3CJHB

Tim8-tim13 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
b'NSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 21
structure length 59
sequence length 59
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhB00
3CJHB 2BSKA 2BSKB 3DXRA 3DXRB 3CJHA
chains in the Genus database with same CATH superfamily
2ADQB 2R9IA 1XOUA 3SJBC 1VF5B 4KUMA 3E8GA 3CCUV 2X7RB 3L74H 4HBNA 4CS2A 3KG2A 5L3EA 4UVAA 1IBMB 1R3KC 2CGOA 1VQMV 1PNKA 2IBZH 4EFBA 3CXHF 4XBFA 3U0ZA 3VOUA 4W4LA 4DV0B 1JR9A 1SQGA 4FLYA 4BIOA 3UT5A 3OT7A 5IYCO 1YZBA 4DR2O 3QO7A 4O4IB 1F4NA 5E79Z 4DO2A 3RYCB 4G27B 4MW3A 1P84F 2CTPA 5B3SC 3TETA 3OTOO 3CWBH 3ABKB 5C8YA 3BA9A 1XQ8A 2LP7A 5IE9A 1AP6A 1JX9A 2YDEA 2GBOA 4D7SA 4JV5B 1PV0A 4JI4O 4TQDA 4DR6O 1NQTA 3CHXA 2RJZA 2HLDG 4JI7O 3JAKB 2HFEC 5FPRA 1D5NA 1VF6C 4Z1MG 2HG5C 2ATKC 1ORQC 3CCQV 3A2FA 1OCOB 4FLVA 1YJNV 2CTRA 2DWDC 5ITZA 3F7YC 1NJIW 4IHJA 2DJVA 4DV6B 2UXDB 4DV2B 2BOBC 2Y0IA 3CRQA 4GX5A 4EKWA 3RFRA 4MT8A 4C7UA 3VQXA 1H2MA 5KAIZ 3UM7A 1R6NA 3J81N 5IY5B 1HR0O 1AI7A 4K0KO 4JYCA 1FFXA 2Y69C 4LF7B 5C93A 3ZHUA 4LH6A 1QR8A 1BS3A 4TUYA 2Y69B 2LGWA 4JPRA 3AK2A 2RN9A 2QSAA 2ODMA 3OMNB 4O4HB 3CCLV 3IAYA 4MTXA 1XHZA 1Q5OA 2CE4A 3JATA 2N04A 2IH1C 4YY3B 3CCEV 4O4JA 3QG5A 4X62O 2VRZA 5CB4A 3CRAA 1GKFA 1SQFA 3LSUA 2UU9B 1I94B 1ZWIC 1GK9A 1ENVA 3MHSC 1RSOB 1Q82W 1DGSA 2XNDG 2CH7A 3JALA 3CRCA 2QA4V 3AG4C 4OPHA 3APQA 3L71H 1SF9A 2PY5A 1IURA 2YXLA 1G6UA 1PNMA 4QE9A 4DUZO 4OX9B 3OAAG 1IBLO 4U3FH 2RNBA 1IXBA 5BY1A 3GWOA 5EC1C 3BABA 3JD3A 3B77A 5JJJB 1SERA 3K04A 3DGEA 5DEDA 4W4KA 3JASA 1MG1A 5FLXN 3AG7A 1Q43A 4JI1O 4LFBO 2RQ6A 3SPJA 1YF2A 2XAJA 2EZOA 2Q5ZA 5KX5B 4PA9A 3K58A 2JS5A 4QPKA 2OIEA 2Q73A 1GN3A 3AK1A 1K34A 1DF4A 1W59A 1QCEA 4LF5O 4JTDB 4PJ0Z 1VQKV 1XBLA 5LL6Y 4LF8B 4QJFB 5CA0B 3M99B 3OM3B 1GN6A 1T5EA 1RPOA 1U97A 2W6JG 4JI2B 3RGBA 3F5WC 1VQOV 4YXWG 1J95A 5LYJB 4UUJC 2UUCB 4LFAO 2QKCA 4PI2A 1WAZA 1PNLA 3G71V 4JYAB 2ZNJA 3JSNA 1RP3B 5LOVB 2YUAA 2JEXA 5BXZA 2ZIOA 1KC8W 1QR9A 5IDJA 3ASNC 3AG2C 4DV4O 1FKAO 3H1HH 3CD6V 3OGCC 3OW2U 2LQTA 4X66O 4DR5B 4IIJB 2XHBA 1VQ5V 1F23A 4O2AB 3SPHA 1CPYA 3ETDA 1YSCA 4MTFA 5LXTB 1DF5A 4H13B 4XDLA 4D6TH 4DW1A 2XT9A 2RDCA 1ZAUA 3H1KH 1M93A 4JI3B 3VQWA 1PL0A 4NXMB 4PA3A 5CBFA 4X65B 2B5UA 3JARA 3SJCC 4K8XA 3SPGA 1IXMA 3N2KB 5IT9N 5IYZB 4LCUC 3RYHA 3GVMA 4X1YB 3DC5A 3WU2Z 1J5EO 1FD9A 1TA8A 2UXNA 1BL8A 5GW7A 3E22B 2YIDA 2VQEB 4EB6A 2N05A 1XEQA 1IBKB 3J7AU 3K79A 1BHAA 1N0NA 1WB7A 1PM9A 1Z5WA 3H01A 5LA6A 4ZHQA 2ILMA 1U96A 2BTQA 3NXSA 5LP6C 1L0LH 2JJ2G 1QLNA 4DR2B 2Y4TA 4O4LA 3CCMV 2JGDB 3ABTA 1I5YA 1K92A 2YSUB 1KB9F 1OV9A 4XDJA 2ZINA 5KHIA 1XDCA 3RBZA 2DE0X 2NNUA 4FFBA 2DYRB 1SZXA 2F1MA 1HNXB 3CCJV 3I55V 3LDDA 1V54B 4P30A 5BR8B 3SYCA 2IU0A 4I5SA 5FNVB 1HNZB 4DV7O 2A9HA 3IJ4A 1XMOO 4JI8O 4KFMA 3ZS8C 2YIBA 3QVNA 1AP5A 4QIWF 1G1XB 3C3TA 4LF6O 4H37A 3BHPA 4DUYB 4FZ0A 2LGQA 3H9VA 1HDJA 5DECA 3GB7C 4B7KA 2HVKC 1S77D 2EZPA 1TUBB 4EFEA 1DLBA 1Y74A 1KKCA 5L3BA 2IW5A 2DYSB 3I56V 3JD4A 1HP8A 3L70H 5KAFZ 1US6A 2Q7HA 1HR0B 4U3JA 4G28B 1WNSA 4TV9A 3A8TA 4NTXA 1YEWA 2E74B 5JH7A 3UT5B 5JQGA 3U11A 2JS3A 2IU3A 1SRYA 1Q6IA 3HKDA 2WA3A 3LUTB 2OTLV 3CCSV 1L1FA 1XL4A 1I0HA 4NXNB 2EIJC 5C8YB 2NR5A 2GSMB 3BA8A 3ZCCA 4I9QA 2NN4A 2CDYA 4LNUB 2EIJB 2EINC 5CBGA 1AR1B 3K0DA 5JCOA 1AI5A 5L3FA 1BGYH 2JIZG 4IYHA 4DYLA 1XUQA 4JI0O 2IJHA 1JMKC 1FFTB 3SYAA 4I0XA 2QJ1A 4UFZA 1BQZA 2XAHA 1K4CC 3D3IA 2OCHA 4FLTA 1Q90D 2YICA 5LHGA 1K5SA 4DUZB 5GONA 3TCUA 2IM9A 2ZDIC 3BEHA 3U10A 5ITZB 1H2KA 1FPOA 2A7WA 3ABLC 4IHJB 3HKBA 5GTIZ 2KB1A 1FXKC 2PGGA 3K57A 3H1IH 3ZHRA 5KA5A 2EILB 3ABLB 2ZXWB 4JI1B 3ASOB 1OCRC 2H94A 2N74A 3LDEA 5B1NA 1QVGU 1H2SB 4RQFA 4LWSA 4PV1B 3OUSA 4GKJB 1CP9A 1JCHA 2ZIMA 4TUYB 1GN4A 1GH6A 3A0BZ 1V9PA 3ETGA 4A5UB 1GM8A 1S5HC 1LR1A 2WLLA 4GLXA 1NS1A 3A0RA 1MMMA 2XAFA 1O9HA 4Q6GA 3B09A 3MD0A 2ARHA 2DOSA 3WB1A 3JATB 2QE7G 2YEVA 3CRRA 1L0NH 4WFAV 4LFAB 5CB4B 3J80N 4MVSA 1THZA 5IWAB 4ZI7A 5JJNB 1COWG 1AJNA 5CMUA 4MS2A 1ZTEA 4B3MB 4HYOA 1WP7A 4CH6A 2R9AA 3ABUA 4I4TA 4DV5O 1RM1B 3K5MA 4AHCA 1PKXA 3G80A 2CH7B 4HNAA 5EBWC 3JALB 1DK1A 3UQ8A 3ZMSA 2EJRA 2HKOA 4J80A 4UCRA 4FM2A 4B3TB 2QM7A 2WLIA 2WLMA 5EBMC 2YXYA 5FL7G 1UPGA 1FS0G 4YHHO 4FVMA 4FLZA 2AHYA 2Q6AA 3BVOA 1AR4A 2Q0OC 1SQPH 3K3WA 3TXSA 4QE7A 3VBBA 3JASB 1QBZA 3ABKC 3T1YB 2LW1A 2ZE7A 1EFRG 4DR1B 2EJ7A 1K73W 4GX0A 2UXBB 2ADPA 4DR7O 3ABMB 3CXCU 4AQYO 1N33B 4FLWA 1BHBA 1H2LA 3STZC 2VQFB 2ZNIA 2A06H 3LDCA 1N36B 2V7QG 3P3PA 4TQFA 4DV3O 5CA1B 4B3RO 1YITV 1TVKA 5J2UA 1K3EA 2UXXA 1AB3A 1I5XA 3JD1A 3W7TA 1MNGA 4PI0A 4LFCO 3EHBB 1YI2V 2YS8A 2Z0AA 1OCCB 4WBNA 1Q86W 2K9PA 3OFNG 1SQXH 1OCOC 2KG7A 5AG2A 4J7ZA 3ZHSA 1P49A 2Q7GA 4DR3O 2P06A 3G67A 2F4VO 2Q67A 4YJ2B 1Y76A 2E75B 4X89A 2R70A 5A9GA 1JVMA 3HKCA 3ZHVA 1NTMH 5IY5C 2LJ2A 2E5LO 3FAVA 4JI6B 3BCCH 3OTFA 1M57B 1Q6UA 3JAWA 2OWOA 4B3SB 1SESA 1Y67A 4X64B 4JI8B 3BFRA 3D36C 2ITDC 5B1AB 5H2FZ 1A32A 3FKSG 3AG1B 3DSQA 1JQ0A 2BSKB 2CK3G 1XI1A 2Q68A 2A0LA 3UO2A 4JI5B 1Y4MA 4OGQB 2UUAO 2L6LA 5EYPA 5EIBD 3T1CA 1N32O 2LFRA 5LHIA 1JA8A 3KCYA 4UB8Z 1JFFA 2VS0A 1NBMG 1VMGA 3M7MX 5H5NA 1NVPB 3RVYA 4KHPO 3RYHB 4NKGB 1GM7A 4B7EA 1ZUQA 3O65A 4OXSA 4E4EA 4UCSA 4UB6Z 1EBOA 5EBLC 4UV8A 3D3QA 2IJJA 3H1JH 3C90A 1K8AW 2HP8A 4J9YB 2YC0A 4ZOLA 1JJ2U 2KSDA 2PTMA 5J9PC 1QQCA 2F23A 1BT8A 4X20A 5LA6B 3S3WA 1RPRA 3CRMA 3L72H 2BTQB 1DTOA 4Z1VA 1IX9A 2DQ0A 2FB5A 4O4LB 2BOCC 3Q4HA 2YI9A 3T4ZA 4MVOA 2HJFC 4LR3A 2E76B 1VARA 4CC5A 4FFBB 1L8DA 4J7KA 4IT5A 4X8AA 2PF4E 3DXRB 4K8ZA 1XMQB 4NB5A 1KKDA 3DTUB 3OE7G 5KHGA 3VQVA 4OPAA 5B1OA 4WCEV 3OEHG 1SQQH 4RAIA 1B06A 2LO1A 1M5IA 1AI4A 4UCUA 4UCVA 1YVWA 3ZHQA 2ZM6O 1H8HG 1AVMA 1HWYA 1EZJA 4JAUA 4LBEC 4ZBMA 2FTKA 1NH2B 4J9ZB 1Y74B 5F2VO 5KHJA 3FD9A 2KQXA 1F7YA 4Q20A 4BWAA 5FPOA 3B8NA 1FJGO 3HR0A 1TGOA 3L75H 4U3JB 4BIZA 3JAKA 2WLHA 2GDSA 3TK1A 1S72V 3JCUZ 5JJEB 4J10A 4TWKA 4LH7A 2F95B 3T4DA 5CN0A 5JH7B 5JQGB 1M9NA 1VF6A 1VQNV 4QGPA 4MTOA 3HKDB 1N34B 3ETQA 4DW0A 1PD3A 2QWRB 3P32A 4MVQA 4LF4O 3KCXA 4FLUA 1NR7A 2CTQA 5J2TA 1SZTA 4FIPC 2A3QA 1Q8IA 1GTOA 3CEIA 2ITCC 4Z2WA 2P7TC 2QWPB 1XILA 2Y4UA 4FZ1A 1OJHA 1IBMO 1NKDA 4O2BB 4HAMA 3G6EV 1R6TA 4I0XB 2HJDA 4FM0A 3QF7A 4NTYA 2QEXV 5LBQA 3C3SA 2R72A 1WA8B 2ZE5A 5GONB 3SPCA 3CSXA 2AHZA 1B04A 4BAYA 4YHHB 1KYOF 4DV1O 1BSMA 1XNQO 3P30A 4DK0A 2Q7EA 1NVPD 5LGTA 4NTWA 2DYRC 2OTJV 3OTOB 2WA4A 4F6RA 1IZ3A 1YIJV 1GRJA 4ASUG 1V54C 4LWSB 2RCVA 4AQYB 1AJPA 3ZN0A 2G38A 3CJHA 3FX7A 3EXAA 4WFHA 4EEQA 1P4RA 1M56B 3HB3B 3K59A 3AG3B 1VQ7V 4NYKA 3CC4V 2Q69A 4JI4B 4B3RB 2YXHA 5E1AC 4CZZA 4DR6B 1VEWA 2WLLB 1K33A 1GMGA 4PDMA 5LGUA 4JI7B 1LUWA 1R3JC 4TT3G 2UXDO 1ZSPA 3LNNA 2YEVB 4UXNA 4DR3B 3BAAA 1WLEA 1IDSA 2W0XA 2WLNA 2X6BA 3SR2C 4ZI7B 2F4VB 3ZMZA 3PJSK 2DYSC 4LF7O 1R3IC 2GUZA 5LMNO 4I4TB 4CH4A 1S0VA 4PDLA 3OR6C 3G4SV 2DWEC 4HNAB 2AW9A 5HFMA 1K9MW 3CMAV 2NLJC 2WSSG 4J41A 2BTOA 1MSWD 1Q3EA 2YIBD 3ZEDA 4K0KB 4I50A 2FKXA 3ZMTA 5LMUO 3STLC 1PL4A 3FB7C 4MW8A 3UO3A 1VQ4V 4LP8A 1KP2A 2HEPA 1W2BU 3MDSA 2AZ0A 2M6YA 4JZ2A 4MVUA 4GX1A 5KLVH 2QR4A 1NH2D 3SPIA 2UUAB 3CC2V 1AJQA 2UU9O 1I94O 4H44B 5LGNA 1N32B 4BW9A 1KQSU 4X1IA 2OIGA 2IH3C 3K5NA 2ZD9A 2WAMA 3N27A 3PN1A 4KHPB 2JDIG 3RWRD 4X62B 2IJIA 5EZYA 1TVKB 4JYYA 1G8MA 5J2UB 4OX9O 1GAXA 1NU1H 2QTOA 2HHHO 3AK3A 1SA0A 3E89A 4NR1A 3BY6A 1KMIZ 5EC2C 1MZFA 1PP9H 3I5DA 2KG7B 5JVDA 5H6RA 2ZR2A 2F93B 4JAVA 3WG7C 3OMAB 5IJ9A 2F66C 3WB2A 5EIBC 3CYOA 5B1BB 2PUSA 3E8FA 4WFGA 2W0FC 4QPJA 3H1LH 1Y76B 1IBLB 4JTCB 3WG7B 2RMKB 3RYFA 4TV8A 4YIPA 2EILC 3W7SA 1NR1A 2ZXWC 3T2MA 1SC5B 3ASOC 1XREA 1WPBA 1B3QA 1FXHA 3D8CA 3FAVB 4LFBB 4RUEA 4UVCA 4ABMA 4KL1A 1QLEC 3JAWB 1M4UA 1FFXB 3ZMVA 1FAFA 1K97A 4R7CA 1IVSA 1VQLV 1QLEB 4IL6Z 2UUBO 1X4TA 3HPLC 2UUCO 2XTAA 5LP6A 4LF5B 2GTSA 1F51A 1SQVH 2L35A 1ZL8A 3KKYA 2ZM6B 3ZRXA 1ZLZA 4JYAO 5EYPB 3ZMUA 2EIMC 2EIKC 1OZ0A 3HKEA 3L73H 4R50A 5BMVA 1EN5A 2EIMB 4H33A 1SS3A 2EIKB 4UVBA 3S3XA 1XNRO 3P3NA 4O4JB 1VQPV 5K1XA 5FNVA 1CEZA 4DR5O 1MSDA 2PZSA 1RM1C 5B66Z 4QNHB 4ZOLB 1YTFD 1EM1A 4PDVA 1E1RG 5B5EZ 1S5JA 1V55B 3IC7A 2OCCB 4X20B 4K3AA 1VQ8V 4JI3O 4DV4B 4WF9V 4NXMO 2XUMA 4X65O 3Q4HB 3ETEA 3E35A 3E8HA 4X66B 4LF4B 4ZIBA 3G6BA 3T1HO 1FXVA 1WP8A 5CA3A 1N0JA 2QKAA 1AR5A 1LUVA 4PA7A 3RYIA 4I55A 1AILA 2M7WA 3RW0A 3MHHC 4JZGA 1UFIA 3X2QB 1N8RW 3K5OA 3TGUH 3ZX6A 4FJCC 2CTWA 3SGIA 3ABMC 3W7UA 2VQEO 2Q9LA 1QU7A 4J11A 4F6EA 2DMXA 1IBKO 4N21A 4BR6A 2JVDA 3APOA 1E1QG 1J5EB 2PYLA 4YJ3A 1BZKA 4N23A 1OCCC 2VWKA 2C2AA 3RT3C 1GN2A 4IGGA 2B9ZA 5B3SB 3SYOA 1FYJA 1HNXO 1Y66A 2JRIA 4LNUA 1NTKH 5BR8O 3ZRWA 4DV1B 1WJZA 1XNQB 2WWWA 5KUKA 4DRXA 1E79G 4WFFA 1HNZO 2P90A 3R66A 4MSWC 3KZIZ 4DR4O 1S76D 2B1GA 5L3GA 2B1IA 1Q7YW 4ICGA 2YIAA 4X1KA 1P7BA 2ZE6A 3K9SA 3E8BA 2DN9A 3FFQA 2OYQA 4DUYO 1M57C 1ZX3A 2WLJA 4JAAA 3IFXA 2DQ3A 2JJ1G 3SYPA 4MVMA 5B1AC 1BCCH 1XL6A 3K03A 1B6QA 5IYDO 4DV7B 3AG1C 1HNWO 2EX3A 1XMOB 5J2TB 1W0JG 4PHZA 4NVPA 2UXCO 2ZDIA 3W7WA 3CMEV 4GKKO 1ROPA 4LF6B 4R6ZA 4D7TA 1R73A 3GWKC 1Z2GA 4L87A 2A79B 3OUFA 1FXKA 3CP1A 1SKVA 3SJAC 2JEUA 3JARB 1Z5VA 2Y0PA 1NZ6A 5LMNB 2CGNA 4FFKA 1EZVH 1CXZB 1QNMA 3TXQA 3QNEA 3RVZA 2LFSA 5IYBO 1VP7A 4EB6B 3THOA 4CS4A 1KU9A 2Q8VA 5KMGA 4NXNO 3O9OA 5LMUB 2ZKOA 4ZHQB 1I7FA 2P5OA 4P9OA 2ZQMA 4FM1A 1UJWB 2Q4PA 3R65A 3K9AA 5IJ0A 3F5TA 3N2GA 4F6RB 1W0KG 4AILC 4GUNA 4RWUA 4LF9O 3CJHB 1P7GA 2P4KA 1Q6HA 2D3OW 4CH5A 2P6JA 2BCCH 3BPZA 4WFEA 3OGIB 3AG4B 2XAQA 4FPPA 2QM8A 2HHHB 2JGUA 4JI0B 3CX5F 2ZE8A 3K06A 1KD1W 4O4IA 3RYCA 3IC9A 1H8EG 2Z5UA 1BMFG 4J7JA 1YCIA 4XDKA 3ZJZA 2H8PC 2AXTZ 3FYIB 5JWPA 4GKJO 2GUZB 3LSQA 2HR3A 4E2LA 1RFYA 1M1KW 1MABG 1QHTA 3K0GA 4GCZA 4YIOA 2O57A 4CC6A 3JD0A 5CA1A 4JTAB 3E83A 4PELA 4LC1A 3FYEB 4DK1A 1Y6XA 4CH3A 5DN6G 1R6KA 4I50B 1G4YB 2XAGA 3LSSA 2HVJC 2KKWA 4WFBV 4TV9B 3IGAC 3JD2A 2UUBB 4UCTA 2GV9A 3VQYA 2ZCEA 2AGAA 4X9QA 2QKSA 5IWAO 2BE3A 1AROP 4JGSA 4R8CA 4B08A 4GZRB 4YJ2A 4B3MO 4I7ZB 1VQ6V 4X1IB 3ZN1A 3RN4A 2QTSA 2QWNB 3B8MA 3SDLA 4TOIA 4HZ3A 1XNRB 1NTZH 5JCOC 4B3TO 2W6IG 4JYBA 3E86A 5EZYB 3L9DA 3ASNB 3AG2B 1R3LC 4GT1A 5KHHA 1SA0B 2E3CA 4DXWA 4ZKIA 4DV0O 4DV5B 5LHHA 1N4CA 5GTHZ 2YI8A 3B40A 3D36A 5JVDB 2BSKA 2IJKA 1M90W 4BW5A 3T1YO 1AI6A 4FMTA 5IJ9B 1WPXA 4O4HA 4GX2A 4DR1O 3NR7A 2UXBO 3T1HB 3E2EA 3OEEG 1D5AA 3RYFB 1JPXA 3FB6C 1NI8A 4TV8B 3ZIAG 1N33O 1MOFA 3HKBB 2VQFO 4AI8A 5D5PA 1N36O 4JV5O 4F4LA 2PI5A 4P2ZA 1GO3F 5KUMA 3JYCA 4RQEA 4K35A 1H2GA 2AZ2A 4PA6A 4MVRA 1KECA 1M56C 2QWQB 1RSOA 1URFA 2FYUH 3AG3C 2CUGA 4DR7B 2F43G 2LW7A 2OT5A 2Q0AA 5L3DA 4MTGA 1YTFB 2P67A 3CCVV 2MW2B 3JCZA 2EBOA 1HW7A 5DM6V 1JOYA 3W7XA 4DV3B 2ZR3A 5LP6B 1EN6A 4U7NA 1ZL8B 1JJOA 4MVZA 5L3CA 4RO2A 4LFCB 3OMIB 3HKEB 5BMVB 4DV6O 1KUQA 4DV2O 3BRCA 2JK5C 2EULA 3DC6A 3DXRA 3ICXA 2X6CA 2QWOB 3ML0A 1X59A 1H2NA 5KA6A 4JI6O 1EN4A 2FMLA 2FL4A 2QDOA 2V4DA 1R1BA 4B3SO 4DR4B 1WN7A 4X64O 5KX5A 4GYCB 1F4MA 1YXBA 4KXRA 1LNQA 2D2CB 2ETNA 1XHXA 4PD4F 3EVKA 1OHHG 2E5LB 4JI5O 5CA0A 2WLIB 1TUEB 1HNWB 3ZBHA 4CBCA 3FB5C 4H0LB 1VIBA 1I08A 1MZEA 1K5QA 3RYIB 2UXCB 4I55B 2VWJA 4GKKB 3JSLA 4YY3O 1MA1A 5LYJA 1S3JA 1VF7A 3FB8C 2GTAA 1K7DA 2Y48A 3AEIA 2XOKG 1OCZC 1BE3H 5LOVA 3ZRVA 1OCZB 3UCSC 2P4VA 2X0LA 1TAEA 3EFFK 3SJQC 1VQ9V 2WPDG 2K1EA 1YJWV 4KP4A 4UV9A 4YJ3B 4P9PA 4IIJA 4O2AA 1WB8A 5LXTA 2X6AA 4RUFA 4X88A 3CC7V 5BZBA 4WBNB 1YHQV 2PI4A 1XMQO 5B1BC 5TISZ 3ZRWB 1QVFU 1S5LZ 5D5QA 1BQ0A 4JF3A 1SETA 4O2BA 3N2KA 1Q81W 2V1DA 4DRXB 5HFLA 2EINB 4IYIA 5KHKA 5IYZA 3CB2A 1KBHA 3ZHTA 1YJ9V 3K08A 2DW4A 4BIUA 4JASA 4X1YA 4X1KB 4LF9B 3HKCB 1K4DC 3QO8A 2ZT9B 1WA8A 5H9CA 4G2KA 3E22A 4LF8O 3CS5A 4UCOA 4PA4A 2GHYA 3WB0A 2WLKA 4JI2O 3CE2A 3OD4A 1KP3A 3UKMA 4U7OA 5EK0A 2QM4A 2JGDA 1FXKB 3QO5A 5A2QN 3OR7C 3LNMB 3A0HZ 1D2DA 2XASA 1OCRB 1JFFB 4CS3A 1NT2B 3CPWU 2R9RB 1H38A 2MK3A 4L8JA 3MAQA 2Z3YA 3M8AA 3TJTA 2P22C 5K1PA 2PYJA 1N34O 4I9WA 4TSFG 1V55C 1FJGB 4FLXA 2CAZC 2OCCC 4PDRA 5KMGB 5CBHA 3B2EE 3F7VC 1GM9A 3SYQA 2QGNA 4FK5C 3JAMN 3CCRV 1YDXA 3K5LA 3ZRSA 3QTCA 1PPJH 5IJ0B 2H3OA 1TUBA 5H6QA 4J42A 3B4SA 1SQBH 3WFVA 3N2GB 3X2QC 1O9GA
chains in the Genus database with same CATH topology
3CJHB 2BSKA 2BSKB 3DXRA 3DXRB 3CJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH B;  2BSK A;  2BSK B;  3DXR A;  3DXR B;  3CJH A; 
#chains in the Genus database with same CATH topology
 2ADQ B;  2R9I A;  1XOU A;  3SJB C;  1VF5 B;  4KUM A;  3E8G A;  3CCU V;  2X7R B;  3L74 H;  4HBN A;  4CS2 A;  3KG2 A;  5L3E A;  4UVA A;  1IBM B;  1R3K C;  2CGO A;  1VQM V;  1PNK A;  2IBZ H;  4EFB A;  3CXH F;  4XBF A;  3U0Z A;  3VOU A;  4W4L A;  4DV0 B;  1JR9 A;  1SQG A;  4FLY A;  4BIO A;  3UT5 A;  3OT7 A;  5IYC O;  1YZB A;  4DR2 O;  3QO7 A;  4O4I B;  1F4N A;  5E79 Z;  4DO2 A;  3RYC B;  4G27 B;  4MW3 A;  1P84 F;  2CTP A;  5B3S C;  3TET A;  3OTO O;  3CWB H;  3ABK B;  5C8Y A;  3BA9 A;  1XQ8 A;  2LP7 A;  5IE9 A;  1AP6 A;  1JX9 A;  2YDE A;  2GBO A;  4D7S A;  4JV5 B;  1PV0 A;  4JI4 O;  4TQD A;  4DR6 O;  1NQT A;  3CHX A;  2RJZ A;  2HLD G;  4JI7 O;  3JAK B;  2HFE C;  5FPR A;  1D5N A;  1VF6 C;  4Z1M G;  2HG5 C;  2ATK C;  1ORQ C;  3CCQ V;  3A2F A;  1OCO B;  4FLV A;  1YJN V;  2CTR A;  2DWD C;  5ITZ A;  3F7Y C;  1NJI W;  4IHJ A;  2DJV A;  4DV6 B;  2UXD B;  4DV2 B;  2BOB C;  2Y0I A;  3CRQ A;  4GX5 A;  4EKW A;  3RFR A;  4MT8 A;  4C7U A;  3VQX A;  1H2M A;  5KAI Z;  3UM7 A;  1R6N A;  3J81 N;  5IY5 B;  1HR0 O;  1AI7 A;  4K0K O;  4JYC A;  1FFX A;  2Y69 C;  4LF7 B;  5C93 A;  3ZHU A;  4LH6 A;  1QR8 A;  1BS3 A;  4TUY A;  2Y69 B;  2LGW A;  4JPR A;  3AK2 A;  2RN9 A;  2QSA A;  2ODM A;  3OMN B;  4O4H B;  3CCL V;  3IAY A;  4MTX A;  1XHZ A;  1Q5O A;  2CE4 A;  3JAT A;  2N04 A;  2IH1 C;  4YY3 B;  3CCE V;  4O4J A;  3QG5 A;  4X62 O;  2VRZ A;  5CB4 A;  3CRA A;  1GKF A;  1SQF A;  3LSU A;  2UU9 B;  1I94 B;  1ZWI C;  1GK9 A;  1ENV A;  3MHS C;  1RSO B;  1Q82 W;  1DGS A;  2XND G;  2CH7 A;  3JAL A;  3CRC A;  2QA4 V;  3AG4 C;  4OPH A;  3APQ A;  3L71 H;  1SF9 A;  2PY5 A;  1IUR A;  2YXL A;  1G6U A;  1PNM A;  4QE9 A;  4DUZ O;  4OX9 B;  3OAA G;  1IBL O;  4U3F H;  2RNB A;  1IXB A;  5BY1 A;  3GWO A;  5EC1 C;  3BAB A;  3JD3 A;  3B77 A;  5JJJ B;  1SER A;  3K04 A;  3DGE A;  5DED A;  4W4K A;  3JAS A;  1MG1 A;  5FLX N;  3AG7 A;  1Q43 A;  4JI1 O;  4LFB O;  2RQ6 A;  3SPJ A;  1YF2 A;  2XAJ A;  2EZO A;  2Q5Z A;  5KX5 B;  4PA9 A;  3K58 A;  2JS5 A;  4QPK A;  2OIE A;  2Q73 A;  1GN3 A;  3AK1 A;  1K34 A;  1DF4 A;  1W59 A;  1QCE A;  4LF5 O;  4JTD B;  4PJ0 Z;  1VQK V;  1XBL A;  5LL6 Y;  4LF8 B;  4QJF B;  5CA0 B;  3M99 B;  3OM3 B;  1GN6 A;  1T5E A;  1RPO A;  1U97 A;  2W6J G;  4JI2 B;  3RGB A;  3F5W C;  1VQO V;  4YXW G;  1J95 A;  5LYJ B;  4UUJ C;  2UUC B;  4LFA O;  2QKC A;  4PI2 A;  1WAZ A;  1PNL A;  3G71 V;  4JYA B;  2ZNJ A;  3JSN A;  1RP3 B;  5LOV B;  2YUA A;  2JEX A;  5BXZ A;  2ZIO A;  1KC8 W;  1QR9 A;  5IDJ A;  3ASN C;  3AG2 C;  4DV4 O;  1FKA O;  3H1H H;  3CD6 V;  3OGC C;  3OW2 U;  2LQT A;  4X66 O;  4DR5 B;  4IIJ B;  2XHB A;  1VQ5 V;  1F23 A;  4O2A B;  3SPH A;  1CPY A;  3ETD A;  1YSC A;  4MTF A;  5LXT B;  1DF5 A;  4H13 B;  4XDL A;  4D6T H;  4DW1 A;  2XT9 A;  2RDC A;  1ZAU A;  3H1K H;  1M93 A;  4JI3 B;  3VQW A;  1PL0 A;  4NXM B;  4PA3 A;  5CBF A;  4X65 B;  2B5U A;  3JAR A;  3SJC C;  4K8X A;  3SPG A;  1IXM A;  3N2K B;  5IT9 N;  5IYZ B;  4LCU C;  3RYH A;  3GVM A;  4X1Y B;  3DC5 A;  3WU2 Z;  1J5E O;  1FD9 A;  1TA8 A;  2UXN A;  1BL8 A;  5GW7 A;  3E22 B;  2YID A;  2VQE B;  4EB6 A;  2N05 A;  1XEQ A;  1IBK B;  3J7A U;  3K79 A;  1BHA A;  1N0N A;  1WB7 A;  1PM9 A;  1Z5W A;  3H01 A;  5LA6 A;  4ZHQ A;  2ILM A;  1U96 A;  2BTQ A;  3NXS A;  5LP6 C;  1L0L H;  2JJ2 G;  1QLN A;  4DR2 B;  2Y4T A;  4O4L A;  3CCM V;  2JGD B;  3ABT A;  1I5Y A;  1K92 A;  2YSU B;  1KB9 F;  1OV9 A;  4XDJ A;  2ZIN A;  5KHI A;  1XDC A;  3RBZ A;  2DE0 X;  2NNU A;  4FFB A;  2DYR B;  1SZX A;  2F1M A;  1HNX B;  3CCJ V;  3I55 V;  3LDD A;  1V54 B;  4P30 A;  5BR8 B;  3SYC A;  2IU0 A;  4I5S A;  5FNV B;  1HNZ B;  4DV7 O;  2A9H A;  3IJ4 A;  1XMO O;  4JI8 O;  4KFM A;  3ZS8 C;  2YIB A;  3QVN A;  1AP5 A;  4QIW F;  1G1X B;  3C3T A;  4LF6 O;  4H37 A;  3BHP A;  4DUY B;  4FZ0 A;  2LGQ A;  3H9V A;  1HDJ A;  5DEC A;  3GB7 C;  4B7K A;  2HVK C;  1S77 D;  2EZP A;  1TUB B;  4EFE A;  1DLB A;  1Y74 A;  1KKC A;  5L3B A;  2IW5 A;  2DYS B;  3I56 V;  3JD4 A;  1HP8 A;  3L70 H;  5KAF Z;  1US6 A;  2Q7H A;  1HR0 B;  4U3J A;  4G28 B;  1WNS A;  4TV9 A;  3A8T A;  4NTX A;  1YEW A;  2E74 B;  5JH7 A;  3UT5 B;  5JQG A;  3U11 A;  2JS3 A;  2IU3 A;  1SRY A;  1Q6I A;  3HKD A;  2WA3 A;  3LUT B;  2OTL V;  3CCS V;  1L1F A;  1XL4 A;  1I0H A;  4NXN B;  2EIJ C;  5C8Y B;  2NR5 A;  2GSM B;  3BA8 A;  3ZCC A;  4I9Q A;  2NN4 A;  2CDY A;  4LNU B;  2EIJ B;  2EIN C;  5CBG A;  1AR1 B;  3K0D A;  5JCO A;  1AI5 A;  5L3F A;  1BGY H;  2JIZ G;  4IYH A;  4DYL A;  1XUQ A;  4JI0 O;  2IJH A;  1JMK C;  1FFT B;  3SYA A;  4I0X A;  2QJ1 A;  4UFZ A;  1BQZ A;  2XAH A;  1K4C C;  3D3I A;  2OCH A;  4FLT A;  1Q90 D;  2YIC A;  5LHG A;  1K5S A;  4DUZ B;  5GON A;  3TCU A;  2IM9 A;  2ZDI C;  3BEH A;  3U10 A;  5ITZ B;  1H2K A;  1FPO A;  2A7W A;  3ABL C;  4IHJ B;  3HKB A;  5GTI Z;  2KB1 A;  1FXK C;  2PGG A;  3K57 A;  3H1I H;  3ZHR A;  5KA5 A;  2EIL B;  3ABL B;  2ZXW B;  4JI1 B;  3ASO B;  1OCR C;  2H94 A;  2N74 A;  3LDE A;  5B1N A;  1QVG U;  1H2S B;  4RQF A;  4LWS A;  4PV1 B;  3OUS A;  4GKJ B;  1CP9 A;  1JCH A;  2ZIM A;  4TUY B;  1GN4 A;  1GH6 A;  3A0B Z;  1V9P A;  3ETG A;  4A5U B;  1GM8 A;  1S5H C;  1LR1 A;  2WLL A;  4GLX A;  1NS1 A;  3A0R A;  1MMM A;  2XAF A;  1O9H A;  4Q6G A;  3B09 A;  3MD0 A;  2ARH A;  2DOS A;  3WB1 A;  3JAT B;  2QE7 G;  2YEV A;  3CRR A;  1L0N H;  4WFA V;  4LFA B;  5CB4 B;  3J80 N;  4MVS A;  1THZ A;  5IWA B;  4ZI7 A;  5JJN B;  1COW G;  1AJN A;  5CMU A;  4MS2 A;  1ZTE A;  4B3M B;  4HYO A;  1WP7 A;  4CH6 A;  2R9A A;  3ABU A;  4I4T A;  4DV5 O;  1RM1 B;  3K5M A;  4AHC A;  1PKX A;  3G80 A;  2CH7 B;  4HNA A;  5EBW C;  3JAL B;  1DK1 A;  3UQ8 A;  3ZMS A;  2EJR A;  2HKO A;  4J80 A;  4UCR A;  4FM2 A;  4B3T B;  2QM7 A;  2WLI A;  2WLM A;  5EBM C;  2YXY A;  5FL7 G;  1UPG A;  1FS0 G;  4YHH O;  4FVM A;  4FLZ A;  2AHY A;  2Q6A A;  3BVO A;  1AR4 A;  2Q0O C;  1SQP H;  3K3W A;  3TXS A;  4QE7 A;  3VBB A;  3JAS B;  1QBZ A;  3ABK C;  3T1Y B;  2LW1 A;  2ZE7 A;  1EFR G;  4DR1 B;  2EJ7 A;  1K73 W;  4GX0 A;  2UXB B;  2ADP A;  4DR7 O;  3ABM B;  3CXC U;  4AQY O;  1N33 B;  4FLW A;  1BHB A;  1H2L A;  3STZ C;  2VQF B;  2ZNI A;  2A06 H;  3LDC A;  1N36 B;  2V7Q G;  3P3P A;  4TQF A;  4DV3 O;  5CA1 B;  4B3R O;  1YIT V;  1TVK A;  5J2U A;  1K3E A;  2UXX A;  1AB3 A;  1I5X A;  3JD1 A;  3W7T A;  1MNG A;  4PI0 A;  4LFC O;  3EHB B;  1YI2 V;  2YS8 A;  2Z0A A;  1OCC B;  4WBN A;  1Q86 W;  2K9P A;  3OFN G;  1SQX H;  1OCO C;  2KG7 A;  5AG2 A;  4J7Z A;  3ZHS A;  1P49 A;  2Q7G A;  4DR3 O;  2P06 A;  3G67 A;  2F4V O;  2Q67 A;  4YJ2 B;  1Y76 A;  2E75 B;  4X89 A;  2R70 A;  5A9G A;  1JVM A;  3HKC A;  3ZHV A;  1NTM H;  5IY5 C;  2LJ2 A;  2E5L O;  3FAV A;  4JI6 B;  3BCC H;  3OTF A;  1M57 B;  1Q6U A;  3JAW A;  2OWO A;  4B3S B;  1SES A;  1Y67 A;  4X64 B;  4JI8 B;  3BFR A;  3D36 C;  2ITD C;  5B1A B;  5H2F Z;  1A32 A;  3FKS G;  3AG1 B;  3DSQ A;  1JQ0 A;  2BSK B;  2CK3 G;  1XI1 A;  2Q68 A;  2A0L A;  3UO2 A;  4JI5 B;  1Y4M A;  4OGQ B;  2UUA O;  2L6L A;  5EYP A;  5EIB D;  3T1C A;  1N32 O;  2LFR A;  5LHI A;  1JA8 A;  3KCY A;  4UB8 Z;  1JFF A;  2VS0 A;  1NBM G;  1VMG A;  3M7M X;  5H5N A;  1NVP B;  3RVY A;  4KHP O;  3RYH B;  4NKG B;  1GM7 A;  4B7E A;  1ZUQ A;  3O65 A;  4OXS A;  4E4E A;  4UCS A;  4UB6 Z;  1EBO A;  5EBL C;  4UV8 A;  3D3Q A;  2IJJ A;  3H1J H;  3C90 A;  1K8A W;  2HP8 A;  4J9Y B;  2YC0 A;  4ZOL A;  1JJ2 U;  2KSD A;  2PTM A;  5J9P C;  1QQC A;  2F23 A;  1BT8 A;  4X20 A;  5LA6 B;  3S3W A;  1RPR A;  3CRM A;  3L72 H;  2BTQ B;  1DTO A;  4Z1V A;  1IX9 A;  2DQ0 A;  2FB5 A;  4O4L B;  2BOC C;  3Q4H A;  2YI9 A;  3T4Z A;  4MVO A;  2HJF C;  4LR3 A;  2E76 B;  1VAR A;  4CC5 A;  4FFB B;  1L8D A;  4J7K A;  4IT5 A;  4X8A A;  2PF4 E;  3DXR B;  4K8Z A;  1XMQ B;  4NB5 A;  1KKD A;  3DTU B;  3OE7 G;  5KHG A;  3VQV A;  4OPA A;  5B1O A;  4WCE V;  3OEH G;  1SQQ H;  4RAI A;  1B06 A;  2LO1 A;  1M5I A;  1AI4 A;  4UCU A;  4UCV A;  1YVW A;  3ZHQ A;  2ZM6 O;  1H8H G;  1AVM A;  1HWY A;  1EZJ A;  4JAU A;  4LBE C;  4ZBM A;  2FTK A;  1NH2 B;  4J9Z B;  1Y74 B;  5F2V O;  5KHJ A;  3FD9 A;  2KQX A;  1F7Y A;  4Q20 A;  4BWA A;  5FPO A;  3B8N A;  1FJG O;  3HR0 A;  1TGO A;  3L75 H;  4U3J B;  4BIZ A;  3JAK A;  2WLH A;  2GDS A;  3TK1 A;  1S72 V;  3JCU Z;  5JJE B;  4J10 A;  4TWK A;  4LH7 A;  2F95 B;  3T4D A;  5CN0 A;  5JH7 B;  5JQG B;  1M9N A;  1VF6 A;  1VQN V;  4QGP A;  4MTO A;  3HKD B;  1N34 B;  3ETQ A;  4DW0 A;  1PD3 A;  2QWR B;  3P32 A;  4MVQ A;  4LF4 O;  3KCX A;  4FLU A;  1NR7 A;  2CTQ A;  5J2T A;  1SZT A;  4FIP C;  2A3Q A;  1Q8I A;  1GTO A;  3CEI A;  2ITC C;  4Z2W A;  2P7T C;  2QWP B;  1XIL A;  2Y4U A;  4FZ1 A;  1OJH A;  1IBM O;  1NKD A;  4O2B B;  4HAM A;  3G6E V;  1R6T A;  4I0X B;  2HJD A;  4FM0 A;  3QF7 A;  4NTY A;  2QEX V;  5LBQ A;  3C3S A;  2R72 A;  1WA8 B;  2ZE5 A;  5GON B;  3SPC A;  3CSX A;  2AHZ A;  1B04 A;  4BAY A;  4YHH B;  1KYO F;  4DV1 O;  1BSM A;  1XNQ O;  3P30 A;  4DK0 A;  2Q7E A;  1NVP D;  5LGT A;  4NTW A;  2DYR C;  2OTJ V;  3OTO B;  2WA4 A;  4F6R A;  1IZ3 A;  1YIJ V;  1GRJ A;  4ASU G;  1V54 C;  4LWS B;  2RCV A;  4AQY B;  1AJP A;  3ZN0 A;  2G38 A;  3CJH A;  3FX7 A;  3EXA A;  4WFH A;  4EEQ A;  1P4R A;  1M56 B;  3HB3 B;  3K59 A;  3AG3 B;  1VQ7 V;  4NYK A;  3CC4 V;  2Q69 A;  4JI4 B;  4B3R B;  2YXH A;  5E1A C;  4CZZ A;  4DR6 B;  1VEW A;  2WLL B;  1K33 A;  1GMG A;  4PDM A;  5LGU A;  4JI7 B;  1LUW A;  1R3J C;  4TT3 G;  2UXD O;  1ZSP A;  3LNN A;  2YEV B;  4UXN A;  4DR3 B;  3BAA A;  1WLE A;  1IDS A;  2W0X A;  2WLN A;  2X6B A;  3SR2 C;  4ZI7 B;  2F4V B;  3ZMZ A;  3PJS K;  2DYS C;  4LF7 O;  1R3I C;  2GUZ A;  5LMN O;  4I4T B;  4CH4 A;  1S0V A;  4PDL A;  3OR6 C;  3G4S V;  2DWE C;  4HNA B;  2AW9 A;  5HFM A;  1K9M W;  3CMA V;  2NLJ C;  2WSS G;  4J41 A;  2BTO A;  1MSW D;  1Q3E A;  2YIB D;  3ZED A;  4K0K B;  4I50 A;  2FKX A;  3ZMT A;  5LMU O;  3STL C;  1PL4 A;  3FB7 C;  4MW8 A;  3UO3 A;  1VQ4 V;  4LP8 A;  1KP2 A;  2HEP A;  1W2B U;  3MDS A;  2AZ0 A;  2M6Y A;  4JZ2 A;  4MVU A;  4GX1 A;  5KLV H;  2QR4 A;  1NH2 D;  3SPI A;  2UUA B;  3CC2 V;  1AJQ A;  2UU9 O;  1I94 O;  4H44 B;  5LGN A;  1N32 B;  4BW9 A;  1KQS U;  4X1I A;  2OIG A;  2IH3 C;  3K5N A;  2ZD9 A;  2WAM A;  3N27 A;  3PN1 A;  4KHP B;  2JDI G;  3RWR D;  4X62 B;  2IJI A;  5EZY A;  1TVK B;  4JYY A;  1G8M A;  5J2U B;  4OX9 O;  1GAX A;  1NU1 H;  2QTO A;  2HHH O;  3AK3 A;  1SA0 A;  3E89 A;  4NR1 A;  3BY6 A;  1KMI Z;  5EC2 C;  1MZF A;  1PP9 H;  3I5D A;  2KG7 B;  5JVD A;  5H6R A;  2ZR2 A;  2F93 B;  4JAV A;  3WG7 C;  3OMA B;  5IJ9 A;  2F66 C;  3WB2 A;  5EIB C;  3CYO A;  5B1B B;  2PUS A;  3E8F A;  4WFG A;  2W0F C;  4QPJ A;  3H1L H;  1Y76 B;  1IBL B;  4JTC B;  3WG7 B;  2RMK B;  3RYF A;  4TV8 A;  4YIP A;  2EIL C;  3W7S A;  1NR1 A;  2ZXW C;  3T2M A;  1SC5 B;  3ASO C;  1XRE A;  1WPB A;  1B3Q A;  1FXH A;  3D8C A;  3FAV B;  4LFB B;  4RUE A;  4UVC A;  4ABM A;  4KL1 A;  1QLE C;  3JAW B;  1M4U A;  1FFX B;  3ZMV A;  1FAF A;  1K97 A;  4R7C A;  1IVS A;  1VQL V;  1QLE B;  4IL6 Z;  2UUB O;  1X4T A;  3HPL C;  2UUC O;  2XTA A;  5LP6 A;  4LF5 B;  2GTS A;  1F51 A;  1SQV H;  2L35 A;  1ZL8 A;  3KKY A;  2ZM6 B;  3ZRX A;  1ZLZ A;  4JYA O;  5EYP B;  3ZMU A;  2EIM C;  2EIK C;  1OZ0 A;  3HKE A;  3L73 H;  4R50 A;  5BMV A;  1EN5 A;  2EIM B;  4H33 A;  1SS3 A;  2EIK B;  4UVB A;  3S3X A;  1XNR O;  3P3N A;  4O4J B;  1VQP V;  5K1X A;  5FNV A;  1CEZ A;  4DR5 O;  1MSD A;  2PZS A;  1RM1 C;  5B66 Z;  4QNH B;  4ZOL B;  1YTF D;  1EM1 A;  4PDV A;  1E1R G;  5B5E Z;  1S5J A;  1V55 B;  3IC7 A;  2OCC B;  4X20 B;  4K3A A;  1VQ8 V;  4JI3 O;  4DV4 B;  4WF9 V;  4NXM O;  2XUM A;  4X65 O;  3Q4H B;  3ETE A;  3E35 A;  3E8H A;  4X66 B;  4LF4 B;  4ZIB A;  3G6B A;  3T1H O;  1FXV A;  1WP8 A;  5CA3 A;  1N0J A;  2QKA A;  1AR5 A;  1LUV A;  4PA7 A;  3RYI A;  4I55 A;  1AIL A;  2M7W A;  3RW0 A;  3MHH C;  4JZG A;  1UFI A;  3X2Q B;  1N8R W;  3K5O A;  3TGU H;  3ZX6 A;  4FJC C;  2CTW A;  3SGI A;  3ABM C;  3W7U A;  2VQE O;  2Q9L A;  1QU7 A;  4J11 A;  4F6E A;  2DMX A;  1IBK O;  4N21 A;  4BR6 A;  2JVD A;  3APO A;  1E1Q G;  1J5E B;  2PYL A;  4YJ3 A;  1BZK A;  4N23 A;  1OCC C;  2VWK A;  2C2A A;  3RT3 C;  1GN2 A;  4IGG A;  2B9Z A;  5B3S B;  3SYO A;  1FYJ A;  1HNX O;  1Y66 A;  2JRI A;  4LNU A;  1NTK H;  5BR8 O;  3ZRW A;  4DV1 B;  1WJZ A;  1XNQ B;  2WWW A;  5KUK A;  4DRX A;  1E79 G;  4WFF A;  1HNZ O;  2P90 A;  3R66 A;  4MSW C;  3KZI Z;  4DR4 O;  1S76 D;  2B1G A;  5L3G A;  2B1I A;  1Q7Y W;  4ICG A;  2YIA A;  4X1K A;  1P7B A;  2ZE6 A;  3K9S A;  3E8B A;  2DN9 A;  3FFQ A;  2OYQ A;  4DUY O;  1M57 C;  1ZX3 A;  2WLJ A;  4JAA A;  3IFX A;  2DQ3 A;  2JJ1 G;  3SYP A;  4MVM A;  5B1A C;  1BCC H;  1XL6 A;  3K03 A;  1B6Q A;  5IYD O;  4DV7 B;  3AG1 C;  1HNW O;  2EX3 A;  1XMO B;  5J2T B;  1W0J G;  4PHZ A;  4NVP A;  2UXC O;  2ZDI A;  3W7W A;  3CME V;  4GKK O;  1ROP A;  4LF6 B;  4R6Z A;  4D7T A;  1R73 A;  3GWK C;  1Z2G A;  4L87 A;  2A79 B;  3OUF A;  1FXK A;  3CP1 A;  1SKV A;  3SJA C;  2JEU A;  3JAR B;  1Z5V A;  2Y0P A;  1NZ6 A;  5LMN B;  2CGN A;  4FFK A;  1EZV H;  1CXZ B;  1QNM A;  3TXQ A;  3QNE A;  3RVZ A;  2LFS A;  5IYB O;  1VP7 A;  4EB6 B;  3THO A;  4CS4 A;  1KU9 A;  2Q8V A;  5KMG A;  4NXN O;  3O9O A;  5LMU B;  2ZKO A;  4ZHQ B;  1I7F A;  2P5O A;  4P9O A;  2ZQM A;  4FM1 A;  1UJW B;  2Q4P A;  3R65 A;  3K9A A;  5IJ0 A;  3F5T A;  3N2G A;  4F6R B;  1W0K G;  4AIL C;  4GUN A;  4RWU A;  4LF9 O;  3CJH B;  1P7G A;  2P4K A;  1Q6H A;  2D3O W;  4CH5 A;  2P6J A;  2BCC H;  3BPZ A;  4WFE A;  3OGI B;  3AG4 B;  2XAQ A;  4FPP A;  2QM8 A;  2HHH B;  2JGU A;  4JI0 B;  3CX5 F;  2ZE8 A;  3K06 A;  1KD1 W;  4O4I A;  3RYC A;  3IC9 A;  1H8E G;  2Z5U A;  1BMF G;  4J7J A;  1YCI A;  4XDK A;  3ZJZ A;  2H8P C;  2AXT Z;  3FYI B;  5JWP A;  4GKJ O;  2GUZ B;  3LSQ A;  2HR3 A;  4E2L A;  1RFY A;  1M1K W;  1MAB G;  1QHT A;  3K0G A;  4GCZ A;  4YIO A;  2O57 A;  4CC6 A;  3JD0 A;  5CA1 A;  4JTA B;  3E83 A;  4PEL A;  4LC1 A;  3FYE B;  4DK1 A;  1Y6X A;  4CH3 A;  5DN6 G;  1R6K A;  4I50 B;  1G4Y B;  2XAG A;  3LSS A;  2HVJ C;  2KKW A;  4WFB V;  4TV9 B;  3IGA C;  3JD2 A;  2UUB B;  4UCT A;  2GV9 A;  3VQY A;  2ZCE A;  2AGA A;  4X9Q A;  2QKS A;  5IWA O;  2BE3 A;  1ARO P;  4JGS A;  4R8C A;  4B08 A;  4GZR B;  4YJ2 A;  4B3M O;  4I7Z B;  1VQ6 V;  4X1I B;  3ZN1 A;  3RN4 A;  2QTS A;  2QWN B;  3B8M A;  3SDL A;  4TOI A;  4HZ3 A;  1XNR B;  1NTZ H;  5JCO C;  4B3T O;  2W6I G;  4JYB A;  3E86 A;  5EZY B;  3L9D A;  3ASN B;  3AG2 B;  1R3L C;  4GT1 A;  5KHH A;  1SA0 B;  2E3C A;  4DXW A;  4ZKI A;  4DV0 O;  4DV5 B;  5LHH A;  1N4C A;  5GTH Z;  2YI8 A;  3B40 A;  3D36 A;  5JVD B;  2BSK A;  2IJK A;  1M90 W;  4BW5 A;  3T1Y O;  1AI6 A;  4FMT A;  5IJ9 B;  1WPX A;  4O4H A;  4GX2 A;  4DR1 O;  3NR7 A;  2UXB O;  3T1H B;  3E2E A;  3OEE G;  1D5A A;  3RYF B;  1JPX A;  3FB6 C;  1NI8 A;  4TV8 B;  3ZIA G;  1N33 O;  1MOF A;  3HKB B;  2VQF O;  4AI8 A;  5D5P A;  1N36 O;  4JV5 O;  4F4L A;  2PI5 A;  4P2Z A;  1GO3 F;  5KUM A;  3JYC A;  4RQE A;  4K35 A;  1H2G A;  2AZ2 A;  4PA6 A;  4MVR A;  1KEC A;  1M56 C;  2QWQ B;  1RSO A;  1URF A;  2FYU H;  3AG3 C;  2CUG A;  4DR7 B;  2F43 G;  2LW7 A;  2OT5 A;  2Q0A A;  5L3D A;  4MTG A;  1YTF B;  2P67 A;  3CCV V;  2MW2 B;  3JCZ A;  2EBO A;  1HW7 A;  5DM6 V;  1JOY A;  3W7X A;  4DV3 B;  2ZR3 A;  5LP6 B;  1EN6 A;  4U7N A;  1ZL8 B;  1JJO A;  4MVZ A;  5L3C A;  4RO2 A;  4LFC B;  3OMI B;  3HKE B;  5BMV B;  4DV6 O;  1KUQ A;  4DV2 O;  3BRC A;  2JK5 C;  2EUL A;  3DC6 A;  3DXR A;  3ICX A;  2X6C A;  2QWO B;  3ML0 A;  1X59 A;  1H2N A;  5KA6 A;  4JI6 O;  1EN4 A;  2FML A;  2FL4 A;  2QDO A;  2V4D A;  1R1B A;  4B3S O;  4DR4 B;  1WN7 A;  4X64 O;  5KX5 A;  4GYC B;  1F4M A;  1YXB A;  4KXR A;  1LNQ A;  2D2C B;  2ETN A;  1XHX A;  4PD4 F;  3EVK A;  1OHH G;  2E5L B;  4JI5 O;  5CA0 A;  2WLI B;  1TUE B;  1HNW B;  3ZBH A;  4CBC A;  3FB5 C;  4H0L B;  1VIB A;  1I08 A;  1MZE A;  1K5Q A;  3RYI B;  2UXC B;  4I55 B;  2VWJ A;  4GKK B;  3JSL A;  4YY3 O;  1MA1 A;  5LYJ A;  1S3J A;  1VF7 A;  3FB8 C;  2GTA A;  1K7D A;  2Y48 A;  3AEI A;  2XOK G;  1OCZ C;  1BE3 H;  5LOV A;  3ZRV A;  1OCZ B;  3UCS C;  2P4V A;  2X0L A;  1TAE A;  3EFF K;  3SJQ C;  1VQ9 V;  2WPD G;  2K1E A;  1YJW V;  4KP4 A;  4UV9 A;  4YJ3 B;  4P9P A;  4IIJ A;  4O2A A;  1WB8 A;  5LXT A;  2X6A A;  4RUF A;  4X88 A;  3CC7 V;  5BZB A;  4WBN B;  1YHQ V;  2PI4 A;  1XMQ O;  5B1B C;  5TIS Z;  3ZRW B;  1QVF U;  1S5L Z;  5D5Q A;  1BQ0 A;  4JF3 A;  1SET A;  4O2B A;  3N2K A;  1Q81 W;  2V1D A;  4DRX B;  5HFL A;  2EIN B;  4IYI A;  5KHK A;  5IYZ A;  3CB2 A;  1KBH A;  3ZHT A;  1YJ9 V;  3K08 A;  2DW4 A;  4BIU A;  4JAS A;  4X1Y A;  4X1K B;  4LF9 B;  3HKC B;  1K4D C;  3QO8 A;  2ZT9 B;  1WA8 A;  5H9C A;  4G2K A;  3E22 A;  4LF8 O;  3CS5 A;  4UCO A;  4PA4 A;  2GHY A;  3WB0 A;  2WLK A;  4JI2 O;  3CE2 A;  3OD4 A;  1KP3 A;  3UKM A;  4U7O A;  5EK0 A;  2QM4 A;  2JGD A;  1FXK B;  3QO5 A;  5A2Q N;  3OR7 C;  3LNM B;  3A0H Z;  1D2D A;  2XAS A;  1OCR B;  1JFF B;  4CS3 A;  1NT2 B;  3CPW U;  2R9R B;  1H38 A;  2MK3 A;  4L8J A;  3MAQ A;  2Z3Y A;  3M8A A;  3TJT A;  2P22 C;  5K1P A;  2PYJ A;  1N34 O;  4I9W A;  4TSF G;  1V55 C;  1FJG B;  4FLX A;  2CAZ C;  2OCC C;  4PDR A;  5KMG B;  5CBH A;  3B2E E;  3F7V C;  1GM9 A;  3SYQ A;  2QGN A;  4FK5 C;  3JAM N;  3CCR V;  1YDX A;  3K5L A;  3ZRS A;  3QTC A;  1PPJ H;  5IJ0 B;  2H3O A;  1TUB A;  5H6Q A;  4J42 A;  3B4S A;  1SQB H;  3WFV A;  3N2G B;  3X2Q C;  1O9G A; 
#chains in the Genus database with same CATH homology
 3CJH B;  2BSK A;  2BSK B;  3DXR A;  3DXR B;  3CJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...