3CJHB

Tim8-tim13 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
NSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 21
structure length 59
sequence length 59
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhB00
2BSKB 3DXRA 3CJHA 3CJHB 3DXRB 2BSKA
chains in the Genus database with same CATH superfamily
2P4VA 1XL4A 3AG2C 2RNBA 2B5UA 3CJHB 4DR3O 2ZR2A 5EZYA 2LW1A 1MNGA 1D5AA 2DE0X 3ETQA 2UU9B 2QM4A 3K0DA 1EFRG 4P9PA 1XL6A 1NR7A 1Y4MA 2JS3A 1QLEB 1TA8A 1F23A 1R3JC 2GTAA 1VQ6V 5LGUA 2JDIG 1Y76A 3ZHRA 2AGAA 1G1XB 5GONA 3SPCA 4LWSA 4DV2B 5IYCO 2QE7G 1KKCA 3CCQV 4DR4O 1N32O 4JI3O 1KU9A 1SS3A 3JALA 3MD0A 1I5XA 2Y69B 3D3IA 5CA0B 3TK1A 4I50A 1K4CC 1VEWA 2GDSA 1QBZA 3N2KB 4H33A 2XAFA 3B40A 1CXZB 4GZRB 3RYHA 4JTDB 4DYLA 1OCCB 4FFBB 1NTMH 4LFAO 4LFBB 2M6YA 1N33O 2ZNIA 1IX9A 3N2GB 4O4HB 5FNVB 1XNRO 1OCRB 5CMUA 2QKAA 2AHYA 4WBNB 5F2VO 1R3KC 1N34B 3QG5A 3JCUZ 3MDSA 3PJSK 3FKSG 3T2MA 5JJNB 4ABMA 5LYJB 1M56B 2KB1A 3KZIZ 3JATA 2PTMA 5LXTB 4FM2A 3K04A 2Q0OC 4NR1A 1AP6A 1F4NA 3KG2A 5EC2C 1Q86W 4KFMA 3JD4A 2N04A 1K34A 1I94O 3E86A 3L71H 4MVQA 2QWRB 1RSOA 1TVKA 3HKEA 1NS1A 2AW9A 5IY5B 1VQ8V 2ETNA 5B1BC 5LGNA 3AG3B 3H9VA 1COWG 2EBOA 4LC1A 3TGUH 5BR8B 1OV9A 1R6TA 3I5DA 4KHPO 4LNUA 3G4SV 2F66C 2XNDG 4EB6A 3HB3B 1FD9A 2BE3A 4J9ZB 2F23A 4BIZA 1Z2GA 3UT5B 4RWUA 1W2BU 1WN7A 1OCOC 5IE9A 3JYCA 1SA0B 1WAZA 4JI7O 4FM0A 4LF7O 4JYCA 2PZSA 1VQKV 4PI0A 1TGOA 2XAJA 2A3QA 4NXMO 1VMGA 1PD3A 5J2TA 4U7OA 4TV9B 3E8FA 2JVDA 5LMUB 4DR1O 1VQNV 3CPWU 3W7SA 4JAAA 4FLXA 2P7TC 5CN0A 1FAFA 1BL8A 2BTOA 4K8XA 2CH7B 2PYLA 4U3FH 4B7KA 3H1HH 4PELA 1HR0O 3ZEDA 2QM7A 4JTAB 2UXNA 5JCOA 2LGWA 4J7ZA 4NB5A 2PY5A 2DYSC 2O57A 1S5LZ 1NH2B 3RWRD 3SDLA 3K9SA 3CCUV 4X64B 1YCIA 4DR2B 4JI0B 1GKFA 3LUTB 4OX9O 2VRZA 4C7UA 1RFYA 1HNZB 4DR7O 3HKCB 3SPHA 3CXHF 4DUYO 1AR1B 4AI8A 3H1IH 4J7KA 5EBWC 1V55B 5FLXN 2QDOA 5IJ9A 1VF7A 1OCZC 2BTQA 2XASA 3OTOB 2DWDC 3WG7B 3CCMV 2B9ZA 1XDCA 3P30A 3ZN0A 3OGCC 4FPPA 1Q5OA 3HKBA 3VQVA 4PA6A 4B3RO 4WFEA 4BW9A 4NTYA 4HZ3A 4YJ2A 4B3TO 4I4TB 1KKDA 4OPAA 2KG7A 4UCUA 4CC5A 3BA9A 3ZHUA 4LF4O 4DR6O 3EFFK 3U11A 1PP9H 4ZHQB 1XI1A 2P06A 3LSUA 1NQTA 2HHHO 1RP3B 3VBBA 2B1IA 4TV8A 1HP8A 2OTLV 4B3SB 2VQEB 3T1HB 3CCRV 4DV0B 4Z1VA 3OGIB 5KX5A 1WPXA 5LGTA 5JH7B 2ITDC 1DK1A 2ZD9A 1BS3A 3WB0A 1PV0A 2QWPB 1SESA 1E1QG 2ZXWC 4H37A 2YUAA 4O4IB 1KD1W 3IC7A 1R3IC 1OCOB 2RN9A 2UXCO 3BEHA 4LF6O 2ZM6O 3ZMTA 2E5LO 1GN2A 4O4LB 1SF9A 1Q81W 2QTSA 4X65B 1U96A 1R73A 3ZN1A 1Q3EA 4X1KA 3JD2A 1X4TA 3FYEB 2YS8A 3ABKB 5EIBC 1YJWV 1AILA 4UB8Z 4CS2A 4DV7B 3BABA 4GX1A 3O9OA 4JI8O 4CZZA 1IURA 1NBMG 5KUKA 4LH6A 4JI2B 1WB7A 1H8EG 5HFMA 3WB1A 4GKJB 1JQ0A 4K8ZA 1Q8IA 1KUQA 2W6JG 4NXNB 3L75H 2D2CB 1UFIA 2GUZB 2PI5A 2MK3A 2NN4A 2QWOB 5IYZB 3CRCA 2DYSB 2V4DA 3JSLA 4L8JA 3P3NA 2K1EA 4I55B 4BAYA 4JI1B 1K92A 5KAFZ 3E89A 3Q4HA 4O4JA 3RBZA 5GTIZ 4J7JA 1AB3A 3RN4A 2XAHA 2Q8VA 3E22B 4BIOA 1AJPA 4GX2A 3QNEA 1N36O 4QNHB 1YJ9V 3K5NA 5DM6V 5CA0A 3B4SA 3SYAA 3N2KA 5H9CA 4TUYA 2YI8A 1GH6A 4E4EA 2XUMA 3SPJA 4FFBA 1JR9A 5AG2A 3CE2A 1OZ0A 3ASOB 2Y0IA 1SC5B 1S72V 1L0LH 2P6JA 3AG7A 3JD0A 3T1YO 3SR2C 1GMGA 3N2GA 4O4HA 5FNVA 3L74H 4QIWF 3FB8C 2UXDB 5J2UB 1VQPV 1KB9F 4JTCB 4WBNA 5KHJA 4JI4B 2JRIA 2YIBD 1H8HG 3K79A 1NT2B 5KHHA 4B3MB 4CS3A 1J5EB 2HEPA 4LH7A 2WAMA 4JV5O 1AR5A 3M99B 1SZXA 2YI9A 2HVJC 3LDEA 5LXTA 3AEIA 1TUBB 1XOUA 2ZXWB 4E2LA 1MSWD 1QLEC 1HNWB 1QVFU 1GM9A 5L3CA 2OIGA 3BFRA 4NKGB 2HFEC 4GKKO 2UUCB 4AQYB 3TJTA 4DR5O 1FPOA 1QHTA 4X1IB 4WCEV 2Q4PA 4PDMA 5JVDB 2Y69C 4MVMA 5L3BA 3CHXA 5B3SB 1KMIZ 4I0XB 2E3CA 4JASA 5LA6B 3EHBB 4DW1A 4UCRA 1ZWIC 5JQGB 1P49A 2Z3YA 1OCCC 3M8AA 1YZBA 1V9PA 2ZIMA 1US6A 1IXBA 2CDYA 1WP7A 2IBZH 4IGGA 5L3DA 3EVKA 3UT5A 3A0BZ 3VOUA 4EFBA 5K1XA 5A9GA 3KCYA 4PI2A 1SA0A 1OCRC 3CYOA 2Q7EA 1E1RG 4XDJA 3BPZA 2LO1A 1ZSPA 4F6RB 4DO2A 2R9AA 3ZJZA 4WFFA 1K73W 1F4MA 1GN6A 4TV9A 4QPKA 3H1LH 2OT5A 5CBFA 4LF9O 4TT3G 1M56C 1D5NA 4RQEA 1K3EA 3JAMN 1S5JA 2X7RB 3D36C 1FYJA 5LMNO 2CH7A 2JEXA 4MTOA 2Y0PA 4TSFG 3OD4A 3OMNB 4FLZA 1VQ5V 5EBLC 3THOA 1K8AW 2VS0A 1NR1A 3JAKB 1LR1A 1XMQB 4QGPA 1BE3H 3OE7G 2UUBO 4DV5O 1B06A 3SPGA 4OXSA 3BY6A 4QPJA 5IY5C 1BT8A 1P4RA 4GX0A 3AG3C 4FZ1A 3E8GA 3HKCA 2H3OA 2BOCC 3GVMA 4X89A 1WNSA 4UCTA 1H2MA 5LHGA 3DXRB 4JYBA 1LUWA 4PA7A 2PUSA 5CBGA 4TOIA 5BY1A 1P84F 1WA8B 3L9DA 2WSSG 3W7UA 4R50A 3CRRA 3J7AU 2DJVA 2QGNA 5FPOA 4Z2WA 1NVPD 1PNLA 4I4TA 1XNQB 2YEVB 1ENVA 3HPLC 1YXBA 2KSDA 3MHSC 3CRAA 1GO3F 4JAUA 4FLYA 4DRXB 4ZHQA 5B5EZ 1M5IA 2F95B 1BCCH 3K59A 1R3LC 2WLIB 2FB5A 2VQFB 4W4LA 3B8NA 4YHHB 1XQ8A 3DGEA 3DC5A 3IC9A 1YJNV 1VIBA 2DQ3A 5IWAO 1EZVH 3FB7C 3C3SA 3G67A 4MW8A 2BSKB 1AI5A 3G71V 4JZ2A 1AR4A 5BMVB 5JH7A 2QKCA 4UCVA 1URFA 3HR0A 4FLTA 2IJKA 1BHAA 3QF7A 2A7WA 3IJ4A 3CCEV 1WB8A 1JX9A 4YIPA 1M57C 4O2AB 4TQDA 3N27A 2F4VO 2D3OW 4O4IA 2F1MA 5B1AB 1I5YA 3SJQC 1P7GA 1SQGA 4O4LA 2CTWA 4DV3B 5LMUO 2WLNA 1V55C 4FVMA 4PA9A 1Z5VA 3CRQA 3WG7C 2R70A 3B77A 4I5SA 3ZHVA 4N23A 1FFXB 4H13B 2PGGA 2W0FC 4R7CA 4DV4B 1OHHG 2ZKOA 1JFFB 3GWKC 3VQYA 2N05A 2ILMA 1ZAUA 2WLLB 3QO5A 2F43G 4I7ZB 1QVGU 3JAWB 4FM1A 1VQ4V 4MTFA 3GWOA 1FXKB 2IW5A 4DR2O 1XILA 2GUZA 2JGDA 4H0LB 4JPRA 1QCEA 4JI0O 2LGQA 4P2ZA 5IYZA 1MSDA 1XMOO 2XOKG 3CP1A 5KAIZ 4I55A 2ITCC 1FJGO 4YY3B 2LW7A 3ZHSA 1GM8A 2KKWA 1JOYA 3P3PA 4DR3B 1NTKH 1XREA 5ITZB 3E22A 4F4LA 3AK3A 2FKXA 1SQBH 3I55V 1SQXH 3L72H 4JI6O 3OMAB 3FB6C 3H1JH 2A06H 2RDCA 3X2QC 5BZBA 2Z0AA 3VQXA 2A9HA 3G6BA 2GBOA 2QA4V 4BW5A 1DF4A 2P4KA 2LJ2A 4EKWA 4WF9V 2ZT9B 2ZINA 1DGSA 2IH1C 4DR4B 4R6ZA 1N32B 4JI3B 3AG1C 4J42A 4UVBA 4B3SO 3ABKC 2VQEO 1V54C 3T1HO 1MOFA 3QTCA 1RM1B 5HFLA 1RPRA 1RPOA 4PDRA 3JASB 2Q0AA 3JARB 1N33B 2E76B 2ZDIC 1IXMA 3OEHG 5IJ0B 5E79Z 2Q9LA 4HBNA 1XNRB 4WFHA 1WP8A 3D3QA 3K58A 4YJ3B 4U7NA 2EIKB 2A79B 1AP5A 5IT9N 4B7EA 1Q82W 1QR8A 1TUBA 1Y74B 3F5TA 1YTFD 3ZX6A 1M1KW 1M57B 2AZ2A 4X65O 4HNAB 4GT1A 2YXYA 2K9PA 1Y6XA 1J95A 2BOBC 5EYPB 5H6QA 5D5PA 1IBLO 1G8MA 2JJ2G 1AJQA 3OEEG 4X1IA 5JVDA 2Q7GA 1M90W 2R9IA 2L35A 5CA3A 2OIEA 4I0XA 3G6EV 4XBFA 5LA6A 4NXNO 1I94B 3FD9A 2QWNB 4IHJB 5JQGA 4TQFA 4MW3A 2CK3G 1VF6C 3K3WA 3ASOC 1BZKA 4AILC 3JD1A 2H94A 1O9HA 2H8PC 4X8AA 2RMKB 3K5OA 4KHPB 2YSUB 1O9GA 4B08A 3WB2A 1VP7A 3K9AA 3T1CA 4OGQB 4F6RA 4DV6O 1IBKO 4I9QA 1Q90D 2RCVA 5EC1C 4X66O 1WPBA 4ZOLB 2QKSA 3TCUA 3ZRVA 4G27B 2CGNA 1L0NH 2JJ1G 3I56V 4JGSA 4ASUG 1VQOV 2ZNJA 4WFBV 2PYJA 4LF7B 3GB7C 2NNUA 5GONB 4JYAO 5C8YB 3X2QB 4PA3A 3W7XA 4IYHA 5DN6G 4IIJB 1EN4A 1KYOF 3FB5C 1S76D 5H6RA 3JAKA 4WFAV 4I50B 4DR1B 3ZS8C 4EFEA 4XDLA 3UKMA 4JI4O 3AG1B 3E35A 3P32A 3IAYA 2BCCH 1NVPB 1HR0B 1V54B 4DUZB 1FXVA 3K06A 5B3SC 3APOA 4K0KO 2WLMA 4JYYA 1HWYA 3A0RA 5L3FA 3G80A 5KMGA 3DXRA 1KP3A 1W0JG 1M9NA 5KHKA 4GCZA 4LR3A 2CTRA 3A0HZ 5LHHA 4AHCA 1FXHA 1HNXB 4OX9B 1BMFG 3CJHA 1WA8A 3SPIA 3U0ZA 3B09A 5BXZA 4LF5O 2EIJB 4JI5B 1HNWO 1TAEA 1ZL8B 1BHBA 2YEVA 2UUCO 5J9PC 2JS5A 5DEDA 3CMAV 4DRXA 3AG4B 2F93B 1JCHA 2WLIA 3CXCU 1DLBA 4IYIA 1K33A 3LDDA 1NTZH 1XBLA 4B3TB 3RYFB 1XHXA 2HJDA 4ZI7B 1K5SA 5EBMC 1VQLV 4LF4B 2UXXA 5LP6C 2B1GA 1AJNA 4X88A 5BMVA 1AI7A 3TETA 4UB6Z 1QR9A 2W0XA 3HKDB 2JGUA 3RVYA 1R6NA 4HAMA 3ZBHA 1NU1H 5IYDO 4GYCB 2Y4UA 3FAVB 4O2AA 3ZRWB 3CCSV 1GK9A 3E83A 2Q5ZA 1Y67A 3TXQA 4JZGA 1K97A 4J11A 5B66Z 2EJ7A 1QU7A 4R8CA 2ZQMA 5B1OA 3W7TA 2M7WA 1YVWA 4U3JB 1L1FA 3KKYA 2HVKC 2RJZA 3LNNA 5LYJA 4BR6A 3ML0A 3D36A 2E5LB 1FFXA 1THZA 2EZPA 1MABG 1JFFA 1K9MW 1QLNA 3CS5A 2WLLA 3JAWA 1FXKA 1AI4A 5IYBO 1DTOA 3SYQA 3B2EE 3ZMUA 2UXBB 4JI8B 4MVRA 2JIZG 3CCJV 1IBMO 4PDLA 3H1KH 3STLC 3CSXA 1H2LA 3ETDA 4IT5A 2Y48A 5ITZA 4LFCB 1Z5WA 4G28B 4K3AA 1X59A 3CEIA 2FTKA 1FKAO 2UU9O 4GLXA 2XT9A 3DC6A 2EILC 1S3JA 5JJJB 1T5EA 1F7YA 1S0VA 2LQTA 2DOSA 5B1AC 2G38A 3S3WA 3CC2V 4TWKA 1KBHA 3SYCA 4A5UB 2HP8A 1N8RW 1PL4A 1I08A 5FL7G 4ICGA 4DV2O 4IL6Z 2EZOA 3ZRSA 2IU3A 2Q7HA 4YHHO 1ZLZA 1I7FA 3IGAC 4NTWA 3AK1A 3EXAA 4O2BB 1UPGA 3JASA 2UUAB 3JARA 2OYQA 3F7YC 5IJ0A 5CBHA 4PJ0Z 1MMMA 2LFSA 3UM7A 4LFBO 4Z1MG 4YJ3A 5LP6B 2FYUH 2YIDA 1FXKC 1G6UA 1H2KA 4FJCC 2QWQB 2ADQB 2YIAA 5IDJA 1N0NA 2HR3A 3BAAA 2FMLA 4MT8A 4MVZA 2ODMA 2VWKA 1JVMA 4RAIA 4DV1B 4DV3O 4UUJC 5A2QN 2CTQA 4HNAA 5CA1B 2WLHA 1N34O 1BSMA 2A0LA 5EYPA 2ZR3A 2OWOA 1B6QA 3LSSA 3SJAC 1YDXA 4FK5C 5GTHZ 1SQPH 2X6AA 1JMKC 3RVZA 3ZMZA 4DV4O 1ZUQA 3K5MA 3OUFA 4PV1B 3RFRA 3JCZA 4X1KB 3C90A 4X1YB 3OR7C 4IHJA 5TISZ 3ETEA 4PA4A 3ABMC 4NYKA 2P5OA 3KCXA 2P22C 2GHYA 1YF2A 3CCLV 5EK0A 2XHBA 2Q6AA 2ZCEA 2NR5A 4Q6GA 1IVSA 2P90A 2IJJA 3SGIA 3BA8A 4D7TA 2DMXA 5BR8O 2QEXV 1HDJA 2RQ6A 3PN1A 1RM1C 2WA3A 5L3GA 1GTOA 2L6LA 5GW7A 1CP9A 1ROPA 4ZOLA 1EZJA 3Q4HB 4O4JB 3H01A 5L3EA 2HG5C 2EIKC 2JEUA 4LF8B 5C8YA 4GX5A 1CEZA 3QO8A 3UCSC 2EILB 4MVSA 4X9QA 3ICXA 4UVAA 4IIJA 3BCCH 4ZIBA 5LOVB 3C3TA 4DK0A 3RW0A 4MSWC 4LF9B 4LCUC 1KP2A 5B1NA 2EINB 1MA1A 4LBEC 1PPJH 4TUYB 5H2FZ 4CC6A 4UCSA 4X62B 5JWPA 5LMNB 3L73H 4CS4A 3UQ8A 1M4UA 2NLJC 3OAAG 1EBOA 1GRJA 1NKDA 4X20B 2OCCB 1Q43A 1PNKA 2IH3C 1VQ9V 1R6KA 2V7QG 2UUBB 5KHGA 3JD3A 4DV5B 2WPDG 2ZDIA 4RUEA 1MG1A 1OJHA 4Q20A 1QQCA 2CE4A 2DWEC 4X64O 1H2GA 4XDKA 2Q67A 3ZIAG 1ZL8A 3ABLC 1HNZO 4BWAA 5LBQA 3AK2A 3JSNA 2HJFC 5H5NA 3ZMVA 3VQWA 1H2SB 1JPXA 3F7VC 1IZ3A 3OTOO 2DYRB 4KL1A 3RYFA 4ZI7A 2CGOA 2QJ1A 3T4DA 1JJOA 1R1BA 4N21A 4CH3A 4BIUA 1G4YB 3FFQA 1YITV 3ABMB 1F51A 2IJHA 3HKDA 1VF6A 2Q69A 4RUFA 5K1PA 4GUNA 3O65A 2DN9A 3FAVA 3ZRWA 5IWAB 3AG2B 3ASNC 5J2UA 1VQMV 2PF4E 4DV0O 2QTOA 1Y66A 4LFAB 4KUMA 3ZCCA 5EIBD 2YICA 4U3JA 3K03A 2F4VB 2N74A 4CH5A 4MS2A 3RYCB 3BRCA 3L70H 2EIJC 5D5QA 1K4DC 1MZFA 3R66A 4QE7A 4D7SA 3CB2A 3FX7A 1K5QA 1N0JA 4J41A 4EEQA 3AG4C 4LP8A 2EJRA 4DUZO 1PM9A 1FS0G 1S77D 4DV7O 3RYIB 1AVMA 5KLVH 3ZHQA 3LNMB 3DSQA 2R72A 5E1AC 4RQFA 4JI2O 1BQ0A 3OW2U 3OR6C 4GKJO 1HNXO 1B3QA 4H44B 1XMOB 3WFVA 4JI5O 3SJCC 1SQFA 1FJGB 2AZ0A 1WLEA 3OTFA 5CB4B 4JI1O 4UV8A 4P30A 1KECA 1JA8A 3U10A 1YIJV 4FLUA 3ABLB 5EZYB 4FMTA 4FFKA 4JI6B 4MVUA 3NXSA 2OCHA 1E79G 1NJIW 4O2BA 1AI6A 4PHZA 1EN5A 4ZKIA 1Y76B 1U97A 1YEWA 4JI7B 4LWSB 3CC4V 4QJFB 3OM3B 4F6EA 5B1BB 2EIMC 4YIOA 4NXMB 1BQZA 4FZ0A 3CD6V 5LP6A 1WJZA 3ZHTA 2LFRA 4OPHA 3T4ZA 3TXSA 3JALB 4DK1A 1W59A 1PL0A 2UXDO 3RYHB 5JCOC 4MTXA 2ARHA 1DF5A 5CA1A 4B3MO 3F5WC 1CPYA 3ASNB 1J5EO 1SETA 1M93A 3OT7A 1SQQH 4G2KA 4P9OA 3DTUB 2WLKA 2ZE5A 2QM8A 1LNQA 4PDVA 1ZTEA 2R9RB 2FL4A 1SRYA 4X1YA 4FIPC 5DECA 3ABTA 4DR7B 5KUMA 5C93A 4MTGA 4DUYB 4YXWG 2UXBO 1GM7A 1IBLB 4PD4F 3UO3A 3OUSA 1Q6UA 1KC8W 4AQYO 1IDSA 1YHQV 3UO2A 1VF5B 2ATKC 3JATB 1D2DA 3LSQA 3CWBH 3OFNG 4LFCO 1K7DA 4KP4A 1VARA 2JGDB 4B3RB 3SJBC 2YC0A 4J80A 4I9WA 4UCOA 3E8BA 1RSOB 1TVKB 3A2FA 3HKEB 2C2AA 2MW2B 2ZIOA 2BSKA 4JF3A 3ZRXA 4DR6B 5FPRA 1MZEA 1YSCA 2HHHB 2Z5UA 3QVNA 3WU2Z 4DXWA 1S5HC 3ZMSA 4LNUB 4DV6B 4D6TH 1IBKB 2CTPA 2E74B 2X0LA 1OCZB 4X66B 4QE9A 3OMIB 4EB6B 4KXRA 5KA6A 5LOVA 4MVOA 2P67A 2ZE7A 4UVCA 4NTXA 3RT3C 3QO7A 4J9YB 2Q68A 3J81N 4UV9A 1SQVH 2ZE8A 4JYAB 4RO2A 1TUEB 3CX5F 2ZE6A 1FFTB 1NI8A 1PKXA 2UUAO 4X20A 2YDEA 2DW4A 3R65A 1LUVA 2YXLA 2AXTZ 2UXCB 4LF6B 3STZC 5J2TB 2ZM6B 1SERA 5JJEB 2GSMB 1XMQO 1Q6HA 3CC7V 3SYOA 2ADPA 2EIMB 4J10A 4DV1O 3CRMA 2IJIA 1ZX3A 2X6CA 4K0KB 2VWJA 5LHIA 2XTAA 3W7WA 2W6IG 2PI4A 1YI2V 1SKVA 4FLWA 3IFXA 2X6BA 1L8DA 3E2EA 1XEQA 3ETGA 4LF5B 4HYOA 2Q73A 2EX3A 2QR4A 3RGBA 2WWWA 1JJ2U 3BHPA 1XHZA 1Q6IA 4JAVA 2EULA 1PNMA 2WLJA 2YIBA 5IJ9B 2HLDG 1XNQO 3D8CA 1BGYH 2JK5C 2BTQB 2KQXA 4UXNA 2QSAA 2AHZA 2XAQA 2EINC 2IU0A 1NH2D 3A8TA 1N36B 1H2NA 3ABUA 3HKBB 2HKOA 2CUGA 2VQFO 4ZBMA 1EM1A 4YJ2B 2OCCC 4FLVA 1YTFB 1ORQC 2KG7B 2IM9A 3LDCA 1QNMA 2GTSA 5KA5A 2OTJV 2YXHA 1H38A 4LF8O 3K0GA 3FYIB 2V1DA 3T1YB 2Y4TA 4CH4A 5LL6Y 4NVPA 4CBCA 4TV8B 1B04A 4K35A 3MHHC 3RYCA 2XAGA 3CCVV 2LP7A 2WA4A 1N4CA 2E75B 5KHIA 2GV9A 5KX5B 3NR7A 1P7BA 4DW0A 1Y74A 1EN6A 3B8MA 4X62O 1AROP 4UFZA 4CH6A 3BVOA 4JV5B 3K57A 3APQA 2DQ0A 1KQSU 2DYRC 3RYIA 3CMEV 3S3XA 4WFGA 3M7MX 3E8HA 1GN4A 1NZ6A 1I0HA 2CAZC 4W4KA 1Q7YW 1SZTA 1GAXA 3K08A 1VQ7V 1UJWB 1GN3A 3J80N 1IBMB 4GKKB 4L87A 3MAQA 1W0KG 1HW7A 4DR5B 3K5LA 1XUQA 3SYPA 5CB4A 1A32A 5KMGB 4YY3O
chains in the Genus database with same CATH topology
2BSKB 3DXRA 3CJHA 3CJHB 3DXRB 2BSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK B;  3DXR A;  3CJH A;  3CJH B;  3DXR B;  2BSK A; 
#chains in the Genus database with same CATH topology
 2P4V A;  1XL4 A;  3AG2 C;  2RNB A;  2B5U A;  3CJH B;  4DR3 O;  2ZR2 A;  5EZY A;  2LW1 A;  1MNG A;  1D5A A;  2DE0 X;  3ETQ A;  2UU9 B;  2QM4 A;  3K0D A;  1EFR G;  4P9P A;  1XL6 A;  1NR7 A;  1Y4M A;  2JS3 A;  1QLE B;  1TA8 A;  1F23 A;  1R3J C;  2GTA A;  1VQ6 V;  5LGU A;  2JDI G;  1Y76 A;  3ZHR A;  2AGA A;  1G1X B;  5GON A;  3SPC A;  4LWS A;  4DV2 B;  5IYC O;  2QE7 G;  1KKC A;  3CCQ V;  4DR4 O;  1N32 O;  4JI3 O;  1KU9 A;  1SS3 A;  3JAL A;  3MD0 A;  1I5X A;  2Y69 B;  3D3I A;  5CA0 B;  3TK1 A;  4I50 A;  1K4C C;  1VEW A;  2GDS A;  1QBZ A;  3N2K B;  4H33 A;  2XAF A;  3B40 A;  1CXZ B;  4GZR B;  3RYH A;  4JTD B;  4DYL A;  1OCC B;  4FFB B;  1NTM H;  4LFA O;  4LFB B;  2M6Y A;  1N33 O;  2ZNI A;  1IX9 A;  3N2G B;  4O4H B;  5FNV B;  1XNR O;  1OCR B;  5CMU A;  2QKA A;  2AHY A;  4WBN B;  5F2V O;  1R3K C;  1N34 B;  3QG5 A;  3JCU Z;  3MDS A;  3PJS K;  3FKS G;  3T2M A;  5JJN B;  4ABM A;  5LYJ B;  1M56 B;  2KB1 A;  3KZI Z;  3JAT A;  2PTM A;  5LXT B;  4FM2 A;  3K04 A;  2Q0O C;  4NR1 A;  1AP6 A;  1F4N A;  3KG2 A;  5EC2 C;  1Q86 W;  4KFM A;  3JD4 A;  2N04 A;  1K34 A;  1I94 O;  3E86 A;  3L71 H;  4MVQ A;  2QWR B;  1RSO A;  1TVK A;  3HKE A;  1NS1 A;  2AW9 A;  5IY5 B;  1VQ8 V;  2ETN A;  5B1B C;  5LGN A;  3AG3 B;  3H9V A;  1COW G;  2EBO A;  4LC1 A;  3TGU H;  5BR8 B;  1OV9 A;  1R6T A;  3I5D A;  4KHP O;  4LNU A;  3G4S V;  2F66 C;  2XND G;  4EB6 A;  3HB3 B;  1FD9 A;  2BE3 A;  4J9Z B;  2F23 A;  4BIZ A;  1Z2G A;  3UT5 B;  4RWU A;  1W2B U;  1WN7 A;  1OCO C;  5IE9 A;  3JYC A;  1SA0 B;  1WAZ A;  4JI7 O;  4FM0 A;  4LF7 O;  4JYC A;  2PZS A;  1VQK V;  4PI0 A;  1TGO A;  2XAJ A;  2A3Q A;  4NXM O;  1VMG A;  1PD3 A;  5J2T A;  4U7O A;  4TV9 B;  3E8F A;  2JVD A;  5LMU B;  4DR1 O;  1VQN V;  3CPW U;  3W7S A;  4JAA A;  4FLX A;  2P7T C;  5CN0 A;  1FAF A;  1BL8 A;  2BTO A;  4K8X A;  2CH7 B;  2PYL A;  4U3F H;  4B7K A;  3H1H H;  4PEL A;  1HR0 O;  3ZED A;  2QM7 A;  4JTA B;  2UXN A;  5JCO A;  2LGW A;  4J7Z A;  4NB5 A;  2PY5 A;  2DYS C;  2O57 A;  1S5L Z;  1NH2 B;  3RWR D;  3SDL A;  3K9S A;  3CCU V;  4X64 B;  1YCI A;  4DR2 B;  4JI0 B;  1GKF A;  3LUT B;  4OX9 O;  2VRZ A;  4C7U A;  1RFY A;  1HNZ B;  4DR7 O;  3HKC B;  3SPH A;  3CXH F;  4DUY O;  1AR1 B;  4AI8 A;  3H1I H;  4J7K A;  5EBW C;  1V55 B;  5FLX N;  2QDO A;  5IJ9 A;  1VF7 A;  1OCZ C;  2BTQ A;  2XAS A;  3OTO B;  2DWD C;  3WG7 B;  3CCM V;  2B9Z A;  1XDC A;  3P30 A;  3ZN0 A;  3OGC C;  4FPP A;  1Q5O A;  3HKB A;  3VQV A;  4PA6 A;  4B3R O;  4WFE A;  4BW9 A;  4NTY A;  4HZ3 A;  4YJ2 A;  4B3T O;  4I4T B;  1KKD A;  4OPA A;  2KG7 A;  4UCU A;  4CC5 A;  3BA9 A;  3ZHU A;  4LF4 O;  4DR6 O;  3EFF K;  3U11 A;  1PP9 H;  4ZHQ B;  1XI1 A;  2P06 A;  3LSU A;  1NQT A;  2HHH O;  1RP3 B;  3VBB A;  2B1I A;  4TV8 A;  1HP8 A;  2OTL V;  4B3S B;  2VQE B;  3T1H B;  3CCR V;  4DV0 B;  4Z1V A;  3OGI B;  5KX5 A;  1WPX A;  5LGT A;  5JH7 B;  2ITD C;  1DK1 A;  2ZD9 A;  1BS3 A;  3WB0 A;  1PV0 A;  2QWP B;  1SES A;  1E1Q G;  2ZXW C;  4H37 A;  2YUA A;  4O4I B;  1KD1 W;  3IC7 A;  1R3I C;  1OCO B;  2RN9 A;  2UXC O;  3BEH A;  4LF6 O;  2ZM6 O;  3ZMT A;  2E5L O;  1GN2 A;  4O4L B;  1SF9 A;  1Q81 W;  2QTS A;  4X65 B;  1U96 A;  1R73 A;  3ZN1 A;  1Q3E A;  4X1K A;  3JD2 A;  1X4T A;  3FYE B;  2YS8 A;  3ABK B;  5EIB C;  1YJW V;  1AIL A;  4UB8 Z;  4CS2 A;  4DV7 B;  3BAB A;  4GX1 A;  3O9O A;  4JI8 O;  4CZZ A;  1IUR A;  1NBM G;  5KUK A;  4LH6 A;  4JI2 B;  1WB7 A;  1H8E G;  5HFM A;  3WB1 A;  4GKJ B;  1JQ0 A;  4K8Z A;  1Q8I A;  1KUQ A;  2W6J G;  4NXN B;  3L75 H;  2D2C B;  1UFI A;  2GUZ B;  2PI5 A;  2MK3 A;  2NN4 A;  2QWO B;  5IYZ B;  3CRC A;  2DYS B;  2V4D A;  3JSL A;  4L8J A;  3P3N A;  2K1E A;  4I55 B;  4BAY A;  4JI1 B;  1K92 A;  5KAF Z;  3E89 A;  3Q4H A;  4O4J A;  3RBZ A;  5GTI Z;  4J7J A;  1AB3 A;  3RN4 A;  2XAH A;  2Q8V A;  3E22 B;  4BIO A;  1AJP A;  4GX2 A;  3QNE A;  1N36 O;  4QNH B;  1YJ9 V;  3K5N A;  5DM6 V;  5CA0 A;  3B4S A;  3SYA A;  3N2K A;  5H9C A;  4TUY A;  2YI8 A;  1GH6 A;  4E4E A;  2XUM A;  3SPJ A;  4FFB A;  1JR9 A;  5AG2 A;  3CE2 A;  1OZ0 A;  3ASO B;  2Y0I A;  1SC5 B;  1S72 V;  1L0L H;  2P6J A;  3AG7 A;  3JD0 A;  3T1Y O;  3SR2 C;  1GMG A;  3N2G A;  4O4H A;  5FNV A;  3L74 H;  4QIW F;  3FB8 C;  2UXD B;  5J2U B;  1VQP V;  1KB9 F;  4JTC B;  4WBN A;  5KHJ A;  4JI4 B;  2JRI A;  2YIB D;  1H8H G;  3K79 A;  1NT2 B;  5KHH A;  4B3M B;  4CS3 A;  1J5E B;  2HEP A;  4LH7 A;  2WAM A;  4JV5 O;  1AR5 A;  3M99 B;  1SZX A;  2YI9 A;  2HVJ C;  3LDE A;  5LXT A;  3AEI A;  1TUB B;  1XOU A;  2ZXW B;  4E2L A;  1MSW D;  1QLE C;  1HNW B;  1QVF U;  1GM9 A;  5L3C A;  2OIG A;  3BFR A;  4NKG B;  2HFE C;  4GKK O;  2UUC B;  4AQY B;  3TJT A;  4DR5 O;  1FPO A;  1QHT A;  4X1I B;  4WCE V;  2Q4P A;  4PDM A;  5JVD B;  2Y69 C;  4MVM A;  5L3B A;  3CHX A;  5B3S B;  1KMI Z;  4I0X B;  2E3C A;  4JAS A;  5LA6 B;  3EHB B;  4DW1 A;  4UCR A;  1ZWI C;  5JQG B;  1P49 A;  2Z3Y A;  1OCC C;  3M8A A;  1YZB A;  1V9P A;  2ZIM A;  1US6 A;  1IXB A;  2CDY A;  1WP7 A;  2IBZ H;  4IGG A;  5L3D A;  3EVK A;  3UT5 A;  3A0B Z;  3VOU A;  4EFB A;  5K1X A;  5A9G A;  3KCY A;  4PI2 A;  1SA0 A;  1OCR C;  3CYO A;  2Q7E A;  1E1R G;  4XDJ A;  3BPZ A;  2LO1 A;  1ZSP A;  4F6R B;  4DO2 A;  2R9A A;  3ZJZ A;  4WFF A;  1K73 W;  1F4M A;  1GN6 A;  4TV9 A;  4QPK A;  3H1L H;  2OT5 A;  5CBF A;  4LF9 O;  4TT3 G;  1M56 C;  1D5N A;  4RQE A;  1K3E A;  3JAM N;  1S5J A;  2X7R B;  3D36 C;  1FYJ A;  5LMN O;  2CH7 A;  2JEX A;  4MTO A;  2Y0P A;  4TSF G;  3OD4 A;  3OMN B;  4FLZ A;  1VQ5 V;  5EBL C;  3THO A;  1K8A W;  2VS0 A;  1NR1 A;  3JAK B;  1LR1 A;  1XMQ B;  4QGP A;  1BE3 H;  3OE7 G;  2UUB O;  4DV5 O;  1B06 A;  3SPG A;  4OXS A;  3BY6 A;  4QPJ A;  5IY5 C;  1BT8 A;  1P4R A;  4GX0 A;  3AG3 C;  4FZ1 A;  3E8G A;  3HKC A;  2H3O A;  2BOC C;  3GVM A;  4X89 A;  1WNS A;  4UCT A;  1H2M A;  5LHG A;  3DXR B;  4JYB A;  1LUW A;  4PA7 A;  2PUS A;  5CBG A;  4TOI A;  5BY1 A;  1P84 F;  1WA8 B;  3L9D A;  2WSS G;  3W7U A;  4R50 A;  3CRR A;  3J7A U;  2DJV A;  2QGN A;  5FPO A;  4Z2W A;  1NVP D;  1PNL A;  4I4T A;  1XNQ B;  2YEV B;  1ENV A;  3HPL C;  1YXB A;  2KSD A;  3MHS C;  3CRA A;  1GO3 F;  4JAU A;  4FLY A;  4DRX B;  4ZHQ A;  5B5E Z;  1M5I A;  2F95 B;  1BCC H;  3K59 A;  1R3L C;  2WLI B;  2FB5 A;  2VQF B;  4W4L A;  3B8N A;  4YHH B;  1XQ8 A;  3DGE A;  3DC5 A;  3IC9 A;  1YJN V;  1VIB A;  2DQ3 A;  5IWA O;  1EZV H;  3FB7 C;  3C3S A;  3G67 A;  4MW8 A;  2BSK B;  1AI5 A;  3G71 V;  4JZ2 A;  1AR4 A;  5BMV B;  5JH7 A;  2QKC A;  4UCV A;  1URF A;  3HR0 A;  4FLT A;  2IJK A;  1BHA A;  3QF7 A;  2A7W A;  3IJ4 A;  3CCE V;  1WB8 A;  1JX9 A;  4YIP A;  1M57 C;  4O2A B;  4TQD A;  3N27 A;  2F4V O;  2D3O W;  4O4I A;  2F1M A;  5B1A B;  1I5Y A;  3SJQ C;  1P7G A;  1SQG A;  4O4L A;  2CTW A;  4DV3 B;  5LMU O;  2WLN A;  1V55 C;  4FVM A;  4PA9 A;  1Z5V A;  3CRQ A;  3WG7 C;  2R70 A;  3B77 A;  4I5S A;  3ZHV A;  4N23 A;  1FFX B;  4H13 B;  2PGG A;  2W0F C;  4R7C A;  4DV4 B;  1OHH G;  2ZKO A;  1JFF B;  3GWK C;  3VQY A;  2N05 A;  2ILM A;  1ZAU A;  2WLL B;  3QO5 A;  2F43 G;  4I7Z B;  1QVG U;  3JAW B;  4FM1 A;  1VQ4 V;  4MTF A;  3GWO A;  1FXK B;  2IW5 A;  4DR2 O;  1XIL A;  2GUZ A;  2JGD A;  4H0L B;  4JPR A;  1QCE A;  4JI0 O;  2LGQ A;  4P2Z A;  5IYZ A;  1MSD A;  1XMO O;  2XOK G;  3CP1 A;  5KAI Z;  4I55 A;  2ITC C;  1FJG O;  4YY3 B;  2LW7 A;  3ZHS A;  1GM8 A;  2KKW A;  1JOY A;  3P3P A;  4DR3 B;  1NTK H;  1XRE A;  5ITZ B;  3E22 A;  4F4L A;  3AK3 A;  2FKX A;  1SQB H;  3I55 V;  1SQX H;  3L72 H;  4JI6 O;  3OMA B;  3FB6 C;  3H1J H;  2A06 H;  2RDC A;  3X2Q C;  5BZB A;  2Z0A A;  3VQX A;  2A9H A;  3G6B A;  2GBO A;  2QA4 V;  4BW5 A;  1DF4 A;  2P4K A;  2LJ2 A;  4EKW A;  4WF9 V;  2ZT9 B;  2ZIN A;  1DGS A;  2IH1 C;  4DR4 B;  4R6Z A;  1N32 B;  4JI3 B;  3AG1 C;  4J42 A;  4UVB A;  4B3S O;  3ABK C;  2VQE O;  1V54 C;  3T1H O;  1MOF A;  3QTC A;  1RM1 B;  5HFL A;  1RPR A;  1RPO A;  4PDR A;  3JAS B;  2Q0A A;  3JAR B;  1N33 B;  2E76 B;  2ZDI C;  1IXM A;  3OEH G;  5IJ0 B;  5E79 Z;  2Q9L A;  4HBN A;  1XNR B;  4WFH A;  1WP8 A;  3D3Q A;  3K58 A;  4YJ3 B;  4U7N A;  2EIK B;  2A79 B;  1AP5 A;  5IT9 N;  4B7E A;  1Q82 W;  1QR8 A;  1TUB A;  1Y74 B;  3F5T A;  1YTF D;  3ZX6 A;  1M1K W;  1M57 B;  2AZ2 A;  4X65 O;  4HNA B;  4GT1 A;  2YXY A;  2K9P A;  1Y6X A;  1J95 A;  2BOB C;  5EYP B;  5H6Q A;  5D5P A;  1IBL O;  1G8M A;  2JJ2 G;  1AJQ A;  3OEE G;  4X1I A;  5JVD A;  2Q7G A;  1M90 W;  2R9I A;  2L35 A;  5CA3 A;  2OIE A;  4I0X A;  3G6E V;  4XBF A;  5LA6 A;  4NXN O;  1I94 B;  3FD9 A;  2QWN B;  4IHJ B;  5JQG A;  4TQF A;  4MW3 A;  2CK3 G;  1VF6 C;  3K3W A;  3ASO C;  1BZK A;  4AIL C;  3JD1 A;  2H94 A;  1O9H A;  2H8P C;  4X8A A;  2RMK B;  3K5O A;  4KHP B;  2YSU B;  1O9G A;  4B08 A;  3WB2 A;  1VP7 A;  3K9A A;  3T1C A;  4OGQ B;  4F6R A;  4DV6 O;  1IBK O;  4I9Q A;  1Q90 D;  2RCV A;  5EC1 C;  4X66 O;  1WPB A;  4ZOL B;  2QKS A;  3TCU A;  3ZRV A;  4G27 B;  2CGN A;  1L0N H;  2JJ1 G;  3I56 V;  4JGS A;  4ASU G;  1VQO V;  2ZNJ A;  4WFB V;  2PYJ A;  4LF7 B;  3GB7 C;  2NNU A;  5GON B;  4JYA O;  5C8Y B;  3X2Q B;  4PA3 A;  3W7X A;  4IYH A;  5DN6 G;  4IIJ B;  1EN4 A;  1KYO F;  3FB5 C;  1S76 D;  5H6R A;  3JAK A;  4WFA V;  4I50 B;  4DR1 B;  3ZS8 C;  4EFE A;  4XDL A;  3UKM A;  4JI4 O;  3AG1 B;  3E35 A;  3P32 A;  3IAY A;  2BCC H;  1NVP B;  1HR0 B;  1V54 B;  4DUZ B;  1FXV A;  3K06 A;  5B3S C;  3APO A;  4K0K O;  2WLM A;  4JYY A;  1HWY A;  3A0R A;  5L3F A;  3G80 A;  5KMG A;  3DXR A;  1KP3 A;  1W0J G;  1M9N A;  5KHK A;  4GCZ A;  4LR3 A;  2CTR A;  3A0H Z;  5LHH A;  4AHC A;  1FXH A;  1HNX B;  4OX9 B;  1BMF G;  3CJH A;  1WA8 A;  3SPI A;  3U0Z A;  3B09 A;  5BXZ A;  4LF5 O;  2EIJ B;  4JI5 B;  1HNW O;  1TAE A;  1ZL8 B;  1BHB A;  2YEV A;  2UUC O;  5J9P C;  2JS5 A;  5DED A;  3CMA V;  4DRX A;  3AG4 B;  2F93 B;  1JCH A;  2WLI A;  3CXC U;  1DLB A;  4IYI A;  1K33 A;  3LDD A;  1NTZ H;  1XBL A;  4B3T B;  3RYF B;  1XHX A;  2HJD A;  4ZI7 B;  1K5S A;  5EBM C;  1VQL V;  4LF4 B;  2UXX A;  5LP6 C;  2B1G A;  1AJN A;  4X88 A;  5BMV A;  1AI7 A;  3TET A;  4UB6 Z;  1QR9 A;  2W0X A;  3HKD B;  2JGU A;  3RVY A;  1R6N A;  4HAM A;  3ZBH A;  1NU1 H;  5IYD O;  4GYC B;  2Y4U A;  3FAV B;  4O2A A;  3ZRW B;  3CCS V;  1GK9 A;  3E83 A;  2Q5Z A;  1Y67 A;  3TXQ A;  4JZG A;  1K97 A;  4J11 A;  5B66 Z;  2EJ7 A;  1QU7 A;  4R8C A;  2ZQM A;  5B1O A;  3W7T A;  2M7W A;  1YVW A;  4U3J B;  1L1F A;  3KKY A;  2HVK C;  2RJZ A;  3LNN A;  5LYJ A;  4BR6 A;  3ML0 A;  3D36 A;  2E5L B;  1FFX A;  1THZ A;  2EZP A;  1MAB G;  1JFF A;  1K9M W;  1QLN A;  3CS5 A;  2WLL A;  3JAW A;  1FXK A;  1AI4 A;  5IYB O;  1DTO A;  3SYQ A;  3B2E E;  3ZMU A;  2UXB B;  4JI8 B;  4MVR A;  2JIZ G;  3CCJ V;  1IBM O;  4PDL A;  3H1K H;  3STL C;  3CSX A;  1H2L A;  3ETD A;  4IT5 A;  2Y48 A;  5ITZ A;  4LFC B;  1Z5W A;  4G28 B;  4K3A A;  1X59 A;  3CEI A;  2FTK A;  1FKA O;  2UU9 O;  4GLX A;  2XT9 A;  3DC6 A;  2EIL C;  1S3J A;  5JJJ B;  1T5E A;  1F7Y A;  1S0V A;  2LQT A;  2DOS A;  5B1A C;  2G38 A;  3S3W A;  3CC2 V;  4TWK A;  1KBH A;  3SYC A;  4A5U B;  2HP8 A;  1N8R W;  1PL4 A;  1I08 A;  5FL7 G;  4ICG A;  4DV2 O;  4IL6 Z;  2EZO A;  3ZRS A;  2IU3 A;  2Q7H A;  4YHH O;  1ZLZ A;  1I7F A;  3IGA C;  4NTW A;  3AK1 A;  3EXA A;  4O2B B;  1UPG A;  3JAS A;  2UUA B;  3JAR A;  2OYQ A;  3F7Y C;  5IJ0 A;  5CBH A;  4PJ0 Z;  1MMM A;  2LFS A;  3UM7 A;  4LFB O;  4Z1M G;  4YJ3 A;  5LP6 B;  2FYU H;  2YID A;  1FXK C;  1G6U A;  1H2K A;  4FJC C;  2QWQ B;  2ADQ B;  2YIA A;  5IDJ A;  1N0N A;  2HR3 A;  3BAA A;  2FML A;  4MT8 A;  4MVZ A;  2ODM A;  2VWK A;  1JVM A;  4RAI A;  4DV1 B;  4DV3 O;  4UUJ C;  5A2Q N;  2CTQ A;  4HNA A;  5CA1 B;  2WLH A;  1N34 O;  1BSM A;  2A0L A;  5EYP A;  2ZR3 A;  2OWO A;  1B6Q A;  3LSS A;  3SJA C;  1YDX A;  4FK5 C;  5GTH Z;  1SQP H;  2X6A A;  1JMK C;  3RVZ A;  3ZMZ A;  4DV4 O;  1ZUQ A;  3K5M A;  3OUF A;  4PV1 B;  3RFR A;  3JCZ A;  4X1K B;  3C90 A;  4X1Y B;  3OR7 C;  4IHJ A;  5TIS Z;  3ETE A;  4PA4 A;  3ABM C;  4NYK A;  2P5O A;  3KCX A;  2P22 C;  2GHY A;  1YF2 A;  3CCL V;  5EK0 A;  2XHB A;  2Q6A A;  2ZCE A;  2NR5 A;  4Q6G A;  1IVS A;  2P90 A;  2IJJ A;  3SGI A;  3BA8 A;  4D7T A;  2DMX A;  5BR8 O;  2QEX V;  1HDJ A;  2RQ6 A;  3PN1 A;  1RM1 C;  2WA3 A;  5L3G A;  1GTO A;  2L6L A;  5GW7 A;  1CP9 A;  1ROP A;  4ZOL A;  1EZJ A;  3Q4H B;  4O4J B;  3H01 A;  5L3E A;  2HG5 C;  2EIK C;  2JEU A;  4LF8 B;  5C8Y A;  4GX5 A;  1CEZ A;  3QO8 A;  3UCS C;  2EIL B;  4MVS A;  4X9Q A;  3ICX A;  4UVA A;  4IIJ A;  3BCC H;  4ZIB A;  5LOV B;  3C3T A;  4DK0 A;  3RW0 A;  4MSW C;  4LF9 B;  4LCU C;  1KP2 A;  5B1N A;  2EIN B;  1MA1 A;  4LBE C;  1PPJ H;  4TUY B;  5H2F Z;  4CC6 A;  4UCS A;  4X62 B;  5JWP A;  5LMN B;  3L73 H;  4CS4 A;  3UQ8 A;  1M4U A;  2NLJ C;  3OAA G;  1EBO A;  1GRJ A;  1NKD A;  4X20 B;  2OCC B;  1Q43 A;  1PNK A;  2IH3 C;  1VQ9 V;  1R6K A;  2V7Q G;  2UUB B;  5KHG A;  3JD3 A;  4DV5 B;  2WPD G;  2ZDI A;  4RUE A;  1MG1 A;  1OJH A;  4Q20 A;  1QQC A;  2CE4 A;  2DWE C;  4X64 O;  1H2G A;  4XDK A;  2Q67 A;  3ZIA G;  1ZL8 A;  3ABL C;  1HNZ O;  4BWA A;  5LBQ A;  3AK2 A;  3JSN A;  2HJF C;  5H5N A;  3ZMV A;  3VQW A;  1H2S B;  1JPX A;  3F7V C;  1IZ3 A;  3OTO O;  2DYR B;  4KL1 A;  3RYF A;  4ZI7 A;  2CGO A;  2QJ1 A;  3T4D A;  1JJO A;  1R1B A;  4N21 A;  4CH3 A;  4BIU A;  1G4Y B;  3FFQ A;  1YIT V;  3ABM B;  1F51 A;  2IJH A;  3HKD A;  1VF6 A;  2Q69 A;  4RUF A;  5K1P A;  4GUN A;  3O65 A;  2DN9 A;  3FAV A;  3ZRW A;  5IWA B;  3AG2 B;  3ASN C;  5J2U A;  1VQM V;  2PF4 E;  4DV0 O;  2QTO A;  1Y66 A;  4LFA B;  4KUM A;  3ZCC A;  5EIB D;  2YIC A;  4U3J A;  3K03 A;  2F4V B;  2N74 A;  4CH5 A;  4MS2 A;  3RYC B;  3BRC A;  3L70 H;  2EIJ C;  5D5Q A;  1K4D C;  1MZF A;  3R66 A;  4QE7 A;  4D7S A;  3CB2 A;  3FX7 A;  1K5Q A;  1N0J A;  4J41 A;  4EEQ A;  3AG4 C;  4LP8 A;  2EJR A;  4DUZ O;  1PM9 A;  1FS0 G;  1S77 D;  4DV7 O;  3RYI B;  1AVM A;  5KLV H;  3ZHQ A;  3LNM B;  3DSQ A;  2R72 A;  5E1A C;  4RQF A;  4JI2 O;  1BQ0 A;  3OW2 U;  3OR6 C;  4GKJ O;  1HNX O;  1B3Q A;  4H44 B;  1XMO B;  3WFV A;  4JI5 O;  3SJC C;  1SQF A;  1FJG B;  2AZ0 A;  1WLE A;  3OTF A;  5CB4 B;  4JI1 O;  4UV8 A;  4P30 A;  1KEC A;  1JA8 A;  3U10 A;  1YIJ V;  4FLU A;  3ABL B;  5EZY B;  4FMT A;  4FFK A;  4JI6 B;  4MVU A;  3NXS A;  2OCH A;  1E79 G;  1NJI W;  4O2B A;  1AI6 A;  4PHZ A;  1EN5 A;  4ZKI A;  1Y76 B;  1U97 A;  1YEW A;  4JI7 B;  4LWS B;  3CC4 V;  4QJF B;  3OM3 B;  4F6E A;  5B1B B;  2EIM C;  4YIO A;  4NXM B;  1BQZ A;  4FZ0 A;  3CD6 V;  5LP6 A;  1WJZ A;  3ZHT A;  2LFR A;  4OPH A;  3T4Z A;  3TXS A;  3JAL B;  4DK1 A;  1W59 A;  1PL0 A;  2UXD O;  3RYH B;  5JCO C;  4MTX A;  2ARH A;  1DF5 A;  5CA1 A;  4B3M O;  3F5W C;  1CPY A;  3ASN B;  1J5E O;  1SET A;  1M93 A;  3OT7 A;  1SQQ H;  4G2K A;  4P9O A;  3DTU B;  2WLK A;  2ZE5 A;  2QM8 A;  1LNQ A;  4PDV A;  1ZTE A;  2R9R B;  2FL4 A;  1SRY A;  4X1Y A;  4FIP C;  5DEC A;  3ABT A;  4DR7 B;  5KUM A;  5C93 A;  4MTG A;  4DUY B;  4YXW G;  2UXB O;  1GM7 A;  1IBL B;  4PD4 F;  3UO3 A;  3OUS A;  1Q6U A;  1KC8 W;  4AQY O;  1IDS A;  1YHQ V;  3UO2 A;  1VF5 B;  2ATK C;  3JAT B;  1D2D A;  3LSQ A;  3CWB H;  3OFN G;  4LFC O;  1K7D A;  4KP4 A;  1VAR A;  2JGD B;  4B3R B;  3SJB C;  2YC0 A;  4J80 A;  4I9W A;  4UCO A;  3E8B A;  1RSO B;  1TVK B;  3A2F A;  3HKE B;  2C2A A;  2MW2 B;  2ZIO A;  2BSK A;  4JF3 A;  3ZRX A;  4DR6 B;  5FPR A;  1MZE A;  1YSC A;  2HHH B;  2Z5U A;  3QVN A;  3WU2 Z;  4DXW A;  1S5H C;  3ZMS A;  4LNU B;  4DV6 B;  4D6T H;  1IBK B;  2CTP A;  2E74 B;  2X0L A;  1OCZ B;  4X66 B;  4QE9 A;  3OMI B;  4EB6 B;  4KXR A;  5KA6 A;  5LOV A;  4MVO A;  2P67 A;  2ZE7 A;  4UVC A;  4NTX A;  3RT3 C;  3QO7 A;  4J9Y B;  2Q68 A;  3J81 N;  4UV9 A;  1SQV H;  2ZE8 A;  4JYA B;  4RO2 A;  1TUE B;  3CX5 F;  2ZE6 A;  1FFT B;  1NI8 A;  1PKX A;  2UUA O;  4X20 A;  2YDE A;  2DW4 A;  3R65 A;  1LUV A;  2YXL A;  2AXT Z;  2UXC B;  4LF6 B;  3STZ C;  5J2T B;  2ZM6 B;  1SER A;  5JJE B;  2GSM B;  1XMQ O;  1Q6H A;  3CC7 V;  3SYO A;  2ADP A;  2EIM B;  4J10 A;  4DV1 O;  3CRM A;  2IJI A;  1ZX3 A;  2X6C A;  4K0K B;  2VWJ A;  5LHI A;  2XTA A;  3W7W A;  2W6I G;  2PI4 A;  1YI2 V;  1SKV A;  4FLW A;  3IFX A;  2X6B A;  1L8D A;  3E2E A;  1XEQ A;  3ETG A;  4LF5 B;  4HYO A;  2Q73 A;  2EX3 A;  2QR4 A;  3RGB A;  2WWW A;  1JJ2 U;  3BHP A;  1XHZ A;  1Q6I A;  4JAV A;  2EUL A;  1PNM A;  2WLJ A;  2YIB A;  5IJ9 B;  2HLD G;  1XNQ O;  3D8C A;  1BGY H;  2JK5 C;  2BTQ B;  2KQX A;  4UXN A;  2QSA A;  2AHZ A;  2XAQ A;  2EIN C;  2IU0 A;  1NH2 D;  3A8T A;  1N36 B;  1H2N A;  3ABU A;  3HKB B;  2HKO A;  2CUG A;  2VQF O;  4ZBM A;  1EM1 A;  4YJ2 B;  2OCC C;  4FLV A;  1YTF B;  1ORQ C;  2KG7 B;  2IM9 A;  3LDC A;  1QNM A;  2GTS A;  5KA5 A;  2OTJ V;  2YXH A;  1H38 A;  4LF8 O;  3K0G A;  3FYI B;  2V1D A;  3T1Y B;  2Y4T A;  4CH4 A;  5LL6 Y;  4NVP A;  4CBC A;  4TV8 B;  1B04 A;  4K35 A;  3MHH C;  3RYC A;  2XAG A;  3CCV V;  2LP7 A;  2WA4 A;  1N4C A;  2E75 B;  5KHI A;  2GV9 A;  5KX5 B;  3NR7 A;  1P7B A;  4DW0 A;  1Y74 A;  1EN6 A;  3B8M A;  4X62 O;  1ARO P;  4UFZ A;  4CH6 A;  3BVO A;  4JV5 B;  3K57 A;  3APQ A;  2DQ0 A;  1KQS U;  2DYR C;  3RYI A;  3CME V;  3S3X A;  4WFG A;  3M7M X;  3E8H A;  1GN4 A;  1NZ6 A;  1I0H A;  2CAZ C;  4W4K A;  1Q7Y W;  1SZT A;  1GAX A;  3K08 A;  1VQ7 V;  1UJW B;  1GN3 A;  3J80 N;  1IBM B;  4GKK B;  4L87 A;  3MAQ A;  1W0K G;  1HW7 A;  4DR5 B;  3K5L A;  1XUQ A;  3SYP A;  5CB4 A;  1A32 A;  5KMG B;  4YY3 O; 
#chains in the Genus database with same CATH homology
 2BSK B;  3DXR A;  3CJH A;  3CJH B;  3DXR B;  2BSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...