2E5LO

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2e5lO00
3OTOO 4GKKO 4DUYO 4X66O 4DV6O 4DR3O 4DV3O 1FYJA 4NXNO 4X64O 4KHPO 1XNRO 1HR0O 3R66A 4NXMO 4OPAA 4JYAO 5LMNO 2HHHO 4LFAO 4OPHA 4DV5O 3M8AA 5FLXN 4GKJO 1F7YA 3J81N 2VQFO 4DV2O 1HNXO 2UUBO 2FKXA 1XEQA 2JRIA 2UXCO 3T1YO 1IBKO 4B3RO 5BY1A 4DV7O 1N32O 4DR5O 4LF9O 2DOSA 4JI5O 1G1XB 4B3TO 1NS1A 4B3SO 2UXDO 4DV1O 2Z0AA 2UUAO 3J7AU 2UXBO 2AGAA 3O65A 4OX9O 1J5EO 1A32A 1X59A 2N74A 1FJGO 4JI3O 4JI7O 4AQYO 4LF4O 4JI0O 4JI1O 4LF8O 4X62O 1YZBA 1XMQO 4LF7O 1R6TA 5IT9N 1FKAO 5LL6Y 4DR7O 1XNQO 1IBMO 2VQEO 4LF6O 4JV5O 1AB3A 5H5NA 3SDLA 4DUZO 2ZM6O 5LMUO 1I94O 4DR4O 4LFBO 2UUCO 5BXZA 4B3MO 4JI4O 3JAMN 4YY3O 3J80N 1HNZO 2F4VO 4K0KO 4LF5O 1AILA 4DV0O 2LW7A 4DR1O 1KUQA 4DV4O 3RT3C 3F5TA 2E5LO 1D2DA 1HNWO 1R1BA 2UU9O 5A2QN 1IBLO 4JI2O 2ZKOA 1XMOO 1N36O 1N33O 4JI6O 4X65O 4A5UB 3T1HO 4DR6O 4DR2O 2DJVA 4YHHO 5IWAO 4LFCO 5BR8O 4JI8O 1N34O 1DK1A
chains in the Genus database with same CATH superfamily
3BFRA 5J9PC 1N0JA 1VQNV 2B1GA 2PTMA 3K03A 1F23A 4DR3B 4KUMA 4OPAA 2ITDC 2CGOA 1S5HC 4G2KA 5CBGA 4X1IB 1VIBA 1OCRC 4GKJO 4CH5A 1LUVA 1S72V 1KBHA 3C90A 5BZBA 3X2QC 1Q6IA 4B3RO 4LC1A 4YJ2B 4DR5O 3QO5A 1JFFB 4O4HA 4TWKA 3FFQA 2O57A 1I08A 2L35A 3CSXA 3CMAV 2Z0AA 5JQGA 5DEDA 5LXTA 1SC5B 2A79B 3HKDB 3U0ZA 3RW0A 3WB2A 1W59A 3A2FA 5LYJA 4B7KA 1URFA 3CWBH 3NR7A 2WA3A 1YDXA 4UCOA 1WP7A 5KX5A 4K0KB 1QVGU 2G38A 2KKWA 3JD4A 3IGAC 3H1JH 2E76B 2JDIG 2ZM6O 4O4LB 1WA8A 1ZLZA 4J41A 5H9CA 1K33A 1F4NA 1XMOB 2MK3A 3W7XA 4B3MO 5L3BA 2PI5A 2P06A 1TVKB 1EN5A 3BEHA 1J95A 1KP3A 3SYQA 1BL8A 1D2DA 4J9YB 1H2LA 1NTMH 2HJDA 4MSWC 3E8BA 2PI4A 2AZ0A 3QO7A 4WFAV 2ZKOA 3AEIA 5H2FZ 3E22A 4MVQA 1QLNA 4FFBA 2ZINA 5KUKA 5IJ9A 2RDCA 1GN6A 1UPGA 1IXBA 1PD3A 5HFLA 4X1YA 2QE7G 3TXSA 3PN1A 4B3TB 3OMAB 5C93A 1PL4A 1I7FA 1YF2A 3B77A 4H37A 3M8AA 1I0HA 4U7OA 2JS5A 2ZR2A 3WG7C 2UXNA 3VQWA 2YI9A 3T1YO 3KCXA 3RYCB 1DGSA 3UO3A 2A7WA 4DV7B 4JI5O 4X1KA 5L3CA 4B08A 2RMKB 5GONB 3QO8A 1AJNA 2EJRA 3CCVV 2GUZB 4D7TA 5KUMA 3QNEA 1ROPA 1EFRG 2Y48A 4MVRA 4YJ3B 1AROP 3H1LH 2YEVB 3HKEB 3OFNG 3LSQA 4AQYO 4F6RB 4X62O 1YVWA 3LDDA 5EIBC 4WBNB 1E79G 3RYFB 1NR1A 2OIEA 5CA1A 2WLIB 2QM7A 1VQ5V 1JQ0A 5B66Z 1V54C 3AG1B 2JS3A 5BMVB 3JASA 3CCUV 3CE2A 1EN6A 2EZOA 2QSAA 3C3SA 1B06A 4LFBB 1SS3A 2ETNA 5FNVB 1OCCC 2IJKA 5C8YB 3J80N 1VQ6V 1N34B 4TUYA 1PNLA 4WFHA 2N05A 2IJHA 5CN0A 1MG1A 2CH7B 4GZRB 1H2SB 1YJWV 2IH1C 4Z2WA 4H0LB 2IJIA 2P4KA 3HPLC 1EM1A 2B9ZA 4XDKA 4IL6Z 2WAMA 4JI6O 4X65O 1JCHA 1KC8W 4YHHO 1ZAUA 1KU9A 4BIOA 4LFCO 1ZX3A 2XAGA 2XAJA 3I5DA 4PDMA 4MS2A 4DV3O 3BABA 1XUQA 2JGUA 1V55B 4UV9A 4NXNO 1GN3A 2UXDB 1I5XA 3VQYA 1RPOA 4UB6Z 5L3DA 3ZCCA 3CRRA 1N4CA 1BCCH 1Y6XA 1F7YA 4CH4A 3E8GA 4FMTA 3OR6C 4GKJB 3K59A 1MSWD 4TV8A 3K57A 1RSOB 1YTFB 4ZHQA 1N32O 2E3CA 2NLJC 1FXVA 2BSKA 3ICXA 3W7UA 4DR5B 1H2GA 3WB0A 1XHZA 5GW7A 2EIMB 2UUAO 2UXBO 1F4MA 4UCRA 4HNAB 4JGSA 3DC6A 3LDEA 1K92A 2XOKG 2DQ0A 5JJJB 3LDCA 1Q90D 2X7RB 2YIAA 3CJHA 5LL6Y 4UCSA 4ZOLB 3ZRXA 2GTAA 2Q69A 1THZA 5JVDA 1R6NA 4O4IB 5LA6B 2DYRC 2QJ1A 2Q8VA 5J2TA 4PA3A 2UU9B 2EIKB 2XAFA 2ZM6B 1GKFA 3SJAC 4EKWA 4NYKA 4DXWA 1RFYA 4JI4O 1JOYA 3ZRVA 1YJNV 4TOIA 5KHIA 2R72A 3B2EE 4TV9B 2W6JG 4LF5O 1R3IC 1P84F 2IW5A 4LWSB 1PNMA 2PGGA 3A0RA 3CCLV 4BW5A 3JAWA 1KKDA 4C7UA 2YXYA 2QA4V 4GYCB 3SJBC 3UQ8A 4GKKO 4WFGA 2Y69C 4X89A 3Q4HB 5ITZB 2EINC 1AP6A 1X4TA 4NXMO 3SPCA 1GTOA 2OT5A 4TQDA 4DV5O 1NT2B 1AI6A 2RCVA 5IJ0B 2VQFO 1S5JA 1J5EB 3SR2C 1Q6HA 5JH7B 2QKAA 3N27A 2X6CA 2WWWA 1TAEA 4LF7B 4DR7B 1K7DA 3F5WC 3B40A 4EEQA 2AHZA 3CEIA 4QPKA 1A32A 3ZMSA 1Q8IA 1SESA 5LHGA 2DW4A 1ZL8A 4HAMA 3K5NA 2YXHA 1UJWB 2XUMA 2EULA 3RYHB 4RQFA 1V9PA 3WU2Z 3JATB 4PDVA 3B09A 3HKBA 2OWOA 1AB3A 2EILB 3FYEB 1G6UA 1S3JA 1R73A 1KMIZ 5K1XA 1SA0B 5BXZA 2BOBC 4I7ZB 4PELA 2A3QA 4GLXA 4RUEA 3ZMTA 4ZI7A 4I50A 4I0XB 4K0KO 4P2ZA 1KUQA 4QE7A 2E5LO 2QDOA 5EIBD 1KYOF 4ZBMA 2WLHA 3NXSA 1XMOO 3ZMVA 1RP3B 1RPRA 3K0DA 1G4YB 4JI6B 5L3FA 5LOVA 1VMGA 4X8AA 4LFCB 3ETEA 2ZR3A 1AR1B 4LF9B 2LJ2A 4PA4A 4X1IA 3JCZA 3KCYA 3SPIA 1SZXA 2QWQB 3OMNB 5B1BB 3SYCA 1IURA 1N0NA 3D8CA 1NJIW 1US6A 5LGTA 2BOCC 2PYJA 1KD1W 2CTPA 1DF5A 1JFFA 2HR3A 2JVDA 4IHJB 3K08A 5LP6B 2JEUA 4B3TO 1MABG 3ETGA 3HKDA 3ABKC 1IBMB 4MTGA 4MTOA 1U97A 4WFEA 1VQOV 1IX9A 4TT3G 3BVOA 5EYPB 2YUAA 1JJOA 4CH6A 4LNUB 1FFXB 1Q81W 2DQ3A 1HNZB 4DRXB 4UVCA 3CRAA 4X88A 4O4LA 1ZSPA 2VQEO 1L1FA 2Q6AA 4AI8A 4JTDB 4I9WA 5LMUO 2GBOA 2CTQA 1I94O 1P4RA 2RJZA 2UUCO 1PNKA 2IM9A 3QF7A 1BHBA 1TVKA 1MZFA 1VARA 5LBQA 1VQLV 4AHCA 5IWAB 3FB7C 4JI4B 4P9OA 2WLNA 3CD6V 4K8XA 3CHXA 4X66B 2ZNJA 4PD4F 3VOUA 4GX5A 2IBZH 1FD9A 2LW1A 4YIOA 3UM7A 4O2AB 3FAVB 1K4DC 3ZHTA 3K9SA 4O4JB 5BR8O 1O9GA 1N34O 1Q7YW 3CC4V 2ILMA 2X0LA 2PZSA 3ZMUA 1M56B 2HJFC 1SQQH 3ASOB 1BS3A 2LP7A 4O2BB 1HP8A 2Y4UA 4EFBA 1H2NA 2H3OA 4FVMA 5KAFZ 4NXMB 3K0GA 2VWKA 3FB6C 3JAKB 4DV5B 5EZYB 3RYCA 5E79Z 4QE9A 3H1IH 5GONA 2BTQB 2DOSA 2Q67A 5JJEB 1SERA 4J7JA 1NS1A 2DE0X 2UXDO 2GDSA 2GUZA 1QLEB 3K9AA 4UVAA 4BIUA 1WJZA 4YJ3A 2F43G 1NKDA 4H33A 1LNQA 2YEVA 1RM1B 3HKEA 4DR4B 3ZEDA 4F6RA 3AG1C 1Q6UA 1FS0G 2Z3YA 4LF4O 3I55V 4WBNA 4JI0O 1CEZA 4NR1A 3RYFA 3A0BZ 1ZUQA 3O9OA 4LF6O 1Q43A 2ZNIA 4DUZO 4RUFA 1SKVA 1K5QA 5FNVA 1OHHG 5C8YA 1IXMA 1K8AW 2CH7A 3H01A 2EBOA 4I4TB 2F4VO 1H2MA 3G4SV 1NH2D 2B5UA 3UT5B 5JWPA 2E74B 3OEEG 4LH7A 2R9RB 3ZRWB 1V55C 5D5QA 3G80A 3HB3B 2E5LB 1TUBB 2UU9O 1IDSA 1OJHA 4MW8A 3HKCB 4R6ZA 3S3WA 5LMNB 4FLZA 2A0LA 4D6TH 3K5OA 1WNSA 5KLVH 4ICGA 3BPZA 1BE3H 2YIBA 2P6JA 5TISZ 2R70A 1IBKB 2ZE5A 1VP7A 2ATKC 3T2MA 3EHBB 4GT1A 1FYJA 4K35A 3RBZA 1XQ8A 5LHIA 4IT5A 2Q73A 3APQA 4LFAO 2ZQMA 2EIMC 4W4KA 4L87A 5LHHA 3J81N 1RSOA 3JD1A 4EB6A 3CCQV 4CS2A 4FLYA 3UKMA 1GM8A 1U96A 1QHTA 2WSSG 4PHZA 2F23A 4HNAA 1NVPD 2AW9A 3MHHC 1J5EO 3BA8A 3BHPA 3OM3B 1KP2A 3ML0A 2F95B 3ZIAG 2EIKC 3AK2A 2Q7EA 1YSCA 3OUSA 2ZE8A 4J80A 3ZHQA 2V4DA 2OCHA 4ZOLA 4LF8O 4E4EA 3RVZA 4LF7O 1K9MW 4DYLA 4O4IA 5LA6A 1VQPV 4DR7O 1Z5VA 1BMFG 3R65A 3ZRSA 4TQFA 5A9GA 2VQEB 2Q9LA 3OGIB 1WPBA 4JPRA 1VQKV 2ARHA 1N33B 5LMUB 3T4ZA 1I94B 2HFEC 2UUCB 3OD4A 5GTHZ 4TV9A 2EIJB 2R9AA 2ZE7A 4LWSA 1Q86W 4UCUA 2YSUB 2ZD9A 2K9PA 1ENVA 4UFZA 1LUWA 5EBWC 1HR0B 4NVPA 1BZKA 5DM6V 2OCCC 3AK1A 1JMKC 3BY6A 1HNXB 4GCZA 1CPYA 3M7MX 5BR8B 1FAFA 3Q4HA 5ITZA 2WA4A 3OTOO 2QTSA 4CBCA 4KP4A 1WP8A 2KQXA 4PA9A 1OCRB 2B1IA 4K8ZA 1TA8A 3AG2B 1HWYA 5B3SB 4X9QA 1BQ0A 5JH7A 2BTOA 1QR8A 2ADPA 4KFMA 2YIDA 3OAAG 4JZGA 4LF9O 4MVUA 3IAYA 4LBEC 3CS5A 4LR3A 3DSQA 3B8NA 1M57B 4N21A 5KX5B 1NBMG 1P7BA 4MVZA 2K1EA 1CP9A 1GRJA 3TJTA 3OR7C 1GO3F 1WA8B 2EILC 3SPJA 2L6LA 2N74A 3ZN1A 2JEXA 2Z5UA 3ABLB 3JATA 3F7YC 3RVYA 4LP8A 4LF4B 4JI0B 2QR4A 2AXTZ 2D3OW 2A06H 5IY5B 1IBMO 3CCRV 3TCUA 4FM2A 4J9ZB 1M5IA 4LF6B 4DUZB 3SYPA 2HP8A 3H9VA 4JYBA 1JA8A 2F1MA 4IYHA 4GUNA 4PI2A 5L3GA 4I0XA 1HNZO 3N2GA 3BCCH 3L72H 5KHHA 1B6QA 2KG7A 1HW7A 1VQ9V 4GX1A 3W7SA 4DUYB 2F4VB 2WLJA 3F5TA 5EBLC 3B8MA 1MNGA 1HNWO 1AR5A 4JYAB 2AHYA 2LGQA 2HHHB 4G27B 3GWOA 2UXXA 4DR2O 1Q82W 1CXZB 3H1HH 5IWAO 4JI8O 5B1AB 5B1BC 4UUJC 5HFMA 2JK5C 5IYCO 3G71V 4DW0A 1QQCA 3JCUZ 4QJFB 2PY5A 2YICA 4X66O 3ZS8C 1VEWA 2EZPA 2QGNA 5KMGA 4MW3A 1GAXA 2JIZG 3K06A 2CK3G 3TXQA 2ZIOA 2Y0PA 4N23A 4JF3A 4OPHA 1G8MA 1MA1A 5IYZB 4LFAB 3EVKA 3STLC 4UCTA 4QIWF 4IHJA 4I9QA 1K4CC 1WN7A 4JZ2A 3MDSA 1G1XB 3IFXA 1R3JC 5B1NA 5KHJA 3KG2A 2Q0OC 2AGAA 4JYYA 1GMGA 5EYPA 3RGBA 2Q68A 4LNUA 2CTWA 1FFXA 1QU7A 2E75B 1E1QG 2QWRB 3ZMZA 5FL7G 4JI3O 4DRXA 4D7SA 4I55B 4FLVA 3QTCA 2QKSA 4WF9V 4LF8B 1XNQO 4KXRA 3ZJZA 1Z2GA 2IU0A 5H5NA 3SDLA 3CC7V 3BAAA 4DR4O 1I5YA 2ITCC 4ASUG 4BWAA 1O9HA 4J7KA 1AILA 5CMUA 3AG3B 4OXSA 1VQ8V 1M56C 3DGEA 3ASOC 1L8DA 4O2AA 3FAVA 5A2QN 3ZBHA 2HVKC 1Y74B 2QWNB 2LQTA 5CA0A 1VQMV 1OZ0A 3P3PA 3VQXA 4O2BA 3RYIA 2WPDG 3OTOB 2GV9A 4P9PA 5LMNO 1GN4A 3JARA 1EN4A 4RAIA 1QLEC 4K3AA 2FKXA 1GH6A 2JRIA 2EX3A 2BTQA 1IBKO 5KAIZ 2ODMA 1MOFA 2NN4A 3JALB 1XMQB 4DV1O 1KECA 3DTUB 1HDJA 1QCEA 2DWEC 2FB5A 3ETQA 4OX9O 4FLUA 2DYSB 3RFRA 4JYCA 1IVSA 2FMLA 5FPRA 5H6QA 4YJ2A 2FL4A 2Q0AA 3CP1A 1YZBA 3ABUA 1B04A 3CXCU 2OTJV 3ABTA 3STZC 4OGQB 2Q5ZA 3E83A 2CDYA 1Z5WA 1MMMA 2JJ1G 2WLMA 4NTYA 4YY3O 5F2VO 1VQ4V 5CB4B 1W0KG 1Q5OA 3IJ4A 1K34A 3UT5A 2KSDA 4FM1A 3RN4A 1H8HG 1YJ9V 4J7ZA 2CUGA 3ZRWA 4DV4O 4XDJA 5EC1C 3HKCA 3SPHA 2V1DA 1HNWB 1N33O 1ZWIC 2XTAA 1NTZH 4BIZA 3CXHF 1NU1H 4DR2B 2FTKA 5EK0A 1OCZB 4JI8B 2XHBA 2H8PC 3BA9A 4X64O 1AI7A 4KHPO 1HR0O 2Y4TA 3R66A 1S0VA 2ZXWB 4MTXA 5L3EA 1HNXO 1H38A 1FXHA 5JCOC 4RWUA 1M4UA 4DK0A 4CS3A 3AK3A 3GB7C 4FFKA 1L0NH 4U3JB 3E35A 5CBFA 5JCOA 1Y4MA 2RNBA 4LCUC 4CC5A 3HKBB 3AG4B 4Z1VA 2HEPA 2HKOA 1UFIA 2DMXA 2DWDC 1XDCA 4JI7O 4WCEV 4JI3B 1B3QA 1K97A 3L70H 1SZTA 1DLBA 2EIJC 2P67A 2PUSA 1XNQB 1AR4A 2QM4A 4X20B 2QKCA 1W2BU 5EBMC 1XI1A 4J11A 2Q7HA 2NNUA 3L71H 2HG5C 2LGWA 4MT8A 3ETDA 3G67A 3ZHRA 3G6EV 1M93A 1PKXA 2GHYA 4YXWG 3TGUH 1WPXA 5KA6A 1YIJV 2CE4A 2WLIA 3ASNB 4UB8Z 3UCSC 3K04A 5BMVA 1YI2V 4CH3A 2JGDB 3OT7A 1NQTA 4ZIBA 1FFTB 4JAUA 3AG2C 5B3SC 1NVPB 2P5OA 4DUYO 5J2UB 4UXNA 1SQGA 1XNRO 3WFVA 1SF9A 1S76D 4JYAO 1JX9A 2HHHO 2FYUH 4FIPC 1M57C 1KQSU 3K58A 1AP5A 1FXKB 4DV2O 1H8EG 3FD9A 4MVMA 1SETA 4IIJB 1AJPA 3B4SA 3CPWU 1XL6A 3DXRB 2QWOB 4FZ1A 2YS8A 2VWJA 3ABKB 1WB7A 2ZT9B 3ABLC 2YC0A 1Y76B 3OTFA 4DV1B 1S5LZ 3J7AU 5IY5C 2HVJC 2WLKA 3AG7A 4OX9B 5IYBO 2ZDIC 4RO2A 3ABMB 4XBFA 2MW2B 2WLLB 3F7VC 2VRZA 4JAAA 1S77D 4L8JA 3ZN0A 1N8RW 1ORQC 4JV5O 1QBZA 2ZDIA 2V7QG 1PL0A 3LNNA 4G28B 4FM0A 2OIGA 4FLWA 1XHXA 2X6BA 3W7TA 4YY3B 3MHSC 5B1AC 2XT9A 2CAZC 3FB5C 1OCOB 1E1RG 3SYOA 3TK1A 3FB8C 4DV4B 1VF7A 1IBLO 3N2KB 2QWPB 1M1KW 4BAYA 5D5PA 4PDLA 4FLXA 3JSLA 2P4VA 2UUBB 1VF6C 1SQPH 3CRQA 1Y66A 1TUEB 4DV6O 3E8HA 2Q7GA 3CCMV 1VF6A 1K3EA 4X64B 5IYZA 4KHPB 3E8FA 1ZTEA 4JTAB 3CMEV 2NR5A 1XEQA 3ZX6A 2UXCO 2IJJA 2XAQA 3SJQC 3VBBA 4JTCB 1FJGB 3D36C 4UVBA 4F4LA 4MVSA 1YHQV 4O4HB 2IH3C 1T5EA 1P49A 3APOA 3O65A 1IZ3A 5IJ0A 3ZHSA 3X2QB 3W7WA 5JQGB 3D36A 2PF4E 5LXTB 3L74H 1JPXA 3CCEV 4I55A 5LYJB 4AILC 3GWKC 3E86A 4JI1O 4JI7B 4HYOA 2BCCH 4EFEA 2W0XA 1XMQO 1R6TA 3OGCC 5IT9N 3OE7G 4NB5A 4RQEA 1BHAA 1XREA 5KA5A 1BT8A 4BW9A 3AG3C 4CS4A 3D3IA 2QEXV 4FPPA 2P90A 2ADQB 4DR6B 3SJCC 3RYHA 5GTIZ 3JD3A 1EBOA 3FX7A 2PYLA 4Q6GA 3GVMA 2RN9A 3RT3C 5KHGA 2RQ6A 4PA7A 2LFSA 4HBNA 4HZ3A 2HLDG 2Q4PA 1N36O 5LGNA 3A8TA 1SA0A 1Y74A 2X6AA 3E22B 4DK1A 4U7NA 1YCIA 4FFBB 4EB6B 5IJ9B 4B3RB 1XOUA 1DK1A 1K73W 2P7TC 3U10A 4R7CA 1D5AA 2H94A 2F93B 4X1YB 3BRCA 3K5LA 3CX5F 1SRYA 1XNRB 1WB8A 1AI4A 5IE9A 2AZ2A 2M6YA 1L0LH 1W0JG 3P32A 4ZKIA 4DV2B 2DYSC 3JALA 3WB1A 4NTXA 4B3SO 4X1KB 5E1AC 3JYCA 5LP6C 4J10A 1JR9A 4YIPA 3WG7B 4PJ0Z 2YIBD 2ZCEA 4H44B 1X59A 3FKSG 2IU3A 2DN9A 3LSSA 1JJ2U 2YI8A 1DF4A 1H2KA 1EZVH 5B1OA 5LP6A 4B3MB 3CCSV 4FJCC 3L9DA 3K79A 2F66C 2YXLA 1YTFD 1GM7A 3K3WA 4JV5B 4QPJA 1R3KC 5CA1B 1PPJH 2BE3A 1R6KA 3CC2V 3IC7A 2C2AA 3JASB 3LSUA 5CB4A 4KL1A 3ZHVA 3JAMN 5FPOA 1K5SA 4FLTA 5CA3A 3EXAA 1SQFA 5IDJA 4TUYB 4DV0O 1OCZC 2LW7A 4DR1O 1V54B 1XBLA 1R1BA 2W0FC 4UV8A 2OCCB 3VQVA 4FZ0A 1M90W 4JI2O 2XASA 1OCCB 3CRMA 3CYOA 4WFFA 1VF5B 3T1HO 1IBLB 3U11A 3JSNA 1COWG 2GSMB 2ZXWC 1KKCA 4CZZA 2P22C 3OEHG 5B5EZ 5H6RA 4CC6A 3TETA 3T1YB 3H1KH 1R3LC 4QGPA 2CTRA 4PI0A 4DR3O 4JI5B 4MVOA 5AG2A 4DV6B 4MTFA 1JVMA 3EFFK 3MD0A 3OUFA 3LNMB 2QM8A 3JD2A 2Y0IA 5FLXN 1AI5A 4O4JA 5LGUA 1YEWA 1PP9H 3AG4C 4W4LA 3KZIZ 4Z1MG 4U3JA 4UCVA 4LH6A 2UXCB 2OYQA 4TV8B 4NTWA 2VS0A 4AQYB 4ZHQB 5EC2C 4X62B 4JAVA 4GX0A 5DN6G 1SQBH 2BSKB 3QG5A 4U3FH 3CRCA 1Q3EA 1WAZA 1AJQA 3JAKA 3UO2A 1EZJA 5EZYA 1SQXH 3OMIB 3THOA 3FYIB 2OTLV 1Y67A 3P3NA 1RM1C 3CB2A 3N2GB 1FKAO 4JI1B 2KG7B 3CJHB 2M7WA 5JJNB 3SYAA 2XNDG 4DW1A 4X20A 1FPOA 1OV9A 3ASNC 3C3TA 1NZ6A 5JVDB 1BQZA 3A0HZ 3K5MA 1MZEA 5J2TB 4X65B 1BGYH 4JASA 4YHHB 2JJ2G 3L73H 2YDEA 3SGIA 4GX2A 3LUTB 4TSFG 1P7GA 1TGOA 1WLEA 2DYRB 4DV3B 2ZE6A 2KB1A 5KMGB 4IGGA 3PJSK 4NXNB 2JGDA 1QVFU 1AVMA 4E2LA 3P30A 5KHKA 2DJVA 1N36B 4NKGB 4R50A 4BR6A 3M99B 4PA6A 3JAWB 3RWRD 1YXBA 4WFBV 1FXKC 4I4TA 5J2UA 3D3QA 1N32B 3SPGA 2R9IA 1GM9A 3KKYA 1TUBA 2A9HA 1FXKA 2UUAB 2UXBB 2GTSA 4IIJA 2LFRA 2UUBO 1M9NA 5DECA 3DC5A 3DXRA 1GN2A 2Y69B 5IYDO 1F51A 5BY1A 4DV7O 3L75H 2EINB 1NTKH 5K1PA 3ZHUA 1Y76A 3QVNA 3ABMC 4B7EA 3IC9A 4B3SB 2QTOA 4R8CA 1BSMA 3JD0A 1DTOA 1PV0A 1QR9A 1XL4A 1QNMA 3G6BA 2CGNA 4P30A 4Q20A 1FJGO 2WLLA 4DO2A 2N04A 1VQ7V 1ZL8B 4LF5B 4PV1B 3T4DA 3OW2U 1OCOC 4LFBO 4XDLA 3S3XA 3T1CA 1NH2B 1GK9A 1XILA 2D2CB 4FK5C 4H13B 5CBHA 2XAHA 2EJ7A 3I56V 1SQVH 1YITV 5CA0B 1MSDA 1KB9F 4GKKB 3E2EA 4ZI7B 3RYIB 4I5SA 4ABMA 1D5NA 1PM9A 4I50B 3CCJV 4DV0B 4DR1B 3N2KA 4J42A 4PDRA 3HR0A 2W6IG 1LR1A 4QNHB 3JARB 2ZIMA 4A5UB 2LO1A 4DR6O 4JI2B 2VQFB 3T1HB 4F6EA 1NR7A 4IYIA 3MAQA 5LOVB 1NI8A 3E89A
chains in the Genus database with same CATH topology
3OTOO 4GKKO 4DUYO 4X66O 4DV6O 4DR3O 4DV3O 1FYJA 4NXNO 4X64O 4KHPO 1XNRO 1HR0O 3R66A 4NXMO 4OPAA 4JYAO 5LMNO 2HHHO 4LFAO 4OPHA 4DV5O 3M8AA 5FLXN 4GKJO 1F7YA 3J81N 2VQFO 4DV2O 1HNXO 2UUBO 2FKXA 1XEQA 2JRIA 2UXCO 3T1YO 1IBKO 4B3RO 5BY1A 4DV7O 1N32O 4DR5O 4LF9O 2DOSA 4JI5O 1G1XB 4B3TO 1NS1A 4B3SO 2UXDO 4DV1O 2Z0AA 2UUAO 3J7AU 2UXBO 2AGAA 3O65A 4OX9O 1J5EO 1A32A 1X59A 2N74A 1FJGO 4JI3O 4JI7O 4AQYO 4LF4O 4JI0O 4JI1O 4LF8O 4X62O 1YZBA 1XMQO 4LF7O 1R6TA 5IT9N 1FKAO 5LL6Y 4DR7O 1XNQO 1IBMO 2VQEO 4LF6O 4JV5O 1AB3A 5H5NA 3SDLA 4DUZO 2ZM6O 5LMUO 1I94O 4DR4O 4LFBO 2UUCO 5BXZA 4B3MO 4JI4O 3JAMN 4YY3O 3J80N 1HNZO 2F4VO 4K0KO 4LF5O 1AILA 4DV0O 2LW7A 4DR1O 1KUQA 4DV4O 3RT3C 3F5TA 2E5LO 1D2DA 1HNWO 1R1BA 2UU9O 5A2QN 1IBLO 4JI2O 2ZKOA 1XMOO 1N36O 1N33O 4JI6O 4X65O 4A5UB 3T1HO 4DR6O 4DR2O 2DJVA 4YHHO 5IWAO 4LFCO 5BR8O 4JI8O 1N34O 1DK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO O;  4GKK O;  4DUY O;  4X66 O;  4DV6 O;  4DR3 O;  4DV3 O;  1FYJ A;  4NXN O;  4X64 O;  4KHP O;  1XNR O;  1HR0 O;  3R66 A;  4NXM O;  4OPA A;  4JYA O;  5LMN O;  2HHH O;  4LFA O;  4OPH A;  4DV5 O;  3M8A A;  5FLX N;  4GKJ O;  1F7Y A;  3J81 N;  2VQF O;  4DV2 O;  1HNX O;  2UUB O;  2FKX A;  1XEQ A;  2JRI A;  2UXC O;  3T1Y O;  1IBK O;  4B3R O;  5BY1 A;  4DV7 O;  1N32 O;  4DR5 O;  4LF9 O;  2DOS A;  4JI5 O;  1G1X B;  4B3T O;  1NS1 A;  4B3S O;  2UXD O;  4DV1 O;  2Z0A A;  2UUA O;  3J7A U;  2UXB O;  2AGA A;  3O65 A;  4OX9 O;  1J5E O;  1A32 A;  1X59 A;  2N74 A;  1FJG O;  4JI3 O;  4JI7 O;  4AQY O;  4LF4 O;  4JI0 O;  4JI1 O;  4LF8 O;  4X62 O;  1YZB A;  1XMQ O;  4LF7 O;  1R6T A;  5IT9 N;  1FKA O;  5LL6 Y;  4DR7 O;  1XNQ O;  1IBM O;  2VQE O;  4LF6 O;  4JV5 O;  1AB3 A;  5H5N A;  3SDL A;  4DUZ O;  2ZM6 O;  5LMU O;  1I94 O;  4DR4 O;  4LFB O;  2UUC O;  5BXZ A;  4B3M O;  4JI4 O;  3JAM N;  4YY3 O;  3J80 N;  1HNZ O;  2F4V O;  4K0K O;  4LF5 O;  1AIL A;  4DV0 O;  2LW7 A;  4DR1 O;  1KUQ A;  4DV4 O;  3RT3 C;  3F5T A;  2E5L O;  1D2D A;  1HNW O;  1R1B A;  2UU9 O;  5A2Q N;  1IBL O;  4JI2 O;  2ZKO A;  1XMO O;  1N36 O;  1N33 O;  4JI6 O;  4X65 O;  4A5U B;  3T1H O;  4DR6 O;  4DR2 O;  2DJV A;  4YHH O;  5IWA O;  4LFC O;  5BR8 O;  4JI8 O;  1N34 O;  1DK1 A; 
#chains in the Genus database with same CATH topology
 3BFR A;  5J9P C;  1N0J A;  1VQN V;  2B1G A;  2PTM A;  3K03 A;  1F23 A;  4DR3 B;  4KUM A;  4OPA A;  2ITD C;  2CGO A;  1S5H C;  4G2K A;  5CBG A;  4X1I B;  1VIB A;  1OCR C;  4GKJ O;  4CH5 A;  1LUV A;  1S72 V;  1KBH A;  3C90 A;  5BZB A;  3X2Q C;  1Q6I A;  4B3R O;  4LC1 A;  4YJ2 B;  4DR5 O;  3QO5 A;  1JFF B;  4O4H A;  4TWK A;  3FFQ A;  2O57 A;  1I08 A;  2L35 A;  3CSX A;  3CMA V;  2Z0A A;  5JQG A;  5DED A;  5LXT A;  1SC5 B;  2A79 B;  3HKD B;  3U0Z A;  3RW0 A;  3WB2 A;  1W59 A;  3A2F A;  5LYJ A;  4B7K A;  1URF A;  3CWB H;  3NR7 A;  2WA3 A;  1YDX A;  4UCO A;  1WP7 A;  5KX5 A;  4K0K B;  1QVG U;  2G38 A;  2KKW A;  3JD4 A;  3IGA C;  3H1J H;  2E76 B;  2JDI G;  2ZM6 O;  4O4L B;  1WA8 A;  1ZLZ A;  4J41 A;  5H9C A;  1K33 A;  1F4N A;  1XMO B;  2MK3 A;  3W7X A;  4B3M O;  5L3B A;  2PI5 A;  2P06 A;  1TVK B;  1EN5 A;  3BEH A;  1J95 A;  1KP3 A;  3SYQ A;  1BL8 A;  1D2D A;  4J9Y B;  1H2L A;  1NTM H;  2HJD A;  4MSW C;  3E8B A;  2PI4 A;  2AZ0 A;  3QO7 A;  4WFA V;  2ZKO A;  3AEI A;  5H2F Z;  3E22 A;  4MVQ A;  1QLN A;  4FFB A;  2ZIN A;  5KUK A;  5IJ9 A;  2RDC A;  1GN6 A;  1UPG A;  1IXB A;  1PD3 A;  5HFL A;  4X1Y A;  2QE7 G;  3TXS A;  3PN1 A;  4B3T B;  3OMA B;  5C93 A;  1PL4 A;  1I7F A;  1YF2 A;  3B77 A;  4H37 A;  3M8A A;  1I0H A;  4U7O A;  2JS5 A;  2ZR2 A;  3WG7 C;  2UXN A;  3VQW A;  2YI9 A;  3T1Y O;  3KCX A;  3RYC B;  1DGS A;  3UO3 A;  2A7W A;  4DV7 B;  4JI5 O;  4X1K A;  5L3C A;  4B08 A;  2RMK B;  5GON B;  3QO8 A;  1AJN A;  2EJR A;  3CCV V;  2GUZ B;  4D7T A;  5KUM A;  3QNE A;  1ROP A;  1EFR G;  2Y48 A;  4MVR A;  4YJ3 B;  1ARO P;  3H1L H;  2YEV B;  3HKE B;  3OFN G;  3LSQ A;  4AQY O;  4F6R B;  4X62 O;  1YVW A;  3LDD A;  5EIB C;  4WBN B;  1E79 G;  3RYF B;  1NR1 A;  2OIE A;  5CA1 A;  2WLI B;  2QM7 A;  1VQ5 V;  1JQ0 A;  5B66 Z;  1V54 C;  3AG1 B;  2JS3 A;  5BMV B;  3JAS A;  3CCU V;  3CE2 A;  1EN6 A;  2EZO A;  2QSA A;  3C3S A;  1B06 A;  4LFB B;  1SS3 A;  2ETN A;  5FNV B;  1OCC C;  2IJK A;  5C8Y B;  3J80 N;  1VQ6 V;  1N34 B;  4TUY A;  1PNL A;  4WFH A;  2N05 A;  2IJH A;  5CN0 A;  1MG1 A;  2CH7 B;  4GZR B;  1H2S B;  1YJW V;  2IH1 C;  4Z2W A;  4H0L B;  2IJI A;  2P4K A;  3HPL C;  1EM1 A;  2B9Z A;  4XDK A;  4IL6 Z;  2WAM A;  4JI6 O;  4X65 O;  1JCH A;  1KC8 W;  4YHH O;  1ZAU A;  1KU9 A;  4BIO A;  4LFC O;  1ZX3 A;  2XAG A;  2XAJ A;  3I5D A;  4PDM A;  4MS2 A;  4DV3 O;  3BAB A;  1XUQ A;  2JGU A;  1V55 B;  4UV9 A;  4NXN O;  1GN3 A;  2UXD B;  1I5X A;  3VQY A;  1RPO A;  4UB6 Z;  5L3D A;  3ZCC A;  3CRR A;  1N4C A;  1BCC H;  1Y6X A;  1F7Y A;  4CH4 A;  3E8G A;  4FMT A;  3OR6 C;  4GKJ B;  3K59 A;  1MSW D;  4TV8 A;  3K57 A;  1RSO B;  1YTF B;  4ZHQ A;  1N32 O;  2E3C A;  2NLJ C;  1FXV A;  2BSK A;  3ICX A;  3W7U A;  4DR5 B;  1H2G A;  3WB0 A;  1XHZ A;  5GW7 A;  2EIM B;  2UUA O;  2UXB O;  1F4M A;  4UCR A;  4HNA B;  4JGS A;  3DC6 A;  3LDE A;  1K92 A;  2XOK G;  2DQ0 A;  5JJJ B;  3LDC A;  1Q90 D;  2X7R B;  2YIA A;  3CJH A;  5LL6 Y;  4UCS A;  4ZOL B;  3ZRX A;  2GTA A;  2Q69 A;  1THZ A;  5JVD A;  1R6N A;  4O4I B;  5LA6 B;  2DYR C;  2QJ1 A;  2Q8V A;  5J2T A;  4PA3 A;  2UU9 B;  2EIK B;  2XAF A;  2ZM6 B;  1GKF A;  3SJA C;  4EKW A;  4NYK A;  4DXW A;  1RFY A;  4JI4 O;  1JOY A;  3ZRV A;  1YJN V;  4TOI A;  5KHI A;  2R72 A;  3B2E E;  4TV9 B;  2W6J G;  4LF5 O;  1R3I C;  1P84 F;  2IW5 A;  4LWS B;  1PNM A;  2PGG A;  3A0R A;  3CCL V;  4BW5 A;  3JAW A;  1KKD A;  4C7U A;  2YXY A;  2QA4 V;  4GYC B;  3SJB C;  3UQ8 A;  4GKK O;  4WFG A;  2Y69 C;  4X89 A;  3Q4H B;  5ITZ B;  2EIN C;  1AP6 A;  1X4T A;  4NXM O;  3SPC A;  1GTO A;  2OT5 A;  4TQD A;  4DV5 O;  1NT2 B;  1AI6 A;  2RCV A;  5IJ0 B;  2VQF O;  1S5J A;  1J5E B;  3SR2 C;  1Q6H A;  5JH7 B;  2QKA A;  3N27 A;  2X6C A;  2WWW A;  1TAE A;  4LF7 B;  4DR7 B;  1K7D A;  3F5W C;  3B40 A;  4EEQ A;  2AHZ A;  3CEI A;  4QPK A;  1A32 A;  3ZMS A;  1Q8I A;  1SES A;  5LHG A;  2DW4 A;  1ZL8 A;  4HAM A;  3K5N A;  2YXH A;  1UJW B;  2XUM A;  2EUL A;  3RYH B;  4RQF A;  1V9P A;  3WU2 Z;  3JAT B;  4PDV A;  3B09 A;  3HKB A;  2OWO A;  1AB3 A;  2EIL B;  3FYE B;  1G6U A;  1S3J A;  1R73 A;  1KMI Z;  5K1X A;  1SA0 B;  5BXZ A;  2BOB C;  4I7Z B;  4PEL A;  2A3Q A;  4GLX A;  4RUE A;  3ZMT A;  4ZI7 A;  4I50 A;  4I0X B;  4K0K O;  4P2Z A;  1KUQ A;  4QE7 A;  2E5L O;  2QDO A;  5EIB D;  1KYO F;  4ZBM A;  2WLH A;  3NXS A;  1XMO O;  3ZMV A;  1RP3 B;  1RPR A;  3K0D A;  1G4Y B;  4JI6 B;  5L3F A;  5LOV A;  1VMG A;  4X8A A;  4LFC B;  3ETE A;  2ZR3 A;  1AR1 B;  4LF9 B;  2LJ2 A;  4PA4 A;  4X1I A;  3JCZ A;  3KCY A;  3SPI A;  1SZX A;  2QWQ B;  3OMN B;  5B1B B;  3SYC A;  1IUR A;  1N0N A;  3D8C A;  1NJI W;  1US6 A;  5LGT A;  2BOC C;  2PYJ A;  1KD1 W;  2CTP A;  1DF5 A;  1JFF A;  2HR3 A;  2JVD A;  4IHJ B;  3K08 A;  5LP6 B;  2JEU A;  4B3T O;  1MAB G;  3ETG A;  3HKD A;  3ABK C;  1IBM B;  4MTG A;  4MTO A;  1U97 A;  4WFE A;  1VQO V;  1IX9 A;  4TT3 G;  3BVO A;  5EYP B;  2YUA A;  1JJO A;  4CH6 A;  4LNU B;  1FFX B;  1Q81 W;  2DQ3 A;  1HNZ B;  4DRX B;  4UVC A;  3CRA A;  4X88 A;  4O4L A;  1ZSP A;  2VQE O;  1L1F A;  2Q6A A;  4AI8 A;  4JTD B;  4I9W A;  5LMU O;  2GBO A;  2CTQ A;  1I94 O;  1P4R A;  2RJZ A;  2UUC O;  1PNK A;  2IM9 A;  3QF7 A;  1BHB A;  1TVK A;  1MZF A;  1VAR A;  5LBQ A;  1VQL V;  4AHC A;  5IWA B;  3FB7 C;  4JI4 B;  4P9O A;  2WLN A;  3CD6 V;  4K8X A;  3CHX A;  4X66 B;  2ZNJ A;  4PD4 F;  3VOU A;  4GX5 A;  2IBZ H;  1FD9 A;  2LW1 A;  4YIO A;  3UM7 A;  4O2A B;  3FAV B;  1K4D C;  3ZHT A;  3K9S A;  4O4J B;  5BR8 O;  1O9G A;  1N34 O;  1Q7Y W;  3CC4 V;  2ILM A;  2X0L A;  2PZS A;  3ZMU A;  1M56 B;  2HJF C;  1SQQ H;  3ASO B;  1BS3 A;  2LP7 A;  4O2B B;  1HP8 A;  2Y4U A;  4EFB A;  1H2N A;  2H3O A;  4FVM A;  5KAF Z;  4NXM B;  3K0G A;  2VWK A;  3FB6 C;  3JAK B;  4DV5 B;  5EZY B;  3RYC A;  5E79 Z;  4QE9 A;  3H1I H;  5GON A;  2BTQ B;  2DOS A;  2Q67 A;  5JJE B;  1SER A;  4J7J A;  1NS1 A;  2DE0 X;  2UXD O;  2GDS A;  2GUZ A;  1QLE B;  3K9A A;  4UVA A;  4BIU A;  1WJZ A;  4YJ3 A;  2F43 G;  1NKD A;  4H33 A;  1LNQ A;  2YEV A;  1RM1 B;  3HKE A;  4DR4 B;  3ZED A;  4F6R A;  3AG1 C;  1Q6U A;  1FS0 G;  2Z3Y A;  4LF4 O;  3I55 V;  4WBN A;  4JI0 O;  1CEZ A;  4NR1 A;  3RYF A;  3A0B Z;  1ZUQ A;  3O9O A;  4LF6 O;  1Q43 A;  2ZNI A;  4DUZ O;  4RUF A;  1SKV A;  1K5Q A;  5FNV A;  1OHH G;  5C8Y A;  1IXM A;  1K8A W;  2CH7 A;  3H01 A;  2EBO A;  4I4T B;  2F4V O;  1H2M A;  3G4S V;  1NH2 D;  2B5U A;  3UT5 B;  5JWP A;  2E74 B;  3OEE G;  4LH7 A;  2R9R B;  3ZRW B;  1V55 C;  5D5Q A;  3G80 A;  3HB3 B;  2E5L B;  1TUB B;  2UU9 O;  1IDS A;  1OJH A;  4MW8 A;  3HKC B;  4R6Z A;  3S3W A;  5LMN B;  4FLZ A;  2A0L A;  4D6T H;  3K5O A;  1WNS A;  5KLV H;  4ICG A;  3BPZ A;  1BE3 H;  2YIB A;  2P6J A;  5TIS Z;  2R70 A;  1IBK B;  2ZE5 A;  1VP7 A;  2ATK C;  3T2M A;  3EHB B;  4GT1 A;  1FYJ A;  4K35 A;  3RBZ A;  1XQ8 A;  5LHI A;  4IT5 A;  2Q73 A;  3APQ A;  4LFA O;  2ZQM A;  2EIM C;  4W4K A;  4L87 A;  5LHH A;  3J81 N;  1RSO A;  3JD1 A;  4EB6 A;  3CCQ V;  4CS2 A;  4FLY A;  3UKM A;  1GM8 A;  1U96 A;  1QHT A;  2WSS G;  4PHZ A;  2F23 A;  4HNA A;  1NVP D;  2AW9 A;  3MHH C;  1J5E O;  3BA8 A;  3BHP A;  3OM3 B;  1KP2 A;  3ML0 A;  2F95 B;  3ZIA G;  2EIK C;  3AK2 A;  2Q7E A;  1YSC A;  3OUS A;  2ZE8 A;  4J80 A;  3ZHQ A;  2V4D A;  2OCH A;  4ZOL A;  4LF8 O;  4E4E A;  3RVZ A;  4LF7 O;  1K9M W;  4DYL A;  4O4I A;  5LA6 A;  1VQP V;  4DR7 O;  1Z5V A;  1BMF G;  3R65 A;  3ZRS A;  4TQF A;  5A9G A;  2VQE B;  2Q9L A;  3OGI B;  1WPB A;  4JPR A;  1VQK V;  2ARH A;  1N33 B;  5LMU B;  3T4Z A;  1I94 B;  2HFE C;  2UUC B;  3OD4 A;  5GTH Z;  4TV9 A;  2EIJ B;  2R9A A;  2ZE7 A;  4LWS A;  1Q86 W;  4UCU A;  2YSU B;  2ZD9 A;  2K9P A;  1ENV A;  4UFZ A;  1LUW A;  5EBW C;  1HR0 B;  4NVP A;  1BZK A;  5DM6 V;  2OCC C;  3AK1 A;  1JMK C;  3BY6 A;  1HNX B;  4GCZ A;  1CPY A;  3M7M X;  5BR8 B;  1FAF A;  3Q4H A;  5ITZ A;  2WA4 A;  3OTO O;  2QTS A;  4CBC A;  4KP4 A;  1WP8 A;  2KQX A;  4PA9 A;  1OCR B;  2B1I A;  4K8Z A;  1TA8 A;  3AG2 B;  1HWY A;  5B3S B;  4X9Q A;  1BQ0 A;  5JH7 A;  2BTO A;  1QR8 A;  2ADP A;  4KFM A;  2YID A;  3OAA G;  4JZG A;  4LF9 O;  4MVU A;  3IAY A;  4LBE C;  3CS5 A;  4LR3 A;  3DSQ A;  3B8N A;  1M57 B;  4N21 A;  5KX5 B;  1NBM G;  1P7B A;  4MVZ A;  2K1E A;  1CP9 A;  1GRJ A;  3TJT A;  3OR7 C;  1GO3 F;  1WA8 B;  2EIL C;  3SPJ A;  2L6L A;  2N74 A;  3ZN1 A;  2JEX A;  2Z5U A;  3ABL B;  3JAT A;  3F7Y C;  3RVY A;  4LP8 A;  4LF4 B;  4JI0 B;  2QR4 A;  2AXT Z;  2D3O W;  2A06 H;  5IY5 B;  1IBM O;  3CCR V;  3TCU A;  4FM2 A;  4J9Z B;  1M5I A;  4LF6 B;  4DUZ B;  3SYP A;  2HP8 A;  3H9V A;  4JYB A;  1JA8 A;  2F1M A;  4IYH A;  4GUN A;  4PI2 A;  5L3G A;  4I0X A;  1HNZ O;  3N2G A;  3BCC H;  3L72 H;  5KHH A;  1B6Q A;  2KG7 A;  1HW7 A;  1VQ9 V;  4GX1 A;  3W7S A;  4DUY B;  2F4V B;  2WLJ A;  3F5T A;  5EBL C;  3B8M A;  1MNG A;  1HNW O;  1AR5 A;  4JYA B;  2AHY A;  2LGQ A;  2HHH B;  4G27 B;  3GWO A;  2UXX A;  4DR2 O;  1Q82 W;  1CXZ B;  3H1H H;  5IWA O;  4JI8 O;  5B1A B;  5B1B C;  4UUJ C;  5HFM A;  2JK5 C;  5IYC O;  3G71 V;  4DW0 A;  1QQC A;  3JCU Z;  4QJF B;  2PY5 A;  2YIC A;  4X66 O;  3ZS8 C;  1VEW A;  2EZP A;  2QGN A;  5KMG A;  4MW3 A;  1GAX A;  2JIZ G;  3K06 A;  2CK3 G;  3TXQ A;  2ZIO A;  2Y0P A;  4N23 A;  4JF3 A;  4OPH A;  1G8M A;  1MA1 A;  5IYZ B;  4LFA B;  3EVK A;  3STL C;  4UCT A;  4QIW F;  4IHJ A;  4I9Q A;  1K4C C;  1WN7 A;  4JZ2 A;  3MDS A;  1G1X B;  3IFX A;  1R3J C;  5B1N A;  5KHJ A;  3KG2 A;  2Q0O C;  2AGA A;  4JYY A;  1GMG A;  5EYP A;  3RGB A;  2Q68 A;  4LNU A;  2CTW A;  1FFX A;  1QU7 A;  2E75 B;  1E1Q G;  2QWR B;  3ZMZ A;  5FL7 G;  4JI3 O;  4DRX A;  4D7S A;  4I55 B;  4FLV A;  3QTC A;  2QKS A;  4WF9 V;  4LF8 B;  1XNQ O;  4KXR A;  3ZJZ A;  1Z2G A;  2IU0 A;  5H5N A;  3SDL A;  3CC7 V;  3BAA A;  4DR4 O;  1I5Y A;  2ITC C;  4ASU G;  4BWA A;  1O9H A;  4J7K A;  1AIL A;  5CMU A;  3AG3 B;  4OXS A;  1VQ8 V;  1M56 C;  3DGE A;  3ASO C;  1L8D A;  4O2A A;  3FAV A;  5A2Q N;  3ZBH A;  2HVK C;  1Y74 B;  2QWN B;  2LQT A;  5CA0 A;  1VQM V;  1OZ0 A;  3P3P A;  3VQX A;  4O2B A;  3RYI A;  2WPD G;  3OTO B;  2GV9 A;  4P9P A;  5LMN O;  1GN4 A;  3JAR A;  1EN4 A;  4RAI A;  1QLE C;  4K3A A;  2FKX A;  1GH6 A;  2JRI A;  2EX3 A;  2BTQ A;  1IBK O;  5KAI Z;  2ODM A;  1MOF A;  2NN4 A;  3JAL B;  1XMQ B;  4DV1 O;  1KEC A;  3DTU B;  1HDJ A;  1QCE A;  2DWE C;  2FB5 A;  3ETQ A;  4OX9 O;  4FLU A;  2DYS B;  3RFR A;  4JYC A;  1IVS A;  2FML A;  5FPR A;  5H6Q A;  4YJ2 A;  2FL4 A;  2Q0A A;  3CP1 A;  1YZB A;  3ABU A;  1B04 A;  3CXC U;  2OTJ V;  3ABT A;  3STZ C;  4OGQ B;  2Q5Z A;  3E83 A;  2CDY A;  1Z5W A;  1MMM A;  2JJ1 G;  2WLM A;  4NTY A;  4YY3 O;  5F2V O;  1VQ4 V;  5CB4 B;  1W0K G;  1Q5O A;  3IJ4 A;  1K34 A;  3UT5 A;  2KSD A;  4FM1 A;  3RN4 A;  1H8H G;  1YJ9 V;  4J7Z A;  2CUG A;  3ZRW A;  4DV4 O;  4XDJ A;  5EC1 C;  3HKC A;  3SPH A;  2V1D A;  1HNW B;  1N33 O;  1ZWI C;  2XTA A;  1NTZ H;  4BIZ A;  3CXH F;  1NU1 H;  4DR2 B;  2FTK A;  5EK0 A;  1OCZ B;  4JI8 B;  2XHB A;  2H8P C;  3BA9 A;  4X64 O;  1AI7 A;  4KHP O;  1HR0 O;  2Y4T A;  3R66 A;  1S0V A;  2ZXW B;  4MTX A;  5L3E A;  1HNX O;  1H38 A;  1FXH A;  5JCO C;  4RWU A;  1M4U A;  4DK0 A;  4CS3 A;  3AK3 A;  3GB7 C;  4FFK A;  1L0N H;  4U3J B;  3E35 A;  5CBF A;  5JCO A;  1Y4M A;  2RNB A;  4LCU C;  4CC5 A;  3HKB B;  3AG4 B;  4Z1V A;  2HEP A;  2HKO A;  1UFI A;  2DMX A;  2DWD C;  1XDC A;  4JI7 O;  4WCE V;  4JI3 B;  1B3Q A;  1K97 A;  3L70 H;  1SZT A;  1DLB A;  2EIJ C;  2P67 A;  2PUS A;  1XNQ B;  1AR4 A;  2QM4 A;  4X20 B;  2QKC A;  1W2B U;  5EBM C;  1XI1 A;  4J11 A;  2Q7H A;  2NNU A;  3L71 H;  2HG5 C;  2LGW A;  4MT8 A;  3ETD A;  3G67 A;  3ZHR A;  3G6E V;  1M93 A;  1PKX A;  2GHY A;  4YXW G;  3TGU H;  1WPX A;  5KA6 A;  1YIJ V;  2CE4 A;  2WLI A;  3ASN B;  4UB8 Z;  3UCS C;  3K04 A;  5BMV A;  1YI2 V;  4CH3 A;  2JGD B;  3OT7 A;  1NQT A;  4ZIB A;  1FFT B;  4JAU A;  3AG2 C;  5B3S C;  1NVP B;  2P5O A;  4DUY O;  5J2U B;  4UXN A;  1SQG A;  1XNR O;  3WFV A;  1SF9 A;  1S76 D;  4JYA O;  1JX9 A;  2HHH O;  2FYU H;  4FIP C;  1M57 C;  1KQS U;  3K58 A;  1AP5 A;  1FXK B;  4DV2 O;  1H8E G;  3FD9 A;  4MVM A;  1SET A;  4IIJ B;  1AJP A;  3B4S A;  3CPW U;  1XL6 A;  3DXR B;  2QWO B;  4FZ1 A;  2YS8 A;  2VWJ A;  3ABK B;  1WB7 A;  2ZT9 B;  3ABL C;  2YC0 A;  1Y76 B;  3OTF A;  4DV1 B;  1S5L Z;  3J7A U;  5IY5 C;  2HVJ C;  2WLK A;  3AG7 A;  4OX9 B;  5IYB O;  2ZDI C;  4RO2 A;  3ABM B;  4XBF A;  2MW2 B;  2WLL B;  3F7V C;  2VRZ A;  4JAA A;  1S77 D;  4L8J A;  3ZN0 A;  1N8R W;  1ORQ C;  4JV5 O;  1QBZ A;  2ZDI A;  2V7Q G;  1PL0 A;  3LNN A;  4G28 B;  4FM0 A;  2OIG A;  4FLW A;  1XHX A;  2X6B A;  3W7T A;  4YY3 B;  3MHS C;  5B1A C;  2XT9 A;  2CAZ C;  3FB5 C;  1OCO B;  1E1R G;  3SYO A;  3TK1 A;  3FB8 C;  4DV4 B;  1VF7 A;  1IBL O;  3N2K B;  2QWP B;  1M1K W;  4BAY A;  5D5P A;  4PDL A;  4FLX A;  3JSL A;  2P4V A;  2UUB B;  1VF6 C;  1SQP H;  3CRQ A;  1Y66 A;  1TUE B;  4DV6 O;  3E8H A;  2Q7G A;  3CCM V;  1VF6 A;  1K3E A;  4X64 B;  5IYZ A;  4KHP B;  3E8F A;  1ZTE A;  4JTA B;  3CME V;  2NR5 A;  1XEQ A;  3ZX6 A;  2UXC O;  2IJJ A;  2XAQ A;  3SJQ C;  3VBB A;  4JTC B;  1FJG B;  3D36 C;  4UVB A;  4F4L A;  4MVS A;  1YHQ V;  4O4H B;  2IH3 C;  1T5E A;  1P49 A;  3APO A;  3O65 A;  1IZ3 A;  5IJ0 A;  3ZHS A;  3X2Q B;  3W7W A;  5JQG B;  3D36 A;  2PF4 E;  5LXT B;  3L74 H;  1JPX A;  3CCE V;  4I55 A;  5LYJ B;  4AIL C;  3GWK C;  3E86 A;  4JI1 O;  4JI7 B;  4HYO A;  2BCC H;  4EFE A;  2W0X A;  1XMQ O;  1R6T A;  3OGC C;  5IT9 N;  3OE7 G;  4NB5 A;  4RQE A;  1BHA A;  1XRE A;  5KA5 A;  1BT8 A;  4BW9 A;  3AG3 C;  4CS4 A;  3D3I A;  2QEX V;  4FPP A;  2P90 A;  2ADQ B;  4DR6 B;  3SJC C;  3RYH A;  5GTI Z;  3JD3 A;  1EBO A;  3FX7 A;  2PYL A;  4Q6G A;  3GVM A;  2RN9 A;  3RT3 C;  5KHG A;  2RQ6 A;  4PA7 A;  2LFS A;  4HBN A;  4HZ3 A;  2HLD G;  2Q4P A;  1N36 O;  5LGN A;  3A8T A;  1SA0 A;  1Y74 A;  2X6A A;  3E22 B;  4DK1 A;  4U7N A;  1YCI A;  4FFB B;  4EB6 B;  5IJ9 B;  4B3R B;  1XOU A;  1DK1 A;  1K73 W;  2P7T C;  3U10 A;  4R7C A;  1D5A A;  2H94 A;  2F93 B;  4X1Y B;  3BRC A;  3K5L A;  3CX5 F;  1SRY A;  1XNR B;  1WB8 A;  1AI4 A;  5IE9 A;  2AZ2 A;  2M6Y A;  1L0L H;  1W0J G;  3P32 A;  4ZKI A;  4DV2 B;  2DYS C;  3JAL A;  3WB1 A;  4NTX A;  4B3S O;  4X1K B;  5E1A C;  3JYC A;  5LP6 C;  4J10 A;  1JR9 A;  4YIP A;  3WG7 B;  4PJ0 Z;  2YIB D;  2ZCE A;  4H44 B;  1X59 A;  3FKS G;  2IU3 A;  2DN9 A;  3LSS A;  1JJ2 U;  2YI8 A;  1DF4 A;  1H2K A;  1EZV H;  5B1O A;  5LP6 A;  4B3M B;  3CCS V;  4FJC C;  3L9D A;  3K79 A;  2F66 C;  2YXL A;  1YTF D;  1GM7 A;  3K3W A;  4JV5 B;  4QPJ A;  1R3K C;  5CA1 B;  1PPJ H;  2BE3 A;  1R6K A;  3CC2 V;  3IC7 A;  2C2A A;  3JAS B;  3LSU A;  5CB4 A;  4KL1 A;  3ZHV A;  3JAM N;  5FPO A;  1K5S A;  4FLT A;  5CA3 A;  3EXA A;  1SQF A;  5IDJ A;  4TUY B;  4DV0 O;  1OCZ C;  2LW7 A;  4DR1 O;  1V54 B;  1XBL A;  1R1B A;  2W0F C;  4UV8 A;  2OCC B;  3VQV A;  4FZ0 A;  1M90 W;  4JI2 O;  2XAS A;  1OCC B;  3CRM A;  3CYO A;  4WFF A;  1VF5 B;  3T1H O;  1IBL B;  3U11 A;  3JSN A;  1COW G;  2GSM B;  2ZXW C;  1KKC A;  4CZZ A;  2P22 C;  3OEH G;  5B5E Z;  5H6R A;  4CC6 A;  3TET A;  3T1Y B;  3H1K H;  1R3L C;  4QGP A;  2CTR A;  4PI0 A;  4DR3 O;  4JI5 B;  4MVO A;  5AG2 A;  4DV6 B;  4MTF A;  1JVM A;  3EFF K;  3MD0 A;  3OUF A;  3LNM B;  2QM8 A;  3JD2 A;  2Y0I A;  5FLX N;  1AI5 A;  4O4J A;  5LGU A;  1YEW A;  1PP9 H;  3AG4 C;  4W4L A;  3KZI Z;  4Z1M G;  4U3J A;  4UCV A;  4LH6 A;  2UXC B;  2OYQ A;  4TV8 B;  4NTW A;  2VS0 A;  4AQY B;  4ZHQ B;  5EC2 C;  4X62 B;  4JAV A;  4GX0 A;  5DN6 G;  1SQB H;  2BSK B;  3QG5 A;  4U3F H;  3CRC A;  1Q3E A;  1WAZ A;  1AJQ A;  3JAK A;  3UO2 A;  1EZJ A;  5EZY A;  1SQX H;  3OMI B;  3THO A;  3FYI B;  2OTL V;  1Y67 A;  3P3N A;  1RM1 C;  3CB2 A;  3N2G B;  1FKA O;  4JI1 B;  2KG7 B;  3CJH B;  2M7W A;  5JJN B;  3SYA A;  2XND G;  4DW1 A;  4X20 A;  1FPO A;  1OV9 A;  3ASN C;  3C3T A;  1NZ6 A;  5JVD B;  1BQZ A;  3A0H Z;  3K5M A;  1MZE A;  5J2T B;  4X65 B;  1BGY H;  4JAS A;  4YHH B;  2JJ2 G;  3L73 H;  2YDE A;  3SGI A;  4GX2 A;  3LUT B;  4TSF G;  1P7G A;  1TGO A;  1WLE A;  2DYR B;  4DV3 B;  2ZE6 A;  2KB1 A;  5KMG B;  4IGG A;  3PJS K;  4NXN B;  2JGD A;  1QVF U;  1AVM A;  4E2L A;  3P30 A;  5KHK A;  2DJV A;  1N36 B;  4NKG B;  4R50 A;  4BR6 A;  3M99 B;  4PA6 A;  3JAW B;  3RWR D;  1YXB A;  4WFB V;  1FXK C;  4I4T A;  5J2U A;  3D3Q A;  1N32 B;  3SPG A;  2R9I A;  1GM9 A;  3KKY A;  1TUB A;  2A9H A;  1FXK A;  2UUA B;  2UXB B;  2GTS A;  4IIJ A;  2LFR A;  2UUB O;  1M9N A;  5DEC A;  3DC5 A;  3DXR A;  1GN2 A;  2Y69 B;  5IYD O;  1F51 A;  5BY1 A;  4DV7 O;  3L75 H;  2EIN B;  1NTK H;  5K1P A;  3ZHU A;  1Y76 A;  3QVN A;  3ABM C;  4B7E A;  3IC9 A;  4B3S B;  2QTO A;  4R8C A;  1BSM A;  3JD0 A;  1DTO A;  1PV0 A;  1QR9 A;  1XL4 A;  1QNM A;  3G6B A;  2CGN A;  4P30 A;  4Q20 A;  1FJG O;  2WLL A;  4DO2 A;  2N04 A;  1VQ7 V;  1ZL8 B;  4LF5 B;  4PV1 B;  3T4D A;  3OW2 U;  1OCO C;  4LFB O;  4XDL A;  3S3X A;  3T1C A;  1NH2 B;  1GK9 A;  1XIL A;  2D2C B;  4FK5 C;  4H13 B;  5CBH A;  2XAH A;  2EJ7 A;  3I56 V;  1SQV H;  1YIT V;  5CA0 B;  1MSD A;  1KB9 F;  4GKK B;  3E2E A;  4ZI7 B;  3RYI B;  4I5S A;  4ABM A;  1D5N A;  1PM9 A;  4I50 B;  3CCJ V;  4DV0 B;  4DR1 B;  3N2K A;  4J42 A;  4PDR A;  3HR0 A;  2W6I G;  1LR1 A;  4QNH B;  3JAR B;  2ZIM A;  4A5U B;  2LO1 A;  4DR6 O;  4JI2 B;  2VQF B;  3T1H B;  4F6E A;  1NR7 A;  4IYI A;  3MAQ A;  5LOV B;  1NI8 A;  3E89 A; 
#chains in the Genus database with same CATH homology
 3OTO O;  4GKK O;  4DUY O;  4X66 O;  4DV6 O;  4DR3 O;  4DV3 O;  1FYJ A;  4NXN O;  4X64 O;  4KHP O;  1XNR O;  1HR0 O;  3R66 A;  4NXM O;  4OPA A;  4JYA O;  5LMN O;  2HHH O;  4LFA O;  4OPH A;  4DV5 O;  3M8A A;  5FLX N;  4GKJ O;  1F7Y A;  3J81 N;  2VQF O;  4DV2 O;  1HNX O;  2UUB O;  2FKX A;  1XEQ A;  2JRI A;  2UXC O;  3T1Y O;  1IBK O;  4B3R O;  5BY1 A;  4DV7 O;  1N32 O;  4DR5 O;  4LF9 O;  2DOS A;  4JI5 O;  1G1X B;  4B3T O;  1NS1 A;  4B3S O;  2UXD O;  4DV1 O;  2Z0A A;  2UUA O;  3J7A U;  2UXB O;  2AGA A;  3O65 A;  4OX9 O;  1J5E O;  1A32 A;  1X59 A;  2N74 A;  1FJG O;  4JI3 O;  4JI7 O;  4AQY O;  4LF4 O;  4JI0 O;  4JI1 O;  4LF8 O;  4X62 O;  1YZB A;  1XMQ O;  4LF7 O;  1R6T A;  5IT9 N;  1FKA O;  5LL6 Y;  4DR7 O;  1XNQ O;  1IBM O;  2VQE O;  4LF6 O;  4JV5 O;  1AB3 A;  5H5N A;  3SDL A;  4DUZ O;  2ZM6 O;  5LMU O;  1I94 O;  4DR4 O;  4LFB O;  2UUC O;  5BXZ A;  4B3M O;  4JI4 O;  3JAM N;  4YY3 O;  3J80 N;  1HNZ O;  2F4V O;  4K0K O;  4LF5 O;  1AIL A;  4DV0 O;  2LW7 A;  4DR1 O;  1KUQ A;  4DV4 O;  3RT3 C;  3F5T A;  2E5L O;  1D2D A;  1HNW O;  1R1B A;  2UU9 O;  5A2Q N;  1IBL O;  4JI2 O;  2ZKO A;  1XMO O;  1N36 O;  1N33 O;  4JI6 O;  4X65 O;  4A5U B;  3T1H O;  4DR6 O;  4DR2 O;  2DJV A;  4YHH O;  5IWA O;  4LFC O;  5BR8 O;  4JI8 O;  1N34 O;  1DK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...