2DJVA

Solution structures of the whep-trs domain of human methionyl-trna synthetase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase
publication title Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 79
sequence length 79
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2djvA00
3T1HO 4LF6O 5FLXN 2Z0AA 2VQFO 1HNXO 2LW7A 4OPAA 2VQEO 1YZBA 4LF7O 4DR1O 3J7AU 3SDLA 2UUBO 4KHPO 4LFAO 3OTOO 4B3SO 5IWAO 4GKKO 4YY3O 3J81N 4X62O 1IBKO 2UUCO 2E5LO 3RT3C 4DR2O 1R1BA 5BXZA 3JAMN 1J5EO 4X65O 4JV5O 4NXNO 1N36O 3F5TA 1A32A 1X59A 4OX9O 2F4VO 5LMNO 4DR6O 4LFBO 2ZKOA 3R66A 1D2DA 2N74A 1DK1A 2AGAA 1HNZO 4JI0O 4JI3O 2UXDO 1I94O 5BY1A 4DR5O 4B3RO 5LMUO 1NS1A 4DV2O 1AB3A 5LL6Y 4JI4O 3O65A 1G1XB 4AQYO 4DUZO 1FYJA 4OPHA 4DR4O 4DUYO 1N32O 4NXMO 2DJVA 1R6TA 1IBLO 2JRIA 4DV5O 4JI7O 4DV4O 1KUQA 1FJGO 1XNQO 1XMOO 4LFCO 3J80N 4JI1O 4DV7O 2UXCO 4LF8O 4JI2O 4JYAO 4X66O 4DV6O 3T1YO 1F7YA 4JI6O 1XEQA 2UU9O 4JI5O 3M8AA 4DV1O 4B3MO 5BR8O 4LF9O 5A2QN 1XMQO 4DV3O 5H5NA 1AILA 2ZM6O 4YHHO 4LF4O 2HHHO 1HNWO 1XNRO 2FKXA 1IBMO 4A5UB 2UUAO 4B3TO 2DOSA 4GKJO 2UXBO 1HR0O 4LF5O 4X64O 4DR3O 4DV0O 4DR7O 1N34O 4K0KO 5IT9N 4JI8O 1N33O 1FKAO
chains in the Genus database with same CATH superfamily
2OWOA 4QE9A 1GO3F 4DR2B 4CC6A 1GN3A 3HKBA 4WFFA 4LFAO 3FAVB 1BHBA 1K97A 3F7YC 4HAMA 4J7KA 4FM1A 2QKCA 1H2KA 3H1KH 4G2KA 5C8YB 3ZEDA 2XAGA 4DYLA 1RM1B 2H8PC 5B1BC 2Q67A 1R3LC 4RWUA 1RP3B 4IIJA 4X65B 1F23A 1S5HC 3HKBB 3HPLC 3HB3B 2FMLA 3STZC 2JS3A 5BY1A 2HJDA 4DV2O 1ENVA 1K8AW 1QR9A 5L3CA 2LGWA 3UKMA 1G4YB 4JI4O 4AQYO 1N32O 2WLJA 5LGTA 3AG1C 2N04A 4IIJB 5J9PC 4JAVA 1KKDA 4DV6O 1IBMB 3FB5C 4QNHB 4UV8A 2PTMA 4LCUC 4TWKA 4AHCA 5HFMA 1KP2A 1KB9F 4DV3O 5IDJA 1TGOA 4H13B 1AILA 5IJ0A 4X9QA 2IJHA 5B1BB 2YXLA 5CN0A 5C93A 2YC0A 1HP8A 1HWYA 2QM7A 1HR0O 1VQ6V 2PYLA 1YHQV 2QEXV 5B3SC 1PPJH 1M93A 1LUVA 5EC1C 5KHGA 4X62B 3W7XA 2R9AA 2LFRA 4LBEC 5DECA 4TOIA 5KLVH 5IJ0B 3OGCC 1BS3A 1SETA 2X6BA 5EK0A 2FL4A 3T2MA 1SQPH 3AG1B 1YEWA 4UCOA 1D5AA 1FXVA 4TV9A 5KAFZ 2B1IA 5D5QA 5F2VO 1A32A 2NLJC 2F4VO 2Q8VA 4GCZA 2WAMA 5GW7A 4LFBO 2DQ3A 3K0DA 3QNEA 5EBLC 2DQ0A 3M7MX 4JI3O 2JGDA 3ZRVA 1VF7A 1YXBA 4JI1B 4TV9B 4WBNA 3FYIB 2RQ6A 1FFXA 5LMUB 4YJ3B 3A0BZ 5B3SB 1G1XB 2QM4A 1Y76B 4OPHA 3MHSC 1N0NA 1IBLO 1JFFA 4YIOA 2JRIA 3ZMUA 1KKCA 1AP5A 3HKCA 4PJ0Z 4I9WA 2JGDB 2YIAA 3IC9A 4X66O 1E79G 3VQXA 1I08A 4WBNB 4ZHQA 4RQEA 2HFEC 4ICGA 1FFXB 2ZCEA 3QTCA 2VRZA 2A9HA 5LYJA 4B3MO 3CXCU 1JFFB 1JX9A 2AHZA 1I5YA 3CRAA 3ETEA 4KUMA 2OIEA 4MVMA 2VQEB 4ZHQB 4DR7O 5CMUA 2HLDG 4JTDB 4GKJB 2YXYA 4X64B 3ABTA 4GLXA 5LYJB 4X88A 4N23A 4Z1VA 5FLXN 4AILC 3KCYA 3VQVA 3K06A 1P7GA 2ZE8A 5JQGA 2EIKB 3STLC 1NR7A 1UFIA 1N8RW 3CRQA 2CDYA 4O2AA 5LHGA 4Z2WA 2P06A 1Q3EA 2IBZH 1SKVA 3N2KA 1NZ6A 4U3FH 1M56C 3KZIZ 1FXHA 2ODMA 2F43G 4JI0O 2H94A 3ABKC 5H2FZ 3GWOA 2WSSG 4KL1A 4O2AB 1Q6IA 3CCLV 3O65A 3OMAB 1FYJA 1GN6A 2UU9B 5JCOC 3N2KB 1OCRC 3SYPA 3SYAA 4K8ZA 1XNQO 1WB7A 3RVZA 3SPCA 1N32B 3P32A 1E1RG 1PNLA 2AZ2A 1HNWB 4I4TA 3BCCH 1JMKC 4X1KA 2Q7EA 2VWJA 1XQ8A 1AR1B 4DV1O 1N34B 3EFFK 1BT8A 1VF6C 1BMFG 1S76D 4NB5A 5JCOA 1XI1A 4RO2A 4I4TB 4UFZA 1M56B 1MNGA 1BCCH 3EHBB 4X1KB 3ABKB 2DYSC 4WFBV 3ABLC 4MVZA 5IT9N 1HR0B 2ZIOA 3SYOA 1S3JA 1QQCA 2Z0AA 3U0ZA 2QDOA 1YZBA 3OMIB 2HKOA 3OE7G 1OCRB 2P90A 2P4VA 2R72A 4KHPO 2Y4TA 1VF6A 1N0JA 5IWAO 2QTSA 4PA9A 1Y66A 1IBKO 2A0LA 1R73A 4YIPA 4DR2O 1R1BA 4Z1MG 2EZPA 3F5TA 1H2GA 4R50A 4MTGA 1L1FA 2QKSA 3JAKA 4DR5O 2HVKC 1PL4A 4D7TA 2YS8A 2DYSB 3ABLB 4I55A 2ZE6A 1VQOV 2LW1A 4BR6A 2P5OA 1SQGA 3JAKB 2GTAA 3L71H 1VQ4V 5L3GA 4DK0A 1XDCA 1BQZA 4J7JA 2IH3C 3UO3A 3BA9A 1VQPV 3OUSA 2GSMB 1V54C 1NVPB 1Z2GA 4JAUA 3TGUH 4FFBA 1FS0G 3T1HB 3ZN1A 1IBMO 1SRYA 4A5UB 3CCJV 4B3TO 1K92A 3SPGA 3K9AA 2OTLV 3CRRA 4HZ3A 4JTCB 1QVFU 3E89A 5AG2A 1Y67A 1N33O 3AG7A 1AI6A 4O4LB 1TUEB 4FFBB 3DXRA 3RWRD 3VOUA 1B6QA 4PDLA 2E74B 3OR6C 4LC1A 4OXSA 5LGUA 3SDLA 1IXMA 2WLHA 2PY5A 5EC2C 4YY3O 4X62O 3D3IA 4IGGA 1ZSPA 2UXDB 1I7FA 1M1KW 5B1OA 4MW8A 3ZRXA 4BW9A 4MW3A 1QVGU 4NTXA 5FPRA 2Q7HA 3DXRB 1V54B 2IW5A 1S5LZ 3ZCCA 2LO1A 3AK2A 4O2BA 1M4UA 2WA4A 4DV5B 1M90W 5EYPA 1KECA 5J2TB 3ZS8C 1DF5A 2EJ7A 4LNUA 2N05A 2Q6AA 4JI0B 1U97A 5LL6Y 2K1EA 4JI5B 3FD9A 3UT5A 2ITDC 5LA6A 2CUGA 3FB7C 4O2BB 1NBMG 4FLUA 3ETQA 4FPPA 2HP8A 4K3AA 4L8JA 5EYPB 3ASNC 4JI1O 3SJCC 5LBQA 5K1XA 3CWBH 1XNQB 1ZX3A 2Q0OC 4LNUB 4MVOA 3E2EA 4MVUA 1QCEA 3OT7A 3UT5B 1WA8A 1GMGA 4NTYA 5LA6B 2GHYA 5KHHA 1ZWIC 4H37A 1K5SA 3CMEV 2XNDG 4DV1B 2C2AA 1Z5WA 3MDSA 3CD6V 3FFQA 5GTHZ 1XREA 3TETA 2HG5C 5LHHA 3DC6A 2ADQB 1SZXA 2PF4E 4QE7A 1BL8A 4JI8O 2ZNJA 3S3XA 3C90A 1WA8B 3JD4A 4UB8Z 2D3OW 3B8MA 5GTIZ 3SR2C 2RDCA 4OPAA 2VQEO 2RNBA 1CP9A 2HEPA 2M6YA 3L72H 1TVKA 2E3CA 4DR6B 4GT1A 3ASNB 4WFHA 4NR1A 3ZHUA 1HNZB 4B3RB 1PM9A 1JVMA 1GM8A 1X4TA 4JZGA 1W2BU 4J9ZB 5L3EA 2A7WA 4LWSA 1FD9A 2Y0PA 1IZ3A 2B1GA 4MTFA 3RYFA 2ZKOA 1TVKB 2F1MA 1WLEA 4UXNA 4I0XA 1NKDA 1D2DA 4RUEA 3LNMB 4LFCB 2GUZA 2RMKB 1SERA 4K8XA 2UXCB 1QLNA 1M5IA 4IT5A 4DR5B 2OYQA 2ZT9B 3OFNG 4I7ZB 4U3JA 2X6AA 4LWSB 2YIBA 1URFA 2V1DA 1D5NA 4XDLA 1KUQA 3JASA 3QG5A 4XDJA 3RYFB 5LP6C 3FB8C 4I0XB 3BA8A 3JALA 4UB6Z 4LF8O 4CZZA 2GUZB 1GN2A 1RPRA 4HYOA 2Q7GA 3R65A 2UU9O 4GZRB 3LSQA 1P84F 2X6CA 4LF9O 1XMQO 4LR3A 5IJ9A 3JASB 4CS3A 1HNWO 2HR3A 3E86A 4B7EA 5LP6A 3TK1A 3K9SA 2JDIG 3QO5A 3X2QC 2O57A 1N34O 2UUBB 1S72V 4B3TB 2RCVA 3WB2A 4MT8A 4UV9A 3EVKA 4GKKB 4WFGA 4JYBA 3ZN0A 5KA5A 1N4CA 5EZYA 5IJ9B 1ZAUA 1VQLV 5FPOA 3D3QA 3Q4HA 4EEQA 1NTKH 1N33B 3AG4C 4GX0A 4D7SA 1N36B 5LP6B 4FLZA 2DYRC 2Z5UA 1PV0A 4YJ2A 3CPWU 3TXSA 1WPBA 1T5EA 2KB1A 1SESA 3LDCA 2XUMA 4JF3A 1L8DA 5EZYB 2QWPB 4YY3B 2EIJC 1PP9H 1GRJA 3CMAV 1GK9A 2KQXA 3QO8A 3E8BA 1YF2A 1QHTA 4FVMA 3OGIB 1XMOB 3N27A 2PI5A 4IHJA 3X2QB 2Q68A 2YUAA 2ZR2A 1WAZA 4LH6A 4UUJC 3QO7A 3JD3A 1PL0A 1ZLZA 1MZFA 3G4SV 1KP3A 3G6BA 1XHXA 3AG4B 3G71V 3PJSK 2DYRB 4TQDA 1DGSA 4IHJB 2WLLA 1JQ0A 4GX1A 1MG1A 1V55C 2PZSA 2XOKG 5E1AC 4QGPA 2EIKC 2EIJB 3BAAA 2PUSA 3THOA 2Q0AA 3HKEA 5CBHA 3JD1A 2XAFA 1EN5A 2WLLB 4H44B 4J41A 3FYEB 1NTMH 2DWEC 3JD0A 3T1HO 4BAYA 2NN4A 4PI2A 4JI8B 1XL6A 3SYQA 3HKCB 3K03A 3H1JH 3IJ4A 2OIGA 1ORQC 3HKEB 1LUWA 4W4KA 1Y4MA 5IYBO 4QIWF 3B2EE 4OX9O 1V55B 2QSAA 1TUBA 5KA6A 1KQSU 2Q73A 3U10A 2AGAA 1Q8IA 1JCHA 2UXDO 2JIZG 1JA8A 2BE3A 2ETNA 5TISZ 2CGOA 1SF9A 4JAAA 4IL6Z 1XOUA 3OEEG 3CC2V 1Q81W 3RGBA 2XAQA 3CC7V 4GUNA 3WB1A 4E4EA 4CS4A 1TUBB 1SQQH 4DV5O 4J80A 3ZHTA 2F93B 3K3WA 2FB5A 5JQGB 4HBNA 4IYIA 4CH5A 2ITCC 1E1QG 5JWPA 3ZMZA 1F7YA 4JI6O 3LDEA 4JI5O 4LF8B 2X7RB 2B9ZA 1SQBH 1VQ5V 4DW0A 2QR4A 1GAXA 5H5NA 4I50A 1XHZA 3UQ8A 3N2GA 5KAIZ 5LGNA 2E75B 2VQFB 4LF9B 1XMQB 3SPIA 1I5XA 1SA0A 1ZL8A 2CTRA 4X1IA 4UCSA 4DXWA 1B06A 2QWRB 3MAQA 4F6RA 3I5DA 1ROPA 1Z5VA 5JJEB 3P3NA 4I50B 4PHZA 5IYDO 3N2GB 2JVDA 3CRCA 4QPJA 1SA0B 1ZL8B 3RYIA 4X1IB 2DN9A 2UXXA 3B4SA 4N21A 5JJJB 4EKWA 3C3TA 3JSLA 2JEXA 4F6RB 5GONA 2QWOB 3JAMN 2GV9A 3DSQA 4JYCA 1VQ8V 1SQXH 1X59A 5L3DA 5B1AC 1QR8A 4P2ZA 3TCUA 4FM2A 4DR6O 1AJQA 4DK1A 1K9MW 3RYIB 1HNZO 1L0LH 2CE4A 1YI2V 4B3RO 3ZMSA 3CSXA 1P7BA 1VEWA 5JH7A 2DMXA 1AVMA 2P67A 4DUZO 5H6RA 2IU0A 1Y74A 2AW9A 1JR9A 5IYZA 4LFCO 3IAYA 1GTOA 2UXCO 2OTJV 4BW5A 2IH1C 4TUYA 4I5SA 5JH7B 1GM7A 1QU7A 4O4IA 2AZ0A 2ZXWC 4PI0A 5A2QN 1Y74B 2BOBC 1JJ2U 2EIMC 2RN9A 1Q43A 5IYZB 2JEUA 4FK5C 1XNRO 2FKXA 2YI9A 5B1AB 4DR1B 1K33A 3B09A 1NVPD 4RUFA 3K5LA 4TUYB 1H2NA 4O4IB 4CBCA 1FKAO 4I55B 4TV8A 1QNMA 1KD1W 3U11A 4X20A 2CTQA 4CH3A 2YDEA 4UCRA 2UUBO 2K9PA 3JD2A 1MZEA 1JOYA 2AXTZ 4GKKO 3P3PA 2A79B 3F7VC 2YEVA 2Y69C 4K35A 3LSSA 5HFLA 3OR7C 4UVBA 2ZD9A 3L75H 1Q6HA 4P30A 2LQTA 4TV8B 1Q5OA 2ZE5A 4NXNO 4FLVA 1N36O 5KX5A 1NR1A 5KHIA 2ZXWB 1WN7A 2ZDIA 5CBFA 2EIMB 2N74A 2EJRA 1DK1A 3BFRA 4FLTA 4OX9B 3LNNA 3WU2Z 2YEVB 2F95B 1MSWD 3BPZA 4JI2B 1NTZH 3T1YB 4EFBA 1SQFA 3JAWA 5CB4A 4MTOA 4DUYO 5KX5B 1AR4A 3ETGA 4FIPC 5BR8B 3APOA 3IC7A 1XMOO 2ZM6B 4ZKIA 2WLIA 4WFAV 2XT9A 1BQ0A 2UXBB 1YCIA 1CXZB 3CP1A 3I55V 2XAHA 2ZQMA 3JAWB 5EBWC 4DR3B 5IYCO 1W0JG 2Y69B 2LGQA 2WPDG 3T4DA 4JI6B 4WCEV 1P4RA 2Q4PA 3OMNB 5CA1A 3ETDA 2WWWA 1V9PA 2WLIB 3ZIAG 1AI5A 4BIUA 1WJZA 2E76B 1W59A 5H9CA 5B5EZ 3OTOB 2BSKA 3CS5A 3AG2C 3FB6C 1EM1A 1MSDA 1M57C 2WLMA 4B7KA 1NH2B 3AEIA 2YSUB 2GBOA 3VQYA 5CA3A 3OM3B 4B08A 4KXRA 2EULA 2AHYA 3ZMVA 1IURA 2UUCO 4BIZA 2BSKB 3APQA 4FLYA 1WNSA 1NQTA 2JGUA 2ADPA 4JV5O 1K7DA 1JPXA 1MMMA 2Y4UA 2GDSA 4CS2A 3FX7A 1K73W 1WPXA 3E8HA 3WG7C 2HJFC 3R66A 2VS0A 3UM7A 3CCQV 2LFSA 3RN4A 3KCXA 4XBFA 1FJGB 1P49A 4FMTA 3VBBA 1GN4A 1G8MA 1S0VA 1GH6A 4DV7B 3S3WA 2F66C 4JYAB 4ZI7A 1L0NH 3G6EV 2GTSA 3DGEA 5DEDA 4DR4O 4O4HA 3LUTB 2DJVA 4PD4F 2IJIA 3AG2B 1YITV 3RBZA 2YIDA 3P30A 3SPJA 4DUZB 1H2MA 1VQNV 3J80N 3RW0A 1DTOA 1IXBA 1M57B 3K0GA 4PDMA 1TA8A 2L6LA 3FAVA 3IGAC 4LF4B 2P6JA 5DM6V 1VF5B 4GX5A 4JGSA 2QJ1A 3MD0A 4ZI7B 3A0HZ 1BE3H 2Q5ZA 4W4LA 4LF5B 3E8FA 5LXTA 4DV0B 1YDXA 4O4HB 4NVPA 1NT2B 4J10A 1EZJA 4KFMA 4YHHO 4AI8A 2HHHO 3H1LH 4P9PA 2UUAO 3BRCA 1EFRG 3WG7B 5JVDA 2P7TC 3ICXA 1KBHA 3OD4A 4X89A 1XNRB 2YIBD 2PGGA 2ZE7A 5LXTB 3B8NA 2IM9A 4GYCB 4U3JB 3CCSV 3ZHRA 2E5LB 4LF6O 3H01A 4F6EA 2VQFO 4PA6A 4DRXA 2QM8A 1GM9A 2CTPA 3C3SA 3LDDA 4RAIA 3SJBC 1F4NA 3E8GA 4EFEA 2PI4A 5JVDB 3JALB 4NKGB 2XTAA 5A9GA 1B3QA 1H38A 1G6UA 5LMNB 4LH7A 3J81N 2ZINA 2CAZC 3ZHQA 4Q20A 1EZVH 3JYCA 4DRXB 1KC8W 4MSWC 3RYCA 4NXNB 3CC4V 4JI7B 3JATA 4H0LB 4YXWG 5D5PA 1JJOA 3ZHVA 4DO2A 3JCUZ 4D6TH 3K5NA 3PN1A 5IY5C 3K04A 1H2LA 4PV1B 4UVCA 3JARA 1LR1A 4ZOLA 1R6TA 1EBOA 3Q4HB 1CEZA 2HVJC 3ZHSA 2JS5A 3RYCB 3O9OA 1TAEA 2MK3A 4DUYB 4OGQB 3SJQC 3JATB 3EXAA 1VARA 5IE9A 4YJ2B 1XL4A 2X0LA 1K34A 3KG2A 2OCCC 3OTFA 3NXSA 2WA3A 1J95A 4Q6GA 3JARB 4ZOLB 1YJWV 4BIOA 2BOCC 3CRMA 2PYJA 3L73H 1Y6XA 2IJKA 1AI4A 4UVAA 2EX3A 3A2FA 3K5MA 2YXHA 3HR0A 1Q86W 1EN6A 1EN4A 2W6IG 1OCZC 4K0KO 1NU1H 1QLEC 1PNMA 4YJ3A 2P22C 5BMVA 1Y76A 1AR5A 5IY5B 1HNXO 1SZTA 1K4CC 4FM0A 4DR1O 1BZKA 2Q69A 1YTFD 1ZUQA 4B3SO 1HDJA 1AROP 5FL7G 3L9DA 1Q90D 3ABMC 2DW4A 2OCCB 2QA4V 5BMVB 4UCTA 1YTFB 1J5EO 2UUCB 5CA0A 3TXQA 4I9QA 1SS3A 4NXMB 2EZOA 3ZMTA 4JV5B 1AP6A 4DV4B 1I94O 1NS1A 5ITZA 4WFEA 2DWDC 3B40A 4WF9V 1BSMA 1OCZB 2BTOA 2BCCH 5CA0B 1QLEB 3ZBHA 1F4MA 4DR4B 5L3BA 3CCRV 4JI2O 5ITZB 5L3FA 1K4DC 1R3KC 1XILA 4JASA 3I56V 3T1YO 3ZJZA 1RPOA 1YJ9V 3CE2A 2XAJA 4ZIBA 3AK1A 4FLXA 3JCZA 4J9YB 2UXNA 3CCMV 2P4KA 3ABMB 4KP4A 5BR8O 4IYHA 2ZM6O 1R3IC 1NI8A 5FNVA 1MOFA 2DOSA 2MW2B 2UXBO 5B66Z 4YHHB 1UPGA 4DR3O 2HHHB 4FJCC 5KUKA 2UUAB 3K79A 3RVYA 3ZX6A 4LFAB 3ABUA 1IVSA 2YICA 4X1YA 1LNQA 4H33A 3K57A 5FNVB 4LF7O 3CJHA 3J7AU 4R6ZA 4LF6B 3GVMA 3DC5A 5JJNB 3OTOO 2ZNIA 2RJZA 4PA4A 4X1YB 3RT3C 4MVQA 3BABA 5BXZA 4DV2B 1BGYH 1U96A 2Q9LA 2VWKA 3B77A 4BWAA 4O4JA 1CPYA 4EB6A 4JI4B 4AQYB 3CJHB 1WB8A 2NR5A 2V7QG 1O9HA 2ZR3A 1IX9A 2F23A 2W6JG 1AJPA 1K5QA 3HKDA 4G28B 5CBGA 2JK5C 5KHJA 3K59A 3WB0A 4DV6B 1HW7A 3K5OA 1SC5B 4JTAB 2JJ1G 5EIBC 3UCSC 3CYOA 3JSNA 4O4JB 4U7NA 4EB6B 1VQKV 4FFKA 3GWKC 1FJGO 3K08A 3G67A 5LOVA 2EILC 4DV3B 5LHIA 1KYOF 4DV7O 4ZBMA 4JYAO 1H8EG 1YJNV 3HKDB 4FZ1A 3LSUA 1FPOA 1COWG 1US6A 4X8AA 2WLNA 2CK3G 4QPKA 2Y0IA 3ZRWA 3CCEV 3T1CA 5GONB 4MS2A 2IU3A 3FKSG 3IFXA 4CH6A 3BEHA 5KMGA 5LOVB 2G38A 4LF4O 1IDSA 1VQ7V 3NR7A 3MHHC 4LF5O 1VQMV 2EBOA 1Q7YW 5KUMA 4DV0O 3OUFA 2R9RB 4J42A 5EIBD 1UJWB 3RFRA 3ZRWB 4JPRA 3ZRSA 3CCUV 2LJ2A 3KKYA 2H3OA 2CTWA 5DN6G 4K0KB 1S77D 5KMGB 1W0KG 2LW7A 3E22A 1BHAA 4GX2A 5E79Z 2B5UA 5K1PA 2L35A 2A3QA 3K58A 4JYYA 1QBZA 1DLBA 3CHXA 4XDKA 1HNXB 1GKFA 2EILB 2F4VB 2A06H 4J11A 4RQFA 2KG7A 4LFBB 2JJ2G 3TJTA 2E5LO 3BY6A 4JI3B 4B3SB 1MABG 3SYCA 3F5WC 3ASOC 4X65O 1DF4A 2M7WA 2EINC 2ZDIC 3E22B 5EBMC 2W0XA 2R9IA 1R6NA 1WP8A 4TQFA 5LMNO 2V4DA 1J5EB 4PA3A 3SPHA 1IBLB 1XBLA 3H9VA 3BVOA 3DTUB 2KG7B 2QGNA 4PA7A 3E35A 3D36C 1OHHG 1FFTB 4X66B 1I94B 1O9GA 4LP8A 2YI8A 1R3JC 1OJHA 4O4LA 2QTOA 2XASA 2ILMA 2QE7G 4MVSA 4MTXA 4UCUA 4JI7O 1NJIW 4B3MB 4X20B 3W7SA 1VP7A 1AJNA 1Q82W 2QWNB 2LP7A 4ABMA 2KSDA 4JZ2A 4QJFB 3WFVA 1XEQA 1AI7A 4TSFG 3L70H 5B1NA 2ZIMA 1OCCC 1FAFA 4DR7B 3M8AA 3D36A 1VMGA 4FLWA 3A0RA 1M9NA 1XUQA 3H1IH 1B04A 3ASOB 1YIJV 2EINB 4U7OA 1F51A 3CCVV 1OCOC 4J7ZA 1THZA 4PDRA 5J2TA 2WLKA 1OZ0A 1ZTEA 1RSOA 4F4LA 2OT5A 2D2CB 2OCHA 5J2UA 1KU9A 5BZBA 3OW2U 4PELA 5CB4B 1S5JA 3D8CA 3M99B 4L87A 4CH4A 3VQWA 4HNAA 1PD3A 2CGNA 3RYHA 3AG3C 1FXKC 4LF7B 1RSOB 4E2LA 3W7UA 3SJAC 5J2UB 1NH2D 5H6QA 2NNUA 3CX5F 1OCCB 2R70A 4HNAB 3ML0A 4C7UA 5CA1B 3RYHB 3W7WA 2QKAA 3T4ZA 3A8TA 2XHBA 1RFYA 1OCOB 1K3EA 2QWQB 1MA1A 5LMUO 2ATKC 3OAAG 3UO2A 1AB3A 1FXKA 3CXHF 3L74H 4DW1A 2ARHA 3E83A 4TT3G 3QF7A 1VIBA 2IJJA 4MVRA 1SQVH 3QVNA 4P9OA 4R7CA 4NXMO 1R6KA 1YSCA 5KHKA 4DV4O 2BTQA 4NYKA 2FTKA 4UCVA 4FZ0A 4R8CA 3G80A 1H8HG 1PNKA 3GB7C 1KMIZ 3CB2A 3AG3B 2CH7A 1FXKB 3H1HH 1YVWA 2KKWA 1RM1C 1PKXA 1WP7A 3BHPA 3CEIA 2BTQB 4NTWA 3OEHG 3SGIA 1I0HA 3W7TA 1Q6UA 4GKJO 3AK3A 4PDVA 2FYUH 2CH7B 4X64O 2Z3YA 1H2SB 2DE0X 2W0FC 4KHPB 4CC5A 4G27B 4ASUG 2Y48A 5IWAB 5C8YA 1VQ9V 1OV9A 1IBKB
chains in the Genus database with same CATH topology
3T1HO 4LF6O 5FLXN 2Z0AA 2VQFO 1HNXO 2LW7A 4OPAA 2VQEO 1YZBA 4LF7O 4DR1O 3J7AU 3SDLA 2UUBO 4KHPO 4LFAO 3OTOO 4B3SO 5IWAO 4GKKO 4YY3O 3J81N 4X62O 1IBKO 2UUCO 2E5LO 3RT3C 4DR2O 1R1BA 5BXZA 3JAMN 1J5EO 4X65O 4JV5O 4NXNO 1N36O 3F5TA 1A32A 1X59A 4OX9O 2F4VO 5LMNO 4DR6O 4LFBO 2ZKOA 3R66A 1D2DA 2N74A 1DK1A 2AGAA 1HNZO 4JI0O 4JI3O 2UXDO 1I94O 5BY1A 4DR5O 4B3RO 5LMUO 1NS1A 4DV2O 1AB3A 5LL6Y 4JI4O 3O65A 1G1XB 4AQYO 4DUZO 1FYJA 4OPHA 4DR4O 4DUYO 1N32O 4NXMO 2DJVA 1R6TA 1IBLO 2JRIA 4DV5O 4JI7O 4DV4O 1KUQA 1FJGO 1XNQO 1XMOO 4LFCO 3J80N 4JI1O 4DV7O 2UXCO 4LF8O 4JI2O 4JYAO 4X66O 4DV6O 3T1YO 1F7YA 4JI6O 1XEQA 2UU9O 4JI5O 3M8AA 4DV1O 4B3MO 5BR8O 4LF9O 5A2QN 1XMQO 4DV3O 5H5NA 1AILA 2ZM6O 4YHHO 4LF4O 2HHHO 1HNWO 1XNRO 2FKXA 1IBMO 4A5UB 2UUAO 4B3TO 2DOSA 4GKJO 2UXBO 1HR0O 4LF5O 4X64O 4DR3O 4DV0O 4DR7O 1N34O 4K0KO 5IT9N 4JI8O 1N33O 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H O;  4LF6 O;  5FLX N;  2Z0A A;  2VQF O;  1HNX O;  2LW7 A;  4OPA A;  2VQE O;  1YZB A;  4LF7 O;  4DR1 O;  3J7A U;  3SDL A;  2UUB O;  4KHP O;  4LFA O;  3OTO O;  4B3S O;  5IWA O;  4GKK O;  4YY3 O;  3J81 N;  4X62 O;  1IBK O;  2UUC O;  2E5L O;  3RT3 C;  4DR2 O;  1R1B A;  5BXZ A;  3JAM N;  1J5E O;  4X65 O;  4JV5 O;  4NXN O;  1N36 O;  3F5T A;  1A32 A;  1X59 A;  4OX9 O;  2F4V O;  5LMN O;  4DR6 O;  4LFB O;  2ZKO A;  3R66 A;  1D2D A;  2N74 A;  1DK1 A;  2AGA A;  1HNZ O;  4JI0 O;  4JI3 O;  2UXD O;  1I94 O;  5BY1 A;  4DR5 O;  4B3R O;  5LMU O;  1NS1 A;  4DV2 O;  1AB3 A;  5LL6 Y;  4JI4 O;  3O65 A;  1G1X B;  4AQY O;  4DUZ O;  1FYJ A;  4OPH A;  4DR4 O;  4DUY O;  1N32 O;  4NXM O;  2DJV A;  1R6T A;  1IBL O;  2JRI A;  4DV5 O;  4JI7 O;  4DV4 O;  1KUQ A;  1FJG O;  1XNQ O;  1XMO O;  4LFC O;  3J80 N;  4JI1 O;  4DV7 O;  2UXC O;  4LF8 O;  4JI2 O;  4JYA O;  4X66 O;  4DV6 O;  3T1Y O;  1F7Y A;  4JI6 O;  1XEQ A;  2UU9 O;  4JI5 O;  3M8A A;  4DV1 O;  4B3M O;  5BR8 O;  4LF9 O;  5A2Q N;  1XMQ O;  4DV3 O;  5H5N A;  1AIL A;  2ZM6 O;  4YHH O;  4LF4 O;  2HHH O;  1HNW O;  1XNR O;  2FKX A;  1IBM O;  4A5U B;  2UUA O;  4B3T O;  2DOS A;  4GKJ O;  2UXB O;  1HR0 O;  4LF5 O;  4X64 O;  4DR3 O;  4DV0 O;  4DR7 O;  1N34 O;  4K0K O;  5IT9 N;  4JI8 O;  1N33 O;  1FKA O; 
#chains in the Genus database with same CATH topology
 2OWO A;  4QE9 A;  1GO3 F;  4DR2 B;  4CC6 A;  1GN3 A;  3HKB A;  4WFF A;  4LFA O;  3FAV B;  1BHB A;  1K97 A;  3F7Y C;  4HAM A;  4J7K A;  4FM1 A;  2QKC A;  1H2K A;  3H1K H;  4G2K A;  5C8Y B;  3ZED A;  2XAG A;  4DYL A;  1RM1 B;  2H8P C;  5B1B C;  2Q67 A;  1R3L C;  4RWU A;  1RP3 B;  4IIJ A;  4X65 B;  1F23 A;  1S5H C;  3HKB B;  3HPL C;  3HB3 B;  2FML A;  3STZ C;  2JS3 A;  5BY1 A;  2HJD A;  4DV2 O;  1ENV A;  1K8A W;  1QR9 A;  5L3C A;  2LGW A;  3UKM A;  1G4Y B;  4JI4 O;  4AQY O;  1N32 O;  2WLJ A;  5LGT A;  3AG1 C;  2N04 A;  4IIJ B;  5J9P C;  4JAV A;  1KKD A;  4DV6 O;  1IBM B;  3FB5 C;  4QNH B;  4UV8 A;  2PTM A;  4LCU C;  4TWK A;  4AHC A;  5HFM A;  1KP2 A;  1KB9 F;  4DV3 O;  5IDJ A;  1TGO A;  4H13 B;  1AIL A;  5IJ0 A;  4X9Q A;  2IJH A;  5B1B B;  2YXL A;  5CN0 A;  5C93 A;  2YC0 A;  1HP8 A;  1HWY A;  2QM7 A;  1HR0 O;  1VQ6 V;  2PYL A;  1YHQ V;  2QEX V;  5B3S C;  1PPJ H;  1M93 A;  1LUV A;  5EC1 C;  5KHG A;  4X62 B;  3W7X A;  2R9A A;  2LFR A;  4LBE C;  5DEC A;  4TOI A;  5KLV H;  5IJ0 B;  3OGC C;  1BS3 A;  1SET A;  2X6B A;  5EK0 A;  2FL4 A;  3T2M A;  1SQP H;  3AG1 B;  1YEW A;  4UCO A;  1D5A A;  1FXV A;  4TV9 A;  5KAF Z;  2B1I A;  5D5Q A;  5F2V O;  1A32 A;  2NLJ C;  2F4V O;  2Q8V A;  4GCZ A;  2WAM A;  5GW7 A;  4LFB O;  2DQ3 A;  3K0D A;  3QNE A;  5EBL C;  2DQ0 A;  3M7M X;  4JI3 O;  2JGD A;  3ZRV A;  1VF7 A;  1YXB A;  4JI1 B;  4TV9 B;  4WBN A;  3FYI B;  2RQ6 A;  1FFX A;  5LMU B;  4YJ3 B;  3A0B Z;  5B3S B;  1G1X B;  2QM4 A;  1Y76 B;  4OPH A;  3MHS C;  1N0N A;  1IBL O;  1JFF A;  4YIO A;  2JRI A;  3ZMU A;  1KKC A;  1AP5 A;  3HKC A;  4PJ0 Z;  4I9W A;  2JGD B;  2YIA A;  3IC9 A;  4X66 O;  1E79 G;  3VQX A;  1I08 A;  4WBN B;  4ZHQ A;  4RQE A;  2HFE C;  4ICG A;  1FFX B;  2ZCE A;  3QTC A;  2VRZ A;  2A9H A;  5LYJ A;  4B3M O;  3CXC U;  1JFF B;  1JX9 A;  2AHZ A;  1I5Y A;  3CRA A;  3ETE A;  4KUM A;  2OIE A;  4MVM A;  2VQE B;  4ZHQ B;  4DR7 O;  5CMU A;  2HLD G;  4JTD B;  4GKJ B;  2YXY A;  4X64 B;  3ABT A;  4GLX A;  5LYJ B;  4X88 A;  4N23 A;  4Z1V A;  5FLX N;  4AIL C;  3KCY A;  3VQV A;  3K06 A;  1P7G A;  2ZE8 A;  5JQG A;  2EIK B;  3STL C;  1NR7 A;  1UFI A;  1N8R W;  3CRQ A;  2CDY A;  4O2A A;  5LHG A;  4Z2W A;  2P06 A;  1Q3E A;  2IBZ H;  1SKV A;  3N2K A;  1NZ6 A;  4U3F H;  1M56 C;  3KZI Z;  1FXH A;  2ODM A;  2F43 G;  4JI0 O;  2H94 A;  3ABK C;  5H2F Z;  3GWO A;  2WSS G;  4KL1 A;  4O2A B;  1Q6I A;  3CCL V;  3O65 A;  3OMA B;  1FYJ A;  1GN6 A;  2UU9 B;  5JCO C;  3N2K B;  1OCR C;  3SYP A;  3SYA A;  4K8Z A;  1XNQ O;  1WB7 A;  3RVZ A;  3SPC A;  1N32 B;  3P32 A;  1E1R G;  1PNL A;  2AZ2 A;  1HNW B;  4I4T A;  3BCC H;  1JMK C;  4X1K A;  2Q7E A;  2VWJ A;  1XQ8 A;  1AR1 B;  4DV1 O;  1N34 B;  3EFF K;  1BT8 A;  1VF6 C;  1BMF G;  1S76 D;  4NB5 A;  5JCO A;  1XI1 A;  4RO2 A;  4I4T B;  4UFZ A;  1M56 B;  1MNG A;  1BCC H;  3EHB B;  4X1K B;  3ABK B;  2DYS C;  4WFB V;  3ABL C;  4MVZ A;  5IT9 N;  1HR0 B;  2ZIO A;  3SYO A;  1S3J A;  1QQC A;  2Z0A A;  3U0Z A;  2QDO A;  1YZB A;  3OMI B;  2HKO A;  3OE7 G;  1OCR B;  2P90 A;  2P4V A;  2R72 A;  4KHP O;  2Y4T A;  1VF6 A;  1N0J A;  5IWA O;  2QTS A;  4PA9 A;  1Y66 A;  1IBK O;  2A0L A;  1R73 A;  4YIP A;  4DR2 O;  1R1B A;  4Z1M G;  2EZP A;  3F5T A;  1H2G A;  4R50 A;  4MTG A;  1L1F A;  2QKS A;  3JAK A;  4DR5 O;  2HVK C;  1PL4 A;  4D7T A;  2YS8 A;  2DYS B;  3ABL B;  4I55 A;  2ZE6 A;  1VQO V;  2LW1 A;  4BR6 A;  2P5O A;  1SQG A;  3JAK B;  2GTA A;  3L71 H;  1VQ4 V;  5L3G A;  4DK0 A;  1XDC A;  1BQZ A;  4J7J A;  2IH3 C;  3UO3 A;  3BA9 A;  1VQP V;  3OUS A;  2GSM B;  1V54 C;  1NVP B;  1Z2G A;  4JAU A;  3TGU H;  4FFB A;  1FS0 G;  3T1H B;  3ZN1 A;  1IBM O;  1SRY A;  4A5U B;  3CCJ V;  4B3T O;  1K92 A;  3SPG A;  3K9A A;  2OTL V;  3CRR A;  4HZ3 A;  4JTC B;  1QVF U;  3E89 A;  5AG2 A;  1Y67 A;  1N33 O;  3AG7 A;  1AI6 A;  4O4L B;  1TUE B;  4FFB B;  3DXR A;  3RWR D;  3VOU A;  1B6Q A;  4PDL A;  2E74 B;  3OR6 C;  4LC1 A;  4OXS A;  5LGU A;  3SDL A;  1IXM A;  2WLH A;  2PY5 A;  5EC2 C;  4YY3 O;  4X62 O;  3D3I A;  4IGG A;  1ZSP A;  2UXD B;  1I7F A;  1M1K W;  5B1O A;  4MW8 A;  3ZRX A;  4BW9 A;  4MW3 A;  1QVG U;  4NTX A;  5FPR A;  2Q7H A;  3DXR B;  1V54 B;  2IW5 A;  1S5L Z;  3ZCC A;  2LO1 A;  3AK2 A;  4O2B A;  1M4U A;  2WA4 A;  4DV5 B;  1M90 W;  5EYP A;  1KEC A;  5J2T B;  3ZS8 C;  1DF5 A;  2EJ7 A;  4LNU A;  2N05 A;  2Q6A A;  4JI0 B;  1U97 A;  5LL6 Y;  2K1E A;  4JI5 B;  3FD9 A;  3UT5 A;  2ITD C;  5LA6 A;  2CUG A;  3FB7 C;  4O2B B;  1NBM G;  4FLU A;  3ETQ A;  4FPP A;  2HP8 A;  4K3A A;  4L8J A;  5EYP B;  3ASN C;  4JI1 O;  3SJC C;  5LBQ A;  5K1X A;  3CWB H;  1XNQ B;  1ZX3 A;  2Q0O C;  4LNU B;  4MVO A;  3E2E A;  4MVU A;  1QCE A;  3OT7 A;  3UT5 B;  1WA8 A;  1GMG A;  4NTY A;  5LA6 B;  2GHY A;  5KHH A;  1ZWI C;  4H37 A;  1K5S A;  3CME V;  2XND G;  4DV1 B;  2C2A A;  1Z5W A;  3MDS A;  3CD6 V;  3FFQ A;  5GTH Z;  1XRE A;  3TET A;  2HG5 C;  5LHH A;  3DC6 A;  2ADQ B;  1SZX A;  2PF4 E;  4QE7 A;  1BL8 A;  4JI8 O;  2ZNJ A;  3S3X A;  3C90 A;  1WA8 B;  3JD4 A;  4UB8 Z;  2D3O W;  3B8M A;  5GTI Z;  3SR2 C;  2RDC A;  4OPA A;  2VQE O;  2RNB A;  1CP9 A;  2HEP A;  2M6Y A;  3L72 H;  1TVK A;  2E3C A;  4DR6 B;  4GT1 A;  3ASN B;  4WFH A;  4NR1 A;  3ZHU A;  1HNZ B;  4B3R B;  1PM9 A;  1JVM A;  1GM8 A;  1X4T A;  4JZG A;  1W2B U;  4J9Z B;  5L3E A;  2A7W A;  4LWS A;  1FD9 A;  2Y0P A;  1IZ3 A;  2B1G A;  4MTF A;  3RYF A;  2ZKO A;  1TVK B;  2F1M A;  1WLE A;  4UXN A;  4I0X A;  1NKD A;  1D2D A;  4RUE A;  3LNM B;  4LFC B;  2GUZ A;  2RMK B;  1SER A;  4K8X A;  2UXC B;  1QLN A;  1M5I A;  4IT5 A;  4DR5 B;  2OYQ A;  2ZT9 B;  3OFN G;  4I7Z B;  4U3J A;  2X6A A;  4LWS B;  2YIB A;  1URF A;  2V1D A;  1D5N A;  4XDL A;  1KUQ A;  3JAS A;  3QG5 A;  4XDJ A;  3RYF B;  5LP6 C;  3FB8 C;  4I0X B;  3BA8 A;  3JAL A;  4UB6 Z;  4LF8 O;  4CZZ A;  2GUZ B;  1GN2 A;  1RPR A;  4HYO A;  2Q7G A;  3R65 A;  2UU9 O;  4GZR B;  3LSQ A;  1P84 F;  2X6C A;  4LF9 O;  1XMQ O;  4LR3 A;  5IJ9 A;  3JAS B;  4CS3 A;  1HNW O;  2HR3 A;  3E86 A;  4B7E A;  5LP6 A;  3TK1 A;  3K9S A;  2JDI G;  3QO5 A;  3X2Q C;  2O57 A;  1N34 O;  2UUB B;  1S72 V;  4B3T B;  2RCV A;  3WB2 A;  4MT8 A;  4UV9 A;  3EVK A;  4GKK B;  4WFG A;  4JYB A;  3ZN0 A;  5KA5 A;  1N4C A;  5EZY A;  5IJ9 B;  1ZAU A;  1VQL V;  5FPO A;  3D3Q A;  3Q4H A;  4EEQ A;  1NTK H;  1N33 B;  3AG4 C;  4GX0 A;  4D7S A;  1N36 B;  5LP6 B;  4FLZ A;  2DYR C;  2Z5U A;  1PV0 A;  4YJ2 A;  3CPW U;  3TXS A;  1WPB A;  1T5E A;  2KB1 A;  1SES A;  3LDC A;  2XUM A;  4JF3 A;  1L8D A;  5EZY B;  2QWP B;  4YY3 B;  2EIJ C;  1PP9 H;  1GRJ A;  3CMA V;  1GK9 A;  2KQX A;  3QO8 A;  3E8B A;  1YF2 A;  1QHT A;  4FVM A;  3OGI B;  1XMO B;  3N27 A;  2PI5 A;  4IHJ A;  3X2Q B;  2Q68 A;  2YUA A;  2ZR2 A;  1WAZ A;  4LH6 A;  4UUJ C;  3QO7 A;  3JD3 A;  1PL0 A;  1ZLZ A;  1MZF A;  3G4S V;  1KP3 A;  3G6B A;  1XHX A;  3AG4 B;  3G71 V;  3PJS K;  2DYR B;  4TQD A;  1DGS A;  4IHJ B;  2WLL A;  1JQ0 A;  4GX1 A;  1MG1 A;  1V55 C;  2PZS A;  2XOK G;  5E1A C;  4QGP A;  2EIK C;  2EIJ B;  3BAA A;  2PUS A;  3THO A;  2Q0A A;  3HKE A;  5CBH A;  3JD1 A;  2XAF A;  1EN5 A;  2WLL B;  4H44 B;  4J41 A;  3FYE B;  1NTM H;  2DWE C;  3JD0 A;  3T1H O;  4BAY A;  2NN4 A;  4PI2 A;  4JI8 B;  1XL6 A;  3SYQ A;  3HKC B;  3K03 A;  3H1J H;  3IJ4 A;  2OIG A;  1ORQ C;  3HKE B;  1LUW A;  4W4K A;  1Y4M A;  5IYB O;  4QIW F;  3B2E E;  4OX9 O;  1V55 B;  2QSA A;  1TUB A;  5KA6 A;  1KQS U;  2Q73 A;  3U10 A;  2AGA A;  1Q8I A;  1JCH A;  2UXD O;  2JIZ G;  1JA8 A;  2BE3 A;  2ETN A;  5TIS Z;  2CGO A;  1SF9 A;  4JAA A;  4IL6 Z;  1XOU A;  3OEE G;  3CC2 V;  1Q81 W;  3RGB A;  2XAQ A;  3CC7 V;  4GUN A;  3WB1 A;  4E4E A;  4CS4 A;  1TUB B;  1SQQ H;  4DV5 O;  4J80 A;  3ZHT A;  2F93 B;  3K3W A;  2FB5 A;  5JQG B;  4HBN A;  4IYI A;  4CH5 A;  2ITC C;  1E1Q G;  5JWP A;  3ZMZ A;  1F7Y A;  4JI6 O;  3LDE A;  4JI5 O;  4LF8 B;  2X7R B;  2B9Z A;  1SQB H;  1VQ5 V;  4DW0 A;  2QR4 A;  1GAX A;  5H5N A;  4I50 A;  1XHZ A;  3UQ8 A;  3N2G A;  5KAI Z;  5LGN A;  2E75 B;  2VQF B;  4LF9 B;  1XMQ B;  3SPI A;  1I5X A;  1SA0 A;  1ZL8 A;  2CTR A;  4X1I A;  4UCS A;  4DXW A;  1B06 A;  2QWR B;  3MAQ A;  4F6R A;  3I5D A;  1ROP A;  1Z5V A;  5JJE B;  3P3N A;  4I50 B;  4PHZ A;  5IYD O;  3N2G B;  2JVD A;  3CRC A;  4QPJ A;  1SA0 B;  1ZL8 B;  3RYI A;  4X1I B;  2DN9 A;  2UXX A;  3B4S A;  4N21 A;  5JJJ B;  4EKW A;  3C3T A;  3JSL A;  2JEX A;  4F6R B;  5GON A;  2QWO B;  3JAM N;  2GV9 A;  3DSQ A;  4JYC A;  1VQ8 V;  1SQX H;  1X59 A;  5L3D A;  5B1A C;  1QR8 A;  4P2Z A;  3TCU A;  4FM2 A;  4DR6 O;  1AJQ A;  4DK1 A;  1K9M W;  3RYI B;  1HNZ O;  1L0L H;  2CE4 A;  1YI2 V;  4B3R O;  3ZMS A;  3CSX A;  1P7B A;  1VEW A;  5JH7 A;  2DMX A;  1AVM A;  2P67 A;  4DUZ O;  5H6R A;  2IU0 A;  1Y74 A;  2AW9 A;  1JR9 A;  5IYZ A;  4LFC O;  3IAY A;  1GTO A;  2UXC O;  2OTJ V;  4BW5 A;  2IH1 C;  4TUY A;  4I5S A;  5JH7 B;  1GM7 A;  1QU7 A;  4O4I A;  2AZ0 A;  2ZXW C;  4PI0 A;  5A2Q N;  1Y74 B;  2BOB C;  1JJ2 U;  2EIM C;  2RN9 A;  1Q43 A;  5IYZ B;  2JEU A;  4FK5 C;  1XNR O;  2FKX A;  2YI9 A;  5B1A B;  4DR1 B;  1K33 A;  3B09 A;  1NVP D;  4RUF A;  3K5L A;  4TUY B;  1H2N A;  4O4I B;  4CBC A;  1FKA O;  4I55 B;  4TV8 A;  1QNM A;  1KD1 W;  3U11 A;  4X20 A;  2CTQ A;  4CH3 A;  2YDE A;  4UCR A;  2UUB O;  2K9P A;  3JD2 A;  1MZE A;  1JOY A;  2AXT Z;  4GKK O;  3P3P A;  2A79 B;  3F7V C;  2YEV A;  2Y69 C;  4K35 A;  3LSS A;  5HFL A;  3OR7 C;  4UVB A;  2ZD9 A;  3L75 H;  1Q6H A;  4P30 A;  2LQT A;  4TV8 B;  1Q5O A;  2ZE5 A;  4NXN O;  4FLV A;  1N36 O;  5KX5 A;  1NR1 A;  5KHI A;  2ZXW B;  1WN7 A;  2ZDI A;  5CBF A;  2EIM B;  2N74 A;  2EJR A;  1DK1 A;  3BFR A;  4FLT A;  4OX9 B;  3LNN A;  3WU2 Z;  2YEV B;  2F95 B;  1MSW D;  3BPZ A;  4JI2 B;  1NTZ H;  3T1Y B;  4EFB A;  1SQF A;  3JAW A;  5CB4 A;  4MTO A;  4DUY O;  5KX5 B;  1AR4 A;  3ETG A;  4FIP C;  5BR8 B;  3APO A;  3IC7 A;  1XMO O;  2ZM6 B;  4ZKI A;  2WLI A;  4WFA V;  2XT9 A;  1BQ0 A;  2UXB B;  1YCI A;  1CXZ B;  3CP1 A;  3I55 V;  2XAH A;  2ZQM A;  3JAW B;  5EBW C;  4DR3 B;  5IYC O;  1W0J G;  2Y69 B;  2LGQ A;  2WPD G;  3T4D A;  4JI6 B;  4WCE V;  1P4R A;  2Q4P A;  3OMN B;  5CA1 A;  3ETD A;  2WWW A;  1V9P A;  2WLI B;  3ZIA G;  1AI5 A;  4BIU A;  1WJZ A;  2E76 B;  1W59 A;  5H9C A;  5B5E Z;  3OTO B;  2BSK A;  3CS5 A;  3AG2 C;  3FB6 C;  1EM1 A;  1MSD A;  1M57 C;  2WLM A;  4B7K A;  1NH2 B;  3AEI A;  2YSU B;  2GBO A;  3VQY A;  5CA3 A;  3OM3 B;  4B08 A;  4KXR A;  2EUL A;  2AHY A;  3ZMV A;  1IUR A;  2UUC O;  4BIZ A;  2BSK B;  3APQ A;  4FLY A;  1WNS A;  1NQT A;  2JGU A;  2ADP A;  4JV5 O;  1K7D A;  1JPX A;  1MMM A;  2Y4U A;  2GDS A;  4CS2 A;  3FX7 A;  1K73 W;  1WPX A;  3E8H A;  3WG7 C;  2HJF C;  3R66 A;  2VS0 A;  3UM7 A;  3CCQ V;  2LFS A;  3RN4 A;  3KCX A;  4XBF A;  1FJG B;  1P49 A;  4FMT A;  3VBB A;  1GN4 A;  1G8M A;  1S0V A;  1GH6 A;  4DV7 B;  3S3W A;  2F66 C;  4JYA B;  4ZI7 A;  1L0N H;  3G6E V;  2GTS A;  3DGE A;  5DED A;  4DR4 O;  4O4H A;  3LUT B;  2DJV A;  4PD4 F;  2IJI A;  3AG2 B;  1YIT V;  3RBZ A;  2YID A;  3P30 A;  3SPJ A;  4DUZ B;  1H2M A;  1VQN V;  3J80 N;  3RW0 A;  1DTO A;  1IXB A;  1M57 B;  3K0G A;  4PDM A;  1TA8 A;  2L6L A;  3FAV A;  3IGA C;  4LF4 B;  2P6J A;  5DM6 V;  1VF5 B;  4GX5 A;  4JGS A;  2QJ1 A;  3MD0 A;  4ZI7 B;  3A0H Z;  1BE3 H;  2Q5Z A;  4W4L A;  4LF5 B;  3E8F A;  5LXT A;  4DV0 B;  1YDX A;  4O4H B;  4NVP A;  1NT2 B;  4J10 A;  1EZJ A;  4KFM A;  4YHH O;  4AI8 A;  2HHH O;  3H1L H;  4P9P A;  2UUA O;  3BRC A;  1EFR G;  3WG7 B;  5JVD A;  2P7T C;  3ICX A;  1KBH A;  3OD4 A;  4X89 A;  1XNR B;  2YIB D;  2PGG A;  2ZE7 A;  5LXT B;  3B8N A;  2IM9 A;  4GYC B;  4U3J B;  3CCS V;  3ZHR A;  2E5L B;  4LF6 O;  3H01 A;  4F6E A;  2VQF O;  4PA6 A;  4DRX A;  2QM8 A;  1GM9 A;  2CTP A;  3C3S A;  3LDD A;  4RAI A;  3SJB C;  1F4N A;  3E8G A;  4EFE A;  2PI4 A;  5JVD B;  3JAL B;  4NKG B;  2XTA A;  5A9G A;  1B3Q A;  1H38 A;  1G6U A;  5LMN B;  4LH7 A;  3J81 N;  2ZIN A;  2CAZ C;  3ZHQ A;  4Q20 A;  1EZV H;  3JYC A;  4DRX B;  1KC8 W;  4MSW C;  3RYC A;  4NXN B;  3CC4 V;  4JI7 B;  3JAT A;  4H0L B;  4YXW G;  5D5P A;  1JJO A;  3ZHV A;  4DO2 A;  3JCU Z;  4D6T H;  3K5N A;  3PN1 A;  5IY5 C;  3K04 A;  1H2L A;  4PV1 B;  4UVC A;  3JAR A;  1LR1 A;  4ZOL A;  1R6T A;  1EBO A;  3Q4H B;  1CEZ A;  2HVJ C;  3ZHS A;  2JS5 A;  3RYC B;  3O9O A;  1TAE A;  2MK3 A;  4DUY B;  4OGQ B;  3SJQ C;  3JAT B;  3EXA A;  1VAR A;  5IE9 A;  4YJ2 B;  1XL4 A;  2X0L A;  1K34 A;  3KG2 A;  2OCC C;  3OTF A;  3NXS A;  2WA3 A;  1J95 A;  4Q6G A;  3JAR B;  4ZOL B;  1YJW V;  4BIO A;  2BOC C;  3CRM A;  2PYJ A;  3L73 H;  1Y6X A;  2IJK A;  1AI4 A;  4UVA A;  2EX3 A;  3A2F A;  3K5M A;  2YXH A;  3HR0 A;  1Q86 W;  1EN6 A;  1EN4 A;  2W6I G;  1OCZ C;  4K0K O;  1NU1 H;  1QLE C;  1PNM A;  4YJ3 A;  2P22 C;  5BMV A;  1Y76 A;  1AR5 A;  5IY5 B;  1HNX O;  1SZT A;  1K4C C;  4FM0 A;  4DR1 O;  1BZK A;  2Q69 A;  1YTF D;  1ZUQ A;  4B3S O;  1HDJ A;  1ARO P;  5FL7 G;  3L9D A;  1Q90 D;  3ABM C;  2DW4 A;  2OCC B;  2QA4 V;  5BMV B;  4UCT A;  1YTF B;  1J5E O;  2UUC B;  5CA0 A;  3TXQ A;  4I9Q A;  1SS3 A;  4NXM B;  2EZO A;  3ZMT A;  4JV5 B;  1AP6 A;  4DV4 B;  1I94 O;  1NS1 A;  5ITZ A;  4WFE A;  2DWD C;  3B40 A;  4WF9 V;  1BSM A;  1OCZ B;  2BTO A;  2BCC H;  5CA0 B;  1QLE B;  3ZBH A;  1F4M A;  4DR4 B;  5L3B A;  3CCR V;  4JI2 O;  5ITZ B;  5L3F A;  1K4D C;  1R3K C;  1XIL A;  4JAS A;  3I56 V;  3T1Y O;  3ZJZ A;  1RPO A;  1YJ9 V;  3CE2 A;  2XAJ A;  4ZIB A;  3AK1 A;  4FLX A;  3JCZ A;  4J9Y B;  2UXN A;  3CCM V;  2P4K A;  3ABM B;  4KP4 A;  5BR8 O;  4IYH A;  2ZM6 O;  1R3I C;  1NI8 A;  5FNV A;  1MOF A;  2DOS A;  2MW2 B;  2UXB O;  5B66 Z;  4YHH B;  1UPG A;  4DR3 O;  2HHH B;  4FJC C;  5KUK A;  2UUA B;  3K79 A;  3RVY A;  3ZX6 A;  4LFA B;  3ABU A;  1IVS A;  2YIC A;  4X1Y A;  1LNQ A;  4H33 A;  3K57 A;  5FNV B;  4LF7 O;  3CJH A;  3J7A U;  4R6Z A;  4LF6 B;  3GVM A;  3DC5 A;  5JJN B;  3OTO O;  2ZNI A;  2RJZ A;  4PA4 A;  4X1Y B;  3RT3 C;  4MVQ A;  3BAB A;  5BXZ A;  4DV2 B;  1BGY H;  1U96 A;  2Q9L A;  2VWK A;  3B77 A;  4BWA A;  4O4J A;  1CPY A;  4EB6 A;  4JI4 B;  4AQY B;  3CJH B;  1WB8 A;  2NR5 A;  2V7Q G;  1O9H A;  2ZR3 A;  1IX9 A;  2F23 A;  2W6J G;  1AJP A;  1K5Q A;  3HKD A;  4G28 B;  5CBG A;  2JK5 C;  5KHJ A;  3K59 A;  3WB0 A;  4DV6 B;  1HW7 A;  3K5O A;  1SC5 B;  4JTA B;  2JJ1 G;  5EIB C;  3UCS C;  3CYO A;  3JSN A;  4O4J B;  4U7N A;  4EB6 B;  1VQK V;  4FFK A;  3GWK C;  1FJG O;  3K08 A;  3G67 A;  5LOV A;  2EIL C;  4DV3 B;  5LHI A;  1KYO F;  4DV7 O;  4ZBM A;  4JYA O;  1H8E G;  1YJN V;  3HKD B;  4FZ1 A;  3LSU A;  1FPO A;  1COW G;  1US6 A;  4X8A A;  2WLN A;  2CK3 G;  4QPK A;  2Y0I A;  3ZRW A;  3CCE V;  3T1C A;  5GON B;  4MS2 A;  2IU3 A;  3FKS G;  3IFX A;  4CH6 A;  3BEH A;  5KMG A;  5LOV B;  2G38 A;  4LF4 O;  1IDS A;  1VQ7 V;  3NR7 A;  3MHH C;  4LF5 O;  1VQM V;  2EBO A;  1Q7Y W;  5KUM A;  4DV0 O;  3OUF A;  2R9R B;  4J42 A;  5EIB D;  1UJW B;  3RFR A;  3ZRW B;  4JPR A;  3ZRS A;  3CCU V;  2LJ2 A;  3KKY A;  2H3O A;  2CTW A;  5DN6 G;  4K0K B;  1S77 D;  5KMG B;  1W0K G;  2LW7 A;  3E22 A;  1BHA A;  4GX2 A;  5E79 Z;  2B5U A;  5K1P A;  2L35 A;  2A3Q A;  3K58 A;  4JYY A;  1QBZ A;  1DLB A;  3CHX A;  4XDK A;  1HNX B;  1GKF A;  2EIL B;  2F4V B;  2A06 H;  4J11 A;  4RQF A;  2KG7 A;  4LFB B;  2JJ2 G;  3TJT A;  2E5L O;  3BY6 A;  4JI3 B;  4B3S B;  1MAB G;  3SYC A;  3F5W C;  3ASO C;  4X65 O;  1DF4 A;  2M7W A;  2EIN C;  2ZDI C;  3E22 B;  5EBM C;  2W0X A;  2R9I A;  1R6N A;  1WP8 A;  4TQF A;  5LMN O;  2V4D A;  1J5E B;  4PA3 A;  3SPH A;  1IBL B;  1XBL A;  3H9V A;  3BVO A;  3DTU B;  2KG7 B;  2QGN A;  4PA7 A;  3E35 A;  3D36 C;  1OHH G;  1FFT B;  4X66 B;  1I94 B;  1O9G A;  4LP8 A;  2YI8 A;  1R3J C;  1OJH A;  4O4L A;  2QTO A;  2XAS A;  2ILM A;  2QE7 G;  4MVS A;  4MTX A;  4UCU A;  4JI7 O;  1NJI W;  4B3M B;  4X20 B;  3W7S A;  1VP7 A;  1AJN A;  1Q82 W;  2QWN B;  2LP7 A;  4ABM A;  2KSD A;  4JZ2 A;  4QJF B;  3WFV A;  1XEQ A;  1AI7 A;  4TSF G;  3L70 H;  5B1N A;  2ZIM A;  1OCC C;  1FAF A;  4DR7 B;  3M8A A;  3D36 A;  1VMG A;  4FLW A;  3A0R A;  1M9N A;  1XUQ A;  3H1I H;  1B04 A;  3ASO B;  1YIJ V;  2EIN B;  4U7O A;  1F51 A;  3CCV V;  1OCO C;  4J7Z A;  1THZ A;  4PDR A;  5J2T A;  2WLK A;  1OZ0 A;  1ZTE A;  1RSO A;  4F4L A;  2OT5 A;  2D2C B;  2OCH A;  5J2U A;  1KU9 A;  5BZB A;  3OW2 U;  4PEL A;  5CB4 B;  1S5J A;  3D8C A;  3M99 B;  4L87 A;  4CH4 A;  3VQW A;  4HNA A;  1PD3 A;  2CGN A;  3RYH A;  3AG3 C;  1FXK C;  4LF7 B;  1RSO B;  4E2L A;  3W7U A;  3SJA C;  5J2U B;  1NH2 D;  5H6Q A;  2NNU A;  3CX5 F;  1OCC B;  2R70 A;  4HNA B;  3ML0 A;  4C7U A;  5CA1 B;  3RYH B;  3W7W A;  2QKA A;  3T4Z A;  3A8T A;  2XHB A;  1RFY A;  1OCO B;  1K3E A;  2QWQ B;  1MA1 A;  5LMU O;  2ATK C;  3OAA G;  3UO2 A;  1AB3 A;  1FXK A;  3CXH F;  3L74 H;  4DW1 A;  2ARH A;  3E83 A;  4TT3 G;  3QF7 A;  1VIB A;  2IJJ A;  4MVR A;  1SQV H;  3QVN A;  4P9O A;  4R7C A;  4NXM O;  1R6K A;  1YSC A;  5KHK A;  4DV4 O;  2BTQ A;  4NYK A;  2FTK A;  4UCV A;  4FZ0 A;  4R8C A;  3G80 A;  1H8H G;  1PNK A;  3GB7 C;  1KMI Z;  3CB2 A;  3AG3 B;  2CH7 A;  1FXK B;  3H1H H;  1YVW A;  2KKW A;  1RM1 C;  1PKX A;  1WP7 A;  3BHP A;  3CEI A;  2BTQ B;  4NTW A;  3OEH G;  3SGI A;  1I0H A;  3W7T A;  1Q6U A;  4GKJ O;  3AK3 A;  4PDV A;  2FYU H;  2CH7 B;  4X64 O;  2Z3Y A;  1H2S B;  2DE0 X;  2W0F C;  4KHP B;  4CC5 A;  4G27 B;  4ASU G;  2Y48 A;  5IWA B;  5C8Y A;  1VQ9 V;  1OV9 A;  1IBK B; 
#chains in the Genus database with same CATH homology
 3T1H O;  4LF6 O;  5FLX N;  2Z0A A;  2VQF O;  1HNX O;  2LW7 A;  4OPA A;  2VQE O;  1YZB A;  4LF7 O;  4DR1 O;  3J7A U;  3SDL A;  2UUB O;  4KHP O;  4LFA O;  3OTO O;  4B3S O;  5IWA O;  4GKK O;  4YY3 O;  3J81 N;  4X62 O;  1IBK O;  2UUC O;  2E5L O;  3RT3 C;  4DR2 O;  1R1B A;  5BXZ A;  3JAM N;  1J5E O;  4X65 O;  4JV5 O;  4NXN O;  1N36 O;  3F5T A;  1A32 A;  1X59 A;  4OX9 O;  2F4V O;  5LMN O;  4DR6 O;  4LFB O;  2ZKO A;  3R66 A;  1D2D A;  2N74 A;  1DK1 A;  2AGA A;  1HNZ O;  4JI0 O;  4JI3 O;  2UXD O;  1I94 O;  5BY1 A;  4DR5 O;  4B3R O;  5LMU O;  1NS1 A;  4DV2 O;  1AB3 A;  5LL6 Y;  4JI4 O;  3O65 A;  1G1X B;  4AQY O;  4DUZ O;  1FYJ A;  4OPH A;  4DR4 O;  4DUY O;  1N32 O;  4NXM O;  2DJV A;  1R6T A;  1IBL O;  2JRI A;  4DV5 O;  4JI7 O;  4DV4 O;  1KUQ A;  1FJG O;  1XNQ O;  1XMO O;  4LFC O;  3J80 N;  4JI1 O;  4DV7 O;  2UXC O;  4LF8 O;  4JI2 O;  4JYA O;  4X66 O;  4DV6 O;  3T1Y O;  1F7Y A;  4JI6 O;  1XEQ A;  2UU9 O;  4JI5 O;  3M8A A;  4DV1 O;  4B3M O;  5BR8 O;  4LF9 O;  5A2Q N;  1XMQ O;  4DV3 O;  5H5N A;  1AIL A;  2ZM6 O;  4YHH O;  4LF4 O;  2HHH O;  1HNW O;  1XNR O;  2FKX A;  1IBM O;  4A5U B;  2UUA O;  4B3T O;  2DOS A;  4GKJ O;  2UXB O;  1HR0 O;  4LF5 O;  4X64 O;  4DR3 O;  4DV0 O;  4DR7 O;  1N34 O;  4K0K O;  5IT9 N;  4JI8 O;  1N33 O;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...