1PD3A

Influenza a nep m1-binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural protein NS2
publication title Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).
pubmed doi rcsb
source organism Influenza a virus
molecule tags Unknown function
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pd3A00
1GMGA 2IJJA 2IJKA 1RPOA 2IJHA 1PD3A 2GHYA 3K79A 1GTOA 1B6QA 1NKDA 1ROPA 1RPRA 1F4MA 2IJIA 1F4NA 4DO2A
chains in the Genus database with same CATH superfamily
4DR7O 3B40A 1HR0B 1EZVH 1AR1B 5KHJA 3T1HO 4N21A 4N23A 4HBNA 2A0LA 3DGEA 5LMNB 3JALB 1DTOA 1PNLA 1RFYA 1BMFG 1B6QA 4CS4A 2GUZA 4F4LA 1NH2D 2XAHA 5IYDO 1J95A 4BWAA 1N0JA 1FS0G 2PZSA 1M5IA 1JJOA 2BCCH 4EB6A 2Q68A 4O4HA 2PYJA 3M7MX 4TSFG 4DW1A 2ZNIA 1KP3A 1OJHA 1FAFA 4RUFA 1F23A 1FJGB 2AZ2A 4X20B 5KHGA 5DECA 1Y66A 2F95B 3CYOA 2FTKA 2XAGA 5H6QA 4P30A 4YJ3B 3S3WA 4PDVA 1M57B 5JH7B 4L87A 3ETQA 2LQTA 3BA9A 1P7BA 2KKWA 1QHTA 4JYAB 5K1PA 1IBMB 1WA8B 4J42A 4UVCA 5B1NA 1NS1A 4WFBV 5DM6V 3E35A 5H9CA 1FXKB 4DV4O 2Q7GA 3BFRA 3B2EE 2F93B 5CA1A 5KAFZ 2B1GA 1YF2A 4LF5O 3K58A 3UCSC 3JARB 2P90A 2HR3A 2YC0A 5GTHZ 4JI4B 1QNMA 3ZRSA 1R3LC 4PDMA 1Y74A 3VQXA 4A5UB 3CJHB 4BW9A 3H01A 3VBBA 1GM8A 4B3SB 3D3QA 3MHSC 1TVKA 2PF4E 3UQ8A 3LSUA 3QO8A 3STLC 1M4UA 4FLYA 1B06A 5EYPB 1K5QA 1VQ9V 2IJIA 4X88A 1QU7A 3SPGA 4FLXA 2P06A 1LR1A 3IFXA 5BXZA 2HHHO 4X66O 5BR8O 1R3JC 2JGDB 3DC6A 5ITZB 5BMVB 1GM7A 2F1MA 4LF6B 5HFMA 4NTYA 3W7SA 3OD4A 4U3JA 2HJFC 1I7FA 4KFMA 5EBLC 5KA6A 1SZXA 1R3IC 3APQA 3FX7A 3G71V 3OGCC 3HKDB 4CS2A 4MT8A 4DUYO 2R9AA 4X1KB 3ZRWB 3WB2A 3AG4B 3HKEB 3Q4HA 1BCCH 3CRAA 4JI5O 4UXNA 5LP6B 1SQXH 5IWAB 4FFBB 3VQYA 4FLTA 2ZQMA 4NXNO 3CSXA 4I9QA 4X1IA 2XAQA 3DSQA 1QQCA 3D8CA 2UUBB 4DR1O 2UXBO 5LOVB 5H6RA 4CH4A 4UV8A 4CZZA 3SPJA 3MHHC 3MAQA 1H2LA 2IU3A 4GKKO 4ZIBA 2GTAA 1S76D 1DGSA 2RNBA 1OHHG 2NLJC 4J10A 5KAIZ 2UXCO 2QWPB 1YEWA 3N2GA 1M56C 1K9MW 1YSCA 4LNUA 5GONB 2VS0A 3ZIAG 1TUBA 1SA0B 4JI1B 5LHHA 4DV1B 4JTCB 3L73H 4WFFA 4DR6B 3RN4A 2L6LA 2YXHA 4MTGA 3X2QB 3U11A 4JI6O 2UUCO 3ETEA 4WFAV 3QO5A 3LSQA 2KB1A 4DR7B 5LXTB 2ZIOA 3T1HB 4TWKA 1URFA 1W2BU 2YIBD 2AW9A 4JZGA 4X89A 1Q8IA 1GM9A 4O4LA 1UPGA 3JASA 1VQ8V 3R65A 2KQXA 4R50A 2BSKB 2IJKA 2HP8A 1OCCB 1MNGA 1KU9A 2DYSC 4X64B 4UVBA 1VQ7V 5KMGA 3CD6V 2O57A 5FNVB 3CC7V 3K03A 2QWNB 1W0JG 2P67A 5CB4A 4DO2A 3RVYA 3UT5A 3RGBA 1SQPH 1RSOB 1AI6A 4LF9B 2DE0X 2QM7A 5FPRA 3J80N 3WG7B 1JFFB 3D3IA 2KG7A 3G80A 3G67A 1VEWA 4Z1MG 1CEZA 1HWYA 4MTXA 3ZCCA 4LFBB 4NR1A 4GT1A 3JAWA 2Y69B 2QM4A 4GYCB 2V1DA 1WJZA 3H9VA 4WBNB 3F5WC 4TOIA 3LSSA 1ZL8B 1IX9A 2DYRB 3IAYA 4DV4B 4K3AA 1SRYA 4I50B 4I4TA 2FB5A 4W4LA 4IIJB 1VF6C 5CA0B 2E74B 4OGQB 5DEDA 2QWQB 4LF7O 2D3OW 5IJ0B 3K04A 4NTXA 3G6EV 1LUVA 1N34O 2LW7A 3CRQA 4IHJB 1N33O 2WLIB 1Y76A 1HR0O 1R73A 4F6RA 5BZBA 4J9ZB 4B7EA 2Z0AA 3OW2U 1XUQA 5JCOA 1SESA 2WLMA 3QVNA 3OEHG 2AZ0A 1H2KA 3CCLV 3ZHTA 4J80A 1M9NA 4ZBMA 3L75H 4UCUA 3ABMC 1OCOB 3A8TA 4JTAB 2LFSA 3K9SA 2YS8A 1CXZB 3BPZA 4TV8A 1NKDA 4X66B 5BR8B 3I56V 1GN4A 5J2UB 4QNHB 3WFVA 1AJQA 1OCRC 1KUQA 3L9DA 1WAZA 4U7NA 1M93A 5FPOA 1XREA 3EFFK 4P9PA 4CC5A 4WFGA 5L3GA 1NVPD 1EFRG 1WB7A 1FYJA 2WLKA 5B1BC 3SYOA 1AVMA 4DUYB 1YVWA 3STZC 2WSSG 4YXWG 1GK9A 3K06A 1MZFA 1D5AA 2C2AA 5IY5B 1A32A 3ZN1A 3SDLA 1ZWIC 4JI5B 5EBWC 1G1XB 1YJNV 2UXXA 1FD9A 3F5TA 2VQFO 4LH7A 3JAKB 1AR4A 3H1IH 1WP7A 4AQYB 4NXNB 2X6AA 3T1YO 2EINC 2UXBB 4PJ0Z 4XDKA 4I0XB 2EIMC 3E2EA 1KB9F 3SYAA 4NB5A 3RYHA 4X1YA 5H2FZ 2RQ6A 4JZ2A 3CXHF 4K8XA 4CH3A 4MSWC 1ZUQA 4IL6Z 4U3FH 2QKCA 2UXCB 2H94A 1Q86W 2WLLB 2YIDA 2Z5UA 4DV7B 1YIJV 4NVPA 1PV0A 4MTOA 2ZXWC 3IC9A 4O4JA 1VQ6V 3CCEV 3ZMSA 1CPYA 3JYCA 2X6CA 4K0KO 5L3CA 3BEHA 4JI6B 4X65O 3A2FA 4RQEA 5KHKA 3CHXA 4LF6O 1H8EG 3CCQV 3FB6C 5J2TB 3EXAA 1JA8A 2FKXA 2AHZA 3E8GA 4P9OA 1RPOA 3KG2A 4I55A 4R8CA 1GTOA 1XOUA 3FB5C 1V54B 1EZJA 3E22A 4CH6A 3AG2C 3CCJV 5EZYB 1K34A 2ZKOA 2E75B 2Q0AA 1SETA 2YIBA 4CH5A 4PELA 2EX3A 4AI8A 5LYJB 2PY5A 2VRZA 4YJ2A 4OPHA 4LF4B 4LBEC 3ABUA 3M8AA 2V7QG 4XBFA 4B3MO 5LA6A 2CTPA 3JALA 1QVFU 1TAEA 2OTJV 2DQ3A 3BCCH 2CTQA 4G28B 1V55C 4FVMA 3JAMN 3IC7A 4J7JA 4GCZA 4XDJA 2QA4V 2WPDG 3HKBA 2LGWA 1SZTA 1S5JA 5CBFA 1FFXB 2KSDA 2QDOA 1ZX3A 1Q82W 2X0LA 1VQMV 1RM1B 3PN1A 4X20A 4LF7B 1UFIA 2W6JG 4B7KA 2M7WA 1VQKV 2Z3YA 1IDSA 4W4KA 5KHIA 1SKVA 1N33B 2IH1C 1GN2A 5JH7A 5HFLA 1ZAUA 3L72H 2DOSA 5B1AC 4YHHO 3L74H 2EIKC 4TQDA 3W7XA 4JV5O 3RYFB 4MW8A 4FK5C 3BHPA 3AG1B 3SJAC 3FKSG 4X8AA 4FPPA 1NTMH 1SQVH 1JR9A 2Q8VA 3ABKC 4RQFA 4X64O 1T5EA 3E8FA 4RO2A 2WA4A 2QEXV 1VMGA 2UUAB 4O2AA 3QO7A 1EN4A 3ETDA 4XDLA 3ASOB 4PV1B 3F7YC 4G27B 3P32A 4OPAA 3LUTB 3ZHRA 5CBGA 2ZT9B 3OR6C 4LF9O 3E8HA 4LFAO 2JIZG 3LDEA 2IJHA 3K57A 3E86A 2YEVA 4DUZB 1VQ5V 1BL8A 2LGQA 2OCCB 4LFBO 2WWWA 2CK3G 1PNKA 3VQVA 4PA3A 4UUJC 2VQFB 4UB6Z 4DRXB 4MVOA 2UXDO 4D7SA 3RT3C 3ASNB 1W0KG 2ADQB 2P4VA 4JI3B 3S3XA 1K73W 5B1OA 3T1YB 2OTLV 2YXYA 4IYHA 1OCZC 5L3FA 3D36C 4MVZA 3TETA 1DF4A 3E83A 2ZE6A 4X1KA 5LHIA 1YJWV 4KP4A 2VQEO 2GUZB 2OIGA 1F51A 2XAJA 4TV9A 3BA8A 1O9HA 1RPRA 2NNUA 2EILB 1R1BA 4FFBA 3KCYA 1LNQA 4PA6A 4PDLA 4DV6B 1XHXA 4EB6B 3SYPA 3WB1A 5LOVA 1BQ0A 1I94O 4K0KB 3ZEDA 2H3OA 4BIOA 4FLUA 1WNSA 4O2BB 2XNDG 4X65B 2JRIA 1IBLO 1XEQA 4P2ZA 1PD3A 3H1KH 4JYYA 2GBOA 1YXBA 4J41A 1DK1A 5IYZA 2G38A 3DXRA 2Y4TA 3K3WA 1PPJH 1VIBA 4JPRA 1ENVA 1GH6A 5GONA 4FLZA 1TUEB 4QIWF 3N27A 1IBKO 3K0DA 1K5SA 1S77D 5CA1B 1Q5OA 2X6BA 3FYEB 2QKAA 1XL4A 2Y0PA 4AQYO 5LXTA 3G6BA 1I0HA 1MSWD 3OE7G 2P4KA 4JI8B 5K1XA 3LNMB 4B3MB 4DW0A 4BIZA 3B8NA 5JCOC 1TVKB 2R9RB 4FLWA 4DV3B 3OUFA 3AG3C 2GSMB 4QE7A 4PI2A 1XQ8A 4BAYA 5FNVA 2CGOA 3H1HH 1BT8A 4YY3O 2PGGA 4UCVA 3RWRD 4DV7O 4JAVA 2MW2B 2HG5C 1QBZA 3HKCB 3SYCA 2QWOB 1YJ9V 2EBOA 1RSOA 4LWSA 3K9AA 2ZR2A 3ZHSA 5LGUA 1Q43A 4AHCA 3C90A 1EBOA 5E1AC 1R6NA 3E8BA 4GX2A 2EJ7A 2HJDA 3FB8C 1YITV 2YI9A 3R66A 2VWJA 2K1EA 4J7KA 1E1RG 1P4RA 3D36A 1OV9A 3KKYA 4GKJO 1S5LZ 5B3SC 2JGUA 4YHHB 4JV5B 3Q4HB 1BQZA 2Q9LA 2IJJA 2R9IA 5JVDA 4KL1A 1AJNA 2ZDIC 3F7VC 1GO3F 2D2CB 3CRMA 3ABLC 4IIJA 3CRRA 1I08A 3SPIA 4MVSA 3ABKB 4BIUA 1WLEA 2F66C 3VOUA 2ITDC 4MVUA 2RJZA 1QLEC 3SPCA 4FZ0A 3ZMUA 3CC2V 2B9ZA 1G6UA 5JJJB 4HNAA 4LF4O 3TCUA 4JYBA 4LFAB 4HZ3A 4RUEA 2EIJC 3C3TA 5EIBD 2JVDA 4TUYA 3N2KA 3N2GB 4FFKA 2MK3A 1NQTA 3UO2A 4CBCA 1H8HG 5LL6Y 5KUMA 3ZJZA 1TUBB 2EZOA 2UXDB 3SGIA 3FAVA 5J2UA 2CTRA 3M99B 2CH7A 1V9PA 3JATA 1PP9H 1JJ2U 1N32O 4ASUG 4KXRA 4PI0A 1PL4A 4QPJA 1QCEA 4DK1A 1HW7A 4DV0B 4ABMA 4G2KA 1QVGU 3MDSA 2QSAA 1Z2GA 5IYCO 3L71H 5D5PA 2ZIMA 3K5NA 1L1FA 4FM0A 1IVSA 1VP7A 2ZE7A 3JASB 2PTMA 2VQEB 2HKOA 2RN9A 4JI0B 1R6TA 2FL4A 3OFNG 3ZHVA 4NTWA 5KMGB 3RYCA 5J9PC 1US6A 2PYLA 1GRJA 5L3EA 1ZTEA 1XDCA 1NH2B 2DN9A 1I94B 4I0XA 2QJ1A 4E4EA 5IE9A 2BOCC 1IBLB 4PHZA 4O4IA 3RYIA 2UUAO 4JASA 1JPXA 4RWUA 3JSNA 2EJRA 2KG7B 3O9OA 3OGIB 1D5NA 2ETNA 1PL0A 1H2MA 1AROP 2OCHA 2WA3A 4QE9A 3ZHUA 2NR5A 1WN7A 2WLLA 1VQ4V 1GN3A 4I7ZB 4JAAA 5EIBC 3JAWB 4DUZO 4X62O 4DK0A 1SERA 1K4DC 1AP5A 1KP2A 1IBKB 5LMUB 4H0LB 4LH6A 1M90W 4I4TB 1NR1A 3UKMA 4L8JA 4DR3B 4GUNA 5E79Z 3EVKA 2Y0IA 2ZDIA 4JI3O 2BOBC 5F2VO 2F43G 2XASA 1M57C 2IU0A 1JCHA 5J2TA 2YSUB 1CP9A 1JOYA 3ML0A 1SQBH 2FYUH 1NBMG 2JK5C 2Q6AA 4JI7B 5A2QN 2Q69A 3ETGA 1FXKC 3B4SA 5EZYA 1X59A 3LNNA 3ZBHA 5LGNA 4ZI7B 1TGOA 3BVOA 4YY3B 3GWOA 2Q5ZA 3T4DA 2JDIG 1B04A 1H38A 1IURA 5L3DA 2P22C 4TV8B 1MMMA 1M56B 4DV6O 2QE7G 1X4TA 4ZHQB 3QG5A 1NTKH 3CE2A 1Z5WA 4ZOLA 4H13B 4MS2A 2DMXA 1SQFA 2ZE8A 4FLVA 2W0FC 4CS3A 2R72A 1HNWO 3NXSA 4NXMO 1K4CC 3UO3A 3OUSA 1BSMA 4GKJB 3FFQA 2P5OA 1FFTB 2HVKC 2Q0OC 1EN5A 4LCUC 1P84F 1VQPV 3CX5F 3JD2A 3TK1A 5C8YB 2CGNA 2EZPA 3MD0A 5EC1C 5IJ9A 3W7UA 2BTQB 1BZKA 4PD4F 2WLNA 1DF5A 1FKAO 2WAMA 5BY1A 2GDSA 2XUMA 2DYSB 1MZEA 1YZBA 3P3NA 1Q6UA 3K5OA 5LGTA 4EFEA 1G8MA 1LUWA 2JEXA 3FB7C 5JQGB 3ZX6A 4X1YB 3OMIB 3QF7A 2LFRA 3CCUV 3BABA 1KYOF 3AG4C 1XMQO 2CTWA 2HVJC 2F23A 4JI8O 3LDCA 1ZSPA 2Q73A 3RYFA 5LP6C 2W6IG 2N04A 1AJPA 2P7TC 1K7DA 2P6JA 4FIPC 3DTUB 3J81N 3WB0A 4DV3O 5A9GA 4FM2A 2VWKA 4LF8O 1B3QA 4Q6GA 3L70H 2GHYA 3OM3B 4E2LA 1H2NA 3OEEG 1H2SB 2QTOA 3GVMA 3QNEA 3AG7A 2LP7A 3RFRA 1E1QG 1N32B 3T4ZA 4H33A 1QR9A 3CXCU 1VQOV 1QR8A 3K59A 3JCZA 1EN6A 2YXLA 4YJ3A 4I55B 3OR7C 5KX5B 3RVZA 1ORQC 1VQNV 4DR5O 3E22B 4J11A 3PJSK 4DRXA 2RDCA 1WA8A 3X2QC 2PUSA 1I5YA 4Q20A 2UU9O 2ATKC 1FXKA 1AI4A 4YIPA 1Q6HA 4LP8A 2N05A 4Z1VA 4PA7A 4YJ2B 3ABMB 1FXVA 3JARA 3ICXA 5LA6B 2GV9A 3P30A 1OCRB 4FM1A 3CJHA 1HNZO 5EBMC 4H37A 1OCCC 1U96A 3ZRXA 3ZRVA 4GZRB 2DJVA 2EULA 5EYPA 1YTFB 3AK2A 5B1BB 4X62B 3H1JH 1R3KC 3K08A 3HKBB 4JF3A 5CN0A 2A79B 1WB8A 2PI4A 3CEIA 2RMKB 2XAFA 2B1IA 4O2BA 3WG7C 2QTSA 2JGDA 2N74A 5ITZA 4KHPB 5CA3A 5BMVA 3JD1A 4UFZA 3EHBB 1KQSU 2OT5A 3A0BZ 1JQ0A 3K79A 5IT9N 2EINB 3AK3A 1E79G 1PKXA 3CRCA 5CBHA 5FLXN 2Y69C 3H1LH 2JS5A 3HKDA 2UXNA 2HLDG 5TISZ 1FXHA 3TXSA 4DV0O 2EIMB 1SF9A 3HPLC 2DYRC 3ZRWA 4AILC 2RCVA 5JJEB 4DV2O 3OTOB 1OZ0A 1Q7YW 3HKEA 1BHAA 1SC5B 2YDEA 4JTDB 2W0XA 5LP6A 1VF7A 1YCIA 4JI0O 4MVRA 5LHGA 1YHQV 4WCEV 4MVMA 1AI7A 4OX9O 3B77A 4WFEA 1XI1A 3JD3A 4O4HB 4O2AB 2E5LO 1K8AW 2ZXWB 5EC2C 3CMAV 3CB2A 1PNMA 2YUAA 4QGPA 4GLXA 4FMTA 3JSLA 1M1KW 1HNWB 3ZHQA 4DXWA 4NXMB 2WLJA 3A0RA 3O65A 1YDXA 1N36B 2YEVB 2YI8A 1Q81W 2JS3A 4CC6A 1Y6XA 1XNQB 1XHZA 2ZD9A 1OCOC 4NKGB 4WF9V 4MW3A 1AILA 1NVPB 1AR5A 1KKCA 2A3QA 3HKCA 1Y4MA 4X9QA 5KA5A 1VQLV 4F6EA 5B5EZ 1SA0A 3ZS8C 1F4NA 4YIOA 2F4VO 3BAAA 4B3RO 3AG2B 2LJ2A 1N8RW 5LMUO 4J9YB 1ZLZA 4DV5B 3E89A 1NZ6A 3FYIB 2DW4A 4UV9A 4DR3O 4DR2B 2K9PA 1I5XA 5IY5C 2YIAA 3CCSV 1XMQB 4EFBA 3BY6A 2ARHA 4IT5A 1Y74B 4Z2WA 1SS3A 2ZNJA 2Q4PA 3C3SA 4TV9B 4JGSA 1FPOA 2XTAA 4GX5A 3P3PA 2A9HA 4U7OA 5JJNB 4JI7O 3ZMZA 4ZKIA 2BSKA 4UCSA 4PA4A 4LF8B 1V55B 3HB3B 3JCUZ 1U97A 1F4MA 4DR4O 2LO1A 5DN6G 4JI2O 2NN4A 1KC8W 4MVQA 2CE4A 2QM8A 1XILA 1JFFA 3WU2Z 4U3JB 3TJTA 1XL6A 5IYZB 4GX1A 3DXRB 1S5HC 3ABTA 4C7UA 4B08A 4DR5B 3I55V 5B1AB 1GN6A 3SR2C 3JD0A 4WBNA 1GAXA 2EIKB 1J5EO 1AB3A 1ZL8A 2UU9B 1K33A 4DYLA 1QLNA 3TGUH 3G4SV 4I50A 3W7TA 3GB7C 3SJCC 4I5SA 5CA0A 4X1IB 1P7GA 2GTSA 1XBLA 4IYIA 5IJ0A 4UCRA 1D2DA 1HDJA 2B5UA 3CCRV 1V54C 4IHJA 2WLIA 1HNZB 1XMOO 1NR7A 2ZM6O 5D5QA 4BW5A 2CAZC 3NR7A 2E3CA 3OMNB 1K92A 2IBZH 2Q67A 3ZN0A 3K5LA 1XNRO 1L8DA 1GKFA 4TT3G 2IM9A 1UJWB 3CCMV 3RW0A 4LNUB 4LWSB 3SJBC 1YTFD 3K0GA 4EKWA 2QR4A 1S0VA 1DLBA 3CWBH 3OAAG 3SPHA 1KD1W 3VQWA 1OCZB 2XHBA 2X7RB 2R70A 1KKDA 3CS5A 1JVMA 3FD9A 3K5MA 4TQFA 4LFCO 2DWDC 3GWKC 1MG1A 4DV2B 4O4LB 1L0LH 5JVDB 5IDJA 1BS3A 4FZ1A 1RM1C 2L35A 1HNXO 1VF5B 3U0ZA 4UB8Z 2Y4UA 2CDYA 4GX0A 4LF5B 4OX9B 4MTFA 3JAKA 1KECA 1ROPA 2XT9A 5L3BA 2E5LB 4B3TO 5CB4B 4JYCA 1BGYH 1MSDA 3UT5B 4D6TH 2QKSA 4HNAB 1BHBA 2OIEA 1AP6A 4QPKA 1YI2V 3OT7A 4LC1A 3AG1C 1NU1H 3RBZA 3THOA 5LMNO 2DWEC 4K35A 2ZE5A 4TUYB 1IXBA 4WFHA 3N2KB 4IGGA 4ZI7A 1MABG 3J7AU 1L0NH 1KBHA 1IXMA 1G4YB 2CUGA 3W7WA 2HHHB 1COWG 3FAVB 4RAIA 4ZHQA 3DC5A 3ASOC 4I9WA 4PA9A 2CH7B 2F4VB 4B3RB 4J7ZA 3JATB 3T1CA 3KZIZ 1HP8A 3SYQA 3IJ4A 4QJFB 1FJGO 3ZMTA 1AI5A 4KHPO 1O9GA 1N0NA 1SQGA 5B66Z 2OCCC 1NJIW 2QWRB 1JX9A 2AGAA 4H44B 1Y76B 1Y67A 2BE3A 5C8YA 2A7WA 4F6RB 2E76B 2IW5A 3ASNC 5KLVH 4JYAO 1IBMO 2BTQA 1MA1A 3RYCB 3OTOO 3OTFA 3JD4A 1S3JA 1MOFA 2OWOA 3AG3B 2ILMA 1K3EA 4DR1B 3U10A 5IYBO 4DR4B 5LYJA 5FL7G 4K8ZA 5JQGA 4EEQA 3AK1A 1Q6IA 4JI2B 1NI8A 2M6YA 4O4IB 3RYIB 5GTIZ 4GKKB 1H2GA 1R6KA 4PDRA 4JI4O 5H5NA 3IGAC 3BRCA 1EM1A 3I5DA 2Y48A 2EILC 3A0HZ 4LR3A 4UCTA 5JWPA 2AHYA 5C93A 1BE3H 1PM9A 5AG2A 5GW7A 4B3SO 2ZINA 2JJ1G 1IZ3A 1P49A 1N36O 2HFEC 4UCOA 2Q7HA 4UVAA 1XNQO 3OMAB 5B3SB 2JJ2G 1J5EB 1S72V 2ZCEA 2ZR3A 2JEUA 3TXQA 2UUCB 1THZA 1WP8A 2BTOA 1FFXA 2ADPA 5EK0A 1GMGA 4HYOA 2QGNA 3ABLB 1VF6A 4R6ZA 3LDDA 4DV5O 2OYQA 1WPBA 1F7YA 4DR2O 5KHHA 3RYHB 5KX5A 4JAUA 4HAMA 1XMOB 1QLEB 2ZM6B 3QTCA 1Q3EA 4OXSA 3CMEV 1TA8A 2A06H 2YICA 1KMIZ 2V4DA 4R7CA 1VARA 1W59A 3SJQC 2ITCC 1XNRB 2DQ0A 3B8MA 4KUMA 3B09A 2EIJB 5IWAO 4NYKA 2LW1A 2HEPA 1JMKC 4D7TA 3CCVV 1Z5VA 4O4JB 5CMUA 4ZOLB 2UUBO 3KCXA 1NT2B 3UM7A 2FMLA 1RP3B 4FJCC 2Q7EA 3ZMVA 3CC4V 3T2MA 3CPWU 3APOA 1K97A 4LFCB 4BR6A 2IH3C 1Q90D 2XOKG 5IJ9B 1SQQH 5LBQA 1HNXB 3CP1A 4ICGA 4JI1O 3HR0A 4DV1O 5KUKA 2PI5A 4DR6O 2WLHA 1NTZH 3AEIA 4B3TB 1N4CA 1N34B 1WPXA 2H8PC 2ODMA 2AXTZ
chains in the Genus database with same CATH topology
4CBCA 3AG2B 1H8HG 1N8RW 1AR1B 5KUMA 4N21A 3ZJZA 4J9YB 2EZOA 4N23A 2H94A 3E89A 1Q86W 2WLLB 2Z5UA 3FYIB 2A0LA 2DW4A 3DGEA 4UV9A 3M99B 1YIJV 4MTOA 1DTOA 1PNLA 1I5XA 1BMFG 2ZXWC 1B6QA 5IY5C 3CCSV 4F4LA 1JJ2U 1NH2D 1VQ6V 4ASUG 3BY6A 2XAHA 5IYDO 3CCEV 1J95A 3ZMSA 1CPYA 3JYCA 4QPJA 1QCEA 2X6CA 5L3CA 1FS0G 3BEHA 4G2KA 4JGSA 1QVGU 4GX5A 2A9HA 2Q68A 4U7OA 5IYCO 4RQEA 4TSFG 3ZMZA 4ZKIA 1L1FA 1KP3A 4PA4A 1H8EG 4RUFA 1F23A 3CCQV 1V55B 3HB3B 2HKOA 3FB6C 1F4MA 2AHZA 3E8GA 3OFNG 4P9OA 1Y66A 1RPOA 3KG2A 4R8CA 3CYOA 5DN6G 1GTOA 2FTKA 5J9PC 2XAGA 5H6QA 4P30A 3FB5C 1V54B 5L3EA 1EZJA 4PDVA 1KC8W 3AG2C 3CCJV 4MVQA 1K34A 1M57B 1NH2B 2QM8A 4L87A 1SETA 2BOCC 1XL6A 1P7BA 4GX1A 4PELA 4JASA 1JPXA 4UVCA 1S5HC 3ABTA 2EJRA 5B1NA 4WFBV 5DM6V 3E35A 5H9CA 1FXKB 1PL0A 4LBEC 1AROP 3I55V 4QE9A 3ABUA 5B1AB 2WLLA 2V7QG 4XBFA 1VQ4V 3JD0A 2EIKB 2B1GA 1K33A 1QVFU 2OTJV 2P90A 2HR3A 2DQ3A 1SERA 1K4DC 1QLNA 3ZRSA 3G4SV 4G28B 3W7TA 1R3LC 1KP2A 3GB7C 4PDMA 1V55C 4I5SA 3IC7A 1M90W 3H01A 4GCZA 1NR1A 3VBBA 1GM8A 3UKMA 4XDJA 2B5UA 3MHSC 2QA4V 2WPDG 3CCRV 3QO8A 3STLC 2ZDIA 1V54C 1SZTA 2BOBC 1K5QA 1VQ9V 2IJIA 2WLIA 4X88A 5CBFA 2F43G 2XASA 1M57C 2IU0A 3SPGA 1NR7A 1JCHA 4BW5A 1Q82W 2X0LA 3IFXA 1VQMV 1RM1B 2YSUB 1CP9A 2W6JG 3OMNB 2M7WA 1K92A 1JOYA 1VQKV 2Q67A 3ZN0A 3ML0A 1R3JC 1GKFA 2Z3YA 4TT3G 1NBMG 2JK5C 2Q6AA 2Q69A 3ETGA 1FXKC 1GM7A 2IH1C 1UJWB 5HFLA 3CCMV 5HFMA 3W7SA 5LGNA 3RW0A 5B1AC 3GWOA 3T4DA 2HJFC 2JDIG 2EIKC 4KFMA 5EBLC 1H38A 5KA6A 3W7XA 5L3DA 1R3IC 3G71V 3OGCC 4MW8A 4FK5C 1YTFD 3K0GA 4EKWA 3AG1B 1M56B 4MT8A 1S0VA 2QE7G 3FKSG 4X8AA 1DLBA 3OAAG 3SPHA 4FPPA 3ZRWB 1KD1W 3AG4B 4MS2A 3ABKC 1OCZB 4RQFA 4UXNA 2W0FC 3E8FA 4RO2A 2QEXV 2X7RB 1KKDA 1JVMA 3NXSA 3QO7A 1K4CC 3ETDA 4XDLA 3ASOB 2DWDC 1MG1A 3F7YC 2ZQMA 3OUSA 4G27B 5IDJA 2XAQA 3P32A 1RM1C 3LUTB 5CBGA 1FFTB 2HVKC 3OR6C 3E8HA 5H6RA 4LCUC 2JIZG 3LDEA 4GX0A 2IJHA 1VQPV 3E86A 4UV8A 3JD2A 3TK1A 4CZZA 4MTFA 1KECA 1ROPA 2EZPA 2YEVA 3MD0A 3MHHC 3SPJA 5L3BA 5EC1C 1VQ5V 3W7UA 2IU3A 1BL8A 2OCCB 4JYCA 2WLNA 1DF5A 1S76D 2WWWA 2WAMA 2CK3G 2QKSA 1BHBA 1PNKA 1OHHG 2NLJC 4PA3A 4QPKA 4UUJC 2DYSB 1YI2V 4MVOA 4LC1A 3ASNB 1W0KG 1M56C 3AG1C 3RBZA 5LGTA 1G8MA 2JEXA 1K9MW 2DWEC 3FB7C 1YSCA 3OMIB 1K73W 2LFRA 4WFHA 5B1OA 3CCUV 3AG4C 1MABG 2HVJC 2OTLV 3ZIAG 5LHHA 1OCZC 3LDCA 5L3FA 1IXMA 4JTCB 4WFFA 4MVZA 3TETA 1DF4A 1G4YB 2W6IG 3W7WA 3E83A 1COWG 4MTGA 1AJPA 3X2QB 2P7TC 4RAIA 3ASOC 4I9WA 3ETEA 4PA9A 5LHIA 4WFAV 1YJWV 1K7DA 2P6JA 4FIPC 3DTUB 4KP4A 3QO5A 3LSQA 2KB1A 3T1CA 3SYQA 1F51A 2XAJA 4QJFB 2GHYA 4TWKA 1W2BU 3ZMTA 1RPRA 3OM3B 4E2LA 2NNUA 1AI5A 2EILB 2QTOA 3OEEG 3QNEA 4X89A 1LNQA 4PA6A 2LP7A 1GM9A 4PDLA 1E1QG 2OCCC 1VQ8V 3R65A 1NJIW 3T4ZA 4H33A 1QR9A 3CXCU 3SYPA 1QR8A 4R50A 1VQOV 1JX9A 2IJKA 3JCZA 1OCCB 2DYSC 1VQ7V 3CD6V 4UVBA 3CC7V 2XNDG 2IW5A 3ASNC 4P2ZA 1PD3A 3K03A 1W0JG 2P67A 3OR7C 4DO2A 3RVZA 3RVYA 1ORQC 3JD4A 1VQNV 1S3JA 1MOFA 1AI6A 3AG3B 1K3EA 2QM7A 3PJSK 5IYBO 3WG7B 3X2QC 3K3WA 3D3IA 5FL7G 1I5YA 4Q20A 2ATKC 4JPRA 1FXKA 1ENVA 1H2GA 4Z1MG 1AI4A 1R6KA 4PDRA 1CEZA 1TUEB 1HWYA 4QIWF 4MTXA 3ZCCA 4LP8A 3IGAC 4PA7A 3K0DA 4GT1A 1K5SA 2Y48A 3ABMB 1S77D 2EILC 1FXVA 2X6BA 2Y69B 2V1DA 2AHYA 5C93A 3F5WC 3FYEB 5GW7A 3LSSA 1XL4A 2JJ1G 3P30A 2DYRB 2HFEC 1OCRB 1MSWD 3OE7G 4UVAA 5EBMC 4H37A 1SRYA 1OCCC 3OMAB 3ZRXA 3LNMB 5B3SB 3ZRVA 2JJ2G 1S72V 2ZR3A 2D3OW 4BIZA 3B8NA 1YTFB 5B1BB 3K04A 2JEUA 1R3KC 2R9RB 3K08A 4JF3A 1THZA 3G6EV 5CN0A 5EK0A 2A79B 1GMGA 3OUFA 2PI4A 2WLIB 4HYOA 3AG3C 1R73A 2GSMB 4QE7A 3ABLB 4BAYA 2XAFA 4R6ZA 2B1IA 5BZBA 3WG7C 4J9ZB 3LDDA 5CA3A 3JD1A 4JAVA 3OW2U 3SYCA 2HG5C 1QBZA 1SESA 2WLMA 4JAUA 4HAMA 3EHBB 1YJ9V 1KQSU 2OT5A 3OEHG 1QLEB 3CCLV 2EBOA 1JQ0A 1M9NA 4ZBMA 3K79A 4OXSA 3ABMC 2EINB 3CMEV 3K9AA 1E79G 1PKXA 2ZR2A 1OCOB 5CBHA 2Y69C 4JTAB 2LFSA 4R7CA 3SJQC 5LGUA 2ITCC 2UXNA 2HLDG 1EBOA 1NKDA 3I56V 2DQ0A 3B8MA 1FXHA 1R6NA 3E8BA 4GX2A 2EIMB 4KUMA 5E1AC 4QNHB 2EIJB 3WFVA 3HPLC 2DYRC 1AJQA 3ZRWA 1OCRC 3FB8C 1YITV 2K1EA 4U7NA 1E1RG 1OZ0A 1Q7YW 1BHAA 3EFFK 4P9PA 3CCVV 1P4RA 3D36A 5CMUA 5B3SC 4JTDB 4WFGA 5L3GA 1NVPD 1EFRG 4MVRA 2WLKA 5LHGA 1YHQV 4WCEV 5B1BC 4MVMA 3SYOA 1AI7A 2IJJA 2R9IA 3B77A 4WFEA 3STZC 1AJNA 2WSSG 2ZDIC 3JD3A 3UM7A 4YXWG 1GK9A 3F7VC 3K06A 1GO3F 1K8AW 2C2AA 2ZXWB 5EC2C 5IY5B 3CMAV 1PNMA 3ABLC 3ZN1A 1ZWIC 4FJCC 4FMTA 3SPIA 5EBWC 4MVSA 3ABKB 3ZMVA 3CC4V 1YJNV 2UXXA 1M1KW 3T2MA 4DXWA 4BIUA 1WLEA 3CPWU 2WLJA 3A0RA 3VOUA 1K97A 2ITDC 4MVUA 2YEVB 1QLEC 3SPCA 2IH3C 2XOKG 3ZMUA 1Q81W 3CC2V 2X6AA 5LBQA 2EINC 3TCUA 3CP1A 2ZD9A 1OCOC 4JYBA 5KUKA 2PI5A 4WF9V 4MW3A 4XDKA 1NVPB 4HZ3A 4RUEA 2EIMC 3E2EA 2EIJC 3SYAA 2WLHA 1Y4MA 3AEIA 5KA5A 1VQLV 1WPXA 2H8PC 2MK3A 4MSWC 1F4NA 1NQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMG A;  2IJJ A;  2IJK A;  1RPO A;  2IJH A;  1PD3 A;  2GHY A;  3K79 A;  1GTO A;  1B6Q A;  1NKD A;  1ROP A;  1RPR A;  1F4M A;  2IJI A;  1F4N A;  4DO2 A; 
#chains in the Genus database with same CATH topology
 4DR7 O;  3B40 A;  1HR0 B;  1EZV H;  1AR1 B;  5KHJ A;  3T1H O;  4N21 A;  4N23 A;  4HBN A;  2A0L A;  3DGE A;  5LMN B;  3JAL B;  1DTO A;  1PNL A;  1RFY A;  1BMF G;  1B6Q A;  4CS4 A;  2GUZ A;  4F4L A;  1NH2 D;  2XAH A;  5IYD O;  1J95 A;  4BWA A;  1N0J A;  1FS0 G;  2PZS A;  1M5I A;  1JJO A;  2BCC H;  4EB6 A;  2Q68 A;  4O4H A;  2PYJ A;  3M7M X;  4TSF G;  4DW1 A;  2ZNI A;  1KP3 A;  1OJH A;  1FAF A;  4RUF A;  1F23 A;  1FJG B;  2AZ2 A;  4X20 B;  5KHG A;  5DEC A;  1Y66 A;  2F95 B;  3CYO A;  2FTK A;  2XAG A;  5H6Q A;  4P30 A;  4YJ3 B;  3S3W A;  4PDV A;  1M57 B;  5JH7 B;  4L87 A;  3ETQ A;  2LQT A;  3BA9 A;  1P7B A;  2KKW A;  1QHT A;  4JYA B;  5K1P A;  1IBM B;  1WA8 B;  4J42 A;  4UVC A;  5B1N A;  1NS1 A;  4WFB V;  5DM6 V;  3E35 A;  5H9C A;  1FXK B;  4DV4 O;  2Q7G A;  3BFR A;  3B2E E;  2F93 B;  5CA1 A;  5KAF Z;  2B1G A;  1YF2 A;  4LF5 O;  3K58 A;  3UCS C;  3JAR B;  2P90 A;  2HR3 A;  2YC0 A;  5GTH Z;  4JI4 B;  1QNM A;  3ZRS A;  1R3L C;  4PDM A;  1Y74 A;  3VQX A;  4A5U B;  3CJH B;  4BW9 A;  3H01 A;  3VBB A;  1GM8 A;  4B3S B;  3D3Q A;  3MHS C;  1TVK A;  2PF4 E;  3UQ8 A;  3LSU A;  3QO8 A;  3STL C;  1M4U A;  4FLY A;  1B06 A;  5EYP B;  1K5Q A;  1VQ9 V;  2IJI A;  4X88 A;  1QU7 A;  3SPG A;  4FLX A;  2P06 A;  1LR1 A;  3IFX A;  5BXZ A;  2HHH O;  4X66 O;  5BR8 O;  1R3J C;  2JGD B;  3DC6 A;  5ITZ B;  5BMV B;  1GM7 A;  2F1M A;  4LF6 B;  5HFM A;  4NTY A;  3W7S A;  3OD4 A;  4U3J A;  2HJF C;  1I7F A;  4KFM A;  5EBL C;  5KA6 A;  1SZX A;  1R3I C;  3APQ A;  3FX7 A;  3G71 V;  3OGC C;  3HKD B;  4CS2 A;  4MT8 A;  4DUY O;  2R9A A;  4X1K B;  3ZRW B;  3WB2 A;  3AG4 B;  3HKE B;  3Q4H A;  1BCC H;  3CRA A;  4JI5 O;  4UXN A;  5LP6 B;  1SQX H;  5IWA B;  4FFB B;  3VQY A;  4FLT A;  2ZQM A;  4NXN O;  3CSX A;  4I9Q A;  4X1I A;  2XAQ A;  3DSQ A;  1QQC A;  3D8C A;  2UUB B;  4DR1 O;  2UXB O;  5LOV B;  5H6R A;  4CH4 A;  4UV8 A;  4CZZ A;  3SPJ A;  3MHH C;  3MAQ A;  1H2L A;  2IU3 A;  4GKK O;  4ZIB A;  2GTA A;  1S76 D;  1DGS A;  2RNB A;  1OHH G;  2NLJ C;  4J10 A;  5KAI Z;  2UXC O;  2QWP B;  1YEW A;  3N2G A;  1M56 C;  1K9M W;  1YSC A;  4LNU A;  5GON B;  2VS0 A;  3ZIA G;  1TUB A;  1SA0 B;  4JI1 B;  5LHH A;  4DV1 B;  4JTC B;  3L73 H;  4WFF A;  4DR6 B;  3RN4 A;  2L6L A;  2YXH A;  4MTG A;  3X2Q B;  3U11 A;  4JI6 O;  2UUC O;  3ETE A;  4WFA V;  3QO5 A;  3LSQ A;  2KB1 A;  4DR7 B;  5LXT B;  2ZIO A;  3T1H B;  4TWK A;  1URF A;  1W2B U;  2YIB D;  2AW9 A;  4JZG A;  4X89 A;  1Q8I A;  1GM9 A;  4O4L A;  1UPG A;  3JAS A;  1VQ8 V;  3R65 A;  2KQX A;  4R50 A;  2BSK B;  2IJK A;  2HP8 A;  1OCC B;  1MNG A;  1KU9 A;  2DYS C;  4X64 B;  4UVB A;  1VQ7 V;  5KMG A;  3CD6 V;  2O57 A;  5FNV B;  3CC7 V;  3K03 A;  2QWN B;  1W0J G;  2P67 A;  5CB4 A;  4DO2 A;  3RVY A;  3UT5 A;  3RGB A;  1SQP H;  1RSO B;  1AI6 A;  4LF9 B;  2DE0 X;  2QM7 A;  5FPR A;  3J80 N;  3WG7 B;  1JFF B;  3D3I A;  2KG7 A;  3G80 A;  3G67 A;  1VEW A;  4Z1M G;  1CEZ A;  1HWY A;  4MTX A;  3ZCC A;  4LFB B;  4NR1 A;  4GT1 A;  3JAW A;  2Y69 B;  2QM4 A;  4GYC B;  2V1D A;  1WJZ A;  3H9V A;  4WBN B;  3F5W C;  4TOI A;  3LSS A;  1ZL8 B;  1IX9 A;  2DYR B;  3IAY A;  4DV4 B;  4K3A A;  1SRY A;  4I50 B;  4I4T A;  2FB5 A;  4W4L A;  4IIJ B;  1VF6 C;  5CA0 B;  2E74 B;  4OGQ B;  5DED A;  2QWQ B;  4LF7 O;  2D3O W;  5IJ0 B;  3K04 A;  4NTX A;  3G6E V;  1LUV A;  1N34 O;  2LW7 A;  3CRQ A;  4IHJ B;  1N33 O;  2WLI B;  1Y76 A;  1HR0 O;  1R73 A;  4F6R A;  5BZB A;  4J9Z B;  4B7E A;  2Z0A A;  3OW2 U;  1XUQ A;  5JCO A;  1SES A;  2WLM A;  3QVN A;  3OEH G;  2AZ0 A;  1H2K A;  3CCL V;  3ZHT A;  4J80 A;  1M9N A;  4ZBM A;  3L75 H;  4UCU A;  3ABM C;  1OCO B;  3A8T A;  4JTA B;  2LFS A;  3K9S A;  2YS8 A;  1CXZ B;  3BPZ A;  4TV8 A;  1NKD A;  4X66 B;  5BR8 B;  3I56 V;  1GN4 A;  5J2U B;  4QNH B;  3WFV A;  1AJQ A;  1OCR C;  1KUQ A;  3L9D A;  1WAZ A;  4U7N A;  1M93 A;  5FPO A;  1XRE A;  3EFF K;  4P9P A;  4CC5 A;  4WFG A;  5L3G A;  1NVP D;  1EFR G;  1WB7 A;  1FYJ A;  2WLK A;  5B1B C;  3SYO A;  1AVM A;  4DUY B;  1YVW A;  3STZ C;  2WSS G;  4YXW G;  1GK9 A;  3K06 A;  1MZF A;  1D5A A;  2C2A A;  5IY5 B;  1A32 A;  3ZN1 A;  3SDL A;  1ZWI C;  4JI5 B;  5EBW C;  1G1X B;  1YJN V;  2UXX A;  1FD9 A;  3F5T A;  2VQF O;  4LH7 A;  3JAK B;  1AR4 A;  3H1I H;  1WP7 A;  4AQY B;  4NXN B;  2X6A A;  3T1Y O;  2EIN C;  2UXB B;  4PJ0 Z;  4XDK A;  4I0X B;  2EIM C;  3E2E A;  1KB9 F;  3SYA A;  4NB5 A;  3RYH A;  4X1Y A;  5H2F Z;  2RQ6 A;  4JZ2 A;  3CXH F;  4K8X A;  4CH3 A;  4MSW C;  1ZUQ A;  4IL6 Z;  4U3F H;  2QKC A;  2UXC B;  2H94 A;  1Q86 W;  2WLL B;  2YID A;  2Z5U A;  4DV7 B;  1YIJ V;  4NVP A;  1PV0 A;  4MTO A;  2ZXW C;  3IC9 A;  4O4J A;  1VQ6 V;  3CCE V;  3ZMS A;  1CPY A;  3JYC A;  2X6C A;  4K0K O;  5L3C A;  3BEH A;  4JI6 B;  4X65 O;  3A2F A;  4RQE A;  5KHK A;  3CHX A;  4LF6 O;  1H8E G;  3CCQ V;  3FB6 C;  5J2T B;  3EXA A;  1JA8 A;  2FKX A;  2AHZ A;  3E8G A;  4P9O A;  1RPO A;  3KG2 A;  4I55 A;  4R8C A;  1GTO A;  1XOU A;  3FB5 C;  1V54 B;  1EZJ A;  3E22 A;  4CH6 A;  3AG2 C;  3CCJ V;  5EZY B;  1K34 A;  2ZKO A;  2E75 B;  2Q0A A;  1SET A;  2YIB A;  4CH5 A;  4PEL A;  2EX3 A;  4AI8 A;  5LYJ B;  2PY5 A;  2VRZ A;  4YJ2 A;  4OPH A;  4LF4 B;  4LBE C;  3ABU A;  3M8A A;  2V7Q G;  4XBF A;  4B3M O;  5LA6 A;  2CTP A;  3JAL A;  1QVF U;  1TAE A;  2OTJ V;  2DQ3 A;  3BCC H;  2CTQ A;  4G28 B;  1V55 C;  4FVM A;  3JAM N;  3IC7 A;  4J7J A;  4GCZ A;  4XDJ A;  2QA4 V;  2WPD G;  3HKB A;  2LGW A;  1SZT A;  1S5J A;  5CBF A;  1FFX B;  2KSD A;  2QDO A;  1ZX3 A;  1Q82 W;  2X0L A;  1VQM V;  1RM1 B;  3PN1 A;  4X20 A;  4LF7 B;  1UFI A;  2W6J G;  4B7K A;  2M7W A;  1VQK V;  2Z3Y A;  1IDS A;  4W4K A;  5KHI A;  1SKV A;  1N33 B;  2IH1 C;  1GN2 A;  5JH7 A;  5HFL A;  1ZAU A;  3L72 H;  2DOS A;  5B1A C;  4YHH O;  3L74 H;  2EIK C;  4TQD A;  3W7X A;  4JV5 O;  3RYF B;  4MW8 A;  4FK5 C;  3BHP A;  3AG1 B;  3SJA C;  3FKS G;  4X8A A;  4FPP A;  1NTM H;  1SQV H;  1JR9 A;  2Q8V A;  3ABK C;  4RQF A;  4X64 O;  1T5E A;  3E8F A;  4RO2 A;  2WA4 A;  2QEX V;  1VMG A;  2UUA B;  4O2A A;  3QO7 A;  1EN4 A;  3ETD A;  4XDL A;  3ASO B;  4PV1 B;  3F7Y C;  4G27 B;  3P32 A;  4OPA A;  3LUT B;  3ZHR A;  5CBG A;  2ZT9 B;  3OR6 C;  4LF9 O;  3E8H A;  4LFA O;  2JIZ G;  3LDE A;  2IJH A;  3K57 A;  3E86 A;  2YEV A;  4DUZ B;  1VQ5 V;  1BL8 A;  2LGQ A;  2OCC B;  4LFB O;  2WWW A;  2CK3 G;  1PNK A;  3VQV A;  4PA3 A;  4UUJ C;  2VQF B;  4UB6 Z;  4DRX B;  4MVO A;  2UXD O;  4D7S A;  3RT3 C;  3ASN B;  1W0K G;  2ADQ B;  2P4V A;  4JI3 B;  3S3X A;  1K73 W;  5B1O A;  3T1Y B;  2OTL V;  2YXY A;  4IYH A;  1OCZ C;  5L3F A;  3D36 C;  4MVZ A;  3TET A;  1DF4 A;  3E83 A;  2ZE6 A;  4X1K A;  5LHI A;  1YJW V;  4KP4 A;  2VQE O;  2GUZ B;  2OIG A;  1F51 A;  2XAJ A;  4TV9 A;  3BA8 A;  1O9H A;  1RPR A;  2NNU A;  2EIL B;  1R1B A;  4FFB A;  3KCY A;  1LNQ A;  4PA6 A;  4PDL A;  4DV6 B;  1XHX A;  4EB6 B;  3SYP A;  3WB1 A;  5LOV A;  1BQ0 A;  1I94 O;  4K0K B;  3ZED A;  2H3O A;  4BIO A;  4FLU A;  1WNS A;  4O2B B;  2XND G;  4X65 B;  2JRI A;  1IBL O;  1XEQ A;  4P2Z A;  1PD3 A;  3H1K H;  4JYY A;  2GBO A;  1YXB A;  4J41 A;  1DK1 A;  5IYZ A;  2G38 A;  3DXR A;  2Y4T A;  3K3W A;  1PPJ H;  1VIB A;  4JPR A;  1ENV A;  1GH6 A;  5GON A;  4FLZ A;  1TUE B;  4QIW F;  3N27 A;  1IBK O;  3K0D A;  1K5S A;  1S77 D;  5CA1 B;  1Q5O A;  2X6B A;  3FYE B;  2QKA A;  1XL4 A;  2Y0P A;  4AQY O;  5LXT A;  3G6B A;  1I0H A;  1MSW D;  3OE7 G;  2P4K A;  4JI8 B;  5K1X A;  3LNM B;  4B3M B;  4DW0 A;  4BIZ A;  3B8N A;  5JCO C;  1TVK B;  2R9R B;  4FLW A;  4DV3 B;  3OUF A;  3AG3 C;  2GSM B;  4QE7 A;  4PI2 A;  1XQ8 A;  4BAY A;  5FNV A;  2CGO A;  3H1H H;  1BT8 A;  4YY3 O;  2PGG A;  4UCV A;  3RWR D;  4DV7 O;  4JAV A;  2MW2 B;  2HG5 C;  1QBZ A;  3HKC B;  3SYC A;  2QWO B;  1YJ9 V;  2EBO A;  1RSO A;  4LWS A;  3K9A A;  2ZR2 A;  3ZHS A;  5LGU A;  1Q43 A;  4AHC A;  3C90 A;  1EBO A;  5E1A C;  1R6N A;  3E8B A;  4GX2 A;  2EJ7 A;  2HJD A;  3FB8 C;  1YIT V;  2YI9 A;  3R66 A;  2VWJ A;  2K1E A;  4J7K A;  1E1R G;  1P4R A;  3D36 A;  1OV9 A;  3KKY A;  4GKJ O;  1S5L Z;  5B3S C;  2JGU A;  4YHH B;  4JV5 B;  3Q4H B;  1BQZ A;  2Q9L A;  2IJJ A;  2R9I A;  5JVD A;  4KL1 A;  1AJN A;  2ZDI C;  3F7V C;  1GO3 F;  2D2C B;  3CRM A;  3ABL C;  4IIJ A;  3CRR A;  1I08 A;  3SPI A;  4MVS A;  3ABK B;  4BIU A;  1WLE A;  2F66 C;  3VOU A;  2ITD C;  4MVU A;  2RJZ A;  1QLE C;  3SPC A;  4FZ0 A;  3ZMU A;  3CC2 V;  2B9Z A;  1G6U A;  5JJJ B;  4HNA A;  4LF4 O;  3TCU A;  4JYB A;  4LFA B;  4HZ3 A;  4RUE A;  2EIJ C;  3C3T A;  5EIB D;  2JVD A;  4TUY A;  3N2K A;  3N2G B;  4FFK A;  2MK3 A;  1NQT A;  3UO2 A;  4CBC A;  1H8H G;  5LL6 Y;  5KUM A;  3ZJZ A;  1TUB B;  2EZO A;  2UXD B;  3SGI A;  3FAV A;  5J2U A;  2CTR A;  3M99 B;  2CH7 A;  1V9P A;  3JAT A;  1PP9 H;  1JJ2 U;  1N32 O;  4ASU G;  4KXR A;  4PI0 A;  1PL4 A;  4QPJ A;  1QCE A;  4DK1 A;  1HW7 A;  4DV0 B;  4ABM A;  4G2K A;  1QVG U;  3MDS A;  2QSA A;  1Z2G A;  5IYC O;  3L71 H;  5D5P A;  2ZIM A;  3K5N A;  1L1F A;  4FM0 A;  1IVS A;  1VP7 A;  2ZE7 A;  3JAS B;  2PTM A;  2VQE B;  2HKO A;  2RN9 A;  4JI0 B;  1R6T A;  2FL4 A;  3OFN G;  3ZHV A;  4NTW A;  5KMG B;  3RYC A;  5J9P C;  1US6 A;  2PYL A;  1GRJ A;  5L3E A;  1ZTE A;  1XDC A;  1NH2 B;  2DN9 A;  1I94 B;  4I0X A;  2QJ1 A;  4E4E A;  5IE9 A;  2BOC C;  1IBL B;  4PHZ A;  4O4I A;  3RYI A;  2UUA O;  4JAS A;  1JPX A;  4RWU A;  3JSN A;  2EJR A;  2KG7 B;  3O9O A;  3OGI B;  1D5N A;  2ETN A;  1PL0 A;  1H2M A;  1ARO P;  2OCH A;  2WA3 A;  4QE9 A;  3ZHU A;  2NR5 A;  1WN7 A;  2WLL A;  1VQ4 V;  1GN3 A;  4I7Z B;  4JAA A;  5EIB C;  3JAW B;  4DUZ O;  4X62 O;  4DK0 A;  1SER A;  1K4D C;  1AP5 A;  1KP2 A;  1IBK B;  5LMU B;  4H0L B;  4LH6 A;  1M90 W;  4I4T B;  1NR1 A;  3UKM A;  4L8J A;  4DR3 B;  4GUN A;  5E79 Z;  3EVK A;  2Y0I A;  2ZDI A;  4JI3 O;  2BOB C;  5F2V O;  2F43 G;  2XAS A;  1M57 C;  2IU0 A;  1JCH A;  5J2T A;  2YSU B;  1CP9 A;  1JOY A;  3ML0 A;  1SQB H;  2FYU H;  1NBM G;  2JK5 C;  2Q6A A;  4JI7 B;  5A2Q N;  2Q69 A;  3ETG A;  1FXK C;  3B4S A;  5EZY A;  1X59 A;  3LNN A;  3ZBH A;  5LGN A;  4ZI7 B;  1TGO A;  3BVO A;  4YY3 B;  3GWO A;  2Q5Z A;  3T4D A;  2JDI G;  1B04 A;  1H38 A;  1IUR A;  5L3D A;  2P22 C;  4TV8 B;  1MMM A;  1M56 B;  4DV6 O;  2QE7 G;  1X4T A;  4ZHQ B;  3QG5 A;  1NTK H;  3CE2 A;  1Z5W A;  4ZOL A;  4H13 B;  4MS2 A;  2DMX A;  1SQF A;  2ZE8 A;  4FLV A;  2W0F C;  4CS3 A;  2R72 A;  1HNW O;  3NXS A;  4NXM O;  1K4C C;  3UO3 A;  3OUS A;  1BSM A;  4GKJ B;  3FFQ A;  2P5O A;  1FFT B;  2HVK C;  2Q0O C;  1EN5 A;  4LCU C;  1P84 F;  1VQP V;  3CX5 F;  3JD2 A;  3TK1 A;  5C8Y B;  2CGN A;  2EZP A;  3MD0 A;  5EC1 C;  5IJ9 A;  3W7U A;  2BTQ B;  1BZK A;  4PD4 F;  2WLN A;  1DF5 A;  1FKA O;  2WAM A;  5BY1 A;  2GDS A;  2XUM A;  2DYS B;  1MZE A;  1YZB A;  3P3N A;  1Q6U A;  3K5O A;  5LGT A;  4EFE A;  1G8M A;  1LUW A;  2JEX A;  3FB7 C;  5JQG B;  3ZX6 A;  4X1Y B;  3OMI B;  3QF7 A;  2LFR A;  3CCU V;  3BAB A;  1KYO F;  3AG4 C;  1XMQ O;  2CTW A;  2HVJ C;  2F23 A;  4JI8 O;  3LDC A;  1ZSP A;  2Q73 A;  3RYF A;  5LP6 C;  2W6I G;  2N04 A;  1AJP A;  2P7T C;  1K7D A;  2P6J A;  4FIP C;  3DTU B;  3J81 N;  3WB0 A;  4DV3 O;  5A9G A;  4FM2 A;  2VWK A;  4LF8 O;  1B3Q A;  4Q6G A;  3L70 H;  2GHY A;  3OM3 B;  4E2L A;  1H2N A;  3OEE G;  1H2S B;  2QTO A;  3GVM A;  3QNE A;  3AG7 A;  2LP7 A;  3RFR A;  1E1Q G;  1N32 B;  3T4Z A;  4H33 A;  1QR9 A;  3CXC U;  1VQO V;  1QR8 A;  3K59 A;  3JCZ A;  1EN6 A;  2YXL A;  4YJ3 A;  4I55 B;  3OR7 C;  5KX5 B;  3RVZ A;  1ORQ C;  1VQN V;  4DR5 O;  3E22 B;  4J11 A;  3PJS K;  4DRX A;  2RDC A;  1WA8 A;  3X2Q C;  2PUS A;  1I5Y A;  4Q20 A;  2UU9 O;  2ATK C;  1FXK A;  1AI4 A;  4YIP A;  1Q6H A;  4LP8 A;  2N05 A;  4Z1V A;  4PA7 A;  4YJ2 B;  3ABM B;  1FXV A;  3JAR A;  3ICX A;  5LA6 B;  2GV9 A;  3P30 A;  1OCR B;  4FM1 A;  3CJH A;  1HNZ O;  5EBM C;  4H37 A;  1OCC C;  1U96 A;  3ZRX A;  3ZRV A;  4GZR B;  2DJV A;  2EUL A;  5EYP A;  1YTF B;  3AK2 A;  5B1B B;  4X62 B;  3H1J H;  1R3K C;  3K08 A;  3HKB B;  4JF3 A;  5CN0 A;  2A79 B;  1WB8 A;  2PI4 A;  3CEI A;  2RMK B;  2XAF A;  2B1I A;  4O2B A;  3WG7 C;  2QTS A;  2JGD A;  2N74 A;  5ITZ A;  4KHP B;  5CA3 A;  5BMV A;  3JD1 A;  4UFZ A;  3EHB B;  1KQS U;  2OT5 A;  3A0B Z;  1JQ0 A;  3K79 A;  5IT9 N;  2EIN B;  3AK3 A;  1E79 G;  1PKX A;  3CRC A;  5CBH A;  5FLX N;  2Y69 C;  3H1L H;  2JS5 A;  3HKD A;  2UXN A;  2HLD G;  5TIS Z;  1FXH A;  3TXS A;  4DV0 O;  2EIM B;  1SF9 A;  3HPL C;  2DYR C;  3ZRW A;  4AIL C;  2RCV A;  5JJE B;  4DV2 O;  3OTO B;  1OZ0 A;  1Q7Y W;  3HKE A;  1BHA A;  1SC5 B;  2YDE A;  4JTD B;  2W0X A;  5LP6 A;  1VF7 A;  1YCI A;  4JI0 O;  4MVR A;  5LHG A;  1YHQ V;  4WCE V;  4MVM A;  1AI7 A;  4OX9 O;  3B77 A;  4WFE A;  1XI1 A;  3JD3 A;  4O4H B;  4O2A B;  2E5L O;  1K8A W;  2ZXW B;  5EC2 C;  3CMA V;  3CB2 A;  1PNM A;  2YUA A;  4QGP A;  4GLX A;  4FMT A;  3JSL A;  1M1K W;  1HNW B;  3ZHQ A;  4DXW A;  4NXM B;  2WLJ A;  3A0R A;  3O65 A;  1YDX A;  1N36 B;  2YEV B;  2YI8 A;  1Q81 W;  2JS3 A;  4CC6 A;  1Y6X A;  1XNQ B;  1XHZ A;  2ZD9 A;  1OCO C;  4NKG B;  4WF9 V;  4MW3 A;  1AIL A;  1NVP B;  1AR5 A;  1KKC A;  2A3Q A;  3HKC A;  1Y4M A;  4X9Q A;  5KA5 A;  1VQL V;  4F6E A;  5B5E Z;  1SA0 A;  3ZS8 C;  1F4N A;  4YIO A;  2F4V O;  3BAA A;  4B3R O;  3AG2 B;  2LJ2 A;  1N8R W;  5LMU O;  4J9Y B;  1ZLZ A;  4DV5 B;  3E89 A;  1NZ6 A;  3FYI B;  2DW4 A;  4UV9 A;  4DR3 O;  4DR2 B;  2K9P A;  1I5X A;  5IY5 C;  2YIA A;  3CCS V;  1XMQ B;  4EFB A;  3BY6 A;  2ARH A;  4IT5 A;  1Y74 B;  4Z2W A;  1SS3 A;  2ZNJ A;  2Q4P A;  3C3S A;  4TV9 B;  4JGS A;  1FPO A;  2XTA A;  4GX5 A;  3P3P A;  2A9H A;  4U7O A;  5JJN B;  4JI7 O;  3ZMZ A;  4ZKI A;  2BSK A;  4UCS A;  4PA4 A;  4LF8 B;  1V55 B;  3HB3 B;  3JCU Z;  1U97 A;  1F4M A;  4DR4 O;  2LO1 A;  5DN6 G;  4JI2 O;  2NN4 A;  1KC8 W;  4MVQ A;  2CE4 A;  2QM8 A;  1XIL A;  1JFF A;  3WU2 Z;  4U3J B;  3TJT A;  1XL6 A;  5IYZ B;  4GX1 A;  3DXR B;  1S5H C;  3ABT A;  4C7U A;  4B08 A;  4DR5 B;  3I55 V;  5B1A B;  1GN6 A;  3SR2 C;  3JD0 A;  4WBN A;  1GAX A;  2EIK B;  1J5E O;  1AB3 A;  1ZL8 A;  2UU9 B;  1K33 A;  4DYL A;  1QLN A;  3TGU H;  3G4S V;  4I50 A;  3W7T A;  3GB7 C;  3SJC C;  4I5S A;  5CA0 A;  4X1I B;  1P7G A;  2GTS A;  1XBL A;  4IYI A;  5IJ0 A;  4UCR A;  1D2D A;  1HDJ A;  2B5U A;  3CCR V;  1V54 C;  4IHJ A;  2WLI A;  1HNZ B;  1XMO O;  1NR7 A;  2ZM6 O;  5D5Q A;  4BW5 A;  2CAZ C;  3NR7 A;  2E3C A;  3OMN B;  1K92 A;  2IBZ H;  2Q67 A;  3ZN0 A;  3K5L A;  1XNR O;  1L8D A;  1GKF A;  4TT3 G;  2IM9 A;  1UJW B;  3CCM V;  3RW0 A;  4LNU B;  4LWS B;  3SJB C;  1YTF D;  3K0G A;  4EKW A;  2QR4 A;  1S0V A;  1DLB A;  3CWB H;  3OAA G;  3SPH A;  1KD1 W;  3VQW A;  1OCZ B;  2XHB A;  2X7R B;  2R70 A;  1KKD A;  3CS5 A;  1JVM A;  3FD9 A;  3K5M A;  4TQF A;  4LFC O;  2DWD C;  3GWK C;  1MG1 A;  4DV2 B;  4O4L B;  1L0L H;  5JVD B;  5IDJ A;  1BS3 A;  4FZ1 A;  1RM1 C;  2L35 A;  1HNX O;  1VF5 B;  3U0Z A;  4UB8 Z;  2Y4U A;  2CDY A;  4GX0 A;  4LF5 B;  4OX9 B;  4MTF A;  3JAK A;  1KEC A;  1ROP A;  2XT9 A;  5L3B A;  2E5L B;  4B3T O;  5CB4 B;  4JYC A;  1BGY H;  1MSD A;  3UT5 B;  4D6T H;  2QKS A;  4HNA B;  1BHB A;  2OIE A;  1AP6 A;  4QPK A;  1YI2 V;  3OT7 A;  4LC1 A;  3AG1 C;  1NU1 H;  3RBZ A;  3THO A;  5LMN O;  2DWE C;  4K35 A;  2ZE5 A;  4TUY B;  1IXB A;  4WFH A;  3N2K B;  4IGG A;  4ZI7 A;  1MAB G;  3J7A U;  1L0N H;  1KBH A;  1IXM A;  1G4Y B;  2CUG A;  3W7W A;  2HHH B;  1COW G;  3FAV B;  4RAI A;  4ZHQ A;  3DC5 A;  3ASO C;  4I9W A;  4PA9 A;  2CH7 B;  2F4V B;  4B3R B;  4J7Z A;  3JAT B;  3T1C A;  3KZI Z;  1HP8 A;  3SYQ A;  3IJ4 A;  4QJF B;  1FJG O;  3ZMT A;  1AI5 A;  4KHP O;  1O9G A;  1N0N A;  1SQG A;  5B66 Z;  2OCC C;  1NJI W;  2QWR B;  1JX9 A;  2AGA A;  4H44 B;  1Y76 B;  1Y67 A;  2BE3 A;  5C8Y A;  2A7W A;  4F6R B;  2E76 B;  2IW5 A;  3ASN C;  5KLV H;  4JYA O;  1IBM O;  2BTQ A;  1MA1 A;  3RYC B;  3OTO O;  3OTF A;  3JD4 A;  1S3J A;  1MOF A;  2OWO A;  3AG3 B;  2ILM A;  1K3E A;  4DR1 B;  3U10 A;  5IYB O;  4DR4 B;  5LYJ A;  5FL7 G;  4K8Z A;  5JQG A;  4EEQ A;  3AK1 A;  1Q6I A;  4JI2 B;  1NI8 A;  2M6Y A;  4O4I B;  3RYI B;  5GTI Z;  4GKK B;  1H2G A;  1R6K A;  4PDR A;  4JI4 O;  5H5N A;  3IGA C;  3BRC A;  1EM1 A;  3I5D A;  2Y48 A;  2EIL C;  3A0H Z;  4LR3 A;  4UCT A;  5JWP A;  2AHY A;  5C93 A;  1BE3 H;  1PM9 A;  5AG2 A;  5GW7 A;  4B3S O;  2ZIN A;  2JJ1 G;  1IZ3 A;  1P49 A;  1N36 O;  2HFE C;  4UCO A;  2Q7H A;  4UVA A;  1XNQ O;  3OMA B;  5B3S B;  2JJ2 G;  1J5E B;  1S72 V;  2ZCE A;  2ZR3 A;  2JEU A;  3TXQ A;  2UUC B;  1THZ A;  1WP8 A;  2BTO A;  1FFX A;  2ADP A;  5EK0 A;  1GMG A;  4HYO A;  2QGN A;  3ABL B;  1VF6 A;  4R6Z A;  3LDD A;  4DV5 O;  2OYQ A;  1WPB A;  1F7Y A;  4DR2 O;  5KHH A;  3RYH B;  5KX5 A;  4JAU A;  4HAM A;  1XMO B;  1QLE B;  2ZM6 B;  3QTC A;  1Q3E A;  4OXS A;  3CME V;  1TA8 A;  2A06 H;  2YIC A;  1KMI Z;  2V4D A;  4R7C A;  1VAR A;  1W59 A;  3SJQ C;  2ITC C;  1XNR B;  2DQ0 A;  3B8M A;  4KUM A;  3B09 A;  2EIJ B;  5IWA O;  4NYK A;  2LW1 A;  2HEP A;  1JMK C;  4D7T A;  3CCV V;  1Z5V A;  4O4J B;  5CMU A;  4ZOL B;  2UUB O;  3KCX A;  1NT2 B;  3UM7 A;  2FML A;  1RP3 B;  4FJC C;  2Q7E A;  3ZMV A;  3CC4 V;  3T2M A;  3CPW U;  3APO A;  1K97 A;  4LFC B;  4BR6 A;  2IH3 C;  1Q90 D;  2XOK G;  5IJ9 B;  1SQQ H;  5LBQ A;  1HNX B;  3CP1 A;  4ICG A;  4JI1 O;  3HR0 A;  4DV1 O;  5KUK A;  2PI5 A;  4DR6 O;  2WLH A;  1NTZ H;  3AEI A;  4B3T B;  1N4C A;  1N34 B;  1WPX A;  2H8P C;  2ODM A;  2AXT Z; 
#chains in the Genus database with same CATH homology
 4CBC A;  3AG2 B;  1H8H G;  1N8R W;  1AR1 B;  5KUM A;  4N21 A;  3ZJZ A;  4J9Y B;  2EZO A;  4N23 A;  2H94 A;  3E89 A;  1Q86 W;  2WLL B;  2Z5U A;  3FYI B;  2A0L A;  2DW4 A;  3DGE A;  4UV9 A;  3M99 B;  1YIJ V;  4MTO A;  1DTO A;  1PNL A;  1I5X A;  1BMF G;  2ZXW C;  1B6Q A;  5IY5 C;  3CCS V;  4F4L A;  1JJ2 U;  1NH2 D;  1VQ6 V;  4ASU G;  3BY6 A;  2XAH A;  5IYD O;  3CCE V;  1J95 A;  3ZMS A;  1CPY A;  3JYC A;  4QPJ A;  1QCE A;  2X6C A;  5L3C A;  1FS0 G;  3BEH A;  4G2K A;  4JGS A;  1QVG U;  4GX5 A;  2A9H A;  2Q68 A;  4U7O A;  5IYC O;  4RQE A;  4TSF G;  3ZMZ A;  4ZKI A;  1L1F A;  1KP3 A;  4PA4 A;  1H8E G;  4RUF A;  1F23 A;  3CCQ V;  1V55 B;  3HB3 B;  2HKO A;  3FB6 C;  1F4M A;  2AHZ A;  3E8G A;  3OFN G;  4P9O A;  1Y66 A;  1RPO A;  3KG2 A;  4R8C A;  3CYO A;  5DN6 G;  1GTO A;  2FTK A;  5J9P C;  2XAG A;  5H6Q A;  4P30 A;  3FB5 C;  1V54 B;  5L3E A;  1EZJ A;  4PDV A;  1KC8 W;  3AG2 C;  3CCJ V;  4MVQ A;  1K34 A;  1M57 B;  1NH2 B;  2QM8 A;  4L87 A;  1SET A;  2BOC C;  1XL6 A;  1P7B A;  4GX1 A;  4PEL A;  4JAS A;  1JPX A;  4UVC A;  1S5H C;  3ABT A;  2EJR A;  5B1N A;  4WFB V;  5DM6 V;  3E35 A;  5H9C A;  1FXK B;  1PL0 A;  4LBE C;  1ARO P;  3I55 V;  4QE9 A;  3ABU A;  5B1A B;  2WLL A;  2V7Q G;  4XBF A;  1VQ4 V;  3JD0 A;  2EIK B;  2B1G A;  1K33 A;  1QVF U;  2OTJ V;  2P90 A;  2HR3 A;  2DQ3 A;  1SER A;  1K4D C;  1QLN A;  3ZRS A;  3G4S V;  4G28 B;  3W7T A;  1R3L C;  1KP2 A;  3GB7 C;  4PDM A;  1V55 C;  4I5S A;  3IC7 A;  1M90 W;  3H01 A;  4GCZ A;  1NR1 A;  3VBB A;  1GM8 A;  3UKM A;  4XDJ A;  2B5U A;  3MHS C;  2QA4 V;  2WPD G;  3CCR V;  3QO8 A;  3STL C;  2ZDI A;  1V54 C;  1SZT A;  2BOB C;  1K5Q A;  1VQ9 V;  2IJI A;  2WLI A;  4X88 A;  5CBF A;  2F43 G;  2XAS A;  1M57 C;  2IU0 A;  3SPG A;  1NR7 A;  1JCH A;  4BW5 A;  1Q82 W;  2X0L A;  3IFX A;  1VQM V;  1RM1 B;  2YSU B;  1CP9 A;  2W6J G;  3OMN B;  2M7W A;  1K92 A;  1JOY A;  1VQK V;  2Q67 A;  3ZN0 A;  3ML0 A;  1R3J C;  1GKF A;  2Z3Y A;  4TT3 G;  1NBM G;  2JK5 C;  2Q6A A;  2Q69 A;  3ETG A;  1FXK C;  1GM7 A;  2IH1 C;  1UJW B;  5HFL A;  3CCM V;  5HFM A;  3W7S A;  5LGN A;  3RW0 A;  5B1A C;  3GWO A;  3T4D A;  2HJF C;  2JDI G;  2EIK C;  4KFM A;  5EBL C;  1H38 A;  5KA6 A;  3W7X A;  5L3D A;  1R3I C;  3G71 V;  3OGC C;  4MW8 A;  4FK5 C;  1YTF D;  3K0G A;  4EKW A;  3AG1 B;  1M56 B;  4MT8 A;  1S0V A;  2QE7 G;  3FKS G;  4X8A A;  1DLB A;  3OAA G;  3SPH A;  4FPP A;  3ZRW B;  1KD1 W;  3AG4 B;  4MS2 A;  3ABK C;  1OCZ B;  4RQF A;  4UXN A;  2W0F C;  3E8F A;  4RO2 A;  2QEX V;  2X7R B;  1KKD A;  1JVM A;  3NXS A;  3QO7 A;  1K4C C;  3ETD A;  4XDL A;  3ASO B;  2DWD C;  1MG1 A;  3F7Y C;  2ZQM A;  3OUS A;  4G27 B;  5IDJ A;  2XAQ A;  3P32 A;  1RM1 C;  3LUT B;  5CBG A;  1FFT B;  2HVK C;  3OR6 C;  3E8H A;  5H6R A;  4LCU C;  2JIZ G;  3LDE A;  4GX0 A;  2IJH A;  1VQP V;  3E86 A;  4UV8 A;  3JD2 A;  3TK1 A;  4CZZ A;  4MTF A;  1KEC A;  1ROP A;  2EZP A;  2YEV A;  3MD0 A;  3MHH C;  3SPJ A;  5L3B A;  5EC1 C;  1VQ5 V;  3W7U A;  2IU3 A;  1BL8 A;  2OCC B;  4JYC A;  2WLN A;  1DF5 A;  1S76 D;  2WWW A;  2WAM A;  2CK3 G;  2QKS A;  1BHB A;  1PNK A;  1OHH G;  2NLJ C;  4PA3 A;  4QPK A;  4UUJ C;  2DYS B;  1YI2 V;  4MVO A;  4LC1 A;  3ASN B;  1W0K G;  1M56 C;  3AG1 C;  3RBZ A;  5LGT A;  1G8M A;  2JEX A;  1K9M W;  2DWE C;  3FB7 C;  1YSC A;  3OMI B;  1K73 W;  2LFR A;  4WFH A;  5B1O A;  3CCU V;  3AG4 C;  1MAB G;  2HVJ C;  2OTL V;  3ZIA G;  5LHH A;  1OCZ C;  3LDC A;  5L3F A;  1IXM A;  4JTC B;  4WFF A;  4MVZ A;  3TET A;  1DF4 A;  1G4Y B;  2W6I G;  3W7W A;  3E83 A;  1COW G;  4MTG A;  1AJP A;  3X2Q B;  2P7T C;  4RAI A;  3ASO C;  4I9W A;  3ETE A;  4PA9 A;  5LHI A;  4WFA V;  1YJW V;  1K7D A;  2P6J A;  4FIP C;  3DTU B;  4KP4 A;  3QO5 A;  3LSQ A;  2KB1 A;  3T1C A;  3SYQ A;  1F51 A;  2XAJ A;  4QJF B;  2GHY A;  4TWK A;  1W2B U;  3ZMT A;  1RPR A;  3OM3 B;  4E2L A;  2NNU A;  1AI5 A;  2EIL B;  2QTO A;  3OEE G;  3QNE A;  4X89 A;  1LNQ A;  4PA6 A;  2LP7 A;  1GM9 A;  4PDL A;  1E1Q G;  2OCC C;  1VQ8 V;  3R65 A;  1NJI W;  3T4Z A;  4H33 A;  1QR9 A;  3CXC U;  3SYP A;  1QR8 A;  4R50 A;  1VQO V;  1JX9 A;  2IJK A;  3JCZ A;  1OCC B;  2DYS C;  1VQ7 V;  3CD6 V;  4UVB A;  3CC7 V;  2XND G;  2IW5 A;  3ASN C;  4P2Z A;  1PD3 A;  3K03 A;  1W0J G;  2P67 A;  3OR7 C;  4DO2 A;  3RVZ A;  3RVY A;  1ORQ C;  3JD4 A;  1VQN V;  1S3J A;  1MOF A;  1AI6 A;  3AG3 B;  1K3E A;  2QM7 A;  3PJS K;  5IYB O;  3WG7 B;  3X2Q C;  3K3W A;  3D3I A;  5FL7 G;  1I5Y A;  4Q20 A;  2ATK C;  4JPR A;  1FXK A;  1ENV A;  1H2G A;  4Z1M G;  1AI4 A;  1R6K A;  4PDR A;  1CEZ A;  1TUE B;  1HWY A;  4QIW F;  4MTX A;  3ZCC A;  4LP8 A;  3IGA C;  4PA7 A;  3K0D A;  4GT1 A;  1K5S A;  2Y48 A;  3ABM B;  1S77 D;  2EIL C;  1FXV A;  2X6B A;  2Y69 B;  2V1D A;  2AHY A;  5C93 A;  3F5W C;  3FYE B;  5GW7 A;  3LSS A;  1XL4 A;  2JJ1 G;  3P30 A;  2DYR B;  2HFE C;  1OCR B;  1MSW D;  3OE7 G;  4UVA A;  5EBM C;  4H37 A;  1SRY A;  1OCC C;  3OMA B;  3ZRX A;  3LNM B;  5B3S B;  3ZRV A;  2JJ2 G;  1S72 V;  2ZR3 A;  2D3O W;  4BIZ A;  3B8N A;  1YTF B;  5B1B B;  3K04 A;  2JEU A;  1R3K C;  2R9R B;  3K08 A;  4JF3 A;  1THZ A;  3G6E V;  5CN0 A;  5EK0 A;  2A79 B;  1GMG A;  3OUF A;  2PI4 A;  2WLI B;  4HYO A;  3AG3 C;  1R73 A;  2GSM B;  4QE7 A;  3ABL B;  4BAY A;  2XAF A;  4R6Z A;  2B1I A;  5BZB A;  3WG7 C;  4J9Z B;  3LDD A;  5CA3 A;  3JD1 A;  4JAV A;  3OW2 U;  3SYC A;  2HG5 C;  1QBZ A;  1SES A;  2WLM A;  4JAU A;  4HAM A;  3EHB B;  1YJ9 V;  1KQS U;  2OT5 A;  3OEH G;  1QLE B;  3CCL V;  2EBO A;  1JQ0 A;  1M9N A;  4ZBM A;  3K79 A;  4OXS A;  3ABM C;  2EIN B;  3CME V;  3K9A A;  1E79 G;  1PKX A;  2ZR2 A;  1OCO B;  5CBH A;  2Y69 C;  4JTA B;  2LFS A;  4R7C A;  3SJQ C;  5LGU A;  2ITC C;  2UXN A;  2HLD G;  1EBO A;  1NKD A;  3I56 V;  2DQ0 A;  3B8M A;  1FXH A;  1R6N A;  3E8B A;  4GX2 A;  2EIM B;  4KUM A;  5E1A C;  4QNH B;  2EIJ B;  3WFV A;  3HPL C;  2DYR C;  1AJQ A;  3ZRW A;  1OCR C;  3FB8 C;  1YIT V;  2K1E A;  4U7N A;  1E1R G;  1OZ0 A;  1Q7Y W;  1BHA A;  3EFF K;  4P9P A;  3CCV V;  1P4R A;  3D36 A;  5CMU A;  5B3S C;  4JTD B;  4WFG A;  5L3G A;  1NVP D;  1EFR G;  4MVR A;  2WLK A;  5LHG A;  1YHQ V;  4WCE V;  5B1B C;  4MVM A;  3SYO A;  1AI7 A;  2IJJ A;  2R9I A;  3B77 A;  4WFE A;  3STZ C;  1AJN A;  2WSS G;  2ZDI C;  3JD3 A;  3UM7 A;  4YXW G;  1GK9 A;  3F7V C;  3K06 A;  1GO3 F;  1K8A W;  2C2A A;  2ZXW B;  5EC2 C;  5IY5 B;  3CMA V;  1PNM A;  3ABL C;  3ZN1 A;  1ZWI C;  4FJC C;  4FMT A;  3SPI A;  5EBW C;  4MVS A;  3ABK B;  3ZMV A;  3CC4 V;  1YJN V;  2UXX A;  1M1K W;  3T2M A;  4DXW A;  4BIU A;  1WLE A;  3CPW U;  2WLJ A;  3A0R A;  3VOU A;  1K97 A;  2ITD C;  4MVU A;  2YEV B;  1QLE C;  3SPC A;  2IH3 C;  2XOK G;  3ZMU A;  1Q81 W;  3CC2 V;  2X6A A;  5LBQ A;  2EIN C;  3TCU A;  3CP1 A;  2ZD9 A;  1OCO C;  4JYB A;  5KUK A;  2PI5 A;  4WF9 V;  4MW3 A;  4XDK A;  1NVP B;  4HZ3 A;  4RUE A;  2EIM C;  3E2E A;  2EIJ C;  3SYA A;  2WLH A;  1Y4M A;  3AEI A;  5KA5 A;  1VQL V;  1WPX A;  2H8P C;  2MK3 A;  4MSW C;  1F4N A;  1NQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...