2DJVA

Solution structures of the whep-trs domain of human methionyl-trna synthetase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Methionyl-tRNA synthetase
publication title Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase
rcsb
source organism Homo sapiens
total genus 20
structure length 79
sequence length 79
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2djvA00
4DR7O 1FJGO 1IBMO 4AQYO 3O65A 3J80N 3J81N 3OTOO 4B3TO 2Z0AA 1XEQA 1I94O 4NXNO 4K0KO 5LMNO 4LFBO 1X59A 2FKXA 1XMOO 3JAMN 2UUBO 5H5NA 4JYAO 2AGAA 4X66O 1D2DA 4YY3O 4LF6O 5BXZA 3SDLA 4B3SO 1N34O 4LF9O 1FYJA 4X65O 4DUYO 4JI7O 2DOSA 4DV3O 4DUZO 1NS1A 4DV7O 4DV4O 4LF5O 3T1HO 4X64O 2HHHO 5FLXN 2UU9O 1R6TA 4JI4O 4JI5O 4NXMO 1XNQO 1N33O 1AB3A 1FKAO 1KUQA 2UXCO 2F4VO 4JI0O 4JI2O 4JI8O 2UXBO 4DV6O 4LFCO 2ZKOA 3F5TA 4DV5O 1J5EO 4LF4O 5LMUO 4YHHO 1N36O 3RT3C 3R66A 4X62O 1XMQO 2UUAO 1XNRO 1IBLO 1YZBA 2DJVA 4OPAA 4JI6O 4LF8O 2LW7A 4JI3O 3M8AA 1HR0O 5IT9N 4DV0O 4DV1O 2E5LO 2JRIA 1A32A 5IWAO 5BY1A 4DR2O 2VQFO 1HNXO 4DR3O 4DR6O 4KHPO 4DR4O 1DK1A 1HNZO 4LF7O 1G1XB 1HNWO 1N32O 3J7AU 4JV5O 2ZM6O 5BR8O 3T1YO 2N74A 1IBKO 2UUCO 5LL6Y 4DV2O 4DR1O 4JI1O 1F7YA 4A5UB 4DR5O 4GKJO 4GKKO 4LFAO 2UXDO 5A2QN 4OX9O 4B3RO 4OPHA 2VQEO 1AILA 4B3MO 1R1BA
chains in the Genus database with same CATH superfamily
2CAZC 1PM9A 2QM4A 1XILA 3IC9A 5AG2A 3ABMB 4FIPC 1YF2A 4NXNO 4LFBO 5LMNO 4LF9B 5LXTB 1VQ7V 1S77D 2G38A 4GX5A 3T1HB 2JIZG 4RWUA 2E74B 4MVUA 2UXNA 3OMAB 2EIMB 3GVMA 2ZIOA 2BOCC 3HB3B 2WLLB 1Q90D 3DXRB 4LR3A 1K4CC 1L1FA 1H8HG 4JI4O 1F51A 1QNMA 2R9RB 1IZ3A 1LR1A 1KUQA 3TGUH 4YJ3B 1SKVA 1BSMA 3Q4HB 3K9AA 2JGDB 1P49A 4JI8O 1Q5OA 3ZHQA 1B6QA 1PNMA 2GV9A 2HEPA 4WFEA 1YJ9V 3CCSV 3OGCC 5LYJB 4YHHO 4X62O 1XNRO 3K06A 4UVAA 4LNUB 3RGBA 2R9AA 2VWKA 5IYZA 2P7TC 5EIBC 3CEIA 3OUFA 1GRJA 5IYDO 4W4LA 2QKCA 4I50B 5GTIZ 4DR4O 1G1XB 1UFIA 1QCEA 2Y4UA 3STZC 1N0JA 4I0XB 1AI7A 3CRCA 5L3GA 4X1IA 1EM1A 2IBZH 1ROPA 4QJFB 1SF9A 4PI2A 2YEVA 2UUBB 3I55V 2P06A 4B3MO 1AR1B 3ZEDA 3J81N 5KAIZ 4YY3B 2XAQA 4J11A 4B3SB 1VMGA 5TISZ 3B09A 1TUEB 5L3EA 4O2BA 1VQ8V 4UVBA 3E8FA 3B8NA 4FM0A 2Q9LA 1Q43A 1MSDA 2ATKC 4GX2A 2DE0X 1EN5A 4X66O 1SA0B 4LP8A 4CS3A 1MNGA 3JSNA 2ADPA 1YTFD 2CTPA 1MABG 3TXSA 2N04A 3K79A 3LSSA 1NI8A 3BFRA 4DR6B 4WCEV 2QWOB 3OE7G 4JTCB 4K35A 1PKXA 5LMUB 2Q4PA 1N33O 1Q7YW 4UXNA 5LGUA 3FAVA 1NU1H 3G67A 5E79Z 2XHBA 4DK1A 1V55B 1H2KA 4LFCO 3H1KH 1S5LZ 3OEHG 1NZ6A 1US6A 4X1IB 3ZMSA 3L75H 1K73W 4JI3O 4ZIBA 1HP8A 4U3JB 3CCLV 2V7QG 2YXHA 1FPOA 4GKKB 5H6RA 3A0BZ 4RQFA 4ASUG 4FLYA 2QA4V 1EBOA 2W6IG 3OFNG 1VF6C 1XREA 4UCUA 1FXHA 4O2BB 4DR1O 1GM9A 2ITCC 1U96A 1WP7A 2Z3YA 3K5MA 4A5UB 4CH4A 5B1NA 4FM1A 2VWJA 1YIJV 1Y4MA 5FPRA 3WB1A 3BABA 4JYAB 2AHYA 4CH3A 4I7ZB 2ARHA 1M5IA 5B1BC 4UCTA 1NVPD 4J9YB 2XTAA 1I94O 2QE7G 4MVQA 2QDOA 2AZ2A 2XAGA 5JH7A 1EFRG 1AI6A 5CA1A 3JAWA 4GLXA 4LF6O 5KMGA 3CJHA 2LO1A 1H2GA 2GTAA 2PI4A 3FB8C 4DV7O 4X64O 1YDXA 2JJ1G 2WLIB 2GDSA 4NXMO 1XNQO 1IBLB 4DV0B 2YS8A 1Q6UA 1K97A 3G71V 1WP8A 4O4IA 4FMTA 1WPXA 1GN6A 4DR2B 2FMLA 3OGIB 4J7ZA 1HNZB 2AZ0A 1XMQO 4LF8O 3M8AA 1HR0O 1VQLV 4H44B 3W7XA 2JRIA 1GN4A 3SJBC 3JARB 4TUYB 1YSCA 1S0VA 3X2QC 3JSLA 3WB0A 1I0HA 2ZM6O 4BIOA 4KL1A 3E86A 3I5DA 1AR4A 5LL6Y 4O2AA 4JI1O 1SC5B 1FFXA 1G6UA 3WB2A 4G27B 4LC1A 1FXKB 1HWYA 4D6TH 4OGQB 1H8EG 2WSSG 4MVRA 3JD2A 4I5SA 3CJHB 3K08A 2LFRA 4WBNA 4FVMA 1N34B 1AP6A 2X6BA 3L71H 3D36C 3S3WA 1WA8B 2ZNJA 1F23A 3K3WA 3UQ8A 3H9VA 1DF4A 4DV4B 4U7OA 2BOBC 3HKEA 4LH7A 4FLTA 2YI9A 2AGAA 1NTMH 2UU9B 5J2TA 3RYCB 5IYCO 3DC5A 2QKSA 3OR7C 4AI8A 1EZVH 4X65O 2YDEA 1R3JC 1RPOA 4DV3O 4I4TB 5EZYA 3ZMVA 2LGQA 4UFZA 4DV6B 4F6EA 3EFFK 2OTJV 2LW1A 1IVSA 1IXBA 2WLJA 2OTLV 1S5JA 1V54B 1KC8W 3K58A 4JI6B 3HKBA 2EIJC 1AI5A 4LWSA 2EBOA 3JD4A 1KKDA 2VQFB 4LBEC 4FLVA 3IJ4A 4O4JA 3FKSG 2P5OA 2DWEC 4Z1VA 1NTKH 3UT5A 1PNKA 2ZNIA 1SESA 2A9HA 4MW8A 3FD9A 2E5LO 2ZD9A 4P9PA 4XDLA 3OUSA 4TQDA 3UKMA 2DMXA 5IWAO 2UXDB 2RMKB 4Q6GA 1K8AW 5H9CA 4MTOA 1OV9A 3BA8A 4PA6A 1GH6A 3L74H 1OZ0A 3OMNB 2XAFA 3U10A 1AVMA 3ZMTA 4MTGA 4TSFG 3OTOB 4FJCC 1KP3A 3UM7A 3AG4B 2BSKA 5C93A 3P3NA 1CEZA 3AK3A 4FM2A 4E4EA 4BAYA 1XNQB 1YJNV 2ZDIC 2IJIA 5LOVB 4DR7O 1VF5B 2EJRA 1IBMO 4AQYO 2A3QA 4FFBB 1IDSA 1JFFA 5JQGB 2ZE7A 3CCQV 2LGWA 4WFHA 4ZOLA 1X59A 5CB4B 4MTXA 1R73A 2IM9A 2QKAA 4CH5A 3FFQA 3KKYA 2WLKA 5L3CA 2XASA 4I55B 1QQCA 4GT1A 4LWSB 5FL7G 2UXCB 2Q67A 3OT7A 4ZI7A 4DO2A 2B1IA 1Q6HA 4X20B 3B2EE 5CBHA 5JVDA 2HHHO 3UT5B 3WU2Z 4CZZA 2ZCEA 4CH6A 5IE9A 4BW5A 1Q82W 4X1YB 3HKCB 3SYAA 1I5YA 1OCOC 3L70H 4N23A 2PGGA 1N0NA 1OCOB 4DV5O 4J9ZB 2M7WA 2QGNA 4JV5B 1Y67A 4CC6A 3CCEV 1AR5A 3RYHA 2YIBA 3AG2B 2Z5UA 4DV2B 1KP2A 2BSKB 2HVKC 2Q7GA 1GTOA 4DR5B 3CCRV 5BY1A 4YJ2A 2IJHA 4PDLA 4KHPO 4XDJA 5GONA 4TV9A 1XI1A 2XOKG 1ZUQA 3EHBB 3G6EV 4B3TB 4PELA 1P84F 1DF5A 4RAIA 4FK5C 1QR9A 1BMFG 2RN9A 4B3RO 1QVGU 2BCCH 2Q68A 3N2GB 4UVCA 4DK0A 2WWWA 4JZGA 2RDCA 1RM1C 1P7GA 1GKFA 3LSUA 5CA0B 3ZN0A 3A0RA 4TV8B 2LJ2A 5JVDB 3GWOA 2IJJA 5DECA 1GO3F 2JEUA 4GZRB 2DYRC 5KX5B 2D3OW 3SDLA 4XDKA 2CH7B 2OWOA 3ZX6A 3ABKB 3ABMC 3CCUV 5A9GA 1OCRC 3FB5C 2CUGA 1SQXH 3CRQA 1OCRB 2HG5C 1ZTEA 3FYEB 4HAMA 1VQPV 2F93B 5KUKA 3NR7A 2WA4A 1N36B 1U97A 1GN2A 1AB3A 2X0LA 1NKDA 1FKAO 3ZHVA 1ZAUA 1MOFA 4P2ZA 3K0GA 2VS0A 4GYCB 2ZR2A 1M4UA 2EIMC 2CGOA 1I08A 3ASOB 2LP7A 2ETNA 2VRZA 2YSUB 3LNNA 3K5NA 4DR3B 1QLEB 3F7YC 1GK9A 1VQNV 4FPPA 4PA7A 3K5LA 3VQYA 1H2SB 3ZMUA 4AHCA 3T1YB 1GM7A 1VQ5V 1JMKC 3D3IA 5EBLC 2M6YA 2H94A 5BMVB 3ABTA 1HNXO 2EILB 2P22C 1HDJA 4U7NA 3J7AU 1JPXA 2WLMA 1EN4A 3ZHUA 5BR8O 5DN6G 2P67A 2YIAA 3CX5F 2EZOA 2YIDA 3RYIB 1F7YA 4GX1A 1AP5A 4H0LB 3K5OA 3JD1A 1B04A 3E8GA 4HNAA 3M7MX 2X6CA 2F23A 2R72A 1FJGO 1BL8A 4BR6A 2CE4A 1SQFA 3S3XA 3C3SA 5KHKA 1DGSA 3QVNA 4DUYB 2FKXA 1PL4A 1SQBH 1URFA 4LF5B 1KBHA 1D2DA 3CSXA 4B7KA 3OW2U 1XQ8A 5KAFZ 3ICXA 5EYPA 2A06H 2ITDC 4JI7O 4BIUA 4JI0B 4YIPA 3CHXA 4DUZO 1NS1A 4X88A 3E89A 1J5EB 4LF4B 4JI5O 4X89A 1YI2V 3HR0A 1G4YB 1KD1W 3CXCU 2KB1A 1ZL8A 1TAEA 2AHZA 1VF6A 3HKDA 1K92A 1B3QA 2B5UA 1WNSA 4XBFA 2OIEA 3CC4V 2X7RB 2HJDA 4DW1A 4O4HA 4R50A 1Q86W 1SRYA 3UCSC 1HNWB 1N32B 4CC5A 3JYCA 4GUNA 4JTDB 2CTRA 4DV1O 3OMIB 1OHHG 5IYZB 3MD0A 1UPGA 4LFAB 3W7SA 4OXSA 4D7TA 4OX9B 1V55C 5JJNB 5B3SB 5LA6A 3H1IH 4JAAA 2FL4A 4NXNB 4LFBB 2NR5A 5LMNB 3BEHA 1BCCH 2Q5ZA 3U0ZA 2RNBA 2XAHA 1WLEA 1SQQH 3MAQA 2VQEO 1GAXA 3AK2A 1OCCB 2YEVB 3G6BA 3BAAA 5JJEB 2OIGA 1L8DA 3L73H 1JJ2U 3E22A 4RUEA 1S3JA 2H8PC 3CMEV 5KHIA 4JZ2A 1VF7A 1XMOO 3CP1A 3F5WC 4MS2A 3RYFA 4JYCA 2MK3A 3R65A 1BHAA 1K3EA 5B66Z 1MG1A 4JI4B 5IDJA 1JVMA 2JS5A 5FNVA 2HVJC 4J41A 4TOIA 3HKDB 1THZA 1IURA 1K9MW 1WB8A 2DWDC 4JI8B 5FPOA 3KCXA 2NLJC 5C8YA 4YHHB 4X62B 1XNRB 2F95B 1BE3H 3B4SA 5HFMA 3A8TA 3FAVB 2WPDG 3N2KA 4JI2O 4LCUC 2UXBO 2PI5A 3JAKA 4NB5A 1K5SA 2OCHA 3U11A 3K04A 4DR4B 3LSQA 5D5QA 3RT3C 4IYHA 2UUAO 1SZTA 4QIWF 3RVYA 2DJVA 2GSMB 3L72H 1K34A 4FZ1A 2PF4E 2UXXA 5L3BA 3VQXA 2YC0A 3QO7A 4JYYA 1X4TA 3CD6V 4B3MB 4UB6Z 3D36A 1NH2B 2WLNA 4UUJC 5KLVH 2UUCO 1DTOA 4NKGB 3QF7A 4K8XA 2XAJA 4GKJO 5H2FZ 1VQ6V 1ENVA 3K9SA 2Y69B 1SETA 2KG7A 1E1RG 4IHJA 4X66B 2KQXA 1PPJH 3C90A 1PNLA 1WPBA 3EVKA 4UV9A 3L9DA 3K03A 1Y6XA 1FXKC 1DLBA 2H3OA 3T4ZA 5JH7B 1AJPA 3W7WA 5LP6A 2CDYA 4X1KA 5CA1B 1VQKV 3JAWB 5KMGB 2MW2B 1N33B 2WAMA 5KA6A 1K33A 5H6QA 2E3CA 3N2KB 2P90A 1W2BU 1L0NH 5CA3A 1BQZA 2QR4A 1EN6A 4RUFA 1YHQV 1XHZA 4LFCB 1MZEA 4DYLA 1HW7A 4ZBMA 5IY5C 5LHHA 1AJNA 3VQWA 1B06A 5IY5B 3TJTA 1IXMA 3A0HZ 5GTHZ 4IL6Z 3AG3B 4JI3B 4EFBA 1H38A 1JCHA 2R70A 3SPHA 2F4VO 3H1JH 4QPJA 1LNQA 1Z5VA 2GUZA 1F4MA 4MVZA 4O4IB 2ZKOA 3ETQA 3ZJZA 1PP9H 3TK1A 2QM7A 3AEIA 1V54C 5L3DA 1H2LA 2JEXA 4DR1B 1VQ4V 3E8BA 5F2VO 1Z5WA 2ZDIA 3GWKC 4NTWA 1R3IC 3E35A 1K7DA 1VIBA 4LF7O 4J10A 1CXZB 3LDCA 4MVOA 3RN4A 2GHYA 2HR3A 4DW0A 1D5AA 2A0LA 1IBKO 1R3LC 1I94B 5J2UA 2OCCB 1MMMA 4O2AB 3CCMV 1S76D 4PV1B 5LGTA 1FFXB 2W0XA 1YJWV 5JJJB 5LP6B 3ASNB 2Q0AA 5ITZA 2ZE6A 3DTUB 1G8MA 4LF6B 1D5NA 1JR9A 2Z0AA 1FS0G 4JI2B 3CC7V 4WBNB 5JCOC 3RFRA 3W7TA 1P7BA 2ADQB 3O9OA 3AG4C 5DEDA 3JAMN 4DV7B 2GBOA 3JALA 4X64B 2Q8VA 5KHGA 4WFAV 3HKEB 5BXZA 4PA3A 3ZBHA 2XUMA 4NXMB 2V1DA 3IFXA 4PA9A 4LF9O 4NR1A 5J2TB 2KKWA 2XT9A 3WFVA 2HJFC 3RWRD 4R6ZA 3SPJA 1FD9A 5EZYB 3T1HO 4E2LA 3ML0A 4K3AA 1R6TA 3CMAV 3ZCCA 1Y66A 4PJ0Z 4UCRA 1XMQB 3JATA 4LF8B 1HR0B 4U3FH 1QVFU 4DXWA 3HKBB 3P3PA 2DQ0A 3ZRXA 5EBWC 2DQ3A 1NBMG 4DRXA 2EZPA 4FLXA 2FB5A 2EIKC 5EC2C 4C7UA 3PN1A 3ABUA 5KA5A 2EIKB 2ZM6B 4O4JB 1MSWD 5J2UB 4FZ0A 4JI1B 4F6RA 1JQ0A 2EULA 1IX9A 1TUBA 2QWPB 5ITZB 5CMUA 4EKWA 1YITV 1S72V 4IGGA 2ZE5A 2BTOA 1H2MA 3GB7C 2CGNA 3AG2C 3E83A 2EJ7A 4QGPA 2HFEC 1OCZC 2XNDG 4KP4A 1Q81W 1OCZB 4EFEA 3O65A 4PHZA 4TT3G 3AG1B 1NTZH 5LXTA 1AI4A 2EX3A 1JFFB 4X65B 1ZSPA 1VQMV 4ZOLB 2Y0IA 4DV3B 3QNEA 2UUBO 4YXWG 1WN7A 4Q20A 3ABLB 3RVZA 3K0DA 3BCCH 4YY3O 1E1QG 3F7VC 4B3SO 3SPIA 4Z2WA 1FYJA 2JVDA 1WB7A 4EEQA 3MHHC 5HFLA 4DRXB 3CCJV 3STLC 3ZN1A 2WLLA 5B1OA 3LDDA 1M9NA 4ZI7B 4TWKA 1XHXA 3TXQA 3ETGA 3T2MA 1TVKA 4YJ3A 2QTSA 1K4DC 3Q4HA 4ZKIA 2OYQA 2N05A 3ABKC 1KB9F 2E5LB 1JOYA 4JPRA 5IWAB 3K59A 3JCUZ 5LYJA 5KHHA 3CRAA 1NT2B 5LMUO 2HLDG 4LNUA 3R66A 2B9ZA 3FYIB 4J7KA 2K1EA 1FAFA 2Y0PA 5IT9N 3CWBH 2IH1C 3RYHB 4QPKA 5BZBA 4I50A 2D2CB 4I9QA 1COWG 4GCZA 4YJ2B 3ASOC 4I0XA 2IH3C 1Y76A 2PY5A 4DR7B 4HYOA 5GONB 1QLEC 4TV9B 4AQYB 1IBMB 2RCVA 3KG2A 5JWPA 1Y74A 1N8RW 1SQPH 1BHBA 4PDRA 1NJIW 4GKKO 3OTFA 3D8CA 4X9QA 3TETA 3A2FA 1AILA 2EILC 4JAVA 4JTAB 1PV0A 1VQ9V 2L35A 4PI0A 4K0KO 3RW0A 5B5EZ 4MTFA 1EZJA 3ZHSA 3SYCA 4JYAO 4J7JA 1SA0A 1QHTA 1AJQA 1TVKB 3LUTB 2V4DA 2HHHB 4H13B 1AROP 3C3TA 3OAAG 1TGOA 4NTXA 5IJ9A 2AW9A 4DV5B 4MT8A 3BA9A 1SZXA 3BVOA 5K1PA 1R3KC 1I5XA 1SQVH 4L8JA 2Q73A 2NN4A 2NNUA 1Y76B 3F5TA 4H37A 4KHPB 3DGEA 1IBLO 4U3JA 1Y74B 1YZBA 2FYUH 4DV0O 1ZX3A 1A32A 1NR7A 4DR2O 4O4LA 1TA8A 5L3FA 4B3RB 1HNZO 3SPCA 1KKCA 2EINC 2EINB 2ZINA 3CXHF 1J95A 2WA3A 2F66C 4R8CA 2A7WA 1F4NA 4GX0A 2ZE8A 5GW7A 3I56V 4PD4F 3CS5A 2CTQA 5KUMA 4HNAB 1VARA 3IAYA 1Q6IA 3BRCA 5B3SC 4KFMA 4RQEA 4UB8Z 4EB6A 4MVSA 1BS3A 3CB2A 1LUVA 4N21A 1NH2D 1M93A 1BT8A 4RO2A 5IJ9B 5J9PC 5H5NA 2QTOA 1Z2GA 3ZRSA 3UO2A 3E2EA 3SYOA 1YXBA 4CS4A 3OEEG 1OCCC 1Q3EA 1ORQC 1N34O 3E8HA 1YCIA 4LH6A 3ZMZA 5EYPB 1WJZA 3H01A 4DV4O 1KYOF 2JJ2G 4NVPA 4WFFA 2B1GA 3NXSA 2WLIA 2HKOA 4H33A 2AXTZ 2UU9O 3QTCA 1LUWA 2F43G 4BW9A 4TQFA 3B40A 1RFYA 2JDIG 4D7SA 1YVWA 1XL6A 4PA4A 4O4LB 3SR2C 1O9GA 5LHGA 1ZL8B 4DV6O 3CYOA 1HNXB 1MA1A 3EXAA 4FLWA 1JA8A 2DN9A 4O4HB 4K0KB 3MHSC 1R6NA 4JI6O 1M1KW 5BR8B 2IU0A 3UO3A 3CRMA 3ZS8C 3JARA 1VP7A 4TUYA 1GMGA 5EC1C 4J42A 2Q69A 4IT5A 2VQFO 3JD3A 5LBQA 4ICGA 5B1BB 4EB6B 3ZIAG 1FJGB 1XUQA 5LA6B 1ZLZA 4HBNA 1FXKA 5IYBO 4FLZA 4Z1MG 3CC2V 2UXDO 1E79G 2O57A 1OJHA 1XOUA 4UV8A 4OPHA 3H1HH 4QE7A 3AG7A 1YTFB 1KMIZ 3J80N 1ZWIC 3OTOO 2QWNB 2PYJA 4X8AA 1WA8A 3E22B 2Q6AA 4JI7B 4JF3A 2L6LA 4DUZB 2E76B 1SQGA 2Y69C 5E1AC 3RYCA 3RYFB 3MDSA 3KZIZ 4P30A 4JI5B 3PJSK 3SJCC 3ETDA 4UCOA 3VBBA 1KQSU 2DW4A 1YEWA 3B8MA 4IIJA 5FNVB 4I4TA 2QWRB 3G4SV 4KXRA 1M90W 4KUMA 4JAUA 1NR1A 2QWQB 3ZRVA 1W0KG 2OT5A 4W4KA 5C8YB 2UXCO 2QSAA 2JGUA 3M99B 4J80A 4DV1B 2ZXWC 3SYPA 3X2QB 1QLNA 4JASA 5IJ0A 1H2NA 1SS3A 2ZXWB 3OM3B 1NQTA 3T4DA 1XDCA 3JAKB 3JASA 1QU7A 5LGNA 3KCYA 2RQ6A 4OPAA 4L87A 3P30A 1XBLA 2C2AA 4ABMA 1Q8IA 2JS3A 3AG3C 5KHJA 3VQVA 1CP9A 4JYBA 3VOUA 3B77A 4FLUA 2VQEB 1RSOA 1GM8A 4R7CA 2IU3A 1NVPB 4JV5O 3SYQA 4IYIA 5JCOA 2W6JG 1CPYA 4B7EA 4CBCA 3K57A 4DV2O 5D5PA 5B1AC 2IJKA 3FB7C 4DR5O 2YUAA 5B1AB 2P4KA 3CE2A 1XMOB 5LOVA 2JK5C 2E75B 1PL0A 3APOA 3TCUA 2KG7B 3QG5A 4FFBA 2CTWA 4K8ZA 2BE3A 4I9WA 1W0JG 4IIJB 3HPLC 4IHJB 5JQGA 4B3TO 1FXVA 1M57C 1XEQA 2Q7EA 5CB4A 1M57B 1M56C 2Q7HA 2OCCC 3G80A 1M56B 2IW5A 3SPGA 2K9PA 4I55A 3QO5A 4MVMA 5LP6C 1RP3B 3ASNC 4PDVA 2EIJB 3W7UA 2Y4TA 4UCSA 3IC7A 1MZFA 4X1KB 1VEWA 2ILMA 4MW3A 2LQTA 5IJ0B 4X20A 1UJWB 3SJAC 2UXBB 3JASB 1BZKA 2R9IA 4BIZA 3DSQA 3T1CA 2ZR3A 4X1YA 2UUAB 1KU9A 3HKCA 5CBGA 1V9PA 1T5EA 4CS2A 4P9OA 2ZT9B 1RPRA 3CPWU 1RSOB 2GUZB 5CBFA 4AILC 1N36O 3FB6C 5CN0A 3ETEA 2LW7A 1R6KA 1VQOV 2FTKA 3QO8A 4NYKA 2UUCB 3RBZA 3FX7A 3WG7C 4GKJB 3BPZA 3WG7B 2ZIMA 4DR3O 4YIOA 1I7FA 3SJQC 3JCZA 2ODMA 3BY6A 3T1YO 2N74A 4FFKA 4ZHQA 2BTQA 1XL4A 4QE9A 3N2GA 2YIBD 3SGIA 1WAZA 1L0LH 1BQ0A 2A79B 2F1MA 3CRRA 4MSWC 5DM6V 2YI8A 2PTMA 5LHIA 2CK3G 5EK0A 5CA0A 2HP8A 2Q0OC 4TV8A 3ZRWA 1FFTB 4QNHB 3LDEA 5KX5A 1S5HC 2CH7A 3AK1A 3APQA 3JALB 2RJZA 2QM8A 2P6JA 4WFGA 3AG1C 1BGYH 1JX9A 2YXYA 4DUYO 2DOSA 2F4VB 1QR8A 5K1XA 4BWAA 2LFSA 2Y48A 1K5QA 2YXLA 3ZHRA 2PYLA 4LF5O 4JGSA 3JD0A 4WF9V 5FLXN 4NTYA 3ABLC 2W0FC 1KECA 3BHPA 2QJ1A 2KSDA 2P4VA 2QEXV 4F4LA 3P32A 1SERA 3JATB 1W59A 1PD3A 4JI0O 5EBMC 4G2KA 3LNMB 4HZ3A 1O9HA 1J5EO 1JJOA 4LF7B 4LF4O 3DXRA 1QBZA 4ZHQB 2BTQB 1GN3A 4B08A 4UCVA 1IBKB 5EIBD 5BMVA 2PZSA 3OR6C 2GTSA 2ZQMA 3N27A 3OD4A 2DYSC 4F6RB 2JGDA 4WFBV 4DR6O 1N4CA 1DK1A 2DYSB 2X6AA 1P4RA 3THOA 1HNWO 1TUBB 2PUSA 1N32O 4PDMA 3RYIA 3DC6A 1RM1B 2WLHA 4G28B 3ZHTA 4LFAO 3ZRWB 5A2QN 4OX9O 2DYRB 3H1LH 3CCVV 3D3QA 2YICA 3IGAC 1R1BA
chains in the Genus database with same CATH topology
4DR7O 1FJGO 1IBMO 4AQYO 3O65A 3J80N 3J81N 3OTOO 4B3TO 2Z0AA 1XEQA 1I94O 4NXNO 4K0KO 5LMNO 4LFBO 1X59A 2FKXA 1XMOO 3JAMN 2UUBO 5H5NA 4JYAO 2AGAA 4X66O 1D2DA 4YY3O 4LF6O 5BXZA 3SDLA 4B3SO 1N34O 4LF9O 1FYJA 4X65O 4DUYO 4JI7O 2DOSA 4DV3O 4DUZO 1NS1A 4DV7O 4DV4O 4LF5O 3T1HO 4X64O 2HHHO 5FLXN 2UU9O 1R6TA 4JI4O 4JI5O 4NXMO 1XNQO 1N33O 1AB3A 1FKAO 1KUQA 2UXCO 2F4VO 4JI0O 4JI2O 4JI8O 2UXBO 4DV6O 4LFCO 2ZKOA 3F5TA 4DV5O 1J5EO 4LF4O 5LMUO 4YHHO 1N36O 3RT3C 3R66A 4X62O 1XMQO 2UUAO 1XNRO 1IBLO 1YZBA 2DJVA 4OPAA 4JI6O 4LF8O 2LW7A 4JI3O 3M8AA 1HR0O 5IT9N 4DV0O 4DV1O 2E5LO 2JRIA 1A32A 5IWAO 5BY1A 4DR2O 2VQFO 1HNXO 4DR3O 4DR6O 4KHPO 4DR4O 1DK1A 1HNZO 4LF7O 1G1XB 1HNWO 1N32O 3J7AU 4JV5O 2ZM6O 5BR8O 3T1YO 2N74A 1IBKO 2UUCO 5LL6Y 4DV2O 4DR1O 4JI1O 1F7YA 4A5UB 4DR5O 4GKJO 4GKKO 4LFAO 2UXDO 5A2QN 4OX9O 4B3RO 4OPHA 2VQEO 1AILA 4B3MO 1R1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 O;  1FJG O;  1IBM O;  4AQY O;  3O65 A;  3J80 N;  3J81 N;  3OTO O;  4B3T O;  2Z0A A;  1XEQ A;  1I94 O;  4NXN O;  4K0K O;  5LMN O;  4LFB O;  1X59 A;  2FKX A;  1XMO O;  3JAM N;  2UUB O;  5H5N A;  4JYA O;  2AGA A;  4X66 O;  1D2D A;  4YY3 O;  4LF6 O;  5BXZ A;  3SDL A;  4B3S O;  1N34 O;  4LF9 O;  1FYJ A;  4X65 O;  4DUY O;  4JI7 O;  2DOS A;  4DV3 O;  4DUZ O;  1NS1 A;  4DV7 O;  4DV4 O;  4LF5 O;  3T1H O;  4X64 O;  2HHH O;  5FLX N;  2UU9 O;  1R6T A;  4JI4 O;  4JI5 O;  4NXM O;  1XNQ O;  1N33 O;  1AB3 A;  1FKA O;  1KUQ A;  2UXC O;  2F4V O;  4JI0 O;  4JI2 O;  4JI8 O;  2UXB O;  4DV6 O;  4LFC O;  2ZKO A;  3F5T A;  4DV5 O;  1J5E O;  4LF4 O;  5LMU O;  4YHH O;  1N36 O;  3RT3 C;  3R66 A;  4X62 O;  1XMQ O;  2UUA O;  1XNR O;  1IBL O;  1YZB A;  2DJV A;  4OPA A;  4JI6 O;  4LF8 O;  2LW7 A;  4JI3 O;  3M8A A;  1HR0 O;  5IT9 N;  4DV0 O;  4DV1 O;  2E5L O;  2JRI A;  1A32 A;  5IWA O;  5BY1 A;  4DR2 O;  2VQF O;  1HNX O;  4DR3 O;  4DR6 O;  4KHP O;  4DR4 O;  1DK1 A;  1HNZ O;  4LF7 O;  1G1X B;  1HNW O;  1N32 O;  3J7A U;  4JV5 O;  2ZM6 O;  5BR8 O;  3T1Y O;  2N74 A;  1IBK O;  2UUC O;  5LL6 Y;  4DV2 O;  4DR1 O;  4JI1 O;  1F7Y A;  4A5U B;  4DR5 O;  4GKJ O;  4GKK O;  4LFA O;  2UXD O;  5A2Q N;  4OX9 O;  4B3R O;  4OPH A;  2VQE O;  1AIL A;  4B3M O;  1R1B A; 
#chains in the Genus database with same CATH topology
 2CAZ C;  1PM9 A;  2QM4 A;  1XIL A;  3IC9 A;  5AG2 A;  3ABM B;  4FIP C;  1YF2 A;  4NXN O;  4LFB O;  5LMN O;  4LF9 B;  5LXT B;  1VQ7 V;  1S77 D;  2G38 A;  4GX5 A;  3T1H B;  2JIZ G;  4RWU A;  2E74 B;  4MVU A;  2UXN A;  3OMA B;  2EIM B;  3GVM A;  2ZIO A;  2BOC C;  3HB3 B;  2WLL B;  1Q90 D;  3DXR B;  4LR3 A;  1K4C C;  1L1F A;  1H8H G;  4JI4 O;  1F51 A;  1QNM A;  2R9R B;  1IZ3 A;  1LR1 A;  1KUQ A;  3TGU H;  4YJ3 B;  1SKV A;  1BSM A;  3Q4H B;  3K9A A;  2JGD B;  1P49 A;  4JI8 O;  1Q5O A;  3ZHQ A;  1B6Q A;  1PNM A;  2GV9 A;  2HEP A;  4WFE A;  1YJ9 V;  3CCS V;  3OGC C;  5LYJ B;  4YHH O;  4X62 O;  1XNR O;  3K06 A;  4UVA A;  4LNU B;  3RGB A;  2R9A A;  2VWK A;  5IYZ A;  2P7T C;  5EIB C;  3CEI A;  3OUF A;  1GRJ A;  5IYD O;  4W4L A;  2QKC A;  4I50 B;  5GTI Z;  4DR4 O;  1G1X B;  1UFI A;  1QCE A;  2Y4U A;  3STZ C;  1N0J A;  4I0X B;  1AI7 A;  3CRC A;  5L3G A;  4X1I A;  1EM1 A;  2IBZ H;  1ROP A;  4QJF B;  1SF9 A;  4PI2 A;  2YEV A;  2UUB B;  3I55 V;  2P06 A;  4B3M O;  1AR1 B;  3ZED A;  3J81 N;  5KAI Z;  4YY3 B;  2XAQ A;  4J11 A;  4B3S B;  1VMG A;  5TIS Z;  3B09 A;  1TUE B;  5L3E A;  4O2B A;  1VQ8 V;  4UVB A;  3E8F A;  3B8N A;  4FM0 A;  2Q9L A;  1Q43 A;  1MSD A;  2ATK C;  4GX2 A;  2DE0 X;  1EN5 A;  4X66 O;  1SA0 B;  4LP8 A;  4CS3 A;  1MNG A;  3JSN A;  2ADP A;  1YTF D;  2CTP A;  1MAB G;  3TXS A;  2N04 A;  3K79 A;  3LSS A;  1NI8 A;  3BFR A;  4DR6 B;  4WCE V;  2QWO B;  3OE7 G;  4JTC B;  4K35 A;  1PKX A;  5LMU B;  2Q4P A;  1N33 O;  1Q7Y W;  4UXN A;  5LGU A;  3FAV A;  1NU1 H;  3G67 A;  5E79 Z;  2XHB A;  4DK1 A;  1V55 B;  1H2K A;  4LFC O;  3H1K H;  1S5L Z;  3OEH G;  1NZ6 A;  1US6 A;  4X1I B;  3ZMS A;  3L75 H;  1K73 W;  4JI3 O;  4ZIB A;  1HP8 A;  4U3J B;  3CCL V;  2V7Q G;  2YXH A;  1FPO A;  4GKK B;  5H6R A;  3A0B Z;  4RQF A;  4ASU G;  4FLY A;  2QA4 V;  1EBO A;  2W6I G;  3OFN G;  1VF6 C;  1XRE A;  4UCU A;  1FXH A;  4O2B B;  4DR1 O;  1GM9 A;  2ITC C;  1U96 A;  1WP7 A;  2Z3Y A;  3K5M A;  4A5U B;  4CH4 A;  5B1N A;  4FM1 A;  2VWJ A;  1YIJ V;  1Y4M A;  5FPR A;  3WB1 A;  3BAB A;  4JYA B;  2AHY A;  4CH3 A;  4I7Z B;  2ARH A;  1M5I A;  5B1B C;  4UCT A;  1NVP D;  4J9Y B;  2XTA A;  1I94 O;  2QE7 G;  4MVQ A;  2QDO A;  2AZ2 A;  2XAG A;  5JH7 A;  1EFR G;  1AI6 A;  5CA1 A;  3JAW A;  4GLX A;  4LF6 O;  5KMG A;  3CJH A;  2LO1 A;  1H2G A;  2GTA A;  2PI4 A;  3FB8 C;  4DV7 O;  4X64 O;  1YDX A;  2JJ1 G;  2WLI B;  2GDS A;  4NXM O;  1XNQ O;  1IBL B;  4DV0 B;  2YS8 A;  1Q6U A;  1K97 A;  3G71 V;  1WP8 A;  4O4I A;  4FMT A;  1WPX A;  1GN6 A;  4DR2 B;  2FML A;  3OGI B;  4J7Z A;  1HNZ B;  2AZ0 A;  1XMQ O;  4LF8 O;  3M8A A;  1HR0 O;  1VQL V;  4H44 B;  3W7X A;  2JRI A;  1GN4 A;  3SJB C;  3JAR B;  4TUY B;  1YSC A;  1S0V A;  3X2Q C;  3JSL A;  3WB0 A;  1I0H A;  2ZM6 O;  4BIO A;  4KL1 A;  3E86 A;  3I5D A;  1AR4 A;  5LL6 Y;  4O2A A;  4JI1 O;  1SC5 B;  1FFX A;  1G6U A;  3WB2 A;  4G27 B;  4LC1 A;  1FXK B;  1HWY A;  4D6T H;  4OGQ B;  1H8E G;  2WSS G;  4MVR A;  3JD2 A;  4I5S A;  3CJH B;  3K08 A;  2LFR A;  4WBN A;  4FVM A;  1N34 B;  1AP6 A;  2X6B A;  3L71 H;  3D36 C;  3S3W A;  1WA8 B;  2ZNJ A;  1F23 A;  3K3W A;  3UQ8 A;  3H9V A;  1DF4 A;  4DV4 B;  4U7O A;  2BOB C;  3HKE A;  4LH7 A;  4FLT A;  2YI9 A;  2AGA A;  1NTM H;  2UU9 B;  5J2T A;  3RYC B;  5IYC O;  3DC5 A;  2QKS A;  3OR7 C;  4AI8 A;  1EZV H;  4X65 O;  2YDE A;  1R3J C;  1RPO A;  4DV3 O;  4I4T B;  5EZY A;  3ZMV A;  2LGQ A;  4UFZ A;  4DV6 B;  4F6E A;  3EFF K;  2OTJ V;  2LW1 A;  1IVS A;  1IXB A;  2WLJ A;  2OTL V;  1S5J A;  1V54 B;  1KC8 W;  3K58 A;  4JI6 B;  3HKB A;  2EIJ C;  1AI5 A;  4LWS A;  2EBO A;  3JD4 A;  1KKD A;  2VQF B;  4LBE C;  4FLV A;  3IJ4 A;  4O4J A;  3FKS G;  2P5O A;  2DWE C;  4Z1V A;  1NTK H;  3UT5 A;  1PNK A;  2ZNI A;  1SES A;  2A9H A;  4MW8 A;  3FD9 A;  2E5L O;  2ZD9 A;  4P9P A;  4XDL A;  3OUS A;  4TQD A;  3UKM A;  2DMX A;  5IWA O;  2UXD B;  2RMK B;  4Q6G A;  1K8A W;  5H9C A;  4MTO A;  1OV9 A;  3BA8 A;  4PA6 A;  1GH6 A;  3L74 H;  1OZ0 A;  3OMN B;  2XAF A;  3U10 A;  1AVM A;  3ZMT A;  4MTG A;  4TSF G;  3OTO B;  4FJC C;  1KP3 A;  3UM7 A;  3AG4 B;  2BSK A;  5C93 A;  3P3N A;  1CEZ A;  3AK3 A;  4FM2 A;  4E4E A;  4BAY A;  1XNQ B;  1YJN V;  2ZDI C;  2IJI A;  5LOV B;  4DR7 O;  1VF5 B;  2EJR A;  1IBM O;  4AQY O;  2A3Q A;  4FFB B;  1IDS A;  1JFF A;  5JQG B;  2ZE7 A;  3CCQ V;  2LGW A;  4WFH A;  4ZOL A;  1X59 A;  5CB4 B;  4MTX A;  1R73 A;  2IM9 A;  2QKA A;  4CH5 A;  3FFQ A;  3KKY A;  2WLK A;  5L3C A;  2XAS A;  4I55 B;  1QQC A;  4GT1 A;  4LWS B;  5FL7 G;  2UXC B;  2Q67 A;  3OT7 A;  4ZI7 A;  4DO2 A;  2B1I A;  1Q6H A;  4X20 B;  3B2E E;  5CBH A;  5JVD A;  2HHH O;  3UT5 B;  3WU2 Z;  4CZZ A;  2ZCE A;  4CH6 A;  5IE9 A;  4BW5 A;  1Q82 W;  4X1Y B;  3HKC B;  3SYA A;  1I5Y A;  1OCO C;  3L70 H;  4N23 A;  2PGG A;  1N0N A;  1OCO B;  4DV5 O;  4J9Z B;  2M7W A;  2QGN A;  4JV5 B;  1Y67 A;  4CC6 A;  3CCE V;  1AR5 A;  3RYH A;  2YIB A;  3AG2 B;  2Z5U A;  4DV2 B;  1KP2 A;  2BSK B;  2HVK C;  2Q7G A;  1GTO A;  4DR5 B;  3CCR V;  5BY1 A;  4YJ2 A;  2IJH A;  4PDL A;  4KHP O;  4XDJ A;  5GON A;  4TV9 A;  1XI1 A;  2XOK G;  1ZUQ A;  3EHB B;  3G6E V;  4B3T B;  4PEL A;  1P84 F;  1DF5 A;  4RAI A;  4FK5 C;  1QR9 A;  1BMF G;  2RN9 A;  4B3R O;  1QVG U;  2BCC H;  2Q68 A;  3N2G B;  4UVC A;  4DK0 A;  2WWW A;  4JZG A;  2RDC A;  1RM1 C;  1P7G A;  1GKF A;  3LSU A;  5CA0 B;  3ZN0 A;  3A0R A;  4TV8 B;  2LJ2 A;  5JVD B;  3GWO A;  2IJJ A;  5DEC A;  1GO3 F;  2JEU A;  4GZR B;  2DYR C;  5KX5 B;  2D3O W;  3SDL A;  4XDK A;  2CH7 B;  2OWO A;  3ZX6 A;  3ABK B;  3ABM C;  3CCU V;  5A9G A;  1OCR C;  3FB5 C;  2CUG A;  1SQX H;  3CRQ A;  1OCR B;  2HG5 C;  1ZTE A;  3FYE B;  4HAM A;  1VQP V;  2F93 B;  5KUK A;  3NR7 A;  2WA4 A;  1N36 B;  1U97 A;  1GN2 A;  1AB3 A;  2X0L A;  1NKD A;  1FKA O;  3ZHV A;  1ZAU A;  1MOF A;  4P2Z A;  3K0G A;  2VS0 A;  4GYC B;  2ZR2 A;  1M4U A;  2EIM C;  2CGO A;  1I08 A;  3ASO B;  2LP7 A;  2ETN A;  2VRZ A;  2YSU B;  3LNN A;  3K5N A;  4DR3 B;  1QLE B;  3F7Y C;  1GK9 A;  1VQN V;  4FPP A;  4PA7 A;  3K5L A;  3VQY A;  1H2S B;  3ZMU A;  4AHC A;  3T1Y B;  1GM7 A;  1VQ5 V;  1JMK C;  3D3I A;  5EBL C;  2M6Y A;  2H94 A;  5BMV B;  3ABT A;  1HNX O;  2EIL B;  2P22 C;  1HDJ A;  4U7N A;  3J7A U;  1JPX A;  2WLM A;  1EN4 A;  3ZHU A;  5BR8 O;  5DN6 G;  2P67 A;  2YIA A;  3CX5 F;  2EZO A;  2YID A;  3RYI B;  1F7Y A;  4GX1 A;  1AP5 A;  4H0L B;  3K5O A;  3JD1 A;  1B04 A;  3E8G A;  4HNA A;  3M7M X;  2X6C A;  2F23 A;  2R72 A;  1FJG O;  1BL8 A;  4BR6 A;  2CE4 A;  1SQF A;  3S3X A;  3C3S A;  5KHK A;  1DGS A;  3QVN A;  4DUY B;  2FKX A;  1PL4 A;  1SQB H;  1URF A;  4LF5 B;  1KBH A;  1D2D A;  3CSX A;  4B7K A;  3OW2 U;  1XQ8 A;  5KAF Z;  3ICX A;  5EYP A;  2A06 H;  2ITD C;  4JI7 O;  4BIU A;  4JI0 B;  4YIP A;  3CHX A;  4DUZ O;  1NS1 A;  4X88 A;  3E89 A;  1J5E B;  4LF4 B;  4JI5 O;  4X89 A;  1YI2 V;  3HR0 A;  1G4Y B;  1KD1 W;  3CXC U;  2KB1 A;  1ZL8 A;  1TAE A;  2AHZ A;  1VF6 A;  3HKD A;  1K92 A;  1B3Q A;  2B5U A;  1WNS A;  4XBF A;  2OIE A;  3CC4 V;  2X7R B;  2HJD A;  4DW1 A;  4O4H A;  4R50 A;  1Q86 W;  1SRY A;  3UCS C;  1HNW B;  1N32 B;  4CC5 A;  3JYC A;  4GUN A;  4JTD B;  2CTR A;  4DV1 O;  3OMI B;  1OHH G;  5IYZ B;  3MD0 A;  1UPG A;  4LFA B;  3W7S A;  4OXS A;  4D7T A;  4OX9 B;  1V55 C;  5JJN B;  5B3S B;  5LA6 A;  3H1I H;  4JAA A;  2FL4 A;  4NXN B;  4LFB B;  2NR5 A;  5LMN B;  3BEH A;  1BCC H;  2Q5Z A;  3U0Z A;  2RNB A;  2XAH A;  1WLE A;  1SQQ H;  3MAQ A;  2VQE O;  1GAX A;  3AK2 A;  1OCC B;  2YEV B;  3G6B A;  3BAA A;  5JJE B;  2OIG A;  1L8D A;  3L73 H;  1JJ2 U;  3E22 A;  4RUE A;  1S3J A;  2H8P C;  3CME V;  5KHI A;  4JZ2 A;  1VF7 A;  1XMO O;  3CP1 A;  3F5W C;  4MS2 A;  3RYF A;  4JYC A;  2MK3 A;  3R65 A;  1BHA A;  1K3E A;  5B66 Z;  1MG1 A;  4JI4 B;  5IDJ A;  1JVM A;  2JS5 A;  5FNV A;  2HVJ C;  4J41 A;  4TOI A;  3HKD B;  1THZ A;  1IUR A;  1K9M W;  1WB8 A;  2DWD C;  4JI8 B;  5FPO A;  3KCX A;  2NLJ C;  5C8Y A;  4YHH B;  4X62 B;  1XNR B;  2F95 B;  1BE3 H;  3B4S A;  5HFM A;  3A8T A;  3FAV B;  2WPD G;  3N2K A;  4JI2 O;  4LCU C;  2UXB O;  2PI5 A;  3JAK A;  4NB5 A;  1K5S A;  2OCH A;  3U11 A;  3K04 A;  4DR4 B;  3LSQ A;  5D5Q A;  3RT3 C;  4IYH A;  2UUA O;  1SZT A;  4QIW F;  3RVY A;  2DJV A;  2GSM B;  3L72 H;  1K34 A;  4FZ1 A;  2PF4 E;  2UXX A;  5L3B A;  3VQX A;  2YC0 A;  3QO7 A;  4JYY A;  1X4T A;  3CD6 V;  4B3M B;  4UB6 Z;  3D36 A;  1NH2 B;  2WLN A;  4UUJ C;  5KLV H;  2UUC O;  1DTO A;  4NKG B;  3QF7 A;  4K8X A;  2XAJ A;  4GKJ O;  5H2F Z;  1VQ6 V;  1ENV A;  3K9S A;  2Y69 B;  1SET A;  2KG7 A;  1E1R G;  4IHJ A;  4X66 B;  2KQX A;  1PPJ H;  3C90 A;  1PNL A;  1WPB A;  3EVK A;  4UV9 A;  3L9D A;  3K03 A;  1Y6X A;  1FXK C;  1DLB A;  2H3O A;  3T4Z A;  5JH7 B;  1AJP A;  3W7W A;  5LP6 A;  2CDY A;  4X1K A;  5CA1 B;  1VQK V;  3JAW B;  5KMG B;  2MW2 B;  1N33 B;  2WAM A;  5KA6 A;  1K33 A;  5H6Q A;  2E3C A;  3N2K B;  2P90 A;  1W2B U;  1L0N H;  5CA3 A;  1BQZ A;  2QR4 A;  1EN6 A;  4RUF A;  1YHQ V;  1XHZ A;  4LFC B;  1MZE A;  4DYL A;  1HW7 A;  4ZBM A;  5IY5 C;  5LHH A;  1AJN A;  3VQW A;  1B06 A;  5IY5 B;  3TJT A;  1IXM A;  3A0H Z;  5GTH Z;  4IL6 Z;  3AG3 B;  4JI3 B;  4EFB A;  1H38 A;  1JCH A;  2R70 A;  3SPH A;  2F4V O;  3H1J H;  4QPJ A;  1LNQ A;  1Z5V A;  2GUZ A;  1F4M A;  4MVZ A;  4O4I B;  2ZKO A;  3ETQ A;  3ZJZ A;  1PP9 H;  3TK1 A;  2QM7 A;  3AEI A;  1V54 C;  5L3D A;  1H2L A;  2JEX A;  4DR1 B;  1VQ4 V;  3E8B A;  5F2V O;  1Z5W A;  2ZDI A;  3GWK C;  4NTW A;  1R3I C;  3E35 A;  1K7D A;  1VIB A;  4LF7 O;  4J10 A;  1CXZ B;  3LDC A;  4MVO A;  3RN4 A;  2GHY A;  2HR3 A;  4DW0 A;  1D5A A;  2A0L A;  1IBK O;  1R3L C;  1I94 B;  5J2U A;  2OCC B;  1MMM A;  4O2A B;  3CCM V;  1S76 D;  4PV1 B;  5LGT A;  1FFX B;  2W0X A;  1YJW V;  5JJJ B;  5LP6 B;  3ASN B;  2Q0A A;  5ITZ A;  2ZE6 A;  3DTU B;  1G8M A;  4LF6 B;  1D5N A;  1JR9 A;  2Z0A A;  1FS0 G;  4JI2 B;  3CC7 V;  4WBN B;  5JCO C;  3RFR A;  3W7T A;  1P7B A;  2ADQ B;  3O9O A;  3AG4 C;  5DED A;  3JAM N;  4DV7 B;  2GBO A;  3JAL A;  4X64 B;  2Q8V A;  5KHG A;  4WFA V;  3HKE B;  5BXZ A;  4PA3 A;  3ZBH A;  2XUM A;  4NXM B;  2V1D A;  3IFX A;  4PA9 A;  4LF9 O;  4NR1 A;  5J2T B;  2KKW A;  2XT9 A;  3WFV A;  2HJF C;  3RWR D;  4R6Z A;  3SPJ A;  1FD9 A;  5EZY B;  3T1H O;  4E2L A;  3ML0 A;  4K3A A;  1R6T A;  3CMA V;  3ZCC A;  1Y66 A;  4PJ0 Z;  4UCR A;  1XMQ B;  3JAT A;  4LF8 B;  1HR0 B;  4U3F H;  1QVF U;  4DXW A;  3HKB B;  3P3P A;  2DQ0 A;  3ZRX A;  5EBW C;  2DQ3 A;  1NBM G;  4DRX A;  2EZP A;  4FLX A;  2FB5 A;  2EIK C;  5EC2 C;  4C7U A;  3PN1 A;  3ABU A;  5KA5 A;  2EIK B;  2ZM6 B;  4O4J B;  1MSW D;  5J2U B;  4FZ0 A;  4JI1 B;  4F6R A;  1JQ0 A;  2EUL A;  1IX9 A;  1TUB A;  2QWP B;  5ITZ B;  5CMU A;  4EKW A;  1YIT V;  1S72 V;  4IGG A;  2ZE5 A;  2BTO A;  1H2M A;  3GB7 C;  2CGN A;  3AG2 C;  3E83 A;  2EJ7 A;  4QGP A;  2HFE C;  1OCZ C;  2XND G;  4KP4 A;  1Q81 W;  1OCZ B;  4EFE A;  3O65 A;  4PHZ A;  4TT3 G;  3AG1 B;  1NTZ H;  5LXT A;  1AI4 A;  2EX3 A;  1JFF B;  4X65 B;  1ZSP A;  1VQM V;  4ZOL B;  2Y0I A;  4DV3 B;  3QNE A;  2UUB O;  4YXW G;  1WN7 A;  4Q20 A;  3ABL B;  3RVZ A;  3K0D A;  3BCC H;  4YY3 O;  1E1Q G;  3F7V C;  4B3S O;  3SPI A;  4Z2W A;  1FYJ A;  2JVD A;  1WB7 A;  4EEQ A;  3MHH C;  5HFL A;  4DRX B;  3CCJ V;  3STL C;  3ZN1 A;  2WLL A;  5B1O A;  3LDD A;  1M9N A;  4ZI7 B;  4TWK A;  1XHX A;  3TXQ A;  3ETG A;  3T2M A;  1TVK A;  4YJ3 A;  2QTS A;  1K4D C;  3Q4H A;  4ZKI A;  2OYQ A;  2N05 A;  3ABK C;  1KB9 F;  2E5L B;  1JOY A;  4JPR A;  5IWA B;  3K59 A;  3JCU Z;  5LYJ A;  5KHH A;  3CRA A;  1NT2 B;  5LMU O;  2HLD G;  4LNU A;  3R66 A;  2B9Z A;  3FYI B;  4J7K A;  2K1E A;  1FAF A;  2Y0P A;  5IT9 N;  3CWB H;  2IH1 C;  3RYH B;  4QPK A;  5BZB A;  4I50 A;  2D2C B;  4I9Q A;  1COW G;  4GCZ A;  4YJ2 B;  3ASO C;  4I0X A;  2IH3 C;  1Y76 A;  2PY5 A;  4DR7 B;  4HYO A;  5GON B;  1QLE C;  4TV9 B;  4AQY B;  1IBM B;  2RCV A;  3KG2 A;  5JWP A;  1Y74 A;  1N8R W;  1SQP H;  1BHB A;  4PDR A;  1NJI W;  4GKK O;  3OTF A;  3D8C A;  4X9Q A;  3TET A;  3A2F A;  1AIL A;  2EIL C;  4JAV A;  4JTA B;  1PV0 A;  1VQ9 V;  2L35 A;  4PI0 A;  4K0K O;  3RW0 A;  5B5E Z;  4MTF A;  1EZJ A;  3ZHS A;  3SYC A;  4JYA O;  4J7J A;  1SA0 A;  1QHT A;  1AJQ A;  1TVK B;  3LUT B;  2V4D A;  2HHH B;  4H13 B;  1ARO P;  3C3T A;  3OAA G;  1TGO A;  4NTX A;  5IJ9 A;  2AW9 A;  4DV5 B;  4MT8 A;  3BA9 A;  1SZX A;  3BVO A;  5K1P A;  1R3K C;  1I5X A;  1SQV H;  4L8J A;  2Q73 A;  2NN4 A;  2NNU A;  1Y76 B;  3F5T A;  4H37 A;  4KHP B;  3DGE A;  1IBL O;  4U3J A;  1Y74 B;  1YZB A;  2FYU H;  4DV0 O;  1ZX3 A;  1A32 A;  1NR7 A;  4DR2 O;  4O4L A;  1TA8 A;  5L3F A;  4B3R B;  1HNZ O;  3SPC A;  1KKC A;  2EIN C;  2EIN B;  2ZIN A;  3CXH F;  1J95 A;  2WA3 A;  2F66 C;  4R8C A;  2A7W A;  1F4N A;  4GX0 A;  2ZE8 A;  5GW7 A;  3I56 V;  4PD4 F;  3CS5 A;  2CTQ A;  5KUM A;  4HNA B;  1VAR A;  3IAY A;  1Q6I A;  3BRC A;  5B3S C;  4KFM A;  4RQE A;  4UB8 Z;  4EB6 A;  4MVS A;  1BS3 A;  3CB2 A;  1LUV A;  4N21 A;  1NH2 D;  1M93 A;  1BT8 A;  4RO2 A;  5IJ9 B;  5J9P C;  5H5N A;  2QTO A;  1Z2G A;  3ZRS A;  3UO2 A;  3E2E A;  3SYO A;  1YXB A;  4CS4 A;  3OEE G;  1OCC C;  1Q3E A;  1ORQ C;  1N34 O;  3E8H A;  1YCI A;  4LH6 A;  3ZMZ A;  5EYP B;  1WJZ A;  3H01 A;  4DV4 O;  1KYO F;  2JJ2 G;  4NVP A;  4WFF A;  2B1G A;  3NXS A;  2WLI A;  2HKO A;  4H33 A;  2AXT Z;  2UU9 O;  3QTC A;  1LUW A;  2F43 G;  4BW9 A;  4TQF A;  3B40 A;  1RFY A;  2JDI G;  4D7S A;  1YVW A;  1XL6 A;  4PA4 A;  4O4L B;  3SR2 C;  1O9G A;  5LHG A;  1ZL8 B;  4DV6 O;  3CYO A;  1HNX B;  1MA1 A;  3EXA A;  4FLW A;  1JA8 A;  2DN9 A;  4O4H B;  4K0K B;  3MHS C;  1R6N A;  4JI6 O;  1M1K W;  5BR8 B;  2IU0 A;  3UO3 A;  3CRM A;  3ZS8 C;  3JAR A;  1VP7 A;  4TUY A;  1GMG A;  5EC1 C;  4J42 A;  2Q69 A;  4IT5 A;  2VQF O;  3JD3 A;  5LBQ A;  4ICG A;  5B1B B;  4EB6 B;  3ZIA G;  1FJG B;  1XUQ A;  5LA6 B;  1ZLZ A;  4HBN A;  1FXK A;  5IYB O;  4FLZ A;  4Z1M G;  3CC2 V;  2UXD O;  1E79 G;  2O57 A;  1OJH A;  1XOU A;  4UV8 A;  4OPH A;  3H1H H;  4QE7 A;  3AG7 A;  1YTF B;  1KMI Z;  3J80 N;  1ZWI C;  3OTO O;  2QWN B;  2PYJ A;  4X8A A;  1WA8 A;  3E22 B;  2Q6A A;  4JI7 B;  4JF3 A;  2L6L A;  4DUZ B;  2E76 B;  1SQG A;  2Y69 C;  5E1A C;  3RYC A;  3RYF B;  3MDS A;  3KZI Z;  4P30 A;  4JI5 B;  3PJS K;  3SJC C;  3ETD A;  4UCO A;  3VBB A;  1KQS U;  2DW4 A;  1YEW A;  3B8M A;  4IIJ A;  5FNV B;  4I4T A;  2QWR B;  3G4S V;  4KXR A;  1M90 W;  4KUM A;  4JAU A;  1NR1 A;  2QWQ B;  3ZRV A;  1W0K G;  2OT5 A;  4W4K A;  5C8Y B;  2UXC O;  2QSA A;  2JGU A;  3M99 B;  4J80 A;  4DV1 B;  2ZXW C;  3SYP A;  3X2Q B;  1QLN A;  4JAS A;  5IJ0 A;  1H2N A;  1SS3 A;  2ZXW B;  3OM3 B;  1NQT A;  3T4D A;  1XDC A;  3JAK B;  3JAS A;  1QU7 A;  5LGN A;  3KCY A;  2RQ6 A;  4OPA A;  4L87 A;  3P30 A;  1XBL A;  2C2A A;  4ABM A;  1Q8I A;  2JS3 A;  3AG3 C;  5KHJ A;  3VQV A;  1CP9 A;  4JYB A;  3VOU A;  3B77 A;  4FLU A;  2VQE B;  1RSO A;  1GM8 A;  4R7C A;  2IU3 A;  1NVP B;  4JV5 O;  3SYQ A;  4IYI A;  5JCO A;  2W6J G;  1CPY A;  4B7E A;  4CBC A;  3K57 A;  4DV2 O;  5D5P A;  5B1A C;  2IJK A;  3FB7 C;  4DR5 O;  2YUA A;  5B1A B;  2P4K A;  3CE2 A;  1XMO B;  5LOV A;  2JK5 C;  2E75 B;  1PL0 A;  3APO A;  3TCU A;  2KG7 B;  3QG5 A;  4FFB A;  2CTW A;  4K8Z A;  2BE3 A;  4I9W A;  1W0J G;  4IIJ B;  3HPL C;  4IHJ B;  5JQG A;  4B3T O;  1FXV A;  1M57 C;  1XEQ A;  2Q7E A;  5CB4 A;  1M57 B;  1M56 C;  2Q7H A;  2OCC C;  3G80 A;  1M56 B;  2IW5 A;  3SPG A;  2K9P A;  4I55 A;  3QO5 A;  4MVM A;  5LP6 C;  1RP3 B;  3ASN C;  4PDV A;  2EIJ B;  3W7U A;  2Y4T A;  4UCS A;  3IC7 A;  1MZF A;  4X1K B;  1VEW A;  2ILM A;  4MW3 A;  2LQT A;  5IJ0 B;  4X20 A;  1UJW B;  3SJA C;  2UXB B;  3JAS B;  1BZK A;  2R9I A;  4BIZ A;  3DSQ A;  3T1C A;  2ZR3 A;  4X1Y A;  2UUA B;  1KU9 A;  3HKC A;  5CBG A;  1V9P A;  1T5E A;  4CS2 A;  4P9O A;  2ZT9 B;  1RPR A;  3CPW U;  1RSO B;  2GUZ B;  5CBF A;  4AIL C;  1N36 O;  3FB6 C;  5CN0 A;  3ETE A;  2LW7 A;  1R6K A;  1VQO V;  2FTK A;  3QO8 A;  4NYK A;  2UUC B;  3RBZ A;  3FX7 A;  3WG7 C;  4GKJ B;  3BPZ A;  3WG7 B;  2ZIM A;  4DR3 O;  4YIO A;  1I7F A;  3SJQ C;  3JCZ A;  2ODM A;  3BY6 A;  3T1Y O;  2N74 A;  4FFK A;  4ZHQ A;  2BTQ A;  1XL4 A;  4QE9 A;  3N2G A;  2YIB D;  3SGI A;  1WAZ A;  1L0L H;  1BQ0 A;  2A79 B;  2F1M A;  3CRR A;  4MSW C;  5DM6 V;  2YI8 A;  2PTM A;  5LHI A;  2CK3 G;  5EK0 A;  5CA0 A;  2HP8 A;  2Q0O C;  4TV8 A;  3ZRW A;  1FFT B;  4QNH B;  3LDE A;  5KX5 A;  1S5H C;  2CH7 A;  3AK1 A;  3APQ A;  3JAL B;  2RJZ A;  2QM8 A;  2P6J A;  4WFG A;  3AG1 C;  1BGY H;  1JX9 A;  2YXY A;  4DUY O;  2DOS A;  2F4V B;  1QR8 A;  5K1X A;  4BWA A;  2LFS A;  2Y48 A;  1K5Q A;  2YXL A;  3ZHR A;  2PYL A;  4LF5 O;  4JGS A;  3JD0 A;  4WF9 V;  5FLX N;  4NTY A;  3ABL C;  2W0F C;  1KEC A;  3BHP A;  2QJ1 A;  2KSD A;  2P4V A;  2QEX V;  4F4L A;  3P32 A;  1SER A;  3JAT B;  1W59 A;  1PD3 A;  4JI0 O;  5EBM C;  4G2K A;  3LNM B;  4HZ3 A;  1O9H A;  1J5E O;  1JJO A;  4LF7 B;  4LF4 O;  3DXR A;  1QBZ A;  4ZHQ B;  2BTQ B;  1GN3 A;  4B08 A;  4UCV A;  1IBK B;  5EIB D;  5BMV A;  2PZS A;  3OR6 C;  2GTS A;  2ZQM A;  3N27 A;  3OD4 A;  2DYS C;  4F6R B;  2JGD A;  4WFB V;  4DR6 O;  1N4C A;  1DK1 A;  2DYS B;  2X6A A;  1P4R A;  3THO A;  1HNW O;  1TUB B;  2PUS A;  1N32 O;  4PDM A;  3RYI A;  3DC6 A;  1RM1 B;  2WLH A;  4G28 B;  3ZHT A;  4LFA O;  3ZRW B;  5A2Q N;  4OX9 O;  2DYR B;  3H1L H;  3CCV V;  3D3Q A;  2YIC A;  3IGA C;  1R1B A; 
#chains in the Genus database with same CATH homology
 4DR7 O;  1FJG O;  1IBM O;  4AQY O;  3O65 A;  3J80 N;  3J81 N;  3OTO O;  4B3T O;  2Z0A A;  1XEQ A;  1I94 O;  4NXN O;  4K0K O;  5LMN O;  4LFB O;  1X59 A;  2FKX A;  1XMO O;  3JAM N;  2UUB O;  5H5N A;  4JYA O;  2AGA A;  4X66 O;  1D2D A;  4YY3 O;  4LF6 O;  5BXZ A;  3SDL A;  4B3S O;  1N34 O;  4LF9 O;  1FYJ A;  4X65 O;  4DUY O;  4JI7 O;  2DOS A;  4DV3 O;  4DUZ O;  1NS1 A;  4DV7 O;  4DV4 O;  4LF5 O;  3T1H O;  4X64 O;  2HHH O;  5FLX N;  2UU9 O;  1R6T A;  4JI4 O;  4JI5 O;  4NXM O;  1XNQ O;  1N33 O;  1AB3 A;  1FKA O;  1KUQ A;  2UXC O;  2F4V O;  4JI0 O;  4JI2 O;  4JI8 O;  2UXB O;  4DV6 O;  4LFC O;  2ZKO A;  3F5T A;  4DV5 O;  1J5E O;  4LF4 O;  5LMU O;  4YHH O;  1N36 O;  3RT3 C;  3R66 A;  4X62 O;  1XMQ O;  2UUA O;  1XNR O;  1IBL O;  1YZB A;  2DJV A;  4OPA A;  4JI6 O;  4LF8 O;  2LW7 A;  4JI3 O;  3M8A A;  1HR0 O;  5IT9 N;  4DV0 O;  4DV1 O;  2E5L O;  2JRI A;  1A32 A;  5IWA O;  5BY1 A;  4DR2 O;  2VQF O;  1HNX O;  4DR3 O;  4DR6 O;  4KHP O;  4DR4 O;  1DK1 A;  1HNZ O;  4LF7 O;  1G1X B;  1HNW O;  1N32 O;  3J7A U;  4JV5 O;  2ZM6 O;  5BR8 O;  3T1Y O;  2N74 A;  1IBK O;  2UUC O;  5LL6 Y;  4DV2 O;  4DR1 O;  4JI1 O;  1F7Y A;  4A5U B;  4DR5 O;  4GKJ O;  4GKK O;  4LFA O;  2UXD O;  5A2Q N;  4OX9 O;  4B3R O;  4OPH A;  2VQE O;  1AIL A;  4B3M O;  1R1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...