1PD3A

Influenza a nep m1-binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).
pubmed doi rcsb
source organism Influenza a virus
molecule tags Unknown function
molecule keywords Nonstructural protein NS2
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pd3A00
1PD3A 1ROPA 4DO2A 1F4MA 2IJJA 2IJIA 3K79A 2IJKA 1NKDA 1F4NA 1GTOA 1RPOA 1RPRA 2GHYA 2IJHA 1B6QA 1GMGA
chains in the Genus database with same CATH superfamily
1V55B 2QM4A 4K35A 3I5DA 4F6RA 5JJNB 3L70H 1VMGA 1VQOV 4O2BA 3M8AA 1G1XB 3VQWA 4JI8B 2ITDC 2YEVB 2YI8A 1RFYA 2Y69C 1QHTA 3CCSV 4DUYB 4MSWC 3J80N 4RWUA 4WF9V 3EHBB 4MW3A 1OCRB 1YZBA 5JWPA 4R8CA 1NVPB 2RNBA 1VQ4V 4LF4O 2GBOA 2BTQB 4ZI7B 2WLHA 1CXZB 4PV1B 1SQGA 1CEZA 4Q20A 4PDRA 2IH1C 4LNUA 5ITZB 4FVMA 3K5MA 3JASB 4Z1VA 4X20A 4KL1A 3N27A 1B06A 1SESA 4NXMB 2ZM6O 2CTPA 2OCCB 3BPZA 1Q81W 1PPJH 5LMNO 3DTUB 1ZAUA 3K3WA 3OT7A 2B9ZA 5JH7B 4KHPO 3G80A 4DUZB 4U3FH 2WLLB 3AG2C 4O4IB 4YIOA 1F4MA 4JI0B 4DR5B 4PA4A 3J7AU 2VQEO 1Q6UA 4X88A 4PI2A 3LSUA 1HDJA 3UO3A 4LCUC 2FYUH 1MZEA 1QNMA 5KHKA 4R50A 2K1EA 1XL4A 4DUZO 3K5LA 3JATA 2B1GA 5BY1A 3OR7C 2CH7A 3SPGA 2XUMA 1M5IA 1I94O 1MG1A 2DE0X 4K3AA 2F23A 3JD2A 1Z2GA 2WLLA 1YI2V 1P7BA 4MVMA 3T4ZA 4JI2O 1H2NA 4O2AA 1WNSA 2EJ7A 4LF6B 2ZE7A 3I56V 5EBMC 3SR2C 3FB5C 1YJNV 2K9PA 4CBCA 5BMVA 1DLBA 5CA0B 1K4DC 5B5EZ 5L3CA 3ABTA 4CH3A 3CCQV 2LJ2A 1AJQA 3TGUH 4PA7A 2YC0A 4JYAO 4I4TB 3F7VC 1F7YA 5KUKA 3ZMUA 3QTCA 1FAFA 1EBOA 4ZIBA 4X66O 1WB8A 1PL0A 4D7TA 2BOBC 3PJSK 3JD4A 1Q6HA 3E8FA 2RCVA 2A9HA 4PDMA 3K59A 1HNZO 4X1YA 1XILA 4YXWG 1QVGU 1DGSA 2A79B 1NH2D 1COWG 1ZWIC 5KHHA 5EBLC 2WLIB 4J11A 4DV1B 2EIKB 3RVZA 1AROP 1GK9A 3AG3C 4OXSA 2HJFC 1H8EG 3GVMA 2Q73A 1N4CA 1K34A 3G67A 3HR0A 3M7MX 1I94B 4JI7O 4YIPA 4EKWA 1WAZA 1PNLA 2JK5C 5CMUA 3AG4B 2OCCC 5EBWC 4AQYB 1SETA 1NTKH 1K3EA 2CUGA 1EZVH 1KB9F 3LDEA 2UU9O 3BHPA 2WLIA 4TQFA 2ZIMA 1GH6A 1V9PA 3AG1B 1HNWB 1FXKA 5LL6Y 3AK3A 4MTFA 3KG2A 2CGOA 2P4VA 3AK2A 1D2DA 1JFFB 3T1HO 1PV0A 2YXYA 2YUAA 4AI8A 3CSXA 4DV2O 5CB4A 4U3JB 4TQDA 5J2TB 3MAQA 1KBHA 3E8GA 3GWOA 1BGYH 4P30A 1SF9A 2NN4A 4H44B 2GV9A 3GB7C 4O4JA 4DV3O 2XNDG 3D36A 2PUSA 1XUQA 2V1DA 3N2GA 3P30A 5FNVA 5LA6A 4X8AA 1N34B 4MVRA 3E22B 5B1NA 2RDCA 4QIWF 4X64O 1EZJA 1KU9A 3E22A 4DV6B 2CTQA 3ZHRA 5KMGB 2AHYA 2Z5UA 3E86A 4PD4F 4I0XB 5LGUA 1H2KA 2ARHA 1JR9A 3K58A 2ETNA 3LSQA 4MTGA 5JH7A 4UVBA 1RSOB 2XTAA 1BHAA 3RYCB 2HVJC 3ETGA 1JQ0A 4D7SA 2R9AA 2UXDO 2V4DA 1MOFA 1M57B 4NR1A 1JFFA 1Q5OA 1F51A 4E2LA 3RGBA 2Y4TA 3L73H 4GX1A 1XI1A 1FXKB 2OCHA 2HHHB 1OJHA 1G4YB 4UB8Z 2DQ0A 2A7WA 2W0XA 1AP6A 3OGCC 2Y4UA 4WFHA 4UUJC 4MW8A 2FL4A 3SGIA 4ASUG 3QO8A 1NI8A 2WPDG 1MMMA 1M9NA 2A06H 2YIDA 4CS4A 3ABMC 5KUMA 1P4RA 4LNUB 1GN4A 2JS5A 5IY5B 1M57C 4G28B 2H94A 4H0LB 4MVZA 3W7XA 4LF4B 1M1KW 4FLTA 4X1YB 4Z2WA 4MS2A 5KHGA 5H2FZ 1K5QA 1KC8W 4F4LA 1XREA 2DYSC 2IU0A 3CE2A 3OM3B 2PF4E 4XDJA 2VS0A 5HFMA 2QWNB 3A8TA 2KG7B 4D6TH 3ABMB 3Q4HA 2YIBA 5LGNA 4X1KB 5GW7A 4DR1B 1U96A 4MVOA 2NNUA 2WSSG 1YCIA 4YJ3B 3S3XA 4JZ2A 4J9ZB 3ZHQA 2F66C 4J9YB 1I08A 1YEWA 4CS2A 3LNNA 1K7DA 4B3SO 2HFEC 3OMIB 4DRXB 2Q5ZA 1SC5B 1YITV 2IJKA 4X9QA 3CPWU 2LFRA 2E75B 1UJWB 1RM1C 1JJ2U 3U10A 2EIMB 4TWKA 3A0BZ 3Q4HB 1FD9A 3T1YO 2FKXA 2X6AA 4DR2B 2ZNIA 1JJOA 4JYYA 3VQYA 5J2UB 4B3SB 1QLEC 2EX3A 2VRZA 4OPHA 4NXNB 3FAVA 1RPRA 1Q90D 1I5XA 2ZD9A 3QF7A 5IWAB 1VQ8V 1R6TA 2QDOA 2P6JA 4RQEA 1JX9A 1NBMG 2GUZB 2HLDG 3NR7A 1FPOA 1DF4A 1KYOF 3UQ8A 3WB0A 3RYIA 3ZHUA 2VQFO 4A5UB 3ZMVA 4KUMA 3K0DA 3JAWA 3ZRWB 3APQA 3AEIA 1XNQO 3B8MA 3LDCA 4XDKA 2LO1A 4IIJA 5JVDA 1B6QA 1SZTA 1XQ8A 2BCCH 4DV4O 2QKCA 2IH3C 3CC4V 2EZPA 5EYPB 3BVOA 2IBZH 3RWRD 2XAHA 2N74A 3FFQA 1WPBA 1HW7A 4JAAA 3MHHC 3RYFA 3IJ4A 3ZHTA 2UUAB 3E8BA 3QVNA 4WBNA 5IJ0A 2F93B 4UCUA 2G38A 2JIZG 1ZSPA 5KX5B 3H1LH 2BTOA 1G8MA 2M6YA 1AVMA 5LOVB 3A0RA 5CA1A 1AI6A 1QQCA 5LYJB 3CB2A 2ZDIC 1VP7A 2JJ1G 5FL7G 3L75H 2IJIA 4UCTA 5IWAO 1IBLB 4K8ZA 1B04A 1TUEB 3JAKA 1MSDA 2DWEC 1Y6XA 4JF3A 1PP9H 5BXZA 1ROPA 1Q8IA 2LP7A 3SPCA 1M56B 5C8YA 3K9SA 4BWAA 3AK1A 5JJJB 3CJHA 2VQFB 5LP6A 3FB7C 2FMLA 1TVKB 3WFVA 4FPPA 4B3TB 4WFFA 2LQTA 1M56C 3SYCA 5LP6B 3ABLC 4TT3G 4K8XA 3N2GB 3RYHA 5D5QA 4XBFA 3CCUV 1N36B 3P3PA 1J5EO 1RM1B 1Q43A 2B5UA 4F6EA 2AHZA 4GKKB 1QLNA 4TV8A 4IHJA 2OTJV 5C93A 5CB4B 3SJQC 1EN5A 2KB1A 2V7QG 2ADPA 4NB5A 3THOA 2WLKA 1N36O 2EIJB 1X4TA 4DUYO 5LMNB 4GKKO 1K8AW 4ZBMA 1D5NA 4NTXA 2EBOA 1JA8A 3D8CA 4U7OA 2JRIA 3ETEA 4GLXA 2ZXWB 2GHYA 2QKAA 3CYOA 3L74H 1I5YA 4AHCA 3KKYA 5BR8B 3OFNG 2QJ1A 3BRCA 1I7FA 3T1CA 5LOVA 5JVDB 3M99B 4EFBA 5CN0A 1WPXA 5IT9N 1GN2A 1XBLA 1S76D 3K5OA 4KFMA 4EFEA 4N21A 5L3DA 1TGOA 2QTSA 2Q8VA 2P22C 2JEUA 4EB6B 5KHIA 1L0NH 2O57A 3B40A 4UCOA 4LF8O 2Q9LA 1YHQV 4FZ0A 2P5OA 1NS1A 4ZHQA 2M7WA 5EC2C 4LP8A 1E1QG 4X89A 4UVAA 2UXNA 4J7JA 3DXRA 4DR5O 1S5HC 2YSUB 5BMVB 2E76B 5K1XA 4FFBA 4I55A 2PYLA 1FXKC 5L3FA 1NKDA 1WB7A 2P67A 3X2QC 2DJVA 4JI4O 1NTZH 2ZR3A 3C3SA 3CMEV 1RP3B 1IX9A 1VQPV 1XMOO 3R65A 3G6BA 4JI3B 4GT1A 5E1AC 4FLXA 4B7KA 2ZE8A 2WA4A 1ZUQA 3H1JH 3KCXA 2P90A 4X1IB 1SA0B 3QO5A 1YTFB 2EIMC 2QWOB 1T5EA 4QPJA 4X66B 1JMKC 1OCCC 3K9AA 2EIKC 2GTSA 5J2TA 2MW2B 4NTWA 2AZ2A 1HR0B 3U0ZA 5J9PC 1S72V 1HNWO 1H2LA 1SQFA 4JI5B 4FLYA 4K0KO 1S0VA 3T1HB 4H37A 1AR5A 4L8JA 2QWQB 1R3IC 1I0HA 1FYJA 1L0LH 4YJ2B 4LBEC 3UO2A 2X0LA 3RT3C 4HBNA 4PDVA 4ZI7A 4O4LA 4J41A 1SQPH 4I9QA 4K0KB 4GKJB 1AILA 2DYSB 4FM0A 2BSKA 2XAFA 4I9WA 4JZGA 5D5PA 5EIBC 4DV0O 1N34O 3FD9A 1D5AA 2HP8A 2Q7EA 5LXTA 4LWSA 4B3MB 3OD4A 4DV6O 1MSWD 3ABUA 1VEWA 2UUCB 4R7CA 1AB3A 3G4SV 3ETDA 1KQSU 3HKBB 4LF5O 3SJBC 1PKXA 2Q67A 4JASA 3ZRVA 2FTKA 2GDSA 3BFRA 5DECA 4MTXA 4DV2B 1RSOA 5ITZA 2W0FC 1BT8A 3ZJZA 4MT8A 1QBZA 4WFAV 2PTMA 4X64B 3AG4C 5CA0A 3UCSC 5IY5C 4DR7O 2BTQA 5DM6V 4UB6Z 4LH6A 2YI9A 2L35A 1AJPA 1QVFU 2JEXA 1N0NA 4IYIA 1XMQO 3JSLA 2ZINA 3OGIB 1SERA 1VF7A 4TV9B 4IGGA 4WFBV 5H6RA 3JD0A 1IBMO 1K92A 4QJFB 3OMAB 4UCVA 3K57A 1B3QA 3OTFA 2KSDA 4HYOA 1BZKA 3HPLC 4B3TO 2YEVA 3C90A 3O9OA 3SYPA 3EVKA 3SPHA 1R1BA 1V54B 1YJWV 3IGAC 4X65B 1WA8B 5DEDA 5GONA 5LP6C 2IM9A 4XDLA 1US6A 5IYBO 3A2FA 3JD1A 2BOCC 1TUBA 3IC9A 4JI1O 2E3CA 5C8YB 2VQEB 1VF6C 4P9OA 3BABA 5KAFZ 1IBKO 4JAUA 3OW2U 1GKFA 4UXNA 4CH6A 3HKEA 4LF9O 1GM7A 1H8HG 4TV9A 3I55V 4LR3A 4TSFG 2KQXA 3LNMB 3TK1A 4QGPA 1SS3A 2F95B 2OYQA 3BA9A 2A0LA 4ZOLA 2H3OA 1KP3A 4Q6GA 1GAXA 4U7NA 3JAKB 3FKSG 1NQTA 4PA3A 2Y69B 3VOUA 1DK1A 4DR4B 3B09A 3D36C 5H9CA 2XOKG 1L8DA 2HR3A 4TUYA 5CA1B 1GM8A 3UKMA 1WP7A 1KKCA 3L9DA 5KX5A 2QWRB 2OIEA 1GMGA 3J81N 4LFBO 2W6IG 1EFRG 5HFLA 3LDDA 1S5JA 3HKDB 1N33O 1CP9A 3ZRXA 3DC6A 4DV1O 1VARA 1U97A 5E79Z 1P84F 2E74B 4WFEA 5EIBD 1DTOA 4OGQB 4JYCA 4QPKA 1F4NA 3CCEV 3RFRA 2Q6AA 5L3GA 1LNQA 2UXBB 1OHHG 1WJZA 4JTAB 1IXBA 3VQVA 2GUZA 2PY5A 4DRXA 2EJRA 4I55B 3DSQA 4FLUA 3DC5A 2Q69A 5J2UA 4DV4B 1LUWA 1YVWA 4NTYA 3CCMV 4JI2B 4YHHB 1Y74B 2PYJA 1SA0A 1YTFD 3SPIA 3N2KA 3G71V 1V54C 4TOIA 1K4CC 2WLMA 3SJAC 3LSSA 4FM1A 1P49A 2BE3A 1P7GA 3UM7A 4MVQA 2QGNA 5LHHA 2JGUA 2EIJC 5IE9A 1A32A 3JASA 1NVPD 2UUAO 1FXHA 4DK1A 3CD6V 1Q6IA 1R6NA 3JYCA 4DV7B 1K9MW 1QCEA 5FLXN 3ABKB 1OCZB 1IXMA 1HNZB 1SQQH 2HKOA 2Q0OC 4I50A 4O4HB 1GO3F 1XHXA 4LFCO 1JOYA 1K5SA 4B3MO 2WAMA 4J10A 1N8RW 3CMAV 1IBLO 1F23A 3QG5A 3CC2V 3JCZA 1YXBA 4B3RO 2QA4V 4DV7O 3ICXA 4W4LA 1RPOA 1SZXA 4JV5O 3ZCCA 3W7TA 5LMUO 4CC5A 1S3JA 3MDSA 1MABG 4JI6O 2YDEA 3WG7C 5B66Z 1IVSA 4OPAA 1TAEA 4YHHO 3C3TA 1W0KG 1BS3A 4O2BB 2Y0IA 4QE7A 4B3RB 4RUEA 4F6RB 2VWKA 5BZBA 4QNHB 1S5LZ 2OTLV 4JV5B 2P06A 4P2ZA 3E2EA 3JAWB 3ZRWA 3ASOB 2CGNA 1AJNA 3ETQA 2ZDIA 4G2KA 1Q7YW 4JI6B 1X59A 4L87A 3TXSA 2PI5A 3CJHB 4C7UA 2LGQA 1AP5A 3F5WC 4DXWA 3CRQA 1VQ6V 2LGWA 5B1AC 2P4KA 1Y66A 3AG1C 3L72H 4LFCB 4BW9A 1OCOC 1NU1H 3JALB 4J7ZA 1KECA 2DQ3A 2Y0PA 3ZS8C 4AILC 2ZE5A 1BCCH 1NZ6A 1XL6A 3FX7A 3HKDA 4GUNA 4UVCA 4DR1O 2JS3A 1OCCB 2D2CB 2KKWA 3W7SA 4FLVA 4JYAB 5KLVH 4FM2A 3ZX6A 3STLC 2F4VO 1IBKB 1FFXA 2WLJA 2UXDB 4TUYB 1BE3H 4DR3O 2JJ2G 1BHBA 4NKGB 2AGAA 1QU7A 1SKVA 1MZFA 1ORQC 4DV5O 2DYRC 4DR2O 3K5NA 5JJEB 4DO2A 1YJ9V 4JI4B 5GTIZ 3ABLB 5L3BA 1UFIA 4FIPC 2HEPA 2QTOA 1J95A 2PZSA 5IJ0B 4UFZA 3ZMTA 3OE7G 3SDLA 4MVSA 3SPJA 3FAVB 3UT5B 2BSKB 3ZMZA 2Q68A 4RUFA 1H2SB 2XHBA 3IC7A 3KCYA 4LFAO 4G27B 4J7KA 5CBHA 1N32O 3SYAA 2N04A 4ICGA 4I4TA 1TUBB 2AXTZ 4BIUA 3HKCB 1HR0O 1VQMV 4LF6O 2IW5A 2YICA 2ZR2A 4DYLA 4WFGA 1O9HA 5B1AB 4GX0A 3RN4A 3IFXA 5LGTA 5IYZA 4YJ3A 1VF6A 1IZ3A 4YY3B 1R3JC 4CH4A 1Q82W 2ODMA 4B08A 5FPRA 4UCRA 2E5LO 4R6ZA 1K97A 2PGGA 1GRJA 2KG7A 3RYCA 2AW9A 1VQKV 1BMFG 3QO7A 4DR6B 3JATB 1VF5B 4UV9A 1E1RG 4X62B 3FYEB 5JQGA 3R66A 5GONB 4I0XA 5KMGA 3OEEG 1M93A 2ZQMA 4O2AB 1FJGO 3ABKC 4IT5A 4EEQA 1Y76B 3B4SA 4MVUA 4DV0B 4DW0A 4X62O 1KP2A 3ZHSA 4LF5B 2CH7B 5CBFA 4JI7B 1IBMB 1N32B 4FJCC 3ASNB 2IJHA 2UUCO 2ZT9B 1WLEA 1IDSA 2CK3G 2XASA 1R6KA 4RO2A 2UU9B 2W6JG 1FXVA 4WCEV 1XOUA 2JGDA 2QR4A 1XNRB 3BCCH 2R9RB 3T2MA 1XNQB 2UXXA 4YY3O 4LWSB 1W59A 4ZOLB 2ZNJA 1SQBH 3NXSA 2R9IA 2QEXV 2IU3A 1KUQA 5KHJA 4H33A 3CC7V 5KA5A 3MHSC 3GWKC 1PM9A 4X20B 1V55C 3RBZA 3TCUA 1LUVA 4I7ZB 2JVDA 1YSCA 1EM1A 4FLWA 3P3NA 1FJGB 1LR1A 2Y48A 1VIBA 3OMNB 3P32A 2ZE6A 3B8NA 3CRCA 2Q7HA 3BY6A 2YIAA 2XT9A 2XAGA 3JSNA 3S3WA 4O4LB 1NR1A 5LA6B 1AI4A 3N2KB 1BSMA 2Q4PA 5JQGB 1R73A 3CCLV 4YJ2A 1Y74A 1KKDA 5EZYA 4BIOA 4ABMA 3PN1A 2DYRB 4UCSA 2CTWA 2EILB 3E8HA 1W2BU 1EN4A 1FKAO 2AZ0A 4GZRB 1XNRO 1H2GA 4RQFA 1NR7A 3BA8A 2QM7A 3T4DA 3SYQA 3WU2Z 2ZM6B 3CHXA 2QWPB 2WLNA 1YIJV 3HB3B 4CC6A 4NYKA 2EILC 2LW1A 4LFBB 2X6BA 2B1IA 1TVKA 2YS8A 3B2EE 1M90W 1ZL8A 2X7RB 4FFBB 3ZEDA 2ZXWC 3ML0A 1AR4A 4HZ3A 2IJJA 4UV8A 1IURA 2EULA 5H5NA 2UXCB 1BQ0A 4J80A 4ZHQB 1ZX3A 2Z0AA 3ZN1A 1Y67A 2D3OW 5FPOA 4DW1A 4U3JA 3CWBH 1VQNV 4DR4O 4LH7A 4FMTA 4KHPB 3CXHF 4H13B 3CP1A 1QR9A 1BL8A 2UXCO 1NJIW 1HNXO 4MTOA 3AG7A 3FB6C 1WN7A 5LXTB 3B77A 2Q7GA 3ASOC 1AI5A 1DF5A 1NH2B 2UUBB 1GN6A 4KP4A 4PJ0Z 1N33B 2ZKOA 2GSMB 4PHZA 1PNKA 2DOSA 4IIJB 2XAJA 3H01A 1SQVH 2ZCEA 3OR6C 2CE4A 2RJZA 3UT5A 2F1MA 3U11A 1JPXA 3WB2A 3H1KH 3T1YB 3ASNC 4GCZA 2DMXA 4BR6A 3HKEB 1ZTEA 3JARB 1QLEB 5JCOA 3ZHVA 4JTDB 1CPYA 1R3LC 1THZA 3A0HZ 1W0JG 3CRRA 3RVYA 2YIBD 4I5SA 4TV8B 4P9PA 3ZRSA 1VQ9V 3WG7B 1J5EB 3OUSA 4O4IA 4X1IA 4W4KA 1M4UA 4AQYO 4B7EA 2E5LB 2DWDC 4LC1A 4PI0A 2R70A 1URFA 4GX5A 4Z1MG 5F2VO 5IYDO 2UUBO 1TA8A 1XEQA 4RAIA 1AI7A 1ZLZA 4KXRA 5K1PA 1VQ7V 1XMQB 4X1KA 2QKSA 4ZKIA 2RN9A 3LUTB 4JTCB 2HG5C 4HNAB 3RYHB 1VQLV 3QNEA 3TXQA 4OX9B 1Y4MA 3H1HH 1GN3A 3K79A 1QR8A 4GYCB 3E89A 5CA3A 1MA1A 4FLZA 1Q3EA 4JGSA 1O9GA 1BQZA 2RQ6A 3JCUZ 2WWWA 1G6UA 1GTOA 3BAAA 3CXCU 5B3SB 3D3QA 1Q86W 5H6QA 4I50B 4O4HA 5EYPA 1FFTB 4PA9A 5LYJA 4GKJO 5EC1C 1HP8A 2ATKC 3ZN0A 1H38A 5LMUB 1KD1W 2ITCC 3WB1A 5DN6G 2F43G 4DV3B 3HKBA 4JI1B 2Q0AA 3DXRB 5CBGA 2HHHO 3KZIZ 2H8PC 5B1BB 1YF2A 1XHZA 3JAMN 2OT5A 4WBNB 4CZZA 1VQ5V 3TJTA 1FFXB 1S77D 2EINC 5IJ9B 4CH5A 1Y76A 2CDYA 5LHGA 1KMIZ 4N23A 2JGDB 1OZ0A 1K73W 3O65A 2F4VB 4GX2A 1JCHA 3ZIAG 4NVPA 2LW7A 3CCJV 1R3KC 1OCOB 4JI0O 5L3EA 4DR7B 3CRMA 4CS3A 4OX9O 1SQXH 4DV5B 2QSAA 3JD3A 2DN9A 1EN6A 2MK3A 2XAQA 1XMOB 5B1OA 3RYIB 1K33A 2X6CA 2QE7G 3MD0A 3K03A 3OEHG 1N0JA 3AG2B 1Z5VA 2CAZC 2VWJA 4E4EA 2ADQB 3VBBA 5TISZ 3STZC 4J42A 2C2AA 4JPRA 3K0GA 3CRAA 3HKCA 2L6LA 5BR8O 3CCVV 1H2MA 4DR3B 4BAYA 3EXAA 3OAAG 2PI4A 1OV9A 1PD3A 5EK0A 1PNMA 3TETA 1UPGA 4IHJB 5A9GA 3X2QB 2GTAA 3D3IA 3F5TA 2CTRA 4X65O 4JI5O 3BEHA 5KA6A 4JAVA 5LHIA 5IYZB 2LFSA 2QM8A 3K04A 3SYOA 3CEIA 4LF8B 3JARA 1XDCA 3FYIB 1OCRC 4PELA 5JCOC 2UXBO 2R72A 1AR1B 1SRYA 2HJDA 5B3SC 4NXNO 1L1FA 5GTHZ 3RYFB 3G6EV 3IAYA 5IDJA 1OCZC 4LF9B 2YXHA 4FK5C 2ZIOA 4LFAB 2P7TC 3OUFA 3ZMSA 3ZBHA 3SJCC 3VQXA 4DR6O 4IYHA 5A2QN 4BIZA 1MNGA 4FFKA 2Z3YA 3L71H 1HNXB 4EB6A 1ENVA 3OTOB 4BW5A 2EZOA 4JI3O 3H1IH 3CCRV 3F7YC 2NR5A 5AG2A 3APOA 2OWOA 1PL4A 3W7WA 5B1BC 2DW4A 3CS5A 1HWYA 4IL6Z 4QE9A 4LF7B 1WP8A 3FB8C 3E83A 4JYBA 2A3QA 1WA8A 1YDXA 3W7UA 1GM9A 1ZL8B 3K08A 1E79G 5KAIZ 5IYCO 3RW0A 2YXLA 3CX5F 4PA6A 5LBQA 2EINB 3JALA 4PDLA 4LF7O 5FNVB 3AG3B 1NT2B 4HNAA 3DGEA 4O4JB 2ILMA 3EFFK 2JDIG 2RMKB 2WA3A 2NLJC 4FZ1A 1Z5WA 4HAMA 3E35A 2N05A 3OTOO 3H9VA 2HVKC 4JI8O 3K06A 1NTMH 2OIGA 5EZYB 4NXMO 1FS0G 4DK0A 1JVMA 2FB5A 5IJ9A
chains in the Genus database with same CATH topology
2DYRB 1V55B 2EILB 2W6IG 3E8HA 1W2BU 1EFRG 5HFLA 3LDDA 2IH3C 1H2GA 4RQFA 3CC4V 2EZPA 1NR7A 2QM7A 3T4DA 2XAHA 1VQOV 3SYQA 1CP9A 3ZRXA 2ITDC 2YEVB 3MHHC 2WLNA 1YIJV 3HB3B 2Y69C 3E8BA 3CCSV 4MSWC 2EILC 2JIZG 4WFEA 2X6BA 1DTOA 2B1IA 4JYCA 4QPKA 1F4NA 1M90W 4WF9V 3CCEV 1G8MA 3A0RA 3EHBB 1AI6A 2X7RB 2ZXWC 3ML0A 4MW3A 2Q6AA 5L3GA 1LNQA 2ZDIC 4HZ3A 1OHHG 1OCRB 2IJJA 2JJ1G 4UV8A 5FL7G 2IJIA 4JTAB 4R8CA 1NVPB 1TUEB 1VQ4V 2DWEC 2EJRA 3ZN1A 2WLHA 4JF3A 2D3OW 1ROPA 1CEZA 2LP7A 3SPCA 1M56B 1VQNV 4Q20A 4PDRA 2IH1C 4FMTA 2Q69A 3FB7C 3WFVA 3CP1A 4FPPA 4WFFA 1QR9A 1BL8A 1M56C 3SYCA 3CCMV 1NJIW 3ABLC 4TT3G 4MTOA 3FB6C 1SESA 1YTFD 3SPIA 4XBFA 3CCUV 2OCCB 3G71V 1V54C 3B77A 1K4CC 1Q81W 1RM1B 2WLMA 2B5UA 3DTUB 2AHZA 3ASOC 1QLNA 1AI5A 3K3WA 3LSSA 1DF5A 1NH2B 4KP4A 2OTJV 5C93A 2GSMB 2WLLB 3SJQC 3UM7A 2KB1A 3AG2C 1PNKA 4MVQA 2V7QG 1F4MA 5LHHA 4PA4A 2EIJC 2XAJA 3H01A 1NVPD 4X88A 3OR6C 2WLKA 1FXHA 2EIJB 3CD6V 1R6NA 3JYCA 1K8AW 4ZBMA 1K9MW 1QCEA 2EBOA 3ABKB 4LCUC 1OCZB 1IXMA 4R50A 2K1EA 2HKOA 1JPXA 4U7OA 1XL4A 1GO3F 3ASNC 4GCZA 2B1GA 3OR7C 3ETEA 3SPGA 2ZXWB 1JOYA 2GHYA 1K5SA 3CYOA 1MG1A 2WAMA 1I5YA 1N8RW 3CMAV 1QLEB 3JD2A 1F23A 4JTDB 1CPYA 2WLLA 1R3LC 3CC2V 1THZA 1W0JG 3JCZA 3OFNG 1YI2V 1P7BA 3RVYA 2QA4V 4MVMA 3T4ZA 3T1CA 4I5SA 1RPOA 4P9PA 3ZRSA 3ZCCA 3M99B 1VQ9V 3I56V 5CN0A 3W7TA 5EBMC 1WPXA 1S3JA 3WG7B 3FB5C 1YJNV 3OUSA 4CBCA 1MABG 1S76D 1DLBA 3WG7C 1K4DC 4KFMA 5L3CA 3ABTA 4N21A 5L3DA 3CCQV 1AJQA 1W0KG 4PA7A 2DWDC 4QE7A 4RUEA 2JEUA 4LC1A 5BZBA 3F7VC 4QNHB 4GX5A 2OTLV 4Z1MG 4P2ZA 5KUKA 3ZMUA 3ZRWA 5IYDO 3E2EA 3ASOB 1YHQV 1AJNA 1EBOA 2ZDIA 4G2KA 4RAIA 1PL0A 1AI7A 1Q7YW 2M7WA 5EC2C 2BOBC 4LP8A 3PJSK 1E1QG 3JD4A 4L87A 4X89A 4UVAA 3E8FA 2PI5A 1VQ7V 2UXNA 2A9HA 4PDMA 4YXWG 2QKSA 4ZKIA 3LUTB 4JTCB 1QVGU 2A79B 2HG5C 1NH2D 1COWG 1S5HC 1ZWIC 2YSUB 1VQLV 5EBLC 2WLIB 3QNEA 3F5WC 2EIKB 4DXWA 1Y4MA 1FXKC 3RVZA 5L3FA 1AROP 1VQ6V 3K79A 1NKDA 1GK9A 3AG3C 4OXSA 2HJFC 1QR8A 3E89A 2P67A 5B1AC 3X2QC 1Y66A 5CA3A 1H8EG 3AG1C 2ZR3A 4JGSA 1K34A 1OCOC 3CMEV 1KECA 2DQ3A 2WWWA 4EKWA 1GTOA 1PNLA 2JK5C 3CXCU 5B3SB 5CMUA 1VQPV 1Q86W 5H6QA 3AG4B 2OCCC 1XL6A 3R65A 5EBWC 4GT1A 1SETA 5E1AC 1FFTB 4PA9A 1K3EA 4UVCA 5EC1C 3LDEA 2ATKC 1OCCB 2WLIA 3ZN0A 1H38A 3W7SA 1KD1W 2P90A 2ITCC 3AG1B 5DN6G 2F43G 3QO5A 1YTFB 1FXKA 2EIMC 5CBGA 4MTFA 3KG2A 2H8PC 5B1BB 4QPJA 3STLC 1OCCC 3K9AA 2OT5A 4CZZA 2EIKC 2WLJA 1VQ5V 2JJ2G 3E8GA 1BHBA 1S77D 3GWOA 2EINC 4P30A 1ORQC 5LHGA 4N23A 5J9PC 2DYRC 3GB7C 1S72V 2XNDG 1OZ0A 3D36A 2V1DA 3P30A 4DO2A 1K73W 1S0VA 4H37A 4GX2A 1JCHA 3ZIAG 4X8AA 1YJ9V 3CCJV 3ABLB 1R3IC 4MVRA 5B1NA 5L3BA 1R3KC 4QIWF 1OCOB 5L3EA 1EZJA 4LBEC 2X0LA 2AHYA 2Z5UA 4FIPC 2QTOA 3E86A 3JD3A 2MK3A 1J95A 2XAQA 4PDVA 5B1OA 5LGUA 1K33A 2X6CA 3ZMTA 2QE7G 3OE7G 3LSQA 4MTGA 3MD0A 4MVSA 3K03A 3SPJA 2DYSB 2XAFA 4I9WA 3ZMZA 3OEHG 4UVBA 1BHAA 3AG2B 2HVJC 2Q68A 4RUFA 3ETGA 3VBBA 3STZC 1JQ0A 2C2AA 3IC7A 4JPRA 4G27B 5CBHA 1MSWD 3SYAA 3ABUA 3K0GA 1MOFA 4R7CA 1M57B 3CCVV 1F51A 4BIUA 4BAYA 3G4SV 4E2LA 3ETDA 3OAAG 2PI4A 1KQSU 4GX1A 1FXKB 1VQMV 1PD3A 2IW5A 5EK0A 2ZR2A 1PKXA 2Q67A 4JASA 1G4YB 1PNMA 3ZRVA 3TETA 2FTKA 2DQ0A 4WFGA 5B1AB 3D3IA 4GX0A 3X2QB 3IFXA 5LGTA 3BEHA 4MTXA 5KA6A 1R3JC 1Q82W 3OGCC 4JAVA 5LHIA 2W0FC 4WFHA 4UUJC 4MW8A 3ZJZA 4MT8A 2LFSA 2QM8A 1QBZA 4WFAV 3K04A 4R6ZA 4ASUG 3SYOA 1K97A 3QO8A 3AG4C 5IY5C 2WPDG 1M9NA 5DM6V 1VQKV 1BMFG 3FYIB 3ABMC 1OCRC 1AJPA 3QO7A 1QVFU 4PELA 5KUMA 1P4RA 2JEXA 1E1RG 4UV9A 1AR1B 3FYEB 1SRYA 5IY5B 1M57C 4G28B 5B3SC 2H94A 1SERA 4WFBV 4MVZA 5H6RA 3JD0A 1L1FA 1K92A 3OEEG 3W7XA 3G6EV 1M1KW 2ZQMA 5IDJA 1OCZC 4MS2A 3ABKC 4FK5C 2P7TC 3OUFA 4QJFB 3OMAB 3ZMSA 1K5QA 1KC8W 4F4LA 2DYSC 2IU0A 4HYOA 4MVUA 3OM3B 3HPLC 2YEVA 1KP2A 4BIZA 2Z3YA 3SYPA 3SPHA 1V54B 5CBFA 1YJWV 1ENVA 4XDJA 5HFMA 4FJCC 3ASNB 4BW5A 2IJHA 3IGAC 3ABMB 2EZOA 1WLEA 2CK3G 2XASA 5LGNA 1R6KA 4RO2A 4XDLA 3CCRV 5GW7A 3F7YC 5IYBO 4MVOA 2W6JG 1FXVA 2NNUA 4WCEV 3JD1A 2WSSG 2BOCC 4J9ZB 2R9RB 3T2MA 4J9YB 2UXXA 3W7WA 1K7DA 5B1BC 2DW4A 4P9OA 2HFEC 3OMIB 3NXSA 2R9IA 1HWYA 4JAUA 2QEXV 2IU3A 4QE9A 3OW2U 1YITV 2IJKA 3FB8C 3CPWU 1GKFA 3E83A 4UXNA 4JYBA 2LFRA 4H33A 1UJWB 3CC7V 5KA5A 1RM1C 1JJ2U 2EIMB 3MHSC 4TWKA 1GM7A 2X6AA 1H8HG 3W7UA 1GM9A 1V55C 3K08A 3RBZA 3I55V 1E79G 3TCUA 5IYCO 3RW0A 1QLEC 4PA6A 5LBQA 1YSCA 1RPRA 2EINB 4TSFG 4PDLA 3LNMB 3TK1A 1I5XA 2ZD9A 3AG3B 1VQ8V 2Y48A 2A0LA 1GMGA 1KP3A 2P6JA 4RQEA 1JX9A 4U7NA 3OMNB 3DGEA 1NBMG 3FKSG 3P32A 1NQTA 4PA3A 3EFFK 2HLDG 3B8NA 2JDIG 2Y69B 3BY6A 2NLJC 3VOUA 2XAGA 1DF4A 1NR1A 1AI4A 5H9CA 2XOKG 4HAMA 3ZMVA 2HR3A 4KUMA 3E35A 3K0DA 3ZRWB 1R73A 1GM8A 2HVKC 3UKMA 3CCLV 3AEIA 3B8MA 3LDCA 4XDKA 3K06A 1KKDA 1FS0G 1JVMA 1B6QA 1SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1ROP A;  4DO2 A;  1F4M A;  2IJJ A;  2IJI A;  3K79 A;  2IJK A;  1NKD A;  1F4N A;  1GTO A;  1RPO A;  1RPR A;  2GHY A;  2IJH A;  1B6Q A;  1GMG A; 
#chains in the Genus database with same CATH topology
 1V55 B;  2QM4 A;  4K35 A;  3I5D A;  4F6R A;  5JJN B;  3L70 H;  1VMG A;  1VQO V;  4O2B A;  3M8A A;  1G1X B;  3VQW A;  4JI8 B;  2ITD C;  2YEV B;  2YI8 A;  1RFY A;  2Y69 C;  1QHT A;  3CCS V;  4DUY B;  4MSW C;  3J80 N;  4RWU A;  4WF9 V;  3EHB B;  4MW3 A;  1OCR B;  1YZB A;  5JWP A;  4R8C A;  1NVP B;  2RNB A;  1VQ4 V;  4LF4 O;  2GBO A;  2BTQ B;  4ZI7 B;  2WLH A;  1CXZ B;  4PV1 B;  1SQG A;  1CEZ A;  4Q20 A;  4PDR A;  2IH1 C;  4LNU A;  5ITZ B;  4FVM A;  3K5M A;  3JAS B;  4Z1V A;  4X20 A;  4KL1 A;  3N27 A;  1B06 A;  1SES A;  4NXM B;  2ZM6 O;  2CTP A;  2OCC B;  3BPZ A;  1Q81 W;  1PPJ H;  5LMN O;  3DTU B;  1ZAU A;  3K3W A;  3OT7 A;  2B9Z A;  5JH7 B;  4KHP O;  3G80 A;  4DUZ B;  4U3F H;  2WLL B;  3AG2 C;  4O4I B;  4YIO A;  1F4M A;  4JI0 B;  4DR5 B;  4PA4 A;  3J7A U;  2VQE O;  1Q6U A;  4X88 A;  4PI2 A;  3LSU A;  1HDJ A;  3UO3 A;  4LCU C;  2FYU H;  1MZE A;  1QNM A;  5KHK A;  4R50 A;  2K1E A;  1XL4 A;  4DUZ O;  3K5L A;  3JAT A;  2B1G A;  5BY1 A;  3OR7 C;  2CH7 A;  3SPG A;  2XUM A;  1M5I A;  1I94 O;  1MG1 A;  2DE0 X;  4K3A A;  2F23 A;  3JD2 A;  1Z2G A;  2WLL A;  1YI2 V;  1P7B A;  4MVM A;  3T4Z A;  4JI2 O;  1H2N A;  4O2A A;  1WNS A;  2EJ7 A;  4LF6 B;  2ZE7 A;  3I56 V;  5EBM C;  3SR2 C;  3FB5 C;  1YJN V;  2K9P A;  4CBC A;  5BMV A;  1DLB A;  5CA0 B;  1K4D C;  5B5E Z;  5L3C A;  3ABT A;  4CH3 A;  3CCQ V;  2LJ2 A;  1AJQ A;  3TGU H;  4PA7 A;  2YC0 A;  4JYA O;  4I4T B;  3F7V C;  1F7Y A;  5KUK A;  3ZMU A;  3QTC A;  1FAF A;  1EBO A;  4ZIB A;  4X66 O;  1WB8 A;  1PL0 A;  4D7T A;  2BOB C;  3PJS K;  3JD4 A;  1Q6H A;  3E8F A;  2RCV A;  2A9H A;  4PDM A;  3K59 A;  1HNZ O;  4X1Y A;  1XIL A;  4YXW G;  1QVG U;  1DGS A;  2A79 B;  1NH2 D;  1COW G;  1ZWI C;  5KHH A;  5EBL C;  2WLI B;  4J11 A;  4DV1 B;  2EIK B;  3RVZ A;  1ARO P;  1GK9 A;  3AG3 C;  4OXS A;  2HJF C;  1H8E G;  3GVM A;  2Q73 A;  1N4C A;  1K34 A;  3G67 A;  3HR0 A;  3M7M X;  1I94 B;  4JI7 O;  4YIP A;  4EKW A;  1WAZ A;  1PNL A;  2JK5 C;  5CMU A;  3AG4 B;  2OCC C;  5EBW C;  4AQY B;  1SET A;  1NTK H;  1K3E A;  2CUG A;  1EZV H;  1KB9 F;  3LDE A;  2UU9 O;  3BHP A;  2WLI A;  4TQF A;  2ZIM A;  1GH6 A;  1V9P A;  3AG1 B;  1HNW B;  1FXK A;  5LL6 Y;  3AK3 A;  4MTF A;  3KG2 A;  2CGO A;  2P4V A;  3AK2 A;  1D2D A;  1JFF B;  3T1H O;  1PV0 A;  2YXY A;  2YUA A;  4AI8 A;  3CSX A;  4DV2 O;  5CB4 A;  4U3J B;  4TQD A;  5J2T B;  3MAQ A;  1KBH A;  3E8G A;  3GWO A;  1BGY H;  4P30 A;  1SF9 A;  2NN4 A;  4H44 B;  2GV9 A;  3GB7 C;  4O4J A;  4DV3 O;  2XND G;  3D36 A;  2PUS A;  1XUQ A;  2V1D A;  3N2G A;  3P30 A;  5FNV A;  5LA6 A;  4X8A A;  1N34 B;  4MVR A;  3E22 B;  5B1N A;  2RDC A;  4QIW F;  4X64 O;  1EZJ A;  1KU9 A;  3E22 A;  4DV6 B;  2CTQ A;  3ZHR A;  5KMG B;  2AHY A;  2Z5U A;  3E86 A;  4PD4 F;  4I0X B;  5LGU A;  1H2K A;  2ARH A;  1JR9 A;  3K58 A;  2ETN A;  3LSQ A;  4MTG A;  5JH7 A;  4UVB A;  1RSO B;  2XTA A;  1BHA A;  3RYC B;  2HVJ C;  3ETG A;  1JQ0 A;  4D7S A;  2R9A A;  2UXD O;  2V4D A;  1MOF A;  1M57 B;  4NR1 A;  1JFF A;  1Q5O A;  1F51 A;  4E2L A;  3RGB A;  2Y4T A;  3L73 H;  4GX1 A;  1XI1 A;  1FXK B;  2OCH A;  2HHH B;  1OJH A;  1G4Y B;  4UB8 Z;  2DQ0 A;  2A7W A;  2W0X A;  1AP6 A;  3OGC C;  2Y4U A;  4WFH A;  4UUJ C;  4MW8 A;  2FL4 A;  3SGI A;  4ASU G;  3QO8 A;  1NI8 A;  2WPD G;  1MMM A;  1M9N A;  2A06 H;  2YID A;  4CS4 A;  3ABM C;  5KUM A;  1P4R A;  4LNU B;  1GN4 A;  2JS5 A;  5IY5 B;  1M57 C;  4G28 B;  2H94 A;  4H0L B;  4MVZ A;  3W7X A;  4LF4 B;  1M1K W;  4FLT A;  4X1Y B;  4Z2W A;  4MS2 A;  5KHG A;  5H2F Z;  1K5Q A;  1KC8 W;  4F4L A;  1XRE A;  2DYS C;  2IU0 A;  3CE2 A;  3OM3 B;  2PF4 E;  4XDJ A;  2VS0 A;  5HFM A;  2QWN B;  3A8T A;  2KG7 B;  4D6T H;  3ABM B;  3Q4H A;  2YIB A;  5LGN A;  4X1K B;  5GW7 A;  4DR1 B;  1U96 A;  4MVO A;  2NNU A;  2WSS G;  1YCI A;  4YJ3 B;  3S3X A;  4JZ2 A;  4J9Z B;  3ZHQ A;  2F66 C;  4J9Y B;  1I08 A;  1YEW A;  4CS2 A;  3LNN A;  1K7D A;  4B3S O;  2HFE C;  3OMI B;  4DRX B;  2Q5Z A;  1SC5 B;  1YIT V;  2IJK A;  4X9Q A;  3CPW U;  2LFR A;  2E75 B;  1UJW B;  1RM1 C;  1JJ2 U;  3U10 A;  2EIM B;  4TWK A;  3A0B Z;  3Q4H B;  1FD9 A;  3T1Y O;  2FKX A;  2X6A A;  4DR2 B;  2ZNI A;  1JJO A;  4JYY A;  3VQY A;  5J2U B;  4B3S B;  1QLE C;  2EX3 A;  2VRZ A;  4OPH A;  4NXN B;  3FAV A;  1RPR A;  1Q90 D;  1I5X A;  2ZD9 A;  3QF7 A;  5IWA B;  1VQ8 V;  1R6T A;  2QDO A;  2P6J A;  4RQE A;  1JX9 A;  1NBM G;  2GUZ B;  2HLD G;  3NR7 A;  1FPO A;  1DF4 A;  1KYO F;  3UQ8 A;  3WB0 A;  3RYI A;  3ZHU A;  2VQF O;  4A5U B;  3ZMV A;  4KUM A;  3K0D A;  3JAW A;  3ZRW B;  3APQ A;  3AEI A;  1XNQ O;  3B8M A;  3LDC A;  4XDK A;  2LO1 A;  4IIJ A;  5JVD A;  1B6Q A;  1SZT A;  1XQ8 A;  2BCC H;  4DV4 O;  2QKC A;  2IH3 C;  3CC4 V;  2EZP A;  5EYP B;  3BVO A;  2IBZ H;  3RWR D;  2XAH A;  2N74 A;  3FFQ A;  1WPB A;  1HW7 A;  4JAA A;  3MHH C;  3RYF A;  3IJ4 A;  3ZHT A;  2UUA B;  3E8B A;  3QVN A;  4WBN A;  5IJ0 A;  2F93 B;  4UCU A;  2G38 A;  2JIZ G;  1ZSP A;  5KX5 B;  3H1L H;  2BTO A;  1G8M A;  2M6Y A;  1AVM A;  5LOV B;  3A0R A;  5CA1 A;  1AI6 A;  1QQC A;  5LYJ B;  3CB2 A;  2ZDI C;  1VP7 A;  2JJ1 G;  5FL7 G;  3L75 H;  2IJI A;  4UCT A;  5IWA O;  1IBL B;  4K8Z A;  1B04 A;  1TUE B;  3JAK A;  1MSD A;  2DWE C;  1Y6X A;  4JF3 A;  1PP9 H;  5BXZ A;  1ROP A;  1Q8I A;  2LP7 A;  3SPC A;  1M56 B;  5C8Y A;  3K9S A;  4BWA A;  3AK1 A;  5JJJ B;  3CJH A;  2VQF B;  5LP6 A;  3FB7 C;  2FML A;  1TVK B;  3WFV A;  4FPP A;  4B3T B;  4WFF A;  2LQT A;  1M56 C;  3SYC A;  5LP6 B;  3ABL C;  4TT3 G;  4K8X A;  3N2G B;  3RYH A;  5D5Q A;  4XBF A;  3CCU V;  1N36 B;  3P3P A;  1J5E O;  1RM1 B;  1Q43 A;  2B5U A;  4F6E A;  2AHZ A;  4GKK B;  1QLN A;  4TV8 A;  4IHJ A;  2OTJ V;  5C93 A;  5CB4 B;  3SJQ C;  1EN5 A;  2KB1 A;  2V7Q G;  2ADP A;  4NB5 A;  3THO A;  2WLK A;  1N36 O;  2EIJ B;  1X4T A;  4DUY O;  5LMN B;  4GKK O;  1K8A W;  4ZBM A;  1D5N A;  4NTX A;  2EBO A;  1JA8 A;  3D8C A;  4U7O A;  2JRI A;  3ETE A;  4GLX A;  2ZXW B;  2GHY A;  2QKA A;  3CYO A;  3L74 H;  1I5Y A;  4AHC A;  3KKY A;  5BR8 B;  3OFN G;  2QJ1 A;  3BRC A;  1I7F A;  3T1C A;  5LOV A;  5JVD B;  3M99 B;  4EFB A;  5CN0 A;  1WPX A;  5IT9 N;  1GN2 A;  1XBL A;  1S76 D;  3K5O A;  4KFM A;  4EFE A;  4N21 A;  5L3D A;  1TGO A;  2QTS A;  2Q8V A;  2P22 C;  2JEU A;  4EB6 B;  5KHI A;  1L0N H;  2O57 A;  3B40 A;  4UCO A;  4LF8 O;  2Q9L A;  1YHQ V;  4FZ0 A;  2P5O A;  1NS1 A;  4ZHQ A;  2M7W A;  5EC2 C;  4LP8 A;  1E1Q G;  4X89 A;  4UVA A;  2UXN A;  4J7J A;  3DXR A;  4DR5 O;  1S5H C;  2YSU B;  5BMV B;  2E76 B;  5K1X A;  4FFB A;  4I55 A;  2PYL A;  1FXK C;  5L3F A;  1NKD A;  1WB7 A;  2P67 A;  3X2Q C;  2DJV A;  4JI4 O;  1NTZ H;  2ZR3 A;  3C3S A;  3CME V;  1RP3 B;  1IX9 A;  1VQP V;  1XMO O;  3R65 A;  3G6B A;  4JI3 B;  4GT1 A;  5E1A C;  4FLX A;  4B7K A;  2ZE8 A;  2WA4 A;  1ZUQ A;  3H1J H;  3KCX A;  2P90 A;  4X1I B;  1SA0 B;  3QO5 A;  1YTF B;  2EIM C;  2QWO B;  1T5E A;  4QPJ A;  4X66 B;  1JMK C;  1OCC C;  3K9A A;  2EIK C;  2GTS A;  5J2T A;  2MW2 B;  4NTW A;  2AZ2 A;  1HR0 B;  3U0Z A;  5J9P C;  1S72 V;  1HNW O;  1H2L A;  1SQF A;  4JI5 B;  4FLY A;  4K0K O;  1S0V A;  3T1H B;  4H37 A;  1AR5 A;  4L8J A;  2QWQ B;  1R3I C;  1I0H A;  1FYJ A;  1L0L H;  4YJ2 B;  4LBE C;  3UO2 A;  2X0L A;  3RT3 C;  4HBN A;  4PDV A;  4ZI7 A;  4O4L A;  4J41 A;  1SQP H;  4I9Q A;  4K0K B;  4GKJ B;  1AIL A;  2DYS B;  4FM0 A;  2BSK A;  2XAF A;  4I9W A;  4JZG A;  5D5P A;  5EIB C;  4DV0 O;  1N34 O;  3FD9 A;  1D5A A;  2HP8 A;  2Q7E A;  5LXT A;  4LWS A;  4B3M B;  3OD4 A;  4DV6 O;  1MSW D;  3ABU A;  1VEW A;  2UUC B;  4R7C A;  1AB3 A;  3G4S V;  3ETD A;  1KQS U;  3HKB B;  4LF5 O;  3SJB C;  1PKX A;  2Q67 A;  4JAS A;  3ZRV A;  2FTK A;  2GDS A;  3BFR A;  5DEC A;  4MTX A;  4DV2 B;  1RSO A;  5ITZ A;  2W0F C;  1BT8 A;  3ZJZ A;  4MT8 A;  1QBZ A;  4WFA V;  2PTM A;  4X64 B;  3AG4 C;  5CA0 A;  3UCS C;  5IY5 C;  4DR7 O;  2BTQ A;  5DM6 V;  4UB6 Z;  4LH6 A;  2YI9 A;  2L35 A;  1AJP A;  1QVF U;  2JEX A;  1N0N A;  4IYI A;  1XMQ O;  3JSL A;  2ZIN A;  3OGI B;  1SER A;  1VF7 A;  4TV9 B;  4IGG A;  4WFB V;  5H6R A;  3JD0 A;  1IBM O;  1K92 A;  4QJF B;  3OMA B;  4UCV A;  3K57 A;  1B3Q A;  3OTF A;  2KSD A;  4HYO A;  1BZK A;  3HPL C;  4B3T O;  2YEV A;  3C90 A;  3O9O A;  3SYP A;  3EVK A;  3SPH A;  1R1B A;  1V54 B;  1YJW V;  3IGA C;  4X65 B;  1WA8 B;  5DED A;  5GON A;  5LP6 C;  2IM9 A;  4XDL A;  1US6 A;  5IYB O;  3A2F A;  3JD1 A;  2BOC C;  1TUB A;  3IC9 A;  4JI1 O;  2E3C A;  5C8Y B;  2VQE B;  1VF6 C;  4P9O A;  3BAB A;  5KAF Z;  1IBK O;  4JAU A;  3OW2 U;  1GKF A;  4UXN A;  4CH6 A;  3HKE A;  4LF9 O;  1GM7 A;  1H8H G;  4TV9 A;  3I55 V;  4LR3 A;  4TSF G;  2KQX A;  3LNM B;  3TK1 A;  4QGP A;  1SS3 A;  2F95 B;  2OYQ A;  3BA9 A;  2A0L A;  4ZOL A;  2H3O A;  1KP3 A;  4Q6G A;  1GAX A;  4U7N A;  3JAK B;  3FKS G;  1NQT A;  4PA3 A;  2Y69 B;  3VOU A;  1DK1 A;  4DR4 B;  3B09 A;  3D36 C;  5H9C A;  2XOK G;  1L8D A;  2HR3 A;  4TUY A;  5CA1 B;  1GM8 A;  3UKM A;  1WP7 A;  1KKC A;  3L9D A;  5KX5 A;  2QWR B;  2OIE A;  1GMG A;  3J81 N;  4LFB O;  2W6I G;  1EFR G;  5HFL A;  3LDD A;  1S5J A;  3HKD B;  1N33 O;  1CP9 A;  3ZRX A;  3DC6 A;  4DV1 O;  1VAR A;  1U97 A;  5E79 Z;  1P84 F;  2E74 B;  4WFE A;  5EIB D;  1DTO A;  4OGQ B;  4JYC A;  4QPK A;  1F4N A;  3CCE V;  3RFR A;  2Q6A A;  5L3G A;  1LNQ A;  2UXB B;  1OHH G;  1WJZ A;  4JTA B;  1IXB A;  3VQV A;  2GUZ A;  2PY5 A;  4DRX A;  2EJR A;  4I55 B;  3DSQ A;  4FLU A;  3DC5 A;  2Q69 A;  5J2U A;  4DV4 B;  1LUW A;  1YVW A;  4NTY A;  3CCM V;  4JI2 B;  4YHH B;  1Y74 B;  2PYJ A;  1SA0 A;  1YTF D;  3SPI A;  3N2K A;  3G71 V;  1V54 C;  4TOI A;  1K4C C;  2WLM A;  3SJA C;  3LSS A;  4FM1 A;  1P49 A;  2BE3 A;  1P7G A;  3UM7 A;  4MVQ A;  2QGN A;  5LHH A;  2JGU A;  2EIJ C;  5IE9 A;  1A32 A;  3JAS A;  1NVP D;  2UUA O;  1FXH A;  4DK1 A;  3CD6 V;  1Q6I A;  1R6N A;  3JYC A;  4DV7 B;  1K9M W;  1QCE A;  5FLX N;  3ABK B;  1OCZ B;  1IXM A;  1HNZ B;  1SQQ H;  2HKO A;  2Q0O C;  4I50 A;  4O4H B;  1GO3 F;  1XHX A;  4LFC O;  1JOY A;  1K5S A;  4B3M O;  2WAM A;  4J10 A;  1N8R W;  3CMA V;  1IBL O;  1F23 A;  3QG5 A;  3CC2 V;  3JCZ A;  1YXB A;  4B3R O;  2QA4 V;  4DV7 O;  3ICX A;  4W4L A;  1RPO A;  1SZX A;  4JV5 O;  3ZCC A;  3W7T A;  5LMU O;  4CC5 A;  1S3J A;  3MDS A;  1MAB G;  4JI6 O;  2YDE A;  3WG7 C;  5B66 Z;  1IVS A;  4OPA A;  1TAE A;  4YHH O;  3C3T A;  1W0K G;  1BS3 A;  4O2B B;  2Y0I A;  4QE7 A;  4B3R B;  4RUE A;  4F6R B;  2VWK A;  5BZB A;  4QNH B;  1S5L Z;  2OTL V;  4JV5 B;  2P06 A;  4P2Z A;  3E2E A;  3JAW B;  3ZRW A;  3ASO B;  2CGN A;  1AJN A;  3ETQ A;  2ZDI A;  4G2K A;  1Q7Y W;  4JI6 B;  1X59 A;  4L87 A;  3TXS A;  2PI5 A;  3CJH B;  4C7U A;  2LGQ A;  1AP5 A;  3F5W C;  4DXW A;  3CRQ A;  1VQ6 V;  2LGW A;  5B1A C;  2P4K A;  1Y66 A;  3AG1 C;  3L72 H;  4LFC B;  4BW9 A;  1OCO C;  1NU1 H;  3JAL B;  4J7Z A;  1KEC A;  2DQ3 A;  2Y0P A;  3ZS8 C;  4AIL C;  2ZE5 A;  1BCC H;  1NZ6 A;  1XL6 A;  3FX7 A;  3HKD A;  4GUN A;  4UVC A;  4DR1 O;  2JS3 A;  1OCC B;  2D2C B;  2KKW A;  3W7S A;  4FLV A;  4JYA B;  5KLV H;  4FM2 A;  3ZX6 A;  3STL C;  2F4V O;  1IBK B;  1FFX A;  2WLJ A;  2UXD B;  4TUY B;  1BE3 H;  4DR3 O;  2JJ2 G;  1BHB A;  4NKG B;  2AGA A;  1QU7 A;  1SKV A;  1MZF A;  1ORQ C;  4DV5 O;  2DYR C;  4DR2 O;  3K5N A;  5JJE B;  4DO2 A;  1YJ9 V;  4JI4 B;  5GTI Z;  3ABL B;  5L3B A;  1UFI A;  4FIP C;  2HEP A;  2QTO A;  1J95 A;  2PZS A;  5IJ0 B;  4UFZ A;  3ZMT A;  3OE7 G;  3SDL A;  4MVS A;  3SPJ A;  3FAV B;  3UT5 B;  2BSK B;  3ZMZ A;  2Q68 A;  4RUF A;  1H2S B;  2XHB A;  3IC7 A;  3KCY A;  4LFA O;  4G27 B;  4J7K A;  5CBH A;  1N32 O;  3SYA A;  2N04 A;  4ICG A;  4I4T A;  1TUB B;  2AXT Z;  4BIU A;  3HKC B;  1HR0 O;  1VQM V;  4LF6 O;  2IW5 A;  2YIC A;  2ZR2 A;  4DYL A;  4WFG A;  1O9H A;  5B1A B;  4GX0 A;  3RN4 A;  3IFX A;  5LGT A;  5IYZ A;  4YJ3 A;  1VF6 A;  1IZ3 A;  4YY3 B;  1R3J C;  4CH4 A;  1Q82 W;  2ODM A;  4B08 A;  5FPR A;  4UCR A;  2E5L O;  4R6Z A;  1K97 A;  2PGG A;  1GRJ A;  2KG7 A;  3RYC A;  2AW9 A;  1VQK V;  1BMF G;  3QO7 A;  4DR6 B;  3JAT B;  1VF5 B;  4UV9 A;  1E1R G;  4X62 B;  3FYE B;  5JQG A;  3R66 A;  5GON B;  4I0X A;  5KMG A;  3OEE G;  1M93 A;  2ZQM A;  4O2A B;  1FJG O;  3ABK C;  4IT5 A;  4EEQ A;  1Y76 B;  3B4S A;  4MVU A;  4DV0 B;  4DW0 A;  4X62 O;  1KP2 A;  3ZHS A;  4LF5 B;  2CH7 B;  5CBF A;  4JI7 B;  1IBM B;  1N32 B;  4FJC C;  3ASN B;  2IJH A;  2UUC O;  2ZT9 B;  1WLE A;  1IDS A;  2CK3 G;  2XAS A;  1R6K A;  4RO2 A;  2UU9 B;  2W6J G;  1FXV A;  4WCE V;  1XOU A;  2JGD A;  2QR4 A;  1XNR B;  3BCC H;  2R9R B;  3T2M A;  1XNQ B;  2UXX A;  4YY3 O;  4LWS B;  1W59 A;  4ZOL B;  2ZNJ A;  1SQB H;  3NXS A;  2R9I A;  2QEX V;  2IU3 A;  1KUQ A;  5KHJ A;  4H33 A;  3CC7 V;  5KA5 A;  3MHS C;  3GWK C;  1PM9 A;  4X20 B;  1V55 C;  3RBZ A;  3TCU A;  1LUV A;  4I7Z B;  2JVD A;  1YSC A;  1EM1 A;  4FLW A;  3P3N A;  1FJG B;  1LR1 A;  2Y48 A;  1VIB A;  3OMN B;  3P32 A;  2ZE6 A;  3B8N A;  3CRC A;  2Q7H A;  3BY6 A;  2YIA A;  2XT9 A;  2XAG A;  3JSN A;  3S3W A;  4O4L B;  1NR1 A;  5LA6 B;  1AI4 A;  3N2K B;  1BSM A;  2Q4P A;  5JQG B;  1R73 A;  3CCL V;  4YJ2 A;  1Y74 A;  1KKD A;  5EZY A;  4BIO A;  4ABM A;  3PN1 A;  2DYR B;  4UCS A;  2CTW A;  2EIL B;  3E8H A;  1W2B U;  1EN4 A;  1FKA O;  2AZ0 A;  4GZR B;  1XNR O;  1H2G A;  4RQF A;  1NR7 A;  3BA8 A;  2QM7 A;  3T4D A;  3SYQ A;  3WU2 Z;  2ZM6 B;  3CHX A;  2QWP B;  2WLN A;  1YIJ V;  3HB3 B;  4CC6 A;  4NYK A;  2EIL C;  2LW1 A;  4LFB B;  2X6B A;  2B1I A;  1TVK A;  2YS8 A;  3B2E E;  1M90 W;  1ZL8 A;  2X7R B;  4FFB B;  3ZED A;  2ZXW C;  3ML0 A;  1AR4 A;  4HZ3 A;  2IJJ A;  4UV8 A;  1IUR A;  2EUL A;  5H5N A;  2UXC B;  1BQ0 A;  4J80 A;  4ZHQ B;  1ZX3 A;  2Z0A A;  3ZN1 A;  1Y67 A;  2D3O W;  5FPO A;  4DW1 A;  4U3J A;  3CWB H;  1VQN V;  4DR4 O;  4LH7 A;  4FMT A;  4KHP B;  3CXH F;  4H13 B;  3CP1 A;  1QR9 A;  1BL8 A;  2UXC O;  1NJI W;  1HNX O;  4MTO A;  3AG7 A;  3FB6 C;  1WN7 A;  5LXT B;  3B77 A;  2Q7G A;  3ASO C;  1AI5 A;  1DF5 A;  1NH2 B;  2UUB B;  1GN6 A;  4KP4 A;  4PJ0 Z;  1N33 B;  2ZKO A;  2GSM B;  4PHZ A;  1PNK A;  2DOS A;  4IIJ B;  2XAJ A;  3H01 A;  1SQV H;  2ZCE A;  3OR6 C;  2CE4 A;  2RJZ A;  3UT5 A;  2F1M A;  3U11 A;  1JPX A;  3WB2 A;  3H1K H;  3T1Y B;  3ASN C;  4GCZ A;  2DMX A;  4BR6 A;  3HKE B;  1ZTE A;  3JAR B;  1QLE B;  5JCO A;  3ZHV A;  4JTD B;  1CPY A;  1R3L C;  1THZ A;  3A0H Z;  1W0J G;  3CRR A;  3RVY A;  2YIB D;  4I5S A;  4TV8 B;  4P9P A;  3ZRS A;  1VQ9 V;  3WG7 B;  1J5E B;  3OUS A;  4O4I A;  4X1I A;  4W4K A;  1M4U A;  4AQY O;  4B7E A;  2E5L B;  2DWD C;  4LC1 A;  4PI0 A;  2R70 A;  1URF A;  4GX5 A;  4Z1M G;  5F2V O;  5IYD O;  2UUB O;  1TA8 A;  1XEQ A;  4RAI A;  1AI7 A;  1ZLZ A;  4KXR A;  5K1P A;  1VQ7 V;  1XMQ B;  4X1K A;  2QKS A;  4ZKI A;  2RN9 A;  3LUT B;  4JTC B;  2HG5 C;  4HNA B;  3RYH B;  1VQL V;  3QNE A;  3TXQ A;  4OX9 B;  1Y4M A;  3H1H H;  1GN3 A;  3K79 A;  1QR8 A;  4GYC B;  3E89 A;  5CA3 A;  1MA1 A;  4FLZ A;  1Q3E A;  4JGS A;  1O9G A;  1BQZ A;  2RQ6 A;  3JCU Z;  2WWW A;  1G6U A;  1GTO A;  3BAA A;  3CXC U;  5B3S B;  3D3Q A;  1Q86 W;  5H6Q A;  4I50 B;  4O4H A;  5EYP A;  1FFT B;  4PA9 A;  5LYJ A;  4GKJ O;  5EC1 C;  1HP8 A;  2ATK C;  3ZN0 A;  1H38 A;  5LMU B;  1KD1 W;  2ITC C;  3WB1 A;  5DN6 G;  2F43 G;  4DV3 B;  3HKB A;  4JI1 B;  2Q0A A;  3DXR B;  5CBG A;  2HHH O;  3KZI Z;  2H8P C;  5B1B B;  1YF2 A;  1XHZ A;  3JAM N;  2OT5 A;  4WBN B;  4CZZ A;  1VQ5 V;  3TJT A;  1FFX B;  1S77 D;  2EIN C;  5IJ9 B;  4CH5 A;  1Y76 A;  2CDY A;  5LHG A;  1KMI Z;  4N23 A;  2JGD B;  1OZ0 A;  1K73 W;  3O65 A;  2F4V B;  4GX2 A;  1JCH A;  3ZIA G;  4NVP A;  2LW7 A;  3CCJ V;  1R3K C;  1OCO B;  4JI0 O;  5L3E A;  4DR7 B;  3CRM A;  4CS3 A;  4OX9 O;  1SQX H;  4DV5 B;  2QSA A;  3JD3 A;  2DN9 A;  1EN6 A;  2MK3 A;  2XAQ A;  1XMO B;  5B1O A;  3RYI B;  1K33 A;  2X6C A;  2QE7 G;  3MD0 A;  3K03 A;  3OEH G;  1N0J A;  3AG2 B;  1Z5V A;  2CAZ C;  2VWJ A;  4E4E A;  2ADQ B;  3VBB A;  5TIS Z;  3STZ C;  4J42 A;  2C2A A;  4JPR A;  3K0G A;  3CRA A;  3HKC A;  2L6L A;  5BR8 O;  3CCV V;  1H2M A;  4DR3 B;  4BAY A;  3EXA A;  3OAA G;  2PI4 A;  1OV9 A;  1PD3 A;  5EK0 A;  1PNM A;  3TET A;  1UPG A;  4IHJ B;  5A9G A;  3X2Q B;  2GTA A;  3D3I A;  3F5T A;  2CTR A;  4X65 O;  4JI5 O;  3BEH A;  5KA6 A;  4JAV A;  5LHI A;  5IYZ B;  2LFS A;  2QM8 A;  3K04 A;  3SYO A;  3CEI A;  4LF8 B;  3JAR A;  1XDC A;  3FYI B;  1OCR C;  4PEL A;  5JCO C;  2UXB O;  2R72 A;  1AR1 B;  1SRY A;  2HJD A;  5B3S C;  4NXN O;  1L1F A;  5GTH Z;  3RYF B;  3G6E V;  3IAY A;  5IDJ A;  1OCZ C;  4LF9 B;  2YXH A;  4FK5 C;  2ZIO A;  4LFA B;  2P7T C;  3OUF A;  3ZMS A;  3ZBH A;  3SJC C;  3VQX A;  4DR6 O;  4IYH A;  5A2Q N;  4BIZ A;  1MNG A;  4FFK A;  2Z3Y A;  3L71 H;  1HNX B;  4EB6 A;  1ENV A;  3OTO B;  4BW5 A;  2EZO A;  4JI3 O;  3H1I H;  3CCR V;  3F7Y C;  2NR5 A;  5AG2 A;  3APO A;  2OWO A;  1PL4 A;  3W7W A;  5B1B C;  2DW4 A;  3CS5 A;  1HWY A;  4IL6 Z;  4QE9 A;  4LF7 B;  1WP8 A;  3FB8 C;  3E83 A;  4JYB A;  2A3Q A;  1WA8 A;  1YDX A;  3W7U A;  1GM9 A;  1ZL8 B;  3K08 A;  1E79 G;  5KAI Z;  5IYC O;  3RW0 A;  2YXL A;  3CX5 F;  4PA6 A;  5LBQ A;  2EIN B;  3JAL A;  4PDL A;  4LF7 O;  5FNV B;  3AG3 B;  1NT2 B;  4HNA A;  3DGE A;  4O4J B;  2ILM A;  3EFF K;  2JDI G;  2RMK B;  2WA3 A;  2NLJ C;  4FZ1 A;  1Z5W A;  4HAM A;  3E35 A;  2N05 A;  3OTO O;  3H9V A;  2HVK C;  4JI8 O;  3K06 A;  1NTM H;  2OIG A;  5EZY B;  4NXM O;  1FS0 G;  4DK0 A;  1JVM A;  2FB5 A;  5IJ9 A; 
#chains in the Genus database with same CATH homology
 2DYR B;  1V55 B;  2EIL B;  2W6I G;  3E8H A;  1W2B U;  1EFR G;  5HFL A;  3LDD A;  2IH3 C;  1H2G A;  4RQF A;  3CC4 V;  2EZP A;  1NR7 A;  2QM7 A;  3T4D A;  2XAH A;  1VQO V;  3SYQ A;  1CP9 A;  3ZRX A;  2ITD C;  2YEV B;  3MHH C;  2WLN A;  1YIJ V;  3HB3 B;  2Y69 C;  3E8B A;  3CCS V;  4MSW C;  2EIL C;  2JIZ G;  4WFE A;  2X6B A;  1DTO A;  2B1I A;  4JYC A;  4QPK A;  1F4N A;  1M90 W;  4WF9 V;  3CCE V;  1G8M A;  3A0R A;  3EHB B;  1AI6 A;  2X7R B;  2ZXW C;  3ML0 A;  4MW3 A;  2Q6A A;  5L3G A;  1LNQ A;  2ZDI C;  4HZ3 A;  1OHH G;  1OCR B;  2IJJ A;  2JJ1 G;  4UV8 A;  5FL7 G;  2IJI A;  4JTA B;  4R8C A;  1NVP B;  1TUE B;  1VQ4 V;  2DWE C;  2EJR A;  3ZN1 A;  2WLH A;  4JF3 A;  2D3O W;  1ROP A;  1CEZ A;  2LP7 A;  3SPC A;  1M56 B;  1VQN V;  4Q20 A;  4PDR A;  2IH1 C;  4FMT A;  2Q69 A;  3FB7 C;  3WFV A;  3CP1 A;  4FPP A;  4WFF A;  1QR9 A;  1BL8 A;  1M56 C;  3SYC A;  3CCM V;  1NJI W;  3ABL C;  4TT3 G;  4MTO A;  3FB6 C;  1SES A;  1YTF D;  3SPI A;  4XBF A;  3CCU V;  2OCC B;  3G71 V;  1V54 C;  3B77 A;  1K4C C;  1Q81 W;  1RM1 B;  2WLM A;  2B5U A;  3DTU B;  2AHZ A;  3ASO C;  1QLN A;  1AI5 A;  3K3W A;  3LSS A;  1DF5 A;  1NH2 B;  4KP4 A;  2OTJ V;  5C93 A;  2GSM B;  2WLL B;  3SJQ C;  3UM7 A;  2KB1 A;  3AG2 C;  1PNK A;  4MVQ A;  2V7Q G;  1F4M A;  5LHH A;  4PA4 A;  2EIJ C;  2XAJ A;  3H01 A;  1NVP D;  4X88 A;  3OR6 C;  2WLK A;  1FXH A;  2EIJ B;  3CD6 V;  1R6N A;  3JYC A;  1K8A W;  4ZBM A;  1K9M W;  1QCE A;  2EBO A;  3ABK B;  4LCU C;  1OCZ B;  1IXM A;  4R50 A;  2K1E A;  2HKO A;  1JPX A;  4U7O A;  1XL4 A;  1GO3 F;  3ASN C;  4GCZ A;  2B1G A;  3OR7 C;  3ETE A;  3SPG A;  2ZXW B;  1JOY A;  2GHY A;  1K5S A;  3CYO A;  1MG1 A;  2WAM A;  1I5Y A;  1N8R W;  3CMA V;  1QLE B;  3JD2 A;  1F23 A;  4JTD B;  1CPY A;  2WLL A;  1R3L C;  3CC2 V;  1THZ A;  1W0J G;  3JCZ A;  3OFN G;  1YI2 V;  1P7B A;  3RVY A;  2QA4 V;  4MVM A;  3T4Z A;  3T1C A;  4I5S A;  1RPO A;  4P9P A;  3ZRS A;  3ZCC A;  3M99 B;  1VQ9 V;  3I56 V;  5CN0 A;  3W7T A;  5EBM C;  1WPX A;  1S3J A;  3WG7 B;  3FB5 C;  1YJN V;  3OUS A;  4CBC A;  1MAB G;  1S76 D;  1DLB A;  3WG7 C;  1K4D C;  4KFM A;  5L3C A;  3ABT A;  4N21 A;  5L3D A;  3CCQ V;  1AJQ A;  1W0K G;  4PA7 A;  2DWD C;  4QE7 A;  4RUE A;  2JEU A;  4LC1 A;  5BZB A;  3F7V C;  4QNH B;  4GX5 A;  2OTL V;  4Z1M G;  4P2Z A;  5KUK A;  3ZMU A;  3ZRW A;  5IYD O;  3E2E A;  3ASO B;  1YHQ V;  1AJN A;  1EBO A;  2ZDI A;  4G2K A;  4RAI A;  1PL0 A;  1AI7 A;  1Q7Y W;  2M7W A;  5EC2 C;  2BOB C;  4LP8 A;  3PJS K;  1E1Q G;  3JD4 A;  4L87 A;  4X89 A;  4UVA A;  3E8F A;  2PI5 A;  1VQ7 V;  2UXN A;  2A9H A;  4PDM A;  4YXW G;  2QKS A;  4ZKI A;  3LUT B;  4JTC B;  1QVG U;  2A79 B;  2HG5 C;  1NH2 D;  1COW G;  1S5H C;  1ZWI C;  2YSU B;  1VQL V;  5EBL C;  2WLI B;  3QNE A;  3F5W C;  2EIK B;  4DXW A;  1Y4M A;  1FXK C;  3RVZ A;  5L3F A;  1ARO P;  1VQ6 V;  3K79 A;  1NKD A;  1GK9 A;  3AG3 C;  4OXS A;  2HJF C;  1QR8 A;  3E89 A;  2P67 A;  5B1A C;  3X2Q C;  1Y66 A;  5CA3 A;  1H8E G;  3AG1 C;  2ZR3 A;  4JGS A;  1K34 A;  1OCO C;  3CME V;  1KEC A;  2DQ3 A;  2WWW A;  4EKW A;  1GTO A;  1PNL A;  2JK5 C;  3CXC U;  5B3S B;  5CMU A;  1VQP V;  1Q86 W;  5H6Q A;  3AG4 B;  2OCC C;  1XL6 A;  3R65 A;  5EBW C;  4GT1 A;  1SET A;  5E1A C;  1FFT B;  4PA9 A;  1K3E A;  4UVC A;  5EC1 C;  3LDE A;  2ATK C;  1OCC B;  2WLI A;  3ZN0 A;  1H38 A;  3W7S A;  1KD1 W;  2P90 A;  2ITC C;  3AG1 B;  5DN6 G;  2F43 G;  3QO5 A;  1YTF B;  1FXK A;  2EIM C;  5CBG A;  4MTF A;  3KG2 A;  2H8P C;  5B1B B;  4QPJ A;  3STL C;  1OCC C;  3K9A A;  2OT5 A;  4CZZ A;  2EIK C;  2WLJ A;  1VQ5 V;  2JJ2 G;  3E8G A;  1BHB A;  1S77 D;  3GWO A;  2EIN C;  4P30 A;  1ORQ C;  5LHG A;  4N23 A;  5J9P C;  2DYR C;  3GB7 C;  1S72 V;  2XND G;  1OZ0 A;  3D36 A;  2V1D A;  3P30 A;  4DO2 A;  1K73 W;  1S0V A;  4H37 A;  4GX2 A;  1JCH A;  3ZIA G;  4X8A A;  1YJ9 V;  3CCJ V;  3ABL B;  1R3I C;  4MVR A;  5B1N A;  5L3B A;  1R3K C;  4QIW F;  1OCO B;  5L3E A;  1EZJ A;  4LBE C;  2X0L A;  2AHY A;  2Z5U A;  4FIP C;  2QTO A;  3E86 A;  3JD3 A;  2MK3 A;  1J95 A;  2XAQ A;  4PDV A;  5B1O A;  5LGU A;  1K33 A;  2X6C A;  3ZMT A;  2QE7 G;  3OE7 G;  3LSQ A;  4MTG A;  3MD0 A;  4MVS A;  3K03 A;  3SPJ A;  2DYS B;  2XAF A;  4I9W A;  3ZMZ A;  3OEH G;  4UVB A;  1BHA A;  3AG2 B;  2HVJ C;  2Q68 A;  4RUF A;  3ETG A;  3VBB A;  3STZ C;  1JQ0 A;  2C2A A;  3IC7 A;  4JPR A;  4G27 B;  5CBH A;  1MSW D;  3SYA A;  3ABU A;  3K0G A;  1MOF A;  4R7C A;  1M57 B;  3CCV V;  1F51 A;  4BIU A;  4BAY A;  3G4S V;  4E2L A;  3ETD A;  3OAA G;  2PI4 A;  1KQS U;  4GX1 A;  1FXK B;  1VQM V;  1PD3 A;  2IW5 A;  5EK0 A;  2ZR2 A;  1PKX A;  2Q67 A;  4JAS A;  1G4Y B;  1PNM A;  3ZRV A;  3TET A;  2FTK A;  2DQ0 A;  4WFG A;  5B1A B;  3D3I A;  4GX0 A;  3X2Q B;  3IFX A;  5LGT A;  3BEH A;  4MTX A;  5KA6 A;  1R3J C;  1Q82 W;  3OGC C;  4JAV A;  5LHI A;  2W0F C;  4WFH A;  4UUJ C;  4MW8 A;  3ZJZ A;  4MT8 A;  2LFS A;  2QM8 A;  1QBZ A;  4WFA V;  3K04 A;  4R6Z A;  4ASU G;  3SYO A;  1K97 A;  3QO8 A;  3AG4 C;  5IY5 C;  2WPD G;  1M9N A;  5DM6 V;  1VQK V;  1BMF G;  3FYI B;  3ABM C;  1OCR C;  1AJP A;  3QO7 A;  1QVF U;  4PEL A;  5KUM A;  1P4R A;  2JEX A;  1E1R G;  4UV9 A;  1AR1 B;  3FYE B;  1SRY A;  5IY5 B;  1M57 C;  4G28 B;  5B3S C;  2H94 A;  1SER A;  4WFB V;  4MVZ A;  5H6R A;  3JD0 A;  1L1F A;  1K92 A;  3OEE G;  3W7X A;  3G6E V;  1M1K W;  2ZQM A;  5IDJ A;  1OCZ C;  4MS2 A;  3ABK C;  4FK5 C;  2P7T C;  3OUF A;  4QJF B;  3OMA B;  3ZMS A;  1K5Q A;  1KC8 W;  4F4L A;  2DYS C;  2IU0 A;  4HYO A;  4MVU A;  3OM3 B;  3HPL C;  2YEV A;  1KP2 A;  4BIZ A;  2Z3Y A;  3SYP A;  3SPH A;  1V54 B;  5CBF A;  1YJW V;  1ENV A;  4XDJ A;  5HFM A;  4FJC C;  3ASN B;  4BW5 A;  2IJH A;  3IGA C;  3ABM B;  2EZO A;  1WLE A;  2CK3 G;  2XAS A;  5LGN A;  1R6K A;  4RO2 A;  4XDL A;  3CCR V;  5GW7 A;  3F7Y C;  5IYB O;  4MVO A;  2W6J G;  1FXV A;  2NNU A;  4WCE V;  3JD1 A;  2WSS G;  2BOC C;  4J9Z B;  2R9R B;  3T2M A;  4J9Y B;  2UXX A;  3W7W A;  1K7D A;  5B1B C;  2DW4 A;  4P9O A;  2HFE C;  3OMI B;  3NXS A;  2R9I A;  1HWY A;  4JAU A;  2QEX V;  2IU3 A;  4QE9 A;  3OW2 U;  1YIT V;  2IJK A;  3FB8 C;  3CPW U;  1GKF A;  3E83 A;  4UXN A;  4JYB A;  2LFR A;  4H33 A;  1UJW B;  3CC7 V;  5KA5 A;  1RM1 C;  1JJ2 U;  2EIM B;  3MHS C;  4TWK A;  1GM7 A;  2X6A A;  1H8H G;  3W7U A;  1GM9 A;  1V55 C;  3K08 A;  3RBZ A;  3I55 V;  1E79 G;  3TCU A;  5IYC O;  3RW0 A;  1QLE C;  4PA6 A;  5LBQ A;  1YSC A;  1RPR A;  2EIN B;  4TSF G;  4PDL A;  3LNM B;  3TK1 A;  1I5X A;  2ZD9 A;  3AG3 B;  1VQ8 V;  2Y48 A;  2A0L A;  1GMG A;  1KP3 A;  2P6J A;  4RQE A;  1JX9 A;  4U7N A;  3OMN B;  3DGE A;  1NBM G;  3FKS G;  3P32 A;  1NQT A;  4PA3 A;  3EFF K;  2HLD G;  3B8N A;  2JDI G;  2Y69 B;  3BY6 A;  2NLJ C;  3VOU A;  2XAG A;  1DF4 A;  1NR1 A;  1AI4 A;  5H9C A;  2XOK G;  4HAM A;  3ZMV A;  2HR3 A;  4KUM A;  3E35 A;  3K0D A;  3ZRW B;  1R73 A;  1GM8 A;  2HVK C;  3UKM A;  3CCL V;  3AEI A;  3B8M A;  3LDC A;  4XDK A;  3K06 A;  1KKD A;  1FS0 G;  1JVM A;  1B6Q A;  1SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...