2AXTZ

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 2axtZ00
2AXTZ 3WU2Z 5H2FZ 5B66Z 4PJ0Z 4UB8Z 5GTHZ 5B5EZ 5GTIZ 5KAIZ 3JCUZ 3A0HZ 4IL6Z 5E79Z 4UB6Z 5TISZ 5KAFZ 3KZIZ 3A0BZ 1S5LZ
chains in the Genus database with same CATH superfamily
4J11A 1IURA 1AJQA 2GTSA 4X1IB 4DW0A 5L3BA 4OX9O 4JYBA 1NVPD 4WBNB 5IYZB 3SYPA 3E86A 4CC5A 1EM1A 4FFBA 3ZHRA 4AI8A 3FAVB 4MVMA 3K03A 2HJDA 4I9WA 2GV9A 1MSDA 5LYJB 2Q8VA 4IGGA 3T1YB 3UM7A 1SQBH 1SF9A 1XNQB 1S5JA 3C90A 4LF8B 1SQGA 5L3FA 4B3TO 5B1AB 4UCRA 1FFXB 1KP2A 1YXBA 1B06A 4EFEA 5C8YA 4LCUC 5BMVA 4TV8B 5LGTA 4B3RB 1OCOB 3SPCA 5CBHA 3K0GA 4KFMA 4PDMA 2B1GA 3ASNB 2PYJA 4U3JB 4WFBV 2UU9O 3SJQC 1R6NA 2EIKB 2P5OA 2NNUA 2QE7G 1WPXA 4X66O 1WP7A 5DN6G 4FFKA 1VQ5V 5B1BB 3RYFA 1K97A 2YI8A 1VQ4V 1IBLB 3NXSA 5ITZB 1XMOB 4X1YB 1XHZA 2QGNA 4W4KA 1Y74B 3WB0A 2GTAA 4JI1O 3H01A 2IU0A 4MVUA 3K08A 1QHTA 1JJOA 5BXZA 3JAWB 2YIBD 3ZN1A 1NS1A 5JH7A 4X1IA 2EJ7A 1GN4A 5CBGA 4BIZA 3FD9A 2OIGA 3M99B 1MABG 4WBNA 4X1KB 5IYZA 1SQXH 3NR7A 3FX7A 1TVKA 4IIJB 4DV2B 3SYQA 2Y69C 2ITCC 5BR8B 1NR1A 3FAVA 4JI3B 1FJGO 3QG5A 1YSCA 1U97A 5CBFA 1OCCB 2PF4E 2L6LA 4XDJA 3E35A 5LYJA 5FNVB 4J80A 1SESA 1YZBA 2ZE5A 1Q6UA 1FXVA 5H2FZ 3MD0A 1W0KG 1IBKB 4QJFB 4X20B 4QE7A 1FFXA 3CEIA 2XTAA 1SZTA 3BA9A 3JD0A 4A5UB 1VQLV 1DK1A 3OUSA 2BE3A 4DR7B 1K5QA 1IX9A 5D5PA 4DUZO 2IH1C 4TSFG 1N32B 2JJ2G 1LUWA 2O57A 4KUMA 3AEIA 1JX9A 2DYRB 3VBBA 4R6ZA 5DEDA 3KCXA 1RM1C 4JZGA 5H9CA 1QU7A 3FYIB 2CTQA 3I56V 4FZ1A 1SRYA 2A7WA 2YUAA 2EZPA 2FKXA 3N2GB 1US6A 2DQ3A 3OEEG 3BY6A 2UXNA 1PM9A 1G1XB 1QQCA 1WNSA 5AG2A 4PA3A 3DXRB 4X88A 3LSSA 3BCCH 4QIWF 2JEXA 2DYSC 2AW9A 5ITZA 4G2KA 5EZYB 3B09A 3CRQA 4J42A 4GLXA 1RPRA 3CD6V 4Z1MG 4JI7O 1Y74A 5KLVH 3ABLB 5J2TB 4UV9A 3OD4A 3RFRA 2FMLA 3CX5F 1YITV 1K34A 3JAWA 4WFEA 1XDCA 4K0KB 3OTFA 1IVSA 2P7TC 1UPGA 3K5LA 4EFBA 1VQ9V 1FAFA 4AQYB 5EIBC 1BS3A 1ENVA 2JDIG 4MVQA 4TT3G 4JI0O 3L74H 4B3SO 1HNWB 4IIJA 3HKBB 4JI6O 1T5EA 4NXMO 2PTMA 3FYEB 3L75H 1DF4A 5CN0A 4RUFA 3SYAA 3A0HZ 2X7RB 2WAMA 5FNVA 2UUAB 2PYLA 4I4TB 1TUBB 3B8MA 3ZHVA 2YSUB 5A2QN 5L3DA 2XNDG 1TA8A 2W6IG 3N2KB 4J41A 4R7CA 4Z1VA 1GRJA 4X20A 3AG1C 2LO1A 2HFEC 3WB2A 4LF5O 1HWYA 1XMQO 4K8XA 2UXCB 4IL6Z 3CSXA 1Q3EA 5E79Z 2Q67A 4U7NA 1LNQA 2Z0AA 2B1IA 3RYHA 2WLHA 3WU2Z 1NR7A 3FKSG 1NTMH 1Y6XA 4JTCB 2XAQA 3OE7G 2OCCB 4GUNA 4JYCA 2F4VO 4ZI7B 3CRCA 2QM7A 3QO8A 3N2GA 5KAFZ 1NZ6A 1FD9A 5CA0B 4RQEA 1M57B 3DXRA 4DV1O 3E8HA 3K0DA 1GTOA 5EZYA 3QF7A 3ZN0A 1MNGA 2UXXA 5J2TA 4BW5A 3ZMZA 2ILMA 5KUKA 1WP8A 3STLC 4JI5B 2UUBO 5IJ0B 3JALB 2ADQB 3UKMA 3TETA 4I0XB 1K4CC 1RSOB 3IJ4A 4FLWA 1YF2A 3RYCB 4DV0O 1ROPA 2V7QG 1UJWB 2YXLA 1P49A 2DWEC 4ZIBA 2F43G 4JTDB 5IE9A 3ETGA 3QNEA 5EYPB 3HKBA 1QLNA 2CTPA 3T4DA 2BSKB 5B1AC 2JS5A 4CH6A 4JI4O 4YJ2B 1NU1H 4PV1B 1AR5A 2IM9A 2K1EA 5LHGA 3THOA 4IHJB 1JCHA 2YXYA 3JAKB 4FVMA 4MTGA 4I4TA 1S72V 1TUBA 2W6JG 1BHAA 1YJWV 4OGQB 1DGSA 2DQ0A 1P4RA 2P06A 1OCOC 3FB6C 4UVAA 3JYCA 5GONB 1YHQV 2QJ1A 2AHYA 3M8AA 4ICGA 3PN1A 2YICA 1QR8A 5F2VO 1L0LH 1HNZB 2EIKC 4FIPC 2F95B 2WA3A 3S3XA 4KHPO 1BE3H 2KG7B 2XT9A 5B1BC 2VQEO 1YJNV 4U7OA 3IC9A 4FMTA 1UFIA 4YIOA 3D3QA 5B1NA 2P4VA 2CGNA 2EBOA 1VQOV 4KP4A 1AB3A 1BQ0A 4JAAA 4ZI7A 1MOFA 2CTRA 1R3KC 2A0LA 3D36A 5IWAB 1EFRG 1EN4A 4U3FH 4ZKIA 3E22A 4Q20A 5CA0A 4UCTA 3CJHB 4N21A 4KL1A 2LJ2A 3AK1A 4MVOA 1K33A 3L73H 1X59A 3T1YO 3AG4B 2HVJC 1QBZA 2CH7B 1MZFA 5GW7A 3ZHQA 4GKKB 3OW2U 5IJ0A 1Y67A 1AVMA 2HR3A 2LQTA 3ABKB 3JALA 5LMUB 3UO2A 1Y4MA 3OR6C 2YEVB 1OCCC 4I0XA 2R72A 3K59A 1JA8A 3TCUA 1N36B 2JVDA 3RYCA 2P6JA 1F23A 4HBNA 4AILC 4LF9B 4X65O 3N27A 3K5NA 5JVDA 2E5LO 3G6EV 1M5IA 1YDXA 3G80A 3X2QB 4HZ3A 4PHZA 5EYPA 3ZHUA 2GSMB 4ZBMA 2VQFB 2UXDB 2BSKA 1OCZB 3DSQA 1Z2GA 4YJ2A 2E76B 3B2EE 4H33A 3STZC 4X62B 1JFFB 4IHJA 1KBHA 4P9OA 3JAKA 2V4DA 3K57A 4O2BB 1Q43A 3W7TA 3CB2A 3AG7A 1ZTEA 3H1HH 2Q0AA 1PNKA 3UT5B 2DYRC 3FB7C 5GONA 3FB5C 4LFCO 1RP3B 2LP7A 1GK9A 3K9SA 3A0BZ 2JGDB 3ML0A 2OIEA 2DW4A 4ABMA 3P3NA 3JD3A 1N8RW 4DV7B 2CTWA 3IGAC 1VIBA 2GUZA 2RJZA 1M56B 1OJHA 2W0FC 2UXBB 2KG7A 1P7BA 2IBZH 1PKXA 4LFAB 1SZXA 4GZRB 3IAYA 1VF6A 4LP8A 4FLZA 5TISZ 4NXNO 4JYAB 4J10A 1Q8IA 3APOA 3CCQV 1N33B 5CMUA 2MW2B 1HR0B 3QO7A 1YTFB 5LMNB 3ABLC 5BR8O 4I9QA 4B7EA 4NTYA 1NKDA 2XAGA 4FK5C 3AG3B 3CJHA 5JCOA 3A0RA 1VMGA 4DR5O 1Q81W 3ZRWB 2CUGA 3HB3B 2YIAA 3SJCC 3CCUV 2UUCB 2YDEA 5IY5B 1W0JG 4J7KA 1YI2V 3G6BA 3J7AU 4DV6O 4DV5B 2CH7A 4JAUA 3EVKA 2XAFA 1VP7A 1NVPB 4X64O 3P30A 5KAIZ 2ADPA 4TV9A 4YIPA 1IBMB 2ZIMA 2EJRA 4DR6B 5BZBA 3OR7C 2YEVA 3CYOA 4EB6B 4DV3B 1CXZB 3HKCA 4O4IB 2RN9A 4LNUB 2Z5UA 2AXTZ 5JWPA 1EZVH 5BY1A 1L0NH 4CH5A 1O9HA 1AI5A 3T1HB 1XL6A 3CS5A 3A8TA 4JV5B 3RN4A 1XNRB 2NR5A 4DV4B 4WFGA 1K4DC 5L3CA 1JFFA 1JQ0A 1H8HG 1U96A 2JIZG 3SYCA 4MSWC 4LBEC 3HR0A 1HP8A 4O2BA 2BTQB 2HVKC 3AK2A 2EIMB 2HJFC 2WSSG 3UT5A 4P9PA 4LF4B 3OMNB 5B3SB 3ZHSA 5LA6B 2OCCC 3BRCA 2JGDA 1PP9H 5LHIA 1FXHA 5H6RA 3QO5A 2R9RB 2H3OA 3C3TA 4FLYA 1V55B 3D36C 2KB1A 1NJIW 2WLLB 1N0NA 4I5SA 4R8CA 4J7ZA 2P67A 4DUYB 4K0KO 4GKJO 3AG2B 1VQKV 1BGYH 5LOVB 1AP5A 2WLKA 2N04A 3LDCA 1M57C 5GTHZ 1QVGU 3E8GA 2EILB 4C7UA 1I94O 2JRIA 4KXRA 4FM0A 4DRXB 5D5QA 1VQ7V 4JI2O 3JASB 4NTWA 1BZKA 4RAIA 3OGIB 1J95A 1NBMG 1VQPV 1PNLA 1N34O 1BQZA 1QR9A 2IH3C 1OCRB 3E89A 1FXKB 4L87A 4PJ0Z 1WB8A 4RWUA 3DTUB 2ZDIA 3ETQA 3JCZA 2ZNIA 3H1LH 3U0ZA 1GM9A 2N74A 4R50A 2CGOA 3SPHA 4B3TB 5KX5B 2EINB 2Q7GA 3U10A 3ZJZA 1GO3F 4TV8A 2GDSA 2UXCO 1IDSA 4H13B 1HNXO 5A9GA 3CCJV 4E2LA 4U3JA 4O4IA 1RPOA 4LNUA 5KHIA 4J7JA 3E8FA 1ZX3A 2ZM6O 3FB8C 4NKGB 3DC5A 3KCYA 3CRRA 2UU9B 1NTKH 5KA5A 3LNMB 1KP3A 3A2FA 1DLBA 4GX2A 2WA4A 3OTOO 2VWJA 2MK3A 2ZKOA 2X0LA 3CCSV 4X66B 1AR1B 4X1YA 1AI4A 4UB6Z 3ZRXA 2BTQA 3K79A 3B4SA 4JYYA 3CMEV 5KMGB 4QGPA 2H94A 1EN6A 4K3AA 2NN4A 3O65A 4G27B 2DOSA 1VF6C 1FPOA 1M4UA 5LA6A 4FPPA 2QEXV 1BCCH 4JI1B 1S5HC 4DO2A 1N4CA 2YXHA 1R73A 2WLLA 5EC2C 3C3SA 1WA8B 1SQVH 2XASA 5LGUA 2PI4A 4DR4O 5JCOC 4X1KA 2HLDG 3ZBHA 5EBWC 5JQGB 4MTOA 3OT7A 4DRXA 4F6EA 1VQ6V 1I5YA 3I5DA 3AG4C 5IJ9B 3JASA 1QLEB 3CMAV 2VRZA 2QWNB 4RQFA 1O9GA 2OCHA 1S0VA 1FXKA 5CB4B 2L35A 3ABKC 3WG7B 1D5NA 2Q7EA 2B5UA 4HNAB 1V54B 4X89A 4F6RB 4UB8Z 1WJZA 2ZE7A 4N23A 2QTSA 1E1RG 2H8PC 4DR2B 3X2QC 1NH2D 3B77A 5KX5A 1OCZC 1JMKC 1GMGA 2M7WA 1SETA 3RBZA 5LL6Y 2ZD9A 4JI8O 3MHSC 5EBLC 4CS2A 2ZIOA 1Q82W 3H1KH 4B3MO 2ZE8A 4DUZB 1Y76B 2FYUH 2ZE6A 1AILA 3RYIB 1B6QA 4O4HB 4UXNA 4FLXA 1J5EB 4RUEA 4PI0A 1M1KW 5B1OA 2LFRA 3BEHA 3G71V 1SA0B 2P90A 1ZUQA 2A79B 3ZMSA 3CXHF 4JGSA 3W7WA 1M56C 3J81N 4I50B 4L8JA 3ZMVA 3CP1A 5KMGA 3G4SV 1LUVA 1M93A 1XI1A 1YJ9V 5LP6B 3M7MX 5J2UB 5IT9N 1ZWIC 3TGUH 4JI7B 3DGEA 5LXTB 4NTXA 4TUYB 4D6TH 1WB7A 2RQ6A 3RVYA 1XOUA 1S77D 2WLJA 1K3EA 1L8DA 4XDKA 3OGCC 2LGWA 3AG3C 2LW1A 2ZDIC 1H8EG 1K73W 5JQGA 3K3WA 2GHYA 3RGBA 1R6KA 2KSDA 5IY5C 1G8MA 4JI0B 1WLEA 1YVWA 4DK0A 2BCCH 4B3SB 5IJ9A 1GM7A 2VQFO 1ZL8B 4JI6B 4LH7A 4NXMB 2F93B 1L1FA 2ZQMA 2QSAA 2PY5A 4DK1A 5CB4A 3Q4HB 1E1QG 1EBOA 3CRAA 1H2GA 4HNAA 1KECA 4LF6O 3N2KA 1CP9A 3F5TA 1I7FA 1V9PA 3ASNC 2JK5C 3LNNA 1W59A 4CBCA 1R3JC 4I7ZB 3CPWU 4HAMA 4PI2A 3G67A 2CE4A 3LUTB 4LFBO 3JCUZ 5EIBD 3BHPA 2LGQA 2N05A 5HFMA 1AJNA 5FPRA 3OUFA 4TQFA 1XMQB 2X6CA 3BA8A 1F7YA 1FKAO 5IYCO 4MVRA 1G6UA 4PA4A 1K5SA 1M90W 1Y76A 3VQYA 4JASA 2EIMC 2OT5A 5FLXN 3RYIA 4O4HA 1PL0A 3SPGA 3CCRV 4JYAO 2A3QA 3IFXA 5B3SC 3OM3B 5IDJA 1AI6A 2F4VB 4BAYA 1SA0A 4YJ3B 4FFBB 5LMNO 3S3WA 1WPBA 2EIJB 1DF5A 3MHHC 1TGOA 4FZ0A 1V55C 5HFLA 4O4JB 5FPOA 4Q6GA 4PD4F 1XNQO 2DE0X 3AG2C 3E8BA 3VQXA 3CXCU 4DV1B 1H2LA 4LF8O 3SGIA 2EILC 1KKDA 5LP6A 3ZMTA 4JTAB 2P4KA 4MVSA 2HKOA 1KUQA 4K35A 1RSOA 5H5NA 1KYOF 2Q0OC 4OXSA 3U11A 1D5AA 2UUBB 1OCRC 2RNBA 4B3RO 1FXKC 3ZRSA 2V1DA 4DV3O 5L3EA 3F5WC 4CC6A 2XHBA 4TQDA 3ABTA 2Z3YA 4GT1A 3CRMA 4LC1A 3T1HO 1ZSPA 2CK3G 1GH6A 4GX5A 1ZL8A 2PGGA 4LF7B 5LHHA 3CC2V 2JGUA 2X6AA 2EINC 4PELA 1AROP 2QM8A 3Q4HA 1IBLO 2WPDG 1IZ3A 3GWOA 4TWKA 1XMOO 2Q9LA 3CCMV 2FTKA 3KZIZ 1Y66A 4J9ZB 4YY3B 4JZ2A 1YTFD 4O2AB 3TXSA 4DR3B 4NR1A 2RCVA 3T2MA 2R70A 3RWRD 2FB5A 3LSQA 4MS2A 2QDOA 4PA9A 3L71H 2PZSA 5KUMA 2AGAA 3ABUA 2G38A 3CCEV 3GWKC 2AZ0A 4KHPB 3K06A 4PDVA 4WF9V 2VQEB 1MZEA 2QKAA 5JH7B 2Q5ZA 3ICXA 2QWQB 4DV2O 2Q69A 3EFFK 3RT3C 5CA3A 1R1BA 3B40A 4JI3O 3HKEB 4UCVA 2WLNA 2GBOA 3AK3A 1TVKB 1NQTA 3H1JH 4YJ3A 2YS8A 2C2AA 4EEQA 4J9YB 4O4JA 5KHKA 4FM2A 4ZOLB 4MW8A 1IBKO 1XREA 4UUJC 3O9OA 1Z5WA 2F23A 3K9AA 3CE2A 1BL8A 1H2SB 1BSMA 4ZHQB 1SERA 1QLEC 1LR1A 4DR7O 1YCIA 1N32O 2Y48A 1B04A 1COWG 2E3CA 3WG7C 3T4ZA 2QR4A 4PDRA 1V54C 1QVFU 2A9HA 3ZHTA 4X65B 1ZAUA 4BIUA 2BTOA 3L9DA 2E5LB 1XUQA 1B3QA 2ZXWB 4D7SA 4UV8A 3OFNG 1MG1A 3ASOB 2IU3A 1Q6IA 5KHGA 1AJPA 3K58A 3JATB 1H2MA 2QWOB 1XBLA 2QKSA 2QKCA 4CZZA 1QCEA 4ASUG 1G4YB 4W4LA 2BOCC 3UO3A 5L3GA 2WWWA 4DR1B 4XBFA 2PI5A 3H1IH 3QTCA 4X9QA 3DC6A 4O2AA 2HHHB 2RDCA 1S5LZ 4LFCB 3L72H 4YHHB 3W7SA 3R65A 2DJVA 5LGNA 3ZX6A 2Y4TA 4NYKA 3SDLA 2B9ZA 2ZT9B 4QPJA 4H0LB 4AQYO 4OX9B 2QA4V 1VF5B 1HNWO 4OPAA 3BAAA 3HKDB 1P84F 4NXNB 3ETEA 4UCSA 5LP6C 3HKEA 4GCZA 2EX3A 3W7UA 2Q68A 1E79G 4DW1A 2ATKC 3ZRWA 2UUAO 2ZINA 4IT5A 4ZOLA 2CDYA 1KQSU 4DR5B 4RO2A 4K8ZA 3HPLC 3TJTA 2HEPA 2F1MA 1PV0A 3VOUA 4DR2O 4WFFA 4ZHQA 1F4MA 1Z5VA 1MMMA 2LW7A 3ABMB 1ZLZA 4DV6B 2ZCEA 4EB6A 4JPRA 3LDEA 2BOBC 2VS0A 4X64B 3D3IA 4I55B 1WN7A 4P2ZA 3CCVV 2EULA 4DYLA 1NT2B 1KD1W 1Q86W 4BWAA 1GM8A 3RYHB 4GYCB 3MAQA 5K1PA 4B08A 1GAXA 3OAAG 2R9AA 4GX0A 2ITDC 3TK1A 1J5EO 3TXQA 4FM1A 1NI8A 5KHHA 3K04A 5EK0A 1I08A 2DMXA 3OEHG 1PPJH 3JATA 3SYOA 1GN6A 3CHXA 2E75B 1HDJA 4Z2WA 1THZA 4BR6A 2DN9A 1H38A 3JD4A 3P3PA 1X4TA 3ZRVA 2Q6AA 2D2CB 4FLTA 1R6TA 1SS3A 4JI5O 2F66C 2XAJA 3IC7A 1IXMA 4CS4A 2W0XA 3FFQA 5EBMC 5LOVA 2ZR3A 2QWPB 4B7KA 2EIJC 2JEUA 4FJCC 4LH6A 3T1CA 5KHJA 1XQ8A 1OZ0A 4EKWA 1SQQH 2LFSA 2DWDC 1TUEB 2KKWA 5KA6A 4GKJB 2X6BA 4NVPA 1N0JA 1XILA 3LDDA 1CPYA 1RFYA 3VQWA 4CH3A 1AP6A 2XUMA 3W7XA 3HKDA 1I94B 1PD3A 2ZNJA 3E2EA 4AHCA 1FJGB 2OWOA 4MTFA 4H44B 3GVMA 4JI2B 3ZS8C 3JAMN 1GN3A 1N34B 2QM4A 4GX1A 3J80N 1WAZA 1AR4A 3CWBH 2YIDA 4LWSB 3SPJA 3OMAB 4CH4A 1GN2A 2YIBA 1KC8W 3WB1A 1EN5A 3JARB 2RMKB 3MDSA 1TAEA 4PA6A 1I5XA 1DTOA 2A06H 1JPXA 2VWKA 1SQPH 4UFZA 3BVOA 3EHBB 1HNZO 2XOKG 4X8AA 4XDLA 4H37A 1S76D 2EZOA 1JVMA 1R3IC 4P30A 2ZR2A 4MW3A 3CC4V 5LBQA 2Q7HA 4I55A 2YI9A 1D2DA 2FL4A 1HNXB 2QWRB 3KG2A 4PA7A 1Q7YW 4CS3A 2JS3A 1QNMA 5DM6V 2OTLV 2ZM6B 3ZIAG 5IWAO 1VQ8V 3RW0A 4E4EA 1MA1A 1F51A 4LR3A 2OTJV 5FL7G 3ZCCA 1H2NA 3R66A 1YEWA 3OTOB 1K92A 1OHHG 1NH2B 3E22B 2AZ2A 3P32A 3E83A 3OMIB 1K8AW 2K9PA 3JD2A 4D7TA 2Y69B 4O4LB 4F4LA 5H6QA 2ODMA 4GKKO 1WA8A 4UCUA 5LMUO 1IXBA 2Q73A 3UCSC 3BFRA 1N36O 5JJNB 1R3LC 4LF9O 1KB9F 2IJIA 2WLIB 3F7VC 2NLJC 1XHXA 1JJ2U 1FYJA 3SJBC 3VQVA 4DR4B 1MSWD 4WFHA 4OPHA 1S3JA 1JR9A 4DXWA 3WFVA 4FLVA 3CCLV 1VQNV 2JJ1G 2UXDO 2HP8A 5JVDB 2M6YA 1PL4A 4X62O 4MVZA 1K9MW 4LF7O 4F6RA 2D3OW 2WLMA 5JJEB 4LWSA 5DECA 5E1AC 1KKCA 1RM1B 1CEZA 4IYHA 3JARA 5GTIZ 4QNHB 1NTZH 4UVCA 5CA1B 4PDLA 3BPZA 2R9IA 1HW7A 4YY3O 4DR3O 1Q6HA 3H9VA 3D8CA 4WFAV 4DV7O 4LF5B 1XL4A 2ZXWC 1Q5OA 1SKVA 2QTOA 3ZEDA 4WCEV 1I0HA 4HYOA 3ASOC 1YIJV 2E74B 2UXBO 1BHBA 3LSUA 4LFAO 2DYSB 4JI8B 4UCOA 3K5OA 2CAZC 2GUZB 2HG5C 2Q4PA 3JSNA 1N33O 4B3MB 3CC7V 1P7GA 1HR0O 2PUSA 2Y4UA 4BIOA 5B66Z 3ETDA 5J9PC 3JD1A 3UQ8A 4G28B 2AHZA 1W2BU 4I50A 3JSLA 2P22C 4BW9A 2UUCO 1ORQC 3QVNA 3SR2C 5J2UA 2YC0A 3APQA 1A32A 3F7YC 3SPIA 3KKYA 4DV5O 2IJJA 4O4LA 5LXTA 1GKFA 1OV9A 4TUYA 3RVZA 1SC5B 1K7DA 2ETNA 4JF3A 5IYBO 3GB7C 1URFA 1IBMO 4DR6O 2ARHA 5C8YB 3L70H 2IJHA 3PJSK 1Q90D 5BMVB 4TV9B 4DV0B 2WLIA 4JAVA 1F4NA 1EZJA 3SJAC 1SQFA 3HKCB 1JOYA 4QE9A 1M9NA 5JJJB 1XEQA 4IYIA 4JV5O 3AG1B 1XNRO 1PNMA 5C93A 4DV4O 4JI4B 2Y0IA 1H2KA 4NB5A 4TOIA 2Y0PA 1FFTB 3ABMC 3BABA 2KQXA 1VQMV 5EC1C 1BMFG 1KMIZ 3RYFB 4MT8A 4FLUA 1BT8A 1AI7A 4LF6B 4LF4O 2IW5A 5IYDO 4YXWG 1FS0G 5K1XA 5CA1A 3B8NA 4DR1O 1VF7A 1VARA 3K5MA 5B5EZ 3EXAA 2OYQA 4MTXA 3I55V 2HHHO 1KU9A 2IJKA 4QPKA 2XAHA 4YHHO 4LFBB 4DUYO 4UVBA 3ZMUA 1VEWA
chains in the Genus database with same CATH topology
2AXTZ 3WU2Z 5H2FZ 5B66Z 4PJ0Z 4UB8Z 5GTHZ 5B5EZ 5GTIZ 5KAIZ 3JCUZ 3A0HZ 4IL6Z 5E79Z 4UB6Z 5TISZ 5KAFZ 3KZIZ 3A0BZ 1S5LZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT Z;  3WU2 Z;  5H2F Z;  5B66 Z;  4PJ0 Z;  4UB8 Z;  5GTH Z;  5B5E Z;  5GTI Z;  5KAI Z;  3JCU Z;  3A0H Z;  4IL6 Z;  5E79 Z;  4UB6 Z;  5TIS Z;  5KAF Z;  3KZI Z;  3A0B Z;  1S5L Z; 
#chains in the Genus database with same CATH topology
 4J11 A;  1IUR A;  1AJQ A;  2GTS A;  4X1I B;  4DW0 A;  5L3B A;  4OX9 O;  4JYB A;  1NVP D;  4WBN B;  5IYZ B;  3SYP A;  3E86 A;  4CC5 A;  1EM1 A;  4FFB A;  3ZHR A;  4AI8 A;  3FAV B;  4MVM A;  3K03 A;  2HJD A;  4I9W A;  2GV9 A;  1MSD A;  5LYJ B;  2Q8V A;  4IGG A;  3T1Y B;  3UM7 A;  1SQB H;  1SF9 A;  1XNQ B;  1S5J A;  3C90 A;  4LF8 B;  1SQG A;  5L3F A;  4B3T O;  5B1A B;  4UCR A;  1FFX B;  1KP2 A;  1YXB A;  1B06 A;  4EFE A;  5C8Y A;  4LCU C;  5BMV A;  4TV8 B;  5LGT A;  4B3R B;  1OCO B;  3SPC A;  5CBH A;  3K0G A;  4KFM A;  4PDM A;  2B1G A;  3ASN B;  2PYJ A;  4U3J B;  4WFB V;  2UU9 O;  3SJQ C;  1R6N A;  2EIK B;  2P5O A;  2NNU A;  2QE7 G;  1WPX A;  4X66 O;  1WP7 A;  5DN6 G;  4FFK A;  1VQ5 V;  5B1B B;  3RYF A;  1K97 A;  2YI8 A;  1VQ4 V;  1IBL B;  3NXS A;  5ITZ B;  1XMO B;  4X1Y B;  1XHZ A;  2QGN A;  4W4K A;  1Y74 B;  3WB0 A;  2GTA A;  4JI1 O;  3H01 A;  2IU0 A;  4MVU A;  3K08 A;  1QHT A;  1JJO A;  5BXZ A;  3JAW B;  2YIB D;  3ZN1 A;  1NS1 A;  5JH7 A;  4X1I A;  2EJ7 A;  1GN4 A;  5CBG A;  4BIZ A;  3FD9 A;  2OIG A;  3M99 B;  1MAB G;  4WBN A;  4X1K B;  5IYZ A;  1SQX H;  3NR7 A;  3FX7 A;  1TVK A;  4IIJ B;  4DV2 B;  3SYQ A;  2Y69 C;  2ITC C;  5BR8 B;  1NR1 A;  3FAV A;  4JI3 B;  1FJG O;  3QG5 A;  1YSC A;  1U97 A;  5CBF A;  1OCC B;  2PF4 E;  2L6L A;  4XDJ A;  3E35 A;  5LYJ A;  5FNV B;  4J80 A;  1SES A;  1YZB A;  2ZE5 A;  1Q6U A;  1FXV A;  5H2F Z;  3MD0 A;  1W0K G;  1IBK B;  4QJF B;  4X20 B;  4QE7 A;  1FFX A;  3CEI A;  2XTA A;  1SZT A;  3BA9 A;  3JD0 A;  4A5U B;  1VQL V;  1DK1 A;  3OUS A;  2BE3 A;  4DR7 B;  1K5Q A;  1IX9 A;  5D5P A;  4DUZ O;  2IH1 C;  4TSF G;  1N32 B;  2JJ2 G;  1LUW A;  2O57 A;  4KUM A;  3AEI A;  1JX9 A;  2DYR B;  3VBB A;  4R6Z A;  5DED A;  3KCX A;  1RM1 C;  4JZG A;  5H9C A;  1QU7 A;  3FYI B;  2CTQ A;  3I56 V;  4FZ1 A;  1SRY A;  2A7W A;  2YUA A;  2EZP A;  2FKX A;  3N2G B;  1US6 A;  2DQ3 A;  3OEE G;  3BY6 A;  2UXN A;  1PM9 A;  1G1X B;  1QQC A;  1WNS A;  5AG2 A;  4PA3 A;  3DXR B;  4X88 A;  3LSS A;  3BCC H;  4QIW F;  2JEX A;  2DYS C;  2AW9 A;  5ITZ A;  4G2K A;  5EZY B;  3B09 A;  3CRQ A;  4J42 A;  4GLX A;  1RPR A;  3CD6 V;  4Z1M G;  4JI7 O;  1Y74 A;  5KLV H;  3ABL B;  5J2T B;  4UV9 A;  3OD4 A;  3RFR A;  2FML A;  3CX5 F;  1YIT V;  1K34 A;  3JAW A;  4WFE A;  1XDC A;  4K0K B;  3OTF A;  1IVS A;  2P7T C;  1UPG A;  3K5L A;  4EFB A;  1VQ9 V;  1FAF A;  4AQY B;  5EIB C;  1BS3 A;  1ENV A;  2JDI G;  4MVQ A;  4TT3 G;  4JI0 O;  3L74 H;  4B3S O;  1HNW B;  4IIJ A;  3HKB B;  4JI6 O;  1T5E A;  4NXM O;  2PTM A;  3FYE B;  3L75 H;  1DF4 A;  5CN0 A;  4RUF A;  3SYA A;  3A0H Z;  2X7R B;  2WAM A;  5FNV A;  2UUA B;  2PYL A;  4I4T B;  1TUB B;  3B8M A;  3ZHV A;  2YSU B;  5A2Q N;  5L3D A;  2XND G;  1TA8 A;  2W6I G;  3N2K B;  4J41 A;  4R7C A;  4Z1V A;  1GRJ A;  4X20 A;  3AG1 C;  2LO1 A;  2HFE C;  3WB2 A;  4LF5 O;  1HWY A;  1XMQ O;  4K8X A;  2UXC B;  4IL6 Z;  3CSX A;  1Q3E A;  5E79 Z;  2Q67 A;  4U7N A;  1LNQ A;  2Z0A A;  2B1I A;  3RYH A;  2WLH A;  3WU2 Z;  1NR7 A;  3FKS G;  1NTM H;  1Y6X A;  4JTC B;  2XAQ A;  3OE7 G;  2OCC B;  4GUN A;  4JYC A;  2F4V O;  4ZI7 B;  3CRC A;  2QM7 A;  3QO8 A;  3N2G A;  5KAF Z;  1NZ6 A;  1FD9 A;  5CA0 B;  4RQE A;  1M57 B;  3DXR A;  4DV1 O;  3E8H A;  3K0D A;  1GTO A;  5EZY A;  3QF7 A;  3ZN0 A;  1MNG A;  2UXX A;  5J2T A;  4BW5 A;  3ZMZ A;  2ILM A;  5KUK A;  1WP8 A;  3STL C;  4JI5 B;  2UUB O;  5IJ0 B;  3JAL B;  2ADQ B;  3UKM A;  3TET A;  4I0X B;  1K4C C;  1RSO B;  3IJ4 A;  4FLW A;  1YF2 A;  3RYC B;  4DV0 O;  1ROP A;  2V7Q G;  1UJW B;  2YXL A;  1P49 A;  2DWE C;  4ZIB A;  2F43 G;  4JTD B;  5IE9 A;  3ETG A;  3QNE A;  5EYP B;  3HKB A;  1QLN A;  2CTP A;  3T4D A;  2BSK B;  5B1A C;  2JS5 A;  4CH6 A;  4JI4 O;  4YJ2 B;  1NU1 H;  4PV1 B;  1AR5 A;  2IM9 A;  2K1E A;  5LHG A;  3THO A;  4IHJ B;  1JCH A;  2YXY A;  3JAK B;  4FVM A;  4MTG A;  4I4T A;  1S72 V;  1TUB A;  2W6J G;  1BHA A;  1YJW V;  4OGQ B;  1DGS A;  2DQ0 A;  1P4R A;  2P06 A;  1OCO C;  3FB6 C;  4UVA A;  3JYC A;  5GON B;  1YHQ V;  2QJ1 A;  2AHY A;  3M8A A;  4ICG A;  3PN1 A;  2YIC A;  1QR8 A;  5F2V O;  1L0L H;  1HNZ B;  2EIK C;  4FIP C;  2F95 B;  2WA3 A;  3S3X A;  4KHP O;  1BE3 H;  2KG7 B;  2XT9 A;  5B1B C;  2VQE O;  1YJN V;  4U7O A;  3IC9 A;  4FMT A;  1UFI A;  4YIO A;  3D3Q A;  5B1N A;  2P4V A;  2CGN A;  2EBO A;  1VQO V;  4KP4 A;  1AB3 A;  1BQ0 A;  4JAA A;  4ZI7 A;  1MOF A;  2CTR A;  1R3K C;  2A0L A;  3D36 A;  5IWA B;  1EFR G;  1EN4 A;  4U3F H;  4ZKI A;  3E22 A;  4Q20 A;  5CA0 A;  4UCT A;  3CJH B;  4N21 A;  4KL1 A;  2LJ2 A;  3AK1 A;  4MVO A;  1K33 A;  3L73 H;  1X59 A;  3T1Y O;  3AG4 B;  2HVJ C;  1QBZ A;  2CH7 B;  1MZF A;  5GW7 A;  3ZHQ A;  4GKK B;  3OW2 U;  5IJ0 A;  1Y67 A;  1AVM A;  2HR3 A;  2LQT A;  3ABK B;  3JAL A;  5LMU B;  3UO2 A;  1Y4M A;  3OR6 C;  2YEV B;  1OCC C;  4I0X A;  2R72 A;  3K59 A;  1JA8 A;  3TCU A;  1N36 B;  2JVD A;  3RYC A;  2P6J A;  1F23 A;  4HBN A;  4AIL C;  4LF9 B;  4X65 O;  3N27 A;  3K5N A;  5JVD A;  2E5L O;  3G6E V;  1M5I A;  1YDX A;  3G80 A;  3X2Q B;  4HZ3 A;  4PHZ A;  5EYP A;  3ZHU A;  2GSM B;  4ZBM A;  2VQF B;  2UXD B;  2BSK A;  1OCZ B;  3DSQ A;  1Z2G A;  4YJ2 A;  2E76 B;  3B2E E;  4H33 A;  3STZ C;  4X62 B;  1JFF B;  4IHJ A;  1KBH A;  4P9O A;  3JAK A;  2V4D A;  3K57 A;  4O2B B;  1Q43 A;  3W7T A;  3CB2 A;  3AG7 A;  1ZTE A;  3H1H H;  2Q0A A;  1PNK A;  3UT5 B;  2DYR C;  3FB7 C;  5GON A;  3FB5 C;  4LFC O;  1RP3 B;  2LP7 A;  1GK9 A;  3K9S A;  3A0B Z;  2JGD B;  3ML0 A;  2OIE A;  2DW4 A;  4ABM A;  3P3N A;  3JD3 A;  1N8R W;  4DV7 B;  2CTW A;  3IGA C;  1VIB A;  2GUZ A;  2RJZ A;  1M56 B;  1OJH A;  2W0F C;  2UXB B;  2KG7 A;  1P7B A;  2IBZ H;  1PKX A;  4LFA B;  1SZX A;  4GZR B;  3IAY A;  1VF6 A;  4LP8 A;  4FLZ A;  5TIS Z;  4NXN O;  4JYA B;  4J10 A;  1Q8I A;  3APO A;  3CCQ V;  1N33 B;  5CMU A;  2MW2 B;  1HR0 B;  3QO7 A;  1YTF B;  5LMN B;  3ABL C;  5BR8 O;  4I9Q A;  4B7E A;  4NTY A;  1NKD A;  2XAG A;  4FK5 C;  3AG3 B;  3CJH A;  5JCO A;  3A0R A;  1VMG A;  4DR5 O;  1Q81 W;  3ZRW B;  2CUG A;  3HB3 B;  2YIA A;  3SJC C;  3CCU V;  2UUC B;  2YDE A;  5IY5 B;  1W0J G;  4J7K A;  1YI2 V;  3G6B A;  3J7A U;  4DV6 O;  4DV5 B;  2CH7 A;  4JAU A;  3EVK A;  2XAF A;  1VP7 A;  1NVP B;  4X64 O;  3P30 A;  5KAI Z;  2ADP A;  4TV9 A;  4YIP A;  1IBM B;  2ZIM A;  2EJR A;  4DR6 B;  5BZB A;  3OR7 C;  2YEV A;  3CYO A;  4EB6 B;  4DV3 B;  1CXZ B;  3HKC A;  4O4I B;  2RN9 A;  4LNU B;  2Z5U A;  2AXT Z;  5JWP A;  1EZV H;  5BY1 A;  1L0N H;  4CH5 A;  1O9H A;  1AI5 A;  3T1H B;  1XL6 A;  3CS5 A;  3A8T A;  4JV5 B;  3RN4 A;  1XNR B;  2NR5 A;  4DV4 B;  4WFG A;  1K4D C;  5L3C A;  1JFF A;  1JQ0 A;  1H8H G;  1U96 A;  2JIZ G;  3SYC A;  4MSW C;  4LBE C;  3HR0 A;  1HP8 A;  4O2B A;  2BTQ B;  2HVK C;  3AK2 A;  2EIM B;  2HJF C;  2WSS G;  3UT5 A;  4P9P A;  4LF4 B;  3OMN B;  5B3S B;  3ZHS A;  5LA6 B;  2OCC C;  3BRC A;  2JGD A;  1PP9 H;  5LHI A;  1FXH A;  5H6R A;  3QO5 A;  2R9R B;  2H3O A;  3C3T A;  4FLY A;  1V55 B;  3D36 C;  2KB1 A;  1NJI W;  2WLL B;  1N0N A;  4I5S A;  4R8C A;  4J7Z A;  2P67 A;  4DUY B;  4K0K O;  4GKJ O;  3AG2 B;  1VQK V;  1BGY H;  5LOV B;  1AP5 A;  2WLK A;  2N04 A;  3LDC A;  1M57 C;  5GTH Z;  1QVG U;  3E8G A;  2EIL B;  4C7U A;  1I94 O;  2JRI A;  4KXR A;  4FM0 A;  4DRX B;  5D5Q A;  1VQ7 V;  4JI2 O;  3JAS B;  4NTW A;  1BZK A;  4RAI A;  3OGI B;  1J95 A;  1NBM G;  1VQP V;  1PNL A;  1N34 O;  1BQZ A;  1QR9 A;  2IH3 C;  1OCR B;  3E89 A;  1FXK B;  4L87 A;  4PJ0 Z;  1WB8 A;  4RWU A;  3DTU B;  2ZDI A;  3ETQ A;  3JCZ A;  2ZNI A;  3H1L H;  3U0Z A;  1GM9 A;  2N74 A;  4R50 A;  2CGO A;  3SPH A;  4B3T B;  5KX5 B;  2EIN B;  2Q7G A;  3U10 A;  3ZJZ A;  1GO3 F;  4TV8 A;  2GDS A;  2UXC O;  1IDS A;  4H13 B;  1HNX O;  5A9G A;  3CCJ V;  4E2L A;  4U3J A;  4O4I A;  1RPO A;  4LNU A;  5KHI A;  4J7J A;  3E8F A;  1ZX3 A;  2ZM6 O;  3FB8 C;  4NKG B;  3DC5 A;  3KCY A;  3CRR A;  2UU9 B;  1NTK H;  5KA5 A;  3LNM B;  1KP3 A;  3A2F A;  1DLB A;  4GX2 A;  2WA4 A;  3OTO O;  2VWJ A;  2MK3 A;  2ZKO A;  2X0L A;  3CCS V;  4X66 B;  1AR1 B;  4X1Y A;  1AI4 A;  4UB6 Z;  3ZRX A;  2BTQ A;  3K79 A;  3B4S A;  4JYY A;  3CME V;  5KMG B;  4QGP A;  2H94 A;  1EN6 A;  4K3A A;  2NN4 A;  3O65 A;  4G27 B;  2DOS A;  1VF6 C;  1FPO A;  1M4U A;  5LA6 A;  4FPP A;  2QEX V;  1BCC H;  4JI1 B;  1S5H C;  4DO2 A;  1N4C A;  2YXH A;  1R73 A;  2WLL A;  5EC2 C;  3C3S A;  1WA8 B;  1SQV H;  2XAS A;  5LGU A;  2PI4 A;  4DR4 O;  5JCO C;  4X1K A;  2HLD G;  3ZBH A;  5EBW C;  5JQG B;  4MTO A;  3OT7 A;  4DRX A;  4F6E A;  1VQ6 V;  1I5Y A;  3I5D A;  3AG4 C;  5IJ9 B;  3JAS A;  1QLE B;  3CMA V;  2VRZ A;  2QWN B;  4RQF A;  1O9G A;  2OCH A;  1S0V A;  1FXK A;  5CB4 B;  2L35 A;  3ABK C;  3WG7 B;  1D5N A;  2Q7E A;  2B5U A;  4HNA B;  1V54 B;  4X89 A;  4F6R B;  4UB8 Z;  1WJZ A;  2ZE7 A;  4N23 A;  2QTS A;  1E1R G;  2H8P C;  4DR2 B;  3X2Q C;  1NH2 D;  3B77 A;  5KX5 A;  1OCZ C;  1JMK C;  1GMG A;  2M7W A;  1SET A;  3RBZ A;  5LL6 Y;  2ZD9 A;  4JI8 O;  3MHS C;  5EBL C;  4CS2 A;  2ZIO A;  1Q82 W;  3H1K H;  4B3M O;  2ZE8 A;  4DUZ B;  1Y76 B;  2FYU H;  2ZE6 A;  1AIL A;  3RYI B;  1B6Q A;  4O4H B;  4UXN A;  4FLX A;  1J5E B;  4RUE A;  4PI0 A;  1M1K W;  5B1O A;  2LFR A;  3BEH A;  3G71 V;  1SA0 B;  2P90 A;  1ZUQ A;  2A79 B;  3ZMS A;  3CXH F;  4JGS A;  3W7W A;  1M56 C;  3J81 N;  4I50 B;  4L8J A;  3ZMV A;  3CP1 A;  5KMG A;  3G4S V;  1LUV A;  1M93 A;  1XI1 A;  1YJ9 V;  5LP6 B;  3M7M X;  5J2U B;  5IT9 N;  1ZWI C;  3TGU H;  4JI7 B;  3DGE A;  5LXT B;  4NTX A;  4TUY B;  4D6T H;  1WB7 A;  2RQ6 A;  3RVY A;  1XOU A;  1S77 D;  2WLJ A;  1K3E A;  1L8D A;  4XDK A;  3OGC C;  2LGW A;  3AG3 C;  2LW1 A;  2ZDI C;  1H8E G;  1K73 W;  5JQG A;  3K3W A;  2GHY A;  3RGB A;  1R6K A;  2KSD A;  5IY5 C;  1G8M A;  4JI0 B;  1WLE A;  1YVW A;  4DK0 A;  2BCC H;  4B3S B;  5IJ9 A;  1GM7 A;  2VQF O;  1ZL8 B;  4JI6 B;  4LH7 A;  4NXM B;  2F93 B;  1L1F A;  2ZQM A;  2QSA A;  2PY5 A;  4DK1 A;  5CB4 A;  3Q4H B;  1E1Q G;  1EBO A;  3CRA A;  1H2G A;  4HNA A;  1KEC A;  4LF6 O;  3N2K A;  1CP9 A;  3F5T A;  1I7F A;  1V9P A;  3ASN C;  2JK5 C;  3LNN A;  1W59 A;  4CBC A;  1R3J C;  4I7Z B;  3CPW U;  4HAM A;  4PI2 A;  3G67 A;  2CE4 A;  3LUT B;  4LFB O;  3JCU Z;  5EIB D;  3BHP A;  2LGQ A;  2N05 A;  5HFM A;  1AJN A;  5FPR A;  3OUF A;  4TQF A;  1XMQ B;  2X6C A;  3BA8 A;  1F7Y A;  1FKA O;  5IYC O;  4MVR A;  1G6U A;  4PA4 A;  1K5S A;  1M90 W;  1Y76 A;  3VQY A;  4JAS A;  2EIM C;  2OT5 A;  5FLX N;  3RYI A;  4O4H A;  1PL0 A;  3SPG A;  3CCR V;  4JYA O;  2A3Q A;  3IFX A;  5B3S C;  3OM3 B;  5IDJ A;  1AI6 A;  2F4V B;  4BAY A;  1SA0 A;  4YJ3 B;  4FFB B;  5LMN O;  3S3W A;  1WPB A;  2EIJ B;  1DF5 A;  3MHH C;  1TGO A;  4FZ0 A;  1V55 C;  5HFL A;  4O4J B;  5FPO A;  4Q6G A;  4PD4 F;  1XNQ O;  2DE0 X;  3AG2 C;  3E8B A;  3VQX A;  3CXC U;  4DV1 B;  1H2L A;  4LF8 O;  3SGI A;  2EIL C;  1KKD A;  5LP6 A;  3ZMT A;  4JTA B;  2P4K A;  4MVS A;  2HKO A;  1KUQ A;  4K35 A;  1RSO A;  5H5N A;  1KYO F;  2Q0O C;  4OXS A;  3U11 A;  1D5A A;  2UUB B;  1OCR C;  2RNB A;  4B3R O;  1FXK C;  3ZRS A;  2V1D A;  4DV3 O;  5L3E A;  3F5W C;  4CC6 A;  2XHB A;  4TQD A;  3ABT A;  2Z3Y A;  4GT1 A;  3CRM A;  4LC1 A;  3T1H O;  1ZSP A;  2CK3 G;  1GH6 A;  4GX5 A;  1ZL8 A;  2PGG A;  4LF7 B;  5LHH A;  3CC2 V;  2JGU A;  2X6A A;  2EIN C;  4PEL A;  1ARO P;  2QM8 A;  3Q4H A;  1IBL O;  2WPD G;  1IZ3 A;  3GWO A;  4TWK A;  1XMO O;  2Q9L A;  3CCM V;  2FTK A;  3KZI Z;  1Y66 A;  4J9Z B;  4YY3 B;  4JZ2 A;  1YTF D;  4O2A B;  3TXS A;  4DR3 B;  4NR1 A;  2RCV A;  3T2M A;  2R70 A;  3RWR D;  2FB5 A;  3LSQ A;  4MS2 A;  2QDO A;  4PA9 A;  3L71 H;  2PZS A;  5KUM A;  2AGA A;  3ABU A;  2G38 A;  3CCE V;  3GWK C;  2AZ0 A;  4KHP B;  3K06 A;  4PDV A;  4WF9 V;  2VQE B;  1MZE A;  2QKA A;  5JH7 B;  2Q5Z A;  3ICX A;  2QWQ B;  4DV2 O;  2Q69 A;  3EFF K;  3RT3 C;  5CA3 A;  1R1B A;  3B40 A;  4JI3 O;  3HKE B;  4UCV A;  2WLN A;  2GBO A;  3AK3 A;  1TVK B;  1NQT A;  3H1J H;  4YJ3 A;  2YS8 A;  2C2A A;  4EEQ A;  4J9Y B;  4O4J A;  5KHK A;  4FM2 A;  4ZOL B;  4MW8 A;  1IBK O;  1XRE A;  4UUJ C;  3O9O A;  1Z5W A;  2F23 A;  3K9A A;  3CE2 A;  1BL8 A;  1H2S B;  1BSM A;  4ZHQ B;  1SER A;  1QLE C;  1LR1 A;  4DR7 O;  1YCI A;  1N32 O;  2Y48 A;  1B04 A;  1COW G;  2E3C A;  3WG7 C;  3T4Z A;  2QR4 A;  4PDR A;  1V54 C;  1QVF U;  2A9H A;  3ZHT A;  4X65 B;  1ZAU A;  4BIU A;  2BTO A;  3L9D A;  2E5L B;  1XUQ A;  1B3Q A;  2ZXW B;  4D7S A;  4UV8 A;  3OFN G;  1MG1 A;  3ASO B;  2IU3 A;  1Q6I A;  5KHG A;  1AJP A;  3K58 A;  3JAT B;  1H2M A;  2QWO B;  1XBL A;  2QKS A;  2QKC A;  4CZZ A;  1QCE A;  4ASU G;  1G4Y B;  4W4L A;  2BOC C;  3UO3 A;  5L3G A;  2WWW A;  4DR1 B;  4XBF A;  2PI5 A;  3H1I H;  3QTC A;  4X9Q A;  3DC6 A;  4O2A A;  2HHH B;  2RDC A;  1S5L Z;  4LFC B;  3L72 H;  4YHH B;  3W7S A;  3R65 A;  2DJV A;  5LGN A;  3ZX6 A;  2Y4T A;  4NYK A;  3SDL A;  2B9Z A;  2ZT9 B;  4QPJ A;  4H0L B;  4AQY O;  4OX9 B;  2QA4 V;  1VF5 B;  1HNW O;  4OPA A;  3BAA A;  3HKD B;  1P84 F;  4NXN B;  3ETE A;  4UCS A;  5LP6 C;  3HKE A;  4GCZ A;  2EX3 A;  3W7U A;  2Q68 A;  1E79 G;  4DW1 A;  2ATK C;  3ZRW A;  2UUA O;  2ZIN A;  4IT5 A;  4ZOL A;  2CDY A;  1KQS U;  4DR5 B;  4RO2 A;  4K8Z A;  3HPL C;  3TJT A;  2HEP A;  2F1M A;  1PV0 A;  3VOU A;  4DR2 O;  4WFF A;  4ZHQ A;  1F4M A;  1Z5V A;  1MMM A;  2LW7 A;  3ABM B;  1ZLZ A;  4DV6 B;  2ZCE A;  4EB6 A;  4JPR A;  3LDE A;  2BOB C;  2VS0 A;  4X64 B;  3D3I A;  4I55 B;  1WN7 A;  4P2Z A;  3CCV V;  2EUL A;  4DYL A;  1NT2 B;  1KD1 W;  1Q86 W;  4BWA A;  1GM8 A;  3RYH B;  4GYC B;  3MAQ A;  5K1P A;  4B08 A;  1GAX A;  3OAA G;  2R9A A;  4GX0 A;  2ITD C;  3TK1 A;  1J5E O;  3TXQ A;  4FM1 A;  1NI8 A;  5KHH A;  3K04 A;  5EK0 A;  1I08 A;  2DMX A;  3OEH G;  1PPJ H;  3JAT A;  3SYO A;  1GN6 A;  3CHX A;  2E75 B;  1HDJ A;  4Z2W A;  1THZ A;  4BR6 A;  2DN9 A;  1H38 A;  3JD4 A;  3P3P A;  1X4T A;  3ZRV A;  2Q6A A;  2D2C B;  4FLT A;  1R6T A;  1SS3 A;  4JI5 O;  2F66 C;  2XAJ A;  3IC7 A;  1IXM A;  4CS4 A;  2W0X A;  3FFQ A;  5EBM C;  5LOV A;  2ZR3 A;  2QWP B;  4B7K A;  2EIJ C;  2JEU A;  4FJC C;  4LH6 A;  3T1C A;  5KHJ A;  1XQ8 A;  1OZ0 A;  4EKW A;  1SQQ H;  2LFS A;  2DWD C;  1TUE B;  2KKW A;  5KA6 A;  4GKJ B;  2X6B A;  4NVP A;  1N0J A;  1XIL A;  3LDD A;  1CPY A;  1RFY A;  3VQW A;  4CH3 A;  1AP6 A;  2XUM A;  3W7X A;  3HKD A;  1I94 B;  1PD3 A;  2ZNJ A;  3E2E A;  4AHC A;  1FJG B;  2OWO A;  4MTF A;  4H44 B;  3GVM A;  4JI2 B;  3ZS8 C;  3JAM N;  1GN3 A;  1N34 B;  2QM4 A;  4GX1 A;  3J80 N;  1WAZ A;  1AR4 A;  3CWB H;  2YID A;  4LWS B;  3SPJ A;  3OMA B;  4CH4 A;  1GN2 A;  2YIB A;  1KC8 W;  3WB1 A;  1EN5 A;  3JAR B;  2RMK B;  3MDS A;  1TAE A;  4PA6 A;  1I5X A;  1DTO A;  2A06 H;  1JPX A;  2VWK A;  1SQP H;  4UFZ A;  3BVO A;  3EHB B;  1HNZ O;  2XOK G;  4X8A A;  4XDL A;  4H37 A;  1S76 D;  2EZO A;  1JVM A;  1R3I C;  4P30 A;  2ZR2 A;  4MW3 A;  3CC4 V;  5LBQ A;  2Q7H A;  4I55 A;  2YI9 A;  1D2D A;  2FL4 A;  1HNX B;  2QWR B;  3KG2 A;  4PA7 A;  1Q7Y W;  4CS3 A;  2JS3 A;  1QNM A;  5DM6 V;  2OTL V;  2ZM6 B;  3ZIA G;  5IWA O;  1VQ8 V;  3RW0 A;  4E4E A;  1MA1 A;  1F51 A;  4LR3 A;  2OTJ V;  5FL7 G;  3ZCC A;  1H2N A;  3R66 A;  1YEW A;  3OTO B;  1K92 A;  1OHH G;  1NH2 B;  3E22 B;  2AZ2 A;  3P32 A;  3E83 A;  3OMI B;  1K8A W;  2K9P A;  3JD2 A;  4D7T A;  2Y69 B;  4O4L B;  4F4L A;  5H6Q A;  2ODM A;  4GKK O;  1WA8 A;  4UCU A;  5LMU O;  1IXB A;  2Q73 A;  3UCS C;  3BFR A;  1N36 O;  5JJN B;  1R3L C;  4LF9 O;  1KB9 F;  2IJI A;  2WLI B;  3F7V C;  2NLJ C;  1XHX A;  1JJ2 U;  1FYJ A;  3SJB C;  3VQV A;  4DR4 B;  1MSW D;  4WFH A;  4OPH A;  1S3J A;  1JR9 A;  4DXW A;  3WFV A;  4FLV A;  3CCL V;  1VQN V;  2JJ1 G;  2UXD O;  2HP8 A;  5JVD B;  2M6Y A;  1PL4 A;  4X62 O;  4MVZ A;  1K9M W;  4LF7 O;  4F6R A;  2D3O W;  2WLM A;  5JJE B;  4LWS A;  5DEC A;  5E1A C;  1KKC A;  1RM1 B;  1CEZ A;  4IYH A;  3JAR A;  5GTI Z;  4QNH B;  1NTZ H;  4UVC A;  5CA1 B;  4PDL A;  3BPZ A;  2R9I A;  1HW7 A;  4YY3 O;  4DR3 O;  1Q6H A;  3H9V A;  3D8C A;  4WFA V;  4DV7 O;  4LF5 B;  1XL4 A;  2ZXW C;  1Q5O A;  1SKV A;  2QTO A;  3ZED A;  4WCE V;  1I0H A;  4HYO A;  3ASO C;  1YIJ V;  2E74 B;  2UXB O;  1BHB A;  3LSU A;  4LFA O;  2DYS B;  4JI8 B;  4UCO A;  3K5O A;  2CAZ C;  2GUZ B;  2HG5 C;  2Q4P A;  3JSN A;  1N33 O;  4B3M B;  3CC7 V;  1P7G A;  1HR0 O;  2PUS A;  2Y4U A;  4BIO A;  5B66 Z;  3ETD A;  5J9P C;  3JD1 A;  3UQ8 A;  4G28 B;  2AHZ A;  1W2B U;  4I50 A;  3JSL A;  2P22 C;  4BW9 A;  2UUC O;  1ORQ C;  3QVN A;  3SR2 C;  5J2U A;  2YC0 A;  3APQ A;  1A32 A;  3F7Y C;  3SPI A;  3KKY A;  4DV5 O;  2IJJ A;  4O4L A;  5LXT A;  1GKF A;  1OV9 A;  4TUY A;  3RVZ A;  1SC5 B;  1K7D A;  2ETN A;  4JF3 A;  5IYB O;  3GB7 C;  1URF A;  1IBM O;  4DR6 O;  2ARH A;  5C8Y B;  3L70 H;  2IJH A;  3PJS K;  1Q90 D;  5BMV B;  4TV9 B;  4DV0 B;  2WLI A;  4JAV A;  1F4N A;  1EZJ A;  3SJA C;  1SQF A;  3HKC B;  1JOY A;  4QE9 A;  1M9N A;  5JJJ B;  1XEQ A;  4IYI A;  4JV5 O;  3AG1 B;  1XNR O;  1PNM A;  5C93 A;  4DV4 O;  4JI4 B;  2Y0I A;  1H2K A;  4NB5 A;  4TOI A;  2Y0P A;  1FFT B;  3ABM C;  3BAB A;  2KQX A;  1VQM V;  5EC1 C;  1BMF G;  1KMI Z;  3RYF B;  4MT8 A;  4FLU A;  1BT8 A;  1AI7 A;  4LF6 B;  4LF4 O;  2IW5 A;  5IYD O;  4YXW G;  1FS0 G;  5K1X A;  5CA1 A;  3B8N A;  4DR1 O;  1VF7 A;  1VAR A;  3K5M A;  5B5E Z;  3EXA A;  2OYQ A;  4MTX A;  3I55 V;  2HHH O;  1KU9 A;  2IJK A;  4QPK A;  2XAH A;  4YHH O;  4LFB B;  4DUY O;  4UVB A;  3ZMU A;  1VEW A; 
#chains in the Genus database with same CATH homology
 2AXT Z;  3WU2 Z;  5H2F Z;  5B66 Z;  4PJ0 Z;  4UB8 Z;  5GTH Z;  5B5E Z;  5GTI Z;  5KAI Z;  3JCU Z;  3A0H Z;  4IL6 Z;  5E79 Z;  4UB6 Z;  5TIS Z;  5KAF Z;  3KZI Z;  3A0B Z;  1S5L Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...