2AXTZ

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 2axtZ00
4UB8Z 5TISZ 5GTHZ 2AXTZ 5E79Z 4UB6Z 3A0BZ 5KAIZ 5H2FZ 3A0HZ 5B66Z 3KZIZ 4IL6Z 5GTIZ 3WU2Z 5KAFZ 1S5LZ 5B5EZ 4PJ0Z 3JCUZ
chains in the Genus database with same CATH superfamily
1NKDA 4H37A 1MOFA 4TT3G 1M9NA 2X0LA 4TSFG 1TUBA 3QO5A 2HHHO 4I9WA 4I9QA 1NVPB 5CA0A 3UT5B 2VQFO 1XNQO 3GB7C 4JPRA 1B04A 1OCCC 2F4VO 2WLIA 3EXAA 4D7SA 1Z5VA 2HJDA 4D6TH 3HKDB 3CXCU 2Q73A 2QM7A 3K9SA 5CA3A 1MMMA 4LF6B 4KP4A 4JYYA 3OT7A 4FMTA 3AK2A 1S0VA 3FB5C 2RNBA 4CS2A 5GONA 1KD1W 4NXMO 4FK5C 1AR4A 4EEQA 4DYLA 4YIPA 2QA4V 4CZZA 1AI7A 3P3NA 2PZSA 1R3JC 4LCUC 3DXRB 1BT8A 3CEIA 2UXDB 3C3TA 5J2TB 1E1QG 5EIBC 2EIKC 2WLNA 5J2UA 1MG1A 2JS3A 3GWKC 3AG2B 3ZS8C 4DR5B 1HDJA 3SYPA 2A7WA 5JJEB 5L3GA 1WP7A 4X64B 2IJJA 3LSSA 4NTXA 1VQ5V 1A32A 4DV3B 4JF3A 1I0HA 5CBFA 3OUSA 4U3FH 4BW9A 1XNRB 2VS0A 4TUYB 5B66Z 2AZ0A 4TOIA 1JMKC 4JI3B 4UVBA 3RFRA 4G27B 4NTYA 4P2ZA 1R6KA 4G2KA 3IFXA 3M8AA 2XAHA 4R7CA 3JATB 5L3DA 2Q8VA 4JAVA 4H0LB 3DGEA 4XDLA 5BMVA 2GUZA 1AVMA 1VEWA 2Z5UA 4IHJB 2LFRA 4TV9B 3TETA 4IGGA 4E4EA 5D5QA 5BR8O 4CH5A 1OJHA 4DR7O 5LGTA 3SJCC 4JI2B 2CTRA 1SERA 2QWNB 1R1BA 1KU9A 3OM3B 3RYCB 3UT5A 4UB6Z 3HR0A 5LP6A 3HKDA 3JD4A 3LNMB 3VQXA 2EIJC 3KZIZ 4QJFB 2GHYA 3ETGA 3UO2A 2XAQA 5LA6A 1H38A 4U3JB 4LBEC 4OGQB 2Q69A 1XMOB 3D3IA 1GN2A 1SQFA 2LGQA 5FL7G 1V55B 3T4DA 1M1KW 4KHPO 3A0HZ 4DV1B 4JAAA 1EZVH 3CCLV 1JOYA 5EBLC 3EHBB 2ILMA 5KHJA 1GM8A 3DXRA 3RYHB 4JYAB 4GKKB 2HVJC 1CXZB 1RSOA 2L6LA 3FAVB 4OPHA 4IT5A 4PHZA 4CH6A 4MVRA 3T1HB 3P3PA 1M90W 3CCUV 4R50A 3CXHF 1Q90D 1BCCH 3QG5A 1KMIZ 1SA0B 2YS8A 2Y69C 4DV7B 3LNNA 4JI8O 4CH3A 2L35A 1H2GA 2HEPA 2P90A 3JASB 4EB6B 4TUYA 3SPGA 3SGIA 2HLDG 1ZLZA 1AP6A 1IBLO 3JD2A 1VF5B 1I5XA 3GVMA 4PDVA 3JD0A 3ABKB 1NTMH 1ZSPA 2ATKC 3JAMN 1EBOA 1SQGA 3HPLC 3N2KA 4QGPA 4HYOA 2WLJA 1AILA 2YIAA 1NZ6A 4IHJA 1TAEA 3ABLB 4DR3O 1K9MW 3A0BZ 1NR7A 4WFBV 3ABTA 5KA5A 2N05A 4LR3A 5LBQA 1ZL8A 1KBHA 4NTWA 3GWOA 1TUEB 4DUYO 4RAIA 4AILC 3UM7A 2P67A 2JJ1G 4WFEA 2OIEA 3RYCA 4FFKA 4MT8A 4B7KA 2GV9A 1S77D 2CK3G 1GTOA 3ZN1A 2CAZC 4UCUA 2F95B 3U11A 1N33O 4CS4A 1SQVH 3LDCA 1YVWA 2PI4A 2WSSG 1XEQA 2DE0X 1IDSA 3ZHUA 1JJOA 4LFBB 4WBNB 1Q43A 4JI5B 3TXQA 3K79A 4WFHA 1LR1A 4YHHB 1ZUQA 1AR5A 4X65B 3CP1A 2NLJC 1MZFA 4X8AA 1N32B 1YTFD 4LFCO 3W7TA 3CCVV 4X66B 3W7XA 4I7ZB 4JI1O 3UO3A 2QM4A 1M5IA 1R3LC 2F93B 2UUCO 4NXNO 1J5EO 2ZNIA 1VP7A 2BSKB 3BFRA 1F7YA 2A9HA 3FYEB 2WA3A 4KL1A 4BR6A 3L75H 4G28B 5BXZA 4EB6A 1T5EA 2XOKG 4MW8A 1RPOA 5CBHA 1BQ0A 3L74H 1OCOB 4GZRB 1EZJA 2DOSA 2IH3C 2ZR3A 1MSWD 3RYFB 1XL4A 1AI4A 3FYIB 4AQYB 2W0FC 2XTAA 3R65A 5JCOA 1BMFG 3OTOO 4QIWF 1SETA 2ZXWB 2HP8A 1FFXB 3L9DA 5DN6G 3A8TA 4PDMA 3AG2C 3CWBH 3BRCA 3B40A 1XL6A 1VQOV 4UB8Z 2ZIOA 4HZ3A 5JH7B 2YSUB 3S3WA 1QCEA 2DW4A 4OXSA 2OT5A 3VQYA 4WCEV 4YXWG 3KCYA 1PV0A 1SQBH 4DR4B 5BY1A 3JALB 5IYZB 1N0JA 1QBZA 3AK1A 2JRIA 4B3MB 2B9ZA 5GTHZ 1RFYA 3HKBB 4K0KO 4MTFA 2QDOA 2EJRA 5F2VO 1K4CC 4ZI7B 2Q7GA 4JI4O 1HR0B 4IYIA 4FFBA 2VQEB 5IJ0B 3C3SA 4J10A 2WLKA 1YJ9V 2PYLA 2IJKA 2K1EA 1N34O 2XUMA 1K92A 3CC7V 2X7RB 1AR1B 4P9PA 1E1RG 1IBKB 2NR5A 1VQ6V 2CUGA 1TVKB 2QWPB 4I55B 3T2MA 1XI1A 1K73W 2QE7G 3F7VC 1W2BU 4UVCA 5GW7A 5AG2A 3LDEA 1PM9A 4J42A 2NN4A 4X1KB 1P7BA 3K5NA 2BSKA 1MSDA 4X20B 3L73H 5KX5A 1IX9A 1B3QA 1U97A 4K35A 1QHTA 3CS5A 3S3XA 3JSLA 5LMUB 2YI8A 4BWAA 4DUZB 2W0XA 2LP7A 4JYCA 4LNUB 4IL6Z 1KP2A 1LUWA 1I94O 1JFFB 1V55C 4O4IA 1YJWV 3WG7B 4B3TB 4BIZA 3F5TA 2R70A 3RYFA 3H1LH 2Q0OC 1P4RA 3IC7A 1QLEB 5KHGA 3CCJV 1H8EG 1WP8A 5DECA 2XAFA 2K9PA 1WN7A 3ZMZA 1FFXA 3ZHSA 1OCZB 5LYJB 4DR2O 2B1IA 2LGWA 4O4HA 4J11A 1VQ8V 3A0RA 4PDRA 1JVMA 2DJVA 3ZHVA 2YUAA 1N8RW 5B1AB 1EM1A 2E5LB 4LF9O 4UCSA 4EKWA 4B3RB 3Q4HB 2O57A 2M7WA 1YSCA 3JALA 2YEVB 3X2QB 5IYZA 3T1YO 2UXBO 4FLXA 5FNVB 1GM7A 1QR9A 1I5YA 4MVUA 3D36A 4J7KA 1FJGB 3HKBA 1V9PA 2HHHB 3QVNA 1SESA 3ABKC 2HJFC 3OTFA 3ZBHA 1Q81W 2F66C 4ZI7A 5JCOC 1XNQB 1OCRB 1NH2D 4FLVA 1JJ2U 3ABLC 3E83A 4GT1A 5IJ0A 2AGAA 4RQEA 2Y4TA 1M56B 4HAMA 2AHZA 4RWUA 1HNXB 1DLBA 1FXVA 1UPGA 5FPRA 3P30A 3QO8A 4LF4O 3JCUZ 1ORQC 1W0KG 1TVKA 2PYJA 1VQ7V 5JWPA 3IC9A 2FMLA 3LSUA 1NBMG 5DM6V 4NXMB 3CCMV 3MDSA 1AP5A 4X1KA 3DTUB 5H6QA 3HKCB 4LFAB 4CH4A 3N2GB 4X20A 2DN9A 4GLXA 1RPRA 1ZX3A 1HNWO 3ETQA 4DV2B 4RO2A 3ZN0A 1XMQB 1Q8IA 3ASOB 3IJ4A 4LNUA 1D5AA 1XILA 3AEIA 1JFFA 5KLVH 3UCSC 1QVFU 3BAAA 4U7OA 4FLYA 3WFVA 1EN5A 1WB7A 3B09A 1KYOF 3JAKB 5LGUA 2EBOA 3L71H 2MW2B 3H1IH 3T1CA 5LYJA 5A2QN 5CMUA 4KFMA 2FYUH 4LH6A 4F6EA 2CH7B 1XOUA 1GN6A 1B06A 1I7FA 3W7WA 1DTOA 1LUVA 4YY3B 1PP9H 3H1JH 2P7TC 5E1AC 2JEUA 3AG3B 4EFEA 5KHIA 1R6TA 4MVZA 1S5JA 3FKSG 4JI6B 2YEVA 3JD3A 1PNMA 1K97A 4LF6O 1YTFB 2Q4PA 3OAAG 4NB5A 5FNVA 1OCOC 1XBLA 2JGDB 4GX0A 4DV0B 2GSMB 1QQCA 4FZ1A 3DC6A 1SZTA 5B3SB 3E8HA 3KCXA 5GTIZ 1DGSA 1Q3EA 4PJ0Z 2GBOA 1GMGA 1H2SB 1KP3A 1MNGA 1PL4A 3K5LA 1H8HG 2R9RB 1DF4A 4JI7O 2ZXWC 2KG7B 2AXTZ 1Y76A 4PA7A 2UU9O 2UUBO 4I0XA 1HNZO 2V4DA 5KA6A 1J95A 4CC6A 1XUQA 1IBMB 4B08A 4PV1B 2UXDO 3QNEA 1TA8A 3OUFA 2NNUA 1KC8W 2R9AA 2JS5A 4YIOA 5IJ9B 2X6AA 1FXHA 2QSAA 2AW9A 5B1OA 1YCIA 4PI0A 4KHPB 1R73A 1LNQA 3HKCA 4DRXB 4X64O 4XDJA 3HKEB 3UKMA 3N2GA 2VWJA 5JJJB 4DV3O 3D36C 3E8BA 4ZKIA 1YEWA 2N74A 3THOA 1XNRO 2ADQB 2YICA 3QF7A 3L70H 1VARA 1PD3A 2F23A 1S3JA 3L72H 4DV6O 2UUAO 3K58A 4JI3O 1P49A 4UXNA 1PKXA 4FM0A 1THZA 1GRJA 2ZM6B 1Q6UA 5EK0A 1N4CA 3ZMSA 5EBWC 4JI8B 3CMEV 3JARB 4FVMA 2XHBA 2OCCB 1F4NA 1TGOA 4D7TA 1YITV 1S76D 3N27A 4JASA 3T4ZA 4MTOA 5J2TA 1VQMV 4FM2A 4JI2O 3DSQA 1AB3A 2CH7A 4J9YB 4JYBA 3NR7A 2DWEC 4UV9A 1O9GA 4NYKA 2RCVA 2DYSB 1DF5A 2WLHA 2DQ3A 4GX2A 4JZ2A 1FKAO 4MVQA 5KUKA 1Y6XA 2DQ0A 2JGDA 4IIJB 1X59A 3WG7C 2Q7EA 3ZRXA 4DUYB 5IYCO 2XAJA 5CB4B 1Y74B 5IDJA 3I55V 1NU1H 2OIGA 1QLEC 2XT9A 1JR9A 1H2KA 3SJAC 1FYJA 2ETNA 2RQ6A 2QM8A 3R66A 1FXKB 3LUTB 4FLTA 1OCZC 3DC5A 1Y66A 3JATA 5JJNB 2CGNA 1B6QA 2QTOA 5LMNB 1WPXA 2WWWA 3RW0A 4TV9A 2Q0AA 1SQXH 4JYAO 5B1AC 1F4MA 1Q6IA 1F51A 1L8DA 5IJ9A 5EYPB 3T1HO 2ZE7A 3SJBC 2FTKA 3X2QC 1RP3B 4F4LA 3TK1A 4DRXA 4GUNA 3HKEA 4GX5A 2QTSA 3CD6V 2ZE8A 4UCVA 3KG2A 4DV7O 4LFCB 2VWKA 1AJPA 3ZHRA 3CMAV 3SDLA 3SPCA 4DR6B 3D8CA 2LW1A 2D3OW 5IY5B 4UV8A 4GX1A 1QR8A 4OX9O 1OCRC 3OEHG 4NXNB 4U3JA 3WU2Z 1PPJH 2WLLB 1M56C 1SQQH 2JEXA 1R3IC 5LHHA 3E2EA 2QKAA 3E86A 4ZBMA 2OYQA 2FKXA 3JARA 5FLXN 5KUMA 2WAMA 2Y4UA 1I08A 2Q7HA 3W7SA 2W6JG 3E35A 3SYOA 3RYHA 2KSDA 3E8FA 3K04A 1GKFA 2QR4A 3CCRV 1GN4A 5HFLA 4K8ZA 3FAVA 1H2LA 1IZ3A 1S72V 1VQLV 2P5OA 4TQDA 1NH2B 4BIUA 3W7UA 4LF8B 1PNLA 2YDEA 4O2BB 3OTOB 1SA0A 2YXLA 1K7DA 3ASOC 2JVDA 2Z3YA 1YF2A 2BOBC 4IIJA 3JASA 4PI2A 1FPOA 5CB4A 1Y74A 1BE3H 4LFBO 5B1BB 4CS3A 4FLZA 3J80N 4O2AB 1BGYH 1EFRG 4YHHO 1GH6A 1FXKA 3STZC 1N36O 3G6BA 4ASUG 4JTCB 3OGIB 3C90A 2HFEC 1AJQA 2FB5A 4I4TB 4YJ3B 1HWYA 4WF9V 1YI2V 2EIMB 4X66O 1NTKH 1AI5A 2IU3A 2Q9LA 4RUEA 2F43G 3TCUA 3ML0A 5EYPA 4JGSA 3AG3C 4FM1A 1SZXA 1QU7A 4C7UA 1VQ4V 4JI4B 3U0ZA 2B1GA 2ITCC 1IXBA 2RMKB 4DV5B 1N34B 5B5EZ 5LL6Y 5B3SC 1D2DA 1K33A 3M99B 2PF4E 2Q67A 4H13B 4LH7A 4QE7A 2HVKC 4JZGA 3K06A 4DV4O 3BEHA 4PD4F 3G4SV 3EVKA 2WLLA 4WBNA 2YIBA 1MZEA 4GKJB 1WAZA 1SQPH 1VQPV 4AQYO 3B8MA 1PL0A 4CBCA 2G38A 2PY5A 3ZJZA 4F6RB 1WA8B 1SS3A 3IAYA 4JTDB 4RQFA 3H01A 5IWAB 3VQWA 2IJIA 3APOA 3WB1A 3F5WC 1WJZA 1K34A 1G6UA 5B1NA 5KMGB 4JTAB 2ZINA 3LDDA 1RM1B 4O2BA 2LW7A 3OE7G 4MVSA 1Q5OA 2LO1A 3NXSA 4DR2B 4DR1O 3RN4A 4X89A 4B3MO 1L0LH 2P22C 2ZNJA 2B5UA 4PELA 5EC2C 3FB7C 3K5MA 4O2AA 3FFQA 3BA9A 3CRQA 2OCCC 2WLIB 3JSNA 4TV8B 4X62B 4U7NA 2X6CA 1COWG 1O9HA 1BL8A 4UCRA 2Y48A 3TGUH 3T1YB 3OR6C 2UXBB 2ZCEA 3JAWB 4I4TA 4YJ3A 3ZEDA 3RVYA 4JI0B 2ITDC 3K59A 3OMAB 3JYCA 3VBBA 5JH7A 2DYSC 1XQ8A 4DXWA 4J41A 4B3SO 3STLC 3CHXA 2KB1A 3ABMB 2EINB 1Y67A 1H2MA 3H1HH 4LF5O 1Q82W 3E8GA 3AG4B 1P84F 3QTCA 1L1FA 1VF6A 4J7JA 4J9ZB 1NQTA 4DUZO 5DEDA 4FZ0A 2QGNA 4MVOA 1NR1A 1Q6HA 1OZ0A 1FAFA 2YXYA 4B3TO 1FXKC 1GK9A 4WFFA 5EC1C 2VQFB 1JX9A 5H5NA 1BZKA 3SPIA 2F4VB 4MTXA 1K3EA 1HNWB 4LF7O 2QJ1A 1WA8A 5CA1B 4I5SA 1YDXA 3FB8C 5HFMA 1BQZA 4K3AA 4EFBA 3RYIB 4I55A 5BZBA 4NVPA 2OTJV 3CE2A 4JAUA 5EIBD 1KQSU 2AZ2A 4B3RO 1JQ0A 2ZR2A 2UXCO 4JV5O 5IY5C 5LHIA 3BY6A 1FFTB 5EZYB 1P7GA 4KXRA 4PA4A 1XREA 1FJGO 2R72A 4ZHQB 3FX7A 3BABA 2P6JA 4ABMA 3MHHC 2BE3A 4TV8A 3K5OA 5LP6B 2N04A 3OGCC 3CJHB 5IE9A 1HNXO 2C2AA 3MHSC 5ITZB 4DW1A 1YHQV 4XDKA 1K4DC 3JAWA 1VMGA 3UQ8A 2Q68A 5LA6B 1ZAUA 1QNMA 2CDYA 3G80A 3I56V 3IGAC 2QEXV 1YZBA 1SKVA 1K5QA 4JI7B 1ZWIC 5C8YB 1VQ9V 2HKOA 1K5SA 3VOUA 2ZQMA 4LFAO 3CPWU 2UU9B 2UUBB 2PTMA 5TISZ 3Q4HA 5LHGA 1HNZB 4N23A 3RVZA 2GTSA 4DV2O 2PI5A 2W6IG 3A2FA 2E74B 1XMQO 5B1BC 5BR8B 1RSOB 4DR7B 1BHAA 4FPPA 2GDSA 3CRRA 3WB2A 2X6BA 2JIZG 3CSXA 4ZOLB 1MA1A 1Z2GA 1KB9F 4FLUA 4Z1VA 3ZRVA 5K1XA 2KKWA 2EIMC 3RBZA 5CA1A 1XHXA 1AJNA 2XASA 2BTOA 4DV6B 4XBFA 1G4YB 2UUAB 3RYIA 4Q6GA 1FD9A 4W4KA 5CBGA 2UXNA 3ZCCA 4DR5O 3ETDA 4YY3O 5E79Z 2VRZA 3G6EV 2ZIMA 3N2KB 5K1PA 2HG5C 2OTLV 4JI6O 2A06H 1VF6C 1IXMA 1N0NA 1XHZA 5A9GA 2YXHA 1NI8A 5EZYA 1ZL8B 1XDCA 4DV0O 2RN9A 2YC0A 2EZPA 4ZHQA 2QWOB 2EULA 1F23A 3AG1B 3RT3C 4ZIBA 3ZMVA 3ZX6A 1ZTEA 5FPOA 2CTPA 1OHHG 2PGGA 4UFZA 3BVOA 3CJHA 1IVSA 1X4TA 3CCQV 5ITZA 3JAKA 1GO3F 4Z1MG 1IBMO 1V54B 3RWRD 1IURA 2XAGA 2A0LA 4L8JA 3AG7A 1D5NA 3AK3A 4YJ2B 1GM9A 2OCHA 2DWDC 3BCCH 1RM1C 1IBLB 1KUQA 3K57A 3O9OA 3OD4A 5C8YA 2EILB 2A79B 1M57B 2EZOA 4B7EA 3SYCA 3F7YC 4HNAB 4DR3B 4X9QA 2YIDA 2GTAA 1GAXA 2H3OA 1KKCA 2DMXA 2UXXA 3WB0A 3JD1A 4UUJC 4ZOLA 3MAQA 4TQFA 3SYAA 3FB6C 4DK1A 3ZMTA 2ZDIA 4H44B 1XMOO 4OPAA 3ABUA 2ZM6O 4K8XA 2LQTA 2KG7A 1ENVA 4DV1O 4Z2WA 3SPHA 2XNDG 4X88A 1H2NA 1NTZH 2JGUA 1N33B 2Z0AA 3BHPA 1SRYA 2ARHA 4OX9B 1HP8A 4FJCC 3J81N 4ICGA 2DYRB 2IJHA 3H9VA 2QWRB 4GKKO 1CEZA 2E3CA 3ABMC 2E75B 2EINC 1VIBA 3ASNB 5L3EA 1NVPD 4MSWC 3CCSV 2Y0PA 2EX3A 1SF9A 3AG4C 1VF7A 2QKCA 4QPKA 3PJSK 1DK1A 1KECA 4W4LA 5LOVB 2V1DA 2ADPA 2JDIG 2ZD9A 4P30A 4JI1B 2ZT9B 3M7MX 2UUCB 3OR7C 4Q20A 4BW5A 4A5UB 2IU0A 1J5EB 1URFA 5JVDB 3CC2V 1US6A 2JJ2G 1VQKV 4CC5A 1OCCB 5LMNO 3K03A 2WA4A 2BOCC 4P9OA 4YJ2A 3U10A 1OV9A 1QLNA 1S5LZ 1VQNV 3SPJA 4QPJA 3CRAA 4X1IB 4FFBB 1N36B 3J7AU 2QKSA 1U96A 4DW0A 3CB2A 2WPDG 4HNAA 3SJQC 2IBZH 3OW2U 1G8MA 4DR6O 2Q5ZA 2A3QA 1S5HC 1UJWB 3TJTA 5LP6C 4UCOA 4WFGA 2EIKB 2CGOA 4JI5O 5KX5B 1BHBA 3ICXA 1Q7YW 2RDCA 3QO7A 1M4UA 2WLMA 4X65O 1Z5WA 3B2EE 3B8NA 5KAFZ 3ZRWB 2BTQB 3VQVA 1JPXA 4DV4B 1N32O 1R6NA 3RGBA 3E89A 4AI8A 4K0KB 2P4VA 4O4IB 5JQGB 5J9PC 4UVAA 2P4KA 3FD9A 1HW7A 3G71V 4RUFA 2D2CB 4LF8O 1ROPA 2H8PC 4X1YB 5LXTB 3K0DA 4O4HB 5LOVA 3PN1A 5IYDO 4N21A 1BSMA 4LP8A 3K3WA 3K08A 2ZDIC 5L3CA 2RJZA 5KHKA 4E2LA 4GCZA 5D5PA 1W0JG 2LJ2A 1CP9A 3G67A 4O4LB 3MD0A 3TXSA 5JVDA 1QVGU 2ZE6A 5L3BA 4DR1B 1NJIW 1FS0G 3CCEV 4MS2A 3H1KH 4NR1A 2EIJB 3CRCA 4IYHA 4MVMA 2QWQB 4GYCB 3ZHQA 1I94B 4O4JB 3OMNB 2OWOA 4UCTA 2CTQA 4PDLA 3OFNG 2R9IA 4X1IA 1AROP 2BCCH 1NT2B 2H94A 1E79G 4I50B 4LWSB 1WLEA 3E22B 3P32A 4R8CA 3BA8A 4NKGB 2M6YA 4DV5O 1EN6A 2FL4A 3CX5F 4BIOA 4DR4O 3HB3B 5IT9N 4PA6A 2IM9A 4LC1A 3ZRSA 2ODMA 3AG1C 1WB8A 4QE9A 1WPBA 1WNSA 5H6RA 3KKYA 1TUBB 3ZIAG 1K8AW 4B3SB 2JK5C 4GKJO 5CA0B 4LF9B 1M93A 4BAYA 1L0NH 3SR2C 4DK0A 4LF5B 1HR0O 1JA8A 3K0GA 2VQEO 1V54C 4J7ZA 3JCZA 3CYOA 5H9CA 5IWAO 2Q6AA 3ZRWA 4PA9A 2BTQA 1PNKA 1CPYA 4DO2A 5CN0A 1IBKO 2LFSA 1YIJV 2Y69B 2Y0IA 5C93A 5L3FA 2MK3A 1G1XB 4HBNA 5JQGA 5LGNA 2EILC 3ETEA 1M57C 3LSQA 5GONB 3OMIB 1BS3A 4WFAV 1EN4A 1YXBA 2HR3A 4QNHB 3SYQA 1R3KC 1W59A 4R6ZA 1NS1A 4LF7B 2ZKOA 4X1YA 5LXTA 4H33A 4LF4B 3OEEG 3ZMUA 2AHYA 5LMUO 4FLWA 2V7QG 4MW3A 2E76B 3CC4V 1Y4MA 1YJNV 5KHHA 5J2UB 2P06A 1AI6A 4L87A 2IH1C 2YIBD 4PA3A 1MABG 3B4SA 4KUMA 3ZHTA 4O4LA 1UFIA 2F1MA 2PUSA 3B77A 4X62O 5H2FZ 2UXCB 2CE4A 4J80A 4JV5B 3BPZA 1Q86W 4F6RA 4FIPC 3CRMA 2DYRC 1SC5B 5EBMC 3ASNC 4TWKA 4JI0O 5IYBO 4AHCA 4MTGA 3O65A 2KQXA 2EJ7A 4O4JA 2YI9A 2CTWA 5KAIZ 3I5DA 1JCHA 3D3QA 4I50A 1Y76B 4LWSA 3APQA 2E5LO 3E22A 5KMGA 1KKDA 2ZE5A 4I0XB 5BMVB 2GUZB 3EFFK 2IW5A 3K9AA 1GN3A
chains in the Genus database with same CATH topology
4UB8Z 5TISZ 5GTHZ 2AXTZ 5E79Z 4UB6Z 3A0BZ 5KAIZ 5H2FZ 3A0HZ 5B66Z 3KZIZ 4IL6Z 5GTIZ 3WU2Z 5KAFZ 1S5LZ 5B5EZ 4PJ0Z 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 Z;  5TIS Z;  5GTH Z;  2AXT Z;  5E79 Z;  4UB6 Z;  3A0B Z;  5KAI Z;  5H2F Z;  3A0H Z;  5B66 Z;  3KZI Z;  4IL6 Z;  5GTI Z;  3WU2 Z;  5KAF Z;  1S5L Z;  5B5E Z;  4PJ0 Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 1NKD A;  4H37 A;  1MOF A;  4TT3 G;  1M9N A;  2X0L A;  4TSF G;  1TUB A;  3QO5 A;  2HHH O;  4I9W A;  4I9Q A;  1NVP B;  5CA0 A;  3UT5 B;  2VQF O;  1XNQ O;  3GB7 C;  4JPR A;  1B04 A;  1OCC C;  2F4V O;  2WLI A;  3EXA A;  4D7S A;  1Z5V A;  2HJD A;  4D6T H;  3HKD B;  3CXC U;  2Q73 A;  2QM7 A;  3K9S A;  5CA3 A;  1MMM A;  4LF6 B;  4KP4 A;  4JYY A;  3OT7 A;  4FMT A;  3AK2 A;  1S0V A;  3FB5 C;  2RNB A;  4CS2 A;  5GON A;  1KD1 W;  4NXM O;  4FK5 C;  1AR4 A;  4EEQ A;  4DYL A;  4YIP A;  2QA4 V;  4CZZ A;  1AI7 A;  3P3N A;  2PZS A;  1R3J C;  4LCU C;  3DXR B;  1BT8 A;  3CEI A;  2UXD B;  3C3T A;  5J2T B;  1E1Q G;  5EIB C;  2EIK C;  2WLN A;  5J2U A;  1MG1 A;  2JS3 A;  3GWK C;  3AG2 B;  3ZS8 C;  4DR5 B;  1HDJ A;  3SYP A;  2A7W A;  5JJE B;  5L3G A;  1WP7 A;  4X64 B;  2IJJ A;  3LSS A;  4NTX A;  1VQ5 V;  1A32 A;  4DV3 B;  4JF3 A;  1I0H A;  5CBF A;  3OUS A;  4U3F H;  4BW9 A;  1XNR B;  2VS0 A;  4TUY B;  5B66 Z;  2AZ0 A;  4TOI A;  1JMK C;  4JI3 B;  4UVB A;  3RFR A;  4G27 B;  4NTY A;  4P2Z A;  1R6K A;  4G2K A;  3IFX A;  3M8A A;  2XAH A;  4R7C A;  3JAT B;  5L3D A;  2Q8V A;  4JAV A;  4H0L B;  3DGE A;  4XDL A;  5BMV A;  2GUZ A;  1AVM A;  1VEW A;  2Z5U A;  4IHJ B;  2LFR A;  4TV9 B;  3TET A;  4IGG A;  4E4E A;  5D5Q A;  5BR8 O;  4CH5 A;  1OJH A;  4DR7 O;  5LGT A;  3SJC C;  4JI2 B;  2CTR A;  1SER A;  2QWN B;  1R1B A;  1KU9 A;  3OM3 B;  3RYC B;  3UT5 A;  4UB6 Z;  3HR0 A;  5LP6 A;  3HKD A;  3JD4 A;  3LNM B;  3VQX A;  2EIJ C;  3KZI Z;  4QJF B;  2GHY A;  3ETG A;  3UO2 A;  2XAQ A;  5LA6 A;  1H38 A;  4U3J B;  4LBE C;  4OGQ B;  2Q69 A;  1XMO B;  3D3I A;  1GN2 A;  1SQF A;  2LGQ A;  5FL7 G;  1V55 B;  3T4D A;  1M1K W;  4KHP O;  3A0H Z;  4DV1 B;  4JAA A;  1EZV H;  3CCL V;  1JOY A;  5EBL C;  3EHB B;  2ILM A;  5KHJ A;  1GM8 A;  3DXR A;  3RYH B;  4JYA B;  4GKK B;  2HVJ C;  1CXZ B;  1RSO A;  2L6L A;  3FAV B;  4OPH A;  4IT5 A;  4PHZ A;  4CH6 A;  4MVR A;  3T1H B;  3P3P A;  1M90 W;  3CCU V;  4R50 A;  3CXH F;  1Q90 D;  1BCC H;  3QG5 A;  1KMI Z;  1SA0 B;  2YS8 A;  2Y69 C;  4DV7 B;  3LNN A;  4JI8 O;  4CH3 A;  2L35 A;  1H2G A;  2HEP A;  2P90 A;  3JAS B;  4EB6 B;  4TUY A;  3SPG A;  3SGI A;  2HLD G;  1ZLZ A;  1AP6 A;  1IBL O;  3JD2 A;  1VF5 B;  1I5X A;  3GVM A;  4PDV A;  3JD0 A;  3ABK B;  1NTM H;  1ZSP A;  2ATK C;  3JAM N;  1EBO A;  1SQG A;  3HPL C;  3N2K A;  4QGP A;  4HYO A;  2WLJ A;  1AIL A;  2YIA A;  1NZ6 A;  4IHJ A;  1TAE A;  3ABL B;  4DR3 O;  1K9M W;  3A0B Z;  1NR7 A;  4WFB V;  3ABT A;  5KA5 A;  2N05 A;  4LR3 A;  5LBQ A;  1ZL8 A;  1KBH A;  4NTW A;  3GWO A;  1TUE B;  4DUY O;  4RAI A;  4AIL C;  3UM7 A;  2P67 A;  2JJ1 G;  4WFE A;  2OIE A;  3RYC A;  4FFK A;  4MT8 A;  4B7K A;  2GV9 A;  1S77 D;  2CK3 G;  1GTO A;  3ZN1 A;  2CAZ C;  4UCU A;  2F95 B;  3U11 A;  1N33 O;  4CS4 A;  1SQV H;  3LDC A;  1YVW A;  2PI4 A;  2WSS G;  1XEQ A;  2DE0 X;  1IDS A;  3ZHU A;  1JJO A;  4LFB B;  4WBN B;  1Q43 A;  4JI5 B;  3TXQ A;  3K79 A;  4WFH A;  1LR1 A;  4YHH B;  1ZUQ A;  1AR5 A;  4X65 B;  3CP1 A;  2NLJ C;  1MZF A;  4X8A A;  1N32 B;  1YTF D;  4LFC O;  3W7T A;  3CCV V;  4X66 B;  3W7X A;  4I7Z B;  4JI1 O;  3UO3 A;  2QM4 A;  1M5I A;  1R3L C;  2F93 B;  2UUC O;  4NXN O;  1J5E O;  2ZNI A;  1VP7 A;  2BSK B;  3BFR A;  1F7Y A;  2A9H A;  3FYE B;  2WA3 A;  4KL1 A;  4BR6 A;  3L75 H;  4G28 B;  5BXZ A;  4EB6 A;  1T5E A;  2XOK G;  4MW8 A;  1RPO A;  5CBH A;  1BQ0 A;  3L74 H;  1OCO B;  4GZR B;  1EZJ A;  2DOS A;  2IH3 C;  2ZR3 A;  1MSW D;  3RYF B;  1XL4 A;  1AI4 A;  3FYI B;  4AQY B;  2W0F C;  2XTA A;  3R65 A;  5JCO A;  1BMF G;  3OTO O;  4QIW F;  1SET A;  2ZXW B;  2HP8 A;  1FFX B;  3L9D A;  5DN6 G;  3A8T A;  4PDM A;  3AG2 C;  3CWB H;  3BRC A;  3B40 A;  1XL6 A;  1VQO V;  4UB8 Z;  2ZIO A;  4HZ3 A;  5JH7 B;  2YSU B;  3S3W A;  1QCE A;  2DW4 A;  4OXS A;  2OT5 A;  3VQY A;  4WCE V;  4YXW G;  3KCY A;  1PV0 A;  1SQB H;  4DR4 B;  5BY1 A;  3JAL B;  5IYZ B;  1N0J A;  1QBZ A;  3AK1 A;  2JRI A;  4B3M B;  2B9Z A;  5GTH Z;  1RFY A;  3HKB B;  4K0K O;  4MTF A;  2QDO A;  2EJR A;  5F2V O;  1K4C C;  4ZI7 B;  2Q7G A;  4JI4 O;  1HR0 B;  4IYI A;  4FFB A;  2VQE B;  5IJ0 B;  3C3S A;  4J10 A;  2WLK A;  1YJ9 V;  2PYL A;  2IJK A;  2K1E A;  1N34 O;  2XUM A;  1K92 A;  3CC7 V;  2X7R B;  1AR1 B;  4P9P A;  1E1R G;  1IBK B;  2NR5 A;  1VQ6 V;  2CUG A;  1TVK B;  2QWP B;  4I55 B;  3T2M A;  1XI1 A;  1K73 W;  2QE7 G;  3F7V C;  1W2B U;  4UVC A;  5GW7 A;  5AG2 A;  3LDE A;  1PM9 A;  4J42 A;  2NN4 A;  4X1K B;  1P7B A;  3K5N A;  2BSK A;  1MSD A;  4X20 B;  3L73 H;  5KX5 A;  1IX9 A;  1B3Q A;  1U97 A;  4K35 A;  1QHT A;  3CS5 A;  3S3X A;  3JSL A;  5LMU B;  2YI8 A;  4BWA A;  4DUZ B;  2W0X A;  2LP7 A;  4JYC A;  4LNU B;  4IL6 Z;  1KP2 A;  1LUW A;  1I94 O;  1JFF B;  1V55 C;  4O4I A;  1YJW V;  3WG7 B;  4B3T B;  4BIZ A;  3F5T A;  2R70 A;  3RYF A;  3H1L H;  2Q0O C;  1P4R A;  3IC7 A;  1QLE B;  5KHG A;  3CCJ V;  1H8E G;  1WP8 A;  5DEC A;  2XAF A;  2K9P A;  1WN7 A;  3ZMZ A;  1FFX A;  3ZHS A;  1OCZ B;  5LYJ B;  4DR2 O;  2B1I A;  2LGW A;  4O4H A;  4J11 A;  1VQ8 V;  3A0R A;  4PDR A;  1JVM A;  2DJV A;  3ZHV A;  2YUA A;  1N8R W;  5B1A B;  1EM1 A;  2E5L B;  4LF9 O;  4UCS A;  4EKW A;  4B3R B;  3Q4H B;  2O57 A;  2M7W A;  1YSC A;  3JAL A;  2YEV B;  3X2Q B;  5IYZ A;  3T1Y O;  2UXB O;  4FLX A;  5FNV B;  1GM7 A;  1QR9 A;  1I5Y A;  4MVU A;  3D36 A;  4J7K A;  1FJG B;  3HKB A;  1V9P A;  2HHH B;  3QVN A;  1SES A;  3ABK C;  2HJF C;  3OTF A;  3ZBH A;  1Q81 W;  2F66 C;  4ZI7 A;  5JCO C;  1XNQ B;  1OCR B;  1NH2 D;  4FLV A;  1JJ2 U;  3ABL C;  3E83 A;  4GT1 A;  5IJ0 A;  2AGA A;  4RQE A;  2Y4T A;  1M56 B;  4HAM A;  2AHZ A;  4RWU A;  1HNX B;  1DLB A;  1FXV A;  1UPG A;  5FPR A;  3P30 A;  3QO8 A;  4LF4 O;  3JCU Z;  1ORQ C;  1W0K G;  1TVK A;  2PYJ A;  1VQ7 V;  5JWP A;  3IC9 A;  2FML A;  3LSU A;  1NBM G;  5DM6 V;  4NXM B;  3CCM V;  3MDS A;  1AP5 A;  4X1K A;  3DTU B;  5H6Q A;  3HKC B;  4LFA B;  4CH4 A;  3N2G B;  4X20 A;  2DN9 A;  4GLX A;  1RPR A;  1ZX3 A;  1HNW O;  3ETQ A;  4DV2 B;  4RO2 A;  3ZN0 A;  1XMQ B;  1Q8I A;  3ASO B;  3IJ4 A;  4LNU A;  1D5A A;  1XIL A;  3AEI A;  1JFF A;  5KLV H;  3UCS C;  1QVF U;  3BAA A;  4U7O A;  4FLY A;  3WFV A;  1EN5 A;  1WB7 A;  3B09 A;  1KYO F;  3JAK B;  5LGU A;  2EBO A;  3L71 H;  2MW2 B;  3H1I H;  3T1C A;  5LYJ A;  5A2Q N;  5CMU A;  4KFM A;  2FYU H;  4LH6 A;  4F6E A;  2CH7 B;  1XOU A;  1GN6 A;  1B06 A;  1I7F A;  3W7W A;  1DTO A;  1LUV A;  4YY3 B;  1PP9 H;  3H1J H;  2P7T C;  5E1A C;  2JEU A;  3AG3 B;  4EFE A;  5KHI A;  1R6T A;  4MVZ A;  1S5J A;  3FKS G;  4JI6 B;  2YEV A;  3JD3 A;  1PNM A;  1K97 A;  4LF6 O;  1YTF B;  2Q4P A;  3OAA G;  4NB5 A;  5FNV A;  1OCO C;  1XBL A;  2JGD B;  4GX0 A;  4DV0 B;  2GSM B;  1QQC A;  4FZ1 A;  3DC6 A;  1SZT A;  5B3S B;  3E8H A;  3KCX A;  5GTI Z;  1DGS A;  1Q3E A;  4PJ0 Z;  2GBO A;  1GMG A;  1H2S B;  1KP3 A;  1MNG A;  1PL4 A;  3K5L A;  1H8H G;  2R9R B;  1DF4 A;  4JI7 O;  2ZXW C;  2KG7 B;  2AXT Z;  1Y76 A;  4PA7 A;  2UU9 O;  2UUB O;  4I0X A;  1HNZ O;  2V4D A;  5KA6 A;  1J95 A;  4CC6 A;  1XUQ A;  1IBM B;  4B08 A;  4PV1 B;  2UXD O;  3QNE A;  1TA8 A;  3OUF A;  2NNU A;  1KC8 W;  2R9A A;  2JS5 A;  4YIO A;  5IJ9 B;  2X6A A;  1FXH A;  2QSA A;  2AW9 A;  5B1O A;  1YCI A;  4PI0 A;  4KHP B;  1R73 A;  1LNQ A;  3HKC A;  4DRX B;  4X64 O;  4XDJ A;  3HKE B;  3UKM A;  3N2G A;  2VWJ A;  5JJJ B;  4DV3 O;  3D36 C;  3E8B A;  4ZKI A;  1YEW A;  2N74 A;  3THO A;  1XNR O;  2ADQ B;  2YIC A;  3QF7 A;  3L70 H;  1VAR A;  1PD3 A;  2F23 A;  1S3J A;  3L72 H;  4DV6 O;  2UUA O;  3K58 A;  4JI3 O;  1P49 A;  4UXN A;  1PKX A;  4FM0 A;  1THZ A;  1GRJ A;  2ZM6 B;  1Q6U A;  5EK0 A;  1N4C A;  3ZMS A;  5EBW C;  4JI8 B;  3CME V;  3JAR B;  4FVM A;  2XHB A;  2OCC B;  1F4N A;  1TGO A;  4D7T A;  1YIT V;  1S76 D;  3N27 A;  4JAS A;  3T4Z A;  4MTO A;  5J2T A;  1VQM V;  4FM2 A;  4JI2 O;  3DSQ A;  1AB3 A;  2CH7 A;  4J9Y B;  4JYB A;  3NR7 A;  2DWE C;  4UV9 A;  1O9G A;  4NYK A;  2RCV A;  2DYS B;  1DF5 A;  2WLH A;  2DQ3 A;  4GX2 A;  4JZ2 A;  1FKA O;  4MVQ A;  5KUK A;  1Y6X A;  2DQ0 A;  2JGD A;  4IIJ B;  1X59 A;  3WG7 C;  2Q7E A;  3ZRX A;  4DUY B;  5IYC O;  2XAJ A;  5CB4 B;  1Y74 B;  5IDJ A;  3I55 V;  1NU1 H;  2OIG A;  1QLE C;  2XT9 A;  1JR9 A;  1H2K A;  3SJA C;  1FYJ A;  2ETN A;  2RQ6 A;  2QM8 A;  3R66 A;  1FXK B;  3LUT B;  4FLT A;  1OCZ C;  3DC5 A;  1Y66 A;  3JAT A;  5JJN B;  2CGN A;  1B6Q A;  2QTO A;  5LMN B;  1WPX A;  2WWW A;  3RW0 A;  4TV9 A;  2Q0A A;  1SQX H;  4JYA O;  5B1A C;  1F4M A;  1Q6I A;  1F51 A;  1L8D A;  5IJ9 A;  5EYP B;  3T1H O;  2ZE7 A;  3SJB C;  2FTK A;  3X2Q C;  1RP3 B;  4F4L A;  3TK1 A;  4DRX A;  4GUN A;  3HKE A;  4GX5 A;  2QTS A;  3CD6 V;  2ZE8 A;  4UCV A;  3KG2 A;  4DV7 O;  4LFC B;  2VWK A;  1AJP A;  3ZHR A;  3CMA V;  3SDL A;  3SPC A;  4DR6 B;  3D8C A;  2LW1 A;  2D3O W;  5IY5 B;  4UV8 A;  4GX1 A;  1QR8 A;  4OX9 O;  1OCR C;  3OEH G;  4NXN B;  4U3J A;  3WU2 Z;  1PPJ H;  2WLL B;  1M56 C;  1SQQ H;  2JEX A;  1R3I C;  5LHH A;  3E2E A;  2QKA A;  3E86 A;  4ZBM A;  2OYQ A;  2FKX A;  3JAR A;  5FLX N;  5KUM A;  2WAM A;  2Y4U A;  1I08 A;  2Q7H A;  3W7S A;  2W6J G;  3E35 A;  3SYO A;  3RYH A;  2KSD A;  3E8F A;  3K04 A;  1GKF A;  2QR4 A;  3CCR V;  1GN4 A;  5HFL A;  4K8Z A;  3FAV A;  1H2L A;  1IZ3 A;  1S72 V;  1VQL V;  2P5O A;  4TQD A;  1NH2 B;  4BIU A;  3W7U A;  4LF8 B;  1PNL A;  2YDE A;  4O2B B;  3OTO B;  1SA0 A;  2YXL A;  1K7D A;  3ASO C;  2JVD A;  2Z3Y A;  1YF2 A;  2BOB C;  4IIJ A;  3JAS A;  4PI2 A;  1FPO A;  5CB4 A;  1Y74 A;  1BE3 H;  4LFB O;  5B1B B;  4CS3 A;  4FLZ A;  3J80 N;  4O2A B;  1BGY H;  1EFR G;  4YHH O;  1GH6 A;  1FXK A;  3STZ C;  1N36 O;  3G6B A;  4ASU G;  4JTC B;  3OGI B;  3C90 A;  2HFE C;  1AJQ A;  2FB5 A;  4I4T B;  4YJ3 B;  1HWY A;  4WF9 V;  1YI2 V;  2EIM B;  4X66 O;  1NTK H;  1AI5 A;  2IU3 A;  2Q9L A;  4RUE A;  2F43 G;  3TCU A;  3ML0 A;  5EYP A;  4JGS A;  3AG3 C;  4FM1 A;  1SZX A;  1QU7 A;  4C7U A;  1VQ4 V;  4JI4 B;  3U0Z A;  2B1G A;  2ITC C;  1IXB A;  2RMK B;  4DV5 B;  1N34 B;  5B5E Z;  5LL6 Y;  5B3S C;  1D2D A;  1K33 A;  3M99 B;  2PF4 E;  2Q67 A;  4H13 B;  4LH7 A;  4QE7 A;  2HVK C;  4JZG A;  3K06 A;  4DV4 O;  3BEH A;  4PD4 F;  3G4S V;  3EVK A;  2WLL A;  4WBN A;  2YIB A;  1MZE A;  4GKJ B;  1WAZ A;  1SQP H;  1VQP V;  4AQY O;  3B8M A;  1PL0 A;  4CBC A;  2G38 A;  2PY5 A;  3ZJZ A;  4F6R B;  1WA8 B;  1SS3 A;  3IAY A;  4JTD B;  4RQF A;  3H01 A;  5IWA B;  3VQW A;  2IJI A;  3APO A;  3WB1 A;  3F5W C;  1WJZ A;  1K34 A;  1G6U A;  5B1N A;  5KMG B;  4JTA B;  2ZIN A;  3LDD A;  1RM1 B;  4O2B A;  2LW7 A;  3OE7 G;  4MVS A;  1Q5O A;  2LO1 A;  3NXS A;  4DR2 B;  4DR1 O;  3RN4 A;  4X89 A;  4B3M O;  1L0L H;  2P22 C;  2ZNJ A;  2B5U A;  4PEL A;  5EC2 C;  3FB7 C;  3K5M A;  4O2A A;  3FFQ A;  3BA9 A;  3CRQ A;  2OCC C;  2WLI B;  3JSN A;  4TV8 B;  4X62 B;  4U7N A;  2X6C A;  1COW G;  1O9H A;  1BL8 A;  4UCR A;  2Y48 A;  3TGU H;  3T1Y B;  3OR6 C;  2UXB B;  2ZCE A;  3JAW B;  4I4T A;  4YJ3 A;  3ZED A;  3RVY A;  4JI0 B;  2ITD C;  3K59 A;  3OMA B;  3JYC A;  3VBB A;  5JH7 A;  2DYS C;  1XQ8 A;  4DXW A;  4J41 A;  4B3S O;  3STL C;  3CHX A;  2KB1 A;  3ABM B;  2EIN B;  1Y67 A;  1H2M A;  3H1H H;  4LF5 O;  1Q82 W;  3E8G A;  3AG4 B;  1P84 F;  3QTC A;  1L1F A;  1VF6 A;  4J7J A;  4J9Z B;  1NQT A;  4DUZ O;  5DED A;  4FZ0 A;  2QGN A;  4MVO A;  1NR1 A;  1Q6H A;  1OZ0 A;  1FAF A;  2YXY A;  4B3T O;  1FXK C;  1GK9 A;  4WFF A;  5EC1 C;  2VQF B;  1JX9 A;  5H5N A;  1BZK A;  3SPI A;  2F4V B;  4MTX A;  1K3E A;  1HNW B;  4LF7 O;  2QJ1 A;  1WA8 A;  5CA1 B;  4I5S A;  1YDX A;  3FB8 C;  5HFM A;  1BQZ A;  4K3A A;  4EFB A;  3RYI B;  4I55 A;  5BZB A;  4NVP A;  2OTJ V;  3CE2 A;  4JAU A;  5EIB D;  1KQS U;  2AZ2 A;  4B3R O;  1JQ0 A;  2ZR2 A;  2UXC O;  4JV5 O;  5IY5 C;  5LHI A;  3BY6 A;  1FFT B;  5EZY B;  1P7G A;  4KXR A;  4PA4 A;  1XRE A;  1FJG O;  2R72 A;  4ZHQ B;  3FX7 A;  3BAB A;  2P6J A;  4ABM A;  3MHH C;  2BE3 A;  4TV8 A;  3K5O A;  5LP6 B;  2N04 A;  3OGC C;  3CJH B;  5IE9 A;  1HNX O;  2C2A A;  3MHS C;  5ITZ B;  4DW1 A;  1YHQ V;  4XDK A;  1K4D C;  3JAW A;  1VMG A;  3UQ8 A;  2Q68 A;  5LA6 B;  1ZAU A;  1QNM A;  2CDY A;  3G80 A;  3I56 V;  3IGA C;  2QEX V;  1YZB A;  1SKV A;  1K5Q A;  4JI7 B;  1ZWI C;  5C8Y B;  1VQ9 V;  2HKO A;  1K5S A;  3VOU A;  2ZQM A;  4LFA O;  3CPW U;  2UU9 B;  2UUB B;  2PTM A;  5TIS Z;  3Q4H A;  5LHG A;  1HNZ B;  4N23 A;  3RVZ A;  2GTS A;  4DV2 O;  2PI5 A;  2W6I G;  3A2F A;  2E74 B;  1XMQ O;  5B1B C;  5BR8 B;  1RSO B;  4DR7 B;  1BHA A;  4FPP A;  2GDS A;  3CRR A;  3WB2 A;  2X6B A;  2JIZ G;  3CSX A;  4ZOL B;  1MA1 A;  1Z2G A;  1KB9 F;  4FLU A;  4Z1V A;  3ZRV A;  5K1X A;  2KKW A;  2EIM C;  3RBZ A;  5CA1 A;  1XHX A;  1AJN A;  2XAS A;  2BTO A;  4DV6 B;  4XBF A;  1G4Y B;  2UUA B;  3RYI A;  4Q6G A;  1FD9 A;  4W4K A;  5CBG A;  2UXN A;  3ZCC A;  4DR5 O;  3ETD A;  4YY3 O;  5E79 Z;  2VRZ A;  3G6E V;  2ZIM A;  3N2K B;  5K1P A;  2HG5 C;  2OTL V;  4JI6 O;  2A06 H;  1VF6 C;  1IXM A;  1N0N A;  1XHZ A;  5A9G A;  2YXH A;  1NI8 A;  5EZY A;  1ZL8 B;  1XDC A;  4DV0 O;  2RN9 A;  2YC0 A;  2EZP A;  4ZHQ A;  2QWO B;  2EUL A;  1F23 A;  3AG1 B;  3RT3 C;  4ZIB A;  3ZMV A;  3ZX6 A;  1ZTE A;  5FPO A;  2CTP A;  1OHH G;  2PGG A;  4UFZ A;  3BVO A;  3CJH A;  1IVS A;  1X4T A;  3CCQ V;  5ITZ A;  3JAK A;  1GO3 F;  4Z1M G;  1IBM O;  1V54 B;  3RWR D;  1IUR A;  2XAG A;  2A0L A;  4L8J A;  3AG7 A;  1D5N A;  3AK3 A;  4YJ2 B;  1GM9 A;  2OCH A;  2DWD C;  3BCC H;  1RM1 C;  1IBL B;  1KUQ A;  3K57 A;  3O9O A;  3OD4 A;  5C8Y A;  2EIL B;  2A79 B;  1M57 B;  2EZO A;  4B7E A;  3SYC A;  3F7Y C;  4HNA B;  4DR3 B;  4X9Q A;  2YID A;  2GTA A;  1GAX A;  2H3O A;  1KKC A;  2DMX A;  2UXX A;  3WB0 A;  3JD1 A;  4UUJ C;  4ZOL A;  3MAQ A;  4TQF A;  3SYA A;  3FB6 C;  4DK1 A;  3ZMT A;  2ZDI A;  4H44 B;  1XMO O;  4OPA A;  3ABU A;  2ZM6 O;  4K8X A;  2LQT A;  2KG7 A;  1ENV A;  4DV1 O;  4Z2W A;  3SPH A;  2XND G;  4X88 A;  1H2N A;  1NTZ H;  2JGU A;  1N33 B;  2Z0A A;  3BHP A;  1SRY A;  2ARH A;  4OX9 B;  1HP8 A;  4FJC C;  3J81 N;  4ICG A;  2DYR B;  2IJH A;  3H9V A;  2QWR B;  4GKK O;  1CEZ A;  2E3C A;  3ABM C;  2E75 B;  2EIN C;  1VIB A;  3ASN B;  5L3E A;  1NVP D;  4MSW C;  3CCS V;  2Y0P A;  2EX3 A;  1SF9 A;  3AG4 C;  1VF7 A;  2QKC A;  4QPK A;  3PJS K;  1DK1 A;  1KEC A;  4W4L A;  5LOV B;  2V1D A;  2ADP A;  2JDI G;  2ZD9 A;  4P30 A;  4JI1 B;  2ZT9 B;  3M7M X;  2UUC B;  3OR7 C;  4Q20 A;  4BW5 A;  4A5U B;  2IU0 A;  1J5E B;  1URF A;  5JVD B;  3CC2 V;  1US6 A;  2JJ2 G;  1VQK V;  4CC5 A;  1OCC B;  5LMN O;  3K03 A;  2WA4 A;  2BOC C;  4P9O A;  4YJ2 A;  3U10 A;  1OV9 A;  1QLN A;  1S5L Z;  1VQN V;  3SPJ A;  4QPJ A;  3CRA A;  4X1I B;  4FFB B;  1N36 B;  3J7A U;  2QKS A;  1U96 A;  4DW0 A;  3CB2 A;  2WPD G;  4HNA A;  3SJQ C;  2IBZ H;  3OW2 U;  1G8M A;  4DR6 O;  2Q5Z A;  2A3Q A;  1S5H C;  1UJW B;  3TJT A;  5LP6 C;  4UCO A;  4WFG A;  2EIK B;  2CGO A;  4JI5 O;  5KX5 B;  1BHB A;  3ICX A;  1Q7Y W;  2RDC A;  3QO7 A;  1M4U A;  2WLM A;  4X65 O;  1Z5W A;  3B2E E;  3B8N A;  5KAF Z;  3ZRW B;  2BTQ B;  3VQV A;  1JPX A;  4DV4 B;  1N32 O;  1R6N A;  3RGB A;  3E89 A;  4AI8 A;  4K0K B;  2P4V A;  4O4I B;  5JQG B;  5J9P C;  4UVA A;  2P4K A;  3FD9 A;  1HW7 A;  3G71 V;  4RUF A;  2D2C B;  4LF8 O;  1ROP A;  2H8P C;  4X1Y B;  5LXT B;  3K0D A;  4O4H B;  5LOV A;  3PN1 A;  5IYD O;  4N21 A;  1BSM A;  4LP8 A;  3K3W A;  3K08 A;  2ZDI C;  5L3C A;  2RJZ A;  5KHK A;  4E2L A;  4GCZ A;  5D5P A;  1W0J G;  2LJ2 A;  1CP9 A;  3G67 A;  4O4L B;  3MD0 A;  3TXS A;  5JVD A;  1QVG U;  2ZE6 A;  5L3B A;  4DR1 B;  1NJI W;  1FS0 G;  3CCE V;  4MS2 A;  3H1K H;  4NR1 A;  2EIJ B;  3CRC A;  4IYH A;  4MVM A;  2QWQ B;  4GYC B;  3ZHQ A;  1I94 B;  4O4J B;  3OMN B;  2OWO A;  4UCT A;  2CTQ A;  4PDL A;  3OFN G;  2R9I A;  4X1I A;  1ARO P;  2BCC H;  1NT2 B;  2H94 A;  1E79 G;  4I50 B;  4LWS B;  1WLE A;  3E22 B;  3P32 A;  4R8C A;  3BA8 A;  4NKG B;  2M6Y A;  4DV5 O;  1EN6 A;  2FL4 A;  3CX5 F;  4BIO A;  4DR4 O;  3HB3 B;  5IT9 N;  4PA6 A;  2IM9 A;  4LC1 A;  3ZRS A;  2ODM A;  3AG1 C;  1WB8 A;  4QE9 A;  1WPB A;  1WNS A;  5H6R A;  3KKY A;  1TUB B;  3ZIA G;  1K8A W;  4B3S B;  2JK5 C;  4GKJ O;  5CA0 B;  4LF9 B;  1M93 A;  4BAY A;  1L0N H;  3SR2 C;  4DK0 A;  4LF5 B;  1HR0 O;  1JA8 A;  3K0G A;  2VQE O;  1V54 C;  4J7Z A;  3JCZ A;  3CYO A;  5H9C A;  5IWA O;  2Q6A A;  3ZRW A;  4PA9 A;  2BTQ A;  1PNK A;  1CPY A;  4DO2 A;  5CN0 A;  1IBK O;  2LFS A;  1YIJ V;  2Y69 B;  2Y0I A;  5C93 A;  5L3F A;  2MK3 A;  1G1X B;  4HBN A;  5JQG A;  5LGN A;  2EIL C;  3ETE A;  1M57 C;  3LSQ A;  5GON B;  3OMI B;  1BS3 A;  4WFA V;  1EN4 A;  1YXB A;  2HR3 A;  4QNH B;  3SYQ A;  1R3K C;  1W59 A;  4R6Z A;  1NS1 A;  4LF7 B;  2ZKO A;  4X1Y A;  5LXT A;  4H33 A;  4LF4 B;  3OEE G;  3ZMU A;  2AHY A;  5LMU O;  4FLW A;  2V7Q G;  4MW3 A;  2E76 B;  3CC4 V;  1Y4M A;  1YJN V;  5KHH A;  5J2U B;  2P06 A;  1AI6 A;  4L87 A;  2IH1 C;  2YIB D;  4PA3 A;  1MAB G;  3B4S A;  4KUM A;  3ZHT A;  4O4L A;  1UFI A;  2F1M A;  2PUS A;  3B77 A;  4X62 O;  5H2F Z;  2UXC B;  2CE4 A;  4J80 A;  4JV5 B;  3BPZ A;  1Q86 W;  4F6R A;  4FIP C;  3CRM A;  2DYR C;  1SC5 B;  5EBM C;  3ASN C;  4TWK A;  4JI0 O;  5IYB O;  4AHC A;  4MTG A;  3O65 A;  2KQX A;  2EJ7 A;  4O4J A;  2YI9 A;  2CTW A;  5KAI Z;  3I5D A;  1JCH A;  3D3Q A;  4I50 A;  1Y76 B;  4LWS A;  3APQ A;  2E5L O;  3E22 A;  5KMG A;  1KKD A;  2ZE5 A;  4I0X B;  5BMV B;  2GUZ B;  3EFF K;  2IW5 A;  3K9A A;  1GN3 A; 
#chains in the Genus database with same CATH homology
 4UB8 Z;  5TIS Z;  5GTH Z;  2AXT Z;  5E79 Z;  4UB6 Z;  3A0B Z;  5KAI Z;  5H2F Z;  3A0H Z;  5B66 Z;  3KZI Z;  4IL6 Z;  5GTI Z;  3WU2 Z;  5KAF Z;  1S5L Z;  5B5E Z;  4PJ0 Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...