1PD3A

Influenza a nep m1-binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural protein NS2
publication title Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).
pubmed doi rcsb
source organism Influenza a virus
molecule tags Unknown function
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pd3A00
2GHYA 1GTOA 1F4NA 2IJJA 1F4MA 1RPOA 1RPRA 2IJHA 1PD3A 1GMGA 2IJIA 3K79A 1ROPA 2IJKA 1B6QA 1NKDA 4DO2A
chains in the Genus database with same CATH superfamily
1AJQA 3CCEV 5CMUA 5KMGB 2OYQA 2UXDB 1SETA 4B3RO 3L71H 5TISZ 3M8AA 1QLEB 1TUBB 1FAFA 4BIOA 1R3IC 1MSWD 3M99B 4O2BB 2YDEA 1R6NA 4J7ZA 1N0NA 4DR5B 5IYCO 2IH1C 2Y0PA 4B3MB 3ZHSA 3L73H 3CCRV 2BTOA 4LF9O 2X0LA 4O4LB 1QNMA 3SGIA 5IJ0B 3L74H 1IXBA 4A5UB 2Y69C 1QLNA 2XAJA 1BL8A 4GKJO 3AEIA 3ABLB 4BR6A 2FL4A 3OEHG 2BOBC 2O57A 2XHBA 3U10A 1I7FA 2PI5A 3L70H 3NXSA 2EIJB 3H1IH 4LF4B 2K1EA 1I08A 2H3OA 3SYQA 3QO8A 1GO3F 3APQA 4FLYA 5JQGB 2W0XA 4EB6A 4X66B 3APOA 2ZM6O 2JJ1G 4PA7A 1J95A 4X62B 3G6EV 3CSXA 1L1FA 3CRMA 3OT7A 3CC7V 1HDJA 2E75B 2YI8A 2ZR2A 5B1OA 1Q5OA 2AXTZ 3MHSC 1YEWA 1DF4A 2ADQB 3DXRA 5J2UA 3OGCC 5EYPB 4JI4B 1QBZA 3MDSA 5J2TB 2QGNA 2B9ZA 4J9ZB 4RUFA 4FMTA 4L87A 3S3XA 5A2QN 4NYKA 4O4JA 4QPJA 3SYCA 1JQ0A 4DXWA 2PI4A 5IYDO 2EINB 2Z3YA 4GYCB 1KBHA 1H2NA 1ZTEA 3BABA 4TUYA 2WA4A 2LW1A 2UUBO 2FKXA 3JAWB 5KHJA 2JDIG 2A0LA 4UXNA 2KSDA 1XMOB 3UO2A 4JI6B 3E8BA 4FK5C 4X9QA 3JALB 2KG7A 4WF9V 4JYBA 4WFEA 3PN1A 1IBKO 2HJDA 3I55V 5IT9N 1OCRC 2F66C 4J7JA 3DC6A 5AG2A 5KMGA 4Q20A 4IL6Z 3JARB 1OV9A 1FJGO 2FTKA 1T5EA 2WAMA 1IX9A 5B1AC 5B1NA 5ITZB 1TUBA 2ZDIC 3OMAB 3DTUB 2K9PA 2ODMA 3IFXA 3QO5A 4O2BA 3SYOA 1Y4MA 3E8FA 5H2FZ 5L3DA 2CE4A 3CCLV 1A32A 4LF8O 4TSFG 4IYHA 1GN4A 2HEPA 3F7VC 3DC5A 4X65O 3WFVA 1M4UA 3IGAC 1Q6IA 4R7CA 4JI5O 2LFSA 2EZPA 4I0XA 1KMIZ 1KP3A 1Q86W 4B3TO 1WP8A 1WLEA 1RPRA 1YVWA 4UV8A 3T1YO 1CXZB 1UJWB 3UT5B 3GVMA 4MVMA 1VQ4V 2H94A 2CTRA 3C3SA 4JI2B 5DEDA 5L3GA 1ZL8B 1O9HA 2P67A 5JQGA 1ZX3A 5EZYB 4X1IB 1KECA 4Z2WA 2DWEC 1M93A 3KKYA 4FFBA 1NZ6A 3O65A 5B1BC 1P7BA 1SRYA 1TAEA 2UXCO 4FZ0A 1JA8A 5EYPA 4CC6A 3ABMC 1TVKB 5J2TA 2VS0A 4NTXA 2PF4E 5HFLA 4JI3B 2CGOA 4JAVA 1YITV 1EM1A 3AG7A 3HR0A 3MD0A 1Y6XA 1AJNA 3ZHUA 4DK1A 2JGUA 4GKKB 4JAAA 5IE9A 3ETDA 3FB7C 3QO7A 5BZBA 3RBZA 4KHPB 1IURA 1WB7A 4QIWF 4DV1B 2EIKC 2R72A 2IM9A 2OTJV 2NLJC 1FXKC 1GM7A 4MVUA 1OCRB 3JAWA 4DV7B 3CPWU 4LNUB 3JALA 1IVSA 1FKAO 2QKAA 3RYIB 5B1AB 3D8CA 4XDJA 4LF6O 1N32O 5FPRA 1K4DC 4YJ2B 3JARA 2M6YA 3G80A 4B08A 5IJ9B 3LSUA 4JI8B 4NTYA 5ITZA 1JOYA 4WFBV 4DR7O 5L3EA 1FYJA 1URFA 5IDJA 3T4DA 4JV5B 1R6KA 3K08A 1GRJA 2PGGA 1TGOA 2UUCB 2F23A 4E2LA 4DV0B 1Q81W 3EVKA 4O4IB 4ZOLB 3FFQA 2L6LA 1PNKA 3ZRVA 5LGNA 2YEVB 1US6A 3VOUA 2XTAA 4MTFA 3UT5A 1XNQB 1VF6C 1HNZO 1V54C 4IT5A 1FFXA 3B8MA 5F2VO 3FB6C 5B1BB 3CRAA 1GH6A 2YC0A 1FS0G 1ZL8A 4TQDA 3OM3B 3UQ8A 5IYZA 5EZYA 2JS3A 4X1IA 4LFAO 3ICXA 1AI6A 3ABMB 1B6QA 2RDCA 3JAMN 4PA3A 2OIGA 1JMKC 4JI0B 3VQVA 1Q6UA 4FLZA 3K5OA 2HG5C 1TVKA 2HR3A 1XMQO 2N74A 3OEEG 1F4MA 4CS3A 2EIKB 4JGSA 4BAYA 5CA0B 4NXMB 1FXKB 3SPIA 3T1HB 4AQYO 1EBOA 1JVMA 2N05A 5KHHA 4YY3B 3R66A 2ZD9A 1P7GA 1B06A 3ABUA 2Q9LA 1D5AA 2UXXA 2VQEB 1SQQH 3CWBH 4OX9B 4I9WA 1BS3A 1W0JG 4FIPC 1VP7A 4PJ0Z 4LNUA 3WB1A 4ZHQB 1F23A 2QR4A 3RYIA 2ZDIA 1PPJH 1H8EG 1MG1A 1AROP 4DW1A 1N33O 2IJIA 4YJ2A 2ZNJA 4W4KA 1SKVA 2LP7A 2Q7HA 5IJ9A 4XDKA 4JYYA 2X7RB 4AILC 1H2KA 2QE7G 5BMVB 3B8NA 3T1CA 1JFFA 1RP3B 1J5EB 2A06H 2Q6AA 1CP9A 2ZINA 1K4CC 4CS4A 2JRIA 4JYAO 4PI0A 3D3QA 2YXHA 1ZAUA 2LO1A 2HHHO 1P84F 2YSUB 3BHPA 4O4IA 4FLUA 1G6UA 4ZOLA 4DV2B 4FLXA 5KX5B 1V54B 1UFIA 2BSKB 1NU1H 3DSQA 2YEVA 4DV6O 1SQGA 4DR3B 3H01A 3LSQA 2WLNA 1BSMA 3QF7A 3UKMA 4G27B 1YXBA 3WG7C 2P22C 5LHGA 1X59A 5BY1A 1HNXO 1FD9A 3BEHA 3TCUA 3A8TA 1NVPD 1MNGA 5FNVA 4B3RB 5BR8O 4K8ZA 3RGBA 3ZMSA 4ZI7B 3ZMZA 1HW7A 2RJZA 3K5MA 5DN6G 4LF7O 2R70A 4U3FH 4BIZA 4HYOA 4R50A 1K34A 2IU3A 4CBCA 2Q4PA 3OTOB 2CAZC 1N0JA 4LFBO 3VQXA 4GX2A 2WLHA 2CTPA 3P3PA 4LF9B 4K0KB 2AZ0A 1MZFA 2Y0IA 4HAMA 2IJHA 5LXTB 3B40A 4LH6A 4GKJB 3B4SA 2KKWA 2X6AA 5CA0A 4JI7O 3CMAV 1FXKA 2PYLA 1XHZA 1W59A 5LGUA 3J80N 2CTWA 5KHIA 3HPLC 3ETGA 1BHAA 2YUAA 1EN5A 3EXAA 1BGYH 1RPOA 4B3SO 3KCYA 4WFHA 4B7KA 2NNUA 3F7YC 4MT8A 3K3WA 5E79Z 2ADPA 1VQ8V 3OE7G 2F95B 1AJPA 1BQ0A 4ZHQA 1CEZA 4JASA 2ZM6B 1EN6A 4K8XA 3RYFB 4PA4A 3K06A 2QEXV 5A9GA 5JJNB 3UO3A 5IWAO 1EFRG 1VF5B 2R9AA 4I0XB 1R3JC 5JVDB 1I94O 5BMVA 2YIBA 3CRQA 1IBMO 1G4YB 3NR7A 1GK9A 3K0DA 3BRCA 2Q0OC 3J7AU 1SERA 4L8JA 1M56C 2HLDG 3X2QC 4AI8A 5KLVH 2PY5A 3U11A 1EZVH 2FMLA 2A79B 2VWJA 1HNWO 2UU9B 4J41A 4DRXB 3RYCB 1KYOF 3L72H 3CJHB 3AG4C 4P9OA 1KKCA 3WG7B 1VF6A 3LDEA 3ZIAG 5KX5A 4I4TB 2UUBB 4LF5O 2BSKA 1HR0O 2MK3A 2ARHA 1I0HA 4UVCA 4YJ3B 3HKCB 4FFBB 1IBLO 1VQOV 4X88A 3C90A 4DUYB 1IBKB 4IHJB 1PKXA 1SQFA 2YXLA 4DUZO 5FLXN 1L0LH 2C2AA 4I7ZB 5JCOC 1IZ3A 2OCHA 4P2ZA 1FJGB 4OPHA 3CP1A 2X6CA 1M90W 1XNRO 1Q7YW 3P3NA 4QNHB 3D36A 4R8CA 4ZI7A 3FAVB 2GDSA 4IYIA 4KXRA 3ZN0A 1SQXH 2AGAA 1P49A 4O2AB 2IJJA 4WBNB 1OJHA 1V9PA 2YIAA 3CC2V 1I5YA 4IGGA 1NT2B 3K04A 4LF8B 1IDSA 4X65B 3O9OA 2ZIOA 2ITDC 3IC7A 4I50B 4JI5B 1D2DA 3AK1A 2R9IA 5LXTA 1F7YA 4B3TB 1KD1W 1L8DA 1FXVA 3T1YB 4X1KB 2QWPB 1XEQA 1NBMG 1Y74B 5EBLC 3BPZA 2YIBD 3KZIZ 4N23A 3LDDA 5JH7B 3OGIB 4FZ1A 2ZE5A 4KL1A 2VRZA 3BA8A 3CHXA 4Q6GA 4PD4F 4WCEV 1XOUA 4CC5A 4N21A 3CCSV 1WPXA 3PJSK 4TV8A 4EFEA 4UUJC 2YIDA 3RYFA 2Y69B 5D5QA 3CXCU 2UUAO 1Q6HA 5LMUO 2M7WA 4NVPA 4DR6O 5CA1B 2D2CB 5EK0A 1SZTA 3RFRA 1M56B 5E1AC 2UXCB 1GMGA 5JVDA 4I5SA 2XASA 2Q5ZA 4FFKA 3ZMUA 4DR1O 3AG4B 4HZ3A 5FPOA 4D7TA 4DK0A 2G38A 4F4LA 2QM7A 2YI9A 4HNAB 4DRXA 1K9MW 1FFXB 1VIBA 3RYCA 3CJHA 1K92A 5HFMA 3K59A 4I4TA 2QM4A 1BHBA 5IYZB 2DQ0A 3N2GA 1VQNV 4YJ3A 3HKCA 1AR5A 1S72V 3CB2A 4IHJA 4MW3A 1VQKV 4H13B 4LBEC 3TGUH 4LCUC 5LP6C 4LF6B 1N32B 2Y4UA 3E2EA 5L3FA 4LP8A 1WNSA 1K7DA 1NVPB 3IAYA 3FAVA 2NN4A 1M57C 3TETA 4DR7B 2QWRB 1SA0B 3ZRXA 4EKWA 1H38A 4O2AA 4WBNA 3JCZA 1MOFA 1DLBA 1QCEA 1M1KW 4JYCA 2QSAA 3N27A 4YHHO 1NR7A 2Q7EA 3CRRA 4I50A 4PDVA 1PV0A 3GB7C 2YS8A 5LYJB 5GTIZ 2QDOA 1SF9A 1ZSPA 1VQ5V 4DR2O 4X1KA 4GX5A 4LWSB 3FD9A 1QR8A 2OWOA 3LSSA 4MTGA 1HNZB 1Y74A 1S76D 3SYPA 1FXHA 2ZNIA 2EZOA 4CH3A 5JH7A 4X64O 4JTDB 4U7OA 3W7TA 1Q3EA 1JFFB 1NR1A 4CH5A 1DGSA 4LFAB 5GTHZ 2DWDC 1I5XA 2P4KA 3JAKA 3FKSG 5KHKA 2QKCA 1R3LC 1RSOB 1Q8IA 2YXYA 2CGNA 5CA1A 3SDLA 2XOKG 1E1RG 1NTZH 3JATB 4TOIA 2WA3A 2LJ2A 3R65A 2X6BA 1XMQB 1RM1C 2E5LO 1XQ8A 4UVAA 1E1QG 5FL7G 2GTAA 4HNAA 1Q90D 3SR2C 4AQYB 2ZE8A 1P4RA 2WLIB 2Y4TA 4U3JB 3ASOC 5FNVB 2NR5A 2EJ7A 5LP6B 3CXHF 1YSCA 1KQSU 2Q73A 3ABKC 5JCOA 1KUQA 1OHHG 4JI1O 2JEUA 4DV4O 4QJFB 5CBHA 4DR4O 1U96A 3ZRWB 4JI8O 1ZLZA 1M57B 3D36C 2RQ6A 1H2GA 1Q82W 3FB5C 1AB3A 3A0HZ 1QHTA 3HKBB 1N33B 3JCUZ 2UXBO 3K5LA 3JD2A 4DV5O 2Q68A 1SS3A 2ATKC 4NB5A 4PHZA 3GWOA 4Z1VA 4LR3A 1SA0A 4FPPA 4UV9A 1QVFU 2ZQMA 3HB3B 2QKSA 2Z0AA 1HWYA 2ZXWC 3BA9A 1N34O 3ZCCA 4X20B 1X4TA 2XAFA 3HKEB 4JYAB 3W7UA 2A9HA 4X1YB 2WSSG 1EZJA 3JASB 2GBOA 2HHHB 4OPAA 3AG2C 2JEXA 2IBZH 1WP7A 5LYJA 2LGWA 3QTCA 5KAFZ 1SZXA 1K5SA 2CTQA 3FYIB 5H5NA 4DV6B 4R6ZA 2MW2B 1AR4A 2OTLV 2FB5A 4LWSA 2UXNA 1XILA 3M7MX 3ZJZA 3WB2A 3VQYA 1HNXB 2OIEA 1Y67A 3OTFA 5K1PA 1YHQV 3ZHRA 3BY6A 3RT3C 5BR8B 4K3AA 1XL6A 2B1GA 2EIMC 4LFCO 4GZRB 4LF7B 2BTQB 1NKDA 1RSOA 1RM1B 2EILC 2GUZB 1JPXA 2PYJA 1PD3A 4LFBB 3QVNA 1XL4A 2QWNB 1VQPV 1WB8A 2Y48A 1YTFD 3ZN1A 3UCSC 2HVJC 3OMNB 3K57A 3JATA 5GW7A 2PZSA 2GSMB 4Z1MG 1N36O 4QPKA 5JWPA 3WB0A 3SPCA 4D7SA 1H2MA 1XBLA 3ZMVA 4QE7A 4O4HB 3KG2A 2DQ3A 1R1BA 3ASOB 1QU7A 3T4ZA 4JI7B 4FM0A 2ZE7A 5LGTA 3ABKB 3W7XA 3F5WC 1W0KG 3JD4A 4WFGA 2R9RB 1SQVH 4UB8Z 2XT9A 3F5TA 2WLIA 3CCJV 4U3JA 1GTOA 3FYEB 4B3SB 2FYUH 3UM7A 3RYHB 4G28B 5LP6A 2AHZA 3JSNA 2BCCH 2P06A 2F4VO 1XREA 5LOVB 3ABTA 3H1HH 3ZRWA 2JGDB 2CUGA 1B3QA 4HBNA 2N04A 3CCQV 4YXWG 3HKBA 1E79G 4P30A 3RVYA 5EBMC 3OAAG 4YIPA 4FM2A 1YI2V 5IWAB 1Z5WA 3J81N 3OD4A 2ZXWB 3EHBB 1I94B 2YICA 1IBMB 3GWKC 1FPOA 2P90A 2BOCC 3AG2B 3OR6C 1S3JA 1K97A 4X20A 3HKEA 4X1YA 3JASA 4NXNO 4DYLA 1HNWB 4F6EA 4D6TH 5C93A 2V7QG 5CA3A 4QGPA 1GM9A 1VQ6V 1B04A 2GTSA 2VQFO 1PNMA 4LF5B 1HR0B 1G1XB 1YZBA 4BW5A 5IY5C 4TV8B 5K1XA 1K3EA 1Y76B 1AVMA 3EFFK 4WFAV 5H9CA 2QJ1A 2QWQB 4FM1A 1IBLB 4NR1A 5LA6B 2EIMB 4RO2A 4DUZB 3CS5A 4CH6A 1TA8A 1NTKH 2CH7B 3AK2A 1JCHA 5KAIZ 1GN2A 1GKFA 2IW5A 1MSDA 2EILB 2Q0AA 3BAAA 2Q69A 2KB1A 1XNRB 4ZIBA 4UCSA 4TWKA 3SPHA 3OTOO 2LW7A 3TXQA 4TT3G 1XHXA 3JSLA 4B7EA 2BTQA 5LBQA 4K0KO 5LMNO 1PNLA 4DV3O 2GUZA 2E3CA 3SJAC 4ICGA 1TUEB 2XAHA 3KCXA 5D5PA 2ITCC 4MTXA 5KA6A 4I55B 4MVOA 4K35A 3CD6V 3N2GB 5EBWC 3CRCA 3B09A 4O4HA 4FLWA 2GV9A 2UXDO 3RW0A 1Z2GA 1Y66A 1M9NA 2HP8A 4XDLA 4JZ2A 3G4SV 1H2SB 1GAXA 3D3IA 5DM6V 3OW2U 2XUMA 4F6RA 2JK5C 2QM8A 3FB8C 3RYHA 3A0RA 5IYBO 1S77D 4DR5O 5BXZA 2B1IA 4B3MO 5LHIA 4MVQA 2LFRA 2F93B 1SC5B 5LOVA 1Z5VA 1XUQA 2JGDA 3CEIA 1N8RW 4MVRA 2UUAB 4PELA 1O9GA 1VQLV 4GLXA 5LMUB 2DOSA 3P32A 4DR6B 3HKDB 4BW9A 2JVDA 3VQWA 3K58A 2WLJA 4MSWC 4IIJA 2EX3A 3E35A 4ZKIA 4LF4O 2UU9O 2DYRC 1AP6A 4DR1B 2P7TC 2E76B 2DMXA 3CYOA 4YIOA 2OCCC 1DF5A 4X66O 4AHCA 3LNMB 1RFYA 5IY5B 4X62O 4LH7A 4NTWA 4PA6A 2P5OA 2HJFC 5H6QA 2OT5A 3STLC 1AI7A 4DUYO 1QVGU 2P6JA 1S0VA 2F1MA 3G6BA 2XNDG 1V55C 3JAKB 1GM8A 1Y76A 3H1KH 4WFFA 5J9PC 4JI4O 2HKOA 3ZS8C 2EBOA 5LA6A 3CCUV 3K9AA 2WLKA 2CH7A 3H1LH 3AK3A 2XAGA 3X2QB 1AI5A 4W4LA 1NI8A 1WAZA 1WA8B 4OGQB 3RN4A 3E86A 2ZKOA 4PI2A 3BVOA 1H2LA 4G2KA 5DECA 3QNEA 5EC2C 3CX5F 1QR9A 2IH3C 3A2FA 1VQMV 4O4LA 1BE3H 5IJ0A 1XMOO 2PTMA 1NH2D 2WPDG 4JI6O 4CH4A 4H33A 2LGQA 5LL6Y 4YHHB 4I55A 2Z5UA 4KFMA 1YTFB 3JD1A 3ZHTA 3K0GA 2HFEC 4KP4A 4MW8A 1VEWA 5KUKA 3TXSA 4DR2B 4JTCB 3DGEA 1L0NH 1OCZC 1WN7A 1VARA 4JZGA 3P30A 4GX0A 1N4CA 4RUEA 4X8AA 3ETEA 1BMFG 2IJKA 4PDLA 1JJ2U 2Q8VA 2WLLB 4X64B 5LHHA 4TV9B 4J42A 2A7WA 3SJBC 3ZEDA 3VBBA 1UPGA 3L9DA 2LQTA 3CCMV 3ZBHA 3LNNA 1G8MA 4MTOA 1NTMH 3IC9A 1GN6A 1M5IA 3STZC 2DYRB 4X89A 3E89A 1IXMA 3HKDA 3ZRSA 1VMGA 3JYCA 3JD3A 3ZHVA 2BE3A 2QTOA 2OCCB 4J80A 4P9PA 4H37A 4UCOA 2E5LB 2JIZG 3ZHQA 4RQEA 4JI2O 1JX9A 3I56V 2H8PC 4LC1A 3IJ4A 3CCVV 1JJOA 1R3KC 2ETNA 1ROPA 5GONB 4PV1B 4EEQA 1YDXA 1V55B 4DW0A 1K33A 3B77A 4EFBA 1S5HC 3MAQA 2WLMA 3AG1C 3G67A 2D3OW 2V4DA 4JF3A 1YJWV 1CPYA 4KUMA 1OCCC 2E74B 4UFZA 3TK1A 4JI1B 4DV4B 3WU2Z 4CZZA 4DR4B 1PP9H 4PA9A 3H9VA 1W2BU 1AP5A 4PDRA 2PUSA 3E22B 1WJZA 3E8GA 3ZX6A 4RAIA 4MVZA 4JI3O 3RVZA 3RWRD 2Q67A 5B5EZ 5C8YB 2UXBB 4DV5B 1ZUQA 2EULA 1WA8A 4GKKO 2A3QA 4KHPO 4DV1O 3OUSA 1S5JA 1H8HG 1XDCA 5KHGA 3OR7C 1N34B 3SJCC 4DV7O 3ZMTA 1YIJV 3Q4HB 1S5LZ 3JD0A 1U97A 2ZCEA 1NS1A 1OCZB 3LUTB 1AI4A 2W6IG 1MMMA 3N2KB 1LUVA 1ENVA 5CN0A 1R73A 4FLVA 4UCVA 2QA4V 4JPRA 5B3SC 4TQFA 5KUMA 3H1JH 1F51A 1OCOC 1YCIA 3AG3C 1LR1A 3CMEV 4MVSA 5KA5A 2RMKB 2V1DA 4J11A 1K5QA 2ZE6A 2DW4A 4FVMA 3BFRA 1SQBH 4RWUA 4JV5O 2WLLA 4UCTA 4TV9A 3OFNG 2RNBA 1QQCA 2UUCO 5EIBD 4GT1A 4DV0O 4LFCB 4MS2A 4GX1A 1JR9A 1DTOA 3ASNC 4E4EA 3MHHC 4ZBMA 4H0LB 2B5UA 3TJTA 3A0BZ 3FX7A 4GCZA 1LUWA 2IU0A 5B66Z 5CB4B 5L3BA 4J10A 3S3WA 1XNQO 2DYSC 3OMIB 1PL4A 3CC4V 1N36B 2JJ2G 4U7NA 1KKDA 2WWWA 4J7KA 1YJ9V 3SYAA 4QE9A 2KQXA 2QTSA 1LNQA 5JJEB 2RN9A 2F43G 5GONA 3AG1B 3LDCA 2W0FC 1OZ0A 3E8HA 1COWG 4PDMA 1OCCB 1BQZA 1VQ7V 4NKGB 3I5DA 3T2MA 4UCRA 1YJNV 1AILA 2GHYA 3ML0A 5JJJB 1PL0A 3K5NA 4JAUA 1DK1A 4JI0O 1QLEC 1SQPH 2VWKA 1D5NA 3L75H 2F4VB 2ZR3A 1KP2A 2DJVA 2L35A 1VF7A 2ZT9B 3E22A 3W7SA 5CBFA 2EJRA 1FFTB 4H44B 3E83A 2XAQA 2DE0X 1YF2A 5C8YA 3QG5A 4NXMO 1KC8W 3T1HO 1ZWIC 1Q43A 3K9SA 1KB9F 2HVKC 5H6RA 4YY3O 1HP8A 4XBFA 1XI1A 2VQEO 1MZEA 2RCVA 5EC1C 3ABLC 1SESA 4OX9O 3U0ZA 4C7UA 4RQFA 1NJIW 4FLTA 3K03A 1THZA 4EB6B 3THOA 4J9YB 3SPJA 2EIJC 4NXNB 3Q4HA 2AW9A 5B3SB 2JS5A 2ILMA 4F6RB 3W7WA 1NH2B 1OCOB 1F4NA 1PM9A 3AG3B 4OXSA 2VQFB 3N2KA 4BWAA 1MABG 1AR1B 4ABMA 1NQTA 4ASUG 2CDYA 2AHYA 1K8AW 1R6TA 4I9QA 3DXRB 5J2UB 4UCUA 2Q7GA 5CBGA 3C3TA 2AZ2A 1VQ9V 3SJQC 2ZIMA 1WPBA 1J5EO 4BIUA 3ASNB 2W6JG 4GUNA 4IIJB 3K79A 2DN9A 3G71V 4FJCC 4O4JB 5L3CA 4JTAB 3CE2A 1EN4A 2DYSB 4DV2O 5LMNB 1GN3A 4TUYB 4DV3B 3SPGA 5CB4A 1KU9A 1MA1A 2CK3G 4DR3O 4CS2A 2KG7B 2EINC 2P4VA 3BCCH 1ORQC 1BT8A 4DO2A 4UVBA 1BCCH 1BZKA 1K73W 5EIBC 4UB6Z 3OUFA 3ETQA 3B2EE 2QWOB
chains in the Genus database with same CATH topology
1AJQA 5IY5B 4FIPC 3CCEV 4GX5A 5CMUA 4PA6A 1QR8A 2HJFC 5H6QA 3LSSA 4MTGA 1S76D 3SYPA 2OT5A 1F23A 1AI7A 3STLC 1SETA 1QVGU 1FXHA 2P6JA 1S0VA 1QLEB 2EZOA 2XNDG 2ZDIA 1V55C 1GM8A 1H8EG 1R3IC 4JTDB 1MSWD 1MG1A 1AROP 3M99B 4U7OA 4WFFA 2IJIA 5J9PC 3W7TA 2HKOA 1R6NA 2LP7A 1NR1A 2EBOA 3CCUV 3K9AA 2WLKA 2DWDC 1I5XA 4XDKA 5IYCO 3FKSG 2X7RB 2IH1C 3X2QB 1R3LC 2QE7G 2XAGA 3CCRV 1AI5A 3B8NA 3T1CA 2X0LA 3E86A 2Q6AA 1CP9A 2XOKG 4G2KA 1K4CC 3QNEA 1E1RG 5EC2C 2Y69C 1QLNA 2XAJA 1BL8A 1QR9A 2IH3C 3R65A 3AEIA 2X6BA 3ABLB 1RM1C 3OEHG 1VQMV 2YSUB 2BOBC 4UVAA 1E1QG 1NH2D 2WPDG 2PI5A 3NXSA 2EIJB 5FL7G 4H33A 1V54B 2K1EA 3SYQA 3QO8A 2YEVA 2Z5UA 1GO3F 4KFMA 1YTFB 3JD1A 1P4RA 3K0GA 3H01A 2HFEC 3LSQA 2WLIB 2WLNA 4KP4A 3UKMA 4G27B 3WG7C 4MW8A 3ASOC 5LHGA 5KUKA 2JJ1G 4PA7A 1J95A 1YSCA 3TCUA 3BEHA 1KQSU 3ABKC 4JTCB 3DGEA 3G6EV 1NVPD 1L1FA 1OCZC 1OHHG 2JEUA 3CC7V 3P30A 4QJFB 4GX0A 5CBHA 4RUEA 4X8AA 2ZR2A 3ETEA 3ZRWB 5B1OA 1BMFG 3ZMSA 3MHSC 2IJKA 3ZMZA 1M57B 1DF4A 4PDLA 1JJ2U 2WLLB 5DN6G 1H2GA 5LHHA 4BIZA 4HYOA 4R50A 1Q82W 3FB5C 3OGCC 1QBZA 1K34A 2IU3A 3JD2A 4CBCA 3VBBA 2Q68A 3CCMV 2ATKC 1G8MA 4GX2A 4MTOA 4J9ZB 2WLHA 4RUFA 3GWOA 4FMTA 4L87A 3STZC 2DYRB 4QPJA 4FPPA 3SYCA 4X89A 1JQ0A 3E89A 4DXWA 1IXMA 4UV9A 2PI4A 1QVFU 2ZQMA 3HB3B 3ZRSA 5IYDO 2QKSA 3JYCA 2EINB 4HAMA 1HWYA 2ZXWC 3JD3A 2IJHA 3ZCCA 2Z3YA 2QTOA 2XAFA 2OCCB 3W7UA 2A9HA 2WSSG 1EZJA 4P9PA 2X6AA 3CMAV 1FXKA 4H37A 2JIZG 4RQEA 2JDIG 2A0LA 1JX9A 3AG2C 5LGUA 2H8PC 2JEXA 4LC1A 4UXNA 3I56V 3E8BA 3CCVV 4FK5C 1R3KC 1ROPA 3HPLC 3ETGA 1BHAA 4WF9V 4JYBA 4WFEA 1RPOA 1K5SA 3FYIB 3I55V 1V55B 4WFHA 2NNUA 3F7YC 4R6ZA 4MT8A 1K33A 3K3WA 2OTLV 1OCRC 1VQ8V 2UXNA 3OE7G 3B77A 4Q20A 3ZJZA 1AJPA 1S5HC 1CEZA 4JASA 2FTKA 2WLMA 3AG1C 2D3OW 4JF3A 2WAMA 5B1AC 1YJWV 5B1NA 1CPYA 4KUMA 2ZDIC 3OMAB 1YHQV 3DTUB 3BY6A 1OCCC 4PA4A 3TK1A 3IFXA 3K06A 3QO5A 2QEXV 4CZZA 4PA9A 3SYOA 1Y4MA 3E8FA 4PDRA 1W2BU 3E8GA 1XL6A 5L3DA 2B1GA 4RAIA 1EFRG 2EIMC 3CCLV 4MVZA 3RVZA 1R3JC 4TSFG 3F7VC 2Q67A 1NKDA 1RM1B 2EILC 3WFVA 1JPXA 1G4YB 1PD3A 3IGAC 4R7CA 1GK9A 3K0DA 1SERA 2LFSA 1XL4A 2EZPA 1VQPV 2Y48A 1YTFD 3ZN1A 1KP3A 2HVJC 1M56C 3OMNB 1Q86W 2HLDG 3X2QC 3OUSA 5GW7A 1WLEA 2A79B 1H8HG 1RPRA 2GSMB 4Z1MG 4QPKA 3OR7C 4UV8A 3SPCA 1UJWB 4P9OA 3AG4C 3ZMVA 4MVMA 3WG7B 3LDEA 4QE7A 3KG2A 2DQ3A 3ASOB 1VQ4V 3ZIAG 3ZMTA 1YIJV 3T4ZA 2H94A 5LGTA 2MK3A 3ABKB 3JD0A 3W7XA 3F5WC 1W0KG 3JD4A 4WFGA 2R9RB 4UVCA 1OCZB 3LUTB 1AI4A 5L3GA 2W6IG 2P67A 2WLIA 3CCJV 1VQOV 4X88A 1ENVA 5CN0A 1GTOA 1R73A 3FYEB 3UM7A 1PKXA 4G28B 2QA4V 1KECA 4JPRA 5B3SC 5KUMA 2AHZA 2C2AA 2DWEC 1F51A 1OCOC 3AG3C 4P2ZA 5B1BC 3CMEV 3CP1A 4MVSA 1P7BA 2X6CA 3ABTA 5KA5A 2V1DA 1M90W 1Q7YW 1K5QA 1SRYA 4QNHB 3ZRWA 2DW4A 3D36A 4R8CA 2WLLA 3ZN0A 3CCQV 4YXWG 3OFNG 1E79G 4P30A 3RVYA 3ABMC 5EBMC 3OAAG 1YI2V 2IJJA 4GT1A 3CC2V 5HFLA 1I5YA 4MS2A 2ZXWB 3EHBB 4GX1A 3K04A 4JAVA 1DTOA 3ASNC 1YITV 3MD0A 3MHHC 4ZBMA 2B5UA 2ITDC 2P90A 1AJNA 2BOCC 4GCZA 3IC7A 3AG2B 2IU0A 5L3BA 3ETDA 3FB7C 3OR6C 1S3JA 3QO7A 5BZBA 3RBZA 1K97A 2DYSC 2R9IA 4QIWF 2EIKC 3OMIB 3CC4V 1KD1W 2OTJV 2NLJC 2JJ2G 4U7NA 1FXKC 1GM7A 5C93A 2WWWA 2V7QG 5CA3A 1FXVA 1OCRB 4MVUA 1YJ9V 1KKDA 1GM9A 3SYAA 4QE9A 1NBMG 1VQ6V 1LNQA 3CPWU 2F43G 5EBLC 3AG1B 3LDCA 1PNMA 2W0FC 1OZ0A 3E8HA 5B1AB 4N23A 4XDJA 1COWG 3LDDA 4PDMA 4BW5A 1OCCB 1VQ7V 5IY5C 3T2MA 1K3EA 1K4DC 3EFFK 4WFAV 5H9CA 1YJNV 2GHYA 3ML0A 1PL0A 4WCEV 2EIMB 4RO2A 4JAUA 4N21A 3CCSV 1WPXA 3PJSK 1QLEC 1JCHA 1GKFA 2IW5A 4UUJC 3CXCU 2Y69B 1JOYA 4WFBV 2ZR3A 1KP2A 2EILB 2Q69A 2M7WA 2KB1A 5L3EA 4TWKA 3SPHA 5EK0A 1SZTA 3W7SA 5IDJA 5CBFA 3T4DA 1M56B 2EJRA 4TT3G 5E1AC 1FFTB 1R6KA 3K08A 1GMGA 3E83A 2XAQA 4I5SA 2XASA 5LBQA 1PNLA 3ZMUA 1KC8W 1ZWIC 4E2LA 1Q81W 1TUEB 3AG4B 2XAHA 2HVKC 5H6RA 4HZ3A 2ITCC 4F4LA 4MTXA 1PNKA 5KA6A 4XBFA 2QM7A 3ZRVA 5LGNA 2YEVB 4MVOA 5EC1C 3ABLC 1SESA 3VOUA 1K9MW 3CD6V 4MTFA 5EBWC 4RQFA 1NJIW 1K92A 1THZA 3K03A 5HFMA 4J9YB 3RW0A 3SPJA 2EIJC 1Y66A 1M9NA 1V54C 4XDLA 5B3SB 1BHBA 3W7WA 2DQ0A 3G4SV 3B8MA 1NH2B 1VQNV 1OCOB 1F4NA 3FB6C 3AG3B 4OXSA 5B1BB 3D3IA 5DM6V 1FS0G 3OM3B 1MABG 1AR1B 3OW2U 1S72V 1NQTA 2JK5C 4ASUG 2QM8A 4MW3A 4LBEC 3FB8C 2AHYA 1VQKV 3A0RA 4LCUC 1K8AW 5IYBO 1S77D 1AI6A 2B1IA 5CBGA 3ABMB 1B6QA 5LHIA 4MVQA 1VQ9V 2LFRA 3SJQC 3E2EA 4PA3A 5L3FA 4LP8A 1K7DA 1NVPB 1N8RW 4BIUA 3ASNB 4MVRA 2W6JG 1M57C 3K79A 4PELA 3TETA 1VQLV 3G71V 4FJCC 5L3CA 4EKWA 3ZRXA 2HG5C 3P32A 1H38A 2HR3A 4JTAB 3JCZA 2WLJA 4MSWC 3OEEG 2DYSB 1F4MA 1MOFA 1DLBA 1QCEA 2EIKB 1M1KW 4JGSA 3E35A 4JYCA 4BAYA 4ZKIA 1FXKB 3SPGA 1NR7A 3SPIA 2DYRC 1EBOA 2P7TC 1JVMA 4PDVA 2CK3G 3GB7C 2EINC 2ZD9A 3ABUA 1ORQC 3CYOA 2OCCC 4UVBA 1DF5A 2UXXA 4DO2A 1K73W 3OUFA 1VQ5V 4I9WA 1W0JG 3LNMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHY A;  1GTO A;  1F4N A;  2IJJ A;  1F4M A;  1RPO A;  1RPR A;  2IJH A;  1PD3 A;  1GMG A;  2IJI A;  3K79 A;  1ROP A;  2IJK A;  1B6Q A;  1NKD A;  4DO2 A; 
#chains in the Genus database with same CATH topology
 1AJQ A;  3CCE V;  5CMU A;  5KMG B;  2OYQ A;  2UXD B;  1SET A;  4B3R O;  3L71 H;  5TIS Z;  3M8A A;  1QLE B;  1TUB B;  1FAF A;  4BIO A;  1R3I C;  1MSW D;  3M99 B;  4O2B B;  2YDE A;  1R6N A;  4J7Z A;  1N0N A;  4DR5 B;  5IYC O;  2IH1 C;  2Y0P A;  4B3M B;  3ZHS A;  3L73 H;  3CCR V;  2BTO A;  4LF9 O;  2X0L A;  4O4L B;  1QNM A;  3SGI A;  5IJ0 B;  3L74 H;  1IXB A;  4A5U B;  2Y69 C;  1QLN A;  2XAJ A;  1BL8 A;  4GKJ O;  3AEI A;  3ABL B;  4BR6 A;  2FL4 A;  3OEH G;  2BOB C;  2O57 A;  2XHB A;  3U10 A;  1I7F A;  2PI5 A;  3L70 H;  3NXS A;  2EIJ B;  3H1I H;  4LF4 B;  2K1E A;  1I08 A;  2H3O A;  3SYQ A;  3QO8 A;  1GO3 F;  3APQ A;  4FLY A;  5JQG B;  2W0X A;  4EB6 A;  4X66 B;  3APO A;  2ZM6 O;  2JJ1 G;  4PA7 A;  1J95 A;  4X62 B;  3G6E V;  3CSX A;  1L1F A;  3CRM A;  3OT7 A;  3CC7 V;  1HDJ A;  2E75 B;  2YI8 A;  2ZR2 A;  5B1O A;  1Q5O A;  2AXT Z;  3MHS C;  1YEW A;  1DF4 A;  2ADQ B;  3DXR A;  5J2U A;  3OGC C;  5EYP B;  4JI4 B;  1QBZ A;  3MDS A;  5J2T B;  2QGN A;  2B9Z A;  4J9Z B;  4RUF A;  4FMT A;  4L87 A;  3S3X A;  5A2Q N;  4NYK A;  4O4J A;  4QPJ A;  3SYC A;  1JQ0 A;  4DXW A;  2PI4 A;  5IYD O;  2EIN B;  2Z3Y A;  4GYC B;  1KBH A;  1H2N A;  1ZTE A;  3BAB A;  4TUY A;  2WA4 A;  2LW1 A;  2UUB O;  2FKX A;  3JAW B;  5KHJ A;  2JDI G;  2A0L A;  4UXN A;  2KSD A;  1XMO B;  3UO2 A;  4JI6 B;  3E8B A;  4FK5 C;  4X9Q A;  3JAL B;  2KG7 A;  4WF9 V;  4JYB A;  4WFE A;  3PN1 A;  1IBK O;  2HJD A;  3I55 V;  5IT9 N;  1OCR C;  2F66 C;  4J7J A;  3DC6 A;  5AG2 A;  5KMG A;  4Q20 A;  4IL6 Z;  3JAR B;  1OV9 A;  1FJG O;  2FTK A;  1T5E A;  2WAM A;  1IX9 A;  5B1A C;  5B1N A;  5ITZ B;  1TUB A;  2ZDI C;  3OMA B;  3DTU B;  2K9P A;  2ODM A;  3IFX A;  3QO5 A;  4O2B A;  3SYO A;  1Y4M A;  3E8F A;  5H2F Z;  5L3D A;  2CE4 A;  3CCL V;  1A32 A;  4LF8 O;  4TSF G;  4IYH A;  1GN4 A;  2HEP A;  3F7V C;  3DC5 A;  4X65 O;  3WFV A;  1M4U A;  3IGA C;  1Q6I A;  4R7C A;  4JI5 O;  2LFS A;  2EZP A;  4I0X A;  1KMI Z;  1KP3 A;  1Q86 W;  4B3T O;  1WP8 A;  1WLE A;  1RPR A;  1YVW A;  4UV8 A;  3T1Y O;  1CXZ B;  1UJW B;  3UT5 B;  3GVM A;  4MVM A;  1VQ4 V;  2H94 A;  2CTR A;  3C3S A;  4JI2 B;  5DED A;  5L3G A;  1ZL8 B;  1O9H A;  2P67 A;  5JQG A;  1ZX3 A;  5EZY B;  4X1I B;  1KEC A;  4Z2W A;  2DWE C;  1M93 A;  3KKY A;  4FFB A;  1NZ6 A;  3O65 A;  5B1B C;  1P7B A;  1SRY A;  1TAE A;  2UXC O;  4FZ0 A;  1JA8 A;  5EYP A;  4CC6 A;  3ABM C;  1TVK B;  5J2T A;  2VS0 A;  4NTX A;  2PF4 E;  5HFL A;  4JI3 B;  2CGO A;  4JAV A;  1YIT V;  1EM1 A;  3AG7 A;  3HR0 A;  3MD0 A;  1Y6X A;  1AJN A;  3ZHU A;  4DK1 A;  2JGU A;  4GKK B;  4JAA A;  5IE9 A;  3ETD A;  3FB7 C;  3QO7 A;  5BZB A;  3RBZ A;  4KHP B;  1IUR A;  1WB7 A;  4QIW F;  4DV1 B;  2EIK C;  2R72 A;  2IM9 A;  2OTJ V;  2NLJ C;  1FXK C;  1GM7 A;  4MVU A;  1OCR B;  3JAW A;  4DV7 B;  3CPW U;  4LNU B;  3JAL A;  1IVS A;  1FKA O;  2QKA A;  3RYI B;  5B1A B;  3D8C A;  4XDJ A;  4LF6 O;  1N32 O;  5FPR A;  1K4D C;  4YJ2 B;  3JAR A;  2M6Y A;  3G80 A;  4B08 A;  5IJ9 B;  3LSU A;  4JI8 B;  4NTY A;  5ITZ A;  1JOY A;  4WFB V;  4DR7 O;  5L3E A;  1FYJ A;  1URF A;  5IDJ A;  3T4D A;  4JV5 B;  1R6K A;  3K08 A;  1GRJ A;  2PGG A;  1TGO A;  2UUC B;  2F23 A;  4E2L A;  4DV0 B;  1Q81 W;  3EVK A;  4O4I B;  4ZOL B;  3FFQ A;  2L6L A;  1PNK A;  3ZRV A;  5LGN A;  2YEV B;  1US6 A;  3VOU A;  2XTA A;  4MTF A;  3UT5 A;  1XNQ B;  1VF6 C;  1HNZ O;  1V54 C;  4IT5 A;  1FFX A;  3B8M A;  5F2V O;  3FB6 C;  5B1B B;  3CRA A;  1GH6 A;  2YC0 A;  1FS0 G;  1ZL8 A;  4TQD A;  3OM3 B;  3UQ8 A;  5IYZ A;  5EZY A;  2JS3 A;  4X1I A;  4LFA O;  3ICX A;  1AI6 A;  3ABM B;  1B6Q A;  2RDC A;  3JAM N;  4PA3 A;  2OIG A;  1JMK C;  4JI0 B;  3VQV A;  1Q6U A;  4FLZ A;  3K5O A;  2HG5 C;  1TVK A;  2HR3 A;  1XMQ O;  2N74 A;  3OEE G;  1F4M A;  4CS3 A;  2EIK B;  4JGS A;  4BAY A;  5CA0 B;  4NXM B;  1FXK B;  3SPI A;  3T1H B;  4AQY O;  1EBO A;  1JVM A;  2N05 A;  5KHH A;  4YY3 B;  3R66 A;  2ZD9 A;  1P7G A;  1B06 A;  3ABU A;  2Q9L A;  1D5A A;  2UXX A;  2VQE B;  1SQQ H;  3CWB H;  4OX9 B;  4I9W A;  1BS3 A;  1W0J G;  4FIP C;  1VP7 A;  4PJ0 Z;  4LNU A;  3WB1 A;  4ZHQ B;  1F23 A;  2QR4 A;  3RYI A;  2ZDI A;  1PPJ H;  1H8E G;  1MG1 A;  1ARO P;  4DW1 A;  1N33 O;  2IJI A;  4YJ2 A;  2ZNJ A;  4W4K A;  1SKV A;  2LP7 A;  2Q7H A;  5IJ9 A;  4XDK A;  4JYY A;  2X7R B;  4AIL C;  1H2K A;  2QE7 G;  5BMV B;  3B8N A;  3T1C A;  1JFF A;  1RP3 B;  1J5E B;  2A06 H;  2Q6A A;  1CP9 A;  2ZIN A;  1K4C C;  4CS4 A;  2JRI A;  4JYA O;  4PI0 A;  3D3Q A;  2YXH A;  1ZAU A;  2LO1 A;  2HHH O;  1P84 F;  2YSU B;  3BHP A;  4O4I A;  4FLU A;  1G6U A;  4ZOL A;  4DV2 B;  4FLX A;  5KX5 B;  1V54 B;  1UFI A;  2BSK B;  1NU1 H;  3DSQ A;  2YEV A;  4DV6 O;  1SQG A;  4DR3 B;  3H01 A;  3LSQ A;  2WLN A;  1BSM A;  3QF7 A;  3UKM A;  4G27 B;  1YXB A;  3WG7 C;  2P22 C;  5LHG A;  1X59 A;  5BY1 A;  1HNX O;  1FD9 A;  3BEH A;  3TCU A;  3A8T A;  1NVP D;  1MNG A;  5FNV A;  4B3R B;  5BR8 O;  4K8Z A;  3RGB A;  3ZMS A;  4ZI7 B;  3ZMZ A;  1HW7 A;  2RJZ A;  3K5M A;  5DN6 G;  4LF7 O;  2R70 A;  4U3F H;  4BIZ A;  4HYO A;  4R50 A;  1K34 A;  2IU3 A;  4CBC A;  2Q4P A;  3OTO B;  2CAZ C;  1N0J A;  4LFB O;  3VQX A;  4GX2 A;  2WLH A;  2CTP A;  3P3P A;  4LF9 B;  4K0K B;  2AZ0 A;  1MZF A;  2Y0I A;  4HAM A;  2IJH A;  5LXT B;  3B40 A;  4LH6 A;  4GKJ B;  3B4S A;  2KKW A;  2X6A A;  5CA0 A;  4JI7 O;  3CMA V;  1FXK A;  2PYL A;  1XHZ A;  1W59 A;  5LGU A;  3J80 N;  2CTW A;  5KHI A;  3HPL C;  3ETG A;  1BHA A;  2YUA A;  1EN5 A;  3EXA A;  1BGY H;  1RPO A;  4B3S O;  3KCY A;  4WFH A;  4B7K A;  2NNU A;  3F7Y C;  4MT8 A;  3K3W A;  5E79 Z;  2ADP A;  1VQ8 V;  3OE7 G;  2F95 B;  1AJP A;  1BQ0 A;  4ZHQ A;  1CEZ A;  4JAS A;  2ZM6 B;  1EN6 A;  4K8X A;  3RYF B;  4PA4 A;  3K06 A;  2QEX V;  5A9G A;  5JJN B;  3UO3 A;  5IWA O;  1EFR G;  1VF5 B;  2R9A A;  4I0X B;  1R3J C;  5JVD B;  1I94 O;  5BMV A;  2YIB A;  3CRQ A;  1IBM O;  1G4Y B;  3NR7 A;  1GK9 A;  3K0D A;  3BRC A;  2Q0O C;  3J7A U;  1SER A;  4L8J A;  1M56 C;  2HLD G;  3X2Q C;  4AI8 A;  5KLV H;  2PY5 A;  3U11 A;  1EZV H;  2FML A;  2A79 B;  2VWJ A;  1HNW O;  2UU9 B;  4J41 A;  4DRX B;  3RYC B;  1KYO F;  3L72 H;  3CJH B;  3AG4 C;  4P9O A;  1KKC A;  3WG7 B;  1VF6 A;  3LDE A;  3ZIA G;  5KX5 A;  4I4T B;  2UUB B;  4LF5 O;  2BSK A;  1HR0 O;  2MK3 A;  2ARH A;  1I0H A;  4UVC A;  4YJ3 B;  3HKC B;  4FFB B;  1IBL O;  1VQO V;  4X88 A;  3C90 A;  4DUY B;  1IBK B;  4IHJ B;  1PKX A;  1SQF A;  2YXL A;  4DUZ O;  5FLX N;  1L0L H;  2C2A A;  4I7Z B;  5JCO C;  1IZ3 A;  2OCH A;  4P2Z A;  1FJG B;  4OPH A;  3CP1 A;  2X6C A;  1M90 W;  1XNR O;  1Q7Y W;  3P3N A;  4QNH B;  3D36 A;  4R8C A;  4ZI7 A;  3FAV B;  2GDS A;  4IYI A;  4KXR A;  3ZN0 A;  1SQX H;  2AGA A;  1P49 A;  4O2A B;  2IJJ A;  4WBN B;  1OJH A;  1V9P A;  2YIA A;  3CC2 V;  1I5Y A;  4IGG A;  1NT2 B;  3K04 A;  4LF8 B;  1IDS A;  4X65 B;  3O9O A;  2ZIO A;  2ITD C;  3IC7 A;  4I50 B;  4JI5 B;  1D2D A;  3AK1 A;  2R9I A;  5LXT A;  1F7Y A;  4B3T B;  1KD1 W;  1L8D A;  1FXV A;  3T1Y B;  4X1K B;  2QWP B;  1XEQ A;  1NBM G;  1Y74 B;  5EBL C;  3BPZ A;  2YIB D;  3KZI Z;  4N23 A;  3LDD A;  5JH7 B;  3OGI B;  4FZ1 A;  2ZE5 A;  4KL1 A;  2VRZ A;  3BA8 A;  3CHX A;  4Q6G A;  4PD4 F;  4WCE V;  1XOU A;  4CC5 A;  4N21 A;  3CCS V;  1WPX A;  3PJS K;  4TV8 A;  4EFE A;  4UUJ C;  2YID A;  3RYF A;  2Y69 B;  5D5Q A;  3CXC U;  2UUA O;  1Q6H A;  5LMU O;  2M7W A;  4NVP A;  4DR6 O;  5CA1 B;  2D2C B;  5EK0 A;  1SZT A;  3RFR A;  1M56 B;  5E1A C;  2UXC B;  1GMG A;  5JVD A;  4I5S A;  2XAS A;  2Q5Z A;  4FFK A;  3ZMU A;  4DR1 O;  3AG4 B;  4HZ3 A;  5FPO A;  4D7T A;  4DK0 A;  2G38 A;  4F4L A;  2QM7 A;  2YI9 A;  4HNA B;  4DRX A;  1K9M W;  1FFX B;  1VIB A;  3RYC A;  3CJH A;  1K92 A;  5HFM A;  3K59 A;  4I4T A;  2QM4 A;  1BHB A;  5IYZ B;  2DQ0 A;  3N2G A;  1VQN V;  4YJ3 A;  3HKC A;  1AR5 A;  1S72 V;  3CB2 A;  4IHJ A;  4MW3 A;  1VQK V;  4H13 B;  4LBE C;  3TGU H;  4LCU C;  5LP6 C;  4LF6 B;  1N32 B;  2Y4U A;  3E2E A;  5L3F A;  4LP8 A;  1WNS A;  1K7D A;  1NVP B;  3IAY A;  3FAV A;  2NN4 A;  1M57 C;  3TET A;  4DR7 B;  2QWR B;  1SA0 B;  3ZRX A;  4EKW A;  1H38 A;  4O2A A;  4WBN A;  3JCZ A;  1MOF A;  1DLB A;  1QCE A;  1M1K W;  4JYC A;  2QSA A;  3N27 A;  4YHH O;  1NR7 A;  2Q7E A;  3CRR A;  4I50 A;  4PDV A;  1PV0 A;  3GB7 C;  2YS8 A;  5LYJ B;  5GTI Z;  2QDO A;  1SF9 A;  1ZSP A;  1VQ5 V;  4DR2 O;  4X1K A;  4GX5 A;  4LWS B;  3FD9 A;  1QR8 A;  2OWO A;  3LSS A;  4MTG A;  1HNZ B;  1Y74 A;  1S76 D;  3SYP A;  1FXH A;  2ZNI A;  2EZO A;  4CH3 A;  5JH7 A;  4X64 O;  4JTD B;  4U7O A;  3W7T A;  1Q3E A;  1JFF B;  1NR1 A;  4CH5 A;  1DGS A;  4LFA B;  5GTH Z;  2DWD C;  1I5X A;  2P4K A;  3JAK A;  3FKS G;  5KHK A;  2QKC A;  1R3L C;  1RSO B;  1Q8I A;  2YXY A;  2CGN A;  5CA1 A;  3SDL A;  2XOK G;  1E1R G;  1NTZ H;  3JAT B;  4TOI A;  2WA3 A;  2LJ2 A;  3R65 A;  2X6B A;  1XMQ B;  1RM1 C;  2E5L O;  1XQ8 A;  4UVA A;  1E1Q G;  5FL7 G;  2GTA A;  4HNA A;  1Q90 D;  3SR2 C;  4AQY B;  2ZE8 A;  1P4R A;  2WLI B;  2Y4T A;  4U3J B;  3ASO C;  5FNV B;  2NR5 A;  2EJ7 A;  5LP6 B;  3CXH F;  1YSC A;  1KQS U;  2Q73 A;  3ABK C;  5JCO A;  1KUQ A;  1OHH G;  4JI1 O;  2JEU A;  4DV4 O;  4QJF B;  5CBH A;  4DR4 O;  1U96 A;  3ZRW B;  4JI8 O;  1ZLZ A;  1M57 B;  3D36 C;  2RQ6 A;  1H2G A;  1Q82 W;  3FB5 C;  1AB3 A;  3A0H Z;  1QHT A;  3HKB B;  1N33 B;  3JCU Z;  2UXB O;  3K5L A;  3JD2 A;  4DV5 O;  2Q68 A;  1SS3 A;  2ATK C;  4NB5 A;  4PHZ A;  3GWO A;  4Z1V A;  4LR3 A;  1SA0 A;  4FPP A;  4UV9 A;  1QVF U;  2ZQM A;  3HB3 B;  2QKS A;  2Z0A A;  1HWY A;  2ZXW C;  3BA9 A;  1N34 O;  3ZCC A;  4X20 B;  1X4T A;  2XAF A;  3HKE B;  4JYA B;  3W7U A;  2A9H A;  4X1Y B;  2WSS G;  1EZJ A;  3JAS B;  2GBO A;  2HHH B;  4OPA A;  3AG2 C;  2JEX A;  2IBZ H;  1WP7 A;  5LYJ A;  2LGW A;  3QTC A;  5KAF Z;  1SZX A;  1K5S A;  2CTQ A;  3FYI B;  5H5N A;  4DV6 B;  4R6Z A;  2MW2 B;  1AR4 A;  2OTL V;  2FB5 A;  4LWS A;  2UXN A;  1XIL A;  3M7M X;  3ZJZ A;  3WB2 A;  3VQY A;  1HNX B;  2OIE A;  1Y67 A;  3OTF A;  5K1P A;  1YHQ V;  3ZHR A;  3BY6 A;  3RT3 C;  5BR8 B;  4K3A A;  1XL6 A;  2B1G A;  2EIM C;  4LFC O;  4GZR B;  4LF7 B;  2BTQ B;  1NKD A;  1RSO A;  1RM1 B;  2EIL C;  2GUZ B;  1JPX A;  2PYJ A;  1PD3 A;  4LFB B;  3QVN A;  1XL4 A;  2QWN B;  1VQP V;  1WB8 A;  2Y48 A;  1YTF D;  3ZN1 A;  3UCS C;  2HVJ C;  3OMN B;  3K57 A;  3JAT A;  5GW7 A;  2PZS A;  2GSM B;  4Z1M G;  1N36 O;  4QPK A;  5JWP A;  3WB0 A;  3SPC A;  4D7S A;  1H2M A;  1XBL A;  3ZMV A;  4QE7 A;  4O4H B;  3KG2 A;  2DQ3 A;  1R1B A;  3ASO B;  1QU7 A;  3T4Z A;  4JI7 B;  4FM0 A;  2ZE7 A;  5LGT A;  3ABK B;  3W7X A;  3F5W C;  1W0K G;  3JD4 A;  4WFG A;  2R9R B;  1SQV H;  4UB8 Z;  2XT9 A;  3F5T A;  2WLI A;  3CCJ V;  4U3J A;  1GTO A;  3FYE B;  4B3S B;  2FYU H;  3UM7 A;  3RYH B;  4G28 B;  5LP6 A;  2AHZ A;  3JSN A;  2BCC H;  2P06 A;  2F4V O;  1XRE A;  5LOV B;  3ABT A;  3H1H H;  3ZRW A;  2JGD B;  2CUG A;  1B3Q A;  4HBN A;  2N04 A;  3CCQ V;  4YXW G;  3HKB A;  1E79 G;  4P30 A;  3RVY A;  5EBM C;  3OAA G;  4YIP A;  4FM2 A;  1YI2 V;  5IWA B;  1Z5W A;  3J81 N;  3OD4 A;  2ZXW B;  3EHB B;  1I94 B;  2YIC A;  1IBM B;  3GWK C;  1FPO A;  2P90 A;  2BOC C;  3AG2 B;  3OR6 C;  1S3J A;  1K97 A;  4X20 A;  3HKE A;  4X1Y A;  3JAS A;  4NXN O;  4DYL A;  1HNW B;  4F6E A;  4D6T H;  5C93 A;  2V7Q G;  5CA3 A;  4QGP A;  1GM9 A;  1VQ6 V;  1B04 A;  2GTS A;  2VQF O;  1PNM A;  4LF5 B;  1HR0 B;  1G1X B;  1YZB A;  4BW5 A;  5IY5 C;  4TV8 B;  5K1X A;  1K3E A;  1Y76 B;  1AVM A;  3EFF K;  4WFA V;  5H9C A;  2QJ1 A;  2QWQ B;  4FM1 A;  1IBL B;  4NR1 A;  5LA6 B;  2EIM B;  4RO2 A;  4DUZ B;  3CS5 A;  4CH6 A;  1TA8 A;  1NTK H;  2CH7 B;  3AK2 A;  1JCH A;  5KAI Z;  1GN2 A;  1GKF A;  2IW5 A;  1MSD A;  2EIL B;  2Q0A A;  3BAA A;  2Q69 A;  2KB1 A;  1XNR B;  4ZIB A;  4UCS A;  4TWK A;  3SPH A;  3OTO O;  2LW7 A;  3TXQ A;  4TT3 G;  1XHX A;  3JSL A;  4B7E A;  2BTQ A;  5LBQ A;  4K0K O;  5LMN O;  1PNL A;  4DV3 O;  2GUZ A;  2E3C A;  3SJA C;  4ICG A;  1TUE B;  2XAH A;  3KCX A;  5D5P A;  2ITC C;  4MTX A;  5KA6 A;  4I55 B;  4MVO A;  4K35 A;  3CD6 V;  3N2G B;  5EBW C;  3CRC A;  3B09 A;  4O4H A;  4FLW A;  2GV9 A;  2UXD O;  3RW0 A;  1Z2G A;  1Y66 A;  1M9N A;  2HP8 A;  4XDL A;  4JZ2 A;  3G4S V;  1H2S B;  1GAX A;  3D3I A;  5DM6 V;  3OW2 U;  2XUM A;  4F6R A;  2JK5 C;  2QM8 A;  3FB8 C;  3RYH A;  3A0R A;  5IYB O;  1S77 D;  4DR5 O;  5BXZ A;  2B1I A;  4B3M O;  5LHI A;  4MVQ A;  2LFR A;  2F93 B;  1SC5 B;  5LOV A;  1Z5V A;  1XUQ A;  2JGD A;  3CEI A;  1N8R W;  4MVR A;  2UUA B;  4PEL A;  1O9G A;  1VQL V;  4GLX A;  5LMU B;  2DOS A;  3P32 A;  4DR6 B;  3HKD B;  4BW9 A;  2JVD A;  3VQW A;  3K58 A;  2WLJ A;  4MSW C;  4IIJ A;  2EX3 A;  3E35 A;  4ZKI A;  4LF4 O;  2UU9 O;  2DYR C;  1AP6 A;  4DR1 B;  2P7T C;  2E76 B;  2DMX A;  3CYO A;  4YIO A;  2OCC C;  1DF5 A;  4X66 O;  4AHC A;  3LNM B;  1RFY A;  5IY5 B;  4X62 O;  4LH7 A;  4NTW A;  4PA6 A;  2P5O A;  2HJF C;  5H6Q A;  2OT5 A;  3STL C;  1AI7 A;  4DUY O;  1QVG U;  2P6J A;  1S0V A;  2F1M A;  3G6B A;  2XND G;  1V55 C;  3JAK B;  1GM8 A;  1Y76 A;  3H1K H;  4WFF A;  5J9P C;  4JI4 O;  2HKO A;  3ZS8 C;  2EBO A;  5LA6 A;  3CCU V;  3K9A A;  2WLK A;  2CH7 A;  3H1L H;  3AK3 A;  2XAG A;  3X2Q B;  1AI5 A;  4W4L A;  1NI8 A;  1WAZ A;  1WA8 B;  4OGQ B;  3RN4 A;  3E86 A;  2ZKO A;  4PI2 A;  3BVO A;  1H2L A;  4G2K A;  5DEC A;  3QNE A;  5EC2 C;  3CX5 F;  1QR9 A;  2IH3 C;  3A2F A;  1VQM V;  4O4L A;  1BE3 H;  5IJ0 A;  1XMO O;  2PTM A;  1NH2 D;  2WPD G;  4JI6 O;  4CH4 A;  4H33 A;  2LGQ A;  5LL6 Y;  4YHH B;  4I55 A;  2Z5U A;  4KFM A;  1YTF B;  3JD1 A;  3ZHT A;  3K0G A;  2HFE C;  4KP4 A;  4MW8 A;  1VEW A;  5KUK A;  3TXS A;  4DR2 B;  4JTC B;  3DGE A;  1L0N H;  1OCZ C;  1WN7 A;  1VAR A;  4JZG A;  3P30 A;  4GX0 A;  1N4C A;  4RUE A;  4X8A A;  3ETE A;  1BMF G;  2IJK A;  4PDL A;  1JJ2 U;  2Q8V A;  2WLL B;  4X64 B;  5LHH A;  4TV9 B;  4J42 A;  2A7W A;  3SJB C;  3ZED A;  3VBB A;  1UPG A;  3L9D A;  2LQT A;  3CCM V;  3ZBH A;  3LNN A;  1G8M A;  4MTO A;  1NTM H;  3IC9 A;  1GN6 A;  1M5I A;  3STZ C;  2DYR B;  4X89 A;  3E89 A;  1IXM A;  3HKD A;  3ZRS A;  1VMG A;  3JYC A;  3JD3 A;  3ZHV A;  2BE3 A;  2QTO A;  2OCC B;  4J80 A;  4P9P A;  4H37 A;  4UCO A;  2E5L B;  2JIZ G;  3ZHQ A;  4RQE A;  4JI2 O;  1JX9 A;  3I56 V;  2H8P C;  4LC1 A;  3IJ4 A;  3CCV V;  1JJO A;  1R3K C;  2ETN A;  1ROP A;  5GON B;  4PV1 B;  4EEQ A;  1YDX A;  1V55 B;  4DW0 A;  1K33 A;  3B77 A;  4EFB A;  1S5H C;  3MAQ A;  2WLM A;  3AG1 C;  3G67 A;  2D3O W;  2V4D A;  4JF3 A;  1YJW V;  1CPY A;  4KUM A;  1OCC C;  2E74 B;  4UFZ A;  3TK1 A;  4JI1 B;  4DV4 B;  3WU2 Z;  4CZZ A;  4DR4 B;  1PP9 H;  4PA9 A;  3H9V A;  1W2B U;  1AP5 A;  4PDR A;  2PUS A;  3E22 B;  1WJZ A;  3E8G A;  3ZX6 A;  4RAI A;  4MVZ A;  4JI3 O;  3RVZ A;  3RWR D;  2Q67 A;  5B5E Z;  5C8Y B;  2UXB B;  4DV5 B;  1ZUQ A;  2EUL A;  1WA8 A;  4GKK O;  2A3Q A;  4KHP O;  4DV1 O;  3OUS A;  1S5J A;  1H8H G;  1XDC A;  5KHG A;  3OR7 C;  1N34 B;  3SJC C;  4DV7 O;  3ZMT A;  1YIJ V;  3Q4H B;  1S5L Z;  3JD0 A;  1U97 A;  2ZCE A;  1NS1 A;  1OCZ B;  3LUT B;  1AI4 A;  2W6I G;  1MMM A;  3N2K B;  1LUV A;  1ENV A;  5CN0 A;  1R73 A;  4FLV A;  4UCV A;  2QA4 V;  4JPR A;  5B3S C;  4TQF A;  5KUM A;  3H1J H;  1F51 A;  1OCO C;  1YCI A;  3AG3 C;  1LR1 A;  3CME V;  4MVS A;  5KA5 A;  2RMK B;  2V1D A;  4J11 A;  1K5Q A;  2ZE6 A;  2DW4 A;  4FVM A;  3BFR A;  1SQB H;  4RWU A;  4JV5 O;  2WLL A;  4UCT A;  4TV9 A;  3OFN G;  2RNB A;  1QQC A;  2UUC O;  5EIB D;  4GT1 A;  4DV0 O;  4LFC B;  4MS2 A;  4GX1 A;  1JR9 A;  1DTO A;  3ASN C;  4E4E A;  3MHH C;  4ZBM A;  4H0L B;  2B5U A;  3TJT A;  3A0B Z;  3FX7 A;  4GCZ A;  1LUW A;  2IU0 A;  5B66 Z;  5CB4 B;  5L3B A;  4J10 A;  3S3W A;  1XNQ O;  2DYS C;  3OMI B;  1PL4 A;  3CC4 V;  1N36 B;  2JJ2 G;  4U7N A;  1KKD A;  2WWW A;  4J7K A;  1YJ9 V;  3SYA A;  4QE9 A;  2KQX A;  2QTS A;  1LNQ A;  5JJE B;  2RN9 A;  2F43 G;  5GON A;  3AG1 B;  3LDC A;  2W0F C;  1OZ0 A;  3E8H A;  1COW G;  4PDM A;  1OCC B;  1BQZ A;  1VQ7 V;  4NKG B;  3I5D A;  3T2M A;  4UCR A;  1YJN V;  1AIL A;  2GHY A;  3ML0 A;  5JJJ B;  1PL0 A;  3K5N A;  4JAU A;  1DK1 A;  4JI0 O;  1QLE C;  1SQP H;  2VWK A;  1D5N A;  3L75 H;  2F4V B;  2ZR3 A;  1KP2 A;  2DJV A;  2L35 A;  1VF7 A;  2ZT9 B;  3E22 A;  3W7S A;  5CBF A;  2EJR A;  1FFT B;  4H44 B;  3E83 A;  2XAQ A;  2DE0 X;  1YF2 A;  5C8Y A;  3QG5 A;  4NXM O;  1KC8 W;  3T1H O;  1ZWI C;  1Q43 A;  3K9S A;  1KB9 F;  2HVK C;  5H6R A;  4YY3 O;  1HP8 A;  4XBF A;  1XI1 A;  2VQE O;  1MZE A;  2RCV A;  5EC1 C;  3ABL C;  1SES A;  4OX9 O;  3U0Z A;  4C7U A;  4RQF A;  1NJI W;  4FLT A;  3K03 A;  1THZ A;  4EB6 B;  3THO A;  4J9Y B;  3SPJ A;  2EIJ C;  4NXN B;  3Q4H A;  2AW9 A;  5B3S B;  2JS5 A;  2ILM A;  4F6R B;  3W7W A;  1NH2 B;  1OCO B;  1F4N A;  1PM9 A;  3AG3 B;  4OXS A;  2VQF B;  3N2K A;  4BWA A;  1MAB G;  1AR1 B;  4ABM A;  1NQT A;  4ASU G;  2CDY A;  2AHY A;  1K8A W;  1R6T A;  4I9Q A;  3DXR B;  5J2U B;  4UCU A;  2Q7G A;  5CBG A;  3C3T A;  2AZ2 A;  1VQ9 V;  3SJQ C;  2ZIM A;  1WPB A;  1J5E O;  4BIU A;  3ASN B;  2W6J G;  4GUN A;  4IIJ B;  3K79 A;  2DN9 A;  3G71 V;  4FJC C;  4O4J B;  5L3C A;  4JTA B;  3CE2 A;  1EN4 A;  2DYS B;  4DV2 O;  5LMN B;  1GN3 A;  4TUY B;  4DV3 B;  3SPG A;  5CB4 A;  1KU9 A;  1MA1 A;  2CK3 G;  4DR3 O;  4CS2 A;  2KG7 B;  2EIN C;  2P4V A;  3BCC H;  1ORQ C;  1BT8 A;  4DO2 A;  4UVB A;  1BCC H;  1BZK A;  1K73 W;  5EIB C;  4UB6 Z;  3OUF A;  3ETQ A;  3B2E E;  2QWO B; 
#chains in the Genus database with same CATH homology
 1AJQ A;  5IY5 B;  4FIP C;  3CCE V;  4GX5 A;  5CMU A;  4PA6 A;  1QR8 A;  2HJF C;  5H6Q A;  3LSS A;  4MTG A;  1S76 D;  3SYP A;  2OT5 A;  1F23 A;  1AI7 A;  3STL C;  1SET A;  1QVG U;  1FXH A;  2P6J A;  1S0V A;  1QLE B;  2EZO A;  2XND G;  2ZDI A;  1V55 C;  1GM8 A;  1H8E G;  1R3I C;  4JTD B;  1MSW D;  1MG1 A;  1ARO P;  3M99 B;  4U7O A;  4WFF A;  2IJI A;  5J9P C;  3W7T A;  2HKO A;  1R6N A;  2LP7 A;  1NR1 A;  2EBO A;  3CCU V;  3K9A A;  2WLK A;  2DWD C;  1I5X A;  4XDK A;  5IYC O;  3FKS G;  2X7R B;  2IH1 C;  3X2Q B;  1R3L C;  2QE7 G;  2XAG A;  3CCR V;  1AI5 A;  3B8N A;  3T1C A;  2X0L A;  3E86 A;  2Q6A A;  1CP9 A;  2XOK G;  4G2K A;  1K4C C;  3QNE A;  1E1R G;  5EC2 C;  2Y69 C;  1QLN A;  2XAJ A;  1BL8 A;  1QR9 A;  2IH3 C;  3R65 A;  3AEI A;  2X6B A;  3ABL B;  1RM1 C;  3OEH G;  1VQM V;  2YSU B;  2BOB C;  4UVA A;  1E1Q G;  1NH2 D;  2WPD G;  2PI5 A;  3NXS A;  2EIJ B;  5FL7 G;  4H33 A;  1V54 B;  2K1E A;  3SYQ A;  3QO8 A;  2YEV A;  2Z5U A;  1GO3 F;  4KFM A;  1YTF B;  3JD1 A;  1P4R A;  3K0G A;  3H01 A;  2HFE C;  3LSQ A;  2WLI B;  2WLN A;  4KP4 A;  3UKM A;  4G27 B;  3WG7 C;  4MW8 A;  3ASO C;  5LHG A;  5KUK A;  2JJ1 G;  4PA7 A;  1J95 A;  1YSC A;  3TCU A;  3BEH A;  1KQS U;  3ABK C;  4JTC B;  3DGE A;  3G6E V;  1NVP D;  1L1F A;  1OCZ C;  1OHH G;  2JEU A;  3CC7 V;  3P30 A;  4QJF B;  4GX0 A;  5CBH A;  4RUE A;  4X8A A;  2ZR2 A;  3ETE A;  3ZRW B;  5B1O A;  1BMF G;  3ZMS A;  3MHS C;  2IJK A;  3ZMZ A;  1M57 B;  1DF4 A;  4PDL A;  1JJ2 U;  2WLL B;  5DN6 G;  1H2G A;  5LHH A;  4BIZ A;  4HYO A;  4R50 A;  1Q82 W;  3FB5 C;  3OGC C;  1QBZ A;  1K34 A;  2IU3 A;  3JD2 A;  4CBC A;  3VBB A;  2Q68 A;  3CCM V;  2ATK C;  1G8M A;  4GX2 A;  4MTO A;  4J9Z B;  2WLH A;  4RUF A;  3GWO A;  4FMT A;  4L87 A;  3STZ C;  2DYR B;  4QPJ A;  4FPP A;  3SYC A;  4X89 A;  1JQ0 A;  3E89 A;  4DXW A;  1IXM A;  4UV9 A;  2PI4 A;  1QVF U;  2ZQM A;  3HB3 B;  3ZRS A;  5IYD O;  2QKS A;  3JYC A;  2EIN B;  4HAM A;  1HWY A;  2ZXW C;  3JD3 A;  2IJH A;  3ZCC A;  2Z3Y A;  2QTO A;  2XAF A;  2OCC B;  3W7U A;  2A9H A;  2WSS G;  1EZJ A;  4P9P A;  2X6A A;  3CMA V;  1FXK A;  4H37 A;  2JIZ G;  4RQE A;  2JDI G;  2A0L A;  1JX9 A;  3AG2 C;  5LGU A;  2H8P C;  2JEX A;  4LC1 A;  4UXN A;  3I56 V;  3E8B A;  3CCV V;  4FK5 C;  1R3K C;  1ROP A;  3HPL C;  3ETG A;  1BHA A;  4WF9 V;  4JYB A;  4WFE A;  1RPO A;  1K5S A;  3FYI B;  3I55 V;  1V55 B;  4WFH A;  2NNU A;  3F7Y C;  4R6Z A;  4MT8 A;  1K33 A;  3K3W A;  2OTL V;  1OCR C;  1VQ8 V;  2UXN A;  3OE7 G;  3B77 A;  4Q20 A;  3ZJZ A;  1AJP A;  1S5H C;  1CEZ A;  4JAS A;  2FTK A;  2WLM A;  3AG1 C;  2D3O W;  4JF3 A;  2WAM A;  5B1A C;  1YJW V;  5B1N A;  1CPY A;  4KUM A;  2ZDI C;  3OMA B;  1YHQ V;  3DTU B;  3BY6 A;  1OCC C;  4PA4 A;  3TK1 A;  3IFX A;  3K06 A;  3QO5 A;  2QEX V;  4CZZ A;  4PA9 A;  3SYO A;  1Y4M A;  3E8F A;  4PDR A;  1W2B U;  3E8G A;  1XL6 A;  5L3D A;  2B1G A;  4RAI A;  1EFR G;  2EIM C;  3CCL V;  4MVZ A;  3RVZ A;  1R3J C;  4TSF G;  3F7V C;  2Q67 A;  1NKD A;  1RM1 B;  2EIL C;  3WFV A;  1JPX A;  1G4Y B;  1PD3 A;  3IGA C;  4R7C A;  1GK9 A;  3K0D A;  1SER A;  2LFS A;  1XL4 A;  2EZP A;  1VQP V;  2Y48 A;  1YTF D;  3ZN1 A;  1KP3 A;  2HVJ C;  1M56 C;  3OMN B;  1Q86 W;  2HLD G;  3X2Q C;  3OUS A;  5GW7 A;  1WLE A;  2A79 B;  1H8H G;  1RPR A;  2GSM B;  4Z1M G;  4QPK A;  3OR7 C;  4UV8 A;  3SPC A;  1UJW B;  4P9O A;  3AG4 C;  3ZMV A;  4MVM A;  3WG7 B;  3LDE A;  4QE7 A;  3KG2 A;  2DQ3 A;  3ASO B;  1VQ4 V;  3ZIA G;  3ZMT A;  1YIJ V;  3T4Z A;  2H94 A;  5LGT A;  2MK3 A;  3ABK B;  3JD0 A;  3W7X A;  3F5W C;  1W0K G;  3JD4 A;  4WFG A;  2R9R B;  4UVC A;  1OCZ B;  3LUT B;  1AI4 A;  5L3G A;  2W6I G;  2P67 A;  2WLI A;  3CCJ V;  1VQO V;  4X88 A;  1ENV A;  5CN0 A;  1GTO A;  1R73 A;  3FYE B;  3UM7 A;  1PKX A;  4G28 B;  2QA4 V;  1KEC A;  4JPR A;  5B3S C;  5KUM A;  2AHZ A;  2C2A A;  2DWE C;  1F51 A;  1OCO C;  3AG3 C;  4P2Z A;  5B1B C;  3CME V;  3CP1 A;  4MVS A;  1P7B A;  2X6C A;  3ABT A;  5KA5 A;  2V1D A;  1M90 W;  1Q7Y W;  1K5Q A;  1SRY A;  4QNH B;  3ZRW A;  2DW4 A;  3D36 A;  4R8C A;  2WLL A;  3ZN0 A;  3CCQ V;  4YXW G;  3OFN G;  1E79 G;  4P30 A;  3RVY A;  3ABM C;  5EBM C;  3OAA G;  1YI2 V;  2IJJ A;  4GT1 A;  3CC2 V;  5HFL A;  1I5Y A;  4MS2 A;  2ZXW B;  3EHB B;  4GX1 A;  3K04 A;  4JAV A;  1DTO A;  3ASN C;  1YIT V;  3MD0 A;  3MHH C;  4ZBM A;  2B5U A;  2ITD C;  2P90 A;  1AJN A;  2BOC C;  4GCZ A;  3IC7 A;  3AG2 B;  2IU0 A;  5L3B A;  3ETD A;  3FB7 C;  3OR6 C;  1S3J A;  3QO7 A;  5BZB A;  3RBZ A;  1K97 A;  2DYS C;  2R9I A;  4QIW F;  2EIK C;  3OMI B;  3CC4 V;  1KD1 W;  2OTJ V;  2NLJ C;  2JJ2 G;  4U7N A;  1FXK C;  1GM7 A;  5C93 A;  2WWW A;  2V7Q G;  5CA3 A;  1FXV A;  1OCR B;  4MVU A;  1YJ9 V;  1KKD A;  1GM9 A;  3SYA A;  4QE9 A;  1NBM G;  1VQ6 V;  1LNQ A;  3CPW U;  2F43 G;  5EBL C;  3AG1 B;  3LDC A;  1PNM A;  2W0F C;  1OZ0 A;  3E8H A;  5B1A B;  4N23 A;  4XDJ A;  1COW G;  3LDD A;  4PDM A;  4BW5 A;  1OCC B;  1VQ7 V;  5IY5 C;  3T2M A;  1K3E A;  1K4D C;  3EFF K;  4WFA V;  5H9C A;  1YJN V;  2GHY A;  3ML0 A;  1PL0 A;  4WCE V;  2EIM B;  4RO2 A;  4JAU A;  4N21 A;  3CCS V;  1WPX A;  3PJS K;  1QLE C;  1JCH A;  1GKF A;  2IW5 A;  4UUJ C;  3CXC U;  2Y69 B;  1JOY A;  4WFB V;  2ZR3 A;  1KP2 A;  2EIL B;  2Q69 A;  2M7W A;  2KB1 A;  5L3E A;  4TWK A;  3SPH A;  5EK0 A;  1SZT A;  3W7S A;  5IDJ A;  5CBF A;  3T4D A;  1M56 B;  2EJR A;  4TT3 G;  5E1A C;  1FFT B;  1R6K A;  3K08 A;  1GMG A;  3E83 A;  2XAQ A;  4I5S A;  2XAS A;  5LBQ A;  1PNL A;  3ZMU A;  1KC8 W;  1ZWI C;  4E2L A;  1Q81 W;  1TUE B;  3AG4 B;  2XAH A;  2HVK C;  5H6R A;  4HZ3 A;  2ITC C;  4F4L A;  4MTX A;  1PNK A;  5KA6 A;  4XBF A;  2QM7 A;  3ZRV A;  5LGN A;  2YEV B;  4MVO A;  5EC1 C;  3ABL C;  1SES A;  3VOU A;  1K9M W;  3CD6 V;  4MTF A;  5EBW C;  4RQF A;  1NJI W;  1K92 A;  1THZ A;  3K03 A;  5HFM A;  4J9Y B;  3RW0 A;  3SPJ A;  2EIJ C;  1Y66 A;  1M9N A;  1V54 C;  4XDL A;  5B3S B;  1BHB A;  3W7W A;  2DQ0 A;  3G4S V;  3B8M A;  1NH2 B;  1VQN V;  1OCO B;  1F4N A;  3FB6 C;  3AG3 B;  4OXS A;  5B1B B;  3D3I A;  5DM6 V;  1FS0 G;  3OM3 B;  1MAB G;  1AR1 B;  3OW2 U;  1S72 V;  1NQT A;  2JK5 C;  4ASU G;  2QM8 A;  4MW3 A;  4LBE C;  3FB8 C;  2AHY A;  1VQK V;  3A0R A;  4LCU C;  1K8A W;  5IYB O;  1S77 D;  1AI6 A;  2B1I A;  5CBG A;  3ABM B;  1B6Q A;  5LHI A;  4MVQ A;  1VQ9 V;  2LFR A;  3SJQ C;  3E2E A;  4PA3 A;  5L3F A;  4LP8 A;  1K7D A;  1NVP B;  1N8R W;  4BIU A;  3ASN B;  4MVR A;  2W6J G;  1M57 C;  3K79 A;  4PEL A;  3TET A;  1VQL V;  3G71 V;  4FJC C;  5L3C A;  4EKW A;  3ZRX A;  2HG5 C;  3P32 A;  1H38 A;  2HR3 A;  4JTA B;  3JCZ A;  2WLJ A;  4MSW C;  3OEE G;  2DYS B;  1F4M A;  1MOF A;  1DLB A;  1QCE A;  2EIK B;  1M1K W;  4JGS A;  3E35 A;  4JYC A;  4BAY A;  4ZKI A;  1FXK B;  3SPG A;  1NR7 A;  3SPI A;  2DYR C;  1EBO A;  2P7T C;  1JVM A;  4PDV A;  2CK3 G;  3GB7 C;  2EIN C;  2ZD9 A;  3ABU A;  1ORQ C;  3CYO A;  2OCC C;  4UVB A;  1DF5 A;  2UXX A;  4DO2 A;  1K73 W;  3OUF A;  1VQ5 V;  4I9W A;  1W0J G;  3LNM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...