ZS8C 5JVDA 5LHGA 1DTOA 2HP8A 3E8HA 4FFBB 1YTFB 2XAGA 2LQTA 5KHHA 2GDSA 2IJIA 2CUGA 2IM9A 3EXAA 2GTSA 1VQ9V 1Q8IA 5H9CA 4ZHQB 3RYCB 4DR1B 3GB7C 4K0KB 2HJFC 4G28B 4X9QA 4X20A 3STLC 4LF7O 1IBLO 2UXBO 2EIKC 1JQ0A 2A0LA 3K06A 4DXWA 5LGTA 5CBFA 1AVMA 2IH3C 1BGYH 5C8YA 2QEXV 5IE9A 2H3OA 3T1YO 4DV6O 1XOUA 4QIWF 3JD3A 4FLUA 2CE4A 2EIMC 2B1GA 1KYOF 4LF4O 5EBMC 3RYIA 1M1KW 1VMGA 3P30A 3JALB 3P3NA 4CS4A 5EIBD 1K7DA 2WLIA 4L8JA 4NXMB 3G6BA 2L6LA 1BE3H 3BABA 3RYFB 1M56C 1EN5A 2QWPB 4FLVA 3RYHA 4JTCB 2CGOA 4DV3O 3ETDA 2N74A 3CC4V 1Q6HA 3ABMC 1Y76B 3BFRA 4CS2A 3LDEA 2M6YA 3NR7A 1S5JA 1KU9A 5EC1C 4TV8B 2CGNA 1E79G 4WFGA 4DV5O 1BHBA 3K08A 3APQA 4MW3A 5BMVA 4DO2A 5B3SB 4FLZA 3QO5A 1N4CA 1JA8A 4NTWA 4BAYA 1EBOA 4KP4A 4QPJA 3H1HH 2GHYA 4JTDB 3ICXA 1TAEA 5LA6A 5B3SC 4QNHB 2FL4A 5EZYA 2EJ7A 4I55B 2JS3A 4HAMA 1S5LZ 4W4LA 4CH5A 5CA3A 2Y48A 2XHBA 1WA8B 4NTXA 4DV7O 1N0NA 4KHPB 5IYZA 2DJVA 3ABUA 1Q43A 2Q0AA 3F7VC 1WP8A 2VWKA 4NVPA 5E1AC 2XT9A 5DEDA 4DR5O 2ILMA 4ZI7B 5LOVA 5DECA 4DR6B 2E75B 2RQ6A 1VQNV 1M56B 1FJGO 3FB5C 3BCCH 1N0JA 3MDSA 3F7YC 4GUNA 3OAAG 1JJ2U 4DV4B 3SPIA 1MSDA 2EIMB 2JJ2G 3ASNC 5L3DA 3T4ZA 1MZEA 3C3SA 1OHHG 3BRCA 2ZIMA 1H2SB 3TXSA 1FXVA 2EBOA 4GX5A 3AEIA 1EN6A 3IC7A 4OXSA 3AG3B 5LP6A 2WA3A 3HKEA 2Q8VA 2EIKB 4YXWG 5EZYB 3CXCU 2UXDO 1AROP 4DW1A 1XMOO 2QTSA 3AG1C 4FMTA 1RM1C 5J2TB 3K57A 2CAZC 2UXXA 4H33A 5CN0A 4WFBV 1YJNV 1QQCA 2YIBA 4MTOA 4DW0A 5A9GA 1JPXA 2NLJC 5L3BA 1R3JC 1F51A 2XNDG 3LSSA 4D6TH 4UVBA 1H38A 3E8GA 4R8CA 2ZD9A 3ZHVA 1HWYA 5KHKA 4GX0A 2LFRA 5CBHA 4IYHA 1M93A 1YTFD 3IAYA 1QU7A 1THZA 4I55A 1AP5A 1S3JA 1CEZA 1V9PA 4U3FH 4NB5A 1LUWA 3CYOA 2OTJV 1R6NA 5LP6B 4UCTA 4TQFA 5J2UA 1KC8W 1AI6A 1SERA 2ZNJA 3MHSC 4PD4F 1WLEA 5GONA 2EZPA 1K9MW 5JH7B 4FLXA 2IJJA 2F95B 3E22A 4FPPA 2ZDIC 2DE0X 1N33B 3L75H 4UB8Z 2P22C 3H1KH 4KHPO 3LDCA 1X4TA 4YHHO 2Q7EA 4TV8A 1OJHA 1R3LC 3FB7C 4LFBB 5EK0A 1VF5B 3EFFK 2ZE8A 4UVAA 3HKBB 4AQYO 5LOVB 2Q4PA 3UCSC 3L72H 3SYCA 1QR9A 2QKAA 4JI3B 4TQDA 3SJCC 2Y0IA 1XUQA 3CRQA 3W7TA 2YI8A 5IYBO 1G1XB 1OCOB 4KL1A 4FLWA 3JSNA 4K3AA 2ADPA 4X20B 3GWKC 3HKDA 5LA6B 2KKWA 4PA9A 1EFRG 1H2KA 3Q4HA 3ZJZA 1HNZB 1VQMV 3TJTA 1NR7A 4DR7O 2P90A 2ZM6B 1VQ4V 3JAWB 1HP8A 3LSUA 3FD9A 3MD0A 3B8NA 5J9PC 2HHHO 3CWBH 2DMXA 2Z0AA 3CRRA 1BQ0A 4IHJB 3UT5B 1R1BA 1KBHA 2XAFA 1Y66A 1HDJA 1FAFA 4HYOA 1XMQO 1M90W 4ZHQA 2DWDC 3ZRWB 2LW7A 3N2KA 4TWKA 3OD4A 5KAIZ 3CCEV 3SJQC 3LUTB 4UV8A 3G6EV 4J7KA 4BIUA 2QKCA 4DV6B 1V55B 3OR7C 4XDLA 4O4IA 1NVPD 2F43G 3JAKB 2DYSB 1SRYA 4LH6A 1Z5VA 5GW7A 4F6RB 3KCXA 1TGOA 4RWUA 3FX7A 4ASUG 5EIBC 3M99B 3ZIAG 4JI1B 1VP7A 5KA6A 2ZIOA 4FLTA 3H9VA 1Y67A 1K5QA 3DXRB 1S77D 2YEVA 2P5OA 4X62B 4FFKA 3GWOA 5B1AB 1L0NH 1AILA 4MVUA 5EYPA 4O2BA 5JQGA 3JATB 2HKOA 4I4TB 2ITDC 1AR5A 4PJ0Z 3N2KB 1VF6A 1GKFA 3HPLC 1EZJA 3CXHF 3S3XA 2EX3A 3M7MX 4DV5B 3T1HB 3ZN1A 1S72V 4JV5O 1Q90D 2F23A 2UXDB 3UT5A 3JATA 1SQPH 1FXKC 2WLLB 1WN7A 5CBGA 3CCUV 1MZFA 1XL6A 4X66O 3ZX6A 2P6JA 3P3PA 2HEPA 2NNUA 4NXNO 1WJZA 4B3RO 2HR3A 2QA4V 2DW4A 2BTQB 3BY6A 2OWOA 1GN4A 4JI1O 3CC7V 4DUZO 1PP9H 3N2GB 3ZN0A 1GM7A 1PL4A 4NKGB 2IJHA 4O4LB 1SQFA 2QSAA 1BS3A 1RSOA 1K8AW 3DC5A 2Z3YA 2EIJB 4QE9A 5IY5C 4EKWA 1S5HC 4P30A 2BTQA 2O57A 2JS5A 5ITZB 4G2KA 1ENVA 5LL6Y 1VF7A 4HNAB 5LYJA 2JK5C 4GX1A 4EB6B 5IY5B 2EIJC 3SYOA 1E1RG 3MAQA 3FYIB 2V4DA 1K3EA 2F66C 3ETEA 1IBKB 2BOBC 4GX2A 2ODMA 1Q86W 1UPGA 1QHTA 2A9HA 3L71H 4RQFA 4DRXA 1HR0B 4D7SA 1RFYA 3ABLB 3RGBA 3DSQA 4E2LA 4FZ0A 3JARA 4DR2O 2LFSA 1AI7A 4JI7O 2XAHA 4DV2B 5CB4B 2UXCO 3ZMTA 2AW9A 1L8DA 2EILC 2ITCC 3G80A 4X88A 2KQXA 4UCSA 2AHZA 4DV1O 1TA8A 3WB2A 1FXKB 3B4SA 3QF7A 5IJ0A 3TXQA 3THOA 4GKKO 1Y74A 5JCOC 1BL8A 3JAWA 1HW7A 4JI4O 1BZKA 5KMGA 3CRMA 3OTOB 4MTFA 3A2FA 1SF9A 1NU1H 3PN1A 2HFEC 5IJ9B 2LJ2A 1IBKO 1W59A 2Y69B 5K1XA 4QE7A 4JI8B 2CTRA 4LF5O 3E22B 4UVCA 5B1AC 3CRCA 5JH7A 4ZOLA 1L1FA 1H8EG 2L35A 3VQXA 2YIBD 1XL4A 4NR1A 3WB1A 4DV1B 2XTAA 2BSKB 1OCRB 3ZBHA 4WFEA 2DYSC 1DF4A 3F5TA 3OE7G 1SQVH 1K4DC 1GMGA 4B3SO 2N04A 4OX9B 4JI0O 4LF8O 1NT2B 1GH6A 3OTOO 1XQ8A 2A3QA 2EZOA 2XAQA 2CTWA 4DR3O 1YHQV 4JGSA 1YZBA 5IJ9A 2XOKG 2E5LB 1CXZB 4MVZA 2DQ3A 2H94A 2AZ0A 2DYRB 1TVKB 2K9PA 1R73A 1LNQA 3CP1A 2PY5A 3OGIB 3CX5F 4U7NA 2A79B 2XAJA 1FXKA 3EVKA 1MABG 3C90A 1XNRO 2X0LA 4PA4A 1NTMH 2Y4TA 1F23A 2YXYA 5LMUO 1PNKA 3CD6V 5K1PA 4NYKA 3S3WA 4WFFA 3JARB 1HNXB 1XHXA 4RUFA 1N32O 1KKCA 5AG2A 5D5QA 1JFFB 1I94B 1M4UA 1OCOC 4DV0O 4KUMA 5FNVB 2CH7B 4TSFG 2YUAA 4JYYA 3K5OA 4X1YB 5EBLC 1EZVH 3K9SA 4G27B 4HZ3A 5FPRA 3FYEB 4JI0B 4LF8B 3G4SV 1Y6XA 4CC5A 1RPOA 3ZHTA 1IX9A 4GCZA 1O9GA 4UCRA 2Q68A 1VQKV 4YJ2B 4JI2O 2XUMA 4WFAV 2WPDG 3F5WC 4O4LA 2X7RB 1RPRA 3LDDA 4TV9B 3P32A 4DYLA 2EINC 5KUMA 2YI9A 4U3JA 4J9ZB 4LF5B 1VQPV 2ARHA 1O9HA 1XNQO 1P84F 2AXTZ 3AK2A 3RN4A 1I0HA 4GYCB 3H1LH 4IIJB 1FS0G 2CTQA 4GT1A 3D36A 1U97A 5LXTA 2QR4A 4JZ2A 4X62O 1HNWO 4PI0A 5EBWC 4LFAB 1N8RW 4MTXA 4WBNA 1OCCC 2D3OW 1M57B 4H44B 3QNEA 4GKJB 4YIOA 2EJRA 1GK9A 3E86A 5L3EA 2UXNA 3GVMA 4E4EA 3SDLA 1QVGU 1JR9A 1GAXA 4J11A 1H8HG 4FK5C 1H2LA 4UV9A 1PPJH 3AG1B 1RM1B 1JOYA 1A32A 5EC2C 4PDRA 3VQYA 2VWJA 5KX5B 2QE7G 4XDJA 2PTMA 1NS1A 3L73H 4ICGA 1MNGA 1N36B 3AG3C 3JCUZ 5KHJA 1SZXA 2YDEA 3KG2A 1N36O 2ZE7A 3KZIZ 1Q5OA 1P7GA 3JD0A 3ABKB 3SYAA 5IYCO 4AI8A 4J10A 2PZSA 5CA1A 2ZR2A 3ASNB 3K3WA 5IYZB 2R9RB 4JF3A 1BCCH 4BIZA 4C7UA 5KUKA 2UUCO 1ZX3A 1SS3A 2QWOB 4Q20A 3K5LA 1B6QA 3CHXA 2X6AA 2UUCB 3SYPA 3CCSV 1Q82W 2ZE5A 1KMIZ 3RVZA 4W4KA 4LF7B 1K4CC 1WP7A 4I0XA 5B1OA 4LNUA 4X1KB 5KMGB 3K04A 1YI2V 1CP9A 3K9AA 5KA5A 5H2FZ 4ZBMA 2B1IA 5BMVB 3LNMB 4LH7A 5H5NA 2GUZA 2GUZB 2FYUH 4JI3O 2UU9B 3AK3A 1DK1A 2F4VB 3RVYA 4LP8A 1JX9A 1K5SA 1P7BA 5B1NA 1BQZA 4RO2A 5CB4A 1NR1A 1H2GA 4J42A 4WF9V 3ZEDA 2Q67A 1Q6UA 4I4TA 1RSOB 2GSMB 4RUEA 3M8AA 3ZCCA 1OV9A 2JEUA 1BSMA 3N2GA 4JV5B 3SPCA 4YJ3B 1OCZC 4DR2B 4JI7B 1MG1A 2R72A 3TGUH 1Z2GA 3DXRA 3EHBB 4LBEC 1F4NA 3T1CA 4OX9O 1ZLZA 4LCUC 5A2QN 3ABMB 5CA1B 3LNNA 3FAVB 3ZRSA 2JDIG 3QVNA 5D5PA 4FM2A 4TUYA 4X1IA 2JJ1G 2GV9A 1R3KC 4ZIBA 2CH7A 2N05A 1SC5B 1BHAA 1YJ9V 5IT9N 3W7WA 4R6ZA 1LR1A 1IBMB 4DR4O 4YIPA 1I7FA 1MSWD 2F93B 3W7XA 1ZAUA 4F4LA 2Q5ZA 4TT3G 4YJ2A 4B3TO 5KLVH 2HLDG 2UU9O 2FB5A 2ZINA 3L74H 4JI2B 3UQ8A 1DLBA 1IDSA 2Q69A 3A0HZ 3VQVA 5GONB 1KP2A 1R3IC 5JJJB 4H37A 3OUFA 5LGNA 5F2VO 2QM4A 4PA3A 3CCVV 1XNQB 3R66A 4X89A 2YSUB 2WLLA 1PKXA 3LSQA 4DV3B 3Q4HB 4I0XB 3RBZA 1PM9A 4K8ZA 3I56V 2PGGA 4MS2A 1DF5A 4DK0A 3VBBA 2W6JG 1M5IA 1PL0A 5IWAO 3JASA 1GO3F 5IWAB 3JAKA 3K5NA 3BEHA 1YCIA 1YXBA 3BVOA 3TETA 4R50A 1DGSA 4IT5A 4TV9A 2E74B 1V54C 3UKMA 4CBCA 3T1YB 2WLMA 2YXLA 1B06A 1ZL8B 2WSSG 2YEVB 4MVMA 4P2ZA 3HKCB 1VQ7V 4O2AB 4RQEA 3OMNB 4CH3A 1Q81W 1CPYA 2QWRB 1D5AA 4H13B 4MVOA 3IC9A 3SGIA 4MVSA 1V54B 4Q6GA 3E8BA 5KHGA 4B3RB 1VQ8V 2BOCC 3CCMV 2YC0A 5BR8O 3RT3C 4LWSB 2P4KA 2QJ1A 3BHPA 3CJHB 1Z5WA 3H1JH 1NTZH 1KKDA 1IXBA 1FFTB 2ETNA 1QR8A 2Z5UA 1TUEB
chains in the Genus database with same CATH topology
1VQNV 4PDLA 1G4YB 1M56B 3STZC 1OCRB 3OEEG 4R7CA 4WFEA 2ZR3A 2DYSC 3FB5C 4BW5A 1DF4A 3OE7G 1AJPA 4RAIA 1K4DC 1GMGA 3F7YC 3AG2B 3DGEA 3D3IA 3OAAG 5HFLA 1JJ2U 2EZOA 3G71V 4JAVA 4PDMA 2XAQA 3E83A 3SPIA 4JASA 2EIMB 2JJ2G 3ASNC 5B1BB 5L3DA 4MW8A 1NJIW 3T4ZA 1YHQV 1OHHG 4JGSA 3QO8A 1GTOA 2XOKG 4MVZA 2DQ3A 4I9WA 4MVRA 2H94A 1FXVA 2EBOA 4GX5A 2DYRB 3AEIA 1R73A 1GM9A 3IC7A 1LNQA 4OXSA 3CP1A 3AG3B 4LC1A 4XBFA 2OT5A 2JIZG 4J9YB 4U7NA 2QM8A 2A79B 2XAJA 2EIKB 1FXKA 3JD2A 4YXWG 1AI4A 1JVMA 3CXCU 1MABG 1AI5A 1KP3A 1AROP 3AG4B 4FMTA 3AG1C 1RM1C 2X0LA 2OTLV 2WLHA 4PA4A 1K33A 2MK3A 3ZMVA 1NKDA 5LHIA 1F23A 2IU0A 2UXXA 4H33A 1Q7YW 5CN0A 3IGAC 4JAUA 1PNKA 4WFBV 1YJNV 3CD6V 4MTOA 5L3BA 4CZZA 1JPXA 2NLJC 1MOFA 1R3JC 3UM7A 4WFFA 1NH2B 1F51A 1Y4MA 4RUFA 2ATKC 3OGCC 2XNDG 3LSSA 1H38A 4UVBA 1OZ0A 3E8GA 4R8CA 1ORQC 2K1EA 2ZD9A 1W2BU 3OR6C 1HWYA 5L3FA 1OCZB 4GX0A 2LFRA 5CBHA 5H6RA 3ZRVA 1SZTA 1YTFD 1OCOC 1THZA 4KUMA 5H6QA 4TSFG 1S3JA 1CEZA 3QO7A 1W0JG 5EBLC 3VOUA 3CYOA 2OTJV 1R6NA 4G27B 4HZ3A 3K03A 3E2EA 1KC8W 3FYEB 1AI6A 1SERA 3MHSC 3IFXA 1WLEA 1QCEA 3G4SV 3CCQV 3ZMZA 1RPOA 2EZPA 3B77A 3JCZA 3FKSG 2PI4A 1K9MW 4MSWC 3FB8C 4GCZA 2IJJA 1K97A 4QJFB 2ZXWB 2Q68A 2W0FC 1VQKV 2IH1C 1AJNA 4QPKA 4FPPA 2ZDIC 2Q6AA 3WFVA 1JCHA 2JEXA 4WFAV 2WPDG 3LDCA 3E35A 3ML0A 3OM3B 3X2QC 3F5WC 3X2QB 4MVQA 2X7RB 1RPRA 3LDDA 3P32A 3ABTA 1R3LC 3FB7C 5EK0A 3SPGA 2EINC 5KUMA 1VQ6V 4J9ZB 1PNMA 3EFFK 1VQPV 2ZXWC 4UVAA 2QKSA 1QBZA 1S0VA 1PNLA 3CCRV 3SYCA 4I5SA 1QR9A 1FS0G 2W6IG 1QVFU 4GT1A 3D36A 1YITV 2IW5A 3CMEV 3W7TA 5IYBO 3H01A 3MHHC 2X6BA 5EBWC 2WLNA 3I55V 1OCOB 1V55C 2CK3G 1NH2D 4MTXA 1N8RW 1OCCC 2D3OW 1M57B 3QNEA 2EJRA 1GK9A 1WPXA 3E86A 5C93A 4PA9A 5L3EA 1EFRG 3ABKC 2UXNA 2HG5C 1QVGU 3B8MA 3ZJZA 3ZRXA 1P4RA 4JYCA 1VQMV 1NR7A 2P90A 1H8HG 4FK5C 1VQ4V 2HVJC 1AR1B 3DTUB 2XASA 4U7OA 4FIPC 4FJCC 4UV9A 3AG1B 1RM1B 3AG4C 1JOYA 3CPWU 1G8MA 5LHHA 5EC2C 4PDRA 3MD0A 2WAMA 3B8NA 1J95A 5J9PC 2QE7G 2PI5A 4XDJA 3CCLV 3ETGA 2V7QG 1YJWV 3NXSA 2WWWA 3AG3C 2XAFA 1Y66A 3KG2A 2DQ0A 1QLNA 4HYOA 4KFMA 5LBQA 1M90W 2DWDC 5FL7G 3ZRWB 5DM6V 1KD1W 3JD0A 3ABKB 3CCJV 4TWKA 1E1QG 3SYAA 1F4MA 5IYCO 2P67A 1PD3A 3CMAV 3CCEV 3SJQC 2ZR2A 3ASNB 5B1BC 4ZKIA 3K3WA 1I5YA 3LUTB 4JYBA 3A0RA 4UV8A 5DN6G 3G6EV 1YSCA 2R9RB 1M57C 3AG2C 4MT8A 5L3GA 4BIUA 1OCCB 4JF3A 3OFNG 2H8PC 4MTGA 1V55B 3OR7C 4WCEV 4XDLA 4BIZA 5L3CA 1NVPD 2F43G 2KB1A 2DYSB 1SRYA 3T2MA 1GM8A 5KUKA 4P9PA 4Q20A 2R9IA 1VQLV 2QTOA 1B6QA 2X6AA 1K34A 5GW7A 3SYPA 3CCSV 1Q82W 4ASUG 3SYQA 3W7SA 3JYCA 1SETA 3RVZA 3M99B 3ZIAG 1NQTA 1K4CC 5KA6A 1IXMA 4JPRA 5B1OA 1K5QA 2M7WA 1S77D 2YEVA 3K04A 4PDVA 2AHYA 2QM7A 1YI2V 1CP9A 3RW0A 3OEHG 2EINB 3GWOA 5B1AB 2WLIB 3K9AA 5KA5A 4ZBMA 2B1IA 2WLKA 1QLEB 5IDJA 3LNMB 3ZMSA 3TCUA 4P9OA 4MVUA 4N21A 1AJQA 2HKOA 3RVYA 4LP8A 2ITDC 3R65A 3K0GA 2WLJA 2V1DA 1ROPA 3PJSK 1JX9A 1K5SA 1P7BA 2HVKC 5B1NA 4JTAB 5CMUA 4RO2A 4UXNA 1GKFA 3HPLC 1EZJA 1NR1A 1H2GA 4WF9V 1SESA 3ZN1A 1S72V 2Q67A 3TK1A 2GSMB 3T4DA 4RUEA 4Z1MG 2IU3A 1FXKC 1I5XA 1VQ5V 3ZCCA 3E8FA 3E89A 2WLLB 2JEUA 2OCCC 3OW2U 5CBGA 3ASOB 3W7UA 3SPHA 4L87A 3CCUV 3SPCA 1OCZC 1XL6A 1MG1A 5LHGA 1DTOA 3EHBB 4LBEC 1F4NA 3T1CA 3E8HA 2P6JA 4LCUC 3OUSA 5E1AC 3ABMB 1YTFB 2C2AA 2NNUA 3OMIB 2XAGA 2JDIG 1FXHA 3ZRSA 2IJIA 2LP7A 2HR3A 3ZRWA 1VQ9V 2QA4V 3WG7C 2JJ1G 5H9CA 2DW4A 1R3KC 3GB7C 2HJFC 4G28B 3OMAB 3BY6A 3CC7V 3STLC 3K0DA 1BHAA 1YJ9V 3ZN0A 1GM7A 3W7WA 2IJHA 1YIJV 2X6CA 4PA6A 2EIKC 4R6ZA 1JQ0A 2A0LA 3K06A 4DXWA 5LGTA 5CBFA 1MSWD 1UJWB 1K8AW 2Z3YA 2EIJB 4QE9A 4WFHA 5IY5C 2IH3C 3W7XA 4EKWA 4F4LA 4TT3G 1S5HC 2QEXV 2HLDG 1M9NA 4P30A 2DYRC 3K79A 1ZWIC 2IJKA 4G2KA 1S76D 1ENVA 1DLBA 4QIWF 2Q69A 3JD3A 1KP2A 2EIMC 1R3IC 2JK5C 2ZDIA 4GX1A 5IY5B 2B1GA 2EIJC 3SYOA 1E1RG 5EBMC 4H37A 3FYIB 1M1KW 3OUFA 1K3EA 1VQOV 5LGNA 3P30A 3ETEA 4PA3A 3CCVV 2BOBC 4GX2A 1K7DA 2WLIA 3JD4A 1Q86W 1OCRC 4X89A 2YSUB 2WLLA 1PKXA 3LSQA 3HB3B 1M56C 2A9HA 1KQSU 1BMFG 4RQFA 3RBZA 4JTCB 1W0KG 3WG7B 3ETDA 1R6KA 3ABLB 3I56V 3CC4V 4E2LA 3JD1A 4MS2A 2LFSA 1AI7A 1DF5A 4XDKA 2XAHA 2W6JG 3VBBA 1K92A 3ABMC 1PL0A 3ZMUA 1GO3F 3FB6C 3ZMTA 1KECA 3LDEA 5HFMA 2EILC 2ITCC 3BEHA 5EC1C 4X88A 3TETA 1NBMG 4R50A 1E79G 2AHZA 3ASOC 4WFGA 1V54C 2OCCB 3K08A 1BHBA 3UKMA 2Y69C 4CBCA 4MW3A 1FXKB 4DO2A 5B3SB 2WLMA 1NVPB 1BL8A 3QO5A 2B5UA 2DWEC 3SPJA 2WSSG 2YEVB 4BAYA 4MVMA 4P2ZA 1VQ7V 4MTFA 4RQEA 4X8AA 4N23A 3OMNB 1Q81W 1EBOA 2HFEC 4KP4A 1CPYA 4PA7A 4QPJA 2GHYA 4JTDB 5IYDO 5B3SC 4QNHB 2Y69B 4MVOA 4MVSA 1V54B 3E8BA 4QE7A 2ZQMA 2FTKA 4PELA 4HAMA 5CA3A 1QLEC 2BOCC 1VQ8V 3CCMV 4UUJC 2EILB 2Y48A 4UVCA 5B1AC 1K73W 1COWG 2P7TC 1L1FA 3ABUA 1KKDA 5LGUA 1FFTB 3F7VC 5BZBA 1H8EG 3ABLC 1QR8A 2Z5UA 1XL4A 1TUEB 3CC2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJH A;  2IJJ A;  1B6Q A;  1GMG A;  1RPO A;  2IJK A;  1F4M A;  3K79 A;  1F4N A;  1NKD A;  1PD3 A;  2GHY A;  1RPR A;  1GTO A;  2IJI A;  4DO2 A;  1ROP A; 
#chains in the Genus database with same CATH topology
 4FM0 A;  3SR2 C;  4PDL A;  2JGD B;  1G4Y B;  2RN9 A;  3STZ C;  4BR6 A;  4I9Q A;  4K0K O;  4JAA A;  3OEE G;  4R7C A;  4DR1 O;  2ZR3 A;  2LGQ A;  2WA4 A;  2E5L O;  4RAI A;  1FFX A;  2BTO A;  1L0L H;  3AG2 B;  4X65 O;  3G71 V;  4PDM A;  3E83 A;  4JAS A;  4IIJ A;  2OIE A;  5B1B B;  2DN9 A;  3ETQ A;  4K35 A;  4MVR A;  2ZM6 O;  1GM9 A;  5CA0 B;  4LC1 A;  4FM1 A;  4XBF A;  2OT5 A;  1Y74 B;  2PYL A;  2JIZ G;  3N27 A;  4J9Y B;  2QM8 A;  3JD2 A;  3T1H O;  4JZG A;  3SJB C;  1AI4 A;  1JVM A;  1KP3 A;  3AK1 A;  2YIC A;  5GTH Z;  2VQF B;  2MK3 A;  3ZMV A;  2D2C B;  2IU0 A;  3C3T A;  4GKK B;  4QGP A;  4GKJ O;  1Q7Y W;  2BSK A;  2PUS A;  4O2A A;  4BWA A;  2LO1 A;  5JJN B;  5BR8 B;  2ZCE A;  1ZL8 A;  4ABM A;  1GRJ A;  1Y4M A;  2Q0O C;  1AB3 A;  1OZ0 A;  3HKB A;  3CJH A;  2K1E A;  1XEQ A;  1W2B U;  1OCZ B;  4NXN B;  4UB6 Z;  5H6R A;  3ZRV A;  4AHC A;  4CS3 A;  1D2D A;  5H6Q A;  2ZE6 A;  3UO3 A;  1XRE A;  3QO7 A;  2E76 B;  2JGU A;  1XIL A;  4FLY A;  3E2E A;  2UUB B;  1I94 O;  1QCE A;  4B3S B;  3ZMZ A;  4DV4 O;  2PI4 A;  2UXC B;  3FKS G;  1JJO A;  4F6E A;  4MSW C;  3FB8 C;  3U11 A;  3HKC A;  3CS5 A;  2ZXW B;  4YY3 O;  2W0F C;  4YJ3 A;  2IH1 C;  1AJN A;  2KG7 B;  4QPK A;  1EN4 A;  5C8Y B;  3O9O A;  5IJ0 B;  2JEX A;  1HNZ O;  3E35 A;  3ML0 A;  3OM3 B;  4B3T B;  3X2Q B;  5KAF Z;  4B3M B;  2ZKO A;  3ABT A;  5JCO A;  1H2N A;  3OTF A;  1VQ6 V;  1PNM A;  3BAA A;  3BA9 A;  1S0V A;  3JAS B;  1IZ3 A;  2Y4U A;  4HBN A;  1QVF U;  1YIT V;  1LUV A;  4KXR A;  2RJZ A;  2IW5 A;  4DRX B;  3CME V;  2B9Z A;  1WNS A;  5B5E Z;  3MHH C;  2X6B A;  5J2T A;  2A06 H;  2GTA A;  1NH2 D;  1SQX H;  3APO A;  1XDC A;  3CE2 A;  4ZI7 A;  1Y76 A;  1WPX A;  4O4H B;  5C93 A;  2QGN A;  4LFA O;  3ABK C;  2HG5 C;  4I50 A;  1XNR B;  3B8M A;  1P4R A;  2DOS A;  1GN2 A;  5LMN O;  4J7Z A;  2VRZ A;  2XAS A;  4U7O A;  4FJC C;  1JMK C;  3AG4 C;  5LHH A;  1FPO A;  2PI5 A;  4LR3 A;  4DR3 B;  1YJW V;  3NXS A;  2Y0P A;  3O65 A;  2WWW A;  4FZ1 A;  1KUQ A;  4KFM A;  5FL7 G;  5DM6 V;  3CCJ V;  1E1Q G;  1MA1 A;  1F4M A;  2P67 A;  1PD3 A;  3CMA V;  4DR5 B;  1I5Y A;  1M57 C;  4Z1V A;  1OCC B;  1MMM A;  3OFN G;  2H8P C;  4MTG A;  4WCE V;  2KB1 A;  4IGG A;  3T2M A;  2F4V O;  1GM8 A;  4P9P A;  5LMU B;  2R9I A;  4DR4 B;  1IBM O;  1K34 A;  2CTP A;  4I7Z B;  1Q6I A;  1US6 A;  3SYQ A;  3JYC A;  4NTY A;  2CDY A;  1IBL B;  1NQT A;  4GZR B;  1IXM A;  4JPR A;  2M7W A;  4PDV A;  2AHY A;  2QM7 A;  5TIS Z;  3RW0 A;  1HNW B;  3J7A U;  2EIN B;  2WLI B;  1NTK H;  2ADQ B;  2HJD A;  2WLK A;  5IDJ A;  1QLE B;  3ZMS A;  4DUY O;  3WU2 Z;  4JI4 B;  2Q73 A;  4HNA A;  4B3M O;  4YHH B;  3K0G A;  3CEI A;  2V1D A;  3RFR A;  2HVK C;  2E3C A;  4UXN A;  2QDO A;  4X1K A;  4TUY B;  4X1I B;  4TOI A;  4JI5 O;  3FAV A;  4U3J B;  3TK1 A;  4LFC B;  3T4D A;  2IU3 A;  1I5X A;  1VQ5 V;  3UO2 A;  2OCC C;  1NZ6 A;  1YF2 A;  3ASO B;  4IYI A;  3SPH A;  4L87 A;  1AP6 A;  1XBL A;  3OUS A;  2C2A A;  3OMI B;  2Q7H A;  2QWN B;  1FXH A;  4FFB A;  3D36 C;  2LP7 A;  3ZRW A;  3WG7 C;  3OMA B;  1J5E O;  5FNV A;  1URF A;  3K0D A;  1I08 A;  5FPO A;  1FD9 A;  2YXH A;  3VQW A;  4EFE A;  3AG7 A;  5GTI Z;  1YIJ V;  2X6C A;  4PA6 A;  5JJE B;  1SQB H;  3G67 A;  4OGQ B;  1UJW B;  4GLX A;  3WB0 A;  4WFH A;  2VQF O;  1M9N A;  2DYR C;  3K79 A;  1ZWI C;  2IJK A;  3ZHU A;  1N33 O;  1S76 D;  4J41 A;  2UUA O;  2RNB A;  4UFZ A;  2R9A A;  4PHZ A;  2ZDI A;  5J2U B;  2Q9L A;  1EM1 A;  3OT7 A;  3HKD B;  4O2B B;  1RP3 B;  1VQO V;  4X64 O;  3HKE B;  1SA0 A;  2VS0 A;  4AQY B;  4WBN B;  3JD4 A;  2KG7 A;  1OCR C;  4Z2W A;  2G38 A;  3HB3 B;  1KQS U;  1BMF G;  3I5D A;  3K5M A;  1W0K G;  3WG7 B;  2BCC H;  1QNM A;  1R6K A;  3SJA C;  4CH4 A;  3JD1 A;  2P06 A;  4O4H A;  4XDK A;  1FYJ A;  1K92 A;  1PV0 A;  3ZMU A;  4X1Y A;  5LMN B;  3BPZ A;  3FB6 C;  1KEC A;  5HFM A;  1H2M A;  4YY3 B;  1X59 A;  3CSX A;  2YIA A;  2PF4 E;  1NBM G;  3ASO C;  2MW2 B;  5KX5 A;  2OCC B;  2Y69 C;  4LF9 B;  2W0X A;  4DK1 A;  1NVP B;  1B04 A;  2B5U A;  2DWE C;  3SPJ A;  2UXB B;  3J80 N;  2QWQ B;  4X8A A;  4N23 A;  2BE3 A;  4PA7 A;  4IHJ A;  3D3Q A;  4JYA B;  5IYD O;  4OPA A;  1R6T A;  2ZQM A;  2FTK A;  4PEL A;  3H1I H;  3JSL A;  1QLE C;  1ZUQ A;  4UUJ C;  5CA0 A;  3B09 A;  2EIL B;  1K73 W;  4O4J A;  1COW G;  1SKV A;  4X66 B;  4UCU A;  2P7T C;  2ZNI A;  2RDC A;  5LGU A;  5LXT B;  2FML A;  5BZB A;  2VQE B;  3ABL C;  1WB7 A;  3CC2 V;  5BY1 A;  4JI6 O;  1U96 A;  4B7E A;  1T5E A;  1IVS A;  1AR4 A;  4BW5 A;  5FLX N;  1J5E B;  1AJP A;  5KHI A;  3DGE A;  5HFL A;  3D3I A;  2RMK B;  4JAV A;  3A0B Z;  1NJI W;  4MW8 A;  4BIO A;  4J80 A;  4DV0 B;  3QO8 A;  1GTO A;  4I9W A;  4I50 B;  4X64 B;  3RYH B;  4X65 B;  4NXM O;  4B7K A;  4LWS A;  4UCO A;  1N34 O;  2JRI A;  1XI1 A;  2JVD A;  5B66 Z;  2LGW A;  2UUA B;  2GBO A;  2EUL A;  1AI5 A;  3AG4 B;  3ZHR A;  2R70 A;  4UCV A;  2OTL V;  2WLH A;  1K33 A;  1NKD A;  5LHI A;  1JFF A;  1F7Y A;  4AIL C;  3IGA C;  4JAU A;  3KKY A;  4CZZ A;  1MOF A;  4CH6 A;  3UM7 A;  2F1M A;  1NH2 B;  2PYJ A;  3K59 A;  4B08 A;  2ATK C;  3OGC C;  4DV2 O;  3D8C A;  1ORQ C;  4ZOL B;  3OR6 C;  5L3F A;  1WA8 A;  1ZSP A;  3K58 A;  1XMQ B;  1SZT A;  3KCY A;  1ZTE A;  4K8X A;  2A7W A;  2AZ2 A;  2OYQ A;  1W0J G;  3VOU A;  3DC6 A;  1FKA O;  3K03 A;  4H0L B;  4IL6 Z;  2OCH A;  4LF9 O;  3IFX A;  1TVK A;  3CCQ V;  3B77 A;  3JCZ A;  1VF6 C;  2ZT9 B;  1K97 A;  4O4J B;  4QJF B;  4DR6 O;  4OPH A;  1FJG B;  4JI5 B;  2P4V A;  2Q6A A;  3WFV A;  1JCH A;  5BXZ A;  3X2Q C;  1FFX B;  1WB8 A;  4MVQ A;  3QG5 A;  1YEW A;  1VAR A;  1P49 A;  1D5N A;  2KSD A;  2YS8 A;  3SPG A;  5LYJ B;  3A8T A;  2Q7G A;  2ZXW C;  2JGD A;  1HR0 O;  3QTC A;  2LW1 A;  1QBZ A;  2QKS A;  5E79 Z;  5ITZ A;  4DUZ B;  1PNL A;  3RYC A;  3CCR V;  2IBZ H;  4I5S A;  1G6U A;  4A5U B;  3JAM N;  2W6I G;  1GN6 A;  3BA8 A;  1NI8 A;  5JQG B;  3H01 A;  3RYF A;  1HNX O;  2WLN A;  5JVD B;  1N32 B;  3I55 V;  1V55 C;  2CK3 G;  4CC6 A;  3JAL A;  1WPB A;  3L9D A;  1VEW A;  4LFB O;  1SQG A;  4LF6 B;  4EB6 A;  2OIG A;  4PI2 A;  1UFI A;  2FKX A;  1XMO B;  4FVM A;  3ZRX A;  4JYC A;  4BW9 A;  2HVJ C;  4LFC O;  1AR1 B;  4JYA O;  1B3Q A;  3DTU B;  4FIP C;  5JWP A;  3CPW U;  1G8M A;  2WAM A;  3RWR D;  1J95 A;  2YID A;  3CCL V;  3ETG A;  1TUB B;  2V7Q G;  4PV1 B;  2UUB O;  2DQ0 A;  1QLN A;  2NR5 A;  3ZHS A;  5LBQ A;  3CB2 A;  2HHH B;  1KD1 W;  3FFQ A;  3IJ4 A;  4LF4 B;  1IUR A;  3J81 N;  5B1B C;  4ZKI A;  4D7T A;  4JI6 B;  4JYB A;  3A0R A;  5DN6 G;  1YSC A;  3AG2 C;  4MT8 A;  5EYP B;  5L3G A;  1GN3 A;  5L3C A;  2AGA A;  1KB9 F;  1VQL V;  2VQE O;  3U0Z A;  2QTO A;  4LNU B;  3W7S A;  1XHZ A;  1SET A;  1YVW A;  4J7J A;  4DUY B;  4JI8 O;  1Q3E A;  3B2E E;  1N34 B;  3B40 A;  3OEH G;  1SQQ H;  1WAZ A;  4O4I B;  1BT8 A;  3TCU A;  1TUB A;  4EEQ A;  4P9O A;  4N21 A;  3RYI B;  1AJQ A;  4EFB A;  3HR0 A;  3R65 A;  2WLJ A;  2RCV A;  1ROP A;  3PJS K;  4JTA B;  5CMU A;  3L70 H;  1VIB A;  1YDX A;  1SES A;  4DR7 B;  5LP6 C;  3U10 A;  4Z1M G;  4F6R A;  3E8F A;  3E89 A;  3OW2 U;  4LF6 O;  3W7U A;  2NN4 A;  4DV7 B;  1SA0 B;  3CRA A;  3ZHQ A;  3ZS8 C;  5JVD A;  5LHG A;  1DTO A;  2HP8 A;  3E8H A;  4FFB B;  1YTF B;  2XAG A;  2LQT A;  5KHH A;  2GDS A;  2IJI A;  2CUG A;  2IM9 A;  3EXA A;  2GTS A;  1VQ9 V;  1Q8I A;  5H9C A;  4ZHQ B;  3RYC B;  4DR1 B;  3GB7 C;  4K0K B;  2HJF C;  4G28 B;  4X9Q A;  4X20 A;  3STL C;  4LF7 O;  1IBL O;  2UXB O;  2EIK C;  1JQ0 A;  2A0L A;  3K06 A;  4DXW A;  5LGT A;  5CBF A;  1AVM A;  2IH3 C;  1BGY H;  5C8Y A;  2QEX V;  5IE9 A;  2H3O A;  3T1Y O;  4DV6 O;  1XOU A;  4QIW F;  3JD3 A;  4FLU A;  2CE4 A;  2EIM C;  2B1G A;  1KYO F;  4LF4 O;  5EBM C;  3RYI A;  1M1K W;  1VMG A;  3P30 A;  3JAL B;  3P3N A;  4CS4 A;  5EIB D;  1K7D A;  2WLI A;  4L8J A;  4NXM B;  3G6B A;  2L6L A;  1BE3 H;  3BAB A;  3RYF B;  1M56 C;  1EN5 A;  2QWP B;  4FLV A;  3RYH A;  4JTC B;  2CGO A;  4DV3 O;  3ETD A;  2N74 A;  3CC4 V;  1Q6H A;  3ABM C;  1Y76 B;  3BFR A;  4CS2 A;  3LDE A;  2M6Y A;  3NR7 A;  1S5J A;  1KU9 A;  5EC1 C;  4TV8 B;  2CGN A;  1E79 G;  4WFG A;  4DV5 O;  1BHB A;  3K08 A;  3APQ A;  4MW3 A;  5BMV A;  4DO2 A;  5B3S B;  4FLZ A;  3QO5 A;  1N4C A;  1JA8 A;  4NTW A;  4BAY A;  1EBO A;  4KP4 A;  4QPJ A;  3H1H H;  2GHY A;  4JTD B;  3ICX A;  1TAE A;  5LA6 A;  5B3S C;  4QNH B;  2FL4 A;  5EZY A;  2EJ7 A;  4I55 B;  2JS3 A;  4HAM A;  1S5L Z;  4W4L A;  4CH5 A;  5CA3 A;  2Y48 A;  2XHB A;  1WA8 B;  4NTX A;  4DV7 O;  1N0N A;  4KHP B;  5IYZ A;  2DJV A;  3ABU A;  1Q43 A;  2Q0A A;  3F7V C;  1WP8 A;  2VWK A;  4NVP A;  5E1A C;  2XT9 A;  5DED A;  4DR5 O;  2ILM A;  4ZI7 B;  5LOV A;  5DEC A;  4DR6 B;  2E75 B;  2RQ6 A;  1VQN V;  1M56 B;  1FJG O;  3FB5 C;  3BCC H;  1N0J A;  3MDS A;  3F7Y C;  4GUN A;  3OAA G;  1JJ2 U;  4DV4 B;  3SPI A;  1MSD A;  2EIM B;  2JJ2 G;  3ASN C;  5L3D A;  3T4Z A;  1MZE A;  3C3S A;  1OHH G;  3BRC A;  2ZIM A;  1H2S B;  3TXS A;  1FXV A;  2EBO A;  4GX5 A;  3AEI A;  1EN6 A;  3IC7 A;  4OXS A;  3AG3 B;  5LP6 A;  2WA3 A;  3HKE A;  2Q8V A;  2EIK B;  4YXW G;  5EZY B;  3CXC U;  2UXD O;  1ARO P;  4DW1 A;  1XMO O;  2QTS A;  3AG1 C;  4FMT A;  1RM1 C;  5J2T B;  3K57 A;  2CAZ C;  2UXX A;  4H33 A;  5CN0 A;  4WFB V;  1YJN V;  1QQC A;  2YIB A;  4MTO A;  4DW0 A;  5A9G A;  1JPX A;  2NLJ C;  5L3B A;  1R3J C;  1F51 A;  2XND G;  3LSS A;  4D6T H;  4UVB A;  1H38 A;  3E8G A;  4R8C A;  2ZD9 A;  3ZHV A;  1HWY A;  5KHK A;  4GX0 A;  2LFR A;  5CBH A;  4IYH A;  1M93 A;  1YTF D;  3IAY A;  1QU7 A;  1THZ A;  4I55 A;  1AP5 A;  1S3J A;  1CEZ A;  1V9P A;  4U3F H;  4NB5 A;  1LUW A;  3CYO A;  2OTJ V;  1R6N A;  5LP6 B;  4UCT A;  4TQF A;  5J2U A;  1KC8 W;  1AI6 A;  1SER A;  2ZNJ A;  3MHS C;  4PD4 F;  1WLE A;  5GON A;  2EZP A;  1K9M W;  5JH7 B;  4FLX A;  2IJJ A;  2F95 B;  3E22 A;  4FPP A;  2ZDI C;  2DE0 X;  1N33 B;  3L75 H;  4UB8 Z;  2P22 C;  3H1K H;  4KHP O;  3LDC A;  1X4T A;  4YHH O;  2Q7E A;  4TV8 A;  1OJH A;  1R3L C;  3FB7 C;  4LFB B;  5EK0 A;  1VF5 B;  3EFF K;  2ZE8 A;  4UVA A;  3HKB B;  4AQY O;  5LOV B;  2Q4P A;  3UCS C;  3L72 H;  3SYC A;  1QR9 A;  2QKA A;  4JI3 B;  4TQD A;  3SJC C;  2Y0I A;  1XUQ A;  3CRQ A;  3W7T A;  2YI8 A;  5IYB O;  1G1X B;  1OCO B;  4KL1 A;  4FLW A;  3JSN A;  4K3A A;  2ADP A;  4X20 B;  3GWK C;  3HKD A;  5LA6 B;  2KKW A;  4PA9 A;  1EFR G;  1H2K A;  3Q4H A;  3ZJZ A;  1HNZ B;  1VQM V;  3TJT A;  1NR7 A;  4DR7 O;  2P90 A;  2ZM6 B;  1VQ4 V;  3JAW B;  1HP8 A;  3LSU A;  3FD9 A;  3MD0 A;  3B8N A;  5J9P C;  2HHH O;  3CWB H;  2DMX A;  2Z0A A;  3CRR A;  1BQ0 A;  4IHJ B;  3UT5 B;  1R1B A;  1KBH A;  2XAF A;  1Y66 A;  1HDJ A;  1FAF A;  4HYO A;  1XMQ O;  1M90 W;  4ZHQ A;  2DWD C;  3ZRW B;  2LW7 A;  3N2K A;  4TWK A;  3OD4 A;  5KAI Z;  3CCE V;  3SJQ C;  3LUT B;  4UV8 A;  3G6E V;  4J7K A;  4BIU A;  2QKC A;  4DV6 B;  1V55 B;  3OR7 C;  4XDL A;  4O4I A;  1NVP D;  2F43 G;  3JAK B;  2DYS B;  1SRY A;  4LH6 A;  1Z5V A;  5GW7 A;  4F6R B;  3KCX A;  1TGO A;  4RWU A;  3FX7 A;  4ASU G;  5EIB C;  3M99 B;  3ZIA G;  4JI1 B;  1VP7 A;  5KA6 A;  2ZIO A;  4FLT A;  3H9V A;  1Y67 A;  1K5Q A;  3DXR B;  1S77 D;  2YEV A;  2P5O A;  4X62 B;  4FFK A;  3GWO A;  5B1A B;  1L0N H;  1AIL A;  4MVU A;  5EYP A;  4O2B A;  5JQG A;  3JAT B;  2HKO A;  4I4T B;  2ITD C;  1AR5 A;  4PJ0 Z;  3N2K B;  1VF6 A;  1GKF A;  3HPL C;  1EZJ A;  3CXH F;  3S3X A;  2EX3 A;  3M7M X;  4DV5 B;  3T1H B;  3ZN1 A;  1S72 V;  4JV5 O;  1Q90 D;  2F23 A;  2UXD B;  3UT5 A;  3JAT A;  1SQP H;  1FXK C;  2WLL B;  1WN7 A;  5CBG A;  3CCU V;  1MZF A;  1XL6 A;  4X66 O;  3ZX6 A;  2P6J A;  3P3P A;  2HEP A;  2NNU A;  4NXN O;  1WJZ A;  4B3R O;  2HR3 A;  2QA4 V;  2DW4 A;  2BTQ B;  3BY6 A;  2OWO A;  1GN4 A;  4JI1 O;  3CC7 V;  4DUZ O;  1PP9 H;  3N2G B;  3ZN0 A;  1GM7 A;  1PL4 A;  4NKG B;  2IJH A;  4O4L B;  1SQF A;  2QSA A;  1BS3 A;  1RSO A;  1K8A W;  3DC5 A;  2Z3Y A;  2EIJ B;  4QE9 A;  5IY5 C;  4EKW A;  1S5H C;  4P30 A;  2BTQ A;  2O57 A;  2JS5 A;  5ITZ B;  4G2K A;  1ENV A;  5LL6 Y;  1VF7 A;  4HNA B;  5LYJ A;  2JK5 C;  4GX1 A;  4EB6 B;  5IY5 B;  2EIJ C;  3SYO A;  1E1R G;  3MAQ A;  3FYI B;  2V4D A;  1K3E A;  2F66 C;  3ETE A;  1IBK B;  2BOB C;  4GX2 A;  2ODM A;  1Q86 W;  1UPG A;  1QHT A;  2A9H A;  3L71 H;  4RQF A;  4DRX A;  1HR0 B;  4D7S A;  1RFY A;  3ABL B;  3RGB A;  3DSQ A;  4E2L A;  4FZ0 A;  3JAR A;  4DR2 O;  2LFS A;  1AI7 A;  4JI7 O;  2XAH A;  4DV2 B;  5CB4 B;  2UXC O;  3ZMT A;  2AW9 A;  1L8D A;  2EIL C;  2ITC C;  3G80 A;  4X88 A;  2KQX A;  4UCS A;  2AHZ A;  4DV1 O;  1TA8 A;  3WB2 A;  1FXK B;  3B4S A;  3QF7 A;  5IJ0 A;  3TXQ A;  3THO A;  4GKK O;  1Y74 A;  5JCO C;  1BL8 A;  3JAW A;  1HW7 A;  4JI4 O;  1BZK A;  5KMG A;  3CRM A;  3OTO B;  4MTF A;  3A2F A;  1SF9 A;  1NU1 H;  3PN1 A;  2HFE C;  5IJ9 B;  2LJ2 A;  1IBK O;  1W59 A;  2Y69 B;  5K1X A;  4QE7 A;  4JI8 B;  2CTR A;  4LF5 O;  3E22 B;  4UVC A;  5B1A C;  3CRC A;  5JH7 A;  4ZOL A;  1L1F A;  1H8E G;  2L35 A;  3VQX A;  2YIB D;  1XL4 A;  4NR1 A;  3WB1 A;  4DV1 B;  2XTA A;  2BSK B;  1OCR B;  3ZBH A;  4WFE A;  2DYS C;  1DF4 A;  3F5T A;  3OE7 G;  1SQV H;  1K4D C;  1GMG A;  4B3S O;  2N04 A;  4OX9 B;  4JI0 O;  4LF8 O;  1NT2 B;  1GH6 A;  3OTO O;  1XQ8 A;  2A3Q A;  2EZO A;  2XAQ A;  2CTW A;  4DR3 O;  1YHQ V;  4JGS A;  1YZB A;  5IJ9 A;  2XOK G;  2E5L B;  1CXZ B;  4MVZ A;  2DQ3 A;  2H94 A;  2AZ0 A;  2DYR B;  1TVK B;  2K9P A;  1R73 A;  1LNQ A;  3CP1 A;  2PY5 A;  3OGI B;  3CX5 F;  4U7N A;  2A79 B;  2XAJ A;  1FXK A;  3EVK A;  1MAB G;  3C90 A;  1XNR O;  2X0L A;  4PA4 A;  1NTM H;  2Y4T A;  1F23 A;  2YXY A;  5LMU O;  1PNK A;  3CD6 V;  5K1P A;  4NYK A;  3S3W A;  4WFF A;  3JAR B;  1HNX B;  1XHX A;  4RUF A;  1N32 O;  1KKC A;  5AG2 A;  5D5Q A;  1JFF B;  1I94 B;  1M4U A;  1OCO C;  4DV0 O;  4KUM A;  5FNV B;  2CH7 B;  4TSF G;  2YUA A;  4JYY A;  3K5O A;  4X1Y B;  5EBL C;  1EZV H;  3K9S A;  4G27 B;  4HZ3 A;  5FPR A;  3FYE B;  4JI0 B;  4LF8 B;  3G4S V;  1Y6X A;  4CC5 A;  1RPO A;  3ZHT A;  1IX9 A;  4GCZ A;  1O9G A;  4UCR A;  2Q68 A;  1VQK V;  4YJ2 B;  4JI2 O;  2XUM A;  4WFA V;  2WPD G;  3F5W C;  4O4L A;  2X7R B;  1RPR A;  3LDD A;  4TV9 B;  3P32 A;  4DYL A;  2EIN C;  5KUM A;  2YI9 A;  4U3J A;  4J9Z B;  4LF5 B;  1VQP V;  2ARH A;  1O9H A;  1XNQ O;  1P84 F;  2AXT Z;  3AK2 A;  3RN4 A;  1I0H A;  4GYC B;  3H1L H;  4IIJ B;  1FS0 G;  2CTQ A;  4GT1 A;  3D36 A;  1U97 A;  5LXT A;  2QR4 A;  4JZ2 A;  4X62 O;  1HNW O;  4PI0 A;  5EBW C;  4LFA B;  1N8R W;  4MTX A;  4WBN A;  1OCC C;  2D3O W;  1M57 B;  4H44 B;  3QNE A;  4GKJ B;  4YIO A;  2EJR A;  1GK9 A;  3E86 A;  5L3E A;  2UXN A;  3GVM A;  4E4E A;  3SDL A;  1QVG U;  1JR9 A;  1GAX A;  4J11 A;  1H8H G;  4FK5 C;  1H2L A;  4UV9 A;  1PPJ H;  3AG1 B;  1RM1 B;  1JOY A;  1A32 A;  5EC2 C;  4PDR A;  3VQY A;  2VWJ A;  5KX5 B;  2QE7 G;  4XDJ A;  2PTM A;  1NS1 A;  3L73 H;  4ICG A;  1MNG A;  1N36 B;  3AG3 C;  3JCU Z;  5KHJ A;  1SZX A;  2YDE A;  3KG2 A;  1N36 O;  2ZE7 A;  3KZI Z;  1Q5O A;  1P7G A;  3JD0 A;  3ABK B;  3SYA A;  5IYC O;  4AI8 A;  4J10 A;  2PZS A;  5CA1 A;  2ZR2 A;  3ASN B;  3K3W A;  5IYZ B;  2R9R B;  4JF3 A;  1BCC H;  4BIZ A;  4C7U A;  5KUK A;  2UUC O;  1ZX3 A;  1SS3 A;  2QWO B;  4Q20 A;  3K5L A;  1B6Q A;  3CHX A;  2X6A A;  2UUC B;  3SYP A;  3CCS V;  1Q82 W;  2ZE5 A;  1KMI Z;  3RVZ A;  4W4K A;  4LF7 B;  1K4C C;  1WP7 A;  4I0X A;  5B1O A;  4LNU A;  4X1K B;  5KMG B;  3K04 A;  1YI2 V;  1CP9 A;  3K9A A;  5KA5 A;  5H2F Z;  4ZBM A;  2B1I A;  5BMV B;  3LNM B;  4LH7 A;  5H5N A;  2GUZ A;  2GUZ B;  2FYU H;  4JI3 O;  2UU9 B;  3AK3 A;  1DK1 A;  2F4V B;  3RVY A;  4LP8 A;  1JX9 A;  1K5S A;  1P7B A;  5B1N A;  1BQZ A;  4RO2 A;  5CB4 A;  1NR1 A;  1H2G A;  4J42 A;  4WF9 V;  3ZED A;  2Q67 A;  1Q6U A;  4I4T A;  1RSO B;  2GSM B;  4RUE A;  3M8A A;  3ZCC A;  1OV9 A;  2JEU A;  1BSM A;  3N2G A;  4JV5 B;  3SPC A;  4YJ3 B;  1OCZ C;  4DR2 B;  4JI7 B;  1MG1 A;  2R72 A;  3TGU H;  1Z2G A;  3DXR A;  3EHB B;  4LBE C;  1F4N A;  3T1C A;  4OX9 O;  1ZLZ A;  4LCU C;  5A2Q N;  3ABM B;  5CA1 B;  3LNN A;  3FAV B;  3ZRS A;  2JDI G;  3QVN A;  5D5P A;  4FM2 A;  4TUY A;  4X1I A;  2JJ1 G;  2GV9 A;  1R3K C;  4ZIB A;  2CH7 A;  2N05 A;  1SC5 B;  1BHA A;  1YJ9 V;  5IT9 N;  3W7W A;  4R6Z A;  1LR1 A;  1IBM B;  4DR4 O;  4YIP A;  1I7F A;  1MSW D;  2F93 B;  3W7X A;  1ZAU A;  4F4L A;  2Q5Z A;  4TT3 G;  4YJ2 A;  4B3T O;  5KLV H;  2HLD G;  2UU9 O;  2FB5 A;  2ZIN A;  3L74 H;  4JI2 B;  3UQ8 A;  1DLB A;  1IDS A;  2Q69 A;  3A0H Z;  3VQV A;  5GON B;  1KP2 A;  1R3I C;  5JJJ B;  4H37 A;  3OUF A;  5LGN A;  5F2V O;  2QM4 A;  4PA3 A;  3CCV V;  1XNQ B;  3R66 A;  4X89 A;  2YSU B;  2WLL A;  1PKX A;  3LSQ A;  4DV3 B;  3Q4H B;  4I0X B;  3RBZ A;  1PM9 A;  4K8Z A;  3I56 V;  2PGG A;  4MS2 A;  1DF5 A;  4DK0 A;  3VBB A;  2W6J G;  1M5I A;  1PL0 A;  5IWA O;  3JAS A;  1GO3 F;  5IWA B;  3JAK A;  3K5N A;  3BEH A;  1YCI A;  1YXB A;  3BVO A;  3TET A;  4R50 A;  1DGS A;  4IT5 A;  4TV9 A;  2E74 B;  1V54 C;  3UKM A;  4CBC A;  3T1Y B;  2WLM A;  2YXL A;  1B06 A;  1ZL8 B;  2WSS G;  2YEV B;  4MVM A;  4P2Z A;  3HKC B;  1VQ7 V;  4O2A B;  4RQE A;  3OMN B;  4CH3 A;  1Q81 W;  1CPY A;  2QWR B;  1D5A A;  4H13 B;  4MVO A;  3IC9 A;  3SGI A;  4MVS A;  1V54 B;  4Q6G A;  3E8B A;  5KHG A;  4B3R B;  1VQ8 V;  2BOC C;  3CCM V;  2YC0 A;  5BR8 O;  3RT3 C;  4LWS B;  2P4K A;  2QJ1 A;  3BHP A;  3CJH B;  1Z5W A;  3H1J H;  1NTZ H;  1KKD A;  1IXB A;  1FFT B;  2ETN A;  1QR8 A;  2Z5U A;  1TUE B; 
#chains in the Genus database with same CATH homology
 1VQN V;  4PDL A;  1G4Y B;  1M56 B;  3STZ C;  1OCR B;  3OEE G;  4R7C A;  4WFE A;  2ZR3 A;  2DYS C;  3FB5 C;  4BW5 A;  1DF4 A;  3OE7 G;  1AJP A;  4RAI A;  1K4D C;  1GMG A;  3F7Y C;  3AG2 B;  3DGE A;  3D3I A;  3OAA G;  5HFL A;  1JJ2 U;  2EZO A;  3G71 V;  4JAV A;  4PDM A;  2XAQ A;  3E83 A;  3SPI A;  4JAS A;  2EIM B;  2JJ2 G;  3ASN C;  5B1B B;  5L3D A;  4MW8 A;  1NJI W;  3T4Z A;  1YHQ V;  1OHH G;  4JGS A;  3QO8 A;  1GTO A;  2XOK G;  4MVZ A;  2DQ3 A;  4I9W A;  4MVR A;  2H94 A;  1FXV A;  2EBO A;  4GX5 A;  2DYR B;  3AEI A;  1R73 A;  1GM9 A;  3IC7 A;  1LNQ A;  4OXS A;  3CP1 A;  3AG3 B;  4LC1 A;  4XBF A;  2OT5 A;  2JIZ G;  4J9Y B;  4U7N A;  2QM8 A;  2A79 B;  2XAJ A;  2EIK B;  1FXK A;  3JD2 A;  4YXW G;  1AI4 A;  1JVM A;  3CXC U;  1MAB G;  1AI5 A;  1KP3 A;  1ARO P;  3AG4 B;  4FMT A;  3AG1 C;  1RM1 C;  2X0L A;  2OTL V;  2WLH A;  4PA4 A;  1K33 A;  2MK3 A;  3ZMV A;  1NKD A;  5LHI A;  1F23 A;  2IU0 A;  2UXX A;  4H33 A;  1Q7Y W;  5CN0 A;  3IGA C;  4JAU A;  1PNK A;  4WFB V;  1YJN V;  3CD6 V;  4MTO A;  5L3B A;  4CZZ A;  1JPX A;  2NLJ C;  1MOF A;  1R3J C;  3UM7 A;  4WFF A;  1NH2 B;  1F51 A;  1Y4M A;  4RUF A;  2ATK C;  3OGC C;  2XND G;  3LSS A;  1H38 A;  4UVB A;  1OZ0 A;  3E8G A;  4R8C A;  1ORQ C;  2K1E A;  2ZD9 A;  1W2B U;  3OR6 C;  1HWY A;  5L3F A;  1OCZ B;  4GX0 A;  2LFR A;  5CBH A;  5H6R A;  3ZRV A;  1SZT A;  1YTF D;  1OCO C;  1THZ A;  4KUM A;  5H6Q A;  4TSF G;  1S3J A;  1CEZ A;  3QO7 A;  1W0J G;  5EBL C;  3VOU A;  3CYO A;  2OTJ V;  1R6N A;  4G27 B;  4HZ3 A;  3K03 A;  3E2E A;  1KC8 W;  3FYE B;  1AI6 A;  1SER A;  3MHS C;  3IFX A;  1WLE A;  1QCE A;  3G4S V;  3CCQ V;  3ZMZ A;  1RPO A;  2EZP A;  3B77 A;  3JCZ A;  3FKS G;  2PI4 A;  1K9M W;  4MSW C;  3FB8 C;  4GCZ A;  2IJJ A;  1K97 A;  4QJF B;  2ZXW B;  2Q68 A;  2W0F C;  1VQK V;  2IH1 C;  1AJN A;  4QPK A;  4FPP A;  2ZDI C;  2Q6A A;  3WFV A;  1JCH A;  2JEX A;  4WFA V;  2WPD G;  3LDC A;  3E35 A;  3ML0 A;  3OM3 B;  3X2Q C;  3F5W C;  3X2Q B;  4MVQ A;  2X7R B;  1RPR A;  3LDD A;  3P32 A;  3ABT A;  1R3L C;  3FB7 C;  5EK0 A;  3SPG A;  2EIN C;  5KUM A;  1VQ6 V;  4J9Z B;  1PNM A;  3EFF K;  1VQP V;  2ZXW C;  4UVA A;  2QKS A;  1QBZ A;  1S0V A;  1PNL A;  3CCR V;  3SYC A;  4I5S A;  1QR9 A;  1FS0 G;  2W6I G;  1QVF U;  4GT1 A;  3D36 A;  1YIT V;  2IW5 A;  3CME V;  3W7T A;  5IYB O;  3H01 A;  3MHH C;  2X6B A;  5EBW C;  2WLN A;  3I55 V;  1OCO B;  1V55 C;  2CK3 G;  1NH2 D;  4MTX A;  1N8R W;  1OCC C;  2D3O W;  1M57 B;  3QNE A;  2EJR A;  1GK9 A;  1WPX A;  3E86 A;  5C93 A;  4PA9 A;  5L3E A;  1EFR G;  3ABK C;  2UXN A;  2HG5 C;  1QVG U;  3B8M A;  3ZJZ A;  3ZRX A;  1P4R A;  4JYC A;  1VQM V;  1NR7 A;  2P90 A;  1H8H G;  4FK5 C;  1VQ4 V;  2HVJ C;  1AR1 B;  3DTU B;  2XAS A;  4U7O A;  4FIP C;  4FJC C;  4UV9 A;  3AG1 B;  1RM1 B;  3AG4 C;  1JOY A;  3CPW U;  1G8M A;  5LHH A;  5EC2 C;  4PDR A;  3MD0 A;  2WAM A;  3B8N A;  1J95 A;  5J9P C;  2QE7 G;  2PI5 A;  4XDJ A;  3CCL V;  3ETG A;  2V7Q G;  1YJW V;  3NXS A;  2WWW A;  3AG3 C;  2XAF A;  1Y66 A;  3KG2 A;  2DQ0 A;  1QLN A;  4HYO A;  4KFM A;  5LBQ A;  1M90 W;  2DWD C;  5FL7 G;  3ZRW B;  5DM6 V;  1KD1 W;  3JD0 A;  3ABK B;  3CCJ V;  4TWK A;  1E1Q G;  3SYA A;  1F4M A;  5IYC O;  2P67 A;  1PD3 A;  3CMA V;  3CCE V;  3SJQ C;  2ZR2 A;  3ASN B;  5B1B C;  4ZKI A;  3K3W A;  1I5Y A;  3LUT B;  4JYB A;  3A0R A;  4UV8 A;  5DN6 G;  3G6E V;  1YSC A;  2R9R B;  1M57 C;  3AG2 C;  4MT8 A;  5L3G A;  4BIU A;  1OCC B;  4JF3 A;  3OFN G;  2H8P C;  4MTG A;  1V55 B;  3OR7 C;  4WCE V;  4XDL A;  4BIZ A;  5L3C A;  1NVP D;  2F43 G;  2KB1 A;  2DYS B;  1SRY A;  3T2M A;  1GM8 A;  5KUK A;  4P9P A;  4Q20 A;  2R9I A;  1VQL V;  2QTO A;  1B6Q A;  2X6A A;  1K34 A;  5GW7 A;  3SYP A;  3CCS V;  1Q82 W;  4ASU G;  3SYQ A;  3W7S A;  3JYC A;  1SET A;  3RVZ A;  3M99 B;  3ZIA G;  1NQT A;  1K4C C;  5KA6 A;  1IXM A;  4JPR A;  5B1O A;  1K5Q A;  2M7W A;  1S77 D;  2YEV A;  3K04 A;  4PDV A;  2AHY A;  2QM7 A;  1YI2 V;  1CP9 A;  3RW0 A;  3OEH G;  2EIN B;  3GWO A;  5B1A B;  2WLI B;  3K9A A;  5KA5 A;  4ZBM A;  2B1I A;  2WLK A;  1QLE B;  5IDJ A;  3LNM B;  3ZMS A;  3TCU A;  4P9O A;  4MVU A;  4N21 A;  1AJQ A;  2HKO A;  3RVY A;  4LP8 A;  2ITD C;  3R65 A;  3K0G A;  2WLJ A;  2V1D A;  1ROP A;  3PJS K;  1JX9 A;  1K5S A;  1P7B A;  2HVK C;  5B1N A;  4JTA B;  5CMU A;  4RO2 A;  4UXN A;  1GKF A;  3HPL C;  1EZJ A;  1NR1 A;  1H2G A;  4WF9 V;  1SES A;  3ZN1 A;  1S72 V;  2Q67 A;  3TK1 A;  2GSM B;  3T4D A;  4RUE A;  4Z1M G;  2IU3 A;  1FXK C;  1I5X A;  1VQ5 V;  3ZCC A;  3E8F A;  3E89 A;  2WLL B;  2JEU A;  2OCC C;  3OW2 U;  5CBG A;  3ASO B;  3W7U A;  3SPH A;  4L87 A;  3CCU V;  3SPC A;  1OCZ C;  1XL6 A;  1MG1 A;  5LHG A;  1DTO A;  3EHB B;  4LBE C;  1F4N A;  3T1C A;  3E8H A;  2P6J A;  4LCU C;  3OUS A;  5E1A C;  3ABM B;  1YTF B;  2C2A A;  2NNU A;  3OMI B;  2XAG A;  2JDI G;  1FXH A;  3ZRS A;  2IJI A;  2LP7 A;  2HR3 A;  3ZRW A;  1VQ9 V;  2QA4 V;  3WG7 C;  2JJ1 G;  5H9C A;  2DW4 A;  1R3K C;  3GB7 C;  2HJF C;  4G28 B;  3OMA B;  3BY6 A;  3CC7 V;  3STL C;  3K0D A;  1BHA A;  1YJ9 V;  3ZN0 A;  1GM7 A;  3W7W A;  2IJH A;  1YIJ V;  2X6C A;  4PA6 A;  2EIK C;  4R6Z A;  1JQ0 A;  2A0L A;  3K06 A;  4DXW A;  5LGT A;  5CBF A;  1MSW D;  1UJW B;  1K8A W;  2Z3Y A;  2EIJ B;  4QE9 A;  4WFH A;  5IY5 C;  2IH3 C;  3W7X A;  4EKW A;  4F4L A;  4TT3 G;  1S5H C;  2QEX V;  2HLD G;  1M9N A;  4P30 A;  2DYR C;  3K79 A;  1ZWI C;  2IJK A;  4G2K A;  1S76 D;  1ENV A;  1DLB A;  4QIW F;  2Q69 A;  3JD3 A;  1KP2 A;  2EIM C;  1R3I C;  2JK5 C;  2ZDI A;  4GX1 A;  5IY5 B;  2B1G A;  2EIJ C;  3SYO A;  1E1R G;  5EBM C;  4H37 A;  3FYI B;  1M1K W;  3OUF A;  1K3E A;  1VQO V;  5LGN A;  3P30 A;  3ETE A;  4PA3 A;  3CCV V;  2BOB C;  4GX2 A;  1K7D A;  2WLI A;  3JD4 A;  1Q86 W;  1OCR C;  4X89 A;  2YSU B;  2WLL A;  1PKX A;  3LSQ A;  3HB3 B;  1M56 C;  2A9H A;  1KQS U;  1BMF G;  4RQF A;  3RBZ A;  4JTC B;  1W0K G;  3WG7 B;  3ETD A;  1R6K A;  3ABL B;  3I56 V;  3CC4 V;  4E2L A;  3JD1 A;  4MS2 A;  2LFS A;  1AI7 A;  1DF5 A;  4XDK A;  2XAH A;  2W6J G;  3VBB A;  1K92 A;  3ABM C;  1PL0 A;  3ZMU A;  1GO3 F;  3FB6 C;  3ZMT A;  1KEC A;  3LDE A;  5HFM A;  2EIL C;  2ITC C;  3BEH A;  5EC1 C;  4X88 A;  3TET A;  1NBM G;  4R50 A;  1E79 G;  2AHZ A;  3ASO C;  4WFG A;  1V54 C;  2OCC B;  3K08 A;  1BHB A;  3UKM A;  2Y69 C;  4CBC A;  4MW3 A;  1FXK B;  4DO2 A;  5B3S B;  2WLM A;  1NVP B;  1BL8 A;  3QO5 A;  2B5U A;  2DWE C;  3SPJ A;  2WSS G;  2YEV B;  4BAY A;  4MVM A;  4P2Z A;  1VQ7 V;  4MTF A;  4RQE A;  4X8A A;  4N23 A;  3OMN B;  1Q81 W;  1EBO A;  2HFE C;  4KP4 A;  1CPY A;  4PA7 A;  4QPJ A;  2GHY A;  4JTD B;  5IYD O;  5B3S C;  4QNH B;  2Y69 B;  4MVO A;  4MVS A;  1V54 B;  3E8B A;  4QE7 A;  2ZQM A;  2FTK A;  4PEL A;  4HAM A;  5CA3 A;  1QLE C;  2BOC C;  1VQ8 V;  3CCM V;  4UUJ C;  2EIL B;  2Y48 A;  4UVC A;  5B1A C;  1K73 W;  1COW G;  2P7T C;  1L1F A;  3ABU A;  1KKD A;  5LGU A;  1FFT B;  3F7V C;  5BZB A;  1H8E G;  3ABL C;  1QR8 A;  2Z5U A;  1XL4 A;  1TUE B;  3CC2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...