3CJHB

Tim8-tim13 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
NSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 59
sequence length 59
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhB00
2BSKA 3CJHB 3DXRB 2BSKB 3DXRA 3CJHA
chains in the Genus database with same CATH superfamily
1VQ8V 2QTSA 5LA6B 5L3DA 3MAQA 3K5MA 2QM8A 5IYZA 4DK0A 1H8HG 5J2TA 1H2GA 4JI3B 1MMMA 2HVJC 3CPWU 1PNMA 4BW5A 3ASOC 3ABLC 4O4HA 1Y4MA 4DV6B 1NVPD 5KMGB 1KU9A 5KHJA 4UB6Z 3B2EE 1GN6A 3R65A 3CRAA 3G6EV 5LA6A 1HR0B 4DUYB 2EIMC 3OD4A 2H8PC 4LF9B 3CC2V 1PL4A 3R66A 5LHIA 2ZCEA 1BHAA 2YS8A 5L3BA 5B1AB 3CRRA 2XT9A 2WLHA 4X20B 3JAMN 1Z5VA 3K04A 3BFRA 1S72V 3GWKC 3CMAV 2VQFB 3ZJZA 4CS4A 3ABKC 3CXCU 2Q8VA 5BZBA 1AJPA 2Y48A 3TXSA 1MOFA 1S77D 2A79B 4IIJA 4RQEA 3BA8A 5B5EZ 3HKDB 2F43G 3HB3B 1OV9A 1U97A 4OPAA 2Q5ZA 4JGSA 4JI3O 3SPJA 2E75B 1PNKA 1ZL8B 4J80A 5IYCO 2Y69B 1Y67A 2H94A 4WFEA 1RP3B 5IY5B 3RW0A 1I5YA 2YSUB 3EHBB 4JAAA 2NN4A 5FLXN 3P30A 4ASUG 3RYFB 3TXQA 3P32A 1EZVH 4H37A 4DV7B 1HR0O 3K9AA 4DUYO 1VQMV 1KKDA 4NKGB 4KHPB 1SERA 4LF9O 2D3OW 4K3AA 2MK3A 3KCYA 4JI2O 4TWKA 2V4DA 2A9HA 3B40A 3ZMSA 4CZZA 4OPHA 4X9QA 1HP8A 1M56B 1M5IA 4JYBA 1EN4A 3OMAB 1VQOV 4EFBA 3L75H 4R7CA 1RFYA 1DGSA 1VARA 2K9PA 2BOBC 1F7YA 2Q4PA 1QBZA 1OCZC 5CBGA 4JV5B 4X64B 3BAAA 3U11A 2WA3A 4JF3A 2GV9A 2GUZB 2CDYA 3D36A 3FX7A 1AJNA 3FAVA 4YIOA 2OTJV 3STZC 1SQFA 5B1BB 3E22B 1QR8A 1SKVA 1ZUQA 1IXBA 2BOCC 4HBNA 1P7GA 4RUFA 2Q7EA 4WBNB 3ZN0A 1ZWIC 1EN6A 2A3QA 4LNUB 3G4SV 1SZTA 1Q86W 4GX0A 2X6CA 1I94O 1AP5A 3ZHRA 3KCXA 4J11A 1N33B 3K3WA 1H2MA 3WU2Z 1GM9A 4IYHA 2IW5A 4FFKA 2HG5C 2AHYA 2HFEC 3HR0A 5E79Z 1S5HC 1ZX3A 1PM9A 4ZBMA 4LF5O 2Y4UA 3E22A 4PDMA 3JCUZ 4DV7O 4KXRA 1YTFB 5CA0B 1GRJA 2DYRB 2EJ7A 4QPKA 4KHPO 2Q6AA 5F2VO 5B1AC 3UO2A 1CPYA 2PYJA 4WBNA 3ZCCA 1VMGA 1AR4A 2ZD9A 1R6TA 5FNVB 4CC5A 4OXSA 4FLZA 1MZEA 2DWEC 3I56V 4UV9A 2DW4A 3BEHA 1SS3A 1KYOF 4JV5O 4X64O 2CAZC 2HR3A 2JEXA 3SYOA 1WPXA 2ZR2A 3P3PA 4MTOA 4FLTA 3VQWA 5C93A 1EBOA 5CA0A 5H6QA 4FJCC 5K1PA 2XTAA 2JGDB 2KSDA 4DR4B 1S3JA 4WFGA 4MTFA 3ZRSA 2QKAA 4JI1B 1K73W 2DJVA 3F5WC 1MSWD 5AG2A 1QLNA 5KUKA 2WPDG 1BT8A 5IY5C 3OMIB 1DK1A 5KX5B 1K5QA 1N33O 3E8HA 2QR4A 1UFIA 1YITV 3ZHSA 3CC7V 3D36C 2AW9A 1WB7A 3G67A 1NH2B 2D2CB 3BCCH 1R3IC 3K79A 2EZPA 3CCJV 1B3QA 5FPOA 1J5EO 2UUBB 3QG5A 3HKEA 1BQ0A 4QGPA 2FMLA 2JGDA 4DR5B 5KAFZ 4HYOA 5JVDB 1F4MA 4I0XB 3TK1A 1M56C 1JFFB 4X62B 1L0NH 2YICA 3CCRV 4GLXA 3ASNB 5KX5A 2RN9A 4LWSB 1RSOA 5TISZ 1W59A 1RM1B 4ZHQB 3SDLA 4I5SA 4J10A 5FPRA 5EYPA 1SQPH 1G4YB 3E8GA 1NR7A 1TVKB 3C3TA 4DV1O 4PHZA 5EIBD 1XILA 1FXKB 1SC5B 1VIBA 1XNRB 5KHGA 4TV9A 5JVDA 4I0XA 4CS2A 5A9GA 1JFFA 5DEDA 1WP8A 1R6NA 1R3JC 1TUEB 3CCQV 1Y76A 4LF7B 5B3SC 2JVDA 1QCEA 1YSCA 4LWSA 2ETNA 4TV8B 2JJ2G 1X59A 4WFHA 4ZHQA 5H2FZ 4WFAV 4YXWG 4QIWF 1SQBH 4KL1A 1L0LH 4ICGA 3HKBB 3L72H 1FXKA 2XUMA 4PA3A 2WSSG 2CE4A 3OGIB 5IDJA 4PA9A 4WFFA 2DYRC 3ZEDA 3JCZA 4K8XA 2DWDC 4FK5C 2CTQA 1Z2GA 2UUBO 4DR5O 1BE3H 2DOSA 3ETEA 1QU7A 2R9IA 3N2GB 4B3TB 1AVMA 2ZNIA 2DN9A 3GWOA 1NTMH 1SQVH 4TV8A 1SA0B 1M1KW 2QKCA 3N2KA 4DR3B 1NT2B 1Q8IA 2JRIA 2GDSA 4PD4F 2AZ2A 3H01A 3KKYA 3HKBA 4L87A 1GK9A 1FAFA 3T1HB 3K5OA 3BVOA 5GW7A 2YC0A 1XNRO 4N23A 1B6QA 5KA5A 3N2GA 3X2QB 1R3KC 2YIDA 2W6IG 4LF7O 3AG7A 1JMKC 3L74H 3A0HZ 3ZS8C 4I55B 4W4KA 3SJCC 1CEZA 2UXCO 4KUMA 3KG2A 3SJBC 5LGTA 4A5UB 3L73H 1JJOA 3ZHQA 1K9MW 4OX9O 3ZMVA 2QJ1A 3VQVA 2E5LO 2Z3YA 4GKJB 2ILMA 3J80N 1OZ0A 3CRCA 4ZI7B 3FYEB 2Q7HA 4UCOA 3JSLA 1JA8A 4B3TO 1RPOA 3J81N 2JDIG 1JPXA 4FLXA 4TT3G 1RM1C 4I55A 1MA1A 4WF9V 2NLJC 1FJGB 5IE9A 3QNEA 4LF6B 1Q5OA 4ZKIA 4JYYA 4RAIA 1GTOA 1BHBA 3AG4B 3ZRVA 4E2LA 1FXKC 2IU0A 3T1HO 4WCEV 1EZJA 1EN5A 2UUAO 4NB5A 1IURA 1GM7A 1VQKV 4ZI7A 3CCMV 3K58A 4O4JB 3B8NA 1NQTA 3ZMUA 2CGNA 3LSQA 5BY1A 3MHSC 3MD0A 3E86A 3LSUA 1MNGA 3CXHF 3JD4A 3H1LH 4FPPA 4CH3A 4IGGA 1ROPA 1A32A 1XEQA 1IBLB 2PUSA 2F4VB 3T1CA 3SYPA 2P90A 1IXMA 3SJAC 2FL4A 3QO5A 1ZLZA 2EINB 4O4JA 1XMQB 2HP8A 1K5SA 1VF5B 5CBFA 2P4KA 3CSXA 4G28B 4FM1A 2OYQA 1F4NA 1I0HA 4NR1A 2UXXA 2WLNA 1NBMG 3BHPA 3DSQA 3ZMZA 4XDJA 4DUZB 4BIOA 1HNWB 2UU9B 1R73A 1BQZA 1KECA 1SRYA 3TCUA 3QO8A 4K8ZA 4I7ZB 3BA9A 1Y66A 1UPGA 5HFMA 4J9ZB 3AG2C 4ZIBA 5IJ9B 1PV0A 2ZM6B 1L8DA 4CC6A 1P4RA 3CRQA 3H1JH 1OCRC 1BGYH 4GX5A 3RVZA 3F7YC 1R3LC 4CH4A 4LBEC 1XL6A 2ZINA 2IH3C 4X88A 1YXBA 2CK3G 1BCCH 5D5QA 4MVRA 4JZGA 3CX5F 4R6ZA 5EBWC 4DV3B 1FPOA 1JX9A 5BXZA 1EM1A 2CGOA 3SYQA 4J41A 4MVUA 1N34B 4GUNA 5B66Z 4TOIA 2F93B 4DR6B 3OT7A 4LCUC 2EILC 3W7XA 1F23A 2IBZH 1VF6A 3AG4C 2PI5A 5JJNB 1M57B 1HNWO 1ZSPA 1XDCA 3BRCA 2UU9O 4NXMB 5KMGA 3RGBA 1W0JG 2Q0AA 3T1YB 3RYCB 1O9GA 2EIJB 1GN4A 4AQYB 1P84F 3J7AU 3CCUV 4PJ0Z 4JI6B 3AEIA 2E74B 2JK5C 4EFEA 4HAMA 2QKSA 5IT9N 4GYCB 3WG7B 4FZ1A 1DTOA 4UFZA 2Z0AA 4P9PA 4H33A 2QEXV 4DW0A 4X20A 4J7KA 4Z1MG 2OIGA 4HNAB 2ZXWB 1WAZA 2YIAA 1H38A 4DO2A 4X89A 4BIUA 3DTUB 4MTXA 4DV6O 1MSDA 3W7WA 3RYCA 3SYAA 1S5JA 4X1YB 3UM7A 2XOKG 2QGNA 1E1QG 3HKDA 4DV3O 2CTPA 3DC5A 4DV4B 4U7OA 1AI7A 4XDLA 1ZL8A 4HNAA 1Q6UA 1BMFG 3K57A 2LFRA 4RWUA 3JD1A 4DR6O 4DV0B 3ZRXA 1VQ9V 1THZA 3CEIA 2BSKB 5LP6B 4U3JB 2VQFO 2FB5A 3LUTB 4TUYB 3AG3B 2QWOB 2ZE6A 1W2BU 3TGUH 1QR9A 4X1YA 1HNZB 3FKSG 4E4EA 3THOA 4CH5A 2LP7A 3RYFA 4JI7B 2LGQA 2WLJA 1QHTA 4DRXB 2Y0PA 3IGAC 3W7SA 1G6UA 1W0KG 3JARB 5KUMA 5EBMC 2FYUH 1VP7A 3ABTA 2N74A 3CE2A 3VQYA 2W0FC 3ZRWB 4LFBB 3U10A 5LP6A 2BSKA 1GN3A 1XNQB 4LR3A 2CH7B 2P22C 1VF6C 4TUYA 2UXBB 4UCSA 3JALB 3B4SA 4I4TB 4RQFA 2XAJA 2XAFA 3FB7C 4OGQB 3E2EA 2GUZA 3DC6A 5GTHZ 4UCVA 4PDRA 1LR1A 1Q43A 1NZ6A 4DRXA 3D8CA 1YIJV 1KB9F 2LQTA 3JARA 4H0LB 1VQPV 3S3XA 5D5PA 1FFTB 3RYIB 3ZX6A 5J9PC 4LNUA 2R9RB 2CH7A 4DV0O 3CP1A 5L3FA 1KMIZ 4I4TA 2ZDIA 3K59A 1PKXA 1K92A 1D2DA 1V55B 2EIJC 2V7QG 5B1NA 1VQ4V 2JS3A 2KG7B 3UT5B 5LOVB 2KQXA 1NH2D 5JH7B 1NTKH 4JI7O 3WG7C 4U7NA 2DYSB 3NXSA 4MT8A 5H6RA 4IHJB 4O2AB 2QDOA 2WLMA 5DN6G 1NS1A 2XAGA 5L3EA 2ZXWC 2VS0A 3K5LA 5FNVA 1AI4A 2ZIOA 2Y69C 2YEVB 1XNQO 1XL4A 2QWQB 2UXBO 5KAIZ 1QVGU 2QWRB 3UT5A 5LOVA 4YJ2B 5GTIZ 5JH7A 4R8CA 4FLUA 2Q9LA 1TUBB 2F1MA 4F6EA 2WLLB 3JAKB 5H5NA 4FM2A 4DW1A 1GMGA 4IHJA 4O2AA 1WA8B 4MVMA 1PP9H 4LH6A 4FMTA 1AR5A 1KC8W 1AJQA 2PYLA 5CN0A 2GSMB 4CBCA 2Y0IA 1OHHG 2YEVA 2JGUA 5LP6C 3F5TA 3QTCA 4JI5B 3UO3A 2UXDB 3AG3C 4LFCB 3ZHTA 2Q73A 2Q68A 4NYKA 2GTSA 4O4IB 2RNBA 2YUAA 1K33A 4JI0B 3OR6C 2JJ1G 3STLC 5LMNB 3CJHB 4UCUA 1TUBA 1US6A 2N04A 1N36B 1KP2A 4AILC 3JAKA 5B1BC 5EBLC 2XNDG 3ETDA 3CHXA 2P7TC 3BABA 4DR4O 4R50A 2OWOA 5BR8B 2BTQB 4XDKA 4JI1O 2Z5UA 1HDJA 3GB7C 2E3CA 4B3SB 4MW8A 5KLVH 3EXAA 1R1BA 2W6JG 2ZDIC 2B5UA 2HHHB 1PNLA 4I9QA 2CUGA 1TVKA 3OUFA 3S3WA 2YDEA 3EFFK 4O4LB 1EFRG 3RWRD 4QE9A 1N32B 1HNXB 3L70H 1K4DC 1FYJA 3A2FA 3K9SA 2BTQA 2JIZG 4X62O 1FXHA 4NXNB 1OCOB 1AP6A 2ZKOA 1WPBA 4P30A 4BW9A 4JI5O 1IDSA 1IBKB 2UXDO 4LFCO 5C8YB 4K0KB 1XREA 4RO2A 1CP9A 3SPIA 4YHHB 4O4LA 1OCCB 4LFAB 3FB6C 4B7KA 1YHQV 1P49A 3JD0A 5LMNO 1D5NA 3DXRB 4DR7B 1N36O 1F51A 2QM7A 3RN4A 5IWAB 2DYSC 3MDSA 4PELA 1DF4A 2YIBA 5JJJB 1J95A 1FKAO 3FB8C 2HJDA 5CA1B 5HFLA 4Q6GA 2IJJA 2ITCC 3K5NA 3SYCA 3CRMA 5BR8O 3JATB 4IL6Z 1ENVA 1WJZA 1SA0A 1XUQA 1K34A 5B1OA 5C8YA 2LW7A 2YI9A 3EVKA 3APQA 4G27B 1YJWV 1FD9A 1GN2A 4MVQA 1BL8A 1SF9A 3DXRA 3E8FA 3H1KH 4JTAB 3T4DA 1GO3F 4MVSA 2ADPA 3ML0A 2QWNB 5CA1A 1TAEA 5EC1C 5CMUA 1YF2A 2JEUA 3CS5A 4G2KA 3JATA 2OTLV 4FZ0A 3JASB 2HKOA 4JZ2A 1KUQA 3ASNC 4NXNO 5EZYB 5J2UB 1K8AW 4LH7A 4MTGA 4K35A 5LHHA 4ZOLB 1IBKO 2YXLA 4K0KO 1I5XA 4JTDB 4DR3O 4YHHO 2BTOA 2IU3A 2ITDC 2ZE7A 4LFAO 1PD3A 5CB4B 3B8MA 4N21A 1B04A 4DR7O 3RT3C 4L8JA 1H2KA 5JJEB 5IWAO 3ABMB 1YCIA 5FL7G 3DGEA 3FB5C 2W0XA 1TA8A 3JASA 5JCOA 3ZBHA 4CH6A 1QVFU 5EZYA 1LUWA 4MW3A 5J2UA 2ZE8A 3PN1A 2RJZA 4ZOLA 1MABG 5EK0A 1URFA 5A2QN 2B9ZA 4UVCA 4FIPC 3E35A 1WP7A 5CB4A 5LYJB 5IYBO 3UCSC 3BPZA 2Y4TA 5CA3A 4I9WA 2L35A 4GKJO 3UKMA 1LUVA 2KB1A 1COWG 2LGWA 1NTZH 3G6BA 2L6LA 3I5DA 4FFBB 1H2NA 2ZNJA 1UJWB 3RBZA 2UUCB 1S5LZ 3OTOB 4AI8A 4MVZA 1FJGO 4MVOA 3K0GA 4PV1B 4FLYA 2EBOA 3NR7A 4UB8Z 4LF6O 1OCCC 2XAHA 4FM0A 5LYJA 2X7RB 3VOUA 4PI2A 5IYZB 5LXTB 3P3NA 2IJKA 4W4LA 2F23A 2Q0OC 2F66C 3IAYA 4GZRB 2FKXA 2ADQB 1IVSA 2HJFC 1K4CC 3X2QC 4B7EA 3O65A 2F95B 3RVYA 1ZTEA 3OUSA 2JS5A 1DF5A 1QNMA 4FFBA 2BE3A 3PJSK 1X4TA 3ZIAG 3OW2U 2IH1C 3K08A 3FFQA 2RQ6A 1NKDA 4UVAA 1ZAUA 3A0RA 2DQ3A 4XBFA 2GTAA 4FLVA 4TQFA 1T5EA 5LXTA 3ETGA 1AILA 2KKWA 1IBLO 2F4VO 2OIEA 2OCCB 1V54B 5IJ9A 3QF7A 3CWBH 5JCOC 1Y6XA 3T4ZA 2ZIMA 1XMQO 2IJIA 4J9YB 4YY3B 2NNUA 3LDDA 1K3EA 4YJ3B 3CMEV 2E76B 2P67A 4GKKB 4IIJB 4PDVA 2UUCO 3OEEG 4X1IB 3OTOO 2P06A 4BAYA 4HZ3A 4DUZO 3SR2C 2HVKC 2Q67A 2UXNA 4JI2B 3E89A 3ABMC 1KP3A 1M93A 1VQ5V 1YZBA 2ODMA 4DR2B 1P7BA 3H1IH 4D6TH 2DQ0A 2WA4A 2ZM6O 2XASA 1G1XB 5IYDO 1GAXA 1N0JA 1NVPB 4YJ3A 4J42A 4LF4B 1Q90D 1GKFA 4X1IA 3VBBA 3AK3A 4Z1VA 4JASA 1AI6A 5GONB 3LNMB 5KHIA 2X6BA 2ZQMA 1MG1A 3E8BA 1Q6IA 4PDLA 2HEPA 1JR9A 4GX1A 3L9DA 4FLWA 1SESA 1O9HA 1SZXA 4WFBV 3JYCA 4ABMA 4B3MB 2Q7GA 1YI2V 2EINC 1I94B 4X66B 3E83A 3FYIB 1N34O 3CCEV 4YY3O 2OCHA 3G80A 1SQXH 4Q20A 4JPRA 4GKKO 1WN7A 4C7UA 5GONA 4DV2B 3FAVB 2DE0X 3WB2A 4LF5B 3HKCB 2X0LA 2YXHA 3AK2A 4NXMO 3T1YO 2HLDG 4AQYO 5KHHA 1U96A 1BZKA 4JI6O 1Z5WA 4DR2O 1Q3EA 3C90A 2P5OA 1KBHA 1VQ6V 1YTFD 3K0DA 1IZ3A 4J7ZA 4JAUA 3W7TA 2A7WA 4IT5A 5E1AC 4LF4O 1FFXB 1M4UA 1QQCA 2AGAA 3N27A 4U3JA 3K03A 2Q69A 3HKCA 1H8EG 5EC2C 1VQ7V 1E79G 4AHCA 1IX9A 2V1DA 4LC1A 2RMKB 2OCCC 3B77A 5LMUB 1V54C 2GHYA 2MW2B 3HPLC 4B3MO 1QLEB 1RPRA 4FVMA 2QA4V 5H9CA 4JI4B 3AK1A 1YEWA 3JAWB 5B3SB 4EB6B 5LGUA 4DV4O 2G38A 4X66O 4UUJC 1OJHA 4UXNA 1HW7A 1KQSU 3LDEA 3LDCA 2P4VA 3ZRWA 1FFXA 3QVNA 4DXWA 3M7MX 2PF4E 3WB0A 4H44B 3SPHA 1NI8A 4RUEA 2K1EA 3JALA 4DV2O 1M57C 1JCHA 2R70A 4D7TA 1J5EB 4DYLA 3VQXA 4KFMA 2H3OA 1HNZO 4JI8B 2GBOA 3IFXA 4PA6A 1L1FA 3UQ8A 4QPJA 2ZE5A 2CTWA 3JAWA 4EB6A 1Q81W 3RYIA 3CYOA 3OEHG 3IC7A 3C3SA 2VQEB 4LFBO 4JAVA 4DV1B 2EULA 4YIPA 1NR1A 2PGGA 3ICXA 4UVBA 1JVMA 2CTRA 2KG7A 3HKEB 2PY5A 4NTXA 2R9AA 1H2SB 1D5AA 1VQNV 5LMUO 1FXVA 3TJTA 1ORQC 4JI4O 4KP4A 4PI0A 4DR1B 1AB3A 3K06A 3W7UA 1RSOB 1JJ2U 3Q4HB 2PTMA 2QE7G 2N05A 2RCVA 3APOA 5LGNA 5EYPB 2A0LA 5LBQA 3IC9A 4F4LA 4UCTA 2WLKA 1FS0G 1BS3A 4YJ2A 4QNHB 4JI8O 4TV9B 4MS2A 3JD2A 2FTKA 2WLLA 2EIKB 2B1GA 3SPGA 1NJIW 1AI5A 1Y76B 5LHGA 1SQQH 1HWYA 1JQ0A 1WA8A 2ZT9B 3SJQC 1XI1A 2EJRA 1M9NA 2YIBD 2EX3A 4JTCB 2ARHA 4DV5B 3Q4HA 4TSFG 1IBMB 4JYAB 4QJFB 1E1RG 4LF8B 4X65B 4QE7A 2R72A 1GM8A 2QWPB 3CC4V 3B09A 2VQEO 2NR5A 2WAMA 5LL6Y 4IYIA 4PA4A 1YJNV 1N4CA 2WWWA 1XHZA 4O4IA 1N0NA 5KHKA 3I55V 4GT1A 2QSAA 3H1HH 3CJHA 2X6AA 1QLEC 1LNQA 3G71V 4NVPA 4P9OA 4DR1O 2UXCB 3OFNG 1XHXA 2M6YA 3CB2A 1WB8A 3N2KB 3WFVA 4OX9B 1NU1H 1K97A 3OMNB 1VF7A 2AXTZ 5JQGB 2E5LB 4X1KB 1V55C 3ZHUA 1G8MA 3IJ4A 3KZIZ 3A0BZ 3ETQA 5CBHA 5L3CA 3RFRA 4JI0O 3SGIA 1SQGA 1PPJH 2OT5A 3T2MA 3M8AA 3ZMTA 3JD3A 2ZR3A 1I7FA 1MZFA 3CCSV 4DK1A 4GX2A 2IM9A 1KKCA 4DV5O 1IBMO 4GCZA 2XHBA 4UCRA 4JYAO 4LF8O 4NTWA 1JOYA 4X65O 4O2BB 4B3SO 2YXYA 5JQGA 3AG1B 4X1KA 3H9VA 2HHHO 2UUAB 3TETA 3WB1A 2QTOA 5IJ0B 3M99B 1S0VA 3AG2B 1DLBA 1XBLA 3CCVV 1YJ9V 1N8RW 4PA7A 1V9PA 1N32O 1OCRB 1HNXO 3OM3B 4JYCA 4MSWC 2VRZA 2B1IA 2VWKA 1AR1B 1XQ8A 2A06H 4NTYA 1Q7YW 1S76D 3OTFA 3ZN1A 3O9OA 1B06A 3F7VC 3ASOB 3ABLB 4O2BA 5DECA 2LJ2A 1XMOB 4H13B 4EKWA 2XAQA 2LW1A 3QO7A 3LSSA 3OR7C 3ZHVA 5IJ0A 2O57A 3RYHB 4U3FH 3D3IA 2DMXA 2EIKC 4B3RB 2EIMB 3U0ZA 2C2AA 3ABUA 1XOUA 3OGCC 3OE7G 3MHHC 4BWAA 2AHZA 4F6RB 1R6KA 4I50B 5L3GA 2EILB 3CD6V 2PZSA 1WNSA 3ABKB 3FD9A 2LFSA 2WLIB 1PL0A 3RYHA 1KD1W 4J7JA 4BR6A 2IJHA 1Y74B 1GH6A 2BCCH 3OAAG 3GVMA 2AZ0A 2PI4A 5KA6A 4P2ZA 1Q82W 1WLEA 4F6RA 5BMVB 4I50A 1TGOA 2LO1A 5ITZB 1OCOC 3JSNA 1VQLV 2WLIA 5EIBC 1XMOO 1VEWA 3SPCA 1I08A 1K7DA 2M7WA 1CXZB 4CS3A 1H2LA 3A8TA 1AROP 4TQDA 3BY6A 4X8AA 3CCLV 1YVWA 2YI8A 5K1XA 1Y74A 1M90W 5DM6V 2P6JA 2RDCA 4B3RO 1Q6HA 1SETA 4LP8A 3LNNA 5J2TB 4EEQA 5BMVA 2QM4A 5JWPA 5ITZA 4BIZA 3L71H 4Z2WA 2ATKC 4O4HB 1OCZB 1BSMA 3AG1C 4B08A 2EZOA 2VWJA 3D3QA 4D7SA 4UV8A 1YDXA
chains in the Genus database with same CATH topology
2BSKA 3CJHB 3DXRB 2BSKB 3DXRA 3CJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK A;  3CJH B;  3DXR B;  2BSK B;  3DXR A;  3CJH A; 
#chains in the Genus database with same CATH topology
 1VQ8 V;  2QTS A;  5LA6 B;  5L3D A;  3MAQ A;  3K5M A;  2QM8 A;  5IYZ A;  4DK0 A;  1H8H G;  5J2T A;  1H2G A;  4JI3 B;  1MMM A;  2HVJ C;  3CPW U;  1PNM A;  4BW5 A;  3ASO C;  3ABL C;  4O4H A;  1Y4M A;  4DV6 B;  1NVP D;  5KMG B;  1KU9 A;  5KHJ A;  4UB6 Z;  3B2E E;  1GN6 A;  3R65 A;  3CRA A;  3G6E V;  5LA6 A;  1HR0 B;  4DUY B;  2EIM C;  3OD4 A;  2H8P C;  4LF9 B;  3CC2 V;  1PL4 A;  3R66 A;  5LHI A;  2ZCE A;  1BHA A;  2YS8 A;  5L3B A;  5B1A B;  3CRR A;  2XT9 A;  2WLH A;  4X20 B;  3JAM N;  1Z5V A;  3K04 A;  3BFR A;  1S72 V;  3GWK C;  3CMA V;  2VQF B;  3ZJZ A;  4CS4 A;  3ABK C;  3CXC U;  2Q8V A;  5BZB A;  1AJP A;  2Y48 A;  3TXS A;  1MOF A;  1S77 D;  2A79 B;  4IIJ A;  4RQE A;  3BA8 A;  5B5E Z;  3HKD B;  2F43 G;  3HB3 B;  1OV9 A;  1U97 A;  4OPA A;  2Q5Z A;  4JGS A;  4JI3 O;  3SPJ A;  2E75 B;  1PNK A;  1ZL8 B;  4J80 A;  5IYC O;  2Y69 B;  1Y67 A;  2H94 A;  4WFE A;  1RP3 B;  5IY5 B;  3RW0 A;  1I5Y A;  2YSU B;  3EHB B;  4JAA A;  2NN4 A;  5FLX N;  3P30 A;  4ASU G;  3RYF B;  3TXQ A;  3P32 A;  1EZV H;  4H37 A;  4DV7 B;  1HR0 O;  3K9A A;  4DUY O;  1VQM V;  1KKD A;  4NKG B;  4KHP B;  1SER A;  4LF9 O;  2D3O W;  4K3A A;  2MK3 A;  3KCY A;  4JI2 O;  4TWK A;  2V4D A;  2A9H A;  3B40 A;  3ZMS A;  4CZZ A;  4OPH A;  4X9Q A;  1HP8 A;  1M56 B;  1M5I A;  4JYB A;  1EN4 A;  3OMA B;  1VQO V;  4EFB A;  3L75 H;  4R7C A;  1RFY A;  1DGS A;  1VAR A;  2K9P A;  2BOB C;  1F7Y A;  2Q4P A;  1QBZ A;  1OCZ C;  5CBG A;  4JV5 B;  4X64 B;  3BAA A;  3U11 A;  2WA3 A;  4JF3 A;  2GV9 A;  2GUZ B;  2CDY A;  3D36 A;  3FX7 A;  1AJN A;  3FAV A;  4YIO A;  2OTJ V;  3STZ C;  1SQF A;  5B1B B;  3E22 B;  1QR8 A;  1SKV A;  1ZUQ A;  1IXB A;  2BOC C;  4HBN A;  1P7G A;  4RUF A;  2Q7E A;  4WBN B;  3ZN0 A;  1ZWI C;  1EN6 A;  2A3Q A;  4LNU B;  3G4S V;  1SZT A;  1Q86 W;  4GX0 A;  2X6C A;  1I94 O;  1AP5 A;  3ZHR A;  3KCX A;  4J11 A;  1N33 B;  3K3W A;  1H2M A;  3WU2 Z;  1GM9 A;  4IYH A;  2IW5 A;  4FFK A;  2HG5 C;  2AHY A;  2HFE C;  3HR0 A;  5E79 Z;  1S5H C;  1ZX3 A;  1PM9 A;  4ZBM A;  4LF5 O;  2Y4U A;  3E22 A;  4PDM A;  3JCU Z;  4DV7 O;  4KXR A;  1YTF B;  5CA0 B;  1GRJ A;  2DYR B;  2EJ7 A;  4QPK A;  4KHP O;  2Q6A A;  5F2V O;  5B1A C;  3UO2 A;  1CPY A;  2PYJ A;  4WBN A;  3ZCC A;  1VMG A;  1AR4 A;  2ZD9 A;  1R6T A;  5FNV B;  4CC5 A;  4OXS A;  4FLZ A;  1MZE A;  2DWE C;  3I56 V;  4UV9 A;  2DW4 A;  3BEH A;  1SS3 A;  1KYO F;  4JV5 O;  4X64 O;  2CAZ C;  2HR3 A;  2JEX A;  3SYO A;  1WPX A;  2ZR2 A;  3P3P A;  4MTO A;  4FLT A;  3VQW A;  5C93 A;  1EBO A;  5CA0 A;  5H6Q A;  4FJC C;  5K1P A;  2XTA A;  2JGD B;  2KSD A;  4DR4 B;  1S3J A;  4WFG A;  4MTF A;  3ZRS A;  2QKA A;  4JI1 B;  1K73 W;  2DJV A;  3F5W C;  1MSW D;  5AG2 A;  1QLN A;  5KUK A;  2WPD G;  1BT8 A;  5IY5 C;  3OMI B;  1DK1 A;  5KX5 B;  1K5Q A;  1N33 O;  3E8H A;  2QR4 A;  1UFI A;  1YIT V;  3ZHS A;  3CC7 V;  3D36 C;  2AW9 A;  1WB7 A;  3G67 A;  1NH2 B;  2D2C B;  3BCC H;  1R3I C;  3K79 A;  2EZP A;  3CCJ V;  1B3Q A;  5FPO A;  1J5E O;  2UUB B;  3QG5 A;  3HKE A;  1BQ0 A;  4QGP A;  2FML A;  2JGD A;  4DR5 B;  5KAF Z;  4HYO A;  5JVD B;  1F4M A;  4I0X B;  3TK1 A;  1M56 C;  1JFF B;  4X62 B;  1L0N H;  2YIC A;  3CCR V;  4GLX A;  3ASN B;  5KX5 A;  2RN9 A;  4LWS B;  1RSO A;  5TIS Z;  1W59 A;  1RM1 B;  4ZHQ B;  3SDL A;  4I5S A;  4J10 A;  5FPR A;  5EYP A;  1SQP H;  1G4Y B;  3E8G A;  1NR7 A;  1TVK B;  3C3T A;  4DV1 O;  4PHZ A;  5EIB D;  1XIL A;  1FXK B;  1SC5 B;  1VIB A;  1XNR B;  5KHG A;  4TV9 A;  5JVD A;  4I0X A;  4CS2 A;  5A9G A;  1JFF A;  5DED A;  1WP8 A;  1R6N A;  1R3J C;  1TUE B;  3CCQ V;  1Y76 A;  4LF7 B;  5B3S C;  2JVD A;  1QCE A;  1YSC A;  4LWS A;  2ETN A;  4TV8 B;  2JJ2 G;  1X59 A;  4WFH A;  4ZHQ A;  5H2F Z;  4WFA V;  4YXW G;  4QIW F;  1SQB H;  4KL1 A;  1L0L H;  4ICG A;  3HKB B;  3L72 H;  1FXK A;  2XUM A;  4PA3 A;  2WSS G;  2CE4 A;  3OGI B;  5IDJ A;  4PA9 A;  4WFF A;  2DYR C;  3ZED A;  3JCZ A;  4K8X A;  2DWD C;  4FK5 C;  2CTQ A;  1Z2G A;  2UUB O;  4DR5 O;  1BE3 H;  2DOS A;  3ETE A;  1QU7 A;  2R9I A;  3N2G B;  4B3T B;  1AVM A;  2ZNI A;  2DN9 A;  3GWO A;  1NTM H;  1SQV H;  4TV8 A;  1SA0 B;  1M1K W;  2QKC A;  3N2K A;  4DR3 B;  1NT2 B;  1Q8I A;  2JRI A;  2GDS A;  4PD4 F;  2AZ2 A;  3H01 A;  3KKY A;  3HKB A;  4L87 A;  1GK9 A;  1FAF A;  3T1H B;  3K5O A;  3BVO A;  5GW7 A;  2YC0 A;  1XNR O;  4N23 A;  1B6Q A;  5KA5 A;  3N2G A;  3X2Q B;  1R3K C;  2YID A;  2W6I G;  4LF7 O;  3AG7 A;  1JMK C;  3L74 H;  3A0H Z;  3ZS8 C;  4I55 B;  4W4K A;  3SJC C;  1CEZ A;  2UXC O;  4KUM A;  3KG2 A;  3SJB C;  5LGT A;  4A5U B;  3L73 H;  1JJO A;  3ZHQ A;  1K9M W;  4OX9 O;  3ZMV A;  2QJ1 A;  3VQV A;  2E5L O;  2Z3Y A;  4GKJ B;  2ILM A;  3J80 N;  1OZ0 A;  3CRC A;  4ZI7 B;  3FYE B;  2Q7H A;  4UCO A;  3JSL A;  1JA8 A;  4B3T O;  1RPO A;  3J81 N;  2JDI G;  1JPX A;  4FLX A;  4TT3 G;  1RM1 C;  4I55 A;  1MA1 A;  4WF9 V;  2NLJ C;  1FJG B;  5IE9 A;  3QNE A;  4LF6 B;  1Q5O A;  4ZKI A;  4JYY A;  4RAI A;  1GTO A;  1BHB A;  3AG4 B;  3ZRV A;  4E2L A;  1FXK C;  2IU0 A;  3T1H O;  4WCE V;  1EZJ A;  1EN5 A;  2UUA O;  4NB5 A;  1IUR A;  1GM7 A;  1VQK V;  4ZI7 A;  3CCM V;  3K58 A;  4O4J B;  3B8N A;  1NQT A;  3ZMU A;  2CGN A;  3LSQ A;  5BY1 A;  3MHS C;  3MD0 A;  3E86 A;  3LSU A;  1MNG A;  3CXH F;  3JD4 A;  3H1L H;  4FPP A;  4CH3 A;  4IGG A;  1ROP A;  1A32 A;  1XEQ A;  1IBL B;  2PUS A;  2F4V B;  3T1C A;  3SYP A;  2P90 A;  1IXM A;  3SJA C;  2FL4 A;  3QO5 A;  1ZLZ A;  2EIN B;  4O4J A;  1XMQ B;  2HP8 A;  1K5S A;  1VF5 B;  5CBF A;  2P4K A;  3CSX A;  4G28 B;  4FM1 A;  2OYQ A;  1F4N A;  1I0H A;  4NR1 A;  2UXX A;  2WLN A;  1NBM G;  3BHP A;  3DSQ A;  3ZMZ A;  4XDJ A;  4DUZ B;  4BIO A;  1HNW B;  2UU9 B;  1R73 A;  1BQZ A;  1KEC A;  1SRY A;  3TCU A;  3QO8 A;  4K8Z A;  4I7Z B;  3BA9 A;  1Y66 A;  1UPG A;  5HFM A;  4J9Z B;  3AG2 C;  4ZIB A;  5IJ9 B;  1PV0 A;  2ZM6 B;  1L8D A;  4CC6 A;  1P4R A;  3CRQ A;  3H1J H;  1OCR C;  1BGY H;  4GX5 A;  3RVZ A;  3F7Y C;  1R3L C;  4CH4 A;  4LBE C;  1XL6 A;  2ZIN A;  2IH3 C;  4X88 A;  1YXB A;  2CK3 G;  1BCC H;  5D5Q A;  4MVR A;  4JZG A;  3CX5 F;  4R6Z A;  5EBW C;  4DV3 B;  1FPO A;  1JX9 A;  5BXZ A;  1EM1 A;  2CGO A;  3SYQ A;  4J41 A;  4MVU A;  1N34 B;  4GUN A;  5B66 Z;  4TOI A;  2F93 B;  4DR6 B;  3OT7 A;  4LCU C;  2EIL C;  3W7X A;  1F23 A;  2IBZ H;  1VF6 A;  3AG4 C;  2PI5 A;  5JJN B;  1M57 B;  1HNW O;  1ZSP A;  1XDC A;  3BRC A;  2UU9 O;  4NXM B;  5KMG A;  3RGB A;  1W0J G;  2Q0A A;  3T1Y B;  3RYC B;  1O9G A;  2EIJ B;  1GN4 A;  4AQY B;  1P84 F;  3J7A U;  3CCU V;  4PJ0 Z;  4JI6 B;  3AEI A;  2E74 B;  2JK5 C;  4EFE A;  4HAM A;  2QKS A;  5IT9 N;  4GYC B;  3WG7 B;  4FZ1 A;  1DTO A;  4UFZ A;  2Z0A A;  4P9P A;  4H33 A;  2QEX V;  4DW0 A;  4X20 A;  4J7K A;  4Z1M G;  2OIG A;  4HNA B;  2ZXW B;  1WAZ A;  2YIA A;  1H38 A;  4DO2 A;  4X89 A;  4BIU A;  3DTU B;  4MTX A;  4DV6 O;  1MSD A;  3W7W A;  3RYC A;  3SYA A;  1S5J A;  4X1Y B;  3UM7 A;  2XOK G;  2QGN A;  1E1Q G;  3HKD A;  4DV3 O;  2CTP A;  3DC5 A;  4DV4 B;  4U7O A;  1AI7 A;  4XDL A;  1ZL8 A;  4HNA A;  1Q6U A;  1BMF G;  3K57 A;  2LFR A;  4RWU A;  3JD1 A;  4DR6 O;  4DV0 B;  3ZRX A;  1VQ9 V;  1THZ A;  3CEI A;  2BSK B;  5LP6 B;  4U3J B;  2VQF O;  2FB5 A;  3LUT B;  4TUY B;  3AG3 B;  2QWO B;  2ZE6 A;  1W2B U;  3TGU H;  1QR9 A;  4X1Y A;  1HNZ B;  3FKS G;  4E4E A;  3THO A;  4CH5 A;  2LP7 A;  3RYF A;  4JI7 B;  2LGQ A;  2WLJ A;  1QHT A;  4DRX B;  2Y0P A;  3IGA C;  3W7S A;  1G6U A;  1W0K G;  3JAR B;  5KUM A;  5EBM C;  2FYU H;  1VP7 A;  3ABT A;  2N74 A;  3CE2 A;  3VQY A;  2W0F C;  3ZRW B;  4LFB B;  3U10 A;  5LP6 A;  2BSK A;  1GN3 A;  1XNQ B;  4LR3 A;  2CH7 B;  2P22 C;  1VF6 C;  4TUY A;  2UXB B;  4UCS A;  3JAL B;  3B4S A;  4I4T B;  4RQF A;  2XAJ A;  2XAF A;  3FB7 C;  4OGQ B;  3E2E A;  2GUZ A;  3DC6 A;  5GTH Z;  4UCV A;  4PDR A;  1LR1 A;  1Q43 A;  1NZ6 A;  4DRX A;  3D8C A;  1YIJ V;  1KB9 F;  2LQT A;  3JAR A;  4H0L B;  1VQP V;  3S3X A;  5D5P A;  1FFT B;  3RYI B;  3ZX6 A;  5J9P C;  4LNU A;  2R9R B;  2CH7 A;  4DV0 O;  3CP1 A;  5L3F A;  1KMI Z;  4I4T A;  2ZDI A;  3K59 A;  1PKX A;  1K92 A;  1D2D A;  1V55 B;  2EIJ C;  2V7Q G;  5B1N A;  1VQ4 V;  2JS3 A;  2KG7 B;  3UT5 B;  5LOV B;  2KQX A;  1NH2 D;  5JH7 B;  1NTK H;  4JI7 O;  3WG7 C;  4U7N A;  2DYS B;  3NXS A;  4MT8 A;  5H6R A;  4IHJ B;  4O2A B;  2QDO A;  2WLM A;  5DN6 G;  1NS1 A;  2XAG A;  5L3E A;  2ZXW C;  2VS0 A;  3K5L A;  5FNV A;  1AI4 A;  2ZIO A;  2Y69 C;  2YEV B;  1XNQ O;  1XL4 A;  2QWQ B;  2UXB O;  5KAI Z;  1QVG U;  2QWR B;  3UT5 A;  5LOV A;  4YJ2 B;  5GTI Z;  5JH7 A;  4R8C A;  4FLU A;  2Q9L A;  1TUB B;  2F1M A;  4F6E A;  2WLL B;  3JAK B;  5H5N A;  4FM2 A;  4DW1 A;  1GMG A;  4IHJ A;  4O2A A;  1WA8 B;  4MVM A;  1PP9 H;  4LH6 A;  4FMT A;  1AR5 A;  1KC8 W;  1AJQ A;  2PYL A;  5CN0 A;  2GSM B;  4CBC A;  2Y0I A;  1OHH G;  2YEV A;  2JGU A;  5LP6 C;  3F5T A;  3QTC A;  4JI5 B;  3UO3 A;  2UXD B;  3AG3 C;  4LFC B;  3ZHT A;  2Q73 A;  2Q68 A;  4NYK A;  2GTS A;  4O4I B;  2RNB A;  2YUA A;  1K33 A;  4JI0 B;  3OR6 C;  2JJ1 G;  3STL C;  5LMN B;  3CJH B;  4UCU A;  1TUB A;  1US6 A;  2N04 A;  1N36 B;  1KP2 A;  4AIL C;  3JAK A;  5B1B C;  5EBL C;  2XND G;  3ETD A;  3CHX A;  2P7T C;  3BAB A;  4DR4 O;  4R50 A;  2OWO A;  5BR8 B;  2BTQ B;  4XDK A;  4JI1 O;  2Z5U A;  1HDJ A;  3GB7 C;  2E3C A;  4B3S B;  4MW8 A;  5KLV H;  3EXA A;  1R1B A;  2W6J G;  2ZDI C;  2B5U A;  2HHH B;  1PNL A;  4I9Q A;  2CUG A;  1TVK A;  3OUF A;  3S3W A;  2YDE A;  3EFF K;  4O4L B;  1EFR G;  3RWR D;  4QE9 A;  1N32 B;  1HNX B;  3L70 H;  1K4D C;  1FYJ A;  3A2F A;  3K9S A;  2BTQ A;  2JIZ G;  4X62 O;  1FXH A;  4NXN B;  1OCO B;  1AP6 A;  2ZKO A;  1WPB A;  4P30 A;  4BW9 A;  4JI5 O;  1IDS A;  1IBK B;  2UXD O;  4LFC O;  5C8Y B;  4K0K B;  1XRE A;  4RO2 A;  1CP9 A;  3SPI A;  4YHH B;  4O4L A;  1OCC B;  4LFA B;  3FB6 C;  4B7K A;  1YHQ V;  1P49 A;  3JD0 A;  5LMN O;  1D5N A;  3DXR B;  4DR7 B;  1N36 O;  1F51 A;  2QM7 A;  3RN4 A;  5IWA B;  2DYS C;  3MDS A;  4PEL A;  1DF4 A;  2YIB A;  5JJJ B;  1J95 A;  1FKA O;  3FB8 C;  2HJD A;  5CA1 B;  5HFL A;  4Q6G A;  2IJJ A;  2ITC C;  3K5N A;  3SYC A;  3CRM A;  5BR8 O;  3JAT B;  4IL6 Z;  1ENV A;  1WJZ A;  1SA0 A;  1XUQ A;  1K34 A;  5B1O A;  5C8Y A;  2LW7 A;  2YI9 A;  3EVK A;  3APQ A;  4G27 B;  1YJW V;  1FD9 A;  1GN2 A;  4MVQ A;  1BL8 A;  1SF9 A;  3DXR A;  3E8F A;  3H1K H;  4JTA B;  3T4D A;  1GO3 F;  4MVS A;  2ADP A;  3ML0 A;  2QWN B;  5CA1 A;  1TAE A;  5EC1 C;  5CMU A;  1YF2 A;  2JEU A;  3CS5 A;  4G2K A;  3JAT A;  2OTL V;  4FZ0 A;  3JAS B;  2HKO A;  4JZ2 A;  1KUQ A;  3ASN C;  4NXN O;  5EZY B;  5J2U B;  1K8A W;  4LH7 A;  4MTG A;  4K35 A;  5LHH A;  4ZOL B;  1IBK O;  2YXL A;  4K0K O;  1I5X A;  4JTD B;  4DR3 O;  4YHH O;  2BTO A;  2IU3 A;  2ITD C;  2ZE7 A;  4LFA O;  1PD3 A;  5CB4 B;  3B8M A;  4N21 A;  1B04 A;  4DR7 O;  3RT3 C;  4L8J A;  1H2K A;  5JJE B;  5IWA O;  3ABM B;  1YCI A;  5FL7 G;  3DGE A;  3FB5 C;  2W0X A;  1TA8 A;  3JAS A;  5JCO A;  3ZBH A;  4CH6 A;  1QVF U;  5EZY A;  1LUW A;  4MW3 A;  5J2U A;  2ZE8 A;  3PN1 A;  2RJZ A;  4ZOL A;  1MAB G;  5EK0 A;  1URF A;  5A2Q N;  2B9Z A;  4UVC A;  4FIP C;  3E35 A;  1WP7 A;  5CB4 A;  5LYJ B;  5IYB O;  3UCS C;  3BPZ A;  2Y4T A;  5CA3 A;  4I9W A;  2L35 A;  4GKJ O;  3UKM A;  1LUV A;  2KB1 A;  1COW G;  2LGW A;  1NTZ H;  3G6B A;  2L6L A;  3I5D A;  4FFB B;  1H2N A;  2ZNJ A;  1UJW B;  3RBZ A;  2UUC B;  1S5L Z;  3OTO B;  4AI8 A;  4MVZ A;  1FJG O;  4MVO A;  3K0G A;  4PV1 B;  4FLY A;  2EBO A;  3NR7 A;  4UB8 Z;  4LF6 O;  1OCC C;  2XAH A;  4FM0 A;  5LYJ A;  2X7R B;  3VOU A;  4PI2 A;  5IYZ B;  5LXT B;  3P3N A;  2IJK A;  4W4L A;  2F23 A;  2Q0O C;  2F66 C;  3IAY A;  4GZR B;  2FKX A;  2ADQ B;  1IVS A;  2HJF C;  1K4C C;  3X2Q C;  4B7E A;  3O65 A;  2F95 B;  3RVY A;  1ZTE A;  3OUS A;  2JS5 A;  1DF5 A;  1QNM A;  4FFB A;  2BE3 A;  3PJS K;  1X4T A;  3ZIA G;  3OW2 U;  2IH1 C;  3K08 A;  3FFQ A;  2RQ6 A;  1NKD A;  4UVA A;  1ZAU A;  3A0R A;  2DQ3 A;  4XBF A;  2GTA A;  4FLV A;  4TQF A;  1T5E A;  5LXT A;  3ETG A;  1AIL A;  2KKW A;  1IBL O;  2F4V O;  2OIE A;  2OCC B;  1V54 B;  5IJ9 A;  3QF7 A;  3CWB H;  5JCO C;  1Y6X A;  3T4Z A;  2ZIM A;  1XMQ O;  2IJI A;  4J9Y B;  4YY3 B;  2NNU A;  3LDD A;  1K3E A;  4YJ3 B;  3CME V;  2E76 B;  2P67 A;  4GKK B;  4IIJ B;  4PDV A;  2UUC O;  3OEE G;  4X1I B;  3OTO O;  2P06 A;  4BAY A;  4HZ3 A;  4DUZ O;  3SR2 C;  2HVK C;  2Q67 A;  2UXN A;  4JI2 B;  3E89 A;  3ABM C;  1KP3 A;  1M93 A;  1VQ5 V;  1YZB A;  2ODM A;  4DR2 B;  1P7B A;  3H1I H;  4D6T H;  2DQ0 A;  2WA4 A;  2ZM6 O;  2XAS A;  1G1X B;  5IYD O;  1GAX A;  1N0J A;  1NVP B;  4YJ3 A;  4J42 A;  4LF4 B;  1Q90 D;  1GKF A;  4X1I A;  3VBB A;  3AK3 A;  4Z1V A;  4JAS A;  1AI6 A;  5GON B;  3LNM B;  5KHI A;  2X6B A;  2ZQM A;  1MG1 A;  3E8B A;  1Q6I A;  4PDL A;  2HEP A;  1JR9 A;  4GX1 A;  3L9D A;  4FLW A;  1SES A;  1O9H A;  1SZX A;  4WFB V;  3JYC A;  4ABM A;  4B3M B;  2Q7G A;  1YI2 V;  2EIN C;  1I94 B;  4X66 B;  3E83 A;  3FYI B;  1N34 O;  3CCE V;  4YY3 O;  2OCH A;  3G80 A;  1SQX H;  4Q20 A;  4JPR A;  4GKK O;  1WN7 A;  4C7U A;  5GON A;  4DV2 B;  3FAV B;  2DE0 X;  3WB2 A;  4LF5 B;  3HKC B;  2X0L A;  2YXH A;  3AK2 A;  4NXM O;  3T1Y O;  2HLD G;  4AQY O;  5KHH A;  1U96 A;  1BZK A;  4JI6 O;  1Z5W A;  4DR2 O;  1Q3E A;  3C90 A;  2P5O A;  1KBH A;  1VQ6 V;  1YTF D;  3K0D A;  1IZ3 A;  4J7Z A;  4JAU A;  3W7T A;  2A7W A;  4IT5 A;  5E1A C;  4LF4 O;  1FFX B;  1M4U A;  1QQC A;  2AGA A;  3N27 A;  4U3J A;  3K03 A;  2Q69 A;  3HKC A;  1H8E G;  5EC2 C;  1VQ7 V;  1E79 G;  4AHC A;  1IX9 A;  2V1D A;  4LC1 A;  2RMK B;  2OCC C;  3B77 A;  5LMU B;  1V54 C;  2GHY A;  2MW2 B;  3HPL C;  4B3M O;  1QLE B;  1RPR A;  4FVM A;  2QA4 V;  5H9C A;  4JI4 B;  3AK1 A;  1YEW A;  3JAW B;  5B3S B;  4EB6 B;  5LGU A;  4DV4 O;  2G38 A;  4X66 O;  4UUJ C;  1OJH A;  4UXN A;  1HW7 A;  1KQS U;  3LDE A;  3LDC A;  2P4V A;  3ZRW A;  1FFX A;  3QVN A;  4DXW A;  3M7M X;  2PF4 E;  3WB0 A;  4H44 B;  3SPH A;  1NI8 A;  4RUE A;  2K1E A;  3JAL A;  4DV2 O;  1M57 C;  1JCH A;  2R70 A;  4D7T A;  1J5E B;  4DYL A;  3VQX A;  4KFM A;  2H3O A;  1HNZ O;  4JI8 B;  2GBO A;  3IFX A;  4PA6 A;  1L1F A;  3UQ8 A;  4QPJ A;  2ZE5 A;  2CTW A;  3JAW A;  4EB6 A;  1Q81 W;  3RYI A;  3CYO A;  3OEH G;  3IC7 A;  3C3S A;  2VQE B;  4LFB O;  4JAV A;  4DV1 B;  2EUL A;  4YIP A;  1NR1 A;  2PGG A;  3ICX A;  4UVB A;  1JVM A;  2CTR A;  2KG7 A;  3HKE B;  2PY5 A;  4NTX A;  2R9A A;  1H2S B;  1D5A A;  1VQN V;  5LMU O;  1FXV A;  3TJT A;  1ORQ C;  4JI4 O;  4KP4 A;  4PI0 A;  4DR1 B;  1AB3 A;  3K06 A;  3W7U A;  1RSO B;  1JJ2 U;  3Q4H B;  2PTM A;  2QE7 G;  2N05 A;  2RCV A;  3APO A;  5LGN A;  5EYP B;  2A0L A;  5LBQ A;  3IC9 A;  4F4L A;  4UCT A;  2WLK A;  1FS0 G;  1BS3 A;  4YJ2 A;  4QNH B;  4JI8 O;  4TV9 B;  4MS2 A;  3JD2 A;  2FTK A;  2WLL A;  2EIK B;  2B1G A;  3SPG A;  1NJI W;  1AI5 A;  1Y76 B;  5LHG A;  1SQQ H;  1HWY A;  1JQ0 A;  1WA8 A;  2ZT9 B;  3SJQ C;  1XI1 A;  2EJR A;  1M9N A;  2YIB D;  2EX3 A;  4JTC B;  2ARH A;  4DV5 B;  3Q4H A;  4TSF G;  1IBM B;  4JYA B;  4QJF B;  1E1R G;  4LF8 B;  4X65 B;  4QE7 A;  2R72 A;  1GM8 A;  2QWP B;  3CC4 V;  3B09 A;  2VQE O;  2NR5 A;  2WAM A;  5LL6 Y;  4IYI A;  4PA4 A;  1YJN V;  1N4C A;  2WWW A;  1XHZ A;  4O4I A;  1N0N A;  5KHK A;  3I55 V;  4GT1 A;  2QSA A;  3H1H H;  3CJH A;  2X6A A;  1QLE C;  1LNQ A;  3G71 V;  4NVP A;  4P9O A;  4DR1 O;  2UXC B;  3OFN G;  1XHX A;  2M6Y A;  3CB2 A;  1WB8 A;  3N2K B;  3WFV A;  4OX9 B;  1NU1 H;  1K97 A;  3OMN B;  1VF7 A;  2AXT Z;  5JQG B;  2E5L B;  4X1K B;  1V55 C;  3ZHU A;  1G8M A;  3IJ4 A;  3KZI Z;  3A0B Z;  3ETQ A;  5CBH A;  5L3C A;  3RFR A;  4JI0 O;  3SGI A;  1SQG A;  1PPJ H;  2OT5 A;  3T2M A;  3M8A A;  3ZMT A;  3JD3 A;  2ZR3 A;  1I7F A;  1MZF A;  3CCS V;  4DK1 A;  4GX2 A;  2IM9 A;  1KKC A;  4DV5 O;  1IBM O;  4GCZ A;  2XHB A;  4UCR A;  4JYA O;  4LF8 O;  4NTW A;  1JOY A;  4X65 O;  4O2B B;  4B3S O;  2YXY A;  5JQG A;  3AG1 B;  4X1K A;  3H9V A;  2HHH O;  2UUA B;  3TET A;  3WB1 A;  2QTO A;  5IJ0 B;  3M99 B;  1S0V A;  3AG2 B;  1DLB A;  1XBL A;  3CCV V;  1YJ9 V;  1N8R W;  4PA7 A;  1V9P A;  1N32 O;  1OCR B;  1HNX O;  3OM3 B;  4JYC A;  4MSW C;  2VRZ A;  2B1I A;  2VWK A;  1AR1 B;  1XQ8 A;  2A06 H;  4NTY A;  1Q7Y W;  1S76 D;  3OTF A;  3ZN1 A;  3O9O A;  1B06 A;  3F7V C;  3ASO B;  3ABL B;  4O2B A;  5DEC A;  2LJ2 A;  1XMO B;  4H13 B;  4EKW A;  2XAQ A;  2LW1 A;  3QO7 A;  3LSS A;  3OR7 C;  3ZHV A;  5IJ0 A;  2O57 A;  3RYH B;  4U3F H;  3D3I A;  2DMX A;  2EIK C;  4B3R B;  2EIM B;  3U0Z A;  2C2A A;  3ABU A;  1XOU A;  3OGC C;  3OE7 G;  3MHH C;  4BWA A;  2AHZ A;  4F6R B;  1R6K A;  4I50 B;  5L3G A;  2EIL B;  3CD6 V;  2PZS A;  1WNS A;  3ABK B;  3FD9 A;  2LFS A;  2WLI B;  1PL0 A;  3RYH A;  1KD1 W;  4J7J A;  4BR6 A;  2IJH A;  1Y74 B;  1GH6 A;  2BCC H;  3OAA G;  3GVM A;  2AZ0 A;  2PI4 A;  5KA6 A;  4P2Z A;  1Q82 W;  1WLE A;  4F6R A;  5BMV B;  4I50 A;  1TGO A;  2LO1 A;  5ITZ B;  1OCO C;  3JSN A;  1VQL V;  2WLI A;  5EIB C;  1XMO O;  1VEW A;  3SPC A;  1I08 A;  1K7D A;  2M7W A;  1CXZ B;  4CS3 A;  1H2L A;  3A8T A;  1ARO P;  4TQD A;  3BY6 A;  4X8A A;  3CCL V;  1YVW A;  2YI8 A;  5K1X A;  1Y74 A;  1M90 W;  5DM6 V;  2P6J A;  2RDC A;  4B3R O;  1Q6H A;  1SET A;  4LP8 A;  3LNN A;  5J2T B;  4EEQ A;  5BMV A;  2QM4 A;  5JWP A;  5ITZ A;  4BIZ A;  3L71 H;  4Z2W A;  2ATK C;  4O4H B;  1OCZ B;  1BSM A;  3AG1 C;  4B08 A;  2EZO A;  2VWJ A;  3D3Q A;  4D7S A;  4UV8 A;  1YDX A; 
#chains in the Genus database with same CATH homology
 2BSK A;  3CJH B;  3DXR B;  2BSK B;  3DXR A;  3CJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...