2E5LO

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2e5lO00
4DR1O 1XNQO 2N74A 4OPHA 1R6TA 3OTOO 2FKXA 2E5LO 3F5TA 2VQEO 4DV2O 4AQYO 4LF8O 2F4VO 2ZKOA 4DR2O 5BXZA 3J80N 5IT9N 1FJGO 2JRIA 4B3RO 4GKJO 2UXDO 1J5EO 4YY3O 4X62O 4DUYO 5A2QN 3J7AU 3R66A 1DK1A 2ZM6O 5H5NA 4JI2O 5LL6Y 2HHHO 1YZBA 1FKAO 4LFCO 2AGAA 4JI0O 4JI4O 2LW7A 3SDLA 3J81N 4DV7O 4KHPO 2UUAO 4LFBO 1HNZO 4DR5O 2UUCO 4B3TO 1IBKO 4NXMO 4DV3O 4JV5O 1N32O 4DV1O 1F7YA 4DR6O 1NS1A 1A32A 1FYJA 4DV0O 1AILA 1N33O 3T1YO 4LF7O 4DV4O 3T1HO 2DOSA 1HNWO 1I94O 2VQFO 1HNXO 1R1BA 4K0KO 4X65O 3RT3C 2UXBO 4DV6O 4NXNO 1N34O 2DJVA 1N36O 1IBMO 4A5UB 4DR3O 5LMNO 5BY1A 4JYAO 4JI6O 5LMUO 1XNRO 4DUZO 4B3MO 4JI5O 4OPAA 1G1XB 2UXCO 4DR4O 2UUBO 1XMOO 4LF5O 4LF6O 4JI7O 5IWAO 5BR8O 4JI1O 1HR0O 4DR7O 4B3SO 1X59A 4YHHO 2UU9O 3O65A 4DV5O 3M8AA 1AB3A 1XEQA 1KUQA 4X66O 4LF4O 2Z0AA 3JAMN 1D2DA 4LFAO 1XMQO 4OX9O 4GKKO 5FLXN 1IBLO 4JI8O 4LF9O 4X64O 4JI3O
chains in the Genus database with same CATH superfamily
4DR1O 3ASOB 2CTPA 3IJ4A 5FNVB 2UXCB 4ASUG 2WLNA 3OMIB 1XMOB 4GZRB 3OTOO 4DRXB 3U10A 4PA4A 1HR0B 3ZX6A 3BA9A 4DV5B 3T4ZA 2GDSA 1JX9A 2OCCC 2CTRA 3G71V 1YVWA 2ZM6O 1YITV 1R3IC 3SPHA 4UVAA 3STLC 3ZS8C 2LFSA 1FPOA 1QU7A 4PI0A 1YHQV 1K73W 5JQGA 1KQSU 3N2KB 3J81N 3RFRA 1FAFA 1WJZA 4JI4B 3DXRA 3L9DA 4MS2A 1IXBA 1ZSPA 2KG7B 4NXMB 2Y0PA 2W0FC 3SGIA 3HB3B 4FLZA 3G6BA 5B1NA 4O4JB 4UFZA 3B8MA 5E79Z 1S72V 2R9AA 1K9MW 1PKXA 1WLEA 2EJ7A 3D3IA 4LCUC 3LSQA 2EZPA 4FFBB 2HFEC 1XDCA 3BCCH 1LNQA 3GVMA 1KMIZ 3B77A 1IBMO 5LMUO 2YUAA 1EN5A 1DGSA 2FTKA 5LXTB 5EIBD 4UVCA 1QLEB 1SETA 4JTCB 3JATA 1SKVA 4BW9A 4HAMA 4I0XB 4YHHO 4J41A 1Q82W 4X1KB 4FK5C 4O2AB 2Q7HA 3D36A 4E2LA 1Q90D 4LWSB 1O9GA 3FX7A 4IHJB 2BOBC 2QTSA 5EBWC 3TXQA 4JI8O 4FMTA 4CC5A 4FFKA 3K9AA 4NTYA 3SJQC 1ZAUA 2E76B 2WLLB 1M57C 4JI7B 3ZHSA 2ZE6A 1OJHA 3QF7A 2ZKOA 3O9OA 4DR2O 2JDIG 1KKDA 3APOA 2P22C 4H13B 3U11A 4W4LA 3LDEA 4JZGA 1GRJA 4MSWC 2WA4A 4MTOA 3G80A 3OAAG 1J5EO 5J2TB 3JAWB 2VS0A 5GONB 3ETQA 2RDCA 4R8CA 2NN4A 3CCLV 3UCSC 4EFEA 4LFCO 2HVKC 4HBNA 4FPPA 2EIKC 1NT2B 4QIWF 1AR5A 2XT9A 3CP1A 2RJZA 2G38A 4GKJB 4F6RB 1Q7YW 3NR7A 2YXYA 3RYHB 3VQWA 3ZHTA 3TGUH 3ZRXA 1HNWO 1NVPD 2E75B 3WB1A 3HKBB 3RYFB 2WWWA 2YEVB 1ZL8A 3RYCB 4B3MO 5L3DA 4N21A 1NI8A 4RQFA 3K5OA 2JGDB 4EB6A 4J42A 3MD0A 1DF5A 1M5IA 4I9QA 4PELA 1IVSA 2P6JA 1V55C 3DTUB 5LHIA 1GAXA 4MVMA 3F7VC 3L72H 4YHHB 4LNUB 4TUYB 5GW7A 4GUNA 5DM6V 1OCZB 5B3SB 1AROP 4U7OA 4X64O 3CX5F 4JYAB 4YJ3B 1TUBA 2QTOA 4OPHA 5JCOA 4WFFA 4CH4A 1PV0A 4H44B 1Q6UA 4DV2O 1VQOV 1MSWD 1ZLZA 3ETGA 4PHZA 1K4CC 1S5HC 4RQEA 5IYZB 5H6RA 3CYOA 4YIOA 1OHHG 3K58A 4DRXA 1K7DA 2GBOA 3T1CA 5LL6Y 2ZXWB 1YZBA 5KHJA 5EIBC 2AGAA 1T5EA 3SDLA 3E8BA 4P2ZA 3E22A 2NNUA 1BS3A 1SS3A 3CC4V 2X0LA 1GN4A 4JV5O 1JVMA 3HKDB 4I9WA 4WF9V 2IU0A 2UXNA 1FYJA 2QDOA 1RFYA 4GLXA 3N2KA 3CXCU 4LF7O 1HDJA 2YIBD 2QM4A 2EIMC 1FXKC 5JJJB 3Q4HA 4PDMA 1NTMH 1HNWB 3VQYA 2KQXA 3OGCC 2UXBO 2E74B 1ORQC 2DJVA 4RWUA 3AG4B 4DR3O 4X1IA 1IBKB 4O4JA 1AI5A 2V7QG 1Y76B 5B66Z 4B3MB 4DR6B 4UB6Z 2B1GA 1VQKV 4LF6O 3ABUA 2EINB 1OCOC 1X59A 2ATKC 3JALB 4UXNA 5ITZB 5K1PA 1L0LH 3SYCA 4LFAO 4DV6B 1R3LC 3AG1B 4TWKA 1P7BA 4GX1A 2A0LA 5B1OA 2A06H 4X64B 4WFHA 4TV9B 4X1KA 4WFEA 2E5LO 2R9RB 2CH7B 3ABMB 2VRZA 2PUSA 3HKEB 3E89A 4NVPA 4LF4B 2ITDC 1XL6A 1YSCA 2JEXA 4W4KA 4H0LB 1QNMA 2WLLA 4HNAA 1P49A 3P3NA 5CA0A 3L71H 1XOUA 5KHKA 5DECA 1QLNA 4O4LB 2K1EA 1BHAA 3PJSK 3UT5B 1BZKA 1TUEB 4ICGA 4JAUA 2RQ6A 3JAWA 1SQQH 5FL7G 2R9IA 4DV3O 3GB7C 5KUMA 3SPCA 4JV5B 5IY5C 4DV0O 2QKCA 3PN1A 1VF5B 1VQ5V 2XASA 3T1YO 1KC8W 1Z5WA 3T1HO 5CA3A 3THOA 4RO2A 3SPIA 4CS4A 5D5QA 3C90A 4J9ZB 3CPWU 2A79B 3VQVA 3I56V 1FFTB 3ZN1A 4A5UB 4EEQA 4F6RA 3H1KH 1VMGA 4DUZO 3OTFA 3CE2A 4DV1B 2GUZB 5IWAO 1EZJA 1FFXB 2YEVA 4J7KA 1EZVH 3M99B 4ZHQB 3E86A 3OW2U 3GWOA 3DGEA 3RYCA 2PY5A 5JVDB 2CGOA 1JFFA 5EYPA 2OWOA 1NH2B 3ZMSA 1GN6A 3K0DA 1Z5VA 1KB9F 4O4IB 1E1RG 2N74A 4TQDA 4J11A 4X8AA 4K3AA 4O2BB 1I08A 4G28B 5B1BB 4UVBA 2BE3A 2F4VO 3I5DA 4IIJA 1OCCB 5BXZA 3W7SA 4F6EA 1IXMA 2QE7G 5EC2C 2Q68A 4LBEC 2HLDG 3KKYA 3L75H 5IJ0A 1IBLB 1G8MA 2EILB 4JYBA 2AZ2A 1TAEA 1WA8B 3JASB 1FXVA 2ITCC 2CTWA 2L35A 2V1DA 1SESA 3IFXA 2UUCO 1H2GA 4MT8A 4LF8B 3B40A 3FKSG 4DV3B 4MVRA 2L6LA 5L3CA 2ZT9B 2UXXA 1QBZA 4DUYB 1SZXA 2WLIB 2IJIA 2ZE7A 3ZRWB 4LH6A 4J10A 1I94O 2VQFO 2YI9A 1CPYA 1V54B 3CMEV 3MHHC 5H2FZ 3QO5A 4K35A 3RT3C 3WFVA 3ZRSA 2BTQA 3AK3A 1AP6A 2BCCH 2AHYA 2Q4PA 1LR1A 3BA8A 2B5UA 4FLUA 5JJEB 1KBHA 4D6TH 1NBMG 5CMUA 2ZNIA 4DUZB 3C3SA 5BMVB 5KA5A 3ASNC 1ROPA 2Y48A 1VP7A 5JH7A 2CE4A 4FJCC 5D5PA 1FXHA 2ZNJA 4UCOA 1K8AW 2Y0IA 3HKCB 1G4YB 1PL0A 1Q6HA 3JSLA 4RUFA 3RBZA 2IH1C 5LMNB 1RPRA 3MAQA 2JEUA 1B3QA 3JALA 3JYCA 3SJBC 5FPRA 4FZ0A 2VWJA 4C7UA 4BR6A 4YJ2A 5J2UB 4PA3A 4I7ZB 2VQEO 1BE3H 4B3SB 4IT5A 1WB8A 2F4VB 1JCHA 4B3RO 1YCIA 1S3JA 1K5SA 1JA8A 2LGQA 3ETEA 3J7AU 2FL4A 5H5NA 1Q81W 4JI2O 3RVZA 4JI3B 3T2MA 3RGBA 1YJ9V 1K92A 5LP6B 1Y4MA 2UUAO 3BRCA 1KD1W 1N0JA 4DR5O 4CH5A 3OD4A 4U3JA 1S0VA 2GTAA 2ZIOA 4IL6Z 1F7YA 3UO3A 3KCYA 3SR2C 1XHZA 4MVOA 4RAIA 1X4TA 3S3XA 3RYIB 1RSOB 3OEHG 3W7XA 4DV4O 2OIGA 1HNXO 2DQ3A 1XHXA 2DE0X 1D5AA 4WFBV 4JI0B 1LUVA 4NXNO 4QPKA 2F95B 1N36O 3EXAA 4UV9A 3E2EA 1UFIA 1RP3B 1HP8A 5KHHA 5F2VO 2UUBO 1AJNA 1I7FA 2BTOA 1GN2A 2RNBA 3K59A 2DYSB 4BIUA 3JAKA 1IX9A 5L3FA 4L87A 2V4DA 4P30A 1W0KG 5EBLC 2ZCEA 2Z5UA 3CCJV 1S5LZ 1XMQO 1RM1B 2XUMA 1FFXA 2IW5A 5EBMC 2QEXV 4DR4B 1NJIW 5E1AC 4X88A 5J9PC 2WLHA 4PDRA 2C2AA 2VQEB 1KP2A 3OT7A 4IYHA 3CMAV 2LP7A 4O4IA 2UXDO 1VF7A 1L0NH 1Y66A 1N4CA 4J9YB 3P3PA 2BSKB 2H8PC 4DR1B 2Y69C 4L8JA 4LH7A 2W6JG 4WBNA 1H2LA 4MTGA 3OTOB 1GM7A 4B3TO 2UUAB 4DR5B 3X2QB 1G6UA 2KB1A 2YIBA 1K33A 3OM3B 1H2SB 4G27B 3L73H 1N32O 4PA7A 5KLVH 2WLJA 5L3BA 2NLJC 1WB7A 1DF4A 5C8YA 3I55V 2ZM6B 2DW4A 1SQVH 4PV1B 1VARA 2P90A 2F43G 3OEEG 4CH6A 1JPXA 3W7WA 2QWNB 1HNXB 1P84F 1F51A 2P5OA 4WFGA 1VQPV 2W6IG 1AR4A 4PA6A 1VQ6V 1VQ7V 2P7TC 3ABTA 3ZHUA 4X20A 2PGGA 5IJ9B 4G2KA 3CJHB 5BR8O 5KHGA 5JJNB 1EN4A 3OUFA 3CCSV 3N2GB 4X1YB 4TV8A 4KXRA 2PTMA 2Z0AA 4DXWA 2QKAA 3A8TA 5LOVA 5FLXN 4OX9O 4PJ0Z 4XBFA 1IBMB 1OV9A 4LF9O 5LMUB 4CC6A 2HJDA 4MW8A 1VQNV 3ZHVA 3STZC 1YTFB 1SA0B 3OR7C 1OCZC 2YIAA 5B3SC 2Q8VA 4P9PA 4ZI7B 3RW0A 4AQYO 3DC5A 4O4HA 5DN6G 4FM0A 3HR0A 5L3GA 2JK5C 1R6KA 1I0HA 2R70A 4HZ3A 3CS5A 2ZR2A 4X62O 2XHBA 4QE7A 1SQXH 5KX5B 2QA4V 4JI8B 2ZQMA 5J2UA 1OCRB 1URFA 3RVYA 5LGTA 4I4TB 2RCVA 1FKAO 1CP9A 1JQ0A 2B9ZA 1Y74B 3BY6A 2YC0A 3AK1A 1PD3A 4B3TB 4DR2B 2ZXWC 2YICA 2M6YA 5FNVA 3AG2B 3LDCA 1J5EB 3BABA 5LGNA 1W59A 1VEWA 4GX2A 1OZ0A 1NH2D 4ZKIA 4QGPA 4PD4F 3ZHRA 4KL1A 4LFCB 1B6QA 5CB4B 4X65O 1H2KA 4IGGA 4JGSA 1XNRO 1Q6IA 4JI5O 2Q7GA 4OPAA 1G1XB 3DSQA 3H1IH 4HYOA 1MSDA 3UM7A 1JMKC 4LC1A 3AG4C 1XI1A 2A9HA 1GM9A 4ZOLB 1WN7A 2KG7A 5KAIZ 1PPJH 1AB3A 3OR6C 4FLVA 1EBOA 3EHBB 2Q9LA 3G67A 3E8HA 2EINC 1XNQO 5TISZ 1W0JG 4FFBA 1BQ0A 3S3WA 4R6ZA 3JARB 4J7JA 3LNMB 3AG1C 3ZMZA 3EVKA 3H1HH 3J80N 1FJGO 4BAYA 2EIMB 1FXKB 3FB5C 1W2BU 4JZ2A 3ZEDA 5LXTA 3CWBH 3R66A 3U0ZA 3FYIB 1MG1A 4YIPA 4I0XA 1ZX3A 4NTWA 2Z3YA 3ABMC 2IH3C 3CHXA 1GN3A 1BCCH 2B1IA 4O2AA 4LWSA 3IGAC 3E35A 4IHJA 1HNZO 2DQ0A 3ABKB 3IAYA 4LP8A 3B8NA 2QM8A 3AG7A 4DV2B 3LDDA 1OCOB 3JSNA 2Y4TA 3OE7G 2E3CA 2RMKB 3E83A 3APQA 1PNKA 5L3EA 4J80A 1COWG 4XDKA 2OT5A 1IDSA 1H8HG 5JWPA 3ZBHA 3AK2A 3SJAC 3BHPA 5B1AB 2WAMA 5J2TA 1N34O 5GONA 4X65B 2QWPB 3QTCA 2F93B 3K08A 1BMFG 2BOCC 4LF5O 3ICXA 1Q5OA 3H1JH 3VBBA 4DR7O 3MHSC 2ZDIC 2FMLA 2UU9O 4LF7B 3SYQA 1JR9A 2QSAA 1YXBA 2EIJB 5JQGB 4X66O 4BIOA 4DO2A 2Q67A 5H6QA 3DXRB 2H3OA 2UXBB 4BW5A 3FAVB 4GKKO 3FD9A 3G6EV 5EK0A 4DR3B 3RYHA 1MZEA 3KZIZ 3M7MX 1P7GA 1YIJV 2DWEC 1XNQB 3SYPA 1E79G 1R6TA 1EFRG 1F4NA 3HKBA 3ZIAG 3SYOA 2RN9A 3RYFA 4X1YA 4LF6B 1O9HA 3D8CA 3F5TA 5EZYB 5HFMA 1VIBA 2WA3A 2JGDA 2YDEA 4YY3O 5B1BC 3ZCCA 3KCXA 4LFAB 1S77D 5A2QN 5KHIA 1HWYA 4WFAV 3JD1A 3LSUA 2HHHO 3JD4A 4LNUA 1QVGU 4TUYA 4MW3A 3AG3B 1R73A 4KUMA 1YJWV 4DW1A 3JATB 2EBOA 2OIEA 2E5LB 2EILC 3LUTB 4OGQB 2P4KA 2AZ0A 4YJ3A 1DTOA 2DN9A 4JTAB 1XBLA 2WPDG 4NTXA 1MOFA 1SQPH 3K5MA 2VWKA 4R7CA 2IJKA 4CBCA 4TOIA 2LFRA 1I5YA 1AI4A 5KMGB 4K0KO 5IYZA 1UPGA 4U3FH 3SYAA 3CRCA 5LGUA 4QPJA 4PI2A 3G4SV 2PI4A 4JI6O 2UXCO 4BIZA 3VOUA 1V54C 1XMOO 1QR8A 2GSMB 3BPZA 4DV0B 4DK0A 4YXWG 4LF5B 1HR0O 5CB4A 3WB2A 4DR7B 3T1YB 3ZRVA 2ZD9A 3T1HB 3QNEA 1XL4A 4DV5O 3OUSA 3HKDA 1PP9H 5LA6B 1M56C 1US6A 4MVZA 5DEDA 1L1FA 4X66B 1JJOA 2CDYA 3K5NA 2AHZA 1F23A 1KYOF 2YI8A 1Y67A 3A0RA 3ABLC 1V9PA 5IWAB 1TVKB 1K5QA 4UB8Z 3UO2A 4N23A 1K34A 2MK3A 3CRQA 3H01A 2P06A 3JCUZ 1TGOA 2QM7A 1AVMA 1R6NA 1Y76A 4NB5A 2ADPA 2OCHA 1TA8A 1AJQA 2YXLA 3JARA 4DW0A 1PNLA 5ITZA 2XTAA 1KKCA 2ILMA 2ZR3A 4EB6B 4DV7O 4KHPO 5LHGA 1WP7A 2XAFA 3FB6C 3FFQA 3ASOC 4MVSA 4X89A 2X6CA 4WCEV 3K0GA 5LP6C 1A32A 1Q86W 5CN0A 4TV9A 5GTIZ 3H9VA 5IYDO 1N0NA 3JD0A 3F5WC 5H9CA 4EKWA 1TUBB 4Z1MG 3P30A 2CH7A 2M7WA 4FZ1A 1YTFD 3HKEA 2GV9A 1K3EA 2DYRB 2XNDG 5KAFZ 5K1XA 2UUCB 1ZTEA 4QJFB 4XDJA 3NXSA 3WG7B 4EFBA 2A3QA 3H1LH 3TETA 3CEIA 2KKWA 1D5NA 4O4LA 1EN6A 2X7RB 1CXZB 3UT5A 1B04A 4JI7O 4QNHB 3CCEV 1K4DC 1PL4A 1S76D 4I50B 2IM9A 1I94B 2VQFB 1XEQA 4TT3G 2DYSC 3E22B 5KA6A 1L8DA 1NKDA 1SF9A 2QJ1A 2IJJA 1QCEA 2PF4E 4CS3A 4FLXA 3CXHF 1LUWA 2JGUA 1BQZA 1CEZA 2WLMA 3K79A 2OCCB 4GX0A 3TJTA 1M93A 1RM1C 1XILA 3FAVA 1Y6XA 3CB2A 3W7TA 2ZDIA 3Q4HB 2EZOA 4J7ZA 3CRMA 1ZUQA 4GKJO 1QLEC 2GUZA 4ZIBA 3IC7A 2EX3A 4X1IB 4BWAA 3B2EE 2HJFC 5EZYA 4MVUA 4ZHQA 1UJWB 4LFBO 2H94A 2LW7A 5JVDA 4DV7B 1JJ2U 4KHPB 1GM8A 4FVMA 4GT1A 3BAAA 3GWKC 4B3RB 1Q8IA 4UCTA 4O2BA 4MTFA 4GCZA 1VQ8V 1GH6A 2CTQA 3X2QC 4JAAA 4JI2B 2DOSA 4Q20A 3CCUV 4DYLA 3CCMV 2Q5ZA 2YS8A 1YI2V 1GTOA 3CRAA 3L74H 4JYAO 3BVOA 4IYIA 5BZBA 1M4UA 3TXSA 1YJNV 1WA8A 3JASA 1AI7A 4H33A 2OTJV 5KMGA 2CGNA 3OFNG 1YDXA 4HNAB 5CA0B 4RUEA 1YEWA 4AI8A 4DV4B 3CCRV 3ZMUA 3RWRD 2Y69B 1R3JC 4TQFA 1M90W 3JAMN 3K04A 5CBHA 1NQTA 5CA1B 4TSFG 1M57B 4NXNB 1N36B 2WLIA 2D3OW 2Q69A 3RN4A 3D3QA 1SQGA 1BHBA 3ZRWA 1J95A 3P32A 5IDJA 2UUBB 1HW7A 2D2CB 1U96A 5LA6A 4MTXA 3ZN0A 2KSDA 3WU2Z 2JJ1G 1SRYA 1QHTA 1Q43A 2W0XA 5BMVA 2EIKB 1VQLV 2AW9A 1XMQB 2XAQA 4U7NA 3OMAB 3W7UA 3TCUA 1TVKA 2WLKA 4E4EA 3HKCA 2QWOB 3OGIB 1RPOA 2JS3A 1M9NA 4LFBB 2ADQB 1M1KW 1IBKO 3ML0A 1NR7A 1OCRC 3QO7A 2ETNA 2XAGA 1AR1B 4JASA 4K8ZA 4DR6O 3HPLC 1NS1A 2UXDB 1JFFB 1VQ9V 5EYPB 4B7EA 1NTZH 2Q0AA 4QE9A 1ZWIC 1N33O 2JIZG 1WPBA 5KUKA 1MMMA 2GHYA 4F4LA 3SJCC 1R1BA 3AG2C 4D7SA 2IBZH 4DV6O 4FLWA 2PZSA 2P4VA 1V55B 1GK9A 4PDVA 4IIJB 3SPGA 1WAZA 5GTHZ 1N32B 4I5SA 2K9PA 3ZMTA 2X6BA 4CH3A 5LP6A 3L70H 4XDLA 5LBQA 3ZMVA 1NU1H 5IJ0B 2LO1A 1IZ3A 1BSMA 3K9SA 2X6AA 1KUQA 2HP8A 3DC6A 4LF4O 4UCRA 1BL8A 3SPJA 1D2DA 1H2MA 3RYIA 5IYCO 1RSOA 3LSSA 4PDLA 4I50A 4FM1A 2JJ2G 4H37A 5BR8B 2F1MA 2CK3G 1GKFA 5LYJB 5FPOA 5IT9N 2Q73A 3VQXA 2BTQB 3OMNB 1MA1A 4OX9B 4I55B 4LF9B 4PA9A 3EFFK 5CBGA 3CRRA 1P4RA 4NYKA 4FLYA 1WP8A 3E8GA 5C93A 1JOYA 5JH7B 1YF2A 1VF6C 4UUJC 3KG2A 4AQYB 5B5EZ 2HVJC 4DV1O 3ETDA 2N05A 3CCQV 1BGYH 4LR3A 3ABKC 4X62B 4KP4A 4CZZA 1VQMV 1EM1A 2HG5C 4JF3A 1N33B 1KP3A 2IU3A 3K06A 4YJ2B 2F66C 2LGWA 5BY1A 4D7TA 2BSKA 2R72A 4UCVA 2HKOA 5B1AC 3WB0A 4JI1O 3QO8A 3BFRA 2F23A 3FYEB 1PNMA 3O65A 1QQCA 1S5JA 2CUGA 1U97A 3CSXA 5LHHA 2AXTZ 2DMXA 1IBLO 2OYQA 4U3JB 1XNRB 1H2NA 1NVPB 2EIJC 2QWQB 4JI5B 2YIDA 4FIPC 4R50A 3CC2V 1SZTA 2ZIMA 1VQ4V 1WNSA 4CS2A 2YXHA 4JTDB 4GX5A 2P67A 5CA1A 4LF8O 1Z2GA 2Y4UA 1XUQA 1AP5A 1FS0G 4Z2WA 4NKGB 2EJRA 3C3TA 2JVDA 1KECA 5IJ9A 4DUYO 3CJHA 2YSUB 5AG2A 2Q7EA 4B08A 5A9GA 3A2FA 2ZE8A 1AJPA 3N2GA 2LW1A 1H38A 1NTKH 1FD9A 2N04A 3F7YC 5IY5B 5CBFA 3K57A 1GO3F 3JAKB 2QR4A 1PM9A 1THZA 2ZINA 2DWDC 4ZBMA 4JYYA 1FJGB 3JCZA 3AG3C 1SA0A 3ZHQA 4AILC 2EULA 5IYBO 2HR3A 2XAJA 5HFLA 1IURA 3QG5A 1B06A 1OCCC 4ZI7A 1E1QG 4ABMA 1GMGA 3D36C 1MNGA 1NZ6A 1SQBH 1WPXA 1HNZB 3IC9A 5KX5A 3QVNA 5LMNO 3B4SA 3AEIA 1H8EG 4K8XA 4I4TA 1Q3EA 4Q6GA 3MDSA 1Y74A 3A0BZ 2ODMA 4B3SO 2MW2B 4JI1B 4DK1A 2JS5A 2XOKG 2PI5A 4AHCA 4WBNB 3M8AA 2QWRB 1ENVA 2QKSA 1KU9A 3FB7C 1N34B 3ZJZA 1I5XA 4JI3O 2OTLV 3BEHA 4UCSA 2FB5A 2LQTA 2FKXA 3JD2A 3N27A 5C8YB 5IE9A 2QGNA 2NR5A 1R3KC 3LNNA 4JPRA 3E8FA 2UU9B 1N8RW 3FB8C 2Q6AA 4NR1A 2JRIA 1SC5B 1AI6A 4B7KA 2CAZC 2LJ2A 2Q0OC 2XAHA 4GKKB 1DK1A 3UQ8A 4MVQA 5LYJA 4ZOLA 1SQFA 3B09A 4X20B 2HEPA 2O57A 4JI0O 4JI4O 4UCUA 4X9QA 3A0HZ 4UV8A 2PYJA 2A7WA 1BT8A 4NXMO 2FYUH 4I55A 1K97A 1F4MA 3CCVV 4TV8B 2GTSA 1M56B 4KFMA 4YY3B 5LOVB 3CD6V 1AILA 1ZL8B 1MZFA 3JD3A 1QR9A 3K03A 1DLBA 4JAVA 2ZE5A 2HHHB 4FM2A 1FXKA 3UKMA 1QVFU 3ASNB 3TK1A 3ABLB 4Z1VA 3K3WA 2WSSG 1VF6A 4O4HB 4P9OA 4OXSA 5EC1C 5JCOC 4FLTA 4DR4O 2DYRC 3T4DA 2PYLA 3WG7C 4GYCB 1NR1A 4JYCA 3CC7V 1MABG 2IJHA 1SERA 4K0KB 1XREA 2ARHA 1XQ8A 3K5LA 3R65A 4JI6B
chains in the Genus database with same CATH topology
4DR1O 1XNQO 2N74A 4OPHA 1R6TA 3OTOO 2FKXA 2E5LO 3F5TA 2VQEO 4DV2O 4AQYO 4LF8O 2F4VO 2ZKOA 4DR2O 5BXZA 3J80N 5IT9N 1FJGO 2JRIA 4B3RO 4GKJO 2UXDO 1J5EO 4YY3O 4X62O 4DUYO 5A2QN 3J7AU 3R66A 1DK1A 2ZM6O 5H5NA 4JI2O 5LL6Y 2HHHO 1YZBA 1FKAO 4LFCO 2AGAA 4JI0O 4JI4O 2LW7A 3SDLA 3J81N 4DV7O 4KHPO 2UUAO 4LFBO 1HNZO 4DR5O 2UUCO 4B3TO 1IBKO 4NXMO 4DV3O 4JV5O 1N32O 4DV1O 1F7YA 4DR6O 1NS1A 1A32A 1FYJA 4DV0O 1AILA 1N33O 3T1YO 4LF7O 4DV4O 3T1HO 2DOSA 1HNWO 1I94O 2VQFO 1HNXO 1R1BA 4K0KO 4X65O 3RT3C 2UXBO 4DV6O 4NXNO 1N34O 2DJVA 1N36O 1IBMO 4A5UB 4DR3O 5LMNO 5BY1A 4JYAO 4JI6O 5LMUO 1XNRO 4DUZO 4B3MO 4JI5O 4OPAA 1G1XB 2UXCO 4DR4O 2UUBO 1XMOO 4LF5O 4LF6O 4JI7O 5IWAO 5BR8O 4JI1O 1HR0O 4DR7O 4B3SO 1X59A 4YHHO 2UU9O 3O65A 4DV5O 3M8AA 1AB3A 1XEQA 1KUQA 4X66O 4LF4O 2Z0AA 3JAMN 1D2DA 4LFAO 1XMQO 4OX9O 4GKKO 5FLXN 1IBLO 4JI8O 4LF9O 4X64O 4JI3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 O;  1XNQ O;  2N74 A;  4OPH A;  1R6T A;  3OTO O;  2FKX A;  2E5L O;  3F5T A;  2VQE O;  4DV2 O;  4AQY O;  4LF8 O;  2F4V O;  2ZKO A;  4DR2 O;  5BXZ A;  3J80 N;  5IT9 N;  1FJG O;  2JRI A;  4B3R O;  4GKJ O;  2UXD O;  1J5E O;  4YY3 O;  4X62 O;  4DUY O;  5A2Q N;  3J7A U;  3R66 A;  1DK1 A;  2ZM6 O;  5H5N A;  4JI2 O;  5LL6 Y;  2HHH O;  1YZB A;  1FKA O;  4LFC O;  2AGA A;  4JI0 O;  4JI4 O;  2LW7 A;  3SDL A;  3J81 N;  4DV7 O;  4KHP O;  2UUA O;  4LFB O;  1HNZ O;  4DR5 O;  2UUC O;  4B3T O;  1IBK O;  4NXM O;  4DV3 O;  4JV5 O;  1N32 O;  4DV1 O;  1F7Y A;  4DR6 O;  1NS1 A;  1A32 A;  1FYJ A;  4DV0 O;  1AIL A;  1N33 O;  3T1Y O;  4LF7 O;  4DV4 O;  3T1H O;  2DOS A;  1HNW O;  1I94 O;  2VQF O;  1HNX O;  1R1B A;  4K0K O;  4X65 O;  3RT3 C;  2UXB O;  4DV6 O;  4NXN O;  1N34 O;  2DJV A;  1N36 O;  1IBM O;  4A5U B;  4DR3 O;  5LMN O;  5BY1 A;  4JYA O;  4JI6 O;  5LMU O;  1XNR O;  4DUZ O;  4B3M O;  4JI5 O;  4OPA A;  1G1X B;  2UXC O;  4DR4 O;  2UUB O;  1XMO O;  4LF5 O;  4LF6 O;  4JI7 O;  5IWA O;  5BR8 O;  4JI1 O;  1HR0 O;  4DR7 O;  4B3S O;  1X59 A;  4YHH O;  2UU9 O;  3O65 A;  4DV5 O;  3M8A A;  1AB3 A;  1XEQ A;  1KUQ A;  4X66 O;  4LF4 O;  2Z0A A;  3JAM N;  1D2D A;  4LFA O;  1XMQ O;  4OX9 O;  4GKK O;  5FLX N;  1IBL O;  4JI8 O;  4LF9 O;  4X64 O;  4JI3 O; 
#chains in the Genus database with same CATH topology
 4DR1 O;  3ASO B;  2CTP A;  3IJ4 A;  5FNV B;  2UXC B;  4ASU G;  2WLN A;  3OMI B;  1XMO B;  4GZR B;  3OTO O;  4DRX B;  3U10 A;  4PA4 A;  1HR0 B;  3ZX6 A;  3BA9 A;  4DV5 B;  3T4Z A;  2GDS A;  1JX9 A;  2OCC C;  2CTR A;  3G71 V;  1YVW A;  2ZM6 O;  1YIT V;  1R3I C;  3SPH A;  4UVA A;  3STL C;  3ZS8 C;  2LFS A;  1FPO A;  1QU7 A;  4PI0 A;  1YHQ V;  1K73 W;  5JQG A;  1KQS U;  3N2K B;  3J81 N;  3RFR A;  1FAF A;  1WJZ A;  4JI4 B;  3DXR A;  3L9D A;  4MS2 A;  1IXB A;  1ZSP A;  2KG7 B;  4NXM B;  2Y0P A;  2W0F C;  3SGI A;  3HB3 B;  4FLZ A;  3G6B A;  5B1N A;  4O4J B;  4UFZ A;  3B8M A;  5E79 Z;  1S72 V;  2R9A A;  1K9M W;  1PKX A;  1WLE A;  2EJ7 A;  3D3I A;  4LCU C;  3LSQ A;  2EZP A;  4FFB B;  2HFE C;  1XDC A;  3BCC H;  1LNQ A;  3GVM A;  1KMI Z;  3B77 A;  1IBM O;  5LMU O;  2YUA A;  1EN5 A;  1DGS A;  2FTK A;  5LXT B;  5EIB D;  4UVC A;  1QLE B;  1SET A;  4JTC B;  3JAT A;  1SKV A;  4BW9 A;  4HAM A;  4I0X B;  4YHH O;  4J41 A;  1Q82 W;  4X1K B;  4FK5 C;  4O2A B;  2Q7H A;  3D36 A;  4E2L A;  1Q90 D;  4LWS B;  1O9G A;  3FX7 A;  4IHJ B;  2BOB C;  2QTS A;  5EBW C;  3TXQ A;  4JI8 O;  4FMT A;  4CC5 A;  4FFK A;  3K9A A;  4NTY A;  3SJQ C;  1ZAU A;  2E76 B;  2WLL B;  1M57 C;  4JI7 B;  3ZHS A;  2ZE6 A;  1OJH A;  3QF7 A;  2ZKO A;  3O9O A;  4DR2 O;  2JDI G;  1KKD A;  3APO A;  2P22 C;  4H13 B;  3U11 A;  4W4L A;  3LDE A;  4JZG A;  1GRJ A;  4MSW C;  2WA4 A;  4MTO A;  3G80 A;  3OAA G;  1J5E O;  5J2T B;  3JAW B;  2VS0 A;  5GON B;  3ETQ A;  2RDC A;  4R8C A;  2NN4 A;  3CCL V;  3UCS C;  4EFE A;  4LFC O;  2HVK C;  4HBN A;  4FPP A;  2EIK C;  1NT2 B;  4QIW F;  1AR5 A;  2XT9 A;  3CP1 A;  2RJZ A;  2G38 A;  4GKJ B;  4F6R B;  1Q7Y W;  3NR7 A;  2YXY A;  3RYH B;  3VQW A;  3ZHT A;  3TGU H;  3ZRX A;  1HNW O;  1NVP D;  2E75 B;  3WB1 A;  3HKB B;  3RYF B;  2WWW A;  2YEV B;  1ZL8 A;  3RYC B;  4B3M O;  5L3D A;  4N21 A;  1NI8 A;  4RQF A;  3K5O A;  2JGD B;  4EB6 A;  4J42 A;  3MD0 A;  1DF5 A;  1M5I A;  4I9Q A;  4PEL A;  1IVS A;  2P6J A;  1V55 C;  3DTU B;  5LHI A;  1GAX A;  4MVM A;  3F7V C;  3L72 H;  4YHH B;  4LNU B;  4TUY B;  5GW7 A;  4GUN A;  5DM6 V;  1OCZ B;  5B3S B;  1ARO P;  4U7O A;  4X64 O;  3CX5 F;  4JYA B;  4YJ3 B;  1TUB A;  2QTO A;  4OPH A;  5JCO A;  4WFF A;  4CH4 A;  1PV0 A;  4H44 B;  1Q6U A;  4DV2 O;  1VQO V;  1MSW D;  1ZLZ A;  3ETG A;  4PHZ A;  1K4C C;  1S5H C;  4RQE A;  5IYZ B;  5H6R A;  3CYO A;  4YIO A;  1OHH G;  3K58 A;  4DRX A;  1K7D A;  2GBO A;  3T1C A;  5LL6 Y;  2ZXW B;  1YZB A;  5KHJ A;  5EIB C;  2AGA A;  1T5E A;  3SDL A;  3E8B A;  4P2Z A;  3E22 A;  2NNU A;  1BS3 A;  1SS3 A;  3CC4 V;  2X0L A;  1GN4 A;  4JV5 O;  1JVM A;  3HKD B;  4I9W A;  4WF9 V;  2IU0 A;  2UXN A;  1FYJ A;  2QDO A;  1RFY A;  4GLX A;  3N2K A;  3CXC U;  4LF7 O;  1HDJ A;  2YIB D;  2QM4 A;  2EIM C;  1FXK C;  5JJJ B;  3Q4H A;  4PDM A;  1NTM H;  1HNW B;  3VQY A;  2KQX A;  3OGC C;  2UXB O;  2E74 B;  1ORQ C;  2DJV A;  4RWU A;  3AG4 B;  4DR3 O;  4X1I A;  1IBK B;  4O4J A;  1AI5 A;  2V7Q G;  1Y76 B;  5B66 Z;  4B3M B;  4DR6 B;  4UB6 Z;  2B1G A;  1VQK V;  4LF6 O;  3ABU A;  2EIN B;  1OCO C;  1X59 A;  2ATK C;  3JAL B;  4UXN A;  5ITZ B;  5K1P A;  1L0L H;  3SYC A;  4LFA O;  4DV6 B;  1R3L C;  3AG1 B;  4TWK A;  1P7B A;  4GX1 A;  2A0L A;  5B1O A;  2A06 H;  4X64 B;  4WFH A;  4TV9 B;  4X1K A;  4WFE A;  2E5L O;  2R9R B;  2CH7 B;  3ABM B;  2VRZ A;  2PUS A;  3HKE B;  3E89 A;  4NVP A;  4LF4 B;  2ITD C;  1XL6 A;  1YSC A;  2JEX A;  4W4K A;  4H0L B;  1QNM A;  2WLL A;  4HNA A;  1P49 A;  3P3N A;  5CA0 A;  3L71 H;  1XOU A;  5KHK A;  5DEC A;  1QLN A;  4O4L B;  2K1E A;  1BHA A;  3PJS K;  3UT5 B;  1BZK A;  1TUE B;  4ICG A;  4JAU A;  2RQ6 A;  3JAW A;  1SQQ H;  5FL7 G;  2R9I A;  4DV3 O;  3GB7 C;  5KUM A;  3SPC A;  4JV5 B;  5IY5 C;  4DV0 O;  2QKC A;  3PN1 A;  1VF5 B;  1VQ5 V;  2XAS A;  3T1Y O;  1KC8 W;  1Z5W A;  3T1H O;  5CA3 A;  3THO A;  4RO2 A;  3SPI A;  4CS4 A;  5D5Q A;  3C90 A;  4J9Z B;  3CPW U;  2A79 B;  3VQV A;  3I56 V;  1FFT B;  3ZN1 A;  4A5U B;  4EEQ A;  4F6R A;  3H1K H;  1VMG A;  4DUZ O;  3OTF A;  3CE2 A;  4DV1 B;  2GUZ B;  5IWA O;  1EZJ A;  1FFX B;  2YEV A;  4J7K A;  1EZV H;  3M99 B;  4ZHQ B;  3E86 A;  3OW2 U;  3GWO A;  3DGE A;  3RYC A;  2PY5 A;  5JVD B;  2CGO A;  1JFF A;  5EYP A;  2OWO A;  1NH2 B;  3ZMS A;  1GN6 A;  3K0D A;  1Z5V A;  1KB9 F;  4O4I B;  1E1R G;  2N74 A;  4TQD A;  4J11 A;  4X8A A;  4K3A A;  4O2B B;  1I08 A;  4G28 B;  5B1B B;  4UVB A;  2BE3 A;  2F4V O;  3I5D A;  4IIJ A;  1OCC B;  5BXZ A;  3W7S A;  4F6E A;  1IXM A;  2QE7 G;  5EC2 C;  2Q68 A;  4LBE C;  2HLD G;  3KKY A;  3L75 H;  5IJ0 A;  1IBL B;  1G8M A;  2EIL B;  4JYB A;  2AZ2 A;  1TAE A;  1WA8 B;  3JAS B;  1FXV A;  2ITC C;  2CTW A;  2L35 A;  2V1D A;  1SES A;  3IFX A;  2UUC O;  1H2G A;  4MT8 A;  4LF8 B;  3B40 A;  3FKS G;  4DV3 B;  4MVR A;  2L6L A;  5L3C A;  2ZT9 B;  2UXX A;  1QBZ A;  4DUY B;  1SZX A;  2WLI B;  2IJI A;  2ZE7 A;  3ZRW B;  4LH6 A;  4J10 A;  1I94 O;  2VQF O;  2YI9 A;  1CPY A;  1V54 B;  3CME V;  3MHH C;  5H2F Z;  3QO5 A;  4K35 A;  3RT3 C;  3WFV A;  3ZRS A;  2BTQ A;  3AK3 A;  1AP6 A;  2BCC H;  2AHY A;  2Q4P A;  1LR1 A;  3BA8 A;  2B5U A;  4FLU A;  5JJE B;  1KBH A;  4D6T H;  1NBM G;  5CMU A;  2ZNI A;  4DUZ B;  3C3S A;  5BMV B;  5KA5 A;  3ASN C;  1ROP A;  2Y48 A;  1VP7 A;  5JH7 A;  2CE4 A;  4FJC C;  5D5P A;  1FXH A;  2ZNJ A;  4UCO A;  1K8A W;  2Y0I A;  3HKC B;  1G4Y B;  1PL0 A;  1Q6H A;  3JSL A;  4RUF A;  3RBZ A;  2IH1 C;  5LMN B;  1RPR A;  3MAQ A;  2JEU A;  1B3Q A;  3JAL A;  3JYC A;  3SJB C;  5FPR A;  4FZ0 A;  2VWJ A;  4C7U A;  4BR6 A;  4YJ2 A;  5J2U B;  4PA3 A;  4I7Z B;  2VQE O;  1BE3 H;  4B3S B;  4IT5 A;  1WB8 A;  2F4V B;  1JCH A;  4B3R O;  1YCI A;  1S3J A;  1K5S A;  1JA8 A;  2LGQ A;  3ETE A;  3J7A U;  2FL4 A;  5H5N A;  1Q81 W;  4JI2 O;  3RVZ A;  4JI3 B;  3T2M A;  3RGB A;  1YJ9 V;  1K92 A;  5LP6 B;  1Y4M A;  2UUA O;  3BRC A;  1KD1 W;  1N0J A;  4DR5 O;  4CH5 A;  3OD4 A;  4U3J A;  1S0V A;  2GTA A;  2ZIO A;  4IL6 Z;  1F7Y A;  3UO3 A;  3KCY A;  3SR2 C;  1XHZ A;  4MVO A;  4RAI A;  1X4T A;  3S3X A;  3RYI B;  1RSO B;  3OEH G;  3W7X A;  4DV4 O;  2OIG A;  1HNX O;  2DQ3 A;  1XHX A;  2DE0 X;  1D5A A;  4WFB V;  4JI0 B;  1LUV A;  4NXN O;  4QPK A;  2F95 B;  1N36 O;  3EXA A;  4UV9 A;  3E2E A;  1UFI A;  1RP3 B;  1HP8 A;  5KHH A;  5F2V O;  2UUB O;  1AJN A;  1I7F A;  2BTO A;  1GN2 A;  2RNB A;  3K59 A;  2DYS B;  4BIU A;  3JAK A;  1IX9 A;  5L3F A;  4L87 A;  2V4D A;  4P30 A;  1W0K G;  5EBL C;  2ZCE A;  2Z5U A;  3CCJ V;  1S5L Z;  1XMQ O;  1RM1 B;  2XUM A;  1FFX A;  2IW5 A;  5EBM C;  2QEX V;  4DR4 B;  1NJI W;  5E1A C;  4X88 A;  5J9P C;  2WLH A;  4PDR A;  2C2A A;  2VQE B;  1KP2 A;  3OT7 A;  4IYH A;  3CMA V;  2LP7 A;  4O4I A;  2UXD O;  1VF7 A;  1L0N H;  1Y66 A;  1N4C A;  4J9Y B;  3P3P A;  2BSK B;  2H8P C;  4DR1 B;  2Y69 C;  4L8J A;  4LH7 A;  2W6J G;  4WBN A;  1H2L A;  4MTG A;  3OTO B;  1GM7 A;  4B3T O;  2UUA B;  4DR5 B;  3X2Q B;  1G6U A;  2KB1 A;  2YIB A;  1K33 A;  3OM3 B;  1H2S B;  4G27 B;  3L73 H;  1N32 O;  4PA7 A;  5KLV H;  2WLJ A;  5L3B A;  2NLJ C;  1WB7 A;  1DF4 A;  5C8Y A;  3I55 V;  2ZM6 B;  2DW4 A;  1SQV H;  4PV1 B;  1VAR A;  2P90 A;  2F43 G;  3OEE G;  4CH6 A;  1JPX A;  3W7W A;  2QWN B;  1HNX B;  1P84 F;  1F51 A;  2P5O A;  4WFG A;  1VQP V;  2W6I G;  1AR4 A;  4PA6 A;  1VQ6 V;  1VQ7 V;  2P7T C;  3ABT A;  3ZHU A;  4X20 A;  2PGG A;  5IJ9 B;  4G2K A;  3CJH B;  5BR8 O;  5KHG A;  5JJN B;  1EN4 A;  3OUF A;  3CCS V;  3N2G B;  4X1Y B;  4TV8 A;  4KXR A;  2PTM A;  2Z0A A;  4DXW A;  2QKA A;  3A8T A;  5LOV A;  5FLX N;  4OX9 O;  4PJ0 Z;  4XBF A;  1IBM B;  1OV9 A;  4LF9 O;  5LMU B;  4CC6 A;  2HJD A;  4MW8 A;  1VQN V;  3ZHV A;  3STZ C;  1YTF B;  1SA0 B;  3OR7 C;  1OCZ C;  2YIA A;  5B3S C;  2Q8V A;  4P9P A;  4ZI7 B;  3RW0 A;  4AQY O;  3DC5 A;  4O4H A;  5DN6 G;  4FM0 A;  3HR0 A;  5L3G A;  2JK5 C;  1R6K A;  1I0H A;  2R70 A;  4HZ3 A;  3CS5 A;  2ZR2 A;  4X62 O;  2XHB A;  4QE7 A;  1SQX H;  5KX5 B;  2QA4 V;  4JI8 B;  2ZQM A;  5J2U A;  1OCR B;  1URF A;  3RVY A;  5LGT A;  4I4T B;  2RCV A;  1FKA O;  1CP9 A;  1JQ0 A;  2B9Z A;  1Y74 B;  3BY6 A;  2YC0 A;  3AK1 A;  1PD3 A;  4B3T B;  4DR2 B;  2ZXW C;  2YIC A;  2M6Y A;  5FNV A;  3AG2 B;  3LDC A;  1J5E B;  3BAB A;  5LGN A;  1W59 A;  1VEW A;  4GX2 A;  1OZ0 A;  1NH2 D;  4ZKI A;  4QGP A;  4PD4 F;  3ZHR A;  4KL1 A;  4LFC B;  1B6Q A;  5CB4 B;  4X65 O;  1H2K A;  4IGG A;  4JGS A;  1XNR O;  1Q6I A;  4JI5 O;  2Q7G A;  4OPA A;  1G1X B;  3DSQ A;  3H1I H;  4HYO A;  1MSD A;  3UM7 A;  1JMK C;  4LC1 A;  3AG4 C;  1XI1 A;  2A9H A;  1GM9 A;  4ZOL B;  1WN7 A;  2KG7 A;  5KAI Z;  1PPJ H;  1AB3 A;  3OR6 C;  4FLV A;  1EBO A;  3EHB B;  2Q9L A;  3G67 A;  3E8H A;  2EIN C;  1XNQ O;  5TIS Z;  1W0J G;  4FFB A;  1BQ0 A;  3S3W A;  4R6Z A;  3JAR B;  4J7J A;  3LNM B;  3AG1 C;  3ZMZ A;  3EVK A;  3H1H H;  3J80 N;  1FJG O;  4BAY A;  2EIM B;  1FXK B;  3FB5 C;  1W2B U;  4JZ2 A;  3ZED A;  5LXT A;  3CWB H;  3R66 A;  3U0Z A;  3FYI B;  1MG1 A;  4YIP A;  4I0X A;  1ZX3 A;  4NTW A;  2Z3Y A;  3ABM C;  2IH3 C;  3CHX A;  1GN3 A;  1BCC H;  2B1I A;  4O2A A;  4LWS A;  3IGA C;  3E35 A;  4IHJ A;  1HNZ O;  2DQ0 A;  3ABK B;  3IAY A;  4LP8 A;  3B8N A;  2QM8 A;  3AG7 A;  4DV2 B;  3LDD A;  1OCO B;  3JSN A;  2Y4T A;  3OE7 G;  2E3C A;  2RMK B;  3E83 A;  3APQ A;  1PNK A;  5L3E A;  4J80 A;  1COW G;  4XDK A;  2OT5 A;  1IDS A;  1H8H G;  5JWP A;  3ZBH A;  3AK2 A;  3SJA C;  3BHP A;  5B1A B;  2WAM A;  5J2T A;  1N34 O;  5GON A;  4X65 B;  2QWP B;  3QTC A;  2F93 B;  3K08 A;  1BMF G;  2BOC C;  4LF5 O;  3ICX A;  1Q5O A;  3H1J H;  3VBB A;  4DR7 O;  3MHS C;  2ZDI C;  2FML A;  2UU9 O;  4LF7 B;  3SYQ A;  1JR9 A;  2QSA A;  1YXB A;  2EIJ B;  5JQG B;  4X66 O;  4BIO A;  4DO2 A;  2Q67 A;  5H6Q A;  3DXR B;  2H3O A;  2UXB B;  4BW5 A;  3FAV B;  4GKK O;  3FD9 A;  3G6E V;  5EK0 A;  4DR3 B;  3RYH A;  1MZE A;  3KZI Z;  3M7M X;  1P7G A;  1YIJ V;  2DWE C;  1XNQ B;  3SYP A;  1E79 G;  1R6T A;  1EFR G;  1F4N A;  3HKB A;  3ZIA G;  3SYO A;  2RN9 A;  3RYF A;  4X1Y A;  4LF6 B;  1O9H A;  3D8C A;  3F5T A;  5EZY B;  5HFM A;  1VIB A;  2WA3 A;  2JGD A;  2YDE A;  4YY3 O;  5B1B C;  3ZCC A;  3KCX A;  4LFA B;  1S77 D;  5A2Q N;  5KHI A;  1HWY A;  4WFA V;  3JD1 A;  3LSU A;  2HHH O;  3JD4 A;  4LNU A;  1QVG U;  4TUY A;  4MW3 A;  3AG3 B;  1R73 A;  4KUM A;  1YJW V;  4DW1 A;  3JAT B;  2EBO A;  2OIE A;  2E5L B;  2EIL C;  3LUT B;  4OGQ B;  2P4K A;  2AZ0 A;  4YJ3 A;  1DTO A;  2DN9 A;  4JTA B;  1XBL A;  2WPD G;  4NTX A;  1MOF A;  1SQP H;  3K5M A;  2VWK A;  4R7C A;  2IJK A;  4CBC A;  4TOI A;  2LFR A;  1I5Y A;  1AI4 A;  5KMG B;  4K0K O;  5IYZ A;  1UPG A;  4U3F H;  3SYA A;  3CRC A;  5LGU A;  4QPJ A;  4PI2 A;  3G4S V;  2PI4 A;  4JI6 O;  2UXC O;  4BIZ A;  3VOU A;  1V54 C;  1XMO O;  1QR8 A;  2GSM B;  3BPZ A;  4DV0 B;  4DK0 A;  4YXW G;  4LF5 B;  1HR0 O;  5CB4 A;  3WB2 A;  4DR7 B;  3T1Y B;  3ZRV A;  2ZD9 A;  3T1H B;  3QNE A;  1XL4 A;  4DV5 O;  3OUS A;  3HKD A;  1PP9 H;  5LA6 B;  1M56 C;  1US6 A;  4MVZ A;  5DED A;  1L1F A;  4X66 B;  1JJO A;  2CDY A;  3K5N A;  2AHZ A;  1F23 A;  1KYO F;  2YI8 A;  1Y67 A;  3A0R A;  3ABL C;  1V9P A;  5IWA B;  1TVK B;  1K5Q A;  4UB8 Z;  3UO2 A;  4N23 A;  1K34 A;  2MK3 A;  3CRQ A;  3H01 A;  2P06 A;  3JCU Z;  1TGO A;  2QM7 A;  1AVM A;  1R6N A;  1Y76 A;  4NB5 A;  2ADP A;  2OCH A;  1TA8 A;  1AJQ A;  2YXL A;  3JAR A;  4DW0 A;  1PNL A;  5ITZ A;  2XTA A;  1KKC A;  2ILM A;  2ZR3 A;  4EB6 B;  4DV7 O;  4KHP O;  5LHG A;  1WP7 A;  2XAF A;  3FB6 C;  3FFQ A;  3ASO C;  4MVS A;  4X89 A;  2X6C A;  4WCE V;  3K0G A;  5LP6 C;  1A32 A;  1Q86 W;  5CN0 A;  4TV9 A;  5GTI Z;  3H9V A;  5IYD O;  1N0N A;  3JD0 A;  3F5W C;  5H9C A;  4EKW A;  1TUB B;  4Z1M G;  3P30 A;  2CH7 A;  2M7W A;  4FZ1 A;  1YTF D;  3HKE A;  2GV9 A;  1K3E A;  2DYR B;  2XND G;  5KAF Z;  5K1X A;  2UUC B;  1ZTE A;  4QJF B;  4XDJ A;  3NXS A;  3WG7 B;  4EFB A;  2A3Q A;  3H1L H;  3TET A;  3CEI A;  2KKW A;  1D5N A;  4O4L A;  1EN6 A;  2X7R B;  1CXZ B;  3UT5 A;  1B04 A;  4JI7 O;  4QNH B;  3CCE V;  1K4D C;  1PL4 A;  1S76 D;  4I50 B;  2IM9 A;  1I94 B;  2VQF B;  1XEQ A;  4TT3 G;  2DYS C;  3E22 B;  5KA6 A;  1L8D A;  1NKD A;  1SF9 A;  2QJ1 A;  2IJJ A;  1QCE A;  2PF4 E;  4CS3 A;  4FLX A;  3CXH F;  1LUW A;  2JGU A;  1BQZ A;  1CEZ A;  2WLM A;  3K79 A;  2OCC B;  4GX0 A;  3TJT A;  1M93 A;  1RM1 C;  1XIL A;  3FAV A;  1Y6X A;  3CB2 A;  3W7T A;  2ZDI A;  3Q4H B;  2EZO A;  4J7Z A;  3CRM A;  1ZUQ A;  4GKJ O;  1QLE C;  2GUZ A;  4ZIB A;  3IC7 A;  2EX3 A;  4X1I B;  4BWA A;  3B2E E;  2HJF C;  5EZY A;  4MVU A;  4ZHQ A;  1UJW B;  4LFB O;  2H94 A;  2LW7 A;  5JVD A;  4DV7 B;  1JJ2 U;  4KHP B;  1GM8 A;  4FVM A;  4GT1 A;  3BAA A;  3GWK C;  4B3R B;  1Q8I A;  4UCT A;  4O2B A;  4MTF A;  4GCZ A;  1VQ8 V;  1GH6 A;  2CTQ A;  3X2Q C;  4JAA A;  4JI2 B;  2DOS A;  4Q20 A;  3CCU V;  4DYL A;  3CCM V;  2Q5Z A;  2YS8 A;  1YI2 V;  1GTO A;  3CRA A;  3L74 H;  4JYA O;  3BVO A;  4IYI A;  5BZB A;  1M4U A;  3TXS A;  1YJN V;  1WA8 A;  3JAS A;  1AI7 A;  4H33 A;  2OTJ V;  5KMG A;  2CGN A;  3OFN G;  1YDX A;  4HNA B;  5CA0 B;  4RUE A;  1YEW A;  4AI8 A;  4DV4 B;  3CCR V;  3ZMU A;  3RWR D;  2Y69 B;  1R3J C;  4TQF A;  1M90 W;  3JAM N;  3K04 A;  5CBH A;  1NQT A;  5CA1 B;  4TSF G;  1M57 B;  4NXN B;  1N36 B;  2WLI A;  2D3O W;  2Q69 A;  3RN4 A;  3D3Q A;  1SQG A;  1BHB A;  3ZRW A;  1J95 A;  3P32 A;  5IDJ A;  2UUB B;  1HW7 A;  2D2C B;  1U96 A;  5LA6 A;  4MTX A;  3ZN0 A;  2KSD A;  3WU2 Z;  2JJ1 G;  1SRY A;  1QHT A;  1Q43 A;  2W0X A;  5BMV A;  2EIK B;  1VQL V;  2AW9 A;  1XMQ B;  2XAQ A;  4U7N A;  3OMA B;  3W7U A;  3TCU A;  1TVK A;  2WLK A;  4E4E A;  3HKC A;  2QWO B;  3OGI B;  1RPO A;  2JS3 A;  1M9N A;  4LFB B;  2ADQ B;  1M1K W;  1IBK O;  3ML0 A;  1NR7 A;  1OCR C;  3QO7 A;  2ETN A;  2XAG A;  1AR1 B;  4JAS A;  4K8Z A;  4DR6 O;  3HPL C;  1NS1 A;  2UXD B;  1JFF B;  1VQ9 V;  5EYP B;  4B7E A;  1NTZ H;  2Q0A A;  4QE9 A;  1ZWI C;  1N33 O;  2JIZ G;  1WPB A;  5KUK A;  1MMM A;  2GHY A;  4F4L A;  3SJC C;  1R1B A;  3AG2 C;  4D7S A;  2IBZ H;  4DV6 O;  4FLW A;  2PZS A;  2P4V A;  1V55 B;  1GK9 A;  4PDV A;  4IIJ B;  3SPG A;  1WAZ A;  5GTH Z;  1N32 B;  4I5S A;  2K9P A;  3ZMT A;  2X6B A;  4CH3 A;  5LP6 A;  3L70 H;  4XDL A;  5LBQ A;  3ZMV A;  1NU1 H;  5IJ0 B;  2LO1 A;  1IZ3 A;  1BSM A;  3K9S A;  2X6A A;  1KUQ A;  2HP8 A;  3DC6 A;  4LF4 O;  4UCR A;  1BL8 A;  3SPJ A;  1D2D A;  1H2M A;  3RYI A;  5IYC O;  1RSO A;  3LSS A;  4PDL A;  4I50 A;  4FM1 A;  2JJ2 G;  4H37 A;  5BR8 B;  2F1M A;  2CK3 G;  1GKF A;  5LYJ B;  5FPO A;  5IT9 N;  2Q73 A;  3VQX A;  2BTQ B;  3OMN B;  1MA1 A;  4OX9 B;  4I55 B;  4LF9 B;  4PA9 A;  3EFF K;  5CBG A;  3CRR A;  1P4R A;  4NYK A;  4FLY A;  1WP8 A;  3E8G A;  5C93 A;  1JOY A;  5JH7 B;  1YF2 A;  1VF6 C;  4UUJ C;  3KG2 A;  4AQY B;  5B5E Z;  2HVJ C;  4DV1 O;  3ETD A;  2N05 A;  3CCQ V;  1BGY H;  4LR3 A;  3ABK C;  4X62 B;  4KP4 A;  4CZZ A;  1VQM V;  1EM1 A;  2HG5 C;  4JF3 A;  1N33 B;  1KP3 A;  2IU3 A;  3K06 A;  4YJ2 B;  2F66 C;  2LGW A;  5BY1 A;  4D7T A;  2BSK A;  2R72 A;  4UCV A;  2HKO A;  5B1A C;  3WB0 A;  4JI1 O;  3QO8 A;  3BFR A;  2F23 A;  3FYE B;  1PNM A;  3O65 A;  1QQC A;  1S5J A;  2CUG A;  1U97 A;  3CSX A;  5LHH A;  2AXT Z;  2DMX A;  1IBL O;  2OYQ A;  4U3J B;  1XNR B;  1H2N A;  1NVP B;  2EIJ C;  2QWQ B;  4JI5 B;  2YID A;  4FIP C;  4R50 A;  3CC2 V;  1SZT A;  2ZIM A;  1VQ4 V;  1WNS A;  4CS2 A;  2YXH A;  4JTD B;  4GX5 A;  2P67 A;  5CA1 A;  4LF8 O;  1Z2G A;  2Y4U A;  1XUQ A;  1AP5 A;  1FS0 G;  4Z2W A;  4NKG B;  2EJR A;  3C3T A;  2JVD A;  1KEC A;  5IJ9 A;  4DUY O;  3CJH A;  2YSU B;  5AG2 A;  2Q7E A;  4B08 A;  5A9G A;  3A2F A;  2ZE8 A;  1AJP A;  3N2G A;  2LW1 A;  1H38 A;  1NTK H;  1FD9 A;  2N04 A;  3F7Y C;  5IY5 B;  5CBF A;  3K57 A;  1GO3 F;  3JAK B;  2QR4 A;  1PM9 A;  1THZ A;  2ZIN A;  2DWD C;  4ZBM A;  4JYY A;  1FJG B;  3JCZ A;  3AG3 C;  1SA0 A;  3ZHQ A;  4AIL C;  2EUL A;  5IYB O;  2HR3 A;  2XAJ A;  5HFL A;  1IUR A;  3QG5 A;  1B06 A;  1OCC C;  4ZI7 A;  1E1Q G;  4ABM A;  1GMG A;  3D36 C;  1MNG A;  1NZ6 A;  1SQB H;  1WPX A;  1HNZ B;  3IC9 A;  5KX5 A;  3QVN A;  5LMN O;  3B4S A;  3AEI A;  1H8E G;  4K8X A;  4I4T A;  1Q3E A;  4Q6G A;  3MDS A;  1Y74 A;  3A0B Z;  2ODM A;  4B3S O;  2MW2 B;  4JI1 B;  4DK1 A;  2JS5 A;  2XOK G;  2PI5 A;  4AHC A;  4WBN B;  3M8A A;  2QWR B;  1ENV A;  2QKS A;  1KU9 A;  3FB7 C;  1N34 B;  3ZJZ A;  1I5X A;  4JI3 O;  2OTL V;  3BEH A;  4UCS A;  2FB5 A;  2LQT A;  2FKX A;  3JD2 A;  3N27 A;  5C8Y B;  5IE9 A;  2QGN A;  2NR5 A;  1R3K C;  3LNN A;  4JPR A;  3E8F A;  2UU9 B;  1N8R W;  3FB8 C;  2Q6A A;  4NR1 A;  2JRI A;  1SC5 B;  1AI6 A;  4B7K A;  2CAZ C;  2LJ2 A;  2Q0O C;  2XAH A;  4GKK B;  1DK1 A;  3UQ8 A;  4MVQ A;  5LYJ A;  4ZOL A;  1SQF A;  3B09 A;  4X20 B;  2HEP A;  2O57 A;  4JI0 O;  4JI4 O;  4UCU A;  4X9Q A;  3A0H Z;  4UV8 A;  2PYJ A;  2A7W A;  1BT8 A;  4NXM O;  2FYU H;  4I55 A;  1K97 A;  1F4M A;  3CCV V;  4TV8 B;  2GTS A;  1M56 B;  4KFM A;  4YY3 B;  5LOV B;  3CD6 V;  1AIL A;  1ZL8 B;  1MZF A;  3JD3 A;  1QR9 A;  3K03 A;  1DLB A;  4JAV A;  2ZE5 A;  2HHH B;  4FM2 A;  1FXK A;  3UKM A;  1QVF U;  3ASN B;  3TK1 A;  3ABL B;  4Z1V A;  3K3W A;  2WSS G;  1VF6 A;  4O4H B;  4P9O A;  4OXS A;  5EC1 C;  5JCO C;  4FLT A;  4DR4 O;  2DYR C;  3T4D A;  2PYL A;  3WG7 C;  4GYC B;  1NR1 A;  4JYC A;  3CC7 V;  1MAB G;  2IJH A;  1SER A;  4K0K B;  1XRE A;  2ARH A;  1XQ8 A;  3K5L A;  3R65 A;  4JI6 B; 
#chains in the Genus database with same CATH homology
 4DR1 O;  1XNQ O;  2N74 A;  4OPH A;  1R6T A;  3OTO O;  2FKX A;  2E5L O;  3F5T A;  2VQE O;  4DV2 O;  4AQY O;  4LF8 O;  2F4V O;  2ZKO A;  4DR2 O;  5BXZ A;  3J80 N;  5IT9 N;  1FJG O;  2JRI A;  4B3R O;  4GKJ O;  2UXD O;  1J5E O;  4YY3 O;  4X62 O;  4DUY O;  5A2Q N;  3J7A U;  3R66 A;  1DK1 A;  2ZM6 O;  5H5N A;  4JI2 O;  5LL6 Y;  2HHH O;  1YZB A;  1FKA O;  4LFC O;  2AGA A;  4JI0 O;  4JI4 O;  2LW7 A;  3SDL A;  3J81 N;  4DV7 O;  4KHP O;  2UUA O;  4LFB O;  1HNZ O;  4DR5 O;  2UUC O;  4B3T O;  1IBK O;  4NXM O;  4DV3 O;  4JV5 O;  1N32 O;  4DV1 O;  1F7Y A;  4DR6 O;  1NS1 A;  1A32 A;  1FYJ A;  4DV0 O;  1AIL A;  1N33 O;  3T1Y O;  4LF7 O;  4DV4 O;  3T1H O;  2DOS A;  1HNW O;  1I94 O;  2VQF O;  1HNX O;  1R1B A;  4K0K O;  4X65 O;  3RT3 C;  2UXB O;  4DV6 O;  4NXN O;  1N34 O;  2DJV A;  1N36 O;  1IBM O;  4A5U B;  4DR3 O;  5LMN O;  5BY1 A;  4JYA O;  4JI6 O;  5LMU O;  1XNR O;  4DUZ O;  4B3M O;  4JI5 O;  4OPA A;  1G1X B;  2UXC O;  4DR4 O;  2UUB O;  1XMO O;  4LF5 O;  4LF6 O;  4JI7 O;  5IWA O;  5BR8 O;  4JI1 O;  1HR0 O;  4DR7 O;  4B3S O;  1X59 A;  4YHH O;  2UU9 O;  3O65 A;  4DV5 O;  3M8A A;  1AB3 A;  1XEQ A;  1KUQ A;  4X66 O;  4LF4 O;  2Z0A A;  3JAM N;  1D2D A;  4LFA O;  1XMQ O;  4OX9 O;  4GKK O;  5FLX N;  1IBL O;  4JI8 O;  4LF9 O;  4X64 O;  4JI3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...