2DJVA

Solution structures of the whep-trs domain of human methionyl-trna synthetase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase
publication title Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 79
sequence length 79
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2djvA00
4LF9O 1HNZO 4JV5O 2ZM6O 1HNXO 5BXZA 2JRIA 4DR2O 5LL6Y 1IBKO 4YY3O 4NXMO 5LMUO 1AILA 3M8AA 4OX9O 4NXNO 1HR0O 5IT9N 4LF8O 1XEQA 1R6TA 1FJGO 1IBLO 4B3TO 3T1HO 1AB3A 2AGAA 4GKJO 2DJVA 2DOSA 4JI4O 1DK1A 1N36O 1FKAO 2UUCO 4JI1O 1N33O 2UUBO 4LF7O 2VQFO 1N32O 4DR3O 5IWAO 4DV1O 4JI0O 4DV7O 5A2QN 4DUZO 4DV2O 4DV0O 4JI8O 4DR7O 4LFCO 4LFBO 4X65O 5FLXN 4OPAA 2F4VO 4OPHA 4DV5O 2LW7A 4B3MO 1A32A 4JYAO 5BY1A 4KHPO 3R66A 2VQEO 4DR1O 2ZKOA 1HNWO 1D2DA 4AQYO 1J5EO 2HHHO 1XMOO 4YHHO 4DUYO 3RT3C 3F5TA 4B3SO 1KUQA 2UU9O 1N34O 1FYJA 4LF4O 4A5UB 4GKKO 4K0KO 4LFAO 4DR4O 1R1BA 4X66O 4DV4O 4DV6O 4DR5O 2UXDO 4JI7O 4JI3O 3JAMN 1XNQO 5LMNO 3J80N 1XNRO 1YZBA 2UXCO 4LF6O 2UXBO 4X62O 4X64O 2UUAO 3J7AU 1X59A 3SDLA 2E5LO 4JI5O 3J81N 3OTOO 4B3RO 1IBMO 1I94O 2FKXA 4DV3O 1G1XB 2N74A 5H5NA 3O65A 1NS1A 4JI2O 2Z0AA 1XMQO 5BR8O 3T1YO 4JI6O 1F7YA 4LF5O 4DR6O
chains in the Genus database with same CATH superfamily
3BA9A 4J7ZA 1KP2A 2EX3A 2EJ7A 5EIBC 2PGGA 3E8HA 4MW8A 3ASNB 1MABG 3HR0A 3ZHRA 5B1NA 5KUKA 1AR1B 1J95A 4QPJA 3VOUA 3E8GA 3HPLC 1DK1A 3OTFA 3CCRV 1PV0A 3RW0A 2P5OA 4TQDA 1Y76B 1MNGA 4G27B 1HWYA 1KKCA 1XNQB 4O4JB 4DV1O 4TUYA 5KMGB 2PI5A 1X4TA 4LF6B 4FZ1A 3JATB 1GMGA 5FPOA 5KAFZ 2JEUA 1LUWA 3I5DA 4MTXA 4X65O 2EIKB 4U3JA 1R3LC 4LR3A 1A32A 1VQNV 3JCUZ 4IHJA 4DV6B 3G6BA 4DK0A 3R66A 3BEHA 4P2ZA 1XNRB 4PA3A 2CTRA 3RT3C 2UUAB 3N27A 5LMUB 1SZXA 5CN0A 2IU3A 2VRZA 3X2QC 1ZWIC 4DV6O 3FB8C 2CTWA 1FFXA 4RO2A 5KHGA 5EBLC 1MSDA 1MMMA 1XNRO 1ZX3A 2UUAO 1K8AW 4ICGA 2XT9A 1K97A 1RFYA 3OMAB 1S76D 1ZLZA 2IH3C 1Y76A 1Y74B 3JD2A 3FFQA 1BE3H 1I94O 1G1XB 3NR7A 1Z2GA 5KMGA 1H38A 3L75H 2DQ3A 3S3WA 3AG2C 1PNMA 4NTYA 4YIOA 3ABLB 4XDKA 3FYEB 1H2SB 1Q8IA 5B3SB 1M93A 4JI1B 2ZQMA 1U97A 4I55B 4DR1B 2UUBB 1BMFG 1GKFA 2QE7G 1ZSPA 3F7VC 4WCEV 4Z2WA 2HKOA 2DJVA 2HJFC 5GW7A 1N36O 4N23A 4JI1O 2Y0IA 2CGNA 2UUBO 4B7EA 5L3EA 5BZBA 4TV8B 3D36A 3JAKB 5J9PC 3UO3A 1COWG 3JAWB 4UVCA 5LA6B 4L87A 3WFVA 2QTSA 1S5HC 2Q4PA 1PKXA 1OV9A 4PD4F 1LUVA 5LHHA 4X66B 5BY1A 3U11A 4NTXA 4PHZA 1YJ9V 2ZIOA 2N05A 4CZZA 2EZOA 3FKSG 4I0XB 1HNXB 3IC7A 4F4LA 1TA8A 4X20B 2P90A 3E22B 1KUQA 4X62B 4LWSB 2DWEC 4YY3B 2OCHA 2R9IA 2XASA 4I55A 4X66O 3UQ8A 1R3IC 3AK1A 4B3TB 4JI3O 3JAMN 1OHHG 3L72H 3ZMVA 4B08A 4PA7A 3RYIA 4X62O 2QWRB 5J2TB 4KP4A 2MW2B 4B3RO 3EVKA 2V7QG 5IWAB 1EBOA 4ZHQB 3WU2Z 4FFKA 3JAKA 3RYCB 2Z0AA 1JVMA 3RWRD 5LA6A 1VQPV 1QLEC 4E4EA 1RSOB 4I50B 3O9OA 3CCLV 2GHYA 1SC5B 1UPGA 1XEQA 2IJJA 4DUYB 3T1HO 3K5MA 4I0XA 4X20A 3E22A 3OMIB 1GN4A 4LWSA 1K73W 4DR4B 2R70A 5EC2C 4R50A 3A2FA 3G71V 3SGIA 2WLIA 4JZGA 3DC6A 1JOYA 1VARA 1GN2A 2OYQA 3OMNB 2WLMA 1S77D 5L3GA 1KECA 1DF4A 2DYSC 3UO2A 1RPRA 4JYAO 3RYCA 5KUMA 2F1MA 1Z5VA 2Y69B 3HKBB 3DTUB 5GTIZ 1I5YA 2A0LA 3SYOA 1FXKB 4GT1A 3VBBA 1I5XA 3ETDA 4IGGA 3E35A 1RSOA 4I50A 4GKKO 3FB6C 4IL6Z 3TETA 3K0GA 1BZKA 4JF3A 3IGAC 3OGCC 3ZHUA 4R7CA 4BWAA 3ICXA 3DXRA 3AG1C 4BAYA 2LFRA 2Y48A 2LW1A 1AI5A 1KD1W 1TGOA 2GSMB 2BTQB 4DV2B 4WBNB 2GTAA 4NXNB 1NKDA 2WLLB 4LFBB 4MSWC 4EFEA 5FNVB 4O4HB 1BCCH 1W59A 1OCCB 1NTZH 4H37A 3CD6V 1JR9A 3ZMTA 2Q7EA 2FB5A 5IYCO 4NXNO 3SYPA 3ASNC 1N4CA 2CDYA 4FLWA 1FXKA 3IFXA 5EBMC 3SYCA 2UU9B 4X1KB 3P30A 2DOSA 4CH4A 1K33A 1YITV 1R6KA 2YIBA 3SYAA 3PN1A 4K3AA 3OR7C 4LF7O 4DV7O 1YEWA 2QJ1A 2A06H 4DV0O 1CPYA 1BGYH 4CS3A 1XBLA 1EZJA 1FAFA 3ZEDA 5IDJA 4GX0A 5LGUA 4E2LA 2VQEO 3W7SA 4P9OA 1KU9A 2EIKC 3TXQA 4JI6B 2WLLA 3CC2V 5IYDO 5LP6B 1NVPD 3BRCA 4GZRB 2UXXA 5E79Z 3W7TA 2Q67A 2XAQA 3RVYA 1GM9A 1XDCA 3K03A 3P3PA 4CC5A 1H2KA 2Q9LA 1BQ0A 2XAJA 1WA8B 2EIMC 4PDLA 3U10A 3D36C 2UUCB 3CS5A 3SDLA 3IAYA 1L0NH 2QGNA 4DR3B 5JH7B 3K5OA 3E8FA 1AP6A 1SESA 5KHKA 1RPOA 4JV5O 2X0LA 1JQ0A 2IBZH 2NR5A 1P4RA 1WB7A 1S5JA 5DEDA 4JI4B 3CC7V 2ATKC 4WFHA 5FL7G 4H0LB 1WLEA 3ABLC 2LJ2A 1V54B 2JRIA 3SPHA 3M8AA 3E83A 2YIAA 5B3SC 2E74B 1XMOB 3OFNG 2AXTZ 4LF8O 1FJGO 3QO8A 5H6QA 5LP6A 4LF4B 2Y0PA 4JI4O 3DSQA 1AROP 3SJBC 3BFRA 3WB2A 4GLXA 1SRYA 3H1IH 4DV5B 4MVOA 2BTOA 1WA8A 5EIBD 4CH3A 5CA0B 1VQ5V 4ZOLB 1N8RW 2D3OW 2B1IA 2NLJC 4DR7O 2HVJC 4B3SB 4BW5A 1W0KG 5JH7A 4KL1A 4DV5O 4B3MO 2ADQB 1XL4A 2WPDG 2P4KA 3ZHTA 2X6BA 3JD1A 2QEXV 1D2DA 5LGNA 4CC6A 4GYCB 1HNZB 3ASOB 2ZNJA 3K08A 4MS2A 4BR6A 4B3SO 4HZ3A 1YSCA 1Q6UA 2JEXA 3D3QA 4WFEA 1HR0B 1XUQA 1ZUQA 4JI7O 5HFLA 5IJ0B 2YIBD 1TUEB 1EN6A 3MD0A 4FFBB 3CCVV 5CMUA 5IY5C 5CB4B 3HKCB 5JQGB 2N74A 2DE0X 4TSFG 4ZOLA 5BR8O 1IBLB 4GKJB 1OCZC 2DN9A 4O4LB 2IJIA 1W2BU 1V55B 2ZXWB 4KHPB 2WWWA 4OX9O 2R72A 2VQFB 2F23A 5H2FZ 3JCZA 2CTPA 3SYQA 1IBLO 4GKJO 4PELA 3W7XA 1F51A 4O4IB 2ZINA 4FLYA 5KLVH 2EINB 3HKDB 4HBNA 1CXZB 1NH2B 2VQFO 1N32O 4LNUB 5LMNB 3K9SA 3L73H 4D7SA 5IJ0A 1Q6HA 4J9ZB 4LH7A 4UUJC 2WLJA 1BSMA 4FLVA 2E5LB 1G4YB 3C90A 4FFBA 1KB9F 3EFFK 4JI8O 1AJPA 2IM9A 3AEIA 2L6LA 5CB4A 3HKCA 3OT7A 1W0JG 1AI7A 2ZNIA 2R9AA 3UM7A 1VQMV 1EN5A 4LF9B 3AG3B 3AG7A 3F5TA 2UXBB 1THZA 4O4LA 2WLNA 4ASUG 1FXKC 1QHTA 4FVMA 4N21A 1IBMB 3RVZA 3G6EV 2V4DA 1XNQO 5C8YA 2WSSG 2ETNA 3HB3B 4JGSA 4X8AA 1IVSA 4LF6O 4O4IA 2UXBO 2W6JG 1P7GA 5KHHA 3HKDA 4J7JA 3H01A 2QWNB 1IBMO 4O2BB 1FPOA 3E2EA 4LNUA 2IH1C 4MT8A 2GV9A 1QR9A 1WPXA 1NTKH 4JYBA 1E1RG 2YXLA 3K5LA 4Z1MG 2JVDA 2XAGA 1WPBA 1MZEA 1IXBA 2BSKB 5LMUO 3ZS8C 1LNQA 3CRQA 3ZRVA 1QVGU 2IW5A 3M7MX 1VQKV 1OCCC 4O4JA 1T5EA 3LDDA 3STLC 3BHPA 3JATA 2OIGA 1UJWB 1P7BA 4TOIA 1S3JA 4DR5B 3Q4HB 2VWKA 5H6RA 3D8CA 3H1HH 3SJAC 1BHBA 3OAAG 1M5IA 4RQEA 3EXAA 4AILC 1M57B 3K0DA 2E75B 1WNSA 1R6NA 4O2BA 3B8MA 2PUSA 3OD4A 3CSXA 3CCSV 4FLXA 1YJWV 4DR1O 3CHXA 1QBZA 1KBHA 3CRRA 1FFTB 4P30A 1GK9A 2EILB 3T1CA 2DQ0A 4KUMA 4LH6A 5E1AC 4A5UB 4ZIBA 1UFIA 1IBKB 5LP6C 3AG4C 3ABUA 2KG7B 3CCUV 3IJ4A 1PL0A 1M90W 2HJDA 1Y74A 5CA1B 3KCYA 4NR1A 1ZL8B 4MVZA 1YXBA 1AJQA 2EZPA 4G28B 1X59A 2YXYA 3FB7C 3CRCA 4GX5A 1IX9A 2ZCEA 4UXNA 3F5WC 1PPJH 1WAZA 4P9PA 5KAIZ 4CH5A 1NBMG 1B06A 4LF5O 3RYHB 1VF6C 1KC8W 2DMXA 2A7WA 2WLHA 3CEIA 1Y66A 1HNXO 2Q5ZA 2XUMA 4J41A 4FIPC 4YY3O 3CB2A 4JTAB 4TT3G 2YDEA 3GVMA 4PA6A 4TV8A 4YHHB 2ADPA 4AI8A 4B3TO 1Z5WA 5H9CA 4U3FH 1K92A 2DWDC 1HW7A 4RUFA 1YHQV 4UCRA 3RFRA 3JAWA 4G2KA 3UCSC 2A79B 1YCIA 2QDOA 4NB5A 2QKSA 2MK3A 2RJZA 1KQSU 1GM7A 5IWAO 3B4SA 1I7FA 4OGQB 2ILMA 3H1LH 5IJ9B 3OR6C 1YJNV 3JYCA 4EB6B 2KQXA 3CJHB 1VMGA 1JMKC 2LW7A 1YI2V 2C2AA 4QPKA 3CRMA 3RYHA 1JJOA 1NZ6A 1DTOA 4RWUA 2XNDG 4DUYO 3TJTA 3KCXA 4L8JA 3WG7B 2RN9A 3LNMB 5J2TA 4DR4O 4IT5A 2VS0A 3FYIB 3E8BA 3ZJZA 4ZHQA 5C93A 1Y6XA 2O57A 1VQOV 5GONB 1AR4A 2WA4A 1YZBA 2Q73A 1BQZA 2LO1A 3ML0A 3MHSC 5KX5B 1IDSA 3T2MA 4JI0B 4TV9B 2F93B 1EM1A 3O65A 1VEWA 5IJ9A 4DW1A 2PF4E 2W0XA 4EKWA 1OCRB 4PDVA 1YVWA 4HYOA 3LDCA 2P6JA 3CPWU 3TXSA 1VQ6V 3CJHA 5B1BB 3SJQC 2KB1A 5CBHA 4YXWG 4JAUA 3A0HZ 1Q90D 1F4NA 4PJ0Z 5CBFA 1J5EB 3R65A 1V55C 2ZXWC 2HHHB 4DUZB 3EHBB 2LQTA 1QU7A 3AK2A 2DYRB 1R3KC 2QWPB 4BIOA 4JZ2A 4OXSA 5KHIA 2FYUH 2EINC 1XREA 4UB8Z 1SKVA 1BS3A 1H2MA 3C3SA 2ZR3A 4DUZO 2YEVB 5GONA 2PYJA 4DV2O 3HKBA 2ZE8A 4LFBO 1WP8A 5FLXN 1XHXA 4OPHA 4TV9A 3STZC 1KYOF 4JASA 1SETA 2VWJA 1JJ2U 2W6IG 2ZKOA 2UXDB 1FD9A 2JGUA 3CX5F 1PD3A 2ZM6B 2UU9O 1GAXA 1FS0G 3AG3C 1WB8A 4PV1B 4UV8A 3ZMSA 2A9HA 3RGBA 1RM1B 4X1IB 4UCSA 2UXDO 2CE4A 3ABMB 2BTQA 3GWOA 3FAVB 4WBNA 2QWQB 2PI4A 1N33B 1SS3A 2RMKB 1M56B 3JD3A 3CMEV 4J10A 1DLBA 4PA4A 5L3BA 5JVDB 5FNVA 4O4HA 2JGDB 3H1JH 5H5NA 2YEVA 2HFEC 2OCCB 2OTLV 2Q68A 4JI6O 2YXHA 1K5SA 3UKMA 3JSNA 4X1KA 4H33A 5BXZA 2BE3A 2P06A 4JAAA 5JJEB 3QTCA 2LFSA 2XOKG 4ABMA 4AQYB 2ZR2A 2JJ1G 2AZ0A 2GUZB 3SR2C 3T4DA 1NTMH 1H2GA 1Q82W 1MSWD 1KP3A 2UUCO 4I4TB 4H44B 4PI2A 1SQBH 2HG5C 2F4VB 3T4ZA 3PJSK 2RCVA 4DR3O 5A2QN 4FZ0A 1JA8A 2JK5C 3W7UA 2QSAA 4UCOA 2WA3A 4ZI7B 2F66C 3ZBHA 1SQGA 2F4VO 3CCJV 5JVDA 4K35A 1M57C 1QVFU 4BW9A 3ABKB 3QNEA 4JTCB 3QF7A 2KKWA 4JYCA 5EC1C 3K04A 1R3JC 1K34A 2DW4A 5JJNB 1XMOO 2RQ6A 4PI0A 5EYPB 4I9WA 2N04A 2B5UA 4LF4O 2EILC 3SPIA 5LGTA 3QVNA 2LGQA 2EJRA 4MVRA 2YC0A 3CC4V 2GDSA 1D5AA 1EZVH 2GUZA 1QR8A 1VF6A 3OEHG 5B5EZ 3BAAA 2PTMA 3K57A 4DR6B 3A0RA 4NYKA 1Q81W 1M9NA 4I4TA 4NVPA 1E79G 4O2AB 5D5QA 2KSDA 1ENVA 4FLTA 5LXTB 2P7TC 3JD0A 3JSLA 4C7UA 4DYLA 4DR6O 4FMTA 3GWKC 1QNMA 3I55V 4EEQA 1HNZO 3ZHVA 3GB7C 3K59A 4IIJB 5EK0A 2QA4V 1TVKB 1HR0O 4JAVA 2BOCC 4RAIA 1VIBA 1AB3A 2WLKA 1K3EA 1N34B 5EYPA 5CA0A 3OUSA 1P49A 3UT5B 1FKAO 4X9QA 4J42A 3ZMZA 3L71H 1Q7YW 2EULA 1O9HA 5ITZB 2UXCB 3LSUA 2FL4A 1XL6A 5JCOA 4CS2A 4NKGB 4KFMA 4LCUC 3P32A 3ZMUA 1ZAUA 3LSSA 4TUYB 2CGOA 4LBEC 4O2AA 4DV4B 1GTOA 1P84F 3A8TA 4J11A 4KHPO 3SPCA 5LHGA 5LXTA 4LF5B 3WB0A 2D2CB 3L9DA 5HFMA 3OUFA 3ZIAG 3M99B 4JI5B 4IHJB 1PL4A 4IIJA 4MTGA 4DV4O 2K9PA 2Q69A 4PA9A 3WG7C 4LP8A 4GX1A 1TVKA 5AG2A 5JQGA 1BT8A 5LMNO 1US6A 3FB5C 2QM4A 3UT5A 4JI5O 2E5LO 3WB1A 1XILA 4EFBA 1K9MW 4FM0A 2Y69C 4WF9V 1FFXB 4DV1B 4DR2B 5ITZA 2H8PC 2HEPA 5DM6V 2YS8A 2YUAA 1N0JA 4QNHB 3APQA 1FXVA 4X65B 3MAQA 3W7WA 4LF9O 4U7OA 1OCRC 3L74H 3K5NA 1SQXH 4DR2O 4QIWF 2OIEA 2AHZA 4Q20A 5B1BC 3CCEV 4NTWA 3VQXA 1MA1A 5IT9N 1OCOB 4R6ZA 3ABTA 4F6RB 1NI8A 2F95B 4FM2A 3NXSA 3G4SV 2IJKA 4AHCA 3CMAV 5JWPA 2Q7GA 2BOBC 2PYLA 2DYRC 2ZDIA 3APOA 5LYJB 2CTQA 1HNWB 1VQLV 1S0VA 3RN4A 1AJNA 1GO3F 5DN6G 2ARHA 2CK3G 2AHYA 1JCHA 2EIMB 1AI4A 2X6CA 5D5PA 1VQ8V 1I94B 1AVMA 1CEZA 2LP7A 3ZRXA 1SERA 1HNWO 4QJFB 3CCQV 1MG1A 4X89A 4PDMA 1FYJA 2AZ2A 1NT2B 1DF5A 4IYIA 2GBOA 2X6AA 5IYBO 2JS5A 4DR5O 1K4DC 4MTOA 2QTOA 1ROPA 4F6RA 4UB6Z 1RM1C 2ZE6A 1N36B 1Q5OA 1G6UA 4XBFA 3J7AU 3ABMC 1PNLA 3OW2U 4U7NA 4CS4A 4WFAV 4RUEA 2IU0A 2FKXA 3SPJA 3RYFB 1L8DA 5BMVB 1VQ7V 3CE2A 1M56C 5LYJA 2BSKA 1YIJV 3CRAA 3RYIB 1OJHA 2L35A 1EFRG 1B6QA 1NU1H 1LR1A 1E1QG 1HDJA 4X88A 1SZTA 2OCCC 5LOVB 2Q0OC 1IZ3A 2YICA 3BCCH 3OEEG 4I5SA 3N2KB 3B40A 3TK1A 4TQFA 2ZE5A 4HAMA 1IBKO 3LSQA 4DRXB 1WP7A 1M1KW 1K5QA 3Q4HA 4GCZA 4UV9A 3CWBH 4QGPA 1TUBB 1NVPB 2H3OA 3E89A 2RNBA 2UXNA 5IE9A 4K8ZA 1G8MA 5DECA 1OZ0A 4JI3B 1HP8A 2E3CA 5F2VO 2Z3YA 5J2UB 1V54C 1NJIW 4J9YB 4B3RB 5B1AB 4XDLA 1NR7A 1MZFA 1H2LA 1RP3B 1YDXA 4OPAA 4UCTA 2ITCC 2ODMA 2CH7B 3RYFA 5BMVA 2WLIB 2JDIG 1Y4MA 1URFA 2KG7A 5IY5B 4FM1A 4WFBV 1PP9H 3LNNA 3K06A 4YHHO 5CA1A 3KZIZ 2CAZC 3ABKC 3F7YC 5LOVA 2Y4UA 1ZL8A 1NH2D 4PDRA 3N2KA 1GM8A 4W4LA 3MHHC 4ZKIA 3BVOA 4DRXA 3RBZA 1OCZB 3T1HB 3ZX6A 1YTFB 4UCUA 3IC9A 1DGSA 5CBGA 3FX7A 3KKYA 1TUBA 2W0FC 4LC1A 1AP5A 3CXHF 1XHZA 4DW0A 4GX2A 5JCOC 1JX9A 2EIJB 2Y4TA 3ASOC 3THOA 2GTSA 1L0LH 1V9PA 3DXRB 3FD9A 5J2UA 1XQ8A 1JFFB 3OGIB 3C3TA 3QG5A 4JYAB 2CH7A 2NN4A 1AILA 4BIUA 1IXMA 2IJHA 1WN7A 3ZN1A 3VQWA 1SQQH 1R6TA 5A9GA 3A0BZ 5KA6A 1H8EG 4Z1VA 4GKKB 3U0ZA 3L70H 5EZYB 2PY5A 1Q86W 1I0HA 4EB6A 4IYHA 4H13B 4Q6GA 3OE7G 1FXHA 2Q6AA 4JI0O 1QQCA 2PZSA 2Q7HA 4DK1A 3K3WA 4R8CA 3QO5A 4RQFA 1F4MA 2ZD9A 1XOUA 2JS3A 5IYZB 3VQYA 2NNUA 3N2GB 3JARB 1O9GA 3B8NA 4W4KA 2CUGA 4D7TA 3K58A 3CXCU 4JTDB 3BPZA 1J5EO 2HHHO 3S3XA 3BY6A 1Q3EA 3SJCC 1JFFA 3CCMV 2FMLA 3X2QB 4X64B 2LGWA 3ETEA 5L3FA 2HVKC 3OTOB 2XAFA 5K1PA 5KX5A 3HKEB 2P22C 2P4VA 2Z5UA 3B09A 4XDJA 5GTHZ 2ZDIC 1H2NA 4J80A 3T1YB 4X64O 2YIDA 1BL8A 5EZYA 4LF7B 2G38A 3DGEA 3H9VA 3J81N 3OTOO 4MTFA 4DV7B 5KHJA 3AG2B 4FJCC 1PM9A 3G80A 2ITDC 4DV0B 2WAMA 4FK5C 4MVSA 1AR5A 1L1FA 3T1YO 2Q8VA 1NQTA 5IYZA 2ZM6O 4B7KA 1WJZA 3JALB 3N2GA 4UVBA 5LL6Y 3JARA 3ZCCA 2VQEB 1D5NA 2HLDG 3SPGA 2ZE7A 2AGAA 3K9AA 3OM3B 1OCOC 1PNKA 2QKCA 2E76B 1N0NA 4LFCB 1SQFA 5KA5A 1N33O 3H1KH 4DXWA 3HKEA 4JYYA 2B1GA 4F6EA 4TWKA 3ETQA 1TAEA 2R9RB 4CBCA 4X1YB 2QR4A 3AG4B 1S72V 2P67A 3LUTB 1VF7A 2XAHA 4UCVA 3ETGA 4LFCO 3CP1A 4ZBMA 1K4CC 4K0KB 4LFAB 4YJ3B 3ZN0A 3ZRSA 4J7KA 4JV5B 1B04A 2V1DA 4X1IA 4AQYO 4MVMA 1VQ4V 4BIZA 2QM7A 2XTAA 1SQPH 1SQVH 2HR3A 1Q43A 3FAVA 4KXRA 3JALA 4K0KO 4LFAO 1R1BA 5TISZ 1JPXA 4LF8B 4QE9A 1FJGB 1Y67A 1ORQC 4MVUA 4JI2B 2JGDA 2FTKA 1QLNA 1XMQB 4HNAB 5L3DA 1CP9A 1GN3A 1YTFD 1BHAA 3BA8A 2OT5A 4NXMB 4X1YA 1NS1A 3MDSA 4JI2O 3JD4A 5CA3A 1QLEB 1XMQO 4DR7B 1F7YA 3AK3A 4UVAA 1ZTEA 3QO7A 4B3MB 3D3IA 1VQ9V 2F43G 1SF9A 4YJ3A 4YIPA 4NXMO 3JASB 3VQVA 3TCUA 3TGUH 1SA0B 3BABA 3G67A 3E86A 1H8HG 2X7RB 3ZHSA 2OWOA 3ZRWB 2BCCH 4I7ZB 4ZI7A 3KG2A 4JI7B 1I08A 5FPRA 1S5LZ 5JJJB 2JJ2G 3B77A 1B3QA 1M4UA 4GUNA 2QM8A 2AW9A 2RDCA 4K8XA 2EBOA 4HNAA 5LBQA 4WFFA 4YJ2B 2OTJV 2DYSB 5K1XA 5B1OA 5B66Z 2K1EA 1GH6A 2B9ZA 4FPPA 5B1AC 1AI6A 2QKAA 5LHIA 1NR1A 1R73A 5BR8B 1YF2A 3CYOA 3P3NA 2YSUB 1KMIZ 4FLZA 5EBWC 2XHBA 4MVQA 1XI1A 2JIZG 1N34O 1VF5B 2M7WA 4OX9B 4UFZA 1GN6A 3I56V 3JASA 1MOFA 2ZT9B 4QE7A 1U96A 2YI9A 4D6TH 5L3CA 4DV3B 1VP7A 4JPRA 2YI8A 2H94A 3J80N 1EN4A 3AG1B 1SA0A 2UXCO 1GRJA 1KKDA 4DO2A 1F23A 3DC5A 4MW3A 3ZRWA 1N32B 3LDEA 4U3JB 2A3QA 3K79A 4WFGA 4FLUA 2QWOB 4DV3O 4I9QA 5C8YB 1Q6IA 2ZIMA 4CH6A 1IURA 2HP8A 2EIJC 1K7DA 4JI8B 1QCEA 3B2EE 4YJ2A 2Q0AA 2M6YA 3ZHQA
chains in the Genus database with same CATH topology
4LF9O 1HNZO 4JV5O 2ZM6O 1HNXO 5BXZA 2JRIA 4DR2O 5LL6Y 1IBKO 4YY3O 4NXMO 5LMUO 1AILA 3M8AA 4OX9O 4NXNO 1HR0O 5IT9N 4LF8O 1XEQA 1R6TA 1FJGO 1IBLO 4B3TO 3T1HO 1AB3A 2AGAA 4GKJO 2DJVA 2DOSA 4JI4O 1DK1A 1N36O 1FKAO 2UUCO 4JI1O 1N33O 2UUBO 4LF7O 2VQFO 1N32O 4DR3O 5IWAO 4DV1O 4JI0O 4DV7O 5A2QN 4DUZO 4DV2O 4DV0O 4JI8O 4DR7O 4LFCO 4LFBO 4X65O 5FLXN 4OPAA 2F4VO 4OPHA 4DV5O 2LW7A 4B3MO 1A32A 4JYAO 5BY1A 4KHPO 3R66A 2VQEO 4DR1O 2ZKOA 1HNWO 1D2DA 4AQYO 1J5EO 2HHHO 1XMOO 4YHHO 4DUYO 3RT3C 3F5TA 4B3SO 1KUQA 2UU9O 1N34O 1FYJA 4LF4O 4A5UB 4GKKO 4K0KO 4LFAO 4DR4O 1R1BA 4X66O 4DV4O 4DV6O 4DR5O 2UXDO 4JI7O 4JI3O 3JAMN 1XNQO 5LMNO 3J80N 1XNRO 1YZBA 2UXCO 4LF6O 2UXBO 4X62O 4X64O 2UUAO 3J7AU 1X59A 3SDLA 2E5LO 4JI5O 3J81N 3OTOO 4B3RO 1IBMO 1I94O 2FKXA 4DV3O 1G1XB 2N74A 5H5NA 3O65A 1NS1A 4JI2O 2Z0AA 1XMQO 5BR8O 3T1YO 4JI6O 1F7YA 4LF5O 4DR6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 O;  1HNZ O;  4JV5 O;  2ZM6 O;  1HNX O;  5BXZ A;  2JRI A;  4DR2 O;  5LL6 Y;  1IBK O;  4YY3 O;  4NXM O;  5LMU O;  1AIL A;  3M8A A;  4OX9 O;  4NXN O;  1HR0 O;  5IT9 N;  4LF8 O;  1XEQ A;  1R6T A;  1FJG O;  1IBL O;  4B3T O;  3T1H O;  1AB3 A;  2AGA A;  4GKJ O;  2DJV A;  2DOS A;  4JI4 O;  1DK1 A;  1N36 O;  1FKA O;  2UUC O;  4JI1 O;  1N33 O;  2UUB O;  4LF7 O;  2VQF O;  1N32 O;  4DR3 O;  5IWA O;  4DV1 O;  4JI0 O;  4DV7 O;  5A2Q N;  4DUZ O;  4DV2 O;  4DV0 O;  4JI8 O;  4DR7 O;  4LFC O;  4LFB O;  4X65 O;  5FLX N;  4OPA A;  2F4V O;  4OPH A;  4DV5 O;  2LW7 A;  4B3M O;  1A32 A;  4JYA O;  5BY1 A;  4KHP O;  3R66 A;  2VQE O;  4DR1 O;  2ZKO A;  1HNW O;  1D2D A;  4AQY O;  1J5E O;  2HHH O;  1XMO O;  4YHH O;  4DUY O;  3RT3 C;  3F5T A;  4B3S O;  1KUQ A;  2UU9 O;  1N34 O;  1FYJ A;  4LF4 O;  4A5U B;  4GKK O;  4K0K O;  4LFA O;  4DR4 O;  1R1B A;  4X66 O;  4DV4 O;  4DV6 O;  4DR5 O;  2UXD O;  4JI7 O;  4JI3 O;  3JAM N;  1XNQ O;  5LMN O;  3J80 N;  1XNR O;  1YZB A;  2UXC O;  4LF6 O;  2UXB O;  4X62 O;  4X64 O;  2UUA O;  3J7A U;  1X59 A;  3SDL A;  2E5L O;  4JI5 O;  3J81 N;  3OTO O;  4B3R O;  1IBM O;  1I94 O;  2FKX A;  4DV3 O;  1G1X B;  2N74 A;  5H5N A;  3O65 A;  1NS1 A;  4JI2 O;  2Z0A A;  1XMQ O;  5BR8 O;  3T1Y O;  4JI6 O;  1F7Y A;  4LF5 O;  4DR6 O; 
#chains in the Genus database with same CATH topology
 3BA9 A;  4J7Z A;  1KP2 A;  2EX3 A;  2EJ7 A;  5EIB C;  2PGG A;  3E8H A;  4MW8 A;  3ASN B;  1MAB G;  3HR0 A;  3ZHR A;  5B1N A;  5KUK A;  1AR1 B;  1J95 A;  4QPJ A;  3VOU A;  3E8G A;  3HPL C;  1DK1 A;  3OTF A;  3CCR V;  1PV0 A;  3RW0 A;  2P5O A;  4TQD A;  1Y76 B;  1MNG A;  4G27 B;  1HWY A;  1KKC A;  1XNQ B;  4O4J B;  4DV1 O;  4TUY A;  5KMG B;  2PI5 A;  1X4T A;  4LF6 B;  4FZ1 A;  3JAT B;  1GMG A;  5FPO A;  5KAF Z;  2JEU A;  1LUW A;  3I5D A;  4MTX A;  4X65 O;  2EIK B;  4U3J A;  1R3L C;  4LR3 A;  1A32 A;  1VQN V;  3JCU Z;  4IHJ A;  4DV6 B;  3G6B A;  4DK0 A;  3R66 A;  3BEH A;  4P2Z A;  1XNR B;  4PA3 A;  2CTR A;  3RT3 C;  2UUA B;  3N27 A;  5LMU B;  1SZX A;  5CN0 A;  2IU3 A;  2VRZ A;  3X2Q C;  1ZWI C;  4DV6 O;  3FB8 C;  2CTW A;  1FFX A;  4RO2 A;  5KHG A;  5EBL C;  1MSD A;  1MMM A;  1XNR O;  1ZX3 A;  2UUA O;  1K8A W;  4ICG A;  2XT9 A;  1K97 A;  1RFY A;  3OMA B;  1S76 D;  1ZLZ A;  2IH3 C;  1Y76 A;  1Y74 B;  3JD2 A;  3FFQ A;  1BE3 H;  1I94 O;  1G1X B;  3NR7 A;  1Z2G A;  5KMG A;  1H38 A;  3L75 H;  2DQ3 A;  3S3W A;  3AG2 C;  1PNM A;  4NTY A;  4YIO A;  3ABL B;  4XDK A;  3FYE B;  1H2S B;  1Q8I A;  5B3S B;  1M93 A;  4JI1 B;  2ZQM A;  1U97 A;  4I55 B;  4DR1 B;  2UUB B;  1BMF G;  1GKF A;  2QE7 G;  1ZSP A;  3F7V C;  4WCE V;  4Z2W A;  2HKO A;  2DJV A;  2HJF C;  5GW7 A;  1N36 O;  4N23 A;  4JI1 O;  2Y0I A;  2CGN A;  2UUB O;  4B7E A;  5L3E A;  5BZB A;  4TV8 B;  3D36 A;  3JAK B;  5J9P C;  3UO3 A;  1COW G;  3JAW B;  4UVC A;  5LA6 B;  4L87 A;  3WFV A;  2QTS A;  1S5H C;  2Q4P A;  1PKX A;  1OV9 A;  4PD4 F;  1LUV A;  5LHH A;  4X66 B;  5BY1 A;  3U11 A;  4NTX A;  4PHZ A;  1YJ9 V;  2ZIO A;  2N05 A;  4CZZ A;  2EZO A;  3FKS G;  4I0X B;  1HNX B;  3IC7 A;  4F4L A;  1TA8 A;  4X20 B;  2P90 A;  3E22 B;  1KUQ A;  4X62 B;  4LWS B;  2DWE C;  4YY3 B;  2OCH A;  2R9I A;  2XAS A;  4I55 A;  4X66 O;  3UQ8 A;  1R3I C;  3AK1 A;  4B3T B;  4JI3 O;  3JAM N;  1OHH G;  3L72 H;  3ZMV A;  4B08 A;  4PA7 A;  3RYI A;  4X62 O;  2QWR B;  5J2T B;  4KP4 A;  2MW2 B;  4B3R O;  3EVK A;  2V7Q G;  5IWA B;  1EBO A;  4ZHQ B;  3WU2 Z;  4FFK A;  3JAK A;  3RYC B;  2Z0A A;  1JVM A;  3RWR D;  5LA6 A;  1VQP V;  1QLE C;  4E4E A;  1RSO B;  4I50 B;  3O9O A;  3CCL V;  2GHY A;  1SC5 B;  1UPG A;  1XEQ A;  2IJJ A;  4DUY B;  3T1H O;  3K5M A;  4I0X A;  4X20 A;  3E22 A;  3OMI B;  1GN4 A;  4LWS A;  1K73 W;  4DR4 B;  2R70 A;  5EC2 C;  4R50 A;  3A2F A;  3G71 V;  3SGI A;  2WLI A;  4JZG A;  3DC6 A;  1JOY A;  1VAR A;  1GN2 A;  2OYQ A;  3OMN B;  2WLM A;  1S77 D;  5L3G A;  1KEC A;  1DF4 A;  2DYS C;  3UO2 A;  1RPR A;  4JYA O;  3RYC A;  5KUM A;  2F1M A;  1Z5V A;  2Y69 B;  3HKB B;  3DTU B;  5GTI Z;  1I5Y A;  2A0L A;  3SYO A;  1FXK B;  4GT1 A;  3VBB A;  1I5X A;  3ETD A;  4IGG A;  3E35 A;  1RSO A;  4I50 A;  4GKK O;  3FB6 C;  4IL6 Z;  3TET A;  3K0G A;  1BZK A;  4JF3 A;  3IGA C;  3OGC C;  3ZHU A;  4R7C A;  4BWA A;  3ICX A;  3DXR A;  3AG1 C;  4BAY A;  2LFR A;  2Y48 A;  2LW1 A;  1AI5 A;  1KD1 W;  1TGO A;  2GSM B;  2BTQ B;  4DV2 B;  4WBN B;  2GTA A;  4NXN B;  1NKD A;  2WLL B;  4LFB B;  4MSW C;  4EFE A;  5FNV B;  4O4H B;  1BCC H;  1W59 A;  1OCC B;  1NTZ H;  4H37 A;  3CD6 V;  1JR9 A;  3ZMT A;  2Q7E A;  2FB5 A;  5IYC O;  4NXN O;  3SYP A;  3ASN C;  1N4C A;  2CDY A;  4FLW A;  1FXK A;  3IFX A;  5EBM C;  3SYC A;  2UU9 B;  4X1K B;  3P30 A;  2DOS A;  4CH4 A;  1K33 A;  1YIT V;  1R6K A;  2YIB A;  3SYA A;  3PN1 A;  4K3A A;  3OR7 C;  4LF7 O;  4DV7 O;  1YEW A;  2QJ1 A;  2A06 H;  4DV0 O;  1CPY A;  1BGY H;  4CS3 A;  1XBL A;  1EZJ A;  1FAF A;  3ZED A;  5IDJ A;  4GX0 A;  5LGU A;  4E2L A;  2VQE O;  3W7S A;  4P9O A;  1KU9 A;  2EIK C;  3TXQ A;  4JI6 B;  2WLL A;  3CC2 V;  5IYD O;  5LP6 B;  1NVP D;  3BRC A;  4GZR B;  2UXX A;  5E79 Z;  3W7T A;  2Q67 A;  2XAQ A;  3RVY A;  1GM9 A;  1XDC A;  3K03 A;  3P3P A;  4CC5 A;  1H2K A;  2Q9L A;  1BQ0 A;  2XAJ A;  1WA8 B;  2EIM C;  4PDL A;  3U10 A;  3D36 C;  2UUC B;  3CS5 A;  3SDL A;  3IAY A;  1L0N H;  2QGN A;  4DR3 B;  5JH7 B;  3K5O A;  3E8F A;  1AP6 A;  1SES A;  5KHK A;  1RPO A;  4JV5 O;  2X0L A;  1JQ0 A;  2IBZ H;  2NR5 A;  1P4R A;  1WB7 A;  1S5J A;  5DED A;  4JI4 B;  3CC7 V;  2ATK C;  4WFH A;  5FL7 G;  4H0L B;  1WLE A;  3ABL C;  2LJ2 A;  1V54 B;  2JRI A;  3SPH A;  3M8A A;  3E83 A;  2YIA A;  5B3S C;  2E74 B;  1XMO B;  3OFN G;  2AXT Z;  4LF8 O;  1FJG O;  3QO8 A;  5H6Q A;  5LP6 A;  4LF4 B;  2Y0P A;  4JI4 O;  3DSQ A;  1ARO P;  3SJB C;  3BFR A;  3WB2 A;  4GLX A;  1SRY A;  3H1I H;  4DV5 B;  4MVO A;  2BTO A;  1WA8 A;  5EIB D;  4CH3 A;  5CA0 B;  1VQ5 V;  4ZOL B;  1N8R W;  2D3O W;  2B1I A;  2NLJ C;  4DR7 O;  2HVJ C;  4B3S B;  4BW5 A;  1W0K G;  5JH7 A;  4KL1 A;  4DV5 O;  4B3M O;  2ADQ B;  1XL4 A;  2WPD G;  2P4K A;  3ZHT A;  2X6B A;  3JD1 A;  2QEX V;  1D2D A;  5LGN A;  4CC6 A;  4GYC B;  1HNZ B;  3ASO B;  2ZNJ A;  3K08 A;  4MS2 A;  4BR6 A;  4B3S O;  4HZ3 A;  1YSC A;  1Q6U A;  2JEX A;  3D3Q A;  4WFE A;  1HR0 B;  1XUQ A;  1ZUQ A;  4JI7 O;  5HFL A;  5IJ0 B;  2YIB D;  1TUE B;  1EN6 A;  3MD0 A;  4FFB B;  3CCV V;  5CMU A;  5IY5 C;  5CB4 B;  3HKC B;  5JQG B;  2N74 A;  2DE0 X;  4TSF G;  4ZOL A;  5BR8 O;  1IBL B;  4GKJ B;  1OCZ C;  2DN9 A;  4O4L B;  2IJI A;  1W2B U;  1V55 B;  2ZXW B;  4KHP B;  2WWW A;  4OX9 O;  2R72 A;  2VQF B;  2F23 A;  5H2F Z;  3JCZ A;  2CTP A;  3SYQ A;  1IBL O;  4GKJ O;  4PEL A;  3W7X A;  1F51 A;  4O4I B;  2ZIN A;  4FLY A;  5KLV H;  2EIN B;  3HKD B;  4HBN A;  1CXZ B;  1NH2 B;  2VQF O;  1N32 O;  4LNU B;  5LMN B;  3K9S A;  3L73 H;  4D7S A;  5IJ0 A;  1Q6H A;  4J9Z B;  4LH7 A;  4UUJ C;  2WLJ A;  1BSM A;  4FLV A;  2E5L B;  1G4Y B;  3C90 A;  4FFB A;  1KB9 F;  3EFF K;  4JI8 O;  1AJP A;  2IM9 A;  3AEI A;  2L6L A;  5CB4 A;  3HKC A;  3OT7 A;  1W0J G;  1AI7 A;  2ZNI A;  2R9A A;  3UM7 A;  1VQM V;  1EN5 A;  4LF9 B;  3AG3 B;  3AG7 A;  3F5T A;  2UXB B;  1THZ A;  4O4L A;  2WLN A;  4ASU G;  1FXK C;  1QHT A;  4FVM A;  4N21 A;  1IBM B;  3RVZ A;  3G6E V;  2V4D A;  1XNQ O;  5C8Y A;  2WSS G;  2ETN A;  3HB3 B;  4JGS A;  4X8A A;  1IVS A;  4LF6 O;  4O4I A;  2UXB O;  2W6J G;  1P7G A;  5KHH A;  3HKD A;  4J7J A;  3H01 A;  2QWN B;  1IBM O;  4O2B B;  1FPO A;  3E2E A;  4LNU A;  2IH1 C;  4MT8 A;  2GV9 A;  1QR9 A;  1WPX A;  1NTK H;  4JYB A;  1E1R G;  2YXL A;  3K5L A;  4Z1M G;  2JVD A;  2XAG A;  1WPB A;  1MZE A;  1IXB A;  2BSK B;  5LMU O;  3ZS8 C;  1LNQ A;  3CRQ A;  3ZRV A;  1QVG U;  2IW5 A;  3M7M X;  1VQK V;  1OCC C;  4O4J A;  1T5E A;  3LDD A;  3STL C;  3BHP A;  3JAT A;  2OIG A;  1UJW B;  1P7B A;  4TOI A;  1S3J A;  4DR5 B;  3Q4H B;  2VWK A;  5H6R A;  3D8C A;  3H1H H;  3SJA C;  1BHB A;  3OAA G;  1M5I A;  4RQE A;  3EXA A;  4AIL C;  1M57 B;  3K0D A;  2E75 B;  1WNS A;  1R6N A;  4O2B A;  3B8M A;  2PUS A;  3OD4 A;  3CSX A;  3CCS V;  4FLX A;  1YJW V;  4DR1 O;  3CHX A;  1QBZ A;  1KBH A;  3CRR A;  1FFT B;  4P30 A;  1GK9 A;  2EIL B;  3T1C A;  2DQ0 A;  4KUM A;  4LH6 A;  5E1A C;  4A5U B;  4ZIB A;  1UFI A;  1IBK B;  5LP6 C;  3AG4 C;  3ABU A;  2KG7 B;  3CCU V;  3IJ4 A;  1PL0 A;  1M90 W;  2HJD A;  1Y74 A;  5CA1 B;  3KCY A;  4NR1 A;  1ZL8 B;  4MVZ A;  1YXB A;  1AJQ A;  2EZP A;  4G28 B;  1X59 A;  2YXY A;  3FB7 C;  3CRC A;  4GX5 A;  1IX9 A;  2ZCE A;  4UXN A;  3F5W C;  1PPJ H;  1WAZ A;  4P9P A;  5KAI Z;  4CH5 A;  1NBM G;  1B06 A;  4LF5 O;  3RYH B;  1VF6 C;  1KC8 W;  2DMX A;  2A7W A;  2WLH A;  3CEI A;  1Y66 A;  1HNX O;  2Q5Z A;  2XUM A;  4J41 A;  4FIP C;  4YY3 O;  3CB2 A;  4JTA B;  4TT3 G;  2YDE A;  3GVM A;  4PA6 A;  4TV8 A;  4YHH B;  2ADP A;  4AI8 A;  4B3T O;  1Z5W A;  5H9C A;  4U3F H;  1K92 A;  2DWD C;  1HW7 A;  4RUF A;  1YHQ V;  4UCR A;  3RFR A;  3JAW A;  4G2K A;  3UCS C;  2A79 B;  1YCI A;  2QDO A;  4NB5 A;  2QKS A;  2MK3 A;  2RJZ A;  1KQS U;  1GM7 A;  5IWA O;  3B4S A;  1I7F A;  4OGQ B;  2ILM A;  3H1L H;  5IJ9 B;  3OR6 C;  1YJN V;  3JYC A;  4EB6 B;  2KQX A;  3CJH B;  1VMG A;  1JMK C;  2LW7 A;  1YI2 V;  2C2A A;  4QPK A;  3CRM A;  3RYH A;  1JJO A;  1NZ6 A;  1DTO A;  4RWU A;  2XND G;  4DUY O;  3TJT A;  3KCX A;  4L8J A;  3WG7 B;  2RN9 A;  3LNM B;  5J2T A;  4DR4 O;  4IT5 A;  2VS0 A;  3FYI B;  3E8B A;  3ZJZ A;  4ZHQ A;  5C93 A;  1Y6X A;  2O57 A;  1VQO V;  5GON B;  1AR4 A;  2WA4 A;  1YZB A;  2Q73 A;  1BQZ A;  2LO1 A;  3ML0 A;  3MHS C;  5KX5 B;  1IDS A;  3T2M A;  4JI0 B;  4TV9 B;  2F93 B;  1EM1 A;  3O65 A;  1VEW A;  5IJ9 A;  4DW1 A;  2PF4 E;  2W0X A;  4EKW A;  1OCR B;  4PDV A;  1YVW A;  4HYO A;  3LDC A;  2P6J A;  3CPW U;  3TXS A;  1VQ6 V;  3CJH A;  5B1B B;  3SJQ C;  2KB1 A;  5CBH A;  4YXW G;  4JAU A;  3A0H Z;  1Q90 D;  1F4N A;  4PJ0 Z;  5CBF A;  1J5E B;  3R65 A;  1V55 C;  2ZXW C;  2HHH B;  4DUZ B;  3EHB B;  2LQT A;  1QU7 A;  3AK2 A;  2DYR B;  1R3K C;  2QWP B;  4BIO A;  4JZ2 A;  4OXS A;  5KHI A;  2FYU H;  2EIN C;  1XRE A;  4UB8 Z;  1SKV A;  1BS3 A;  1H2M A;  3C3S A;  2ZR3 A;  4DUZ O;  2YEV B;  5GON A;  2PYJ A;  4DV2 O;  3HKB A;  2ZE8 A;  4LFB O;  1WP8 A;  5FLX N;  1XHX A;  4OPH A;  4TV9 A;  3STZ C;  1KYO F;  4JAS A;  1SET A;  2VWJ A;  1JJ2 U;  2W6I G;  2ZKO A;  2UXD B;  1FD9 A;  2JGU A;  3CX5 F;  1PD3 A;  2ZM6 B;  2UU9 O;  1GAX A;  1FS0 G;  3AG3 C;  1WB8 A;  4PV1 B;  4UV8 A;  3ZMS A;  2A9H A;  3RGB A;  1RM1 B;  4X1I B;  4UCS A;  2UXD O;  2CE4 A;  3ABM B;  2BTQ A;  3GWO A;  3FAV B;  4WBN A;  2QWQ B;  2PI4 A;  1N33 B;  1SS3 A;  2RMK B;  1M56 B;  3JD3 A;  3CME V;  4J10 A;  1DLB A;  4PA4 A;  5L3B A;  5JVD B;  5FNV A;  4O4H A;  2JGD B;  3H1J H;  5H5N A;  2YEV A;  2HFE C;  2OCC B;  2OTL V;  2Q68 A;  4JI6 O;  2YXH A;  1K5S A;  3UKM A;  3JSN A;  4X1K A;  4H33 A;  5BXZ A;  2BE3 A;  2P06 A;  4JAA A;  5JJE B;  3QTC A;  2LFS A;  2XOK G;  4ABM A;  4AQY B;  2ZR2 A;  2JJ1 G;  2AZ0 A;  2GUZ B;  3SR2 C;  3T4D A;  1NTM H;  1H2G A;  1Q82 W;  1MSW D;  1KP3 A;  2UUC O;  4I4T B;  4H44 B;  4PI2 A;  1SQB H;  2HG5 C;  2F4V B;  3T4Z A;  3PJS K;  2RCV A;  4DR3 O;  5A2Q N;  4FZ0 A;  1JA8 A;  2JK5 C;  3W7U A;  2QSA A;  4UCO A;  2WA3 A;  4ZI7 B;  2F66 C;  3ZBH A;  1SQG A;  2F4V O;  3CCJ V;  5JVD A;  4K35 A;  1M57 C;  1QVF U;  4BW9 A;  3ABK B;  3QNE A;  4JTC B;  3QF7 A;  2KKW A;  4JYC A;  5EC1 C;  3K04 A;  1R3J C;  1K34 A;  2DW4 A;  5JJN B;  1XMO O;  2RQ6 A;  4PI0 A;  5EYP B;  4I9W A;  2N04 A;  2B5U A;  4LF4 O;  2EIL C;  3SPI A;  5LGT A;  3QVN A;  2LGQ A;  2EJR A;  4MVR A;  2YC0 A;  3CC4 V;  2GDS A;  1D5A A;  1EZV H;  2GUZ A;  1QR8 A;  1VF6 A;  3OEH G;  5B5E Z;  3BAA A;  2PTM A;  3K57 A;  4DR6 B;  3A0R A;  4NYK A;  1Q81 W;  1M9N A;  4I4T A;  4NVP A;  1E79 G;  4O2A B;  5D5Q A;  2KSD A;  1ENV A;  4FLT A;  5LXT B;  2P7T C;  3JD0 A;  3JSL A;  4C7U A;  4DYL A;  4DR6 O;  4FMT A;  3GWK C;  1QNM A;  3I55 V;  4EEQ A;  1HNZ O;  3ZHV A;  3GB7 C;  3K59 A;  4IIJ B;  5EK0 A;  2QA4 V;  1TVK B;  1HR0 O;  4JAV A;  2BOC C;  4RAI A;  1VIB A;  1AB3 A;  2WLK A;  1K3E A;  1N34 B;  5EYP A;  5CA0 A;  3OUS A;  1P49 A;  3UT5 B;  1FKA O;  4X9Q A;  4J42 A;  3ZMZ A;  3L71 H;  1Q7Y W;  2EUL A;  1O9H A;  5ITZ B;  2UXC B;  3LSU A;  2FL4 A;  1XL6 A;  5JCO A;  4CS2 A;  4NKG B;  4KFM A;  4LCU C;  3P32 A;  3ZMU A;  1ZAU A;  3LSS A;  4TUY B;  2CGO A;  4LBE C;  4O2A A;  4DV4 B;  1GTO A;  1P84 F;  3A8T A;  4J11 A;  4KHP O;  3SPC A;  5LHG A;  5LXT A;  4LF5 B;  3WB0 A;  2D2C B;  3L9D A;  5HFM A;  3OUF A;  3ZIA G;  3M99 B;  4JI5 B;  4IHJ B;  1PL4 A;  4IIJ A;  4MTG A;  4DV4 O;  2K9P A;  2Q69 A;  4PA9 A;  3WG7 C;  4LP8 A;  4GX1 A;  1TVK A;  5AG2 A;  5JQG A;  1BT8 A;  5LMN O;  1US6 A;  3FB5 C;  2QM4 A;  3UT5 A;  4JI5 O;  2E5L O;  3WB1 A;  1XIL A;  4EFB A;  1K9M W;  4FM0 A;  2Y69 C;  4WF9 V;  1FFX B;  4DV1 B;  4DR2 B;  5ITZ A;  2H8P C;  2HEP A;  5DM6 V;  2YS8 A;  2YUA A;  1N0J A;  4QNH B;  3APQ A;  1FXV A;  4X65 B;  3MAQ A;  3W7W A;  4LF9 O;  4U7O A;  1OCR C;  3L74 H;  3K5N A;  1SQX H;  4DR2 O;  4QIW F;  2OIE A;  2AHZ A;  4Q20 A;  5B1B C;  3CCE V;  4NTW A;  3VQX A;  1MA1 A;  5IT9 N;  1OCO B;  4R6Z A;  3ABT A;  4F6R B;  1NI8 A;  2F95 B;  4FM2 A;  3NXS A;  3G4S V;  2IJK A;  4AHC A;  3CMA V;  5JWP A;  2Q7G A;  2BOB C;  2PYL A;  2DYR C;  2ZDI A;  3APO A;  5LYJ B;  2CTQ A;  1HNW B;  1VQL V;  1S0V A;  3RN4 A;  1AJN A;  1GO3 F;  5DN6 G;  2ARH A;  2CK3 G;  2AHY A;  1JCH A;  2EIM B;  1AI4 A;  2X6C A;  5D5P A;  1VQ8 V;  1I94 B;  1AVM A;  1CEZ A;  2LP7 A;  3ZRX A;  1SER A;  1HNW O;  4QJF B;  3CCQ V;  1MG1 A;  4X89 A;  4PDM A;  1FYJ A;  2AZ2 A;  1NT2 B;  1DF5 A;  4IYI A;  2GBO A;  2X6A A;  5IYB O;  2JS5 A;  4DR5 O;  1K4D C;  4MTO A;  2QTO A;  1ROP A;  4F6R A;  4UB6 Z;  1RM1 C;  2ZE6 A;  1N36 B;  1Q5O A;  1G6U A;  4XBF A;  3J7A U;  3ABM C;  1PNL A;  3OW2 U;  4U7N A;  4CS4 A;  4WFA V;  4RUE A;  2IU0 A;  2FKX A;  3SPJ A;  3RYF B;  1L8D A;  5BMV B;  1VQ7 V;  3CE2 A;  1M56 C;  5LYJ A;  2BSK A;  1YIJ V;  3CRA A;  3RYI B;  1OJH A;  2L35 A;  1EFR G;  1B6Q A;  1NU1 H;  1LR1 A;  1E1Q G;  1HDJ A;  4X88 A;  1SZT A;  2OCC C;  5LOV B;  2Q0O C;  1IZ3 A;  2YIC A;  3BCC H;  3OEE G;  4I5S A;  3N2K B;  3B40 A;  3TK1 A;  4TQF A;  2ZE5 A;  4HAM A;  1IBK O;  3LSQ A;  4DRX B;  1WP7 A;  1M1K W;  1K5Q A;  3Q4H A;  4GCZ A;  4UV9 A;  3CWB H;  4QGP A;  1TUB B;  1NVP B;  2H3O A;  3E89 A;  2RNB A;  2UXN A;  5IE9 A;  4K8Z A;  1G8M A;  5DEC A;  1OZ0 A;  4JI3 B;  1HP8 A;  2E3C A;  5F2V O;  2Z3Y A;  5J2U B;  1V54 C;  1NJI W;  4J9Y B;  4B3R B;  5B1A B;  4XDL A;  1NR7 A;  1MZF A;  1H2L A;  1RP3 B;  1YDX A;  4OPA A;  4UCT A;  2ITC C;  2ODM A;  2CH7 B;  3RYF A;  5BMV A;  2WLI B;  2JDI G;  1Y4M A;  1URF A;  2KG7 A;  5IY5 B;  4FM1 A;  4WFB V;  1PP9 H;  3LNN A;  3K06 A;  4YHH O;  5CA1 A;  3KZI Z;  2CAZ C;  3ABK C;  3F7Y C;  5LOV A;  2Y4U A;  1ZL8 A;  1NH2 D;  4PDR A;  3N2K A;  1GM8 A;  4W4L A;  3MHH C;  4ZKI A;  3BVO A;  4DRX A;  3RBZ A;  1OCZ B;  3T1H B;  3ZX6 A;  1YTF B;  4UCU A;  3IC9 A;  1DGS A;  5CBG A;  3FX7 A;  3KKY A;  1TUB A;  2W0F C;  4LC1 A;  1AP5 A;  3CXH F;  1XHZ A;  4DW0 A;  4GX2 A;  5JCO C;  1JX9 A;  2EIJ B;  2Y4T A;  3ASO C;  3THO A;  2GTS A;  1L0L H;  1V9P A;  3DXR B;  3FD9 A;  5J2U A;  1XQ8 A;  1JFF B;  3OGI B;  3C3T A;  3QG5 A;  4JYA B;  2CH7 A;  2NN4 A;  1AIL A;  4BIU A;  1IXM A;  2IJH A;  1WN7 A;  3ZN1 A;  3VQW A;  1SQQ H;  1R6T A;  5A9G A;  3A0B Z;  5KA6 A;  1H8E G;  4Z1V A;  4GKK B;  3U0Z A;  3L70 H;  5EZY B;  2PY5 A;  1Q86 W;  1I0H A;  4EB6 A;  4IYH A;  4H13 B;  4Q6G A;  3OE7 G;  1FXH A;  2Q6A A;  4JI0 O;  1QQC A;  2PZS A;  2Q7H A;  4DK1 A;  3K3W A;  4R8C A;  3QO5 A;  4RQF A;  1F4M A;  2ZD9 A;  1XOU A;  2JS3 A;  5IYZ B;  3VQY A;  2NNU A;  3N2G B;  3JAR B;  1O9G A;  3B8N A;  4W4K A;  2CUG A;  4D7T A;  3K58 A;  3CXC U;  4JTD B;  3BPZ A;  1J5E O;  2HHH O;  3S3X A;  3BY6 A;  1Q3E A;  3SJC C;  1JFF A;  3CCM V;  2FML A;  3X2Q B;  4X64 B;  2LGW A;  3ETE A;  5L3F A;  2HVK C;  3OTO B;  2XAF A;  5K1P A;  5KX5 A;  3HKE B;  2P22 C;  2P4V A;  2Z5U A;  3B09 A;  4XDJ A;  5GTH Z;  2ZDI C;  1H2N A;  4J80 A;  3T1Y B;  4X64 O;  2YID A;  1BL8 A;  5EZY A;  4LF7 B;  2G38 A;  3DGE A;  3H9V A;  3J81 N;  3OTO O;  4MTF A;  4DV7 B;  5KHJ A;  3AG2 B;  4FJC C;  1PM9 A;  3G80 A;  2ITD C;  4DV0 B;  2WAM A;  4FK5 C;  4MVS A;  1AR5 A;  1L1F A;  3T1Y O;  2Q8V A;  1NQT A;  5IYZ A;  2ZM6 O;  4B7K A;  1WJZ A;  3JAL B;  3N2G A;  4UVB A;  5LL6 Y;  3JAR A;  3ZCC A;  2VQE B;  1D5N A;  2HLD G;  3SPG A;  2ZE7 A;  2AGA A;  3K9A A;  3OM3 B;  1OCO C;  1PNK A;  2QKC A;  2E76 B;  1N0N A;  4LFC B;  1SQF A;  5KA5 A;  1N33 O;  3H1K H;  4DXW A;  3HKE A;  4JYY A;  2B1G A;  4F6E A;  4TWK A;  3ETQ A;  1TAE A;  2R9R B;  4CBC A;  4X1Y B;  2QR4 A;  3AG4 B;  1S72 V;  2P67 A;  3LUT B;  1VF7 A;  2XAH A;  4UCV A;  3ETG A;  4LFC O;  3CP1 A;  4ZBM A;  1K4C C;  4K0K B;  4LFA B;  4YJ3 B;  3ZN0 A;  3ZRS A;  4J7K A;  4JV5 B;  1B04 A;  2V1D A;  4X1I A;  4AQY O;  4MVM A;  1VQ4 V;  4BIZ A;  2QM7 A;  2XTA A;  1SQP H;  1SQV H;  2HR3 A;  1Q43 A;  3FAV A;  4KXR A;  3JAL A;  4K0K O;  4LFA O;  1R1B A;  5TIS Z;  1JPX A;  4LF8 B;  4QE9 A;  1FJG B;  1Y67 A;  1ORQ C;  4MVU A;  4JI2 B;  2JGD A;  2FTK A;  1QLN A;  1XMQ B;  4HNA B;  5L3D A;  1CP9 A;  1GN3 A;  1YTF D;  1BHA A;  3BA8 A;  2OT5 A;  4NXM B;  4X1Y A;  1NS1 A;  3MDS A;  4JI2 O;  3JD4 A;  5CA3 A;  1QLE B;  1XMQ O;  4DR7 B;  1F7Y A;  3AK3 A;  4UVA A;  1ZTE A;  3QO7 A;  4B3M B;  3D3I A;  1VQ9 V;  2F43 G;  1SF9 A;  4YJ3 A;  4YIP A;  4NXM O;  3JAS B;  3VQV A;  3TCU A;  3TGU H;  1SA0 B;  3BAB A;  3G67 A;  3E86 A;  1H8H G;  2X7R B;  3ZHS A;  2OWO A;  3ZRW B;  2BCC H;  4I7Z B;  4ZI7 A;  3KG2 A;  4JI7 B;  1I08 A;  5FPR A;  1S5L Z;  5JJJ B;  2JJ2 G;  3B77 A;  1B3Q A;  1M4U A;  4GUN A;  2QM8 A;  2AW9 A;  2RDC A;  4K8X A;  2EBO A;  4HNA A;  5LBQ A;  4WFF A;  4YJ2 B;  2OTJ V;  2DYS B;  5K1X A;  5B1O A;  5B66 Z;  2K1E A;  1GH6 A;  2B9Z A;  4FPP A;  5B1A C;  1AI6 A;  2QKA A;  5LHI A;  1NR1 A;  1R73 A;  5BR8 B;  1YF2 A;  3CYO A;  3P3N A;  2YSU B;  1KMI Z;  4FLZ A;  5EBW C;  2XHB A;  4MVQ A;  1XI1 A;  2JIZ G;  1N34 O;  1VF5 B;  2M7W A;  4OX9 B;  4UFZ A;  1GN6 A;  3I56 V;  3JAS A;  1MOF A;  2ZT9 B;  4QE7 A;  1U96 A;  2YI9 A;  4D6T H;  5L3C A;  4DV3 B;  1VP7 A;  4JPR A;  2YI8 A;  2H94 A;  3J80 N;  1EN4 A;  3AG1 B;  1SA0 A;  2UXC O;  1GRJ A;  1KKD A;  4DO2 A;  1F23 A;  3DC5 A;  4MW3 A;  3ZRW A;  1N32 B;  3LDE A;  4U3J B;  2A3Q A;  3K79 A;  4WFG A;  4FLU A;  2QWO B;  4DV3 O;  4I9Q A;  5C8Y B;  1Q6I A;  2ZIM A;  4CH6 A;  1IUR A;  2HP8 A;  2EIJ C;  1K7D A;  4JI8 B;  1QCE A;  3B2E E;  4YJ2 A;  2Q0A A;  2M6Y A;  3ZHQ A; 
#chains in the Genus database with same CATH homology
 4LF9 O;  1HNZ O;  4JV5 O;  2ZM6 O;  1HNX O;  5BXZ A;  2JRI A;  4DR2 O;  5LL6 Y;  1IBK O;  4YY3 O;  4NXM O;  5LMU O;  1AIL A;  3M8A A;  4OX9 O;  4NXN O;  1HR0 O;  5IT9 N;  4LF8 O;  1XEQ A;  1R6T A;  1FJG O;  1IBL O;  4B3T O;  3T1H O;  1AB3 A;  2AGA A;  4GKJ O;  2DJV A;  2DOS A;  4JI4 O;  1DK1 A;  1N36 O;  1FKA O;  2UUC O;  4JI1 O;  1N33 O;  2UUB O;  4LF7 O;  2VQF O;  1N32 O;  4DR3 O;  5IWA O;  4DV1 O;  4JI0 O;  4DV7 O;  5A2Q N;  4DUZ O;  4DV2 O;  4DV0 O;  4JI8 O;  4DR7 O;  4LFC O;  4LFB O;  4X65 O;  5FLX N;  4OPA A;  2F4V O;  4OPH A;  4DV5 O;  2LW7 A;  4B3M O;  1A32 A;  4JYA O;  5BY1 A;  4KHP O;  3R66 A;  2VQE O;  4DR1 O;  2ZKO A;  1HNW O;  1D2D A;  4AQY O;  1J5E O;  2HHH O;  1XMO O;  4YHH O;  4DUY O;  3RT3 C;  3F5T A;  4B3S O;  1KUQ A;  2UU9 O;  1N34 O;  1FYJ A;  4LF4 O;  4A5U B;  4GKK O;  4K0K O;  4LFA O;  4DR4 O;  1R1B A;  4X66 O;  4DV4 O;  4DV6 O;  4DR5 O;  2UXD O;  4JI7 O;  4JI3 O;  3JAM N;  1XNQ O;  5LMN O;  3J80 N;  1XNR O;  1YZB A;  2UXC O;  4LF6 O;  2UXB O;  4X62 O;  4X64 O;  2UUA O;  3J7A U;  1X59 A;  3SDL A;  2E5L O;  4JI5 O;  3J81 N;  3OTO O;  4B3R O;  1IBM O;  1I94 O;  2FKX A;  4DV3 O;  1G1X B;  2N74 A;  5H5N A;  3O65 A;  1NS1 A;  4JI2 O;  2Z0A A;  1XMQ O;  5BR8 O;  3T1Y O;  4JI6 O;  1F7Y A;  4LF5 O;  4DR6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...