3CJHB

Tim8-tim13 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
b'NSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
total genus 21
structure length 59
sequence length 59
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhB00
3DXRA 3CJHA 3CJHB 2BSKA 3DXRB 2BSKB
chains in the Genus database with same CATH superfamily
2YIAA 4K8ZA 3HKDA 4I50A 3JSLA 3AG3C 4I55B 1P49A 3MDSA 1S3JA 4IYIA 4K0KO 3UKMA 2A7WA 3VBBA 1QVGU 2Q9LA 4JV5O 2Q0OC 2PGGA 5JH7B 2M6YA 1BSMA 2XHBA 2DQ3A 4U3JB 4GKJB 4LF8O 1AI6A 1AI7A 1MNGA 3CYOA 4NXMO 1H2LA 2YXHA 1A32A 4O2BB 4LP8A 1G6UA 2HHHO 3HKEA 4O4JA 4FIPC 3H1IH 3AEIA 5IY5B 2WLNA 3CCLV 1I5XA 1CXZB 3FFQA 2Y4TA 2CAZC 3AG1B 1ZTEA 1KP2A 2CGNA 1QR9A 3ETEA 4UCOA 5E1AC 3OW2U 1BGYH 1Y67A 1Z5VA 2Q67A 2ZE5A 4UVCA 4JYAO 3LNMB 2FKXA 3K58A 1L8DA 3ZS8C 1YJWV 2XAFA 3AG2C 4JAVA 4BIUA 1HNXO 2E3CA 1MABG 3H1LH 3MAQA 3W7SA 1WA8A 4TV9A 4JI7O 1YSCA 2N04A 1YJ9V 5EBWC 5DM6V 1XI1A 3UT5B 3APOA 3AG7A 4LFCO 1KUQA 1UJWB 2MW2B 3DGEA 4B7KA 1BT8A 3ASNC 5B1BC 4DV1O 4K0KB 3ETGA 4AHCA 2ZNIA 1LUWA 1QU7A 4LF7O 2XAGA 2ZIOA 3D36A 3VQYA 3CCUV 3LSUA 4MTOA 5BXZA 2NLJC 1VQ4V 3E2EA 3CX5F 3MHHC 2LQTA 5CA3A 3K5MA 3JATB 4JI3B 4FVMA 3L71H 1M5IA 5EIBD 2QDOA 1R3IC 2P22C 4KHPO 2EZOA 2P5OA 2R9IA 4LF7B 1NVPD 1EZJA 2HR3A 3EXAA 4LWSB 2MK3A 4UB8Z 1MZEA 3K03A 1JPXA 2EZPA 4LF9O 3BAAA 3O65A 2OT5A 2RCVA 4D6TH 1NI8A 3JD3A 4FZ1A 4TV8A 4CH4A 5B1AB 4JYAB 4DYLA 2QR4A 2WPDG 2WAMA 4GLXA 4GX1A 1FKAO 4KL1A 4UCRA 4YJ3A 4GYCB 2Y48A 3OFNG 4KP4A 3SYOA 1D5AA 2BTOA 2XT9A 4U7NA 3ETDA 4YJ3B 1M56C 1NBMG 3RVYA 1F4NA 4LF9B 3CC4V 3QTCA 5LMNO 1RFYA 4PDVA 2X6CA 1GTOA 1QCEA 1XNRB 5B3SC 4LFCB 1YIJV 3A0RA 3FB8C 1JFFA 1OCZC 3NXSA 4J10A 4DR2O 4G2KA 1EBOA 4OPAA 1WJZA 4PI2A 5CA0B 1WA8B 3ZIAG 3N2GB 2RMKB 1Y76A 4GT1A 2OYQA 1YTFD 2B9ZA 2HVJC 2ZXWB 2EIMC 4QPKA 4YY3B 2IH1C 3TXQA 3ABLC 4KUMA 4CZZA 1D2DA 1IBMO 5FLXN 4JAAA 4U3FH 3VOUA 2UXDO 4X62B 3K59A 4E2LA 3WU2Z 5LP6A 4TSFG 2OIEA 1HWYA 1RP3B 5LL6Y 3T1HO 1EM1A 4I4TA 1ZWIC 2XOKG 3IJ4A 4LFAB 5EK0A 3RWRD 4DR1B 1NR7A 2JEUA 3UQ8A 5JQGB 2EILC 1KBHA 1M4UA 3CCSV 2FB5A 5KUKA 2UU9O 3OEEG 2ARHA 5LXTA 4TV8B 1T5EA 1SKVA 4JTCB 1XEQA 1VQ5V 2QM8A 5L3DA 1X59A 4IGGA 4HBNA 4J41A 4MVZA 4FLVA 3A0BZ 4ICGA 3P30A 3U11A 4TQFA 1G1XB 2LO1A 3BEHA 4JI0O 4I50B 2QKCA 4DUYB 3AK2A 3BPZA 4KFMA 2WWWA 2CE4A 4GKKO 1VQ7V 4DV6O 1HW7A 5BZBA 4CH3A 4X66O 3A2FA 2WSSG 3RBZA 1XNRO 1KD1W 2W6IG 2BSKA 1J5EO 1O9GA 4CC5A 4JI8B 1RPRA 3BA8A 3SPGA 1ZL8A 4P9PA 4J11A 3ZHQA 4JI0B 3ZRWB 1Z2GA 2X6BA 1MG1A 3ZJZA 1P4RA 4OPHA 3LDEA 2UXDB 1OCCC 3SDLA 3FB6C 3ABKC 1SA0B 3W7TA 4YIOA 1SF9A 4Q6GA 4PJ0Z 4DUZO 1ZUQA 4CH5A 4YXWG 1BCCH 5BMVB 4BWAA 3K5LA 4LC1A 1FPOA 1L0NH 2KKWA 3UO3A 5JCOC 1PNLA 5LMUB 3E8FA 1EN6A 2CTQA 3CWBH 3ZCCA 2F66C 3DXRA 4LWSA 1G8MA 2ITDC 3RYCB 5KMGA 3C90A 4MT8A 2Z0AA 2CUGA 2RDCA 2R9RB 4NXMB 4OGQB 3HPLC 3M8AA 2HG5C 2NNUA 3L74H 3T2MA 4Z1VA 4DR5O 5EYPB 2R70A 2WLKA 2HLDG 2DYRC 3T1YB 4J7JA 4ZKIA 1FD9A 2CTPA 2QA4V 3FKSG 1Q6UA 4PV1B 2JEXA 1H2SB 3B8MA 3ZHTA 2IJKA 1SQBH 4GKKB 1OCOC 4MW3A 3BHPA 2OTJV 5KAFZ 1NR1A 3FAVB 1WN7A 3B4SA 1Q6IA 5JH7A 3ZEDA 2AZ0A 2NN4A 4PDLA 2W0FC 5JJNB 2F23A 2JGUA 3TJTA 1N32B 4H37A 4RQEA 3P3PA 3APQA 1I0HA 1M93A 4DV4B 2WLIA 2GTAA 2LP7A 2UXXA 1IXBA 3EVKA 4GUNA 1MMMA 5EIBC 5FPOA 4CBCA 5CA1A 2Y0PA 2P4VA 5EBLC 3Q4HB 2H8PC 2JRIA 1HNZB 2YICA 1BZKA 1YTFB 4DW1A 2IH3C 2YI9A 1AJQA 2IJHA 1MSWD 5LHIA 1FFXA 2JS5A 4X1KA 3CMAV 3JASB 4YIPA 4PDMA 2Q4PA 4JYYA 1AI5A 2E76B 1JQ0A 4IIJB 2UUBO 2Q7HA 2ZXWC 3A0HZ 5C8YB 2AHZA 2R9AA 3JCUZ 2YUAA 4O2BA 4O4LA 4D7TA 4DK1A 3J80N 5JVDB 3B77A 1U96A 2X6AA 4H33A 3OR7C 5A9GA 1RM1C 3K5OA 4PELA 4JI1O 2IBZH 5J2TB 1VF6C 2IJJA 2X7RB 1H8EG 4F6EA 3QF7A 4I55A 3G71V 3CRQA 3CSXA 1W0KG 2K9PA 3P3NA 1F51A 4ASUG 2LGQA 5J2UB 5ITZA 3CCVV 1YI2V 3PJSK 3ZRVA 2YC0A 2YIBD 2RNBA 4DW0A 2PTMA 4YJ2B 2KSDA 4CS2A 2CK3G 5LGNA 3SGIA 1JA8A 1I94B 2OCCC 2YS8A 4FM1A 3X2QB 1N4CA 3GVMA 1M9NA 4CC6A 1K73W 3RYIB 2M7WA 2P67A 2AHYA 1GMGA 4NTXA 3K9SA 2XAQA 1IZ3A 3QNEA 3CJHA 3JAWB 1B6QA 3CCQV 1K34A 1KB9F 3G80A 3EHBB 3HKBA 3JARB 5DECA 1R6KA 2UXNA 1PNMA 1FXHA 4TUYA 4LF5B 1H2NA 1NH2D 4O4HA 1IVSA 1D5NA 4N23A 4TQDA 5KHJA 5LA6A 4O4HB 5GONB 4TUYB 4LF6B 1BS3A 5LYJB 1LUVA 1QLEC 3OGIB 3B2EE 2KB1A 1TAEA 3JAKB 4FM2A 3L9DA 5JVDA 5IYCO 3ZX6A 1AI4A 2EIKC 4P2ZA 1XNQO 3RYIA 3D8CA 1N33B 4PA9A 3FX7A 3CD6V 1SA0A 4EEQA 4IIJA 2Q0AA 4DXWA 2X0LA 1UFIA 3MD0A 1HR0B 4HZ3A 4UVAA 2HKOA 1K33A 2Z5UA 4QGPA 3K79A 1KP3A 4NB5A 3FD9A 1MA1A 3B8NA 1VEWA 3NR7A 4DV5O 1Z5WA 4UCTA 2WLIB 1VQ6V 1URFA 2WA4A 2LW7A 5DN6G 2WLLA 1WPXA 1H2KA 4ABMA 5IJ9A 4UB6Z 2ZIMA 2VQEB 1R73A 1MSDA 4WF9V 4AILC 3BVOA 2EILB 4X65B 2EIJC 5AG2A 3RYCA 3G6BA 4LCUC 5J2TA 1IBLB 4BW5A 1P84F 3KG2A 2ZR2A 3D36C 2EX3A 2FL4A 3JAWA 3JALA 3CXHF 1U97A 1V55C 4QIWF 3OTOO 4O4LB 2Y4UA 1W0JG 3RYFB 3TK1A 4A5UB 1NTMH 2A79B 4DV6B 2ZE7A 1K97A 3CC7V 1E1RG 4RO2A 1IURA 1NS1A 4X65O 1AP5A 3N27A 1DLBA 3P32A 4DV3B 1CEZA 1GN3A 1CP9A 2JJ2G 4OX9O 4UVBA 1VMGA 1FFXB 4FFKA 4LH7A 4B3RB 2YIDA 2Q7EA 4N21A 4JI6B 2UXCB 2F43G 1OCZB 5CA1B 4J9YB 5B3SB 5HFLA 3LSQA 2YXYA 1K4CC 3ZRXA 5KA5A 4K8XA 5J2UA 1YJNV 1K3EA 1Y66A 1DGSA 2ILMA 3UM7A 3WFVA 1ZAUA 4OX9B 4GCZA 3SPJA 2H3OA 4FFBB 4Q20A 4DR6B 5J9PC 3E8BA 4JI6O 4XBFA 2CH7B 4B3MB 1AJPA 2YXLA 3SYCA 1EZVH 2RN9A 1N32O 3AG4B 4UXNA 3ZRWA 3FAVA 3I55V 3K08A 1XHXA 3RFRA 3KKYA 4X66B 3DSQA 4MSWC 1JMKC 2N74A 2EIMB 1XL4A 2VWKA 1VIBA 2DJVA 3O9OA 4AQYB 3QO5A 2V7QG 4UCSA 3JAKA 3T1YO 1Q6HA 1BMFG 4DR6O 4DRXA 5ITZB 1JJ2U 3CXCU 1NZ6A 4GX5A 5A2QN 3ASOC 3ZMTA 1OCRC 3IAYA 5LA6B 2DWEC 3H1KH 5IWAB 3L70H 2E75B 5B5EZ 3KCYA 3UCSC 1R1BA 3QO8A 4DV3O 3CB2A 2AGAA 3OD4A 2YI8A 2XAHA 2LJ2A 4RUEA 4B3RO 1VP7A 5LMUO 4FM0A 3WG7C 3B40A 1JFFB 2DOSA 1Q90D 2UXBB 3ETQA 1S5LZ 1RM1B 1YITV 4WFGA 1YHQV 3W7UA 4MVMA 4B7EA 4JZ2A 1US6A 4B08A 2PI4A 2BOCC 4JI8O 4WFEA 1V9PA 3BABA 2ZDIA 1UPGA 4MTFA 1IBKO 2ZE8A 2A3QA 1ZL8B 2HJFC 4R7CA 2PZSA 4J80A 4JI2B 4TV9B 2ZQMA 1AJNA 1J95A 3C3SA 1JJOA 2UXBO 3ZMVA 3E83A 5D5QA 1K4DC 1YVWA 2DE0X 3F7VC 2UUBB 5EC1C 3CRAA 3CC2V 1WPBA 1K5QA 2EJ7A 1JX9A 4UV8A 1M57C 4DV1B 4B3TO 2DW4A 3STLC 5KMGB 2VWJA 3K5NA 1SZXA 4UUJC 4ZOLB 3SJBC 3SYAA 4DV0O 3VQXA 2IU0A 5B66Z 4UCUA 1VQ8V 4JASA 1HNWO 2E5LB 2YEVA 4LR3A 2ZT9B 2PI5A 2XAJA 3N2KA 5CMUA 1AR4A 2ZE6A 5JQGA 3ABUA 4DR5B 1KMIZ 5KHKA 1B3QA 1ROPA 2F95B 2OTLV 2YEVB 2DN9A 5D5PA 3IGAC 1NVPB 5LP6C 2CDYA 4GKJO 1TVKB 4O2AA 4JF3A 1WLEA 2ZR3A 4X64B 2QWQB 2FYUH 4RUFA 4H0LB 2ETNA 5IT9N 4RAIA 3RW0A 2QWRB 1OCRB 2UUAB 1RSOB 4WBNB 2HVKC 3FYIB 5KLVH 2GV9A 4K35A 4FLZA 3L73H 2H94A 4YHHO 1SQGA 1H8HG 1SZTA 3FB5C 2DYSB 2JK5C 3G67A 5BMVA 2GSMB 5CA0A 1N34O 3L75H 4TWKA 4WFAV 3E8HA 4LNUA 2B1GA 3LDDA 4F6RA 1SETA 1YEWA 1IX9A 1G4YB 3T1CA 1KKDA 4BIZA 4IT5A 5IYZA 1FAFA 4PHZA 3JD1A 2QKSA 4JYBA 4EKWA 4CH6A 4W4LA 4I0XB 3UT5A 3M99B 4JV5B 3K0GA 4QE7A 3E86A 4HYOA 1NQTA 2F1MA 3RYHA 1Q7YW 1WP8A 3ICXA 2WA3A 4JI7B 2OWOA 3BFRA 4WFBV 3T4ZA 3GWKC 4LBEC 1FYJA 4ZIBA 2EJRA 2ZNJA 2E5LO 5B1BB 4I7ZB 3WB0A 3X2QC 3AG2B 1PL4A 3THOA 1THZA 4MVSA 4U3JA 4MVRA 1IBLO 1XMOO 4ZOLA 1XUQA 3GB7C 1QVFU 4BR6A 1I94O 2HHHB 5BR8B 4QNHB 1OCOB 5GTIZ 4JI5B 5LP6B 3BA9A 5IYDO 1K92A 3HKCB 2Y69C 3SJAC 4JI1B 3D3IA 1FXKC 4J7ZA 3IFXA 1HR0O 4MS2A 3CPWU 5LMNB 4R6ZA 1F7YA 3OMNB 1QR8A 5IYBO 4DR2B 2P6JA 3KCXA 1F23A 3OAAG 3RYHB 4FLXA 1PM9A 5C93A 4JI5O 1FXVA 4JYCA 3ZN1A 3OTFA 5EZYA 1GAXA 4GZRB 2WLJA 2PYLA 1VF6A 5EBMC 3OEHG 1XBLA 4X1YA 2DWDC 1NKDA 2ZINA 2FMLA 1VQOV 4DUYO 3ZMSA 4X1IB 2OCHA 4MVOA 2ADPA 3SYQA 1M57B 1XMQB 1ENVA 4DR7B 5IYZB 2CH7A 3EFFK 3ZMUA 1K7DA 1PV0A 2BE3A 1GKFA 1NTZH 4GX2A 1JR9A 3U0ZA 2VRZA 1OCCB 1N8RW 2A9HA 3LDCA 5IJ0A 3L72H 1PPJH 4JTDB 1Y76B 1RSOA 2ODMA 3F7YC 3A8TA 2VS0A 1EN4A 3PN1A 1NJIW 5KA6A 3OE7G 2DYRB 2AW9A 2QE7G 4P30A 5LHHA 2QEXV 3J81N 4CS3A 5H9CA 5L3GA 5H2FZ 3LSSA 2ITCC 4JPRA 4PA4A 2AZ2A 1VQ9V 1SQXH 4X1YB 3K3WA 1WB8A 3STZC 1Q3EA 3CRRA 3HKEB 2F4VB 1H2GA 1PKXA 1TGOA 3BY6A 1KQSU 2QTSA 2IJIA 3JALB 1EFRG 4FMTA 5CBGA 2AXTZ 1RPOA 2L6LA 3RT3C 1KECA 3I56V 1SQVH 2HEPA 2PY5A 4X9QA 3QG5A 3SYPA 4KXRA 4X8AA 4FLUA 2CTRA 4C7UA 4NTWA 3OTOB 2WLHA 1DF5A 3F5WC 3W7WA 2D2CB 1S77D 4BW9A 3HKDB 4QE9A 1S72V 3RGBA 2VQFO 1Q43A 4PA6A 4P9OA 1WP7A 3K57A 2NR5A 1X4TA 4WBNA 2BTQA 2FTKA 3D3QA 1NTKH 3AG4C 1SC5B 1XOUA 3RN4A 4NXNO 3MHSC 4EFBA 1S0VA 1BL8A 1VQPV 4UV9A 1TVKA 1GM7A 4W4KA 2VQEO 1M1KW 3DC6A 3BRCA 5IWAO 3SR2C 4DV7B 2QWOB 4FFBA 1Y74B 5JWPA 4G28B 2LFSA 4WFFA 3T1HB 2ZDIC 1AB3A 3ABKB 4NXNB 4E4EA 1PP9H 3E35A 3CMEV 4WFHA 4U7OA 4DR1O 1KYOF 4Z1MG 4ZI7A 2JDIG 2UU9B 1PD3A 1BHBA 5FNVB 5EC2C 4UFZA 1YZBA 3ZHVA 4DK0A 1HNWB 1M90W 3VQWA 2W0XA 2QJ1A 2EINC 3UO2A 4DUZB 1FXKB 1ZSPA 1COWG 2JGDB 4AQYO 4J9ZB 3H01A 4UCVA 3JATA 5GTHZ 4IHJA 1Q81W 1GH6A 3HR0A 4O4JB 1AP6A 1R3KC 3OUSA 1IXMA 2DQ0A 2EIKB 3N2KB 3H9VA 2GHYA 2UUCO 1BHAA 5F2VO 4I0XA 1GO3F 3G4SV 2LFRA 4EFEA 1J5EB 1SQFA 1HP8A 1LNQA 1OJHA 3F5TA 3AG1C 1M56B 2JJ1G 1JOYA 1BQ0A 1HNXB 2P90A 3IC7A 1W2BU 5GW7A 4WCEV 4G27B 4LH6A 4YJ2A 2GUZA 1WB7A 4JGSA 1P7GA 4DR3B 4JAUA 1H2MA 1S5JA 3K9AA 2OIGA 2O57A 1WAZA 4PA7A 3J7AU 4O4IA 4X88A 2Q7GA 4I5SA 4NTYA 4JTAB 4NKGB 1N0JA 5LGUA 2P7TC 4PI0A 1XILA 4J7KA 1IBKB 5KAIZ 2ZM6O 1VQMV 4ZBMA 2XUMA 4X89A 3OMIB 1GK9A 3VQVA 1XL6A 3S3WA 1VF5B 4O2AB 4DV2B 5CBHA 4JI2O 1H38A 2OCCB 1B04A 3CCMV 5LOVB 4QJFB 4NR1A 2YDEA 3HKBB 3JARA 1ZX3A 3FYEB 3T4DA 4FLTA 4MVQA 4DRXB 2Q73A 1SESA 4JI3O 4ZHQA 4FZ0A 5CB4B 5IE9A 3AK3A 3RYFA 1QLEB 1N36O 4H13B 3KZIZ 4HAMA 5JJJB 4ZHQB 5CB4A 1HNZO 1TA8A 1R6TA 5B1NA 1FJGB 4YHHB 1VF7A 5TISZ 1Q86W 4NYKA 2E74B 3SPHA 2A06H 5DEDA 4DO2A 5JJEB 3TXSA 1PNKA 4LF8B 2UUCB 2JVDA 1NT2B 3OM3B 3OGCC 4PD4F 3CCRV 1V54B 5H6RA 2GDSA 1V55B 2LW1A 3Q4HA 5L3CA 2RQ6A 1Y4MA 3JSNA 2WLLB 4CS4A 2DYSC 5IJ9B 2Q5ZA 2RJZA 5LYJA 3CEIA 4B3SB 1JCHA 2C2AA 4F4LA 2G38A 4XDJA 3LNNA 4HNAA 5KX5A 2IM9A 2PF4E 3K0DA 2QWPB 1SS3A 2EIJB 2EULA 1DF4A 3CCEV 4MTXA 3LUTB 1GM9A 1XMQO 3AG3B 4X64O 2W6JG 4TT3G 1CPYA 1QQCA 1VARA 1YXBA 4BIOA 3ZBHA 2BOBC 2UUAO 1R3LC 1K8AW 1S5HC 2ZM6B 1F4MA 1TUBB 1SQQH 1OHHG 2EINB 1KC8W 4YY3O 2B1IA 1BQZA 4DV0B 2QKAA 5IDJA 1IBMB 2Q68A 4XDLA 2BCCH 4FLWA 1NH2B 1I7FA 2Y0IA 4HNAB 5KX5B 4EB6A 3JD4A 2ZD9A 3JAMN 5HFMA 3H1HH 2GBOA 1HDJA 3E22A 3WG7B 4IYHA 1DTOA 4AI8A 3U10A 1N36B 1QLNA 3E8GA 1Q82W 1N33O 4RQFA 4I9QA 2DMXA 2HFEC 3QVNA 5LBQA 4LF4B 1FJGO 5H6QA 3K06A 5L3FA 1MOFA 2KG7A 4FK5C 4NVPA 3R65A 2Q69A 3E22B 2F93B 1GN2A 3S3XA 4DR7O 1Q8IA 1B06A 4MVUA 1GM8A 3DTUB 5LHGA 1XMOB 4MW8A 4LF5O 1VQKV 1QNMA 1ZLZA 5KUMA 5L3EA 1AR1B 3ML0A 1Y74A 4GX0A 1QBZA 1SQPH 2HP8A 4JZGA 4LFBB 5KHIA 5CN0A 1R6NA 2CTWA 1SRYA 4LF6O 1N34B 1FFTB 4X62O 4J42A 2QSAA 2VQFB 1E1QG 3SPIA 2ADQB 3M7MX 3CRMA 2ZCEA 5E79Z 2R72A 1DK1A 2Z3YA 4RWUA 2IU3A 3WB2A 2CGOA 2BSKB 2QM7A 1K5SA 1QHTA 2GTSA 4IHJB 2XNDG 5FL7G 3JD2A 3IC9A 5K1PA 4LFBO 2JGDA 4Z2WA 4FJCC 5BY1A 1XQ8A 1TUEB 3CRCA 1GN6A 4PA3A 1EN5A 4DV7O 5FPRA 3H1JH 3SJCC 1VQNV 4IL6Z 2PUSA 4X20B 3GWOA 3ASOB 3CE2A 3TETA 4ZI7B 5BR8O 4KHPB 1AILA 5LGTA 4I9WA 4EB6B 4DV5B 4LF4O 2QM4A 2YSUB 4D7SA 1ORQC 3WB1A 1SERA 1JVMA 2IW5A 5LXTB 1S76D 5C8YA 4OXSA 5B1AC 4FPPA 3ABTA 3SPCA 4XDKA 1VQLV 5IY5C 3JD0A 1K9MW 3ZRSA 4L87A 2Y69B 2QWNB 5LOVA 2EBOA 4X20A 5GONA 3R66A 3ABLB 1AROP 5L3BA 1XNQB 4X1KB 1P7BA 4LFAO 1GRJA 3ZMZA 2P06A 2XASA 1NU1H 1E79G 5H5NA 5K1XA 1XHZA 3TCUA 4JI4O 3SJQC 3CP1A 5IJ0B 1AR5A 2Q8VA 1WNSA 1Y6XA 2V1DA 2QTOA 3BCCH 1YF2A 1W59A 4R8CA 2XTAA 2GUZB 3CCJV 2N05A 3DC5A 4PDRA 1V54C 2KQXA 3AK1A 3ZN0A 1TUBA 2UXCO 4TOIA 3ZHRA 5KHHA 3I5DA 2L35A 2P4KA 4JI4B 1KU9A 3W7XA 1R3JC 5EZYB 4DR4B 2Q6AA 1XDCA 3JYCA 1BE3H 4R50A 4B3TB 5B1OA 3ABMC 2ZKOA 1O9HA 3CS5A 4FLYA 4B3MO 4DV2O 3OR6C 2F4VO 4I4TB 3C3TA 5EYPA 1FXKA 2KG7B 2V4DA 1AVMA 3K04A 3FB7C 3OT7A 3B09A 3HKCA 2YIBA 4MTGA 4L8JA 2JIZG 1I08A 3DXRB 5FNVA 2WLMA 2K1EA 1Q5OA 1L1FA 1YDXA 3OUFA 2QGNA 5KHGA 4O4IB 3CJHB 3TGUH 1I5YA 3OMAB 3N2GA 1N0NA 3ZHSA 2ATKC 1KKCA 1IDSA 2LGWA 1MZFA 3ASNB 4DR3O 1GN4A 3QO7A 1XREA 3RVZA 3E89A 3ZHUA 4DV4O 2B5UA 3ABMB 1OV9A 1L0LH 3JCZA 1YCIA 4X1IA 2HJDA 3JASA 3HB3B 1FS0G 4K3AA 4B3SO 4H44B 4F6RB 1LR1A 3CHXA 5JCOA 5CBFA 4LNUB 2D3OW 1PL0A 2BTQB 2JS3A 4QPJA 2PYJA 4DR4O 1OZ0A 2A0LA 3G6EV 4BAYA
chains in the Genus database with same CATH topology
3DXRA 3CJHA 3CJHB 2BSKA 3DXRB 2BSKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXR A;  3CJH A;  3CJH B;  2BSK A;  3DXR B;  2BSK B; 
#chains in the Genus database with same CATH topology
 2YIA A;  4K8Z A;  3HKD A;  4I50 A;  3JSL A;  3AG3 C;  4I55 B;  1P49 A;  3MDS A;  1S3J A;  4IYI A;  4K0K O;  3UKM A;  2A7W A;  3VBB A;  1QVG U;  2Q9L A;  4JV5 O;  2Q0O C;  2PGG A;  5JH7 B;  2M6Y A;  1BSM A;  2XHB A;  2DQ3 A;  4U3J B;  4GKJ B;  4LF8 O;  1AI6 A;  1AI7 A;  1MNG A;  3CYO A;  4NXM O;  1H2L A;  2YXH A;  1A32 A;  4O2B B;  4LP8 A;  1G6U A;  2HHH O;  3HKE A;  4O4J A;  4FIP C;  3H1I H;  3AEI A;  5IY5 B;  2WLN A;  3CCL V;  1I5X A;  1CXZ B;  3FFQ A;  2Y4T A;  2CAZ C;  3AG1 B;  1ZTE A;  1KP2 A;  2CGN A;  1QR9 A;  3ETE A;  4UCO A;  5E1A C;  3OW2 U;  1BGY H;  1Y67 A;  1Z5V A;  2Q67 A;  2ZE5 A;  4UVC A;  4JYA O;  3LNM B;  2FKX A;  3K58 A;  1L8D A;  3ZS8 C;  1YJW V;  2XAF A;  3AG2 C;  4JAV A;  4BIU A;  1HNX O;  2E3C A;  1MAB G;  3H1L H;  3MAQ A;  3W7S A;  1WA8 A;  4TV9 A;  4JI7 O;  1YSC A;  2N04 A;  1YJ9 V;  5EBW C;  5DM6 V;  1XI1 A;  3UT5 B;  3APO A;  3AG7 A;  4LFC O;  1KUQ A;  1UJW B;  2MW2 B;  3DGE A;  4B7K A;  1BT8 A;  3ASN C;  5B1B C;  4DV1 O;  4K0K B;  3ETG A;  4AHC A;  2ZNI A;  1LUW A;  1QU7 A;  4LF7 O;  2XAG A;  2ZIO A;  3D36 A;  3VQY A;  3CCU V;  3LSU A;  4MTO A;  5BXZ A;  2NLJ C;  1VQ4 V;  3E2E A;  3CX5 F;  3MHH C;  2LQT A;  5CA3 A;  3K5M A;  3JAT B;  4JI3 B;  4FVM A;  3L71 H;  1M5I A;  5EIB D;  2QDO A;  1R3I C;  2P22 C;  4KHP O;  2EZO A;  2P5O A;  2R9I A;  4LF7 B;  1NVP D;  1EZJ A;  2HR3 A;  3EXA A;  4LWS B;  2MK3 A;  4UB8 Z;  1MZE A;  3K03 A;  1JPX A;  2EZP A;  4LF9 O;  3BAA A;  3O65 A;  2OT5 A;  2RCV A;  4D6T H;  1NI8 A;  3JD3 A;  4FZ1 A;  4TV8 A;  4CH4 A;  5B1A B;  4JYA B;  4DYL A;  2QR4 A;  2WPD G;  2WAM A;  4GLX A;  4GX1 A;  1FKA O;  4KL1 A;  4UCR A;  4YJ3 A;  4GYC B;  2Y48 A;  3OFN G;  4KP4 A;  3SYO A;  1D5A A;  2BTO A;  2XT9 A;  4U7N A;  3ETD A;  4YJ3 B;  1M56 C;  1NBM G;  3RVY A;  1F4N A;  4LF9 B;  3CC4 V;  3QTC A;  5LMN O;  1RFY A;  4PDV A;  2X6C A;  1GTO A;  1QCE A;  1XNR B;  5B3S C;  4LFC B;  1YIJ V;  3A0R A;  3FB8 C;  1JFF A;  1OCZ C;  3NXS A;  4J10 A;  4DR2 O;  4G2K A;  1EBO A;  4OPA A;  1WJZ A;  4PI2 A;  5CA0 B;  1WA8 B;  3ZIA G;  3N2G B;  2RMK B;  1Y76 A;  4GT1 A;  2OYQ A;  1YTF D;  2B9Z A;  2HVJ C;  2ZXW B;  2EIM C;  4QPK A;  4YY3 B;  2IH1 C;  3TXQ A;  3ABL C;  4KUM A;  4CZZ A;  1D2D A;  1IBM O;  5FLX N;  4JAA A;  4U3F H;  3VOU A;  2UXD O;  4X62 B;  3K59 A;  4E2L A;  3WU2 Z;  5LP6 A;  4TSF G;  2OIE A;  1HWY A;  1RP3 B;  5LL6 Y;  3T1H O;  1EM1 A;  4I4T A;  1ZWI C;  2XOK G;  3IJ4 A;  4LFA B;  5EK0 A;  3RWR D;  4DR1 B;  1NR7 A;  2JEU A;  3UQ8 A;  5JQG B;  2EIL C;  1KBH A;  1M4U A;  3CCS V;  2FB5 A;  5KUK A;  2UU9 O;  3OEE G;  2ARH A;  5LXT A;  4TV8 B;  1T5E A;  1SKV A;  4JTC B;  1XEQ A;  1VQ5 V;  2QM8 A;  5L3D A;  1X59 A;  4IGG A;  4HBN A;  4J41 A;  4MVZ A;  4FLV A;  3A0B Z;  4ICG A;  3P30 A;  3U11 A;  4TQF A;  1G1X B;  2LO1 A;  3BEH A;  4JI0 O;  4I50 B;  2QKC A;  4DUY B;  3AK2 A;  3BPZ A;  4KFM A;  2WWW A;  2CE4 A;  4GKK O;  1VQ7 V;  4DV6 O;  1HW7 A;  5BZB A;  4CH3 A;  4X66 O;  3A2F A;  2WSS G;  3RBZ A;  1XNR O;  1KD1 W;  2W6I G;  2BSK A;  1J5E O;  1O9G A;  4CC5 A;  4JI8 B;  1RPR A;  3BA8 A;  3SPG A;  1ZL8 A;  4P9P A;  4J11 A;  3ZHQ A;  4JI0 B;  3ZRW B;  1Z2G A;  2X6B A;  1MG1 A;  3ZJZ A;  1P4R A;  4OPH A;  3LDE A;  2UXD B;  1OCC C;  3SDL A;  3FB6 C;  3ABK C;  1SA0 B;  3W7T A;  4YIO A;  1SF9 A;  4Q6G A;  4PJ0 Z;  4DUZ O;  1ZUQ A;  4CH5 A;  4YXW G;  1BCC H;  5BMV B;  4BWA A;  3K5L A;  4LC1 A;  1FPO A;  1L0N H;  2KKW A;  3UO3 A;  5JCO C;  1PNL A;  5LMU B;  3E8F A;  1EN6 A;  2CTQ A;  3CWB H;  3ZCC A;  2F66 C;  3DXR A;  4LWS A;  1G8M A;  2ITD C;  3RYC B;  5KMG A;  3C90 A;  4MT8 A;  2Z0A A;  2CUG A;  2RDC A;  2R9R B;  4NXM B;  4OGQ B;  3HPL C;  3M8A A;  2HG5 C;  2NNU A;  3L74 H;  3T2M A;  4Z1V A;  4DR5 O;  5EYP B;  2R70 A;  2WLK A;  2HLD G;  2DYR C;  3T1Y B;  4J7J A;  4ZKI A;  1FD9 A;  2CTP A;  2QA4 V;  3FKS G;  1Q6U A;  4PV1 B;  2JEX A;  1H2S B;  3B8M A;  3ZHT A;  2IJK A;  1SQB H;  4GKK B;  1OCO C;  4MW3 A;  3BHP A;  2OTJ V;  5KAF Z;  1NR1 A;  3FAV B;  1WN7 A;  3B4S A;  1Q6I A;  5JH7 A;  3ZED A;  2AZ0 A;  2NN4 A;  4PDL A;  2W0F C;  5JJN B;  2F23 A;  2JGU A;  3TJT A;  1N32 B;  4H37 A;  4RQE A;  3P3P A;  3APQ A;  1I0H A;  1M93 A;  4DV4 B;  2WLI A;  2GTA A;  2LP7 A;  2UXX A;  1IXB A;  3EVK A;  4GUN A;  1MMM A;  5EIB C;  5FPO A;  4CBC A;  5CA1 A;  2Y0P A;  2P4V A;  5EBL C;  3Q4H B;  2H8P C;  2JRI A;  1HNZ B;  2YIC A;  1BZK A;  1YTF B;  4DW1 A;  2IH3 C;  2YI9 A;  1AJQ A;  2IJH A;  1MSW D;  5LHI A;  1FFX A;  2JS5 A;  4X1K A;  3CMA V;  3JAS B;  4YIP A;  4PDM A;  2Q4P A;  4JYY A;  1AI5 A;  2E76 B;  1JQ0 A;  4IIJ B;  2UUB O;  2Q7H A;  2ZXW C;  3A0H Z;  5C8Y B;  2AHZ A;  2R9A A;  3JCU Z;  2YUA A;  4O2B A;  4O4L A;  4D7T A;  4DK1 A;  3J80 N;  5JVD B;  3B77 A;  1U96 A;  2X6A A;  4H33 A;  3OR7 C;  5A9G A;  1RM1 C;  3K5O A;  4PEL A;  4JI1 O;  2IBZ H;  5J2T B;  1VF6 C;  2IJJ A;  2X7R B;  1H8E G;  4F6E A;  3QF7 A;  4I55 A;  3G71 V;  3CRQ A;  3CSX A;  1W0K G;  2K9P A;  3P3N A;  1F51 A;  4ASU G;  2LGQ A;  5J2U B;  5ITZ A;  3CCV V;  1YI2 V;  3PJS K;  3ZRV A;  2YC0 A;  2YIB D;  2RNB A;  4DW0 A;  2PTM A;  4YJ2 B;  2KSD A;  4CS2 A;  2CK3 G;  5LGN A;  3SGI A;  1JA8 A;  1I94 B;  2OCC C;  2YS8 A;  4FM1 A;  3X2Q B;  1N4C A;  3GVM A;  1M9N A;  4CC6 A;  1K73 W;  3RYI B;  2M7W A;  2P67 A;  2AHY A;  1GMG A;  4NTX A;  3K9S A;  2XAQ A;  1IZ3 A;  3QNE A;  3CJH A;  3JAW B;  1B6Q A;  3CCQ V;  1K34 A;  1KB9 F;  3G80 A;  3EHB B;  3HKB A;  3JAR B;  5DEC A;  1R6K A;  2UXN A;  1PNM A;  1FXH A;  4TUY A;  4LF5 B;  1H2N A;  1NH2 D;  4O4H A;  1IVS A;  1D5N A;  4N23 A;  4TQD A;  5KHJ A;  5LA6 A;  4O4H B;  5GON B;  4TUY B;  4LF6 B;  1BS3 A;  5LYJ B;  1LUV A;  1QLE C;  3OGI B;  3B2E E;  2KB1 A;  1TAE A;  3JAK B;  4FM2 A;  3L9D A;  5JVD A;  5IYC O;  3ZX6 A;  1AI4 A;  2EIK C;  4P2Z A;  1XNQ O;  3RYI A;  3D8C A;  1N33 B;  4PA9 A;  3FX7 A;  3CD6 V;  1SA0 A;  4EEQ A;  4IIJ A;  2Q0A A;  4DXW A;  2X0L A;  1UFI A;  3MD0 A;  1HR0 B;  4HZ3 A;  4UVA A;  2HKO A;  1K33 A;  2Z5U A;  4QGP A;  3K79 A;  1KP3 A;  4NB5 A;  3FD9 A;  1MA1 A;  3B8N A;  1VEW A;  3NR7 A;  4DV5 O;  1Z5W A;  4UCT A;  2WLI B;  1VQ6 V;  1URF A;  2WA4 A;  2LW7 A;  5DN6 G;  2WLL A;  1WPX A;  1H2K A;  4ABM A;  5IJ9 A;  4UB6 Z;  2ZIM A;  2VQE B;  1R73 A;  1MSD A;  4WF9 V;  4AIL C;  3BVO A;  2EIL B;  4X65 B;  2EIJ C;  5AG2 A;  3RYC A;  3G6B A;  4LCU C;  5J2T A;  1IBL B;  4BW5 A;  1P84 F;  3KG2 A;  2ZR2 A;  3D36 C;  2EX3 A;  2FL4 A;  3JAW A;  3JAL A;  3CXH F;  1U97 A;  1V55 C;  4QIW F;  3OTO O;  4O4L B;  2Y4U A;  1W0J G;  3RYF B;  3TK1 A;  4A5U B;  1NTM H;  2A79 B;  4DV6 B;  2ZE7 A;  1K97 A;  3CC7 V;  1E1R G;  4RO2 A;  1IUR A;  1NS1 A;  4X65 O;  1AP5 A;  3N27 A;  1DLB A;  3P32 A;  4DV3 B;  1CEZ A;  1GN3 A;  1CP9 A;  2JJ2 G;  4OX9 O;  4UVB A;  1VMG A;  1FFX B;  4FFK A;  4LH7 A;  4B3R B;  2YID A;  2Q7E A;  4N21 A;  4JI6 B;  2UXC B;  2F43 G;  1OCZ B;  5CA1 B;  4J9Y B;  5B3S B;  5HFL A;  3LSQ A;  2YXY A;  1K4C C;  3ZRX A;  5KA5 A;  4K8X A;  5J2U A;  1YJN V;  1K3E A;  1Y66 A;  1DGS A;  2ILM A;  3UM7 A;  3WFV A;  1ZAU A;  4OX9 B;  4GCZ A;  3SPJ A;  2H3O A;  4FFB B;  4Q20 A;  4DR6 B;  5J9P C;  3E8B A;  4JI6 O;  4XBF A;  2CH7 B;  4B3M B;  1AJP A;  2YXL A;  3SYC A;  1EZV H;  2RN9 A;  1N32 O;  3AG4 B;  4UXN A;  3ZRW A;  3FAV A;  3I55 V;  3K08 A;  1XHX A;  3RFR A;  3KKY A;  4X66 B;  3DSQ A;  4MSW C;  1JMK C;  2N74 A;  2EIM B;  1XL4 A;  2VWK A;  1VIB A;  2DJV A;  3O9O A;  4AQY B;  3QO5 A;  2V7Q G;  4UCS A;  3JAK A;  3T1Y O;  1Q6H A;  1BMF G;  4DR6 O;  4DRX A;  5ITZ B;  1JJ2 U;  3CXC U;  1NZ6 A;  4GX5 A;  5A2Q N;  3ASO C;  3ZMT A;  1OCR C;  3IAY A;  5LA6 B;  2DWE C;  3H1K H;  5IWA B;  3L70 H;  2E75 B;  5B5E Z;  3KCY A;  3UCS C;  1R1B A;  3QO8 A;  4DV3 O;  3CB2 A;  2AGA A;  3OD4 A;  2YI8 A;  2XAH A;  2LJ2 A;  4RUE A;  4B3R O;  1VP7 A;  5LMU O;  4FM0 A;  3WG7 C;  3B40 A;  1JFF B;  2DOS A;  1Q90 D;  2UXB B;  3ETQ A;  1S5L Z;  1RM1 B;  1YIT V;  4WFG A;  1YHQ V;  3W7U A;  4MVM A;  4B7E A;  4JZ2 A;  1US6 A;  4B08 A;  2PI4 A;  2BOC C;  4JI8 O;  4WFE A;  1V9P A;  3BAB A;  2ZDI A;  1UPG A;  4MTF A;  1IBK O;  2ZE8 A;  2A3Q A;  1ZL8 B;  2HJF C;  4R7C A;  2PZS A;  4J80 A;  4JI2 B;  4TV9 B;  2ZQM A;  1AJN A;  1J95 A;  3C3S A;  1JJO A;  2UXB O;  3ZMV A;  3E83 A;  5D5Q A;  1K4D C;  1YVW A;  2DE0 X;  3F7V C;  2UUB B;  5EC1 C;  3CRA A;  3CC2 V;  1WPB A;  1K5Q A;  2EJ7 A;  1JX9 A;  4UV8 A;  1M57 C;  4DV1 B;  4B3T O;  2DW4 A;  3STL C;  5KMG B;  2VWJ A;  3K5N A;  1SZX A;  4UUJ C;  4ZOL B;  3SJB C;  3SYA A;  4DV0 O;  3VQX A;  2IU0 A;  5B66 Z;  4UCU A;  1VQ8 V;  4JAS A;  1HNW O;  2E5L B;  2YEV A;  4LR3 A;  2ZT9 B;  2PI5 A;  2XAJ A;  3N2K A;  5CMU A;  1AR4 A;  2ZE6 A;  5JQG A;  3ABU A;  4DR5 B;  1KMI Z;  5KHK A;  1B3Q A;  1ROP A;  2F95 B;  2OTL V;  2YEV B;  2DN9 A;  5D5P A;  3IGA C;  1NVP B;  5LP6 C;  2CDY A;  4GKJ O;  1TVK B;  4O2A A;  4JF3 A;  1WLE A;  2ZR3 A;  4X64 B;  2QWQ B;  2FYU H;  4RUF A;  4H0L B;  2ETN A;  5IT9 N;  4RAI A;  3RW0 A;  2QWR B;  1OCR B;  2UUA B;  1RSO B;  4WBN B;  2HVK C;  3FYI B;  5KLV H;  2GV9 A;  4K35 A;  4FLZ A;  3L73 H;  2H94 A;  4YHH O;  1SQG A;  1H8H G;  1SZT A;  3FB5 C;  2DYS B;  2JK5 C;  3G67 A;  5BMV A;  2GSM B;  5CA0 A;  1N34 O;  3L75 H;  4TWK A;  4WFA V;  3E8H A;  4LNU A;  2B1G A;  3LDD A;  4F6R A;  1SET A;  1YEW A;  1IX9 A;  1G4Y B;  3T1C A;  1KKD A;  4BIZ A;  4IT5 A;  5IYZ A;  1FAF A;  4PHZ A;  3JD1 A;  2QKS A;  4JYB A;  4EKW A;  4CH6 A;  4W4L A;  4I0X B;  3UT5 A;  3M99 B;  4JV5 B;  3K0G A;  4QE7 A;  3E86 A;  4HYO A;  1NQT A;  2F1M A;  3RYH A;  1Q7Y W;  1WP8 A;  3ICX A;  2WA3 A;  4JI7 B;  2OWO A;  3BFR A;  4WFB V;  3T4Z A;  3GWK C;  4LBE C;  1FYJ A;  4ZIB A;  2EJR A;  2ZNJ A;  2E5L O;  5B1B B;  4I7Z B;  3WB0 A;  3X2Q C;  3AG2 B;  1PL4 A;  3THO A;  1THZ A;  4MVS A;  4U3J A;  4MVR A;  1IBL O;  1XMO O;  4ZOL A;  1XUQ A;  3GB7 C;  1QVF U;  4BR6 A;  1I94 O;  2HHH B;  5BR8 B;  4QNH B;  1OCO B;  5GTI Z;  4JI5 B;  5LP6 B;  3BA9 A;  5IYD O;  1K92 A;  3HKC B;  2Y69 C;  3SJA C;  4JI1 B;  3D3I A;  1FXK C;  4J7Z A;  3IFX A;  1HR0 O;  4MS2 A;  3CPW U;  5LMN B;  4R6Z A;  1F7Y A;  3OMN B;  1QR8 A;  5IYB O;  4DR2 B;  2P6J A;  3KCX A;  1F23 A;  3OAA G;  3RYH B;  4FLX A;  1PM9 A;  5C93 A;  4JI5 O;  1FXV A;  4JYC A;  3ZN1 A;  3OTF A;  5EZY A;  1GAX A;  4GZR B;  2WLJ A;  2PYL A;  1VF6 A;  5EBM C;  3OEH G;  1XBL A;  4X1Y A;  2DWD C;  1NKD A;  2ZIN A;  2FML A;  1VQO V;  4DUY O;  3ZMS A;  4X1I B;  2OCH A;  4MVO A;  2ADP A;  3SYQ A;  1M57 B;  1XMQ B;  1ENV A;  4DR7 B;  5IYZ B;  2CH7 A;  3EFF K;  3ZMU A;  1K7D A;  1PV0 A;  2BE3 A;  1GKF A;  1NTZ H;  4GX2 A;  1JR9 A;  3U0Z A;  2VRZ A;  1OCC B;  1N8R W;  2A9H A;  3LDC A;  5IJ0 A;  3L72 H;  1PPJ H;  4JTD B;  1Y76 B;  1RSO A;  2ODM A;  3F7Y C;  3A8T A;  2VS0 A;  1EN4 A;  3PN1 A;  1NJI W;  5KA6 A;  3OE7 G;  2DYR B;  2AW9 A;  2QE7 G;  4P30 A;  5LHH A;  2QEX V;  3J81 N;  4CS3 A;  5H9C A;  5L3G A;  5H2F Z;  3LSS A;  2ITC C;  4JPR A;  4PA4 A;  2AZ2 A;  1VQ9 V;  1SQX H;  4X1Y B;  3K3W A;  1WB8 A;  3STZ C;  1Q3E A;  3CRR A;  3HKE B;  2F4V B;  1H2G A;  1PKX A;  1TGO A;  3BY6 A;  1KQS U;  2QTS A;  2IJI A;  3JAL B;  1EFR G;  4FMT A;  5CBG A;  2AXT Z;  1RPO A;  2L6L A;  3RT3 C;  1KEC A;  3I56 V;  1SQV H;  2HEP A;  2PY5 A;  4X9Q A;  3QG5 A;  3SYP A;  4KXR A;  4X8A A;  4FLU A;  2CTR A;  4C7U A;  4NTW A;  3OTO B;  2WLH A;  1DF5 A;  3F5W C;  3W7W A;  2D2C B;  1S77 D;  4BW9 A;  3HKD B;  4QE9 A;  1S72 V;  3RGB A;  2VQF O;  1Q43 A;  4PA6 A;  4P9O A;  1WP7 A;  3K57 A;  2NR5 A;  1X4T A;  4WBN A;  2BTQ A;  2FTK A;  3D3Q A;  1NTK H;  3AG4 C;  1SC5 B;  1XOU A;  3RN4 A;  4NXN O;  3MHS C;  4EFB A;  1S0V A;  1BL8 A;  1VQP V;  4UV9 A;  1TVK A;  1GM7 A;  4W4K A;  2VQE O;  1M1K W;  3DC6 A;  3BRC A;  5IWA O;  3SR2 C;  4DV7 B;  2QWO B;  4FFB A;  1Y74 B;  5JWP A;  4G28 B;  2LFS A;  4WFF A;  3T1H B;  2ZDI C;  1AB3 A;  3ABK B;  4NXN B;  4E4E A;  1PP9 H;  3E35 A;  3CME V;  4WFH A;  4U7O A;  4DR1 O;  1KYO F;  4Z1M G;  4ZI7 A;  2JDI G;  2UU9 B;  1PD3 A;  1BHB A;  5FNV B;  5EC2 C;  4UFZ A;  1YZB A;  3ZHV A;  4DK0 A;  1HNW B;  1M90 W;  3VQW A;  2W0X A;  2QJ1 A;  2EIN C;  3UO2 A;  4DUZ B;  1FXK B;  1ZSP A;  1COW G;  2JGD B;  4AQY O;  4J9Z B;  3H01 A;  4UCV A;  3JAT A;  5GTH Z;  4IHJ A;  1Q81 W;  1GH6 A;  3HR0 A;  4O4J B;  1AP6 A;  1R3K C;  3OUS A;  1IXM A;  2DQ0 A;  2EIK B;  3N2K B;  3H9V A;  2GHY A;  2UUC O;  1BHA A;  5F2V O;  4I0X A;  1GO3 F;  3G4S V;  2LFR A;  4EFE A;  1J5E B;  1SQF A;  1HP8 A;  1LNQ A;  1OJH A;  3F5T A;  3AG1 C;  1M56 B;  2JJ1 G;  1JOY A;  1BQ0 A;  1HNX B;  2P90 A;  3IC7 A;  1W2B U;  5GW7 A;  4WCE V;  4G27 B;  4LH6 A;  4YJ2 A;  2GUZ A;  1WB7 A;  4JGS A;  1P7G A;  4DR3 B;  4JAU A;  1H2M A;  1S5J A;  3K9A A;  2OIG A;  2O57 A;  1WAZ A;  4PA7 A;  3J7A U;  4O4I A;  4X88 A;  2Q7G A;  4I5S A;  4NTY A;  4JTA B;  4NKG B;  1N0J A;  5LGU A;  2P7T C;  4PI0 A;  1XIL A;  4J7K A;  1IBK B;  5KAI Z;  2ZM6 O;  1VQM V;  4ZBM A;  2XUM A;  4X89 A;  3OMI B;  1GK9 A;  3VQV A;  1XL6 A;  3S3W A;  1VF5 B;  4O2A B;  4DV2 B;  5CBH A;  4JI2 O;  1H38 A;  2OCC B;  1B04 A;  3CCM V;  5LOV B;  4QJF B;  4NR1 A;  2YDE A;  3HKB B;  3JAR A;  1ZX3 A;  3FYE B;  3T4D A;  4FLT A;  4MVQ A;  4DRX B;  2Q73 A;  1SES A;  4JI3 O;  4ZHQ A;  4FZ0 A;  5CB4 B;  5IE9 A;  3AK3 A;  3RYF A;  1QLE B;  1N36 O;  4H13 B;  3KZI Z;  4HAM A;  5JJJ B;  4ZHQ B;  5CB4 A;  1HNZ O;  1TA8 A;  1R6T A;  5B1N A;  1FJG B;  4YHH B;  1VF7 A;  5TIS Z;  1Q86 W;  4NYK A;  2E74 B;  3SPH A;  2A06 H;  5DED A;  4DO2 A;  5JJE B;  3TXS A;  1PNK A;  4LF8 B;  2UUC B;  2JVD A;  1NT2 B;  3OM3 B;  3OGC C;  4PD4 F;  3CCR V;  1V54 B;  5H6R A;  2GDS A;  1V55 B;  2LW1 A;  3Q4H A;  5L3C A;  2RQ6 A;  1Y4M A;  3JSN A;  2WLL B;  4CS4 A;  2DYS C;  5IJ9 B;  2Q5Z A;  2RJZ A;  5LYJ A;  3CEI A;  4B3S B;  1JCH A;  2C2A A;  4F4L A;  2G38 A;  4XDJ A;  3LNN A;  4HNA A;  5KX5 A;  2IM9 A;  2PF4 E;  3K0D A;  2QWP B;  1SS3 A;  2EIJ B;  2EUL A;  1DF4 A;  3CCE V;  4MTX A;  3LUT B;  1GM9 A;  1XMQ O;  3AG3 B;  4X64 O;  2W6J G;  4TT3 G;  1CPY A;  1QQC A;  1VAR A;  1YXB A;  4BIO A;  3ZBH A;  2BOB C;  2UUA O;  1R3L C;  1K8A W;  1S5H C;  2ZM6 B;  1F4M A;  1TUB B;  1SQQ H;  1OHH G;  2EIN B;  1KC8 W;  4YY3 O;  2B1I A;  1BQZ A;  4DV0 B;  2QKA A;  5IDJ A;  1IBM B;  2Q68 A;  4XDL A;  2BCC H;  4FLW A;  1NH2 B;  1I7F A;  2Y0I A;  4HNA B;  5KX5 B;  4EB6 A;  3JD4 A;  2ZD9 A;  3JAM N;  5HFM A;  3H1H H;  2GBO A;  1HDJ A;  3E22 A;  3WG7 B;  4IYH A;  1DTO A;  4AI8 A;  3U10 A;  1N36 B;  1QLN A;  3E8G A;  1Q82 W;  1N33 O;  4RQF A;  4I9Q A;  2DMX A;  2HFE C;  3QVN A;  5LBQ A;  4LF4 B;  1FJG O;  5H6Q A;  3K06 A;  5L3F A;  1MOF A;  2KG7 A;  4FK5 C;  4NVP A;  3R65 A;  2Q69 A;  3E22 B;  2F93 B;  1GN2 A;  3S3X A;  4DR7 O;  1Q8I A;  1B06 A;  4MVU A;  1GM8 A;  3DTU B;  5LHG A;  1XMO B;  4MW8 A;  4LF5 O;  1VQK V;  1QNM A;  1ZLZ A;  5KUM A;  5L3E A;  1AR1 B;  3ML0 A;  1Y74 A;  4GX0 A;  1QBZ A;  1SQP H;  2HP8 A;  4JZG A;  4LFB B;  5KHI A;  5CN0 A;  1R6N A;  2CTW A;  1SRY A;  4LF6 O;  1N34 B;  1FFT B;  4X62 O;  4J42 A;  2QSA A;  2VQF B;  1E1Q G;  3SPI A;  2ADQ B;  3M7M X;  3CRM A;  2ZCE A;  5E79 Z;  2R72 A;  1DK1 A;  2Z3Y A;  4RWU A;  2IU3 A;  3WB2 A;  2CGO A;  2BSK B;  2QM7 A;  1K5S A;  1QHT A;  2GTS A;  4IHJ B;  2XND G;  5FL7 G;  3JD2 A;  3IC9 A;  5K1P A;  4LFB O;  2JGD A;  4Z2W A;  4FJC C;  5BY1 A;  1XQ8 A;  1TUE B;  3CRC A;  1GN6 A;  4PA3 A;  1EN5 A;  4DV7 O;  5FPR A;  3H1J H;  3SJC C;  1VQN V;  4IL6 Z;  2PUS A;  4X20 B;  3GWO A;  3ASO B;  3CE2 A;  3TET A;  4ZI7 B;  5BR8 O;  4KHP B;  1AIL A;  5LGT A;  4I9W A;  4EB6 B;  4DV5 B;  4LF4 O;  2QM4 A;  2YSU B;  4D7S A;  1ORQ C;  3WB1 A;  1SER A;  1JVM A;  2IW5 A;  5LXT B;  1S76 D;  5C8Y A;  4OXS A;  5B1A C;  4FPP A;  3ABT A;  3SPC A;  4XDK A;  1VQL V;  5IY5 C;  3JD0 A;  1K9M W;  3ZRS A;  4L87 A;  2Y69 B;  2QWN B;  5LOV A;  2EBO A;  4X20 A;  5GON A;  3R66 A;  3ABL B;  1ARO P;  5L3B A;  1XNQ B;  4X1K B;  1P7B A;  4LFA O;  1GRJ A;  3ZMZ A;  2P06 A;  2XAS A;  1NU1 H;  1E79 G;  5H5N A;  5K1X A;  1XHZ A;  3TCU A;  4JI4 O;  3SJQ C;  3CP1 A;  5IJ0 B;  1AR5 A;  2Q8V A;  1WNS A;  1Y6X A;  2V1D A;  2QTO A;  3BCC H;  1YF2 A;  1W59 A;  4R8C A;  2XTA A;  2GUZ B;  3CCJ V;  2N05 A;  3DC5 A;  4PDR A;  1V54 C;  2KQX A;  3AK1 A;  3ZN0 A;  1TUB A;  2UXC O;  4TOI A;  3ZHR A;  5KHH A;  3I5D A;  2L35 A;  2P4K A;  4JI4 B;  1KU9 A;  3W7X A;  1R3J C;  5EZY B;  4DR4 B;  2Q6A A;  1XDC A;  3JYC A;  1BE3 H;  4R50 A;  4B3T B;  5B1O A;  3ABM C;  2ZKO A;  1O9H A;  3CS5 A;  4FLY A;  4B3M O;  4DV2 O;  3OR6 C;  2F4V O;  4I4T B;  3C3T A;  5EYP A;  1FXK A;  2KG7 B;  2V4D A;  1AVM A;  3K04 A;  3FB7 C;  3OT7 A;  3B09 A;  3HKC A;  2YIB A;  4MTG A;  4L8J A;  2JIZ G;  1I08 A;  3DXR B;  5FNV A;  2WLM A;  2K1E A;  1Q5O A;  1L1F A;  1YDX A;  3OUF A;  2QGN A;  5KHG A;  4O4I B;  3CJH B;  3TGU H;  1I5Y A;  3OMA B;  3N2G A;  1N0N A;  3ZHS A;  2ATK C;  1KKC A;  1IDS A;  2LGW A;  1MZF A;  3ASN B;  4DR3 O;  1GN4 A;  3QO7 A;  1XRE A;  3RVZ A;  3E89 A;  3ZHU A;  4DV4 O;  2B5U A;  3ABM B;  1OV9 A;  1L0L H;  3JCZ A;  1YCI A;  4X1I A;  2HJD A;  3JAS A;  3HB3 B;  1FS0 G;  4K3A A;  4B3S O;  4H44 B;  4F6R B;  1LR1 A;  3CHX A;  5JCO A;  5CBF A;  4LNU B;  2D3O W;  1PL0 A;  2BTQ B;  2JS3 A;  4QPJ A;  2PYJ A;  4DR4 O;  1OZ0 A;  2A0L A;  3G6E V;  4BAY A; 
#chains in the Genus database with same CATH homology
 3DXR A;  3CJH A;  3CJH B;  2BSK A;  3DXR B;  2BSK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...