2E5LO

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2e5lO00
1XMOO 2DOSA 1AILA 2AGAA 4B3SO 4DV3O 1HNXO 4JI6O 2FKXA 4DR3O 2VQEO 2UXBO 4JI3O 4OPAA 1FYJA 5H5NA 1XNQO 4JV5O 4JI0O 1AB3A 2ZM6O 3O65A 1FKAO 4JI4O 3OTOO 4X66O 2VQFO 3T1YO 1J5EO 4DR2O 2F4VO 5FLXN 4LF5O 3R66A 4LF7O 4JI2O 3M8AA 2UUAO 1KUQA 4OPHA 4LFAO 5BY1A 4X62O 4JYAO 1X59A 4JI7O 4JI5O 4DR4O 4OX9O 1N36O 2UXCO 4X64O 4B3TO 4DUZO 4KHPO 3J80N 2JRIA 3RT3C 4DUYO 4LF4O 4LF8O 1XEQA 1A32A 4DR7O 1YZBA 4DV1O 3J81N 2UUBO 4DV0O 1IBMO 2ZKOA 4DV4O 2Z0AA 4DV7O 3T1HO 1G1XB 4NXNO 1HNWO 1XNRO 3SDLA 5IT9N 1IBKO 3F5TA 4JI8O 1N33O 4DR5O 4GKKO 5LL6Y 2N74A 5BR8O 4YY3O 1R1BA 4DR6O 1F7YA 3J7AU 1FJGO 1D2DA 1NS1A 4DV5O 2HHHO 2UU9O 2E5LO 4B3MO 1N34O 4GKJO 4YHHO 4DR1O 4K0KO 4DV2O 1XMQO 1I94O 4LF6O 5LMNO 1IBLO 4DV6O 2UUCO 3JAMN 4JI1O 5BXZA 4LFCO 2UXDO 4LF9O 1DK1A 5IWAO 1R6TA 4X65O 1N32O 2LW7A 4LFBO 4B3RO 4NXMO 5A2QN 1HNZO 4A5UB 1HR0O 5LMUO 4AQYO 2DJVA
chains in the Genus database with same CATH superfamily
2KKWA 3JASA 2BSKA 3ASOB 5L3GA 1SQFA 1H38A 5H5NA 4MTGA 4JTDB 1D5AA 1Q6HA 1I5YA 4J9YB 4BIZA 1HNXB 1XHZA 4FPPA 5EC2C 1XI1A 2XUMA 2W6JG 4LF8B 4JI2O 3LUTB 3OFNG 1P7BA 3ICXA 3T1YB 4Z1MG 3K03A 1BHAA 4HAMA 4D6TH 1UJWB 4KXRA 1MABG 5J2UB 2CTQA 2A06H 4I7ZB 1VMGA 1AI4A 1JX9A 4JI5B 4OX9B 5BR8B 3SGIA 4ZI7B 1VEWA 3OD4A 3AK3A 1EFRG 1VQLV 3T1HO 4I50B 1BMFG 1YIJV 3OGIB 1VQ9V 3K57A 4MVUA 2YI9A 3CWBH 2ADPA 4YY3O 3OMIB 4LH6A 2ZE6A 1SETA 2OCCB 1N0JA 2OT5A 1OCZB 3FYEB 4GX0A 2HFEC 4TQFA 5KMGB 2DWEC 1N34O 2FMLA 2A7WA 3IFXA 1R6KA 3JAWA 2BCCH 4MTOA 2Y69B 2YIBD 4JI1O 2OIEA 2EILC 3B77A 2UXDO 3DC6A 4LF9O 1FXKC 1K4DC 2QWOB 4NTXA 4A5UB 5LXTA 1JOYA 1EN5A 1RPRA 1AR5A 1NH2B 2DJVA 5JJJB 1J5EB 1GN6A 3E35A 1J95A 1W59A 4L87A 5EK0A 5ITZA 1VF7A 4YJ3B 4OPAA 4JI3O 4U3FH 3Q4HA 4IHJA 4JI7B 4B3SB 4DR2O 4FLZA 5EBMC 2ZXWC 1EN4A 4QPJA 3RYIB 3OTOB 4DV1B 4Q20A 2F93B 4JAUA 3UT5B 2JEXA 4DR4O 3E22B 4O2AB 3DXRA 3VQWA 2YXLA 1R3KC 1SC5B 4UV8A 5CB4A 3VOUA 2NR5A 3J80N 2JRIA 1YCIA 3WB0A 2GUZB 1QLEC 4UCTA 1VF6A 2Y48A 3B8NA 1TVKA 4X62B 1KMIZ 4MS2A 3AG2B 3FAVA 1JCHA 3T2MA 4RWUA 4HNAA 4JZ2A 1VQPV 4GKJB 2XASA 4QPKA 2JJ1G 4TUYB 1EZJA 3BA8A 1VQ8V 1HNWB 2DYSC 3RYHB 3TJTA 4O4JB 1N32B 4YHHO 2IBZH 4FJCC 3K06A 3RFRA 1IBLO 2YXHA 2ZR2A 2WLIA 2FYUH 1VQ5V 5JH7B 1F4MA 1BHBA 4DV2B 2EX3A 3T1CA 4X65O 5LMNB 3QNEA 3R65A 4PA4A 4JF3A 2EIMC 3CCEV 1Z5WA 5J2TA 2XAJA 4MVRA 1F51A 3ETEA 3MD0A 1RSOB 5IWAB 1QQCA 3AG4B 2CUGA 4FZ1A 1LNQA 4AQYO 3APQA 3ASOC 2VQEO 5C93A 5KX5B 1BZKA 1GN3A 2JGDB 4F6EA 1KB9F 4X1KB 1N4CA 3IC9A 1Y76B 3WB2A 1WLEA 4IL6Z 5KHJA 4LF7O 2RQ6A 2QEXV 1WB8A 1K3EA 5JJNB 3KG2A 4DV7B 2P90A 3DSQA 2UXCO 3RYFA 2AZ2A 4GX5A 4GUNA 5IYZA 1SZXA 2YEVA 3X2QB 4LF4O 3FB8C 3SPJA 1QVGU 3ZX6A 1Y6XA 4FFBA 2LGWA 5IE9A 1T5EA 1SQXH 3NR7A 3PJSK 3G67A 1QHTA 4DV4B 3I5DA 4U3JA 3IGAC 1R3IC 1Z5VA 2E74B 1S0VA 3PN1A 1P7GA 3SYOA 2OCCC 5CN0A 1WA8A 4UVAA 5BZBA 1OCZC 3JALA 3CHXA 4CS2A 3ABKB 1SKVA 3CRMA 4DW1A 1YSCA 3A0HZ 4QGPA 1FJGB 1M1KW 3SPIA 1Q81W 4J80A 4CBCA 2E5LB 3D3IA 4RUEA 1OHHG 1GTOA 4K0KB 3BAAA 4EKWA 4AI8A 3A0BZ 4FVMA 1IXMA 1HNZO 5E1AC 3ZBHA 1IXBA 1S5HC 2ZM6B 2WA3A 3K0DA 3CCSV 2YIAA 1M57B 1DGSA 2V4DA 1K4CC 1WPXA 2PF4E 5CA0B 3W7SA 2RDCA 3OEHG 1NT2B 1PM9A 4CS3A 3MAQA 4DK1A 4DV3B 1Y67A 3FB6C 5FLXN 4P30A 3D3QA 3BRCA 4X1YA 5H6QA 3TXSA 3L9DA 3M8AA 4GYCB 2VQFB 4DR7B 4XBFA 4O2BA 3CCUV 5H2FZ 4JYAO 1WP8A 2DYRB 1CXZB 2CE4A 1HW7A 2ZD9A 4NVPA 1MMMA 3M7MX 3P30A 1ROPA 3SR2C 3E8BA 4IYHA 3U11A 1LUVA 3J81N 3ZRWB 2R72A 4DV0O 1IBMO 4DUZB 1NTMH 2UXNA 3AG2C 4MT8A 1VQNV 1F23A 3OW2U 3P3PA 3LSQA 4NYKA 3U10A 2AHZA 3ZN1A 1G8MA 5L3FA 4H33A 4X88A 3RVZA 3SPHA 1R1BA 4DYLA 2R70A 3J7AU 1DF4A 1L8DA 4DW0A 2LFSA 1Y66A 3K79A 3E83A 2P4VA 4O4LB 3H01A 1E1QG 4NB5A 1OCRC 4GX1A 4E4EA 3WB1A 3TK1A 2CK3G 2OTLV 3U0ZA 3FD9A 5J2UA 3CE2A 4PDMA 1JR9A 4LFCB 2XAHA 4D7TA 4RQFA 4Z1VA 1Q86W 1ZAUA 4ZI7A 5JVDB 3HKDA 1KKCA 1QBZA 4FLVA 2F43G 1ZLZA 2F66C 4I50A 3NXSA 5EIBD 2FKXA 3S3XA 1P4RA 3LDEA 5DN6G 2YIBA 4JI2B 1XNQO 1OZ0A 3P3NA 1MOFA 3ZHSA 5LGTA 2VWJA 2RMKB 2WLJA 4UFZA 1GN4A 5IYDO 3JCZA 4LF5O 3H1JH 4WBNB 1VP7A 5KMGA 3OT7A 2C2AA 3QTCA 1H2LA 1XL6A 2X7RB 4ZIBA 5BMVB 1CP9A 5EZYB 3T1HB 2QJ1A 2Y0IA 3JYCA 5LA6B 2UUAB 3N2KB 4FLUA 1SF9A 1N0NA 3CCRV 2IH1C 1NJIW 3OR7C 3ZRXA 5IJ0B 1YTFD 4UB6Z 4X64B 4W4LA 5CA1B 3ZIAG 1B06A 1JPXA 5TISZ 4JPRA 1IBKO 4WFHA 4GKKO 1N33O 3CCVV 3HKBB 4YJ3A 4JI8B 5FL7G 5DEDA 1UPGA 4LR3A 4F6RA 1NU1H 4FZ0A 1I08A 1M4UA 3ABKC 4DR6B 2GSMB 2DQ3A 2BOCC 4PV1B 3RVYA 2JS3A 1TUBB 4UCUA 3W7XA 3LDDA 3ZMSA 2X6CA 1H2MA 2JVDA 4UVBA 2FTKA 3E22A 4O2AA 3E2EA 1S5JA 3TGUH 1L0LH 3HKEA 4OGQB 4JI3B 3ASNC 3RBZA 4FFKA 4B3RB 2YXYA 4DR2B 2E76B 1P49A 4FM2A 1MNGA 1M57C 5LMUB 1Q8IA 2L6LA 2RCVA 4TUYA 1R73A 2RJZA 1EBOA 3JSNA 4G2KA 4JGSA 3RYHA 2A79B 2IJJA 3OAAG 2F4VO 4O4JA 1YF2A 4HBNA 3ABLC 3ZMUA 2YUAA 1WAZA 1Y74A 1JVMA 3ETGA 3SJQC 3CCJV 2DQ0A 2ATKC 4I4TB 2OTJV 5J9PC 5JH7A 2FL4A 2V7QG 1NBMG 4PDVA 3QO5A 4J7ZA 1FXHA 3H1HH 1G6UA 2KG7A 3G4SV 1RSOA 4DUYB 1JFFB 1ZWIC 2FB5A 4MVQA 3AG1B 4YHHB 4K8ZA 1SS3A 2KSDA 4NXNB 1XNRB 1I5XA 5KX5A 4PJ0Z 2HVJC 2JGDA 3AG3B 1TGOA 4FLYA 4B7KA 1IVSA 2YIDA 1SQBH 2G38A 2LGQA 2LP7A 3LNNA 4I5SA 4DV5O 3OGCC 2M6YA 5F2VO 2PTMA 1MZEA 1Y76A 2UU9O 4WFFA 4LCUC 4B3MO 4X89A 1PL0A 4X65B 4BW9A 4GX2A 4RO2A 3CSXA 5L3EA 1K33A 3K9AA 5LGNA 5IY5B 3EXAA 4JTAB 2XAGA 1LR1A 4I9QA 1PP9H 1KP2A 5EIBC 3AK2A 4AQYB 1H8EG 1RM1B 1ZL8B 2ITDC 3MDSA 4DV6B 1LUWA 3GWKC 2R9AA 4FM1A 1ZX3A 2GHYA 4FLXA 5KLVH 5CMUA 2QM4A 5C8YA 4LFBB 2EZOA 4NXMB 2B5UA 1FXVA 1HWYA 2CTPA 5KAFZ 1VQ4V 3UKMA 2UXBO 1PL4A 5JQGB 2AW9A 1VQ7V 3BPZA 2XOKG 1K7DA 4D7SA 4UUJC 1NVPD 4J9ZB 1QLNA 4FIPC 4MVSA 3KCXA 3R66A 3RYCB 4LF4B 5LYJA 3JD2A 2JEUA 2Q7HA 4LFAO 1XREA 4RAIA 1XUQA 4EFEA 3JATB 1K9MW 2LFRA 2E3CA 1K5QA 1M56B 4MW3A 4BAYA 3F5WC 1PNLA 4R7CA 2P06A 1EZVH 1WNSA 1YZBA 1YXBA 4YXWG 1GO3F 2DW4A 2L35A 4PI0A 3W7UA 5IT9N 1AROP 4K8XA 3FX7A 1XBLA 3CP1A 1FAFA 5CA0A 5FPOA 2ZIOA 3OEEG 4KFMA 5LGUA 1FFXB 2K1EA 4FM0A 2EINC 4UVCA 1XMQO 4LF6O 3JD0A 5LP6B 3K9SA 4X1IB 1PNMA 5B1BB 1HNZB 1GN2A 2UUCO 5JWPA 3CB2A 2WLHA 2EBOA 4MTFA 4MVOA 1DF5A 1JJOA 3N2GB 2JS5A 4PA9A 1AP5A 4C7UA 2N05A 1SQPH 4WFEA 2OWOA 2HVKC 2QE7G 1QR8A 2HJDA 3T4ZA 1XMOO 1PV0A 2EIJC 3CPWU 2AGAA 4X20B 1HNXO 2BTOA 3CD6V 3ZJZA 1H2SB 2D2CB 5EYPB 4JAVA 2H8PC 4JYAB 1QCEA 1M9NA 1YEWA 3T1YO 5LOVB 4Q6GA 1VF5B 2RN9A 2PGGA 1OV9A 4O4LA 4DV0B 1IBMB 4JI5O 4OX9O 1N36O 2YS8A 1IDSA 4UCSA 3BFRA 4UB8Z 4TWKA 3UQ8A 4JYYA 1B04A 4DO2A 1OCCB 2Y4TA 2GTAA 2V1DA 2P6JA 2Q5ZA 2WLLB 4ZBMA 3D36A 3T4DA 3FB7C 5JVDA 3CEIA 3AEIA 4XDKA 5LL6Y 3MHHC 3IAYA 2AHYA 1SQGA 1WJZA 2N74A 5FPRA 1SQQH 2IW5A 5B1AB 2KQXA 4DR5B 5KUMA 3AG3C 4P2ZA 2ZCEA 2Z5UA 4PDRA 5IY5C 3E8FA 4MVMA 4G28B 1GH6A 1VQKV 3APOA 3DC5A 1S5LZ 1PPJH 2QWNB 5BMVA 5EZYA 2R9RB 3CYOA 3K5OA 5LA6A 3N2KA 4NKGB 1HR0O 3L71H 2IJHA 5IJ0A 2WLMA 2F23A 4PA3A 1I0HA 4P9PA 4U7NA 5L3BA 3OR6C 5CA1A 2GV9A 3CRCA 3WU2Z 2GTSA 4LF5B 4B3SO 3E89A 3K3WA 4DR3O 2X0LA 1AI5A 1YVWA 2Y69C 4JV5O 4JI0O 3H1LH 3HKBA 2PY5A 5LHHA 2XNDG 3OTOO 4LWSB 4PELA 3OMAB 4I55B 3JCUZ 1DLBA 4AILC 4OPHA 5ITZB 1SERA 1GM7A 3CCMV 1TUBA 4YJ2B 5LHIA 4X62O 2HG5C 1O9GA 4IIJB 1GKFA 2RNBA 4LNUB 4IHJB 1WB7A 1H2GA 4KHPO 3FYIB 3A0RA 4GKKB 1M56C 4BIUA 4CC6A 3E8HA 5FNVB 1Q90D 3M99B 1OCOB 2UUBO 4CH4A 3G80A 1NI8A 4CC5A 1URFA 1HNWO 5H6RA 4L8JA 1V55B 1M5IA 1NZ6A 5D5QA 2ZINA 2MW2B 4QNHB 2W0XA 3CCQV 1WN7A 1Q82W 4ZHQB 1BGYH 1AP6A 2DN9A 5A9GA 1AR4A 1BL8A 1XDCA 2WA4A 5HFMA 4DV2O 2BE3A 5LMNO 4TT3G 1K5SA 5EBWC 3ABTA 5LP6C 5B1BC 2CGNA 5BXZA 4O4IB 3CRAA 3O9OA 2F95B 4DR1B 4I4TA 1DK1A 5IWAO 1XOUA 2LW1A 1E1RG 1EN6A 3ZCCA 2NNUA 2IH3C 1VIBA 5E79Z 3P32A 3VBBA 2X6BA 2MK3A 1FS0G 3K5LA 4X8AA 3JAKB 2Q8VA 1JFFA 2HJFC 3VQYA 4LBEC 4JI6O 1S77D 1FYJA 3CRQA 3O65A 5J2TB 1PNKA 2B1GA 1GM9A 4X66O 2HEPA 4R50A 2ITCC 4J7KA 2OCHA 3TETA 4K3AA 4H37A 3STLC 3AG4C 4XDLA 1MA1A 2Q73A 3FFQA 3H1KH 4PA7A 4TV9B 3L73H 3C3TA 4B3TO 1SA0B 3MHSC 1OCCC 1Q7YW 2Q7GA 1YTFB 4DV4O 3BEHA 3CX5F 3SDLA 3C3SA 2E75B 4K35A 3D8CA 1K34A 4B3MB 2CDYA 2ZNJA 1TAEA 1FXKB 3ML0A 3ABUA 2P22C 1H2KA 4DK0A 3KKYA 5JQGA 1FJGO 4H13B 1NS1A 2BTQB 2WPDG 5B1AC 2HHHO 2WSSG 3VQVA 3X2QC 3I55V 3I56V 3CRRA 4JYBA 4J41A 2E5LO 1SZTA 4YY3B 3ZMTA 4K0KO 1DTOA 2AZ0A 3BVOA 4RQEA 1Q3EA 1N34B 3B09A 4ZOLB 4KP4A 3JATA 1YDXA 5JCOA 1WA8B 1AI7A 1X4TA 4JI1B 3RGBA 2UXDB 4LF9B 2H3OA 2UXXA 3K04A 3ZRSA 3FB5C 1UFIA 4RUFA 5KHGA 1HP8A 3RN4A 3WG7B 3OMNB 4F4LA 4DV3O 3FKSG 3RYIA 2IJKA 2EZPA 1QLEB 5EBLC 2XT9A 3UT5A 4LFAB 5EC1C 3HKCB 3JARB 4B7EA 1R3LC 4JI4O 2VQFO 2GUZA 2ETNA 1MZFA 2PI4A 2DE0X 1FFXA 4YIOA 1NKDA 2CAZC 5CBGA 3EHBB 3S3WA 4Z2WA 2QTOA 2QTSA 3K0GA 4IGGA 5LP6A 4X1IA 1MG1A 5GONB 1R3JC 2DYSB 4MSWC 1JJ2U 4DUZO 2QM7A 3BY6A 3N27A 3E86A 3CXHF 1A32A 1AJPA 2ADQB 4DR4B 1AJQA 1VQ6V 4PD4F 4JZGA 1OCOC 1YHQV 1NR7A 3W7TA 1U96A 3OTFA 4CH6A 1I7FA 1V55C 4DRXB 5JJEB 2OYQA 2DYRC 3CC4V 3C90A 2JDIG 4J7JA 5EYPA 4O4HB 4TQDA 3THOA 2LJ2A 5LOVA 1I94O 3JD4A 2Q4PA 2P67A 3IC7A 3OM3B 2XAFA 2X6AA 4LFCO 5IYBO 3HR0A 2WLNA 2CH7B 4QE9A 1L0NH 4GLXA 3K58A 1MSDA 1XMOB 1IBLB 2A9HA 2QWQB 3G71V 4X1KA 5KA5A 2EJ7A 2CGOA 3EFFK 3QG5A 3EVKA 3B4SA 2WLLA 2LO1A 2PYJA 2ZE5A 4FLWA 5HFLA 4WF9V 1RP3B 2ZNIA 4TSFG 3SJCC 3H1IH 2YI8A 3KZIZ 2YC0A 4ICGA 1FKAO 4U7OA 4X9QA 3ZHQA 3W7WA 1N36B 2VQEB 3HKDB 2QKSA 1E79G 1B6QA 4OXSA 2YDEA 4WFGA 1NVPB 2NN4A 4J10A 3D36C 2UUAO 5K1XA 2Q7EA 3BHPA 4ASUG 2R9IA 4X64O 4LF7B 1BQ0A 1US6A 1SRYA 1XL4A 4E2LA 2UXCB 1SESA 2N04A 1NR1A 1S3JA 4WFAV 4JI8O 1S72V 1ORQC 3CS5A 1WP7A 3UCSC 3L75H 5GW7A 4DR6O 1YJ9V 4TV8B 3K5NA 1VARA 4PHZA 2QWRB 4LWSA 4XDJA 3RW0A 2Y4UA 4I55A 2OIGA 1Q5OA 3OUSA 5IJ9B 5B1NA 2IU0A 1HR0B 1BE3H 3ETQA 3A2FA 4UCOA 4YJ2A 4IIJA 4LNUA 3ZEDA 1R6TA 3ZHTA 1KP3A 1H2NA 1KBHA 4F6RB 4B3RO 4DR3B 4BW5A 2Q68A 5FNVA 2WLKA 1GMGA 4JV5B 4JI0B 4I0XB 5LMUO 1NH2D 2EULA 1SQVH 2IJIA 2LQTA 4CH5A 2VWKA 1KYOF 5KHIA 3LDCA 3SYPA 3ZMZA 3WG7C 3KCYA 5CA3A 3HKEB 4AHCA 1CPYA 1AVMA 3K5MA 5L3DA 3CJHB 2XTAA 4ZHQA 4KHPB 2Q69A 1GK9A 2ILMA 4UV9A 3UM7A 4EB6B 3JD1A 2Z3YA 1BS3A 5GTHZ 3ZRWA 2QDOA 3ZHVA 1XHXA 2UUBB 3QVNA 3QF7A 2PUSA 4O4IA 1NTZH 3GVMA 1OJHA 4G27B 3RT3C 4DUYO 4LF8O 4IYIA 1QR9A 4JYCA 1KQSU 3CXCU 4BWAA 2JIZG 2ZKOA 2GBOA 1CEZA 1Y74B 1OCRB 1TA8A 5DECA 4NXNO 3F7VC 3JASB 4QJFB 2BSKB 1XNRO 2XAQA 3JAKA 3CC2V 3LNMB 1MSWD 4H0LB 4EEQA 4JASA 5BR8O 2WWWA 1RPOA 2KG7B 1ENVA 1Z2GA 1W2BU 2HP8A 1M90W 1KD1W 3B40A 2ZDIC 1M93A 4J11A 2DMXA 4BR6A 1W0KG 3RWRD 2VRZA 4DV6O 2CTWA 1QNMA 5KA6A 3AG1C 3ZS8C 4TV9A 1KKDA 4NTYA 1P84F 1SA0A 1Q6IA 2LW7A 4LFBO 1YI2V 1AJNA 2ZR3A 4JI6B 4TOIA 4NXMO 1KECA 4UXNA 1RFYA 3CMEV 4X66B 3ZHUA 4WBNA 2Q0OC 3AG7A 1AILA 5LHGA 1AR1B 2ARHA 4FMTA 2ZQMA 1FXKA 4MTXA 4QE7A 2NLJC 3DGEA 1GRJA 3ZRVA 1FPOA 2WAMA 4R8CA 1QU7A 1V54B 1IZ3A 1RM1C 4LH7A 2BTQA 5K1PA 1J5EO 2PZSA 4B3TB 5KUKA 5C8YB 4UCVA 1XNQB 3CMAV 4PA6A 1PKXA 2O57A 1KUQA 3JAWB 3HPLC 1THZA 4KUMA 2EIKB 3CC7V 1X59A 4JI7O 1K97A 3DTUB 4ZOLA 4R6ZA 5B1OA 3SJBC 3TXQA 5LXTB 1IX9A 4DV1O 1YJNV 2W6IG 3SYAA 4FLTA 5LYJB 3GB7C 3ZHRA 2Z0AA 1ZTEA 2IU3A 2A0LA 4HYOA 1K8AW 4KL1A 2HHHB 1KU9A 3ABMB 1VQMV 4N23A 3Q4HB 1AI6A 4H44B 2ZIMA 2B1IA 2QR4A 5JCOC 3TCUA 1IBKB 2Q0AA 5B66Z 1N33B 2QSAA 3ASNB 3STZC 3QO7A 3HKCA 3JARA 3H9VA 5B3SB 5IYCO 1YJWV 4GKJO 1ZSPA 4GT1A 5DM6V 3G6EV 1PD3A 1FD9A 4J42A 3A8TA 3JAMN 3K08A 3DXRB 5CB4B 2JJ2G 5GONA 1HDJA 1WPBA 1BCCH 2P7TC 1YITV 2KB1A 1N32O 1TVKB 2IM9A 3SPCA 1B3QA 3BABA 2D3OW 1D5NA 3FAVB 5A2QN 4JAAA 3ABLB 2GDSA 4DXWA 3IJ4A 4HNAB 4GCZA 1BQZA 5CBHA 4JI4B 1Q6UA 2DOSA 4NTWA 2Y0PA 4CS4A 4DRXA 2QWPB 1TUEB 1EM1A 3OE7G 3E8GA 1JQ0A 1XQ8A 4CZZA 4O4HA 3OUFA 4LP8A 2ZDIA 5H9CA 4NR1A 2QKAA 1QVFU 2WLIB 1JA8A 1NTKH 2EJRA 2HKOA 1U97A 1NQTA 2F4VB 2A3QA 5CBFA 1K92A 2VS0A 2AXTZ 4I9WA 3QO8A 2CH7A 2HR3A 1FFTB 4IT5A 1XILA 4W4KA 3ZN0A 4EFBA 4DV7O 2QGNA 1G1XB 3SJAC 1N8RW 1G4YB 4DR5O 2YSUB 2ZE7A 1ZUQA 1I94B 1W0JG 3AK1A 1D2DA 4YIPA 4JTCB 1ZL8A 3G6BA 2B9ZA 3LSSA 2JK5C 4DV5B 3SYQA 2UU9B 3JD3A 2EILB 3RYFB 3L72H 2QM8A 5IYZB 2YEVB 5D5PA 4MVZA 3B2EE 4FFBB 4GZRB 5LBQA 2ODMA 3CCLV 3L74H 4CH3A 1BT8A 1V9PA 1K73W 3RYCA 4HZ3A 2HLDG 1VQOV 4U3JB 3JSLA 2CTRA 1AB3A 2ZM6O 3JALB 4TV8A 2JGUA 2Q6AA 1V54C 3GWOA 2ZXWB 2UXBB 4BIOA 1GM8A 2P4KA 4N21A 5BY1A 3ZMVA 2XHBA 5IJ9A 1R6NA 2EIKC 2ZT9B 4QIWF 1F4NA 3BCCH 2F1MA 2QKCA 1JMKC 3HB3B 1KC8W 2H94A 1Y4MA 2Q67A 1XEQA 4LC1A 4P9OA 3LSUA 3ETDA 1BSMA 4DR7O 2EINB 3VQXA 1GAXA 4I0XA 5B5EZ 3L70H 3F5TA 4UCRA 3ABMC 5KAIZ 3UO2A 2YICA 5KHHA 1Q43A 1F7YA 2PYLA 1S76D 4PDLA 3SPGA 3B8MA 2DWDC 5L3CA 3N2GA 4X1YB 3CJHA 5B3SC 2P5OA 1H8HG 4DR1O 2PI5A 2EIJB 4O2BB 4EB6A 5GTIZ 2K9PA 3BA9A 4B08A 2ZE8A 2Q9LA 4WCEV 2W0FC 4X20A 1O9HA 2QA4V 1IURA 1XMQB 5IDJA 4LF6B 1L1FA 2EIMB 2BOBC 2UUCB 5AG2A 1VF6C 4PI2A 4ZKIA 3WFVA 3K59A 5KHKA 3F7YC 1COWG 4MW8A 4ABMA 4WFBV 3SYCA 2M7WA 4FK5C 3UO3A
chains in the Genus database with same CATH topology
1XMOO 2DOSA 1AILA 2AGAA 4B3SO 4DV3O 1HNXO 4JI6O 2FKXA 4DR3O 2VQEO 2UXBO 4JI3O 4OPAA 1FYJA 5H5NA 1XNQO 4JV5O 4JI0O 1AB3A 2ZM6O 3O65A 1FKAO 4JI4O 3OTOO 4X66O 2VQFO 3T1YO 1J5EO 4DR2O 2F4VO 5FLXN 4LF5O 3R66A 4LF7O 4JI2O 3M8AA 2UUAO 1KUQA 4OPHA 4LFAO 5BY1A 4X62O 4JYAO 1X59A 4JI7O 4JI5O 4DR4O 4OX9O 1N36O 2UXCO 4X64O 4B3TO 4DUZO 4KHPO 3J80N 2JRIA 3RT3C 4DUYO 4LF4O 4LF8O 1XEQA 1A32A 4DR7O 1YZBA 4DV1O 3J81N 2UUBO 4DV0O 1IBMO 2ZKOA 4DV4O 2Z0AA 4DV7O 3T1HO 1G1XB 4NXNO 1HNWO 1XNRO 3SDLA 5IT9N 1IBKO 3F5TA 4JI8O 1N33O 4DR5O 4GKKO 5LL6Y 2N74A 5BR8O 4YY3O 1R1BA 4DR6O 1F7YA 3J7AU 1FJGO 1D2DA 1NS1A 4DV5O 2HHHO 2UU9O 2E5LO 4B3MO 1N34O 4GKJO 4YHHO 4DR1O 4K0KO 4DV2O 1XMQO 1I94O 4LF6O 5LMNO 1IBLO 4DV6O 2UUCO 3JAMN 4JI1O 5BXZA 4LFCO 2UXDO 4LF9O 1DK1A 5IWAO 1R6TA 4X65O 1N32O 2LW7A 4LFBO 4B3RO 4NXMO 5A2QN 1HNZO 4A5UB 1HR0O 5LMUO 4AQYO 2DJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO O;  2DOS A;  1AIL A;  2AGA A;  4B3S O;  4DV3 O;  1HNX O;  4JI6 O;  2FKX A;  4DR3 O;  2VQE O;  2UXB O;  4JI3 O;  4OPA A;  1FYJ A;  5H5N A;  1XNQ O;  4JV5 O;  4JI0 O;  1AB3 A;  2ZM6 O;  3O65 A;  1FKA O;  4JI4 O;  3OTO O;  4X66 O;  2VQF O;  3T1Y O;  1J5E O;  4DR2 O;  2F4V O;  5FLX N;  4LF5 O;  3R66 A;  4LF7 O;  4JI2 O;  3M8A A;  2UUA O;  1KUQ A;  4OPH A;  4LFA O;  5BY1 A;  4X62 O;  4JYA O;  1X59 A;  4JI7 O;  4JI5 O;  4DR4 O;  4OX9 O;  1N36 O;  2UXC O;  4X64 O;  4B3T O;  4DUZ O;  4KHP O;  3J80 N;  2JRI A;  3RT3 C;  4DUY O;  4LF4 O;  4LF8 O;  1XEQ A;  1A32 A;  4DR7 O;  1YZB A;  4DV1 O;  3J81 N;  2UUB O;  4DV0 O;  1IBM O;  2ZKO A;  4DV4 O;  2Z0A A;  4DV7 O;  3T1H O;  1G1X B;  4NXN O;  1HNW O;  1XNR O;  3SDL A;  5IT9 N;  1IBK O;  3F5T A;  4JI8 O;  1N33 O;  4DR5 O;  4GKK O;  5LL6 Y;  2N74 A;  5BR8 O;  4YY3 O;  1R1B A;  4DR6 O;  1F7Y A;  3J7A U;  1FJG O;  1D2D A;  1NS1 A;  4DV5 O;  2HHH O;  2UU9 O;  2E5L O;  4B3M O;  1N34 O;  4GKJ O;  4YHH O;  4DR1 O;  4K0K O;  4DV2 O;  1XMQ O;  1I94 O;  4LF6 O;  5LMN O;  1IBL O;  4DV6 O;  2UUC O;  3JAM N;  4JI1 O;  5BXZ A;  4LFC O;  2UXD O;  4LF9 O;  1DK1 A;  5IWA O;  1R6T A;  4X65 O;  1N32 O;  2LW7 A;  4LFB O;  4B3R O;  4NXM O;  5A2Q N;  1HNZ O;  4A5U B;  1HR0 O;  5LMU O;  4AQY O;  2DJV A; 
#chains in the Genus database with same CATH topology
 2KKW A;  3JAS A;  2BSK A;  3ASO B;  5L3G A;  1SQF A;  1H38 A;  5H5N A;  4MTG A;  4JTD B;  1D5A A;  1Q6H A;  1I5Y A;  4J9Y B;  4BIZ A;  1HNX B;  1XHZ A;  4FPP A;  5EC2 C;  1XI1 A;  2XUM A;  2W6J G;  4LF8 B;  4JI2 O;  3LUT B;  3OFN G;  1P7B A;  3ICX A;  3T1Y B;  4Z1M G;  3K03 A;  1BHA A;  4HAM A;  4D6T H;  1UJW B;  4KXR A;  1MAB G;  5J2U B;  2CTQ A;  2A06 H;  4I7Z B;  1VMG A;  1AI4 A;  1JX9 A;  4JI5 B;  4OX9 B;  5BR8 B;  3SGI A;  4ZI7 B;  1VEW A;  3OD4 A;  3AK3 A;  1EFR G;  1VQL V;  3T1H O;  4I50 B;  1BMF G;  1YIJ V;  3OGI B;  1VQ9 V;  3K57 A;  4MVU A;  2YI9 A;  3CWB H;  2ADP A;  4YY3 O;  3OMI B;  4LH6 A;  2ZE6 A;  1SET A;  2OCC B;  1N0J A;  2OT5 A;  1OCZ B;  3FYE B;  4GX0 A;  2HFE C;  4TQF A;  5KMG B;  2DWE C;  1N34 O;  2FML A;  2A7W A;  3IFX A;  1R6K A;  3JAW A;  2BCC H;  4MTO A;  2Y69 B;  2YIB D;  4JI1 O;  2OIE A;  2EIL C;  3B77 A;  2UXD O;  3DC6 A;  4LF9 O;  1FXK C;  1K4D C;  2QWO B;  4NTX A;  4A5U B;  5LXT A;  1JOY A;  1EN5 A;  1RPR A;  1AR5 A;  1NH2 B;  2DJV A;  5JJJ B;  1J5E B;  1GN6 A;  3E35 A;  1J95 A;  1W59 A;  4L87 A;  5EK0 A;  5ITZ A;  1VF7 A;  4YJ3 B;  4OPA A;  4JI3 O;  4U3F H;  3Q4H A;  4IHJ A;  4JI7 B;  4B3S B;  4DR2 O;  4FLZ A;  5EBM C;  2ZXW C;  1EN4 A;  4QPJ A;  3RYI B;  3OTO B;  4DV1 B;  4Q20 A;  2F93 B;  4JAU A;  3UT5 B;  2JEX A;  4DR4 O;  3E22 B;  4O2A B;  3DXR A;  3VQW A;  2YXL A;  1R3K C;  1SC5 B;  4UV8 A;  5CB4 A;  3VOU A;  2NR5 A;  3J80 N;  2JRI A;  1YCI A;  3WB0 A;  2GUZ B;  1QLE C;  4UCT A;  1VF6 A;  2Y48 A;  3B8N A;  1TVK A;  4X62 B;  1KMI Z;  4MS2 A;  3AG2 B;  3FAV A;  1JCH A;  3T2M A;  4RWU A;  4HNA A;  4JZ2 A;  1VQP V;  4GKJ B;  2XAS A;  4QPK A;  2JJ1 G;  4TUY B;  1EZJ A;  3BA8 A;  1VQ8 V;  1HNW B;  2DYS C;  3RYH B;  3TJT A;  4O4J B;  1N32 B;  4YHH O;  2IBZ H;  4FJC C;  3K06 A;  3RFR A;  1IBL O;  2YXH A;  2ZR2 A;  2WLI A;  2FYU H;  1VQ5 V;  5JH7 B;  1F4M A;  1BHB A;  4DV2 B;  2EX3 A;  3T1C A;  4X65 O;  5LMN B;  3QNE A;  3R65 A;  4PA4 A;  4JF3 A;  2EIM C;  3CCE V;  1Z5W A;  5J2T A;  2XAJ A;  4MVR A;  1F51 A;  3ETE A;  3MD0 A;  1RSO B;  5IWA B;  1QQC A;  3AG4 B;  2CUG A;  4FZ1 A;  1LNQ A;  4AQY O;  3APQ A;  3ASO C;  2VQE O;  5C93 A;  5KX5 B;  1BZK A;  1GN3 A;  2JGD B;  4F6E A;  1KB9 F;  4X1K B;  1N4C A;  3IC9 A;  1Y76 B;  3WB2 A;  1WLE A;  4IL6 Z;  5KHJ A;  4LF7 O;  2RQ6 A;  2QEX V;  1WB8 A;  1K3E A;  5JJN B;  3KG2 A;  4DV7 B;  2P90 A;  3DSQ A;  2UXC O;  3RYF A;  2AZ2 A;  4GX5 A;  4GUN A;  5IYZ A;  1SZX A;  2YEV A;  3X2Q B;  4LF4 O;  3FB8 C;  3SPJ A;  1QVG U;  3ZX6 A;  1Y6X A;  4FFB A;  2LGW A;  5IE9 A;  1T5E A;  1SQX H;  3NR7 A;  3PJS K;  3G67 A;  1QHT A;  4DV4 B;  3I5D A;  4U3J A;  3IGA C;  1R3I C;  1Z5V A;  2E74 B;  1S0V A;  3PN1 A;  1P7G A;  3SYO A;  2OCC C;  5CN0 A;  1WA8 A;  4UVA A;  5BZB A;  1OCZ C;  3JAL A;  3CHX A;  4CS2 A;  3ABK B;  1SKV A;  3CRM A;  4DW1 A;  1YSC A;  3A0H Z;  4QGP A;  1FJG B;  1M1K W;  3SPI A;  1Q81 W;  4J80 A;  4CBC A;  2E5L B;  3D3I A;  4RUE A;  1OHH G;  1GTO A;  4K0K B;  3BAA A;  4EKW A;  4AI8 A;  3A0B Z;  4FVM A;  1IXM A;  1HNZ O;  5E1A C;  3ZBH A;  1IXB A;  1S5H C;  2ZM6 B;  2WA3 A;  3K0D A;  3CCS V;  2YIA A;  1M57 B;  1DGS A;  2V4D A;  1K4C C;  1WPX A;  2PF4 E;  5CA0 B;  3W7S A;  2RDC A;  3OEH G;  1NT2 B;  1PM9 A;  4CS3 A;  3MAQ A;  4DK1 A;  4DV3 B;  1Y67 A;  3FB6 C;  5FLX N;  4P30 A;  3D3Q A;  3BRC A;  4X1Y A;  5H6Q A;  3TXS A;  3L9D A;  3M8A A;  4GYC B;  2VQF B;  4DR7 B;  4XBF A;  4O2B A;  3CCU V;  5H2F Z;  4JYA O;  1WP8 A;  2DYR B;  1CXZ B;  2CE4 A;  1HW7 A;  2ZD9 A;  4NVP A;  1MMM A;  3M7M X;  3P30 A;  1ROP A;  3SR2 C;  3E8B A;  4IYH A;  3U11 A;  1LUV A;  3J81 N;  3ZRW B;  2R72 A;  4DV0 O;  1IBM O;  4DUZ B;  1NTM H;  2UXN A;  3AG2 C;  4MT8 A;  1VQN V;  1F23 A;  3OW2 U;  3P3P A;  3LSQ A;  4NYK A;  3U10 A;  2AHZ A;  3ZN1 A;  1G8M A;  5L3F A;  4H33 A;  4X88 A;  3RVZ A;  3SPH A;  1R1B A;  4DYL A;  2R70 A;  3J7A U;  1DF4 A;  1L8D A;  4DW0 A;  2LFS A;  1Y66 A;  3K79 A;  3E83 A;  2P4V A;  4O4L B;  3H01 A;  1E1Q G;  4NB5 A;  1OCR C;  4GX1 A;  4E4E A;  3WB1 A;  3TK1 A;  2CK3 G;  2OTL V;  3U0Z A;  3FD9 A;  5J2U A;  3CE2 A;  4PDM A;  1JR9 A;  4LFC B;  2XAH A;  4D7T A;  4RQF A;  4Z1V A;  1Q86 W;  1ZAU A;  4ZI7 A;  5JVD B;  3HKD A;  1KKC A;  1QBZ A;  4FLV A;  2F43 G;  1ZLZ A;  2F66 C;  4I50 A;  3NXS A;  5EIB D;  2FKX A;  3S3X A;  1P4R A;  3LDE A;  5DN6 G;  2YIB A;  4JI2 B;  1XNQ O;  1OZ0 A;  3P3N A;  1MOF A;  3ZHS A;  5LGT A;  2VWJ A;  2RMK B;  2WLJ A;  4UFZ A;  1GN4 A;  5IYD O;  3JCZ A;  4LF5 O;  3H1J H;  4WBN B;  1VP7 A;  5KMG A;  3OT7 A;  2C2A A;  3QTC A;  1H2L A;  1XL6 A;  2X7R B;  4ZIB A;  5BMV B;  1CP9 A;  5EZY B;  3T1H B;  2QJ1 A;  2Y0I A;  3JYC A;  5LA6 B;  2UUA B;  3N2K B;  4FLU A;  1SF9 A;  1N0N A;  3CCR V;  2IH1 C;  1NJI W;  3OR7 C;  3ZRX A;  5IJ0 B;  1YTF D;  4UB6 Z;  4X64 B;  4W4L A;  5CA1 B;  3ZIA G;  1B06 A;  1JPX A;  5TIS Z;  4JPR A;  1IBK O;  4WFH A;  4GKK O;  1N33 O;  3CCV V;  3HKB B;  4YJ3 A;  4JI8 B;  5FL7 G;  5DED A;  1UPG A;  4LR3 A;  4F6R A;  1NU1 H;  4FZ0 A;  1I08 A;  1M4U A;  3ABK C;  4DR6 B;  2GSM B;  2DQ3 A;  2BOC C;  4PV1 B;  3RVY A;  2JS3 A;  1TUB B;  4UCU A;  3W7X A;  3LDD A;  3ZMS A;  2X6C A;  1H2M A;  2JVD A;  4UVB A;  2FTK A;  3E22 A;  4O2A A;  3E2E A;  1S5J A;  3TGU H;  1L0L H;  3HKE A;  4OGQ B;  4JI3 B;  3ASN C;  3RBZ A;  4FFK A;  4B3R B;  2YXY A;  4DR2 B;  2E76 B;  1P49 A;  4FM2 A;  1MNG A;  1M57 C;  5LMU B;  1Q8I A;  2L6L A;  2RCV A;  4TUY A;  1R73 A;  2RJZ A;  1EBO A;  3JSN A;  4G2K A;  4JGS A;  3RYH A;  2A79 B;  2IJJ A;  3OAA G;  2F4V O;  4O4J A;  1YF2 A;  4HBN A;  3ABL C;  3ZMU A;  2YUA A;  1WAZ A;  1Y74 A;  1JVM A;  3ETG A;  3SJQ C;  3CCJ V;  2DQ0 A;  2ATK C;  4I4T B;  2OTJ V;  5J9P C;  5JH7 A;  2FL4 A;  2V7Q G;  1NBM G;  4PDV A;  3QO5 A;  4J7Z A;  1FXH A;  3H1H H;  1G6U A;  2KG7 A;  3G4S V;  1RSO A;  4DUY B;  1JFF B;  1ZWI C;  2FB5 A;  4MVQ A;  3AG1 B;  4YHH B;  4K8Z A;  1SS3 A;  2KSD A;  4NXN B;  1XNR B;  1I5X A;  5KX5 A;  4PJ0 Z;  2HVJ C;  2JGD A;  3AG3 B;  1TGO A;  4FLY A;  4B7K A;  1IVS A;  2YID A;  1SQB H;  2G38 A;  2LGQ A;  2LP7 A;  3LNN A;  4I5S A;  4DV5 O;  3OGC C;  2M6Y A;  5F2V O;  2PTM A;  1MZE A;  1Y76 A;  2UU9 O;  4WFF A;  4LCU C;  4B3M O;  4X89 A;  1PL0 A;  4X65 B;  4BW9 A;  4GX2 A;  4RO2 A;  3CSX A;  5L3E A;  1K33 A;  3K9A A;  5LGN A;  5IY5 B;  3EXA A;  4JTA B;  2XAG A;  1LR1 A;  4I9Q A;  1PP9 H;  1KP2 A;  5EIB C;  3AK2 A;  4AQY B;  1H8E G;  1RM1 B;  1ZL8 B;  2ITD C;  3MDS A;  4DV6 B;  1LUW A;  3GWK C;  2R9A A;  4FM1 A;  1ZX3 A;  2GHY A;  4FLX A;  5KLV H;  5CMU A;  2QM4 A;  5C8Y A;  4LFB B;  2EZO A;  4NXM B;  2B5U A;  1FXV A;  1HWY A;  2CTP A;  5KAF Z;  1VQ4 V;  3UKM A;  2UXB O;  1PL4 A;  5JQG B;  2AW9 A;  1VQ7 V;  3BPZ A;  2XOK G;  1K7D A;  4D7S A;  4UUJ C;  1NVP D;  4J9Z B;  1QLN A;  4FIP C;  4MVS A;  3KCX A;  3R66 A;  3RYC B;  4LF4 B;  5LYJ A;  3JD2 A;  2JEU A;  2Q7H A;  4LFA O;  1XRE A;  4RAI A;  1XUQ A;  4EFE A;  3JAT B;  1K9M W;  2LFR A;  2E3C A;  1K5Q A;  1M56 B;  4MW3 A;  4BAY A;  3F5W C;  1PNL A;  4R7C A;  2P06 A;  1EZV H;  1WNS A;  1YZB A;  1YXB A;  4YXW G;  1GO3 F;  2DW4 A;  2L35 A;  4PI0 A;  3W7U A;  5IT9 N;  1ARO P;  4K8X A;  3FX7 A;  1XBL A;  3CP1 A;  1FAF A;  5CA0 A;  5FPO A;  2ZIO A;  3OEE G;  4KFM A;  5LGU A;  1FFX B;  2K1E A;  4FM0 A;  2EIN C;  4UVC A;  1XMQ O;  4LF6 O;  3JD0 A;  5LP6 B;  3K9S A;  4X1I B;  1PNM A;  5B1B B;  1HNZ B;  1GN2 A;  2UUC O;  5JWP A;  3CB2 A;  2WLH A;  2EBO A;  4MTF A;  4MVO A;  1DF5 A;  1JJO A;  3N2G B;  2JS5 A;  4PA9 A;  1AP5 A;  4C7U A;  2N05 A;  1SQP H;  4WFE A;  2OWO A;  2HVK C;  2QE7 G;  1QR8 A;  2HJD A;  3T4Z A;  1XMO O;  1PV0 A;  2EIJ C;  3CPW U;  2AGA A;  4X20 B;  1HNX O;  2BTO A;  3CD6 V;  3ZJZ A;  1H2S B;  2D2C B;  5EYP B;  4JAV A;  2H8P C;  4JYA B;  1QCE A;  1M9N A;  1YEW A;  3T1Y O;  5LOV B;  4Q6G A;  1VF5 B;  2RN9 A;  2PGG A;  1OV9 A;  4O4L A;  4DV0 B;  1IBM B;  4JI5 O;  4OX9 O;  1N36 O;  2YS8 A;  1IDS A;  4UCS A;  3BFR A;  4UB8 Z;  4TWK A;  3UQ8 A;  4JYY A;  1B04 A;  4DO2 A;  1OCC B;  2Y4T A;  2GTA A;  2V1D A;  2P6J A;  2Q5Z A;  2WLL B;  4ZBM A;  3D36 A;  3T4D A;  3FB7 C;  5JVD A;  3CEI A;  3AEI A;  4XDK A;  5LL6 Y;  3MHH C;  3IAY A;  2AHY A;  1SQG A;  1WJZ A;  2N74 A;  5FPR A;  1SQQ H;  2IW5 A;  5B1A B;  2KQX A;  4DR5 B;  5KUM A;  3AG3 C;  4P2Z A;  2ZCE A;  2Z5U A;  4PDR A;  5IY5 C;  3E8F A;  4MVM A;  4G28 B;  1GH6 A;  1VQK V;  3APO A;  3DC5 A;  1S5L Z;  1PPJ H;  2QWN B;  5BMV A;  5EZY A;  2R9R B;  3CYO A;  3K5O A;  5LA6 A;  3N2K A;  4NKG B;  1HR0 O;  3L71 H;  2IJH A;  5IJ0 A;  2WLM A;  2F23 A;  4PA3 A;  1I0H A;  4P9P A;  4U7N A;  5L3B A;  3OR6 C;  5CA1 A;  2GV9 A;  3CRC A;  3WU2 Z;  2GTS A;  4LF5 B;  4B3S O;  3E89 A;  3K3W A;  4DR3 O;  2X0L A;  1AI5 A;  1YVW A;  2Y69 C;  4JV5 O;  4JI0 O;  3H1L H;  3HKB A;  2PY5 A;  5LHH A;  2XND G;  3OTO O;  4LWS B;  4PEL A;  3OMA B;  4I55 B;  3JCU Z;  1DLB A;  4AIL C;  4OPH A;  5ITZ B;  1SER A;  1GM7 A;  3CCM V;  1TUB A;  4YJ2 B;  5LHI A;  4X62 O;  2HG5 C;  1O9G A;  4IIJ B;  1GKF A;  2RNB A;  4LNU B;  4IHJ B;  1WB7 A;  1H2G A;  4KHP O;  3FYI B;  3A0R A;  4GKK B;  1M56 C;  4BIU A;  4CC6 A;  3E8H A;  5FNV B;  1Q90 D;  3M99 B;  1OCO B;  2UUB O;  4CH4 A;  3G80 A;  1NI8 A;  4CC5 A;  1URF A;  1HNW O;  5H6R A;  4L8J A;  1V55 B;  1M5I A;  1NZ6 A;  5D5Q A;  2ZIN A;  2MW2 B;  4QNH B;  2W0X A;  3CCQ V;  1WN7 A;  1Q82 W;  4ZHQ B;  1BGY H;  1AP6 A;  2DN9 A;  5A9G A;  1AR4 A;  1BL8 A;  1XDC A;  2WA4 A;  5HFM A;  4DV2 O;  2BE3 A;  5LMN O;  4TT3 G;  1K5S A;  5EBW C;  3ABT A;  5LP6 C;  5B1B C;  2CGN A;  5BXZ A;  4O4I B;  3CRA A;  3O9O A;  2F95 B;  4DR1 B;  4I4T A;  1DK1 A;  5IWA O;  1XOU A;  2LW1 A;  1E1R G;  1EN6 A;  3ZCC A;  2NNU A;  2IH3 C;  1VIB A;  5E79 Z;  3P32 A;  3VBB A;  2X6B A;  2MK3 A;  1FS0 G;  3K5L A;  4X8A A;  3JAK B;  2Q8V A;  1JFF A;  2HJF C;  3VQY A;  4LBE C;  4JI6 O;  1S77 D;  1FYJ A;  3CRQ A;  3O65 A;  5J2T B;  1PNK A;  2B1G A;  1GM9 A;  4X66 O;  2HEP A;  4R50 A;  2ITC C;  4J7K A;  2OCH A;  3TET A;  4K3A A;  4H37 A;  3STL C;  3AG4 C;  4XDL A;  1MA1 A;  2Q73 A;  3FFQ A;  3H1K H;  4PA7 A;  4TV9 B;  3L73 H;  3C3T A;  4B3T O;  1SA0 B;  3MHS C;  1OCC C;  1Q7Y W;  2Q7G A;  1YTF B;  4DV4 O;  3BEH A;  3CX5 F;  3SDL A;  3C3S A;  2E75 B;  4K35 A;  3D8C A;  1K34 A;  4B3M B;  2CDY A;  2ZNJ A;  1TAE A;  1FXK B;  3ML0 A;  3ABU A;  2P22 C;  1H2K A;  4DK0 A;  3KKY A;  5JQG A;  1FJG O;  4H13 B;  1NS1 A;  2BTQ B;  2WPD G;  5B1A C;  2HHH O;  2WSS G;  3VQV A;  3X2Q C;  3I55 V;  3I56 V;  3CRR A;  4JYB A;  4J41 A;  2E5L O;  1SZT A;  4YY3 B;  3ZMT A;  4K0K O;  1DTO A;  2AZ0 A;  3BVO A;  4RQE A;  1Q3E A;  1N34 B;  3B09 A;  4ZOL B;  4KP4 A;  3JAT A;  1YDX A;  5JCO A;  1WA8 B;  1AI7 A;  1X4T A;  4JI1 B;  3RGB A;  2UXD B;  4LF9 B;  2H3O A;  2UXX A;  3K04 A;  3ZRS A;  3FB5 C;  1UFI A;  4RUF A;  5KHG A;  1HP8 A;  3RN4 A;  3WG7 B;  3OMN B;  4F4L A;  4DV3 O;  3FKS G;  3RYI A;  2IJK A;  2EZP A;  1QLE B;  5EBL C;  2XT9 A;  3UT5 A;  4LFA B;  5EC1 C;  3HKC B;  3JAR B;  4B7E A;  1R3L C;  4JI4 O;  2VQF O;  2GUZ A;  2ETN A;  1MZF A;  2PI4 A;  2DE0 X;  1FFX A;  4YIO A;  1NKD A;  2CAZ C;  5CBG A;  3EHB B;  3S3W A;  4Z2W A;  2QTO A;  2QTS A;  3K0G A;  4IGG A;  5LP6 A;  4X1I A;  1MG1 A;  5GON B;  1R3J C;  2DYS B;  4MSW C;  1JJ2 U;  4DUZ O;  2QM7 A;  3BY6 A;  3N27 A;  3E86 A;  3CXH F;  1A32 A;  1AJP A;  2ADQ B;  4DR4 B;  1AJQ A;  1VQ6 V;  4PD4 F;  4JZG A;  1OCO C;  1YHQ V;  1NR7 A;  3W7T A;  1U96 A;  3OTF A;  4CH6 A;  1I7F A;  1V55 C;  4DRX B;  5JJE B;  2OYQ A;  2DYR C;  3CC4 V;  3C90 A;  2JDI G;  4J7J A;  5EYP A;  4O4H B;  4TQD A;  3THO A;  2LJ2 A;  5LOV A;  1I94 O;  3JD4 A;  2Q4P A;  2P67 A;  3IC7 A;  3OM3 B;  2XAF A;  2X6A A;  4LFC O;  5IYB O;  3HR0 A;  2WLN A;  2CH7 B;  4QE9 A;  1L0N H;  4GLX A;  3K58 A;  1MSD A;  1XMO B;  1IBL B;  2A9H A;  2QWQ B;  3G71 V;  4X1K A;  5KA5 A;  2EJ7 A;  2CGO A;  3EFF K;  3QG5 A;  3EVK A;  3B4S A;  2WLL A;  2LO1 A;  2PYJ A;  2ZE5 A;  4FLW A;  5HFL A;  4WF9 V;  1RP3 B;  2ZNI A;  4TSF G;  3SJC C;  3H1I H;  2YI8 A;  3KZI Z;  2YC0 A;  4ICG A;  1FKA O;  4U7O A;  4X9Q A;  3ZHQ A;  3W7W A;  1N36 B;  2VQE B;  3HKD B;  2QKS A;  1E79 G;  1B6Q A;  4OXS A;  2YDE A;  4WFG A;  1NVP B;  2NN4 A;  4J10 A;  3D36 C;  2UUA O;  5K1X A;  2Q7E A;  3BHP A;  4ASU G;  2R9I A;  4X64 O;  4LF7 B;  1BQ0 A;  1US6 A;  1SRY A;  1XL4 A;  4E2L A;  2UXC B;  1SES A;  2N04 A;  1NR1 A;  1S3J A;  4WFA V;  4JI8 O;  1S72 V;  1ORQ C;  3CS5 A;  1WP7 A;  3UCS C;  3L75 H;  5GW7 A;  4DR6 O;  1YJ9 V;  4TV8 B;  3K5N A;  1VAR A;  4PHZ A;  2QWR B;  4LWS A;  4XDJ A;  3RW0 A;  2Y4U A;  4I55 A;  2OIG A;  1Q5O A;  3OUS A;  5IJ9 B;  5B1N A;  2IU0 A;  1HR0 B;  1BE3 H;  3ETQ A;  3A2F A;  4UCO A;  4YJ2 A;  4IIJ A;  4LNU A;  3ZED A;  1R6T A;  3ZHT A;  1KP3 A;  1H2N A;  1KBH A;  4F6R B;  4B3R O;  4DR3 B;  4BW5 A;  2Q68 A;  5FNV A;  2WLK A;  1GMG A;  4JV5 B;  4JI0 B;  4I0X B;  5LMU O;  1NH2 D;  2EUL A;  1SQV H;  2IJI A;  2LQT A;  4CH5 A;  2VWK A;  1KYO F;  5KHI A;  3LDC A;  3SYP A;  3ZMZ A;  3WG7 C;  3KCY A;  5CA3 A;  3HKE B;  4AHC A;  1CPY A;  1AVM A;  3K5M A;  5L3D A;  3CJH B;  2XTA A;  4ZHQ A;  4KHP B;  2Q69 A;  1GK9 A;  2ILM A;  4UV9 A;  3UM7 A;  4EB6 B;  3JD1 A;  2Z3Y A;  1BS3 A;  5GTH Z;  3ZRW A;  2QDO A;  3ZHV A;  1XHX A;  2UUB B;  3QVN A;  3QF7 A;  2PUS A;  4O4I A;  1NTZ H;  3GVM A;  1OJH A;  4G27 B;  3RT3 C;  4DUY O;  4LF8 O;  4IYI A;  1QR9 A;  4JYC A;  1KQS U;  3CXC U;  4BWA A;  2JIZ G;  2ZKO A;  2GBO A;  1CEZ A;  1Y74 B;  1OCR B;  1TA8 A;  5DEC A;  4NXN O;  3F7V C;  3JAS B;  4QJF B;  2BSK B;  1XNR O;  2XAQ A;  3JAK A;  3CC2 V;  3LNM B;  1MSW D;  4H0L B;  4EEQ A;  4JAS A;  5BR8 O;  2WWW A;  1RPO A;  2KG7 B;  1ENV A;  1Z2G A;  1W2B U;  2HP8 A;  1M90 W;  1KD1 W;  3B40 A;  2ZDI C;  1M93 A;  4J11 A;  2DMX A;  4BR6 A;  1W0K G;  3RWR D;  2VRZ A;  4DV6 O;  2CTW A;  1QNM A;  5KA6 A;  3AG1 C;  3ZS8 C;  4TV9 A;  1KKD A;  4NTY A;  1P84 F;  1SA0 A;  1Q6I A;  2LW7 A;  4LFB O;  1YI2 V;  1AJN A;  2ZR3 A;  4JI6 B;  4TOI A;  4NXM O;  1KEC A;  4UXN A;  1RFY A;  3CME V;  4X66 B;  3ZHU A;  4WBN A;  2Q0O C;  3AG7 A;  1AIL A;  5LHG A;  1AR1 B;  2ARH A;  4FMT A;  2ZQM A;  1FXK A;  4MTX A;  4QE7 A;  2NLJ C;  3DGE A;  1GRJ A;  3ZRV A;  1FPO A;  2WAM A;  4R8C A;  1QU7 A;  1V54 B;  1IZ3 A;  1RM1 C;  4LH7 A;  2BTQ A;  5K1P A;  1J5E O;  2PZS A;  4B3T B;  5KUK A;  5C8Y B;  4UCV A;  1XNQ B;  3CMA V;  4PA6 A;  1PKX A;  2O57 A;  1KUQ A;  3JAW B;  3HPL C;  1THZ A;  4KUM A;  2EIK B;  3CC7 V;  1X59 A;  4JI7 O;  1K97 A;  3DTU B;  4ZOL A;  4R6Z A;  5B1O A;  3SJB C;  3TXQ A;  5LXT B;  1IX9 A;  4DV1 O;  1YJN V;  2W6I G;  3SYA A;  4FLT A;  5LYJ B;  3GB7 C;  3ZHR A;  2Z0A A;  1ZTE A;  2IU3 A;  2A0L A;  4HYO A;  1K8A W;  4KL1 A;  2HHH B;  1KU9 A;  3ABM B;  1VQM V;  4N23 A;  3Q4H B;  1AI6 A;  4H44 B;  2ZIM A;  2B1I A;  2QR4 A;  5JCO C;  3TCU A;  1IBK B;  2Q0A A;  5B66 Z;  1N33 B;  2QSA A;  3ASN B;  3STZ C;  3QO7 A;  3HKC A;  3JAR A;  3H9V A;  5B3S B;  5IYC O;  1YJW V;  4GKJ O;  1ZSP A;  4GT1 A;  5DM6 V;  3G6E V;  1PD3 A;  1FD9 A;  4J42 A;  3A8T A;  3JAM N;  3K08 A;  3DXR B;  5CB4 B;  2JJ2 G;  5GON A;  1HDJ A;  1WPB A;  1BCC H;  2P7T C;  1YIT V;  2KB1 A;  1N32 O;  1TVK B;  2IM9 A;  3SPC A;  1B3Q A;  3BAB A;  2D3O W;  1D5N A;  3FAV B;  5A2Q N;  4JAA A;  3ABL B;  2GDS A;  4DXW A;  3IJ4 A;  4HNA B;  4GCZ A;  1BQZ A;  5CBH A;  4JI4 B;  1Q6U A;  2DOS A;  4NTW A;  2Y0P A;  4CS4 A;  4DRX A;  2QWP B;  1TUE B;  1EM1 A;  3OE7 G;  3E8G A;  1JQ0 A;  1XQ8 A;  4CZZ A;  4O4H A;  3OUF A;  4LP8 A;  2ZDI A;  5H9C A;  4NR1 A;  2QKA A;  1QVF U;  2WLI B;  1JA8 A;  1NTK H;  2EJR A;  2HKO A;  1U97 A;  1NQT A;  2F4V B;  2A3Q A;  5CBF A;  1K92 A;  2VS0 A;  2AXT Z;  4I9W A;  3QO8 A;  2CH7 A;  2HR3 A;  1FFT B;  4IT5 A;  1XIL A;  4W4K A;  3ZN0 A;  4EFB A;  4DV7 O;  2QGN A;  1G1X B;  3SJA C;  1N8R W;  1G4Y B;  4DR5 O;  2YSU B;  2ZE7 A;  1ZUQ A;  1I94 B;  1W0J G;  3AK1 A;  1D2D A;  4YIP A;  4JTC B;  1ZL8 A;  3G6B A;  2B9Z A;  3LSS A;  2JK5 C;  4DV5 B;  3SYQ A;  2UU9 B;  3JD3 A;  2EIL B;  3RYF B;  3L72 H;  2QM8 A;  5IYZ B;  2YEV B;  5D5P A;  4MVZ A;  3B2E E;  4FFB B;  4GZR B;  5LBQ A;  2ODM A;  3CCL V;  3L74 H;  4CH3 A;  1BT8 A;  1V9P A;  1K73 W;  3RYC A;  4HZ3 A;  2HLD G;  1VQO V;  4U3J B;  3JSL A;  2CTR A;  1AB3 A;  2ZM6 O;  3JAL B;  4TV8 A;  2JGU A;  2Q6A A;  1V54 C;  3GWO A;  2ZXW B;  2UXB B;  4BIO A;  1GM8 A;  2P4K A;  4N21 A;  5BY1 A;  3ZMV A;  2XHB A;  5IJ9 A;  1R6N A;  2EIK C;  2ZT9 B;  4QIW F;  1F4N A;  3BCC H;  2F1M A;  2QKC A;  1JMK C;  3HB3 B;  1KC8 W;  2H94 A;  1Y4M A;  2Q67 A;  1XEQ A;  4LC1 A;  4P9O A;  3LSU A;  3ETD A;  1BSM A;  4DR7 O;  2EIN B;  3VQX A;  1GAX A;  4I0X A;  5B5E Z;  3L70 H;  3F5T A;  4UCR A;  3ABM C;  5KAI Z;  3UO2 A;  2YIC A;  5KHH A;  1Q43 A;  1F7Y A;  2PYL A;  1S76 D;  4PDL A;  3SPG A;  3B8M A;  2DWD C;  5L3C A;  3N2G A;  4X1Y B;  3CJH A;  5B3S C;  2P5O A;  1H8H G;  4DR1 O;  2PI5 A;  2EIJ B;  4O2B B;  4EB6 A;  5GTI Z;  2K9P A;  3BA9 A;  4B08 A;  2ZE8 A;  2Q9L A;  4WCE V;  2W0F C;  4X20 A;  1O9H A;  2QA4 V;  1IUR A;  1XMQ B;  5IDJ A;  4LF6 B;  1L1F A;  2EIM B;  2BOB C;  2UUC B;  5AG2 A;  1VF6 C;  4PI2 A;  4ZKI A;  3WFV A;  3K59 A;  5KHK A;  3F7Y C;  1COW G;  4MW8 A;  4ABM A;  4WFB V;  3SYC A;  2M7W A;  4FK5 C;  3UO3 A; 
#chains in the Genus database with same CATH homology
 1XMO O;  2DOS A;  1AIL A;  2AGA A;  4B3S O;  4DV3 O;  1HNX O;  4JI6 O;  2FKX A;  4DR3 O;  2VQE O;  2UXB O;  4JI3 O;  4OPA A;  1FYJ A;  5H5N A;  1XNQ O;  4JV5 O;  4JI0 O;  1AB3 A;  2ZM6 O;  3O65 A;  1FKA O;  4JI4 O;  3OTO O;  4X66 O;  2VQF O;  3T1Y O;  1J5E O;  4DR2 O;  2F4V O;  5FLX N;  4LF5 O;  3R66 A;  4LF7 O;  4JI2 O;  3M8A A;  2UUA O;  1KUQ A;  4OPH A;  4LFA O;  5BY1 A;  4X62 O;  4JYA O;  1X59 A;  4JI7 O;  4JI5 O;  4DR4 O;  4OX9 O;  1N36 O;  2UXC O;  4X64 O;  4B3T O;  4DUZ O;  4KHP O;  3J80 N;  2JRI A;  3RT3 C;  4DUY O;  4LF4 O;  4LF8 O;  1XEQ A;  1A32 A;  4DR7 O;  1YZB A;  4DV1 O;  3J81 N;  2UUB O;  4DV0 O;  1IBM O;  2ZKO A;  4DV4 O;  2Z0A A;  4DV7 O;  3T1H O;  1G1X B;  4NXN O;  1HNW O;  1XNR O;  3SDL A;  5IT9 N;  1IBK O;  3F5T A;  4JI8 O;  1N33 O;  4DR5 O;  4GKK O;  5LL6 Y;  2N74 A;  5BR8 O;  4YY3 O;  1R1B A;  4DR6 O;  1F7Y A;  3J7A U;  1FJG O;  1D2D A;  1NS1 A;  4DV5 O;  2HHH O;  2UU9 O;  2E5L O;  4B3M O;  1N34 O;  4GKJ O;  4YHH O;  4DR1 O;  4K0K O;  4DV2 O;  1XMQ O;  1I94 O;  4LF6 O;  5LMN O;  1IBL O;  4DV6 O;  2UUC O;  3JAM N;  4JI1 O;  5BXZ A;  4LFC O;  2UXD O;  4LF9 O;  1DK1 A;  5IWA O;  1R6T A;  4X65 O;  1N32 O;  2LW7 A;  4LFB O;  4B3R O;  4NXM O;  5A2Q N;  1HNZ O;  4A5U B;  1HR0 O;  5LMU O;  4AQY O;  2DJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...