2AXTZ

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 2axtZ00
5H2FZ 5B66Z 5KAFZ 3WU2Z 3KZIZ 4PJ0Z 4IL6Z 3A0BZ 2AXTZ 1S5LZ 5E79Z 4UB8Z 5KAIZ 5TISZ 5GTIZ 4UB6Z 3A0HZ 3JCUZ 5B5EZ 5GTHZ
chains in the Genus database with same CATH superfamily
4E2LA 3F5TA 3CCLV 3STLC 2JS5A 2H94A 3STZC 3D3IA 3ZN0A 1NU1H 2E5LB 3BFRA 1GM8A 4DUYO 5LA6A 4JI4O 2A06H 4O4LB 4FLXA 3W7WA 3E35A 4JV5O 3ABLC 1HP8A 3F7VC 3WB1A 1NTKH 2IH3C 3APQA 1MABG 2FMLA 4J9YB 5CMUA 1YJ9V 1BHBA 2QWOB 2DE0X 4DV2B 1QVFU 2M6YA 3W7UA 3KZIZ 1NTMH 2AXTZ 2ZXWC 1FD9A 4HBNA 4OX9B 4U3JA 1Y76B 2BCCH 4UB6Z 1MNGA 4NR1A 2N74A 2KB1A 2ADQB 4UV9A 3H1IH 4FZ0A 1R6NA 4I4TA 4NTXA 3QF7A 3ZHSA 4O4IB 1N0NA 4X89A 2EZPA 5B1AC 1O9GA 1BS3A 3SYQA 4DO2A 3L9DA 2P5OA 5CN0A 5J2TB 3ABUA 4LFAB 4FMTA 2DWEC 2UXNA 4FLVA 2A79B 4LF9B 5KUKA 1KD1W 1FFXA 5L3CA 4BIUA 4DV5O 3FKSG 4CS2A 1XL4A 3EVKA 3J81N 4R7CA 4O2AA 5JWPA 5IWAO 3ZMTA 1KQSU 2ZQMA 5IY5B 2NLJC 4KHPB 4DRXA 1DF5A 3ZRWB 3CCUV 3T2MA 1WPBA 4WF9V 2GTSA 2OWOA 1THZA 2Y48A 3RW0A 3NXSA 1E1RG 2X0LA 4BIOA 3ZS8C 1DLBA 4J9ZB 1VQ5V 1XBLA 1JJOA 4GUNA 1RM1C 5LGUA 3SPCA 2DN9A 2JRIA 4RAIA 2UUCB 4GX0A 5CA3A 1JQ0A 3P3NA 4ZBMA 3UKMA 3T1YO 4U7NA 4JZGA 1QLNA 3ZMZA 1OCOC 3IFXA 1QVGU 2FKXA 2LW1A 4WBNB 3OW2U 2Q7HA 3AG4B 3K06A 1S0VA 1XILA 2GV9A 1PD3A 1K33A 2PF4E 4MTXA 2EJ7A 2P4VA 2QGNA 1XHZA 4FFBB 4P9PA 2H3OA 3JATB 3CCVV 3HPLC 2QWNB 2IU3A 2YXHA 1LNQA 1U97A 3EHBB 3ZX6A 1FAFA 4DR3O 4TQDA 4WFFA 2JGUA 5IJ9B 1A32A 4B3MO 4P30A 4J7JA 1Y74A 2D3OW 1I0HA 3F5WC 1R3IC 1RSOB 4IL6Z 4IIJB 5J2UB 3E22B 1H2SB 1OCZC 2Y69B 3JARB 4DV0B 3RBZA 3VQXA 1PNLA 4ZOLA 1IBLO 2R72A 1MMMA 4GX2A 4DR2O 4J11A 4DK1A 5KA6A 5DECA 3AK1A 4BW5A 3FB5C 2F66C 3EXAA 2UUBO 3CXHF 2PYJA 3CRAA 1YITV 1E79G 4NTWA 1SRYA 1MOFA 2EIJB 3SYAA 4DR7O 2UXDO 2MW2B 3VBBA 1EBOA 3OR6C 3RYCB 1HWYA 3ABMB 1L0LH 4DUZB 3G80A 2QKAA 3VOUA 5BXZA 4Z2WA 1FJGO 2HR3A 4PD4F 4MVUA 2WLJA 1QR8A 3D3QA 4I55A 3ZJZA 1EZJA 3N2KB 1K7DA 3A8TA 1ZWIC 2Q0OC 4B3RO 5E1AC 3LDCA 4DR5B 2EIKB 4I7ZB 1IXMA 2EIMC 4UCSA 1R6TA 1GM7A 2Y0PA 5EZYB 4PA4A 1DGSA 3G4SV 5LOVB 4K3AA 4UCTA 2LGQA 3SJQC 5CA1B 1S3JA 2QM7A 3LSQA 1MA1A 2ILMA 4ZHQA 4OXSA 2LO1A 4LF5O 3BVOA 3H01A 1SS3A 3KCYA 3ABLB 2XAFA 2XUMA 2ETNA 4JV5B 1PNKA 1WPXA 2Q4PA 2DYRC 1M5IA 2ZXWB 2A7WA 3B8MA 3HKCA 2Y4UA 4X62B 1TAEA 5L3DA 3ZRSA 1MSDA 4XDKA 1BZKA 3ABTA 2PTMA 5JCOA 2PUSA 1ZL8B 2N04A 1VQPV 2XAJA 4LH6A 1F4NA 4DV1O 1VIBA 1XNQO 3PJSK 5H2FZ 4Q6GA 5B1AB 4KXRA 2GDSA 4NKGB 4G27B 4OPAA 2HLDG 3SPGA 4LFCO 1ZLZA 3K0DA 1X59A 2F4VO 1AILA 2YC0A 5IYZA 3IC7A 3BEHA 2Q6AA 4YJ3A 3CRRA 1SQFA 4JI0O 4X20B 2PI5A 2VWJA 1GK9A 4DV5B 5H9CA 4GKKB 5KHJA 5JJNB 2P6JA 5IWAB 4JAVA 4LF8O 4UCRA 3OEEG 4JASA 4YJ2A 1MZFA 2NR5A 4JI5O 2KKWA 2WLIA 1M90W 3FAVA 4YXWG 5L3BA 2WA3A 4GX1A 3LDDA 4EFEA 2WLHA 3DTUB 4MVQA 1RM1B 3AK2A 3CJHA 4X64O 3K3WA 2ZE5A 1VARA 2KSDA 1KBHA 4U3FH 3B40A 4Q20A 3T1HB 3I55V 1HNXB 4XDLA 1FXHA 2KG7A 4DV4B 2AHZA 1YZBA 5IE9A 1AP5A 4H44B 1OCOB 3G71V 1JA8A 1NKDA 3ETDA 1AJQA 5KHGA 1GKFA 1XMOO 1K3EA 5B1OA 1HW7A 1WA8B 1PNMA 4MTOA 3CX5F 4ZIBA 3LNNA 3CRQA 1XMQB 1L1FA 4EEQA 2GTAA 1UPGA 3J80N 5GONB 2ZINA 3OUSA 3O9OA 1Q6UA 3JALB 4DW1A 1N33B 1P4RA 2JDIG 3O65A 4X65O 3B8NA 1VF5B 4IHJB 3BY6A 5FNVB 4QIWF 4DYLA 1JJ2U 4LFBO 2DW4A 3RN4A 3UCSC 1XREA 1W0KG 5EC2C 2P67A 1JOYA 4JPRA 5EBLC 5LA6B 4DK0A 4DR6O 1P49A 2NNUA 4MS2A 3AG3C 2UXBB 2ATKC 3UT5A 1X4TA 1OCZB 2ZIMA 5B3SC 4XDJA 5ITZB 2V7QG 1F7YA 1FXKA 2RN9A 2IH1C 4JI2B 1SA0B 2V4DA 4X9QA 5LGNA 1IBLB 4DR2B 4RO2A 4FLYA 4KL1A 2ODMA 4DR4O 1SETA 2GSMB 2BTOA 1B04A 5KAFZ 2ZE6A 2UUBB 4YY3O 3TJTA 3L73H 3WU2Z 4U7OA 1GMGA 5JH7A 2YIAA 4D7SA 4DV7B 2BOBC 5JCOC 1GN6A 3OFNG 4UCUA 3C3TA 5LYJA 1SQQH 2X7RB 4DR7B 1H8HG 2UXDB 1M9NA 1JFFA 4EKWA 5IJ0B 1V55C 1NH2B 1FJGB 3S3WA 1LR1A 2BTQA 2CDYA 1BHAA 2HG5C 1QBZA 4CS3A 1YVWA 2YIBD 3K5NA 1Y4MA 3CYOA 5L3EA 1K8AW 1HNWO 3E83A 4B3RB 2CTQA 2EIMB 3A0RA 5CBHA 1US6A 1BCCH 2YICA 3A0HZ 5BMVB 1J5EB 4D6TH 5HFMA 4O2BB 4O2AB 3I5DA 4PDRA 3D36A 2HEPA 5C8YA 4LWSA 1FYJA 3NR7A 1S72V 1VEWA 2QKCA 1PV0A 4HYOA 1HR0B 4A5UB 4K8XA 1BL8A 3B09A 4YHHO 1K97A 2FB5A 4KP4A 1VF6C 3FD9A 3ZMUA 4JI8O 4G2KA 4LF6B 2GBOA 4ZI7A 3K0GA 1BT8A 4TOIA 3T4DA 4FFKA 2Z3YA 3CCJV 1E1QG 1BQ0A 3JAKB 2XNDG 1Q3EA 1QLEC 2RQ6A 1H38A 2DWDC 2LFRA 2B9ZA 1YJNV 3HKDA 3KCXA 5K1XA 4UCOA 5LP6A 4I50A 4P2ZA 1PKXA 2OIGA 3OTOO 2HKOA 4BAYA 4PHZA 4WFBV 5KLVH 4IYIA 4DV1B 1YSCA 2XAQA 1XNQB 1GRJA 1MSWD 1P7BA 2EILC 1IZ3A 1SESA 1S76D 3RYHB 3HB3B 1VP7A 3K04A 2B1GA 4LFCB 4GX5A 3CS5A 2WLLB 4CH4A 1UJWB 3HKBB 3OMAB 2OTJV 4DV3O 4JI0B 4JTDB 2UUAO 4O4HB 5JQGB 3B2EE 4UXNA 1FKAO 3APOA 1HNZB 4K0KO 4UB8Z 4TWKA 4LF8B 1UFIA 4F6RA 4BWAA 3FX7A 1G4YB 2DMXA 3E8HA 1N4CA 5LMUB 2LJ2A 3OT7A 4AQYO 3RYFA 2YEVB 1I94B 4LH7A 4EB6A 2PI4A 2CGNA 4ZOLB 4QE9A 1FXKC 2Q9LA 3ZMSA 2OYQA 1NR7A 3R66A 3QTCA 2EINC 2XOKG 5KMGB 1TUBB 4FLWA 4GKJO 3OEHG 3JASB 4JI3O 2UU9B 2ZNJA 1EZVH 3H1JH 3A2FA 4LNUB 1K34A 1R6KA 4L87A 4NTYA 3CCRV 2ZCEA 5EIBC 3CC4V 4YIPA 1NI8A 1XMOB 5EK0A 1IBMO 1Q6HA 3IGAC 2CUGA 2RMKB 4B08A 1WLEA 4FLZA 5B5EZ 4DR1O 2P4KA 2CTPA 1WAZA 3K59A 5IYDO 2QWQB 1OCRC 4B7EA 4JYAB 5FLXN 1ORQC 3BRCA 1N34O 4UVAA 3K5OA 2WLMA 2HVKC 1NZ6A 3VQYA 4GT1A 1KP3A 4X65B 5JVDA 2Q8VA 1XQ8A 5BR8O 3VQWA 1P84F 3D36C 4LFBB 4CH6A 1Q5OA 1NBMG 4MVRA 1K5QA 4O4LA 3U10A 4QNHB 3AG3B 3JD3A 4NB5A 4PDMA 5B3SB 2VQFO 4DR6B 2AZ2A 4LBEC 2Q7GA 4JI6O 1G8MA 2DQ3A 3SYCA 1I08A 1SQPH 4JI1B 1VQMV 1XNRO 1QCEA 2IU0A 3K5MA 1OV9A 2GUZB 1PL0A 4GZRB 4X1IB 2F1MA 1Y6XA 2F95B 4BW9A 2VQEO 3HKCB 5JJEB 5EBWC 4AILC 4DR4B 2A0LA 2WA4A 1K4DC 2P06A 2OCCC 1CPYA 3X2QC 3I56V 2ZE8A 1NH2D 3HR0A 4X66O 5DEDA 3TXSA 5CBGA 4X1KA 4PELA 3MDSA 4O4IA 5BZBA 4LF4B 3G6BA 3JCUZ 2QWRB 2PGGA 1V55B 2QE7G 3N27A 4J7KA 5LL6Y 3G67A 2W0FC 5DM6V 5LHGA 3SDLA 2E3CA 5E79Z 3ZHRA 3K79A 4CC5A 1XHXA 1OCCC 3SYPA 1G6UA 1IBKO 5GTHZ 4HNAA 4Z1VA 4DV6B 1IVSA 4TSFG 3CB2A 4TV8B 4FK5C 3CCEV 1K5SA 3ZRWA 3GWKC 4YJ2B 3OAAG 5KHIA 3FYIB 1OJHA 2JJ2G 4JGSA 1URFA 2WLIB 2OCHA 5CBFA 3VQVA 3QNEA 3ZCCA 1IX9A 1VQKV 1S5JA 1TVKB 2BSKA 4CH3A 4YHHB 5KX5A 1R73A 2QTSA 3ICXA 1D5NA 3ETEA 3RYIA 4JZ2A 5CB4B 3S3XA 1SKVA 1QLEB 1GTOA 2YDEA 3BA9A 2KG7B 3A0BZ 4QJFB 3ASNC 4UVCA 4LF7O 1FXVA 5LGTA 1DF4A 2Q68A 2YSUB 4MVMA 2FYUH 4DUYB 1YCIA 1KYOF 4JI4B 5EBMC 3Q4HB 4MTFA 4UV8A 1S77D 4WBNA 3UM7A 4QE7A 1Q82W 2QM8A 5EYPA 3SYOA 1WP7A 3ZHQA 2XASA 1FFTB 2ZT9B 2EILB 4FFBA 4GYCB 4B3SO 1Y67A 4XBFA 4TQFA 3L70H 3JATA 5IYBO 2DQ0A 2X6AA 2CH7B 3SJAC 4I9WA 2RJZA 4PA7A 4AHCA 1AJPA 3E8FA 2E5LO 1AVMA 4DV3B 1J95A 3IAYA 1QNMA 4PJ0Z 3ZMVA 1SQBH 4FLUA 3OGCC 4CH5A 4K0KB 3AEIA 5LHIA 3U11A 4IIJA 4TV9B 2YUAA 3RFRA 5J2UA 3CCQV 2HJDA 4UFZA 4LP8A 1BMFG 1AI5A 1FXKB 4UCVA 4AQYB 2A9HA 2A3QA 3T1CA 1ZSPA 2EINB 4L8JA 3CRCA 3QG5A 2M7WA 3SPIA 1TUEB 4J80A 3W7XA 1D2DA 2MK3A 5FPRA 3HKEB 4JI3B 1GAXA 1ZAUA 3CCSV 2YXLA 4EFBA 3RYCA 3JD0A 1K73W 2VWKA 1DTOA 5H6RA 5LYJB 2HHHO 3JAWB 4JI7O 1NQTA 2ZR2A 1M1KW 1JFFB 4JAUA 2IJIA 2P7TC 3RVZA 3PN1A 2QM4A 1IBMB 4LFAO 1VQ9V 5AG2A 5LMNO 4LF9O 3QO8A 1OCRB 1GH6A 4ASUG 4DXWA 4D7TA 3OR7C 4RQFA 3T1YB 3ABKC 4I9QA 4DW0A 1N34B 3M99B 2YIBA 4Z1MG 1L0NH 4KHPO 5C8YB 4LWSB 1W0JG 3BAAA 3SPHA 5BR8B 2WAMA 1VMGA 3N2GA 4F4LA 1K4CC 3H9VA 4FM2A 4H13B 4O4JA 1R1BA 2Q73A 3QO5A 1IDSA 2JEUA 5A2QN 3OD4A 2UUCO 1T5EA 3DGEA 3CD6V 4NXMO 2L35A 4W4LA 1M93A 1N8RW 2AHYA 4DR3B 2VQEB 2XTAA 4MW8A 2DOSA 2WPDG 5CA0A 2OCCB 4B3MB 3X2QB 1ZL8A 1Q81W 3OGIB 1SERA 3U0ZA 3RGBA 2B5UA 4X66B 5TISZ 2RDCA 4PV1B 3CSXA 4JF3A 1KKDA 5B1BC 3P32A 1OZ0A 3H1LH 4ABMA 2E74B 4B7KA 2IJKA 4H37A 1G1XB 3CRMA 3ASOC 4U3JB 2D2CB 3WB2A 1JPXA 1OCCB 1ENVA 5GTIZ 4OPHA 4I4TB 2HVJC 4K8ZA 1RFYA 2ZDIA 3CC7V 1ZUQA 4DV0O 4F6RB 1R3KC 3OTFA 2FTKA 2CGOA 1GN2A 3L71H 1AB3A 3UQ8A 1QU7A 4RUEA 1AI4A 3OM3B 1AP6A 1FFXB 3AG1C 4EB6B 1BQZA 1SZTA 2EZOA 2QJ1A 3JCZA 3E86A 2EX3A 3ETGA 1YF2A 1WB8A 3LSUA 3ASNB 5JJJB 4PDVA 4DRXB 1BGYH 1CP9A 2X6CA 4WCEV 2JVDA 2IW5A 4LF5B 4KFMA 2PZSA 1AJNA 1ROPA 5D5QA 1WA8A 3MHSC 4HZ3A 3BHPA 2RCVA 3OUFA 1VQ8V 4CBCA 3K9AA 3G6EV 2QSAA 4CC6A 1R3LC 2GHYA 3JALA 4B3SB 4I0XA 2E75B 2HP8A 4RWUA 1I5XA 1NS1A 4IHJA 3CMEV 1BSMA 2QTOA 5FPOA 2IM9A 3LSSA 1CEZA 3LNMB 4G28B 5JVDB 2LW7A 1QQCA 1ZX3A 2JGDA 1XUQA 1KKCA 2P90A 2XT9A 5ITZA 2F4VB 1B06A 1SA0A 1Q7YW 1IXBA 2YI8A 2K9PA 3L74H 2F43G 4X62O 1GO3F 4X1YA 5EIBD 3DXRA 1SC5B 1RPRA 5L3FA 3AG2C 3SPJA 1Y74B 3TXQA 1BE3H 3IJ4A 5LXTA 1XEQA 3JD2A 1VQ7V 4PI0A 3K5LA 4JI5B 4X1KB 1N32O 2AGAA 1SQGA 2F23A 3WFVA 2R9RB 3CC2V 3BA8A 4UVBA 1AROP 2HHHB 5IJ0A 4PA9A 4JI7B 1V54C 4QGPA 1Z5WA 3P3PA 4X64B 3F7YC 2Q67A 2P22C 1F4MA 3SJCC 2IJJA 4JTCB 2R9AA 2ZE7A 1U96A 5LMNB 4F6EA 3K57A 3ABKB 1XDCA 3R65A 4GKKO 5BMVA 1Y66A 1JCHA 1XOUA 3CHXA 4O2BA 4MVOA 1LUVA 1YHQV 2QR4A 4N23A 4R6ZA 4HNAB 2L6LA 1MZEA 3SJBC 2Z5UA 3FB8C 3BPZA 3M7MX 1VQ6V 4TUYA 1YJWV 1QHTA 1XL6A 1GM9A 1VQOV 3CCMV 2ZDIC 2CTWA 4I55B 1EN5A 3ZHUA 2LP7A 3BABA 2DYSC 3MAQA 2WWWA 3TGUH 2WLKA 4GCZA 5C93A 2N05A 1RPOA 2BSKB 2YI9A 2XHBA 4LR3A 1K9MW 2HFEC 5KX5B 3JAMN 1PPJH 3T1HO 1KECA 1Q6IA 2JEXA 3WG7C 1HNXO 1XI1A 3JAKA 3RYIB 4DV4O 4NXMB 4N21A 3FB6C 2YIDA 1ZTEA 2LGWA 1H2NA 2EJRA 4ZHQB 5D5PA 4FIPC 4OGQB 1Q90D 4LC1A 5FL7G 2ZM6O 1PL4A 4YIOA 1AI7A 2AW9A 2C2AA 5KHHA 2H8PC 5EYPB 4AI8A 2EBOA 2YS8A 1M56C 1Z5VA 1XMQO 1JR9A 4IYHA 5B1BB 2Q0AA 4JAAA 2NN4A 4MVSA 3RYHA 1F23A 3E8GA 2AZ0A 1N33O 1AR5A 3CP1A 1Y76A 3RWRD 3AG7A 3SR2C 1KC8W 4TT3G 3ASOB 4B3TO 4MT8A 1AR1B 2WLLA 4WFAV 4YY3B 3HKBA 2VRZA 5A9GA 5LP6C 5L3GA 1NVPB 1KMIZ 5F2VO 4O4HA 4ZKIA 2K1EA 4JYYA 4R8CA 5JQGA 3CXCU 2Z0AA 4FM0A 1VQLV 2UXBO 3DC6A 5J2TA 1P7GA 1YEWA 4FVMA 2ARHA 1SQXH 3DSQA 1NJIW 1WNSA 2W0XA 2ADPA 4JI2O 2QEXV 2YEVA 4R50A 5IYZB 3AG1B 4YJ3B 3TCUA 1HNWB 1EFRG 3RVYA 3QVNA 2B1IA 5KMGA 1TUBA 4C7UA 1N36O 3JASA 4HAMA 1R3JC 1I5YA 2JS3A 3IC9A 4DV7O 4J10A 1W2BU 4LNUA 4PA6A 2G38A 3FAVB 4NXNO 4K35A 3ZHTA 4JI8B 2UXCO 1OHHG 3CJHB 3JD4A 2UXXA 4J7ZA 3K58A 1SZXA 3JYCA 2PYLA 1SQVH 1J5EO 1H2MA 2XAHA 2Q69A 5H6QA 1S5HC 3GVMA 3K9SA 2ZNIA 4MW3A 2R9IA 2W6JG 4JTAB 1AI6A 3AK3A 4BR6A 5DN6G 3OTOB 3K03A 3L75H 3B77A 4IGGA 1NT2B 3CPWU 1HR0O 1Z2GA 1COWG 3QO7A 1Q43A 3B4SA 5K1PA 2CTRA 3N2GB 1VQNV 2WSSG 5KAIZ 1NTZH 4LF6O 4O4JB 3THOA 2KQXA 3T4ZA 1M57C 3ZBHA 2VS0A 1YTFB 2GUZA 4X1IA 2E76B 5LBQA 5B1NA 5J9PC 1YI2V 2ZD9A 1N0JA 1CXZB 4PI2A 3OMNB 5IJ9A 2UUAB 3KKYA 4JYBA 2WLNA 3AG2B 1K92A 1WN7A 1B6QA 1JX9A 5CA0B 1RSOA 4PA3A 4FLTA 4MTGA 3E22A 3UT5B 3JARA 2DJVA 4MSWC 4DV2O 3ZEDA 3CWBH 1N32B 1V54B 3W7TA 2Y4TA 1PM9A 2X6BA 3JSLA 3SGIA 4OX9O 3J7AU 1H2LA 4FZ1A 2R70A 2Q7EA 4X88A 3WB0A 2Y0IA 5KA5A 2Q5ZA 2JK5C 4GKJB 5JH7B 3LUTB 2QKSA 5B66Z 4JYCA 3ZN1A 1WP8A 3JD1A 1H2GA 1HNZO 4TV8A 3LDEA 4E4EA 1L8DA 4J41A 5IDJA 1IURA 1Q86W 1VF7A 3GWOA 3ZHVA 2FL4A 4IT5A 5LMUO 4RUFA 3N2KA 1SF9A 2BTQB 2OT5A 2DYSB 3L72H 1VF6A 3TETA 2OIEA 4LCUC 1I94O 4DR1B 1EM1A 4H0LB 1GN3A 4CZZA 1H2KA 1TVKA 3TK1A 2YXYA 2BOCC 3ML0A 4H33A 3D8CA 5EZYA 1H8EG 2W6IG 3WG7B 2HJFC 5LOVA 3FFQA 2XAGA 5CB4A 2UU9O 5CA1A 2O57A 3MHHC 2IJHA 4CS4A 5IY5C 1TGOA 3RT3C 1JVMA 4FPPA 3ZRVA 4WFGA 3Q4HA 4PDLA 2F93B 4KUMA 2JJ1G 2ITDC 2CAZC 1EN6A 2VQFB 3GB7C 2ZM6B 1M56B 2RNBA 4ZI7B 3W7SA 4JI6B 3BCCH 2IBZH 1XNRB 2LFSA 3E89A 4JYAO 5KUMA 1FPOA 1WJZA 3FYEB 1NVPD 3C3SA 5LHHA 1KB9F 4I0XB 1GN4A 3EFFK 3HKDB 4ICGA 5IT9N 4B3TB 2CH7A 5LP6B 4I50B 3UO3A 4P9OA 2OTLV 3ETQA 5HFLA 5BY1A 1S5LZ 4MVZA 3FB7C 2ZIOA 4FM1A 4WFEA 3AG4C 4FJCC 1YIJV 3M8AA 4GLXA 1Q8IA 2BE3A 4TV9A 2JGDB 2QDOA 1LUWA 1KU9A 1D5AA 3KG2A 4JI1O 1EN4A 3CMAV 3OMIB 1YDXA 4X20A 2ZKOA 5KHKA 1HDJA 4X8AA 5GW7A 5IYCO 4X1YB 2PY5A 1YXBA 1KP2A 1IBKB 3H1KH 5H5NA 2EULA 3DXRB 1QR9A 1N36B 3HKEA 1WB7A 4QPJA 1M4UA 4LF4O 4W4KA 5LXTB 2ZR3A 1RP3B 3JAWA 2LQTA 2Y69C 1O9HA 4UUJC 4QPKA 3RYFB 2JIZG 1V9PA 4WFHA 4NXNB 3UO2A 4J42A 4RQEA 2QA4V 1NR1A 3C90A 2UXCB 3CE2A 1I7FA 1VQ4V 3ZRXA 3OE7G 3MD0A 1KUQA 3ZIAG 1AR4A 3E2EA 2CE4A 4DUZO 4BIZA 4LF7B 2EIJC 4DV6O 1W59A 2V1DA 3K08A 1PP9H 2QWPB 3ABMC 3E8BA 5EC1C 4NYKA 3DC5A 4TUYB 3JSNA 1DK1A 1YTFD 1FS0G 3H1HH 4DR5O 5GONA 1TA8A 1MG1A 1F51A 4NVPA 3CEIA 3P30A 2EIKC 1JMKC 1M57B 1B3QA 2DYRB 2ITCC 2CK3G 4I5SA 5FNVA
chains in the Genus database with same CATH topology
5H2FZ 5B66Z 5KAFZ 3WU2Z 3KZIZ 4PJ0Z 4IL6Z 3A0BZ 2AXTZ 1S5LZ 5E79Z 4UB8Z 5KAIZ 5TISZ 5GTIZ 4UB6Z 3A0HZ 3JCUZ 5B5EZ 5GTHZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F Z;  5B66 Z;  5KAF Z;  3WU2 Z;  3KZI Z;  4PJ0 Z;  4IL6 Z;  3A0B Z;  2AXT Z;  1S5L Z;  5E79 Z;  4UB8 Z;  5KAI Z;  5TIS Z;  5GTI Z;  4UB6 Z;  3A0H Z;  3JCU Z;  5B5E Z;  5GTH Z; 
#chains in the Genus database with same CATH topology
 4E2L A;  3F5T A;  3CCL V;  3STL C;  2JS5 A;  2H94 A;  3STZ C;  3D3I A;  3ZN0 A;  1NU1 H;  2E5L B;  3BFR A;  1GM8 A;  4DUY O;  5LA6 A;  4JI4 O;  2A06 H;  4O4L B;  4FLX A;  3W7W A;  3E35 A;  4JV5 O;  3ABL C;  1HP8 A;  3F7V C;  3WB1 A;  1NTK H;  2IH3 C;  3APQ A;  1MAB G;  2FML A;  4J9Y B;  5CMU A;  1YJ9 V;  1BHB A;  2QWO B;  2DE0 X;  4DV2 B;  1QVF U;  2M6Y A;  3W7U A;  3KZI Z;  1NTM H;  2AXT Z;  2ZXW C;  1FD9 A;  4HBN A;  4OX9 B;  4U3J A;  1Y76 B;  2BCC H;  4UB6 Z;  1MNG A;  4NR1 A;  2N74 A;  2KB1 A;  2ADQ B;  4UV9 A;  3H1I H;  4FZ0 A;  1R6N A;  4I4T A;  4NTX A;  3QF7 A;  3ZHS A;  4O4I B;  1N0N A;  4X89 A;  2EZP A;  5B1A C;  1O9G A;  1BS3 A;  3SYQ A;  4DO2 A;  3L9D A;  2P5O A;  5CN0 A;  5J2T B;  3ABU A;  4LFA B;  4FMT A;  2DWE C;  2UXN A;  4FLV A;  2A79 B;  4LF9 B;  5KUK A;  1KD1 W;  1FFX A;  5L3C A;  4BIU A;  4DV5 O;  3FKS G;  4CS2 A;  1XL4 A;  3EVK A;  3J81 N;  4R7C A;  4O2A A;  5JWP A;  5IWA O;  3ZMT A;  1KQS U;  2ZQM A;  5IY5 B;  2NLJ C;  4KHP B;  4DRX A;  1DF5 A;  3ZRW B;  3CCU V;  3T2M A;  1WPB A;  4WF9 V;  2GTS A;  2OWO A;  1THZ A;  2Y48 A;  3RW0 A;  3NXS A;  1E1R G;  2X0L A;  4BIO A;  3ZS8 C;  1DLB A;  4J9Z B;  1VQ5 V;  1XBL A;  1JJO A;  4GUN A;  1RM1 C;  5LGU A;  3SPC A;  2DN9 A;  2JRI A;  4RAI A;  2UUC B;  4GX0 A;  5CA3 A;  1JQ0 A;  3P3N A;  4ZBM A;  3UKM A;  3T1Y O;  4U7N A;  4JZG A;  1QLN A;  3ZMZ A;  1OCO C;  3IFX A;  1QVG U;  2FKX A;  2LW1 A;  4WBN B;  3OW2 U;  2Q7H A;  3AG4 B;  3K06 A;  1S0V A;  1XIL A;  2GV9 A;  1PD3 A;  1K33 A;  2PF4 E;  4MTX A;  2EJ7 A;  2P4V A;  2QGN A;  1XHZ A;  4FFB B;  4P9P A;  2H3O A;  3JAT B;  3CCV V;  3HPL C;  2QWN B;  2IU3 A;  2YXH A;  1LNQ A;  1U97 A;  3EHB B;  3ZX6 A;  1FAF A;  4DR3 O;  4TQD A;  4WFF A;  2JGU A;  5IJ9 B;  1A32 A;  4B3M O;  4P30 A;  4J7J A;  1Y74 A;  2D3O W;  1I0H A;  3F5W C;  1R3I C;  1RSO B;  4IL6 Z;  4IIJ B;  5J2U B;  3E22 B;  1H2S B;  1OCZ C;  2Y69 B;  3JAR B;  4DV0 B;  3RBZ A;  3VQX A;  1PNL A;  4ZOL A;  1IBL O;  2R72 A;  1MMM A;  4GX2 A;  4DR2 O;  4J11 A;  4DK1 A;  5KA6 A;  5DEC A;  3AK1 A;  4BW5 A;  3FB5 C;  2F66 C;  3EXA A;  2UUB O;  3CXH F;  2PYJ A;  3CRA A;  1YIT V;  1E79 G;  4NTW A;  1SRY A;  1MOF A;  2EIJ B;  3SYA A;  4DR7 O;  2UXD O;  2MW2 B;  3VBB A;  1EBO A;  3OR6 C;  3RYC B;  1HWY A;  3ABM B;  1L0L H;  4DUZ B;  3G80 A;  2QKA A;  3VOU A;  5BXZ A;  4Z2W A;  1FJG O;  2HR3 A;  4PD4 F;  4MVU A;  2WLJ A;  1QR8 A;  3D3Q A;  4I55 A;  3ZJZ A;  1EZJ A;  3N2K B;  1K7D A;  3A8T A;  1ZWI C;  2Q0O C;  4B3R O;  5E1A C;  3LDC A;  4DR5 B;  2EIK B;  4I7Z B;  1IXM A;  2EIM C;  4UCS A;  1R6T A;  1GM7 A;  2Y0P A;  5EZY B;  4PA4 A;  1DGS A;  3G4S V;  5LOV B;  4K3A A;  4UCT A;  2LGQ A;  3SJQ C;  5CA1 B;  1S3J A;  2QM7 A;  3LSQ A;  1MA1 A;  2ILM A;  4ZHQ A;  4OXS A;  2LO1 A;  4LF5 O;  3BVO A;  3H01 A;  1SS3 A;  3KCY A;  3ABL B;  2XAF A;  2XUM A;  2ETN A;  4JV5 B;  1PNK A;  1WPX A;  2Q4P A;  2DYR C;  1M5I A;  2ZXW B;  2A7W A;  3B8M A;  3HKC A;  2Y4U A;  4X62 B;  1TAE A;  5L3D A;  3ZRS A;  1MSD A;  4XDK A;  1BZK A;  3ABT A;  2PTM A;  5JCO A;  2PUS A;  1ZL8 B;  2N04 A;  1VQP V;  2XAJ A;  4LH6 A;  1F4N A;  4DV1 O;  1VIB A;  1XNQ O;  3PJS K;  5H2F Z;  4Q6G A;  5B1A B;  4KXR A;  2GDS A;  4NKG B;  4G27 B;  4OPA A;  2HLD G;  3SPG A;  4LFC O;  1ZLZ A;  3K0D A;  1X59 A;  2F4V O;  1AIL A;  2YC0 A;  5IYZ A;  3IC7 A;  3BEH A;  2Q6A A;  4YJ3 A;  3CRR A;  1SQF A;  4JI0 O;  4X20 B;  2PI5 A;  2VWJ A;  1GK9 A;  4DV5 B;  5H9C A;  4GKK B;  5KHJ A;  5JJN B;  2P6J A;  5IWA B;  4JAV A;  4LF8 O;  4UCR A;  3OEE G;  4JAS A;  4YJ2 A;  1MZF A;  2NR5 A;  4JI5 O;  2KKW A;  2WLI A;  1M90 W;  3FAV A;  4YXW G;  5L3B A;  2WA3 A;  4GX1 A;  3LDD A;  4EFE A;  2WLH A;  3DTU B;  4MVQ A;  1RM1 B;  3AK2 A;  3CJH A;  4X64 O;  3K3W A;  2ZE5 A;  1VAR A;  2KSD A;  1KBH A;  4U3F H;  3B40 A;  4Q20 A;  3T1H B;  3I55 V;  1HNX B;  4XDL A;  1FXH A;  2KG7 A;  4DV4 B;  2AHZ A;  1YZB A;  5IE9 A;  1AP5 A;  4H44 B;  1OCO B;  3G71 V;  1JA8 A;  1NKD A;  3ETD A;  1AJQ A;  5KHG A;  1GKF A;  1XMO O;  1K3E A;  5B1O A;  1HW7 A;  1WA8 B;  1PNM A;  4MTO A;  3CX5 F;  4ZIB A;  3LNN A;  3CRQ A;  1XMQ B;  1L1F A;  4EEQ A;  2GTA A;  1UPG A;  3J80 N;  5GON B;  2ZIN A;  3OUS A;  3O9O A;  1Q6U A;  3JAL B;  4DW1 A;  1N33 B;  1P4R A;  2JDI G;  3O65 A;  4X65 O;  3B8N A;  1VF5 B;  4IHJ B;  3BY6 A;  5FNV B;  4QIW F;  4DYL A;  1JJ2 U;  4LFB O;  2DW4 A;  3RN4 A;  3UCS C;  1XRE A;  1W0K G;  5EC2 C;  2P67 A;  1JOY A;  4JPR A;  5EBL C;  5LA6 B;  4DK0 A;  4DR6 O;  1P49 A;  2NNU A;  4MS2 A;  3AG3 C;  2UXB B;  2ATK C;  3UT5 A;  1X4T A;  1OCZ B;  2ZIM A;  5B3S C;  4XDJ A;  5ITZ B;  2V7Q G;  1F7Y A;  1FXK A;  2RN9 A;  2IH1 C;  4JI2 B;  1SA0 B;  2V4D A;  4X9Q A;  5LGN A;  1IBL B;  4DR2 B;  4RO2 A;  4FLY A;  4KL1 A;  2ODM A;  4DR4 O;  1SET A;  2GSM B;  2BTO A;  1B04 A;  5KAF Z;  2ZE6 A;  2UUB B;  4YY3 O;  3TJT A;  3L73 H;  3WU2 Z;  4U7O A;  1GMG A;  5JH7 A;  2YIA A;  4D7S A;  4DV7 B;  2BOB C;  5JCO C;  1GN6 A;  3OFN G;  4UCU A;  3C3T A;  5LYJ A;  1SQQ H;  2X7R B;  4DR7 B;  1H8H G;  2UXD B;  1M9N A;  1JFF A;  4EKW A;  5IJ0 B;  1V55 C;  1NH2 B;  1FJG B;  3S3W A;  1LR1 A;  2BTQ A;  2CDY A;  1BHA A;  2HG5 C;  1QBZ A;  4CS3 A;  1YVW A;  2YIB D;  3K5N A;  1Y4M A;  3CYO A;  5L3E A;  1K8A W;  1HNW O;  3E83 A;  4B3R B;  2CTQ A;  2EIM B;  3A0R A;  5CBH A;  1US6 A;  1BCC H;  2YIC A;  3A0H Z;  5BMV B;  1J5E B;  4D6T H;  5HFM A;  4O2B B;  4O2A B;  3I5D A;  4PDR A;  3D36 A;  2HEP A;  5C8Y A;  4LWS A;  1FYJ A;  3NR7 A;  1S72 V;  1VEW A;  2QKC A;  1PV0 A;  4HYO A;  1HR0 B;  4A5U B;  4K8X A;  1BL8 A;  3B09 A;  4YHH O;  1K97 A;  2FB5 A;  4KP4 A;  1VF6 C;  3FD9 A;  3ZMU A;  4JI8 O;  4G2K A;  4LF6 B;  2GBO A;  4ZI7 A;  3K0G A;  1BT8 A;  4TOI A;  3T4D A;  4FFK A;  2Z3Y A;  3CCJ V;  1E1Q G;  1BQ0 A;  3JAK B;  2XND G;  1Q3E A;  1QLE C;  2RQ6 A;  1H38 A;  2DWD C;  2LFR A;  2B9Z A;  1YJN V;  3HKD A;  3KCX A;  5K1X A;  4UCO A;  5LP6 A;  4I50 A;  4P2Z A;  1PKX A;  2OIG A;  3OTO O;  2HKO A;  4BAY A;  4PHZ A;  4WFB V;  5KLV H;  4IYI A;  4DV1 B;  1YSC A;  2XAQ A;  1XNQ B;  1GRJ A;  1MSW D;  1P7B A;  2EIL C;  1IZ3 A;  1SES A;  1S76 D;  3RYH B;  3HB3 B;  1VP7 A;  3K04 A;  2B1G A;  4LFC B;  4GX5 A;  3CS5 A;  2WLL B;  4CH4 A;  1UJW B;  3HKB B;  3OMA B;  2OTJ V;  4DV3 O;  4JI0 B;  4JTD B;  2UUA O;  4O4H B;  5JQG B;  3B2E E;  4UXN A;  1FKA O;  3APO A;  1HNZ B;  4K0K O;  4UB8 Z;  4TWK A;  4LF8 B;  1UFI A;  4F6R A;  4BWA A;  3FX7 A;  1G4Y B;  2DMX A;  3E8H A;  1N4C A;  5LMU B;  2LJ2 A;  3OT7 A;  4AQY O;  3RYF A;  2YEV B;  1I94 B;  4LH7 A;  4EB6 A;  2PI4 A;  2CGN A;  4ZOL B;  4QE9 A;  1FXK C;  2Q9L A;  3ZMS A;  2OYQ A;  1NR7 A;  3R66 A;  3QTC A;  2EIN C;  2XOK G;  5KMG B;  1TUB B;  4FLW A;  4GKJ O;  3OEH G;  3JAS B;  4JI3 O;  2UU9 B;  2ZNJ A;  1EZV H;  3H1J H;  3A2F A;  4LNU B;  1K34 A;  1R6K A;  4L87 A;  4NTY A;  3CCR V;  2ZCE A;  5EIB C;  3CC4 V;  4YIP A;  1NI8 A;  1XMO B;  5EK0 A;  1IBM O;  1Q6H A;  3IGA C;  2CUG A;  2RMK B;  4B08 A;  1WLE A;  4FLZ A;  5B5E Z;  4DR1 O;  2P4K A;  2CTP A;  1WAZ A;  3K59 A;  5IYD O;  2QWQ B;  1OCR C;  4B7E A;  4JYA B;  5FLX N;  1ORQ C;  3BRC A;  1N34 O;  4UVA A;  3K5O A;  2WLM A;  2HVK C;  1NZ6 A;  3VQY A;  4GT1 A;  1KP3 A;  4X65 B;  5JVD A;  2Q8V A;  1XQ8 A;  5BR8 O;  3VQW A;  1P84 F;  3D36 C;  4LFB B;  4CH6 A;  1Q5O A;  1NBM G;  4MVR A;  1K5Q A;  4O4L A;  3U10 A;  4QNH B;  3AG3 B;  3JD3 A;  4NB5 A;  4PDM A;  5B3S B;  2VQF O;  4DR6 B;  2AZ2 A;  4LBE C;  2Q7G A;  4JI6 O;  1G8M A;  2DQ3 A;  3SYC A;  1I08 A;  1SQP H;  4JI1 B;  1VQM V;  1XNR O;  1QCE A;  2IU0 A;  3K5M A;  1OV9 A;  2GUZ B;  1PL0 A;  4GZR B;  4X1I B;  2F1M A;  1Y6X A;  2F95 B;  4BW9 A;  2VQE O;  3HKC B;  5JJE B;  5EBW C;  4AIL C;  4DR4 B;  2A0L A;  2WA4 A;  1K4D C;  2P06 A;  2OCC C;  1CPY A;  3X2Q C;  3I56 V;  2ZE8 A;  1NH2 D;  3HR0 A;  4X66 O;  5DED A;  3TXS A;  5CBG A;  4X1K A;  4PEL A;  3MDS A;  4O4I A;  5BZB A;  4LF4 B;  3G6B A;  3JCU Z;  2QWR B;  2PGG A;  1V55 B;  2QE7 G;  3N27 A;  4J7K A;  5LL6 Y;  3G67 A;  2W0F C;  5DM6 V;  5LHG A;  3SDL A;  2E3C A;  5E79 Z;  3ZHR A;  3K79 A;  4CC5 A;  1XHX A;  1OCC C;  3SYP A;  1G6U A;  1IBK O;  5GTH Z;  4HNA A;  4Z1V A;  4DV6 B;  1IVS A;  4TSF G;  3CB2 A;  4TV8 B;  4FK5 C;  3CCE V;  1K5S A;  3ZRW A;  3GWK C;  4YJ2 B;  3OAA G;  5KHI A;  3FYI B;  1OJH A;  2JJ2 G;  4JGS A;  1URF A;  2WLI B;  2OCH A;  5CBF A;  3VQV A;  3QNE A;  3ZCC A;  1IX9 A;  1VQK V;  1S5J A;  1TVK B;  2BSK A;  4CH3 A;  4YHH B;  5KX5 A;  1R73 A;  2QTS A;  3ICX A;  1D5N A;  3ETE A;  3RYI A;  4JZ2 A;  5CB4 B;  3S3X A;  1SKV A;  1QLE B;  1GTO A;  2YDE A;  3BA9 A;  2KG7 B;  3A0B Z;  4QJF B;  3ASN C;  4UVC A;  4LF7 O;  1FXV A;  5LGT A;  1DF4 A;  2Q68 A;  2YSU B;  4MVM A;  2FYU H;  4DUY B;  1YCI A;  1KYO F;  4JI4 B;  5EBM C;  3Q4H B;  4MTF A;  4UV8 A;  1S77 D;  4WBN A;  3UM7 A;  4QE7 A;  1Q82 W;  2QM8 A;  5EYP A;  3SYO A;  1WP7 A;  3ZHQ A;  2XAS A;  1FFT B;  2ZT9 B;  2EIL B;  4FFB A;  4GYC B;  4B3S O;  1Y67 A;  4XBF A;  4TQF A;  3L70 H;  3JAT A;  5IYB O;  2DQ0 A;  2X6A A;  2CH7 B;  3SJA C;  4I9W A;  2RJZ A;  4PA7 A;  4AHC A;  1AJP A;  3E8F A;  2E5L O;  1AVM A;  4DV3 B;  1J95 A;  3IAY A;  1QNM A;  4PJ0 Z;  3ZMV A;  1SQB H;  4FLU A;  3OGC C;  4CH5 A;  4K0K B;  3AEI A;  5LHI A;  3U11 A;  4IIJ A;  4TV9 B;  2YUA A;  3RFR A;  5J2U A;  3CCQ V;  2HJD A;  4UFZ A;  4LP8 A;  1BMF G;  1AI5 A;  1FXK B;  4UCV A;  4AQY B;  2A9H A;  2A3Q A;  3T1C A;  1ZSP A;  2EIN B;  4L8J A;  3CRC A;  3QG5 A;  2M7W A;  3SPI A;  1TUE B;  4J80 A;  3W7X A;  1D2D A;  2MK3 A;  5FPR A;  3HKE B;  4JI3 B;  1GAX A;  1ZAU A;  3CCS V;  2YXL A;  4EFB A;  3RYC A;  3JD0 A;  1K73 W;  2VWK A;  1DTO A;  5H6R A;  5LYJ B;  2HHH O;  3JAW B;  4JI7 O;  1NQT A;  2ZR2 A;  1M1K W;  1JFF B;  4JAU A;  2IJI A;  2P7T C;  3RVZ A;  3PN1 A;  2QM4 A;  1IBM B;  4LFA O;  1VQ9 V;  5AG2 A;  5LMN O;  4LF9 O;  3QO8 A;  1OCR B;  1GH6 A;  4ASU G;  4DXW A;  4D7T A;  3OR7 C;  4RQF A;  3T1Y B;  3ABK C;  4I9Q A;  4DW0 A;  1N34 B;  3M99 B;  2YIB A;  4Z1M G;  1L0N H;  4KHP O;  5C8Y B;  4LWS B;  1W0J G;  3BAA A;  3SPH A;  5BR8 B;  2WAM A;  1VMG A;  3N2G A;  4F4L A;  1K4C C;  3H9V A;  4FM2 A;  4H13 B;  4O4J A;  1R1B A;  2Q73 A;  3QO5 A;  1IDS A;  2JEU A;  5A2Q N;  3OD4 A;  2UUC O;  1T5E A;  3DGE A;  3CD6 V;  4NXM O;  2L35 A;  4W4L A;  1M93 A;  1N8R W;  2AHY A;  4DR3 B;  2VQE B;  2XTA A;  4MW8 A;  2DOS A;  2WPD G;  5CA0 A;  2OCC B;  4B3M B;  3X2Q B;  1ZL8 A;  1Q81 W;  3OGI B;  1SER A;  3U0Z A;  3RGB A;  2B5U A;  4X66 B;  5TIS Z;  2RDC A;  4PV1 B;  3CSX A;  4JF3 A;  1KKD A;  5B1B C;  3P32 A;  1OZ0 A;  3H1L H;  4ABM A;  2E74 B;  4B7K A;  2IJK A;  4H37 A;  1G1X B;  3CRM A;  3ASO C;  4U3J B;  2D2C B;  3WB2 A;  1JPX A;  1OCC B;  1ENV A;  5GTI Z;  4OPH A;  4I4T B;  2HVJ C;  4K8Z A;  1RFY A;  2ZDI A;  3CC7 V;  1ZUQ A;  4DV0 O;  4F6R B;  1R3K C;  3OTF A;  2FTK A;  2CGO A;  1GN2 A;  3L71 H;  1AB3 A;  3UQ8 A;  1QU7 A;  4RUE A;  1AI4 A;  3OM3 B;  1AP6 A;  1FFX B;  3AG1 C;  4EB6 B;  1BQZ A;  1SZT A;  2EZO A;  2QJ1 A;  3JCZ A;  3E86 A;  2EX3 A;  3ETG A;  1YF2 A;  1WB8 A;  3LSU A;  3ASN B;  5JJJ B;  4PDV A;  4DRX B;  1BGY H;  1CP9 A;  2X6C A;  4WCE V;  2JVD A;  2IW5 A;  4LF5 B;  4KFM A;  2PZS A;  1AJN A;  1ROP A;  5D5Q A;  1WA8 A;  3MHS C;  4HZ3 A;  3BHP A;  2RCV A;  3OUF A;  1VQ8 V;  4CBC A;  3K9A A;  3G6E V;  2QSA A;  4CC6 A;  1R3L C;  2GHY A;  3JAL A;  4B3S B;  4I0X A;  2E75 B;  2HP8 A;  4RWU A;  1I5X A;  1NS1 A;  4IHJ A;  3CME V;  1BSM A;  2QTO A;  5FPO A;  2IM9 A;  3LSS A;  1CEZ A;  3LNM B;  4G28 B;  5JVD B;  2LW7 A;  1QQC A;  1ZX3 A;  2JGD A;  1XUQ A;  1KKC A;  2P90 A;  2XT9 A;  5ITZ A;  2F4V B;  1B06 A;  1SA0 A;  1Q7Y W;  1IXB A;  2YI8 A;  2K9P A;  3L74 H;  2F43 G;  4X62 O;  1GO3 F;  4X1Y A;  5EIB D;  3DXR A;  1SC5 B;  1RPR A;  5L3F A;  3AG2 C;  3SPJ A;  1Y74 B;  3TXQ A;  1BE3 H;  3IJ4 A;  5LXT A;  1XEQ A;  3JD2 A;  1VQ7 V;  4PI0 A;  3K5L A;  4JI5 B;  4X1K B;  1N32 O;  2AGA A;  1SQG A;  2F23 A;  3WFV A;  2R9R B;  3CC2 V;  3BA8 A;  4UVB A;  1ARO P;  2HHH B;  5IJ0 A;  4PA9 A;  4JI7 B;  1V54 C;  4QGP A;  1Z5W A;  3P3P A;  4X64 B;  3F7Y C;  2Q67 A;  2P22 C;  1F4M A;  3SJC C;  2IJJ A;  4JTC B;  2R9A A;  2ZE7 A;  1U96 A;  5LMN B;  4F6E A;  3K57 A;  3ABK B;  1XDC A;  3R65 A;  4GKK O;  5BMV A;  1Y66 A;  1JCH A;  1XOU A;  3CHX A;  4O2B A;  4MVO A;  1LUV A;  1YHQ V;  2QR4 A;  4N23 A;  4R6Z A;  4HNA B;  2L6L A;  1MZE A;  3SJB C;  2Z5U A;  3FB8 C;  3BPZ A;  3M7M X;  1VQ6 V;  4TUY A;  1YJW V;  1QHT A;  1XL6 A;  1GM9 A;  1VQO V;  3CCM V;  2ZDI C;  2CTW A;  4I55 B;  1EN5 A;  3ZHU A;  2LP7 A;  3BAB A;  2DYS C;  3MAQ A;  2WWW A;  3TGU H;  2WLK A;  4GCZ A;  5C93 A;  2N05 A;  1RPO A;  2BSK B;  2YI9 A;  2XHB A;  4LR3 A;  1K9M W;  2HFE C;  5KX5 B;  3JAM N;  1PPJ H;  3T1H O;  1KEC A;  1Q6I A;  2JEX A;  3WG7 C;  1HNX O;  1XI1 A;  3JAK A;  3RYI B;  4DV4 O;  4NXM B;  4N21 A;  3FB6 C;  2YID A;  1ZTE A;  2LGW A;  1H2N A;  2EJR A;  4ZHQ B;  5D5P A;  4FIP C;  4OGQ B;  1Q90 D;  4LC1 A;  5FL7 G;  2ZM6 O;  1PL4 A;  4YIO A;  1AI7 A;  2AW9 A;  2C2A A;  5KHH A;  2H8P C;  5EYP B;  4AI8 A;  2EBO A;  2YS8 A;  1M56 C;  1Z5V A;  1XMQ O;  1JR9 A;  4IYH A;  5B1B B;  2Q0A A;  4JAA A;  2NN4 A;  4MVS A;  3RYH A;  1F23 A;  3E8G A;  2AZ0 A;  1N33 O;  1AR5 A;  3CP1 A;  1Y76 A;  3RWR D;  3AG7 A;  3SR2 C;  1KC8 W;  4TT3 G;  3ASO B;  4B3T O;  4MT8 A;  1AR1 B;  2WLL A;  4WFA V;  4YY3 B;  3HKB A;  2VRZ A;  5A9G A;  5LP6 C;  5L3G A;  1NVP B;  1KMI Z;  5F2V O;  4O4H A;  4ZKI A;  2K1E A;  4JYY A;  4R8C A;  5JQG A;  3CXC U;  2Z0A A;  4FM0 A;  1VQL V;  2UXB O;  3DC6 A;  5J2T A;  1P7G A;  1YEW A;  4FVM A;  2ARH A;  1SQX H;  3DSQ A;  1NJI W;  1WNS A;  2W0X A;  2ADP A;  4JI2 O;  2QEX V;  2YEV A;  4R50 A;  5IYZ B;  3AG1 B;  4YJ3 B;  3TCU A;  1HNW B;  1EFR G;  3RVY A;  3QVN A;  2B1I A;  5KMG A;  1TUB A;  4C7U A;  1N36 O;  3JAS A;  4HAM A;  1R3J C;  1I5Y A;  2JS3 A;  3IC9 A;  4DV7 O;  4J10 A;  1W2B U;  4LNU A;  4PA6 A;  2G38 A;  3FAV B;  4NXN O;  4K35 A;  3ZHT A;  4JI8 B;  2UXC O;  1OHH G;  3CJH B;  3JD4 A;  2UXX A;  4J7Z A;  3K58 A;  1SZX A;  3JYC A;  2PYL A;  1SQV H;  1J5E O;  1H2M A;  2XAH A;  2Q69 A;  5H6Q A;  1S5H C;  3GVM A;  3K9S A;  2ZNI A;  4MW3 A;  2R9I A;  2W6J G;  4JTA B;  1AI6 A;  3AK3 A;  4BR6 A;  5DN6 G;  3OTO B;  3K03 A;  3L75 H;  3B77 A;  4IGG A;  1NT2 B;  3CPW U;  1HR0 O;  1Z2G A;  1COW G;  3QO7 A;  1Q43 A;  3B4S A;  5K1P A;  2CTR A;  3N2G B;  1VQN V;  2WSS G;  5KAI Z;  1NTZ H;  4LF6 O;  4O4J B;  3THO A;  2KQX A;  3T4Z A;  1M57 C;  3ZBH A;  2VS0 A;  1YTF B;  2GUZ A;  4X1I A;  2E76 B;  5LBQ A;  5B1N A;  5J9P C;  1YI2 V;  2ZD9 A;  1N0J A;  1CXZ B;  4PI2 A;  3OMN B;  5IJ9 A;  2UUA B;  3KKY A;  4JYB A;  2WLN A;  3AG2 B;  1K92 A;  1WN7 A;  1B6Q A;  1JX9 A;  5CA0 B;  1RSO A;  4PA3 A;  4FLT A;  4MTG A;  3E22 A;  3UT5 B;  3JAR A;  2DJV A;  4MSW C;  4DV2 O;  3ZED A;  3CWB H;  1N32 B;  1V54 B;  3W7T A;  2Y4T A;  1PM9 A;  2X6B A;  3JSL A;  3SGI A;  4OX9 O;  3J7A U;  1H2L A;  4FZ1 A;  2R70 A;  2Q7E A;  4X88 A;  3WB0 A;  2Y0I A;  5KA5 A;  2Q5Z A;  2JK5 C;  4GKJ B;  5JH7 B;  3LUT B;  2QKS A;  5B66 Z;  4JYC A;  3ZN1 A;  1WP8 A;  3JD1 A;  1H2G A;  1HNZ O;  4TV8 A;  3LDE A;  4E4E A;  1L8D A;  4J41 A;  5IDJ A;  1IUR A;  1Q86 W;  1VF7 A;  3GWO A;  3ZHV A;  2FL4 A;  4IT5 A;  5LMU O;  4RUF A;  3N2K A;  1SF9 A;  2BTQ B;  2OT5 A;  2DYS B;  3L72 H;  1VF6 A;  3TET A;  2OIE A;  4LCU C;  1I94 O;  4DR1 B;  1EM1 A;  4H0L B;  1GN3 A;  4CZZ A;  1H2K A;  1TVK A;  3TK1 A;  2YXY A;  2BOC C;  3ML0 A;  4H33 A;  3D8C A;  5EZY A;  1H8E G;  2W6I G;  3WG7 B;  2HJF C;  5LOV A;  3FFQ A;  2XAG A;  5CB4 A;  2UU9 O;  5CA1 A;  2O57 A;  3MHH C;  2IJH A;  4CS4 A;  5IY5 C;  1TGO A;  3RT3 C;  1JVM A;  4FPP A;  3ZRV A;  4WFG A;  3Q4H A;  4PDL A;  2F93 B;  4KUM A;  2JJ1 G;  2ITD C;  2CAZ C;  1EN6 A;  2VQF B;  3GB7 C;  2ZM6 B;  1M56 B;  2RNB A;  4ZI7 B;  3W7S A;  4JI6 B;  3BCC H;  2IBZ H;  1XNR B;  2LFS A;  3E89 A;  4JYA O;  5KUM A;  1FPO A;  1WJZ A;  3FYE B;  1NVP D;  3C3S A;  5LHH A;  1KB9 F;  4I0X B;  1GN4 A;  3EFF K;  3HKD B;  4ICG A;  5IT9 N;  4B3T B;  2CH7 A;  5LP6 B;  4I50 B;  3UO3 A;  4P9O A;  2OTL V;  3ETQ A;  5HFL A;  5BY1 A;  1S5L Z;  4MVZ A;  3FB7 C;  2ZIO A;  4FM1 A;  4WFE A;  3AG4 C;  4FJC C;  1YIJ V;  3M8A A;  4GLX A;  1Q8I A;  2BE3 A;  4TV9 A;  2JGD B;  2QDO A;  1LUW A;  1KU9 A;  1D5A A;  3KG2 A;  4JI1 O;  1EN4 A;  3CMA V;  3OMI B;  1YDX A;  4X20 A;  2ZKO A;  5KHK A;  1HDJ A;  4X8A A;  5GW7 A;  5IYC O;  4X1Y B;  2PY5 A;  1YXB A;  1KP2 A;  1IBK B;  3H1K H;  5H5N A;  2EUL A;  3DXR B;  1QR9 A;  1N36 B;  3HKE A;  1WB7 A;  4QPJ A;  1M4U A;  4LF4 O;  4W4K A;  5LXT B;  2ZR3 A;  1RP3 B;  3JAW A;  2LQT A;  2Y69 C;  1O9H A;  4UUJ C;  4QPK A;  3RYF B;  2JIZ G;  1V9P A;  4WFH A;  4NXN B;  3UO2 A;  4J42 A;  4RQE A;  2QA4 V;  1NR1 A;  3C90 A;  2UXC B;  3CE2 A;  1I7F A;  1VQ4 V;  3ZRX A;  3OE7 G;  3MD0 A;  1KUQ A;  3ZIA G;  1AR4 A;  3E2E A;  2CE4 A;  4DUZ O;  4BIZ A;  4LF7 B;  2EIJ C;  4DV6 O;  1W59 A;  2V1D A;  3K08 A;  1PP9 H;  2QWP B;  3ABM C;  3E8B A;  5EC1 C;  4NYK A;  3DC5 A;  4TUY B;  3JSN A;  1DK1 A;  1YTF D;  1FS0 G;  3H1H H;  4DR5 O;  5GON A;  1TA8 A;  1MG1 A;  1F51 A;  4NVP A;  3CEI A;  3P30 A;  2EIK C;  1JMK C;  1M57 B;  1B3Q A;  2DYR B;  2ITC C;  2CK3 G;  4I5S A;  5FNV A; 
#chains in the Genus database with same CATH homology
 5H2F Z;  5B66 Z;  5KAF Z;  3WU2 Z;  3KZI Z;  4PJ0 Z;  4IL6 Z;  3A0B Z;  2AXT Z;  1S5L Z;  5E79 Z;  4UB8 Z;  5KAI Z;  5TIS Z;  5GTI Z;  4UB6 Z;  3A0H Z;  3JCU Z;  5B5E Z;  5GTH Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...