2AXTZ

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 2axtZ00
1S5LZ 5E79Z 5KAIZ 5TISZ 5H2FZ 4UB8Z 4PJ0Z 4UB6Z 3WU2Z 5B5EZ 5KAFZ 3A0BZ 5GTHZ 3JCUZ 2AXTZ 3A0HZ 5GTIZ 5B66Z 3KZIZ 4IL6Z
chains in the Genus database with same CATH superfamily
2W6JG 2B5UA 5KAIZ 4XDLA 5GONB 4FZ1A 4DRXA 3FD9A 4DV3O 1K34A 4B7KA 4MTGA 2XT9A 1GAXA 4Z1VA 5JWPA 4EFEA 3L74H 4BWAA 3LSQA 3L73H 2BSKB 3H1KH 3JAKB 1MMMA 2EILB 3TXSA 4U3FH 3JD4A 4ZBMA 3ZEDA 2EIMC 5L3BA 1FFXA 3OTOO 2HHHB 2NN4A 3HKDA 4YHHO 2ZM6B 2ZR2A 2AZ0A 1X4TA 2Y0IA 4F6RB 1K33A 4BIUA 5CN0A 4X64B 3ZRXA 4NXMB 3GWOA 3B77A 5DECA 3UKMA 3G4SV 1AVMA 3CE2A 3C3TA 3B8NA 3DSQA 4RWUA 1MSDA 3D36A 2KG7A 4WBNA 5EZYA 4DUYO 4LF4B 3OUSA 1CPYA 1N32B 2ZT9B 2M6YA 2VQEB 1XMQO 1I7FA 2F93B 1WPXA 4DV7B 1KU9A 3JALB 4BAYA 4DK0A 5ITZB 4I5SA 3CJHA 2WA4A 2AHYA 1Q43A 2XAGA 2FTKA 3E35A 4FFKA 1S5JA 2P7TC 2FYUH 2V1DA 1SF9A 3ZBHA 1R3IC 3ABLC 3ETDA 1OZ0A 3SDLA 3JARB 1XMQB 3P32A 1PNLA 5CA0B 3W7WA 5LGNA 4GCZA 1M90W 4IIJA 1KMIZ 1N4CA 1CXZB 5KHJA 4HYOA 3W7UA 3OEHG 4ZIBA 2K9PA 3BPZA 2C2AA 5HFLA 1V55B 5IWAO 4KHPO 1FXKB 2WLHA 1M56B 1TVKB 4FIPC 1S5HC 3ZHUA 5L3GA 2JJ2G 3CCRV 1QNMA 1VQ4V 4I9WA 4JYYA 1SESA 3ZHSA 4CH4A 4JI1B 4LF8O 4IIJB 3FAVB 2ZE5A 1XNQB 2E5LB 1IBMO 1JPXA 4X1KA 4MW8A 4NXMO 4IL6Z 2ZQMA 2Q73A 5JVDB 1VQOV 3AK3A 5KA5A 1K73W 2LP7A 2Q4PA 3FAVA 5IJ9B 2UUCO 3JYCA 2YIBD 1G4YB 2JIZG 4O2BB 4TQDA 4EB6A 3BEHA 3FYIB 3SPGA 3CRMA 3E2EA 2BOBC 1R3KC 4ABMA 5EK0A 4GYCB 5EC1C 2HR3A 3F7YC 4WFHA 2Q7GA 3ZX6A 2JEXA 1YTFB 4JI8B 3B2EE 3FB8C 4B3TO 4PA6A 4JYAO 1MZFA 3M7MX 3K03A 4UCVA 2HJDA 5CA0A 2CTWA 4RUFA 3JATA 1AILA 1G8MA 2E74B 3STZC 5IYDO 4DR3B 2H94A 2GDSA 3SYAA 4DV2O 1SZXA 3CRCA 3J80N 3CHXA 1AP5A 3EFFK 1AR1B 4PA4A 4OGQB 2ADPA 4X8AA 4JI2O 5FL7G 3M8AA 4O2BA 1MSWD 4ZHQA 4LF9O 3CYOA 2M7WA 3T2MA 4D7SA 4TV8A 3VQWA 2A9HA 1UPGA 2PYJA 2UUCB 3K5LA 1FFXB 4G2KA 4LF7O 1VQNV 4X65B 1J5EO 3E89A 1R1BA 2QKSA 2B1IA 1AI7A 4W4LA 2ZM6O 3HR0A 4AQYB 3KCXA 4JI0O 5LYJA 1XMOO 4PI2A 5CMUA 2JGDA 3OGCC 2ZXWC 3P3PA 4J9YB 2KG7B 4WBNB 1HNWO 3FX7A 1QR8A 3SJAC 3JD0A 2ZDIC 4DV0B 4DRXB 1KB9F 2QEXV 1LR1A 2EIKC 1WAZA 4BIOA 5IWAB 2PF4E 5LMNB 4F6RA 3JSLA 5LA6A 4WFAV 1H2SB 2HVJC 1D5AA 1O9HA 2CTPA 4J41A 3C90A 3RW0A 2NNUA 2MK3A 4CZZA 4LH7A 2F43G 3L70H 4DV6O 4UCOA 3AG3B 3UO3A 2WLKA 3KKYA 2QGNA 1ZL8A 1YF2A 2ZR3A 2WPDG 1W2BU 4DYLA 2WLLB 3ZHQA 4PELA 2VQFO 5KX5B 4FM0A 3OW2U 4JV5B 2JEUA 1SERA 1UJWB 3VQXA 2X7RB 4LF6B 4DR2O 3CCVV 2E76B 2LW7A 4JGSA 3WG7B 1VQKV 5L3DA 1COWG 4LFBO 2DYRC 2CTQA 1NR7A 4E4EA 3SYQA 1D5NA 4YY3O 2GTAA 4JI5O 3K5NA 4LNUB 3ZIAG 1EBOA 3RYIB 3JD1A 5IDJA 2QE7G 4NTYA 4Q20A 2OIEA 5HFMA 1VQ6V 4P9PA 4W4KA 1BHAA 4LCUC 1HNXO 1I5XA 2LGWA 2BTQA 3JAWA 2DJVA 1M4UA 5IYZA 4TV8B 4TWKA 1VQLV 1GN4A 2E3CA 3J7AU 1G6UA 1JVMA 1BHBA 1BL8A 4YJ2A 3DC6A 1IZ3A 4J11A 1M57B 2QKCA 3GVMA 3B8MA 2OCCC 1K4CC 5J2UB 3WFVA 2IJKA 2DQ0A 2CH7A 2R9AA 5GTIZ 1K8AW 1F23A 2AW9A 1GN3A 1P84F 3JATB 3ZRSA 4CH6A 4LFBB 3HB3B 2N05A 2WLMA 4J10A 5JH7A 3PJSK 2IW5A 2QM7A 2QWQB 5CBGA 3APQA 2YIBA 4JPRA 2QKAA 1US6A 1UFIA 1YJ9V 2AXTZ 1N0JA 1S77D 5BZBA 2X6BA 3E8HA 1K4DC 4KFMA 1IBKB 4GX0A 2F95B 3H1IH 2OCCB 4YXWG 2DYRB 2VQFB 1S72V 5LHHA 1AI5A 1M1KW 2O57A 2OCHA 2XAJA 1HW7A 1VF5B 4CH5A 4TSFG 5EBWC 1FJGO 4FLWA 1AJNA 4J9ZB 1Y76A 2LJ2A 3CX5F 3W7SA 4LF4O 5JCOA 2WLIA 4JI3O 3SPIA 1FAFA 3CMEV 3B40A 2UXNA 3H01A 3BA8A 4FLTA 1VEWA 3E22A 1KYOF 1SA0A 2B1GA 2EINB 2F66C 4B3MB 4GKKB 3CS5A 4GX5A 2ZE6A 4I50A 3RT3C 4G28B 3JAMN 4FMTA 2DW4A 2UXDO 2EX3A 3HKCB 3OGIB 3RYHB 3N2KA 2JK5C 2EIMB 1K97A 1U97A 2MW2B 4LF5O 4DR3O 2UUAB 3JSNA 1Q81W 2YUAA 1XNRB 2P5OA 4JASA 1QVFU 2LQTA 3H1LH 3A0HZ 3OAAG 2RQ6A 2F4VO 2BCCH 1GRJA 1JOYA 5L3EA 1FPOA 5C8YB 1Q82W 2XTAA 1DLBA 1OCRC 2XNDG 2QM8A 4O4IA 3ZRWB 3L71H 4PDRA 5KMGA 2EBOA 3CC4V 3CWBH 1IVSA 2RJZA 1B3QA 1JJOA 1IBLO 4YJ3A 2OT5A 3SYOA 3OR7C 1V9PA 4YIOA 3UM7A 4B3SO 4DV5O 1QCEA 2KB1A 3ABMC 3UT5A 2RN9A 3CRQA 2ZE8A 3LNMB 3Q4HB 1H2LA 3ZMSA 4U3JA 1H2GA 1KQSU 5LMNO 4J7KA 4DR4B 4GKJB 1F51A 3THOA 3SGIA 4MVQA 2QJ1A 3L9DA 2Z5UA 1N8RW 4JTDB 1OCZB 2A0LA 2F23A 3ZHVA 2ETNA 1YVWA 4NR1A 3A0RA 3D36C 1WP8A 4GT1A 4B7EA 1SQQH 2XAHA 1WN7A 1JFFB 4NB5A 1MZEA 4E2LA 1GM9A 2P90A 2ZXWB 3SR2C 2A3QA 2N74A 1NJIW 1Y66A 2K1EA 3JCUZ 4WCEV 2F1MA 3AG1C 5B1BC 3JAKA 5JCOC 2X0LA 1H2NA 1QLNA 2EIKB 5LP6A 4U7OA 3KZIZ 4DUZO 5LMUO 1XBLA 1XQ8A 4H0LB 4Z2WA 1DK1A 2Y69B 1S76D 4CS2A 3GB7C 4H33A 2YC0A 2DQ3A 2V4DA 3D3QA 3UO2A 3AK1A 2XAQA 4EFBA 1FXVA 4MSWC 4X20B 1JJ2U 3CCUV 1NR1A 5B5EZ 2Q68A 1F7YA 2HP8A 2YIDA 4AHCA 3VQVA 2YEVB 1HP8A 2ITCC 4JAAA 4JZ2A 4MVRA 3ZS8C 2YDEA 4ZI7A 5BMVB 4UB8Z 1L1FA 3BY6A 5FLXN 4UCSA 1OCCB 2F4VB 2KKWA 5LA6B 1N32O 5EIBC 3CXHF 1H2MA 4NXNB 5EYPB 1QQCA 4DUZB 1XL6A 3VOUA 1WA8B 4DO2A 4LR3A 1QLEC 2PGGA 5KHHA 1EN6A 4DV6B 2JRIA 4MVUA 1QLEB 1SQBH 5IY5B 4X64O 2P06A 2WSSG 2LW1A 5KHKA 2PYLA 3ZMVA 4YIPA 2QA4V 3U0ZA 1RSOA 4DR4O 4GKJO 5K1PA 1EZVH 3G6BA 1NU1H 3D8CA 4UUJC 4UCUA 3F5WC 2Y4UA 1JFFA 4QPKA 4UXNA 2WA3A 4P2ZA 2G38A 4PDMA 2Z0AA 4CS3A 3RYCA 1IDSA 5B1OA 1IBKO 1ENVA 1YSCA 4FZ0A 1IBLB 4QPJA 3UCSC 1NH2D 1L8DA 1P7BA 2EIJB 1P7GA 4L87A 4DV5B 1KBHA 3LDDA 1U96A 2RMKB 5JH7B 2QWOB 4LFAO 4RO2A 5TISZ 4Q6GA 3QVNA 4NKGB 2EZPA 1SZTA 3CB2A 1Q3EA 1ZLZA 4JI4B 2HVKC 1ROPA 4MVZA 3ZMUA 1TA8A 5KUKA 4X62B 2XHBA 1SETA 1TUEB 5KLVH 2OIGA 4PDLA 5C93A 3LNNA 3CC7V 4JZGA 1FFTB 4ASUG 2ZD9A 4O4IB 3W7TA 3RFRA 1XL4A 4QE7A 1THZA 1NZ6A 1YJWV 4IYIA 4JTCB 1YZBA 1KKCA 1R6KA 2EJRA 2Q6AA 4IYHA 4KL1A 1VQ9V 4X1KB 2WLIB 2Y48A 4A5UB 1MOFA 2GV9A 2W6IG 1TUBA 3ZRVA 1GH6A 2IM9A 1GN6A 4DW0A 4JI0B 4LWSB 4X1YA 2GHYA 1V54C 1GN2A 1N34B 3HKBA 1FD9A 4X89A 4DR1B 3BRCA 5FPOA 3K08A 5B1NA 3UQ8A 4MVOA 5FNVA 5H6RA 4LF8B 1YEWA 3E22B 2YI8A 2R9RB 1VQ7V 4N23A 3CXCU 3T1CA 4YJ3B 2CUGA 3K58A 3B09A 5BR8O 3K04A 4ICGA 3CCQV 1ZSPA 1FYJA 4B08A 4GX1A 3FKSG 3ZN1A 4DV1B 3BVOA 1KKDA 3CJHB 4FFBA 1FS0G 3WB0A 1XEQA 3STLC 3ML0A 4LWSA 4O2AA 2EZOA 1AJQA 1VMGA 1N33B 1XNRO 2XASA 2Q7HA 3RYFB 3AG3C 2QM4A 1BS3A 2P4VA 2PI5A 4K8XA 1XMOB 1EFRG 1QBZA 2LFRA 5B1BB 3SJQC 2ILMA 2YXHA 1S0VA 3F5TA 4LBEC 3DXRB 1YJNV 2FB5A 3FB6C 3TGUH 4FK5C 1AI6A 3ETQA 5EBMC 1K3EA 2IH1C 3IFXA 4H13B 1E1QG 3DTUB 2WLLA 4I7ZB 5LHGA 4XDKA 4O4HA 2YI9A 3CPWU 4PHZA 4JYBA 3ASOB 2JJ1G 2DYSC 5LP6C 3K5OA 4X62O 3BCCH 1Y76B 4ZOLA 4B3SB 2RCVA 3ASOC 4LNUA 2LFSA 2WLNA 4IGGA 4CH3A 4R6ZA 2XOKG 1YDXA 4CC6A 1V54B 1WB8A 3X2QB 3BABA 1FJGB 1HDJA 1T5EA 3K3WA 3T1YO 1HNZB 4MVMA 4TUYA 5GTHZ 4DV1O 4X20A 1ORQC 2P6JA 1BSMA 3AG1B 4PI0A 1N36O 2V7QG 4LH6A 3SYPA 2PY5A 4J80A 3VQYA 3E8BA 3OFNG 3I55V 2RNBA 1OCRB 1MG1A 5BR8B 2JS5A 4JI8O 1XILA 2A06H 4IHJB 4FJCC 1SC5B 5LYJB 2IH3C 4XBFA 2EINC 1F4MA 3B4SA 3RVZA 4OX9B 4DR1O 4DV4B 2CTRA 2Q69A 4X65O 1J5EB 4MVSA 3HKBB 2NLJC 1Y74A 1NI8A 2QWRB 2YICA 4PD4F 4HBNA 3U11A 4O4LB 1VP7A 3AK2A 3F7VC 3NR7A 2JDIG 5EYPA 1M56C 4X66B 3RYIA 3N27A 3CMAV 2JGDB 4PJ0Z 1BMFG 3RGBA 2HFEC 3L72H 4DR5B 4I4TA 3QTCA 2NR5A 5H9CA 2D3OW 3LDCA 3FB7C 1NH2B 3K5MA 2A79B 4WFFA 2UUAO 3A0BZ 5BXZA 1GTOA 1F4NA 1X59A 3EXAA 2ATKC 3O9OA 1NTMH 5GW7A 1V55C 4N21A 3SJCC 4MTXA 2GUZA 4OXSA 3QNEA 3WG7C 4ZKIA 1YXBA 1VQMV 3M99B 1SS3A 4JI7B 3K57A 4P9OA 4GX2A 3LUTB 5IJ0A 1HNXB 2FKXA 2EILC 3CC2V 5IYBO 1PM9A 1VF6A 3OUFA 4PA7A 3OTFA 4WF9V 1GM8A 1TVKA 3AG4B 2QTOA 5LMUB 5JJJB 4UCRA 2CGNA 4G27B 4JYCA 1BZKA 3HPLC 1PNKA 4UV9A 4EKWA 5F2VO 3BFRA 4U3JB 4YY3B 1WJZA 4GUNA 2Y0PA 3TXQA 3OR6C 2AZ2A 1XDCA 4JV5O 3N2GB 3OT7A 5KA6A 3CCJV 4DV4O 5J2TB 4LF6O 4X1IA 2WAMA 2PI4A 3WU2Z 1SQXH 2OYQA 2UUBB 1NKDA 5LBQA 1H8EG 1WA8A 1XOUA 5C8YA 1HNZO 1N33O 1QHTA 2UU9O 3DC5A 5ITZA 5BY1A 1VF6C 3CD6V 2Q9LA 3H1JH 2QR4A 4DV2B 2ZIOA 4ZI7B 1WP7A 5BMVA 2UUBO 3CCEV 1AR4A 4HZ3A 3JARA 3E86A 2Q0OC 4RQEA 1Y4MA 4CC5A 2AGAA 4O4LA 4KP4A 4LFCO 1PL0A 2QDOA 2WLJA 2QWNB 4CS4A 4U7NA 1JR9A 2OWOA 3TETA 5K1XA 3S3WA 3AEIA 4MTFA 5CB4A 2BTQB 3G80A 4AQYO 3WB1A 1GMGA 1ZWIC 2CK3G 3ASNC 2ZNIA 1N34O 3DXRA 5A2QN 3ZCCA 1ZUQA 2ZIMA 5DEDA 1H8HG 2Q8VA 5EBLC 2N04A 4Z1MG 1Q5OA 4OPAA 1BGYH 3EVKA 2KQXA 5LGUA 2JVDA 2PZSA 1FXHA 4FLZA 1ZTEA 1SRYA 1PPJH 1NVPB 1FXKA 1B06A 3AG7A 4GZRB 3P3NA 4FFBB 5AG2A 4FLXA 1I0HA 1KECA 3MHSC 4H44B 1TGOA 3E8GA 1NQTA 4UVBA 4MT8A 1SQVH 1WNSA 3ETGA 3I56V 1ZL8B 4LF5B 4NTXA 3SYCA 4JI4O 1B6QA 3CCLV 1E1RG 1N0NA 3VBBA 1URFA 3K9SA 4FVMA 1I08A 1JA8A 3R66A 1OCOC 4IHJA 1Q6HA 5LL6Y 3FFQA 1LNQA 3G6EV 1XHZA 1PKXA 2DMXA 2XAFA 1MNGA 2BTOA 1VQ5V 3KCYA 1OV9A 2Y4TA 1KUQA 1EN4A 1KP3A 3KG2A 1SKVA 1BE3H 2QTSA 5LP6B 2UXXA 1IXBA 1XHXA 1L0LH 2L35A 1SQPH 3RWRD 3A8TA 2QWPB 1DGSA 3JALA 1R3JC 1P49A 2DOSA 4I4TB 5E79Z 4DK1A 4I55B 3H1HH 1M5IA 3PN1A 2E5LO 4J7JA 3SPJA 5EZYB 2FMLA 3K06A 2Q67A 1NBMG 3OMIB 2UXDB 3HKCA 1B04A 3K0DA 4OX9O 2JGUA 3ZJZA 3OTOB 3AG2B 4TOIA 5B1AC 5IYCO 4JI7O 3K9AA 2GBOA 1I5YA 1QVGU 2VRZA 2ZINA 1I94B 4QNHB 5JJNB 3I5DA 4FLYA 4UVCA 3CSXA 3UT5B 4TQFA 1TAEA 4MTOA 2HG5C 2DWDC 3CP1A 3CEIA 2B9ZA 1P4RA 5DM6V 1NTKH 1N36B 3TK1A 1AR5A 1GO3F 4AILC 1NVPD 1H2KA 1RM1C 2IJIA 1OJHA 5KHGA 2H8PC 1DF5A 3MDSA 5KAFZ 1PD3A 3NXSA 4LP8A 3OEEG 4DV3B 4UCTA 3RN4A 1Q90D 1S5LZ 2A7WA 4UFZA 3RYCB 4FM1A 1VQPV 1GM7A 1E79G 3CRAA 3LSSA 2OTJV 3G67A 4EB6B 4X66O 2VQEO 4JTAB 5EC2C 1LUVA 1RM1B 5IJ9A 2ADQB 4EEQA 3CCSV 2Q7EA 1ZAUA 3T1HB 1MABG 5JVDA 5J2UA 3DGEA 3IC7A 4GLXA 4O4HB 1H38A 1IXMA 5CB4B 4LF7B 1PNMA 1BCCH 3MHHC 2ZDIA 2R72A 5LHIA 2HHHO 1IURA 4DV0O 1SA0B 3IJ4A 1BQ0A 3JAWB 4DXWA 3A2FA 4JI2B 1Z5VA 4NXNO 3L75H 1BT8A 2Y69C 5IJ0B 2P22C 3ABKB 2CE4A 4KXRA 5B66Z 2UXBO 4JAUA 1VQ8V 4BW5A 1M57C 2JS3A 2R9IA 3MD0A 5E1AC 4LC1A 3ABUA 2GSMB 2X6AA 4UB6Z 2ZNJA 2VWKA 2GUZB 4DV7O 1W59A 4WFGA 3SPHA 4K3AA 1Z2GA 4MS2A 4F4LA 3CCMV 1PP9H 2IBZH 2X6CA 4TT3G 4JF3A 1NT2B 1FXKC 1VIBA 4K0KB 4LFAB 1R3LC 3ZN0A 4NVPA 5LXTA 1RSOB 3D3IA 1L0NH 4JI6B 3HKEB 4HNAB 3OE7G 1NS1A 5KHIA 4YHHB 1W0KG 2DYSB 5FNVB 4UVAA 1ZX3A 5IT9N 3SPCA 3J81N 4DR7B 2YIAA 3G71V 1HWYA 2GTSA 4X1YB 4QIWF 4D7TA 5JJEB 2AHZA 1Q6UA 2YXYA 2P67A 4K8ZA 4QE9A 4DW1A 4R50A 2DWEC 1Y6XA 3HKEA 4X9QA 1HR0O 4F6EA 5LXTB 4PDVA 4B3RO 3OM3B 2UXCO 2IU0A 5D5PA 1JMKC 4J7ZA 1A32A 2BSKA 1YHQV 1XI1A 2YS8A 3ETEA 1XREA 1K9MW 3SJBC 3ZMTA 2H3OA 3APOA 3RBZA 1AP6A 1S3JA 4FLVA 3JASA 2Q5ZA 3OMAB 1EZJA 4UV8A 4K0KO 2BOCC 1JQ0A 1DF4A 3WB2A 2ODMA 4L8JA 2L6LA 4FM2A 5CA1A 1W0JG 4IT5A 2ARHA 3ABTA 3T4DA 5J9PC 2UXCB 2YEVA 3H9VA 1R73A 2EJ7A 2HKOA 2ZCEA 1QU7A 3ABKC 2OTLV 4ZOLB 2PUSA 5L3FA 4KUMA 1YTFD 1J95A 1SQGA 3X2QC 1D2DA 5IY5C 4B3RB 3ZHTA 3BAAA 1Y67A 5H6QA 1Y74B 1M9NA 1EM1A 4X1IB 3FYEB 2ZE7A 3QF7A 4PA3A 3EHBB 1I94O 3QO8A 3N2GA 4HNAA 1OCOB 4DR5O 1OCCC 3ZHRA 1RFYA 1AB3A 4NTWA 4I9QA 5CBHA 1SQFA 1Q6IA 4RUEA 5B1AB 3U10A 4P30A 1HNWB 4ZHQB 3BA9A 3K59A 3RYFA 1AI4A 5KMGB 3T1HO 3ZRWA 4BW9A 4O2AB 2HEPA 2EULA 5D5QA 1QR9A 4MW3A 1JCHA 4I0XB 1GKFA 4FPPA 5FPRA 1OHHG 1KD1W 1LUWA 1K5SA 2CDYA 4H37A 2ZKOA 3T1YB 1Q7YW 2CGOA 4PV1B 1G1XB 1DTOA 4TV9A 3RYHA 3AG2C 1AROP 1WB7A 4X88A 1VARA 4DUYB 2CH7B 2CAZC 4C7UA 2E75B 3IC9A 2VWJA 3JASB 2UXBB 3TJTA 4CBCA 2PTMA 4YJ2B 4R7CA 2EIJC 2W0XA 3QG5A 5CA3A 5H5NA 1M93A 1IX9A 3IGAC 1CP9A 1OCZC 5J2TA 1FKAO 5B3SC 1R6TA 5JQGA 3S3XA 1YCIA 2DN9A 3MAQA 2UU9B 1HR0B 1MA1A 1TUBB 4RAIA 2ITDC 2QSAA 3JD2A 2W0FC 4JI5B 2P4KA 2D2CB 4JAVA 4FLUA 1EN5A 5LOVA 3N2KB 4DR7O 3OD4A 3ICXA 1GK9A 4AI8A 4WFEA 3JCZA 3P30A 4R8CA 4I50B 1VF7A 4LF9B 2RDCA 5EIBD 2LGQA 4OPHA 5KX5A 1CEZA 1XNQO 3LSUA 2KSDA 1NTZH 3HKDB 3QO7A 5LGTA 3ABMB 3Q4HA 4HAMA 4K35A 1R6NA 1WPBA 4O4JA 1XUQA 5KUMA 3E83A 2DE0X 2YSUB 2R70A 4J42A 4QJFB 4KHPB 4O4JB 2WWWA 3BHPA 1YITV 2FL4A 1BQZA 2HLDG 1AJPA 1PV0A 4B3TB 2BE3A 2HJFC 5B3SB 1K92A 4I0XA 5GONA 3C3SA 3W7XA 5CBFA 3GWKC 4BIZA 1K5QA 3RVYA 4JYAB 4TUYB 3ABLB 5A9GA 1YIJV 1RPOA 5L3CA 4PA9A 3IAYA 1RPRA 4D6TH 1K7DA 4DR6B 1Q8IA 1KP2A 4XDJA 5LOVB 3R65A 2IJJA 1YI2V 2VS0A 1WLEA 4I55A 4NYKA 4QGPA 4BR6A 4GKKO 4B3MO 3K79A 1IBMB 2YXLA 5JQGB 4RQFA 2IU3A 3JD3A 3T4ZA 3TCUA 1RP3B 1Z5WA 1PL4A 4JI1O 1Q86W 3QO5A 5H2FZ 4LFCB 3K0GA 3CRRA 4JI6O 1KC8W 5IYZB 4DR2B 5IE9A 1O9GA 2Z3YA 2IJHA 3FB5C 3ZMZA 3LDEA 3OMNB 3O65A 4JI3B 2LO1A 4TV9B 4DR6O 4WFBV 3ASNB 3AG4C 5CA1B 5DN6G 3E8FA 1JX9A 2Q0AA 2XUMA
chains in the Genus database with same CATH topology
1S5LZ 5E79Z 5KAIZ 5TISZ 5H2FZ 4UB8Z 4PJ0Z 4UB6Z 3WU2Z 5B5EZ 5KAFZ 3A0BZ 5GTHZ 3JCUZ 2AXTZ 3A0HZ 5GTIZ 5B66Z 3KZIZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  5E79 Z;  5KAI Z;  5TIS Z;  5H2F Z;  4UB8 Z;  4PJ0 Z;  4UB6 Z;  3WU2 Z;  5B5E Z;  5KAF Z;  3A0B Z;  5GTH Z;  3JCU Z;  2AXT Z;  3A0H Z;  5GTI Z;  5B66 Z;  3KZI Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 2W6J G;  2B5U A;  5KAI Z;  4XDL A;  5GON B;  4FZ1 A;  4DRX A;  3FD9 A;  4DV3 O;  1K34 A;  4B7K A;  4MTG A;  2XT9 A;  1GAX A;  4Z1V A;  5JWP A;  4EFE A;  3L74 H;  4BWA A;  3LSQ A;  3L73 H;  2BSK B;  3H1K H;  3JAK B;  1MMM A;  2EIL B;  3TXS A;  4U3F H;  3JD4 A;  4ZBM A;  3ZED A;  2EIM C;  5L3B A;  1FFX A;  3OTO O;  2HHH B;  2NN4 A;  3HKD A;  4YHH O;  2ZM6 B;  2ZR2 A;  2AZ0 A;  1X4T A;  2Y0I A;  4F6R B;  1K33 A;  4BIU A;  5CN0 A;  4X64 B;  3ZRX A;  4NXM B;  3GWO A;  3B77 A;  5DEC A;  3UKM A;  3G4S V;  1AVM A;  3CE2 A;  3C3T A;  3B8N A;  3DSQ A;  4RWU A;  1MSD A;  3D36 A;  2KG7 A;  4WBN A;  5EZY A;  4DUY O;  4LF4 B;  3OUS A;  1CPY A;  1N32 B;  2ZT9 B;  2M6Y A;  2VQE B;  1XMQ O;  1I7F A;  2F93 B;  1WPX A;  4DV7 B;  1KU9 A;  3JAL B;  4BAY A;  4DK0 A;  5ITZ B;  4I5S A;  3CJH A;  2WA4 A;  2AHY A;  1Q43 A;  2XAG A;  2FTK A;  3E35 A;  4FFK A;  1S5J A;  2P7T C;  2FYU H;  2V1D A;  1SF9 A;  3ZBH A;  1R3I C;  3ABL C;  3ETD A;  1OZ0 A;  3SDL A;  3JAR B;  1XMQ B;  3P32 A;  1PNL A;  5CA0 B;  3W7W A;  5LGN A;  4GCZ A;  1M90 W;  4IIJ A;  1KMI Z;  1N4C A;  1CXZ B;  5KHJ A;  4HYO A;  3W7U A;  3OEH G;  4ZIB A;  2K9P A;  3BPZ A;  2C2A A;  5HFL A;  1V55 B;  5IWA O;  4KHP O;  1FXK B;  2WLH A;  1M56 B;  1TVK B;  4FIP C;  1S5H C;  3ZHU A;  5L3G A;  2JJ2 G;  3CCR V;  1QNM A;  1VQ4 V;  4I9W A;  4JYY A;  1SES A;  3ZHS A;  4CH4 A;  4JI1 B;  4LF8 O;  4IIJ B;  3FAV B;  2ZE5 A;  1XNQ B;  2E5L B;  1IBM O;  1JPX A;  4X1K A;  4MW8 A;  4NXM O;  4IL6 Z;  2ZQM A;  2Q73 A;  5JVD B;  1VQO V;  3AK3 A;  5KA5 A;  1K73 W;  2LP7 A;  2Q4P A;  3FAV A;  5IJ9 B;  2UUC O;  3JYC A;  2YIB D;  1G4Y B;  2JIZ G;  4O2B B;  4TQD A;  4EB6 A;  3BEH A;  3FYI B;  3SPG A;  3CRM A;  3E2E A;  2BOB C;  1R3K C;  4ABM A;  5EK0 A;  4GYC B;  5EC1 C;  2HR3 A;  3F7Y C;  4WFH A;  2Q7G A;  3ZX6 A;  2JEX A;  1YTF B;  4JI8 B;  3B2E E;  3FB8 C;  4B3T O;  4PA6 A;  4JYA O;  1MZF A;  3M7M X;  3K03 A;  4UCV A;  2HJD A;  5CA0 A;  2CTW A;  4RUF A;  3JAT A;  1AIL A;  1G8M A;  2E74 B;  3STZ C;  5IYD O;  4DR3 B;  2H94 A;  2GDS A;  3SYA A;  4DV2 O;  1SZX A;  3CRC A;  3J80 N;  3CHX A;  1AP5 A;  3EFF K;  1AR1 B;  4PA4 A;  4OGQ B;  2ADP A;  4X8A A;  4JI2 O;  5FL7 G;  3M8A A;  4O2B A;  1MSW D;  4ZHQ A;  4LF9 O;  3CYO A;  2M7W A;  3T2M A;  4D7S A;  4TV8 A;  3VQW A;  2A9H A;  1UPG A;  2PYJ A;  2UUC B;  3K5L A;  1FFX B;  4G2K A;  4LF7 O;  1VQN V;  4X65 B;  1J5E O;  3E89 A;  1R1B A;  2QKS A;  2B1I A;  1AI7 A;  4W4L A;  2ZM6 O;  3HR0 A;  4AQY B;  3KCX A;  4JI0 O;  5LYJ A;  1XMO O;  4PI2 A;  5CMU A;  2JGD A;  3OGC C;  2ZXW C;  3P3P A;  4J9Y B;  2KG7 B;  4WBN B;  1HNW O;  3FX7 A;  1QR8 A;  3SJA C;  3JD0 A;  2ZDI C;  4DV0 B;  4DRX B;  1KB9 F;  2QEX V;  1LR1 A;  2EIK C;  1WAZ A;  4BIO A;  5IWA B;  2PF4 E;  5LMN B;  4F6R A;  3JSL A;  5LA6 A;  4WFA V;  1H2S B;  2HVJ C;  1D5A A;  1O9H A;  2CTP A;  4J41 A;  3C90 A;  3RW0 A;  2NNU A;  2MK3 A;  4CZZ A;  4LH7 A;  2F43 G;  3L70 H;  4DV6 O;  4UCO A;  3AG3 B;  3UO3 A;  2WLK A;  3KKY A;  2QGN A;  1ZL8 A;  1YF2 A;  2ZR3 A;  2WPD G;  1W2B U;  4DYL A;  2WLL B;  3ZHQ A;  4PEL A;  2VQF O;  5KX5 B;  4FM0 A;  3OW2 U;  4JV5 B;  2JEU A;  1SER A;  1UJW B;  3VQX A;  2X7R B;  4LF6 B;  4DR2 O;  3CCV V;  2E76 B;  2LW7 A;  4JGS A;  3WG7 B;  1VQK V;  5L3D A;  1COW G;  4LFB O;  2DYR C;  2CTQ A;  1NR7 A;  4E4E A;  3SYQ A;  1D5N A;  4YY3 O;  2GTA A;  4JI5 O;  3K5N A;  4LNU B;  3ZIA G;  1EBO A;  3RYI B;  3JD1 A;  5IDJ A;  2QE7 G;  4NTY A;  4Q20 A;  2OIE A;  5HFM A;  1VQ6 V;  4P9P A;  4W4K A;  1BHA A;  4LCU C;  1HNX O;  1I5X A;  2LGW A;  2BTQ A;  3JAW A;  2DJV A;  1M4U A;  5IYZ A;  4TV8 B;  4TWK A;  1VQL V;  1GN4 A;  2E3C A;  3J7A U;  1G6U A;  1JVM A;  1BHB A;  1BL8 A;  4YJ2 A;  3DC6 A;  1IZ3 A;  4J11 A;  1M57 B;  2QKC A;  3GVM A;  3B8M A;  2OCC C;  1K4C C;  5J2U B;  3WFV A;  2IJK A;  2DQ0 A;  2CH7 A;  2R9A A;  5GTI Z;  1K8A W;  1F23 A;  2AW9 A;  1GN3 A;  1P84 F;  3JAT B;  3ZRS A;  4CH6 A;  4LFB B;  3HB3 B;  2N05 A;  2WLM A;  4J10 A;  5JH7 A;  3PJS K;  2IW5 A;  2QM7 A;  2QWQ B;  5CBG A;  3APQ A;  2YIB A;  4JPR A;  2QKA A;  1US6 A;  1UFI A;  1YJ9 V;  2AXT Z;  1N0J A;  1S77 D;  5BZB A;  2X6B A;  3E8H A;  1K4D C;  4KFM A;  1IBK B;  4GX0 A;  2F95 B;  3H1I H;  2OCC B;  4YXW G;  2DYR B;  2VQF B;  1S72 V;  5LHH A;  1AI5 A;  1M1K W;  2O57 A;  2OCH A;  2XAJ A;  1HW7 A;  1VF5 B;  4CH5 A;  4TSF G;  5EBW C;  1FJG O;  4FLW A;  1AJN A;  4J9Z B;  1Y76 A;  2LJ2 A;  3CX5 F;  3W7S A;  4LF4 O;  5JCO A;  2WLI A;  4JI3 O;  3SPI A;  1FAF A;  3CME V;  3B40 A;  2UXN A;  3H01 A;  3BA8 A;  4FLT A;  1VEW A;  3E22 A;  1KYO F;  1SA0 A;  2B1G A;  2EIN B;  2F66 C;  4B3M B;  4GKK B;  3CS5 A;  4GX5 A;  2ZE6 A;  4I50 A;  3RT3 C;  4G28 B;  3JAM N;  4FMT A;  2DW4 A;  2UXD O;  2EX3 A;  3HKC B;  3OGI B;  3RYH B;  3N2K A;  2JK5 C;  2EIM B;  1K97 A;  1U97 A;  2MW2 B;  4LF5 O;  4DR3 O;  2UUA B;  3JSN A;  1Q81 W;  2YUA A;  1XNR B;  2P5O A;  4JAS A;  1QVF U;  2LQT A;  3H1L H;  3A0H Z;  3OAA G;  2RQ6 A;  2F4V O;  2BCC H;  1GRJ A;  1JOY A;  5L3E A;  1FPO A;  5C8Y B;  1Q82 W;  2XTA A;  1DLB A;  1OCR C;  2XND G;  2QM8 A;  4O4I A;  3ZRW B;  3L71 H;  4PDR A;  5KMG A;  2EBO A;  3CC4 V;  3CWB H;  1IVS A;  2RJZ A;  1B3Q A;  1JJO A;  1IBL O;  4YJ3 A;  2OT5 A;  3SYO A;  3OR7 C;  1V9P A;  4YIO A;  3UM7 A;  4B3S O;  4DV5 O;  1QCE A;  2KB1 A;  3ABM C;  3UT5 A;  2RN9 A;  3CRQ A;  2ZE8 A;  3LNM B;  3Q4H B;  1H2L A;  3ZMS A;  4U3J A;  1H2G A;  1KQS U;  5LMN O;  4J7K A;  4DR4 B;  4GKJ B;  1F51 A;  3THO A;  3SGI A;  4MVQ A;  2QJ1 A;  3L9D A;  2Z5U A;  1N8R W;  4JTD B;  1OCZ B;  2A0L A;  2F23 A;  3ZHV A;  2ETN A;  1YVW A;  4NR1 A;  3A0R A;  3D36 C;  1WP8 A;  4GT1 A;  4B7E A;  1SQQ H;  2XAH A;  1WN7 A;  1JFF B;  4NB5 A;  1MZE A;  4E2L A;  1GM9 A;  2P90 A;  2ZXW B;  3SR2 C;  2A3Q A;  2N74 A;  1NJI W;  1Y66 A;  2K1E A;  3JCU Z;  4WCE V;  2F1M A;  3AG1 C;  5B1B C;  3JAK A;  5JCO C;  2X0L A;  1H2N A;  1QLN A;  2EIK B;  5LP6 A;  4U7O A;  3KZI Z;  4DUZ O;  5LMU O;  1XBL A;  1XQ8 A;  4H0L B;  4Z2W A;  1DK1 A;  2Y69 B;  1S76 D;  4CS2 A;  3GB7 C;  4H33 A;  2YC0 A;  2DQ3 A;  2V4D A;  3D3Q A;  3UO2 A;  3AK1 A;  2XAQ A;  4EFB A;  1FXV A;  4MSW C;  4X20 B;  1JJ2 U;  3CCU V;  1NR1 A;  5B5E Z;  2Q68 A;  1F7Y A;  2HP8 A;  2YID A;  4AHC A;  3VQV A;  2YEV B;  1HP8 A;  2ITC C;  4JAA A;  4JZ2 A;  4MVR A;  3ZS8 C;  2YDE A;  4ZI7 A;  5BMV B;  4UB8 Z;  1L1F A;  3BY6 A;  5FLX N;  4UCS A;  1OCC B;  2F4V B;  2KKW A;  5LA6 B;  1N32 O;  5EIB C;  3CXH F;  1H2M A;  4NXN B;  5EYP B;  1QQC A;  4DUZ B;  1XL6 A;  3VOU A;  1WA8 B;  4DO2 A;  4LR3 A;  1QLE C;  2PGG A;  5KHH A;  1EN6 A;  4DV6 B;  2JRI A;  4MVU A;  1QLE B;  1SQB H;  5IY5 B;  4X64 O;  2P06 A;  2WSS G;  2LW1 A;  5KHK A;  2PYL A;  3ZMV A;  4YIP A;  2QA4 V;  3U0Z A;  1RSO A;  4DR4 O;  4GKJ O;  5K1P A;  1EZV H;  3G6B A;  1NU1 H;  3D8C A;  4UUJ C;  4UCU A;  3F5W C;  2Y4U A;  1JFF A;  4QPK A;  4UXN A;  2WA3 A;  4P2Z A;  2G38 A;  4PDM A;  2Z0A A;  4CS3 A;  3RYC A;  1IDS A;  5B1O A;  1IBK O;  1ENV A;  1YSC A;  4FZ0 A;  1IBL B;  4QPJ A;  3UCS C;  1NH2 D;  1L8D A;  1P7B A;  2EIJ B;  1P7G A;  4L87 A;  4DV5 B;  1KBH A;  3LDD A;  1U96 A;  2RMK B;  5JH7 B;  2QWO B;  4LFA O;  4RO2 A;  5TIS Z;  4Q6G A;  3QVN A;  4NKG B;  2EZP A;  1SZT A;  3CB2 A;  1Q3E A;  1ZLZ A;  4JI4 B;  2HVK C;  1ROP A;  4MVZ A;  3ZMU A;  1TA8 A;  5KUK A;  4X62 B;  2XHB A;  1SET A;  1TUE B;  5KLV H;  2OIG A;  4PDL A;  5C93 A;  3LNN A;  3CC7 V;  4JZG A;  1FFT B;  4ASU G;  2ZD9 A;  4O4I B;  3W7T A;  3RFR A;  1XL4 A;  4QE7 A;  1THZ A;  1NZ6 A;  1YJW V;  4IYI A;  4JTC B;  1YZB A;  1KKC A;  1R6K A;  2EJR A;  2Q6A A;  4IYH A;  4KL1 A;  1VQ9 V;  4X1K B;  2WLI B;  2Y48 A;  4A5U B;  1MOF A;  2GV9 A;  2W6I G;  1TUB A;  3ZRV A;  1GH6 A;  2IM9 A;  1GN6 A;  4DW0 A;  4JI0 B;  4LWS B;  4X1Y A;  2GHY A;  1V54 C;  1GN2 A;  1N34 B;  3HKB A;  1FD9 A;  4X89 A;  4DR1 B;  3BRC A;  5FPO A;  3K08 A;  5B1N A;  3UQ8 A;  4MVO A;  5FNV A;  5H6R A;  4LF8 B;  1YEW A;  3E22 B;  2YI8 A;  2R9R B;  1VQ7 V;  4N23 A;  3CXC U;  3T1C A;  4YJ3 B;  2CUG A;  3K58 A;  3B09 A;  5BR8 O;  3K04 A;  4ICG A;  3CCQ V;  1ZSP A;  1FYJ A;  4B08 A;  4GX1 A;  3FKS G;  3ZN1 A;  4DV1 B;  3BVO A;  1KKD A;  3CJH B;  4FFB A;  1FS0 G;  3WB0 A;  1XEQ A;  3STL C;  3ML0 A;  4LWS A;  4O2A A;  2EZO A;  1AJQ A;  1VMG A;  1N33 B;  1XNR O;  2XAS A;  2Q7H A;  3RYF B;  3AG3 C;  2QM4 A;  1BS3 A;  2P4V A;  2PI5 A;  4K8X A;  1XMO B;  1EFR G;  1QBZ A;  2LFR A;  5B1B B;  3SJQ C;  2ILM A;  2YXH A;  1S0V A;  3F5T A;  4LBE C;  3DXR B;  1YJN V;  2FB5 A;  3FB6 C;  3TGU H;  4FK5 C;  1AI6 A;  3ETQ A;  5EBM C;  1K3E A;  2IH1 C;  3IFX A;  4H13 B;  1E1Q G;  3DTU B;  2WLL A;  4I7Z B;  5LHG A;  4XDK A;  4O4H A;  2YI9 A;  3CPW U;  4PHZ A;  4JYB A;  3ASO B;  2JJ1 G;  2DYS C;  5LP6 C;  3K5O A;  4X62 O;  3BCC H;  1Y76 B;  4ZOL A;  4B3S B;  2RCV A;  3ASO C;  4LNU A;  2LFS A;  2WLN A;  4IGG A;  4CH3 A;  4R6Z A;  2XOK G;  1YDX A;  4CC6 A;  1V54 B;  1WB8 A;  3X2Q B;  3BAB A;  1FJG B;  1HDJ A;  1T5E A;  3K3W A;  3T1Y O;  1HNZ B;  4MVM A;  4TUY A;  5GTH Z;  4DV1 O;  4X20 A;  1ORQ C;  2P6J A;  1BSM A;  3AG1 B;  4PI0 A;  1N36 O;  2V7Q G;  4LH6 A;  3SYP A;  2PY5 A;  4J80 A;  3VQY A;  3E8B A;  3OFN G;  3I55 V;  2RNB A;  1OCR B;  1MG1 A;  5BR8 B;  2JS5 A;  4JI8 O;  1XIL A;  2A06 H;  4IHJ B;  4FJC C;  1SC5 B;  5LYJ B;  2IH3 C;  4XBF A;  2EIN C;  1F4M A;  3B4S A;  3RVZ A;  4OX9 B;  4DR1 O;  4DV4 B;  2CTR A;  2Q69 A;  4X65 O;  1J5E B;  4MVS A;  3HKB B;  2NLJ C;  1Y74 A;  1NI8 A;  2QWR B;  2YIC A;  4PD4 F;  4HBN A;  3U11 A;  4O4L B;  1VP7 A;  3AK2 A;  3F7V C;  3NR7 A;  2JDI G;  5EYP A;  1M56 C;  4X66 B;  3RYI A;  3N27 A;  3CMA V;  2JGD B;  4PJ0 Z;  1BMF G;  3RGB A;  2HFE C;  3L72 H;  4DR5 B;  4I4T A;  3QTC A;  2NR5 A;  5H9C A;  2D3O W;  3LDC A;  3FB7 C;  1NH2 B;  3K5M A;  2A79 B;  4WFF A;  2UUA O;  3A0B Z;  5BXZ A;  1GTO A;  1F4N A;  1X59 A;  3EXA A;  2ATK C;  3O9O A;  1NTM H;  5GW7 A;  1V55 C;  4N21 A;  3SJC C;  4MTX A;  2GUZ A;  4OXS A;  3QNE A;  3WG7 C;  4ZKI A;  1YXB A;  1VQM V;  3M99 B;  1SS3 A;  4JI7 B;  3K57 A;  4P9O A;  4GX2 A;  3LUT B;  5IJ0 A;  1HNX B;  2FKX A;  2EIL C;  3CC2 V;  5IYB O;  1PM9 A;  1VF6 A;  3OUF A;  4PA7 A;  3OTF A;  4WF9 V;  1GM8 A;  1TVK A;  3AG4 B;  2QTO A;  5LMU B;  5JJJ B;  4UCR A;  2CGN A;  4G27 B;  4JYC A;  1BZK A;  3HPL C;  1PNK A;  4UV9 A;  4EKW A;  5F2V O;  3BFR A;  4U3J B;  4YY3 B;  1WJZ A;  4GUN A;  2Y0P A;  3TXQ A;  3OR6 C;  2AZ2 A;  1XDC A;  4JV5 O;  3N2G B;  3OT7 A;  5KA6 A;  3CCJ V;  4DV4 O;  5J2T B;  4LF6 O;  4X1I A;  2WAM A;  2PI4 A;  3WU2 Z;  1SQX H;  2OYQ A;  2UUB B;  1NKD A;  5LBQ A;  1H8E G;  1WA8 A;  1XOU A;  5C8Y A;  1HNZ O;  1N33 O;  1QHT A;  2UU9 O;  3DC5 A;  5ITZ A;  5BY1 A;  1VF6 C;  3CD6 V;  2Q9L A;  3H1J H;  2QR4 A;  4DV2 B;  2ZIO A;  4ZI7 B;  1WP7 A;  5BMV A;  2UUB O;  3CCE V;  1AR4 A;  4HZ3 A;  3JAR A;  3E86 A;  2Q0O C;  4RQE A;  1Y4M A;  4CC5 A;  2AGA A;  4O4L A;  4KP4 A;  4LFC O;  1PL0 A;  2QDO A;  2WLJ A;  2QWN B;  4CS4 A;  4U7N A;  1JR9 A;  2OWO A;  3TET A;  5K1X A;  3S3W A;  3AEI A;  4MTF A;  5CB4 A;  2BTQ B;  3G80 A;  4AQY O;  3WB1 A;  1GMG A;  1ZWI C;  2CK3 G;  3ASN C;  2ZNI A;  1N34 O;  3DXR A;  5A2Q N;  3ZCC A;  1ZUQ A;  2ZIM A;  5DED A;  1H8H G;  2Q8V A;  5EBL C;  2N04 A;  4Z1M G;  1Q5O A;  4OPA A;  1BGY H;  3EVK A;  2KQX A;  5LGU A;  2JVD A;  2PZS A;  1FXH A;  4FLZ A;  1ZTE A;  1SRY A;  1PPJ H;  1NVP B;  1FXK A;  1B06 A;  3AG7 A;  4GZR B;  3P3N A;  4FFB B;  5AG2 A;  4FLX A;  1I0H A;  1KEC A;  3MHS C;  4H44 B;  1TGO A;  3E8G A;  1NQT A;  4UVB A;  4MT8 A;  1SQV H;  1WNS A;  3ETG A;  3I56 V;  1ZL8 B;  4LF5 B;  4NTX A;  3SYC A;  4JI4 O;  1B6Q A;  3CCL V;  1E1R G;  1N0N A;  3VBB A;  1URF A;  3K9S A;  4FVM A;  1I08 A;  1JA8 A;  3R66 A;  1OCO C;  4IHJ A;  1Q6H A;  5LL6 Y;  3FFQ A;  1LNQ A;  3G6E V;  1XHZ A;  1PKX A;  2DMX A;  2XAF A;  1MNG A;  2BTO A;  1VQ5 V;  3KCY A;  1OV9 A;  2Y4T A;  1KUQ A;  1EN4 A;  1KP3 A;  3KG2 A;  1SKV A;  1BE3 H;  2QTS A;  5LP6 B;  2UXX A;  1IXB A;  1XHX A;  1L0L H;  2L35 A;  1SQP H;  3RWR D;  3A8T A;  2QWP B;  1DGS A;  3JAL A;  1R3J C;  1P49 A;  2DOS A;  4I4T B;  5E79 Z;  4DK1 A;  4I55 B;  3H1H H;  1M5I A;  3PN1 A;  2E5L O;  4J7J A;  3SPJ A;  5EZY B;  2FML A;  3K06 A;  2Q67 A;  1NBM G;  3OMI B;  2UXD B;  3HKC A;  1B04 A;  3K0D A;  4OX9 O;  2JGU A;  3ZJZ A;  3OTO B;  3AG2 B;  4TOI A;  5B1A C;  5IYC O;  4JI7 O;  3K9A A;  2GBO A;  1I5Y A;  1QVG U;  2VRZ A;  2ZIN A;  1I94 B;  4QNH B;  5JJN B;  3I5D A;  4FLY A;  4UVC A;  3CSX A;  3UT5 B;  4TQF A;  1TAE A;  4MTO A;  2HG5 C;  2DWD C;  3CP1 A;  3CEI A;  2B9Z A;  1P4R A;  5DM6 V;  1NTK H;  1N36 B;  3TK1 A;  1AR5 A;  1GO3 F;  4AIL C;  1NVP D;  1H2K A;  1RM1 C;  2IJI A;  1OJH A;  5KHG A;  2H8P C;  1DF5 A;  3MDS A;  5KAF Z;  1PD3 A;  3NXS A;  4LP8 A;  3OEE G;  4DV3 B;  4UCT A;  3RN4 A;  1Q90 D;  1S5L Z;  2A7W A;  4UFZ A;  3RYC B;  4FM1 A;  1VQP V;  1GM7 A;  1E79 G;  3CRA A;  3LSS A;  2OTJ V;  3G67 A;  4EB6 B;  4X66 O;  2VQE O;  4JTA B;  5EC2 C;  1LUV A;  1RM1 B;  5IJ9 A;  2ADQ B;  4EEQ A;  3CCS V;  2Q7E A;  1ZAU A;  3T1H B;  1MAB G;  5JVD A;  5J2U A;  3DGE A;  3IC7 A;  4GLX A;  4O4H B;  1H38 A;  1IXM A;  5CB4 B;  4LF7 B;  1PNM A;  1BCC H;  3MHH C;  2ZDI A;  2R72 A;  5LHI A;  2HHH O;  1IUR A;  4DV0 O;  1SA0 B;  3IJ4 A;  1BQ0 A;  3JAW B;  4DXW A;  3A2F A;  4JI2 B;  1Z5V A;  4NXN O;  3L75 H;  1BT8 A;  2Y69 C;  5IJ0 B;  2P22 C;  3ABK B;  2CE4 A;  4KXR A;  5B66 Z;  2UXB O;  4JAU A;  1VQ8 V;  4BW5 A;  1M57 C;  2JS3 A;  2R9I A;  3MD0 A;  5E1A C;  4LC1 A;  3ABU A;  2GSM B;  2X6A A;  4UB6 Z;  2ZNJ A;  2VWK A;  2GUZ B;  4DV7 O;  1W59 A;  4WFG A;  3SPH A;  4K3A A;  1Z2G A;  4MS2 A;  4F4L A;  3CCM V;  1PP9 H;  2IBZ H;  2X6C A;  4TT3 G;  4JF3 A;  1NT2 B;  1FXK C;  1VIB A;  4K0K B;  4LFA B;  1R3L C;  3ZN0 A;  4NVP A;  5LXT A;  1RSO B;  3D3I A;  1L0N H;  4JI6 B;  3HKE B;  4HNA B;  3OE7 G;  1NS1 A;  5KHI A;  4YHH B;  1W0K G;  2DYS B;  5FNV B;  4UVA A;  1ZX3 A;  5IT9 N;  3SPC A;  3J81 N;  4DR7 B;  2YIA A;  3G71 V;  1HWY A;  2GTS A;  4X1Y B;  4QIW F;  4D7T A;  5JJE B;  2AHZ A;  1Q6U A;  2YXY A;  2P67 A;  4K8Z A;  4QE9 A;  4DW1 A;  4R50 A;  2DWE C;  1Y6X A;  3HKE A;  4X9Q A;  1HR0 O;  4F6E A;  5LXT B;  4PDV A;  4B3R O;  3OM3 B;  2UXC O;  2IU0 A;  5D5P A;  1JMK C;  4J7Z A;  1A32 A;  2BSK A;  1YHQ V;  1XI1 A;  2YS8 A;  3ETE A;  1XRE A;  1K9M W;  3SJB C;  3ZMT A;  2H3O A;  3APO A;  3RBZ A;  1AP6 A;  1S3J A;  4FLV A;  3JAS A;  2Q5Z A;  3OMA B;  1EZJ A;  4UV8 A;  4K0K O;  2BOC C;  1JQ0 A;  1DF4 A;  3WB2 A;  2ODM A;  4L8J A;  2L6L A;  4FM2 A;  5CA1 A;  1W0J G;  4IT5 A;  2ARH A;  3ABT A;  3T4D A;  5J9P C;  2UXC B;  2YEV A;  3H9V A;  1R73 A;  2EJ7 A;  2HKO A;  2ZCE A;  1QU7 A;  3ABK C;  2OTL V;  4ZOL B;  2PUS A;  5L3F A;  4KUM A;  1YTF D;  1J95 A;  1SQG A;  3X2Q C;  1D2D A;  5IY5 C;  4B3R B;  3ZHT A;  3BAA A;  1Y67 A;  5H6Q A;  1Y74 B;  1M9N A;  1EM1 A;  4X1I B;  3FYE B;  2ZE7 A;  3QF7 A;  4PA3 A;  3EHB B;  1I94 O;  3QO8 A;  3N2G A;  4HNA A;  1OCO B;  4DR5 O;  1OCC C;  3ZHR A;  1RFY A;  1AB3 A;  4NTW A;  4I9Q A;  5CBH A;  1SQF A;  1Q6I A;  4RUE A;  5B1A B;  3U10 A;  4P30 A;  1HNW B;  4ZHQ B;  3BA9 A;  3K59 A;  3RYF A;  1AI4 A;  5KMG B;  3T1H O;  3ZRW A;  4BW9 A;  4O2A B;  2HEP A;  2EUL A;  5D5Q A;  1QR9 A;  4MW3 A;  1JCH A;  4I0X B;  1GKF A;  4FPP A;  5FPR A;  1OHH G;  1KD1 W;  1LUW A;  1K5S A;  2CDY A;  4H37 A;  2ZKO A;  3T1Y B;  1Q7Y W;  2CGO A;  4PV1 B;  1G1X B;  1DTO A;  4TV9 A;  3RYH A;  3AG2 C;  1ARO P;  1WB7 A;  4X88 A;  1VAR A;  4DUY B;  2CH7 B;  2CAZ C;  4C7U A;  2E75 B;  3IC9 A;  2VWJ A;  3JAS B;  2UXB B;  3TJT A;  4CBC A;  2PTM A;  4YJ2 B;  4R7C A;  2EIJ C;  2W0X A;  3QG5 A;  5CA3 A;  5H5N A;  1M93 A;  1IX9 A;  3IGA C;  1CP9 A;  1OCZ C;  5J2T A;  1FKA O;  5B3S C;  1R6T A;  5JQG A;  3S3X A;  1YCI A;  2DN9 A;  3MAQ A;  2UU9 B;  1HR0 B;  1MA1 A;  1TUB B;  4RAI A;  2ITD C;  2QSA A;  3JD2 A;  2W0F C;  4JI5 B;  2P4K A;  2D2C B;  4JAV A;  4FLU A;  1EN5 A;  5LOV A;  3N2K B;  4DR7 O;  3OD4 A;  3ICX A;  1GK9 A;  4AI8 A;  4WFE A;  3JCZ A;  3P30 A;  4R8C A;  4I50 B;  1VF7 A;  4LF9 B;  2RDC A;  5EIB D;  2LGQ A;  4OPH A;  5KX5 A;  1CEZ A;  1XNQ O;  3LSU A;  2KSD A;  1NTZ H;  3HKD B;  3QO7 A;  5LGT A;  3ABM B;  3Q4H A;  4HAM A;  4K35 A;  1R6N A;  1WPB A;  4O4J A;  1XUQ A;  5KUM A;  3E83 A;  2DE0 X;  2YSU B;  2R70 A;  4J42 A;  4QJF B;  4KHP B;  4O4J B;  2WWW A;  3BHP A;  1YIT V;  2FL4 A;  1BQZ A;  2HLD G;  1AJP A;  1PV0 A;  4B3T B;  2BE3 A;  2HJF C;  5B3S B;  1K92 A;  4I0X A;  5GON A;  3C3S A;  3W7X A;  5CBF A;  3GWK C;  4BIZ A;  1K5Q A;  3RVY A;  4JYA B;  4TUY B;  3ABL B;  5A9G A;  1YIJ V;  1RPO A;  5L3C A;  4PA9 A;  3IAY A;  1RPR A;  4D6T H;  1K7D A;  4DR6 B;  1Q8I A;  1KP2 A;  4XDJ A;  5LOV B;  3R65 A;  2IJJ A;  1YI2 V;  2VS0 A;  1WLE A;  4I55 A;  4NYK A;  4QGP A;  4BR6 A;  4GKK O;  4B3M O;  3K79 A;  1IBM B;  2YXL A;  5JQG B;  4RQF A;  2IU3 A;  3JD3 A;  3T4Z A;  3TCU A;  1RP3 B;  1Z5W A;  1PL4 A;  4JI1 O;  1Q86 W;  3QO5 A;  5H2F Z;  4LFC B;  3K0G A;  3CRR A;  4JI6 O;  1KC8 W;  5IYZ B;  4DR2 B;  5IE9 A;  1O9G A;  2Z3Y A;  2IJH A;  3FB5 C;  3ZMZ A;  3LDE A;  3OMN B;  3O65 A;  4JI3 B;  2LO1 A;  4TV9 B;  4DR6 O;  4WFB V;  3ASN B;  3AG4 C;  5CA1 B;  5DN6 G;  3E8F A;  1JX9 A;  2Q0A A;  2XUM A; 
#chains in the Genus database with same CATH homology
 1S5L Z;  5E79 Z;  5KAI Z;  5TIS Z;  5H2F Z;  4UB8 Z;  4PJ0 Z;  4UB6 Z;  3WU2 Z;  5B5E Z;  5KAF Z;  3A0B Z;  5GTH Z;  3JCU Z;  2AXT Z;  3A0H Z;  5GTI Z;  5B66 Z;  3KZI Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...