2AXTZ

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 2axtZ00
1S5LZ 5B66Z 5GTIZ 5B5EZ 2AXTZ 3KZIZ 5E79Z 3WU2Z 5GTHZ 5KAFZ 3A0BZ 3A0HZ 4PJ0Z 4IL6Z 5H2FZ 5KAIZ 5TISZ 4UB8Z 4UB6Z 3JCUZ
chains in the Genus database with same CATH superfamily
5EIBD 5JQGB 4LNUB 3D8CA 1PL0A 4K0KO 1PD3A 3FAVA 4W4LA 4FLZA 3JAWA 4X20B 3TK1A 3B2EE 5C8YB 4RQFA 5EBLC 1K4CC 1YJNV 5CBHA 4UUJC 4ZOLA 4GKJO 1IVSA 4WFGA 1X4TA 4KHPO 2QSAA 3SYCA 4QNHB 1RSOB 3ZMZA 1N8RW 3B8MA 5B1OA 3J80N 4R50A 2R9RB 1IBMB 4J9ZB 3GWKC 5EIBC 5FL7G 2HLDG 3A0BZ 4DK1A 1D2DA 1VF5B 2LW7A 1K5QA 1SQBH 3SPIA 1Q5OA 2Q8VA 3ABKB 4LBEC 4TUYB 4FFKA 4K3AA 1AI5A 3OEHG 4DR3O 1PNLA 4G27B 4JI0B 3ZHQA 3RW0A 4NKGB 2HHHO 3W7XA 3TGUH 1OZ0A 3GB7C 4FLVA 1SQFA 2Q4PA 3CRAA 2EJ7A 2Y0PA 4YJ2A 1IBLO 1BT8A 5H2FZ 4U3FH 2UXCB 1QLEC 3M7MX 1IXBA 3GWOA 4EKWA 5KHJA 5LOVA 1S3JA 4F4LA 4DV7O 3UM7A 2RQ6A 4JTDB 4CS2A 3OM3B 3U11A 3AG7A 4FIPC 3B40A 1K7DA 4TV9A 3H1IH 5IDJA 3LSQA 3K59A 1BS3A 3N2GB 3ABLB 3C90A 1N36O 1V55B 4FMTA 1FXKB 4UCUA 2BOBC 1YJWV 2YICA 2ADQB 4IYIA 3RFRA 1MNGA 5TISZ 4O2AA 4MVQA 2QWRB 5LYJB 5KMGB 1N32B 2ITCC 3EHBB 1K9MW 3NR7A 2Q6AA 5B1BC 2EJRA 4FK5C 4LF4O 1I0HA 3CCRV 1SA0B 5FNVB 4IIJA 3CRCA 2L35A 4DR4O 2EIJC 4CH3A 2NR5A 2E5LB 2CTWA 2ZD9A 5LGTA 2R72A 4IHJA 3K9AA 1ORQC 5IY5C 4YHHO 4HBNA 5KAFZ 2LO1A 4TWKA 4JI5O 1JPXA 2A06H 3VOUA 2LFRA 2KKWA 2PI4A 3CCVV 1VQ4V 5LMNO 1HNXB 3ABUA 1N0NA 4JAVA 5FPOA 2A3QA 5EYPA 2AW9A 4E2LA 2UXNA 1Q82W 2E3CA 2UU9B 4DV6B 1PKXA 2DN9A 4Z1MG 5LL6Y 4DYLA 5DM6V 1N33B 3CHXA 1XI1A 4JI4O 1SC5B 1CEZA 4PI2A 4GX0A 3H1LH 3ZX6A 3FYEB 1JJ2U 3SYQA 1NR1A 2JJ1G 1H38A 4O4JB 2QDOA 4B08A 1XDCA 2WLLA 3TXQA 2BSKA 2ZE6A 2P4VA 3RYIB 4P9OA 1EZVH 2UXDO 1XHXA 1NZ6A 2NN4A 1XL4A 1IBKB 3K3WA 2ZINA 1R6TA 4YIOA 1M56C 5C8YA 4UCRA 5JH7B 1NVPB 1ZL8B 4YIPA 3OTOO 2PUSA 2EULA 2Y69B 3SPGA 2ZDIA 1YF2A 3ZRXA 1RSOA 1R3LC 1A32A 2QM8A 1UJWB 4X66B 3UT5B 1URFA 2JGUA 2YIBD 4J7ZA 4DR5O 3D3IA 4JPRA 2PY5A 1ZWIC 2QTOA 4J80A 3K0DA 1AI7A 4MVUA 4TUYA 4MT8A 3RYFB 2F23A 2A9HA 2FTKA 5H9CA 1OCOC 3U10A 2GTAA 4ZKIA 3G80A 2EIKC 1VQKV 3ABMB 1VEWA 4ICGA 2FL4A 1IX9A 4NXNB 2WLIB 3OT7A 3QVNA 1YITV 2E74B 3EXAA 2UUCB 2XHBA 2QA4V 1CXZB 2EZOA 4IL6Z 4FM1A 2DW4A 1Q90D 3Q4HA 3G71V 4LF7O 2R9AA 3ETQA 2PZSA 3DGEA 2UUBO 3CPWU 1BMFG 2XAFA 4FM2A 1NQTA 4X64B 4X62O 3B8NA 2JJ2G 5LP6C 1I7FA 3OE7G 3MDSA 3H9VA 3N2GA 3SR2C 3E22B 1FXKA 3K9SA 2DYRC 2WLNA 4LF9B 4F6RB 4FLUA 3H01A 4D7SA 1NI8A 1JR9A 1DK1A 1IXMA 1TA8A 1MOFA 5LMUO 4BAYA 5JVDB 1GKFA 2OTJV 1J95A 1TVKB 2DE0X 4J11A 3UQ8A 5IWAB 4DR1O 3OGIB 5KHHA 1GN4A 4JGSA 4X8AA 3ZRSA 4GX2A 2VWJA 4JI7B 3JALB 1XMOB 2C2AA 2EILC 1AP6A 2H94A 1SA0A 1L1FA 1WLEA 4UVCA 4MW3A 4GLXA 1NTKH 5EBWC 3CRMA 1K73W 3BA8A 4FLWA 5KHKA 4PA4A 3FKSG 3ZMVA 2CH7B 3AG4B 4AQYB 1DTOA 4L8JA 2DWDC 1CP9A 3JARB 3WB2A 1WAZA 3L70H 2Q0AA 4J7JA 5LHIA 3E2EA 4LC1A 1FAFA 2E75B 4BIZA 1Z5WA 1RP3B 1PV0A 2WLKA 2X0LA 2UXBO 2Q7GA 2IU3A 3RVYA 3T4ZA 2UUAO 4JI8B 4JYAB 3ZRWB 4UB8Z 4GKKO 4N23A 1AP5A 2HR3A 4J10A 3B77A 2DOSA 4I9QA 3LNNA 4JI2B 5ITZA 1MZFA 3BHPA 4X89A 2OCHA 3IAYA 3K06A 1M9NA 3SDLA 2F93B 4CS4A 3L9DA 2WA4A 3OUFA 1H2GA 5LHGA 3CB2A 1OCCB 1XL6A 4B3RO 4O4JA 1FJGB 4BWAA 2ZXWC 3CE2A 4RUEA 4JASA 5A2QN 5LGNA 3STZC 1PP9H 1R3KC 4RUFA 3ZJZA 3RYIA 3CC2V 1MABG 2EX3A 3VQXA 4LFBB 3CCJV 1NTZH 4L87A 4NYKA 1B04A 3ZMSA 4BW9A 1XMQB 2A79B 1GH6A 1WA8B 1AR5A 5JH7A 1S72V 3O65A 4TV8A 3RYHB 1V9PA 3ZHUA 3ML0A 2V1DA 2N74A 2R9IA 3EFFK 3X2QB 3JSNA 5L3EA 2G38A 3E8BA 2VRZA 1K92A 2EIMC 3ZHVA 1LUWA 3UT5A 1KP2A 1OCRB 4X1KB 3TETA 4BIUA 5JJEB 2EINB 3ZEDA 4MTGA 3BEHA 1NT2B 2JS5A 4E4EA 4GX5A 1SQGA 4FLYA 2XT9A 3RYFA 1HNZB 3ZCCA 3BPZA 3RYCB 5BR8B 3H1KH 1YSCA 2CTRA 4JI0O 5JCOA 4I5SA 4H13B 1TUBB 4TSFG 3ABTA 2BTOA 1OJHA 1AJPA 2IH3C 2F66C 1PPJH 1MA1A 2KSDA 2P6JA 2HJFC 5LXTB 2WLIA 1AVMA 1U97A 1QR9A 5IJ9A 5EK0A 3ASOB 1BZKA 1HW7A 2LP7A 2F4VB 2YIAA 3K57A 4JI1B 1YZBA 3T1HB 1SQPH 3CWBH 3TCUA 2IU0A 2ZIOA 1TAEA 3HKEB 1VQMV 2QWNB 1I5XA 2OTLV 1VQ9V 2VQEB 1BHAA 1TGOA 3CP1A 4NVPA 4CS3A 4WFEA 4WFHA 1GN6A 4ABMA 5H5NA 1MSWD 2QEXV 3CMEV 2HVKC 4RO2A 1P84F 2VQFB 3CC4V 2DQ3A 2CTQA 2ZM6B 5GONB 5JVDA 4UCSA 3ABKC 1KECA 1MZEA 5L3DA 2XASA 1EM1A 3JD3A 3HKCB 4J41A 1N32O 2JS3A 1ZSPA 1R6NA 1VMGA 3JSLA 2FYUH 4PI0A 5L3CA 3JALA 2IBZH 2MW2B 4DUYB 4WCEV 1YIJV 1VQOV 5K1PA 3CRQA 4JYYA 4O4IA 3ASNC 2R70A 4KXRA 4CH6A 4DV5B 3G6EV 4I50B 1K3EA 2E5LO 5CB4B 1P4RA 2QE7G 2CH7A 1DLBA 4U7NA 2FMLA 4ZIBA 4EB6B 3SPHA 1J5EB 4I9WA 5C93A 3JARA 4LF8B 1KYOF 4JI6B 1WP7A 2Z0AA 1R3JC 2QR4A 3JD1A 4O2BA 1KP3A 4IT5A 3RWRD 2LFSA 3SJBC 3APOA 4H37A 4CC6A 4J9YB 4U7OA 3RT3C 1HNXO 2QJ1A 4WBNB 3OTFA 2D2CB 1S76D 3ZRWA 1VARA 4DRXB 3IJ4A 1Q6HA 5FPRA 2DYSB 1YTFD 3SJAC 4BR6A 1AB3A 4IYHA 4DV6O 1VF7A 1ZUQA 3HPLC 2D3OW 1N33O 2KG7B 1AJNA 1YDXA 2GUZB 4NXMB 4DR2B 5EC2C 4AI8A 3L74H 1S5LZ 3OR6C 2VWKA 1VQ6V 1BHBA 5EZYB 1IURA 1QR8A 3BABA 3E35A 1Y74B 1ZAUA 3L72H 2XUMA 3KZIZ 3AK3A 3K5LA 2Z5UA 1QLEB 3CS5A 4I7ZB 3JASB 5BZBA 2NLJC 1VQ7V 2OCCC 3JAMN 4G28B 3I56V 1H2SB 3RN4A 4B7EA 1IBKO 2P06A 1WA8A 3JD2A 4R7CA 3J81N 1KUQA 4LH6A 5CA0A 3DXRA 1Y67A 4YJ3B 1KD1W 4X1KA 1H2KA 3D36A 3E8GA 1G4YB 4X66O 1HNWO 5F2VO 1G6UA 3N27A 2WWWA 1FKAO 1YI2V 2Q68A 4MS2A 3K04A 2YUAA 5BMVB 4K8ZA 2JGDB 4PA9A 1BCCH 5AG2A 1RM1C 1FYJA 3ICXA 3ZS8C 3RYCA 4I55B 5J2TB 2YDEA 4XDKA 2OIGA 4AHCA 1F51A 1B6QA 1IDSA 1Y6XA 2HEPA 3M99B 1NR7A 4DR3B 1BL8A 4B3SB 1NKDA 3JCUZ 1H2NA 3QTCA 2W0FC 2QGNA 3OEEG 5B1BB 2ETNA 4FZ1A 5LXTA 2AXTZ 1EBOA 1T5EA 1PNKA 3LSUA 4PA7A 4NXNO 3CMAV 2KQXA 4F6EA 2UUCO 4NB5A 2EIJB 2RCVA 4G2KA 3AG2C 2QKCA 4HNAB 2XNDG 3WB1A 3MHHC 4LP8A 5IJ0B 5B3SC 3HKEA 2Y4TA 2ZIMA 2N04A 3AG3C 1GN2A 1NU1H 3W7UA 5CBGA 3IFXA 3HKDB 2RNBA 4JI3O 4MW8A 3K79A 4LNUA 5JQGA 2LGWA 4CBCA 1Q86W 4D7TA 5B1AC 2QWQB 4UCVA 4X20A 4WF9V 4LF9O 2RMKB 4QPKA 4PV1B 4O4LB 2K1EA 3SJCC 2M6YA 4X1IB 1XNRB 1ZLZA 4MSWC 4H33A 4GT1A 3JYCA 5J2UB 3VQWA 4PJ0Z 1Y4MA 2IW5A 5IWAO 4GYCB 3HKCA 2MK3A 3MHSC 1I94O 4U3JB 4OX9B 2B5UA 4GZRB 4BIOA 2QWPB 4LF6B 5GW7A 3UCSC 4JI7O 1XMOO 3DTUB 2ZNIA 2JEUA 2B1GA 3SYAA 3BAAA 5KUKA 4UV8A 1M56B 1D5AA 4EB6A 1Q81W 1SQXH 4AQYO 1YVWA 4ZI7B 3CEIA 1AR4A 4YHHB 1GTOA 2PF4E 4R8CA 1GMGA 4PELA 4JI5B 2DQ0A 4LFAB 4WBNA 1QBZA 1M57C 4JYAO 4JI8O 2Q7EA 5B1NA 4UVBA 3UO3A 5GTIZ 4JI2O 2Q67A 2AGAA 1AROP 2KG7A 2GUZA 2XAGA 2W6IG 3ETEA 2M7WA 2CUGA 1NJIW 2IJJA 3D3QA 3LDDA 3P3NA 3SPJA 5KHIA 5EZYA 1OCZC 2EIKB 5LGUA 1FJGO 3QNEA 2KB1A 2CGNA 2ADPA 1HR0B 1DGSA 5JJNB 4O4HB 1I5YA 1AR1B 1N4CA 1XHZA 3JASA 1XOUA 4PDMA 2GSMB 4I0XB 4LFBO 3N2KB 2UXDB 3ZMTA 3P32A 3KCYA 5H6RA 2VS0A 1XMQO 3WG7C 5LYJA 5KMGA 3FAVB 4DR6B 3JAWB 4J42A 1IZ3A 3AG1C 4NTYA 4UFZA 1EZJA 3SYPA 1P7GA 4FLXA 5B5EZ 1XEQA 4YJ3A 5LP6B 5FNVA 3APQA 2IJKA 4TQFA 3WU2Z 2QTSA 3C3SA 1KKDA 5EC1C 5IE9A 3E86A 2DYRB 4YY3B 5BMVA 2JGDA 1M90W 4GUNA 1W0KG 4UB6Z 2P4KA 4Z1VA 4Q6GA 1AJQA 2WAMA 1TUEB 2WLMA 2Q5ZA 1HNZO 4I55A 5J2TA 5BR8O 4LF5B 2HJDA 3B09A 1WPBA 1SERA 1Q43A 1HWYA 1SZXA 1P49A 1NH2D 1W0JG 3K0GA 1WP8A 1GM7A 3L73H 2HVJC 4DXWA 5FLXN 2RN9A 4RWUA 3K58A 5KA5A 2EILB 4P2ZA 3QG5A 2Z3YA 2JIZG 3BVOA 2BTQB 1YHQV 3TJTA 4OGQB 2P5OA 4ZBMA 5LBQA 1I08A 3JCZA 2F4VO 3UO2A 4JI1O 4HAMA 4HNAA 5IYZB 2H3OA 5KA6A 3T1HO 3CCMV 1AILA 3FB7C 1VP7A 5IJ0A 1LNQA 1M93A 2Q73A 3AK2A 2VQEO 3KCXA 1N34B 2BCCH 3LDCA 3X2QC 1LR1A 2EBOA 2F1MA 2HKOA 1FXVA 2B9ZA 4KUMA 2BE3A 2QWOB 2EINC 2JRIA 3TXSA 1ZL8A 2W0XA 2VQFO 3JD0A 4AILC 2ZM6O 5J2UA 4DUZB 2LJ2A 5CA1B 4FLTA 1SETA 4U3JA 1QVGU 3FB5C 3RGBA 2QM4A 2ZXWB 3OR7C 1IBMO 2XAJA 3OMIB 2Y0IA 5DECA 3S3XA 2Y48A 4DUYO 1WB7A 2RJZA 5KLVH 1V54C 2ZT9B 1WN7A 2Q9LA 1XREA 4IIJB 2V7QG 4DV5O 1MSDA 4GX1A 1EN6A 4DV3B 1FS0G 1K8AW 4ZI7A 1RPRA 1J5EO 4DW1A 3LUTB 4LF8O 2PI5A 4EEQA 4JI6O 3R65A 2CDYA 3ZMUA 5BY1A 3T1YB 2ZR2A 4I4TB 2UXCO 4DV0B 3HR0A 2PYJA 1JOYA 1O9GA 3RVZA 3GVMA 4X9QA 1Y66A 4A5UB 2H8PC 3T1CA 4PHZA 1JMKC 2YXYA 5E79Z 4B7KA 1JQ0A 3CC7V 5EYPB 3VQYA 4LWSB 1HDJA 1KQSU 2ZKOA 4FZ0A 2PTMA 1QVFU 1BQ0A 2E76B 3L71H 2WLHA 4DV1B 2RDCA 2WSSG 4DR7B 3G6BA 4NXMO 1L8DA 4J7KA 2CTPA 2ZDIC 4DV4B 3HKBB 1VQ8V 3E22A 2BOCC 1G1XB 4F6RA 4O4HA 1E1QG 3AK1A 2WLLB 2BSKB 5D5QA 4OXSA 2AHZA 4I0XA 5KHGA 1XNQB 1E79G 3ZN1A 1TVKA 3QF7A 3THOA 4XDLA 2X6CA 1KMIZ 1BGYH 1VQNV 3CJHB 1M1KW 1O9HA 1M5IA 1MMMA 2N05A 2LQTA 4QE7A 5LP6A 2ARHA 2XTAA 1S5JA 2F95B 4UCTA 1COWG 1VF6A 3B4SA 3CD6V 3EVKA 4EFEA 2GV9A 3OW2U 3ZN0A 1JA8A 2CGOA 2WLJA 1QHTA 2DYSC 1Z5VA 1XILA 2UXXA 4JTCB 1QU7A 3FD9A 3OUSA 3JAKB 2GHYA 4JF3A 1SRYA 4P30A 4PA3A 4B3MB 2F43G 2YEVB 2L6LA 1GRJA 4B3SO 5LHHA 1R3IC 4TOIA 5CBFA 3ETGA 1JFFB 2AZ2A 1YXBA 3OD4A 3ABLC 1Q7YW 1V55C 4JV5B 1EN5A 3F5WC 2UU9O 1FXKC 4W4KA 1E1RG 2BTQA 4HZ3A 3PN1A 4DV2B 1JJOA 5KX5B 5KAIZ 1N0JA 3ASNB 4FJCC 3M8AA 4X65B 3MAQA 1YJ9V 4IGGA 1DF4A 2IH1C 4B3TB 3PJSK 5IYZA 3ZRVA 1U96A 4CH5A 3F7YC 3CCQV 2IJIA 3Q4HB 1VQ5V 1VQPV 2W6JG 4CC5A 3E8HA 3W7TA 2CK3G 4LFCB 3DC6A 2YXLA 2ITDC 2XAHA 2YI8A 1WB8A 2ZE7A 3K5MA 1H8EG 4XBFA 4K0KB 1SS3A 1SQVH 2ZE8A 2DMXA 3IGAC 3RYHA 3AEIA 1K5SA 1AI6A 1XNRO 4GKJB 4DW0A 4KHPB 4X1YB 2HFEC 3T2MA 2PYLA 2X7RB 2AZ0A 4FFBB 2Q0OC 3G4SV 5CA1A 3ZHSA 2GDSA 3FX7A 4OX9O 3ZIAG 1XBLA 4JYCA 2ODMA 3NXSA 3JATB 4PDVA 1US6A 1Q8IA 4LF6O 4NR1A 3KKYA 1R6KA 1UFIA 1YTFB 2OCCB 3OAAG 2JK5C 2GTSA 3BCCH 2OYQA 1UPGA 1NVPD 1F4NA 4X88A 2ZE5A 1TUBA 1P7BA 2HHHB 1FFXB 1R73A 4KFMA 4MTOA 4MTFA 3OFNG 3OMNB 1MG1A 3U0ZA 3C3TA 1IBLB 5LA6B 3CCLV 1L0NH 2Y4UA 4I4TA 4K35A 2OIEA 4LFAO 3IC7A 2XAQA 1SZTA 3FFQA 4TT3G 4FM0A 4LWSA 1GAXA 1QLNA 1OHHG 2ZNJA 4XDJA 1RM1B 5IY5B 3BFRA 4DV7B 1WPXA 5ITZB 3ZBHA 4WFAV 3SJQC 4ZHQB 2Y69C 3CYOA 4X64O 4EFBA 5H6QA 3HKBA 4MVMA 3E8FA 5D5PA 2Q69A 1N36B 4UXNA 2A0LA 2QM7A 1HR0O 1GN3A 2OWOA 1FXHA 2Q7HA 5A9GA 1SF9A 5GONA 5GTHZ 1HP8A 1WJZA 3SYOA 3AG2B 2YI9A 1RPOA 5DN6G 3OGCC 1KBHA 3H1HH 1XQ8A 2OT5A 3DSQA 3UKMA 1KU9A 5B3SB 1PNMA 4DR6O 3CJHA 5JCOC 1FFTB 1W2BU 1S0VA 3L75H 4TV8B 1YCIA 2WA3A 3AG3B 1FPOA 2B1IA 3ABMC 4LF4B 2ZQMA 5JWPA 3A8TA 4BW5A 4QPJA 3CCSV 1HNWB 3I5DA 4DR4B 3CSXA 1QQCA 2P22C 5B1AB 4MVOA 4I50A 3JD4A 5CB4A 4YY3O 5DEDA 2YIDA 1F7YA 3LNMB 1W59A 1BQZA 1Z2GA 3K5OA 2GBOA 4DK0A 3FYIB 3LSSA 3JAKA 3K08A 1F23A 4LF5O 5J9PC 2YEVA 1BE3H 3WB0A 1K34A 5LMNB 1JFFA 2HP8A 3VBBA 4DRXA 4UCOA 1VIBA 4D6TH 5HFLA 5CN0A 1X59A 5BXZA 2ILMA 3CXCU 4JZ2A 5KX5A 5IT9N 4UV9A 2ZR3A 4LR3A 5IJ9B 5E1AC 1OCOB 3FB6C 1Y76B 2QKSA 4JI4B 1SQQH 2YC0A 3ETDA 2FB5A 3J7AU 1JX9A 1Y74A 4FVMA 3LDEA 4YXWG 3T4DA 4LCUC 1N34O 1M4UA 5IYBO 2JVDA 3H1JH 1ROPA 3BA9A 1ZTEA 1FD9A 5EBMC 4JI3B 4MTXA 2JEXA 1H2LA 2DWEC 1M57B 1QNMA 3CCUV 4ASUG 3ZHTA 1VF6C 3R66A 2P7TC 3AG4C 3G67A 3RBZA 3W7WA 4MVSA 1YEWA 3OTOB 4ZOLB 4X1YA 4FFBA 4DUZO 4JAAA 1K33A 1SESA 2WPDG 4QJFB 1ENVA 1G8MA 5KUMA 3E89A 1OCZB 4OPAA 3S3WA 1I94B 4CH4A 2CAZC 2K9PA 3JATA 2YSUB 4DR5B 3OMAB 1GO3F 3QO7A 4H0LB 1DF5A 4P9PA 1H8HG 4KL1A 3ZHRA 1EFRG 3E83A 3WG7B 4TQDA 4O4IB 2V4DA 4PDLA 4WFFA 4DO2A 5L3FA 3CCEV 4JTAB 3DC5A 1OV9A 4NTWA 4R6ZA 4OPHA 2LGQA 4DV3O 1RFYA 4QIWF 4UVAA 3AG1B 1FFXA 1QCEA 1OCCC 3I55V 3KG2A 4PDRA 5LA6A 4YJ2B 5L3GA 3T1YO 3W7SA 2X6AA 3VQVA 4FPPA 4O2BB 1AI4A 4GCZA 4DV0O 1BSMA 1CPYA 5LOVB 3P3PA 3CX5F 2YS8A 4MVZA 4LF7B 3F7VC 3BY6A 1SKVA 5B66Z 4ZHQA 2UUBB 4DV1O 5IYCO 4DR7O 3A2FA 3HKDA 2YXHA 4X62B 4DV4O 2CE4A 4TV9B 1S5HC 1OCRC 1NBMG 3A0RA 3D36C 1KB9F 1S77D 4CZZA 4O4LA 4Z2WA 4X1IA 2FKXA 2DJVA 1LUVA 1JCHA 3WFVA 1XNQO 5LMUB 3CRRA 2NNUA 5HFMA 4C7UA 4O2AB 3K5NA 5IYDO 1Q3EA 2O57A 4DR1B 1KKCA 4WFBV 4K8XA 1D5NA 1B06A 1NH2B 1JVMA 4HYOA 3STLC 5CA0B 2HG5C 2AHYA 3DXRB 4N21A 4RQEA 1KC8W 3P30A 3HB3B 3ASOC 1VQLV 5L3BA 1F4MA 5JJJB 1K4DC 4QE9A 3MD0A 1GM8A 4IHJB 2ATKC 5CA3A 1Q6IA 1R1BA 2EIMB 1PL4A 4B3MO 1H2MA 1K97A 4LH7A 1PM9A 2QKAA 2X6BA 2UXBB 3O9OA 2UUAB 4PA6A 3CXHF 3F5TA 3A0HZ 4GKKB 2P67A 4JYBA 4JV5O 1L0LH 3FB8C 4DV2O 1V54B 3QO5A 3SGIA 3K03A 2IJHA 4Q20A 1WNSA 4X65O 1XUQA 1Y76A 2ZCEA 3BRCA 4DR2O 4MVRA 2LW1A 4B3TO 4KP4A 2P90A 2A7WA 1GK9A 4JZGA 1EN4A 2IM9A 3QO8A 4NTXA 1ZX3A 5K1XA 2XOKG 2JDIG 2PGGA 4QGPA 5CMUA 4B3RB 3SPCA 4JAUA 2EZPA 1NS1A 1GM9A 1Q6UA 1B3QA 2YIBA 4LFCO 4PD4F 3IC9A 4RAIA 4H44B 1NTMH 1THZA 3N2KA
chains in the Genus database with same CATH topology
1S5LZ 5B66Z 5GTIZ 5B5EZ 2AXTZ 3KZIZ 5E79Z 3WU2Z 5GTHZ 5KAFZ 3A0BZ 3A0HZ 4PJ0Z 4IL6Z 5H2FZ 5KAIZ 5TISZ 4UB8Z 4UB6Z 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  5B66 Z;  5GTI Z;  5B5E Z;  2AXT Z;  3KZI Z;  5E79 Z;  3WU2 Z;  5GTH Z;  5KAF Z;  3A0B Z;  3A0H Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  5KAI Z;  5TIS Z;  4UB8 Z;  4UB6 Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 5EIB D;  5JQG B;  4LNU B;  3D8C A;  1PL0 A;  4K0K O;  1PD3 A;  3FAV A;  4W4L A;  4FLZ A;  3JAW A;  4X20 B;  3TK1 A;  3B2E E;  5C8Y B;  4RQF A;  5EBL C;  1K4C C;  1YJN V;  5CBH A;  4UUJ C;  4ZOL A;  4GKJ O;  1IVS A;  4WFG A;  1X4T A;  4KHP O;  2QSA A;  3SYC A;  4QNH B;  1RSO B;  3ZMZ A;  1N8R W;  3B8M A;  5B1O A;  3J80 N;  4R50 A;  2R9R B;  1IBM B;  4J9Z B;  3GWK C;  5EIB C;  5FL7 G;  2HLD G;  3A0B Z;  4DK1 A;  1D2D A;  1VF5 B;  2LW7 A;  1K5Q A;  1SQB H;  3SPI A;  1Q5O A;  2Q8V A;  3ABK B;  4LBE C;  4TUY B;  4FFK A;  4K3A A;  1AI5 A;  3OEH G;  4DR3 O;  1PNL A;  4G27 B;  4JI0 B;  3ZHQ A;  3RW0 A;  4NKG B;  2HHH O;  3W7X A;  3TGU H;  1OZ0 A;  3GB7 C;  4FLV A;  1SQF A;  2Q4P A;  3CRA A;  2EJ7 A;  2Y0P A;  4YJ2 A;  1IBL O;  1BT8 A;  5H2F Z;  4U3F H;  2UXC B;  1QLE C;  3M7M X;  1IXB A;  3GWO A;  4EKW A;  5KHJ A;  5LOV A;  1S3J A;  4F4L A;  4DV7 O;  3UM7 A;  2RQ6 A;  4JTD B;  4CS2 A;  3OM3 B;  3U11 A;  3AG7 A;  4FIP C;  3B40 A;  1K7D A;  4TV9 A;  3H1I H;  5IDJ A;  3LSQ A;  3K59 A;  1BS3 A;  3N2G B;  3ABL B;  3C90 A;  1N36 O;  1V55 B;  4FMT A;  1FXK B;  4UCU A;  2BOB C;  1YJW V;  2YIC A;  2ADQ B;  4IYI A;  3RFR A;  1MNG A;  5TIS Z;  4O2A A;  4MVQ A;  2QWR B;  5LYJ B;  5KMG B;  1N32 B;  2ITC C;  3EHB B;  1K9M W;  3NR7 A;  2Q6A A;  5B1B C;  2EJR A;  4FK5 C;  4LF4 O;  1I0H A;  3CCR V;  1SA0 B;  5FNV B;  4IIJ A;  3CRC A;  2L35 A;  4DR4 O;  2EIJ C;  4CH3 A;  2NR5 A;  2E5L B;  2CTW A;  2ZD9 A;  5LGT A;  2R72 A;  4IHJ A;  3K9A A;  1ORQ C;  5IY5 C;  4YHH O;  4HBN A;  5KAF Z;  2LO1 A;  4TWK A;  4JI5 O;  1JPX A;  2A06 H;  3VOU A;  2LFR A;  2KKW A;  2PI4 A;  3CCV V;  1VQ4 V;  5LMN O;  1HNX B;  3ABU A;  1N0N A;  4JAV A;  5FPO A;  2A3Q A;  5EYP A;  2AW9 A;  4E2L A;  2UXN A;  1Q82 W;  2E3C A;  2UU9 B;  4DV6 B;  1PKX A;  2DN9 A;  4Z1M G;  5LL6 Y;  4DYL A;  5DM6 V;  1N33 B;  3CHX A;  1XI1 A;  4JI4 O;  1SC5 B;  1CEZ A;  4PI2 A;  4GX0 A;  3H1L H;  3ZX6 A;  3FYE B;  1JJ2 U;  3SYQ A;  1NR1 A;  2JJ1 G;  1H38 A;  4O4J B;  2QDO A;  4B08 A;  1XDC A;  2WLL A;  3TXQ A;  2BSK A;  2ZE6 A;  2P4V A;  3RYI B;  4P9O A;  1EZV H;  2UXD O;  1XHX A;  1NZ6 A;  2NN4 A;  1XL4 A;  1IBK B;  3K3W A;  2ZIN A;  1R6T A;  4YIO A;  1M56 C;  5C8Y A;  4UCR A;  5JH7 B;  1NVP B;  1ZL8 B;  4YIP A;  3OTO O;  2PUS A;  2EUL A;  2Y69 B;  3SPG A;  2ZDI A;  1YF2 A;  3ZRX A;  1RSO A;  1R3L C;  1A32 A;  2QM8 A;  1UJW B;  4X66 B;  3UT5 B;  1URF A;  2JGU A;  2YIB D;  4J7Z A;  4DR5 O;  3D3I A;  4JPR A;  2PY5 A;  1ZWI C;  2QTO A;  4J80 A;  3K0D A;  1AI7 A;  4MVU A;  4TUY A;  4MT8 A;  3RYF B;  2F23 A;  2A9H A;  2FTK A;  5H9C A;  1OCO C;  3U10 A;  2GTA A;  4ZKI A;  3G80 A;  2EIK C;  1VQK V;  3ABM B;  1VEW A;  4ICG A;  2FL4 A;  1IX9 A;  4NXN B;  2WLI B;  3OT7 A;  3QVN A;  1YIT V;  2E74 B;  3EXA A;  2UUC B;  2XHB A;  2QA4 V;  1CXZ B;  2EZO A;  4IL6 Z;  4FM1 A;  2DW4 A;  1Q90 D;  3Q4H A;  3G71 V;  4LF7 O;  2R9A A;  3ETQ A;  2PZS A;  3DGE A;  2UUB O;  3CPW U;  1BMF G;  2XAF A;  4FM2 A;  1NQT A;  4X64 B;  4X62 O;  3B8N A;  2JJ2 G;  5LP6 C;  1I7F A;  3OE7 G;  3MDS A;  3H9V A;  3N2G A;  3SR2 C;  3E22 B;  1FXK A;  3K9S A;  2DYR C;  2WLN A;  4LF9 B;  4F6R B;  4FLU A;  3H01 A;  4D7S A;  1NI8 A;  1JR9 A;  1DK1 A;  1IXM A;  1TA8 A;  1MOF A;  5LMU O;  4BAY A;  5JVD B;  1GKF A;  2OTJ V;  1J95 A;  1TVK B;  2DE0 X;  4J11 A;  3UQ8 A;  5IWA B;  4DR1 O;  3OGI B;  5KHH A;  1GN4 A;  4JGS A;  4X8A A;  3ZRS A;  4GX2 A;  2VWJ A;  4JI7 B;  3JAL B;  1XMO B;  2C2A A;  2EIL C;  1AP6 A;  2H94 A;  1SA0 A;  1L1F A;  1WLE A;  4UVC A;  4MW3 A;  4GLX A;  1NTK H;  5EBW C;  3CRM A;  1K73 W;  3BA8 A;  4FLW A;  5KHK A;  4PA4 A;  3FKS G;  3ZMV A;  2CH7 B;  3AG4 B;  4AQY B;  1DTO A;  4L8J A;  2DWD C;  1CP9 A;  3JAR B;  3WB2 A;  1WAZ A;  3L70 H;  2Q0A A;  4J7J A;  5LHI A;  3E2E A;  4LC1 A;  1FAF A;  2E75 B;  4BIZ A;  1Z5W A;  1RP3 B;  1PV0 A;  2WLK A;  2X0L A;  2UXB O;  2Q7G A;  2IU3 A;  3RVY A;  3T4Z A;  2UUA O;  4JI8 B;  4JYA B;  3ZRW B;  4UB8 Z;  4GKK O;  4N23 A;  1AP5 A;  2HR3 A;  4J10 A;  3B77 A;  2DOS A;  4I9Q A;  3LNN A;  4JI2 B;  5ITZ A;  1MZF A;  3BHP A;  4X89 A;  2OCH A;  3IAY A;  3K06 A;  1M9N A;  3SDL A;  2F93 B;  4CS4 A;  3L9D A;  2WA4 A;  3OUF A;  1H2G A;  5LHG A;  3CB2 A;  1OCC B;  1XL6 A;  4B3R O;  4O4J A;  1FJG B;  4BWA A;  2ZXW C;  3CE2 A;  4RUE A;  4JAS A;  5A2Q N;  5LGN A;  3STZ C;  1PP9 H;  1R3K C;  4RUF A;  3ZJZ A;  3RYI A;  3CC2 V;  1MAB G;  2EX3 A;  3VQX A;  4LFB B;  3CCJ V;  1NTZ H;  4L87 A;  4NYK A;  1B04 A;  3ZMS A;  4BW9 A;  1XMQ B;  2A79 B;  1GH6 A;  1WA8 B;  1AR5 A;  5JH7 A;  1S72 V;  3O65 A;  4TV8 A;  3RYH B;  1V9P A;  3ZHU A;  3ML0 A;  2V1D A;  2N74 A;  2R9I A;  3EFF K;  3X2Q B;  3JSN A;  5L3E A;  2G38 A;  3E8B A;  2VRZ A;  1K92 A;  2EIM C;  3ZHV A;  1LUW A;  3UT5 A;  1KP2 A;  1OCR B;  4X1K B;  3TET A;  4BIU A;  5JJE B;  2EIN B;  3ZED A;  4MTG A;  3BEH A;  1NT2 B;  2JS5 A;  4E4E A;  4GX5 A;  1SQG A;  4FLY A;  2XT9 A;  3RYF A;  1HNZ B;  3ZCC A;  3BPZ A;  3RYC B;  5BR8 B;  3H1K H;  1YSC A;  2CTR A;  4JI0 O;  5JCO A;  4I5S A;  4H13 B;  1TUB B;  4TSF G;  3ABT A;  2BTO A;  1OJH A;  1AJP A;  2IH3 C;  2F66 C;  1PPJ H;  1MA1 A;  2KSD A;  2P6J A;  2HJF C;  5LXT B;  2WLI A;  1AVM A;  1U97 A;  1QR9 A;  5IJ9 A;  5EK0 A;  3ASO B;  1BZK A;  1HW7 A;  2LP7 A;  2F4V B;  2YIA A;  3K57 A;  4JI1 B;  1YZB A;  3T1H B;  1SQP H;  3CWB H;  3TCU A;  2IU0 A;  2ZIO A;  1TAE A;  3HKE B;  1VQM V;  2QWN B;  1I5X A;  2OTL V;  1VQ9 V;  2VQE B;  1BHA A;  1TGO A;  3CP1 A;  4NVP A;  4CS3 A;  4WFE A;  4WFH A;  1GN6 A;  4ABM A;  5H5N A;  1MSW D;  2QEX V;  3CME V;  2HVK C;  4RO2 A;  1P84 F;  2VQF B;  3CC4 V;  2DQ3 A;  2CTQ A;  2ZM6 B;  5GON B;  5JVD A;  4UCS A;  3ABK C;  1KEC A;  1MZE A;  5L3D A;  2XAS A;  1EM1 A;  3JD3 A;  3HKC B;  4J41 A;  1N32 O;  2JS3 A;  1ZSP A;  1R6N A;  1VMG A;  3JSL A;  2FYU H;  4PI0 A;  5L3C A;  3JAL A;  2IBZ H;  2MW2 B;  4DUY B;  4WCE V;  1YIJ V;  1VQO V;  5K1P A;  3CRQ A;  4JYY A;  4O4I A;  3ASN C;  2R70 A;  4KXR A;  4CH6 A;  4DV5 B;  3G6E V;  4I50 B;  1K3E A;  2E5L O;  5CB4 B;  1P4R A;  2QE7 G;  2CH7 A;  1DLB A;  4U7N A;  2FML A;  4ZIB A;  4EB6 B;  3SPH A;  1J5E B;  4I9W A;  5C93 A;  3JAR A;  4LF8 B;  1KYO F;  4JI6 B;  1WP7 A;  2Z0A A;  1R3J C;  2QR4 A;  3JD1 A;  4O2B A;  1KP3 A;  4IT5 A;  3RWR D;  2LFS A;  3SJB C;  3APO A;  4H37 A;  4CC6 A;  4J9Y B;  4U7O A;  3RT3 C;  1HNX O;  2QJ1 A;  4WBN B;  3OTF A;  2D2C B;  1S76 D;  3ZRW A;  1VAR A;  4DRX B;  3IJ4 A;  1Q6H A;  5FPR A;  2DYS B;  1YTF D;  3SJA C;  4BR6 A;  1AB3 A;  4IYH A;  4DV6 O;  1VF7 A;  1ZUQ A;  3HPL C;  2D3O W;  1N33 O;  2KG7 B;  1AJN A;  1YDX A;  2GUZ B;  4NXM B;  4DR2 B;  5EC2 C;  4AI8 A;  3L74 H;  1S5L Z;  3OR6 C;  2VWK A;  1VQ6 V;  1BHB A;  5EZY B;  1IUR A;  1QR8 A;  3BAB A;  3E35 A;  1Y74 B;  1ZAU A;  3L72 H;  2XUM A;  3KZI Z;  3AK3 A;  3K5L A;  2Z5U A;  1QLE B;  3CS5 A;  4I7Z B;  3JAS B;  5BZB A;  2NLJ C;  1VQ7 V;  2OCC C;  3JAM N;  4G28 B;  3I56 V;  1H2S B;  3RN4 A;  4B7E A;  1IBK O;  2P06 A;  1WA8 A;  3JD2 A;  4R7C A;  3J81 N;  1KUQ A;  4LH6 A;  5CA0 A;  3DXR A;  1Y67 A;  4YJ3 B;  1KD1 W;  4X1K A;  1H2K A;  3D36 A;  3E8G A;  1G4Y B;  4X66 O;  1HNW O;  5F2V O;  1G6U A;  3N27 A;  2WWW A;  1FKA O;  1YI2 V;  2Q68 A;  4MS2 A;  3K04 A;  2YUA A;  5BMV B;  4K8Z A;  2JGD B;  4PA9 A;  1BCC H;  5AG2 A;  1RM1 C;  1FYJ A;  3ICX A;  3ZS8 C;  3RYC A;  4I55 B;  5J2T B;  2YDE A;  4XDK A;  2OIG A;  4AHC A;  1F51 A;  1B6Q A;  1IDS A;  1Y6X A;  2HEP A;  3M99 B;  1NR7 A;  4DR3 B;  1BL8 A;  4B3S B;  1NKD A;  3JCU Z;  1H2N A;  3QTC A;  2W0F C;  2QGN A;  3OEE G;  5B1B B;  2ETN A;  4FZ1 A;  5LXT A;  2AXT Z;  1EBO A;  1T5E A;  1PNK A;  3LSU A;  4PA7 A;  4NXN O;  3CMA V;  2KQX A;  4F6E A;  2UUC O;  4NB5 A;  2EIJ B;  2RCV A;  4G2K A;  3AG2 C;  2QKC A;  4HNA B;  2XND G;  3WB1 A;  3MHH C;  4LP8 A;  5IJ0 B;  5B3S C;  3HKE A;  2Y4T A;  2ZIM A;  2N04 A;  3AG3 C;  1GN2 A;  1NU1 H;  3W7U A;  5CBG A;  3IFX A;  3HKD B;  2RNB A;  4JI3 O;  4MW8 A;  3K79 A;  4LNU A;  5JQG A;  2LGW A;  4CBC A;  1Q86 W;  4D7T A;  5B1A C;  2QWQ B;  4UCV A;  4X20 A;  4WF9 V;  4LF9 O;  2RMK B;  4QPK A;  4PV1 B;  4O4L B;  2K1E A;  3SJC C;  2M6Y A;  4X1I B;  1XNR B;  1ZLZ A;  4MSW C;  4H33 A;  4GT1 A;  3JYC A;  5J2U B;  3VQW A;  4PJ0 Z;  1Y4M A;  2IW5 A;  5IWA O;  4GYC B;  3HKC A;  2MK3 A;  3MHS C;  1I94 O;  4U3J B;  4OX9 B;  2B5U A;  4GZR B;  4BIO A;  2QWP B;  4LF6 B;  5GW7 A;  3UCS C;  4JI7 O;  1XMO O;  3DTU B;  2ZNI A;  2JEU A;  2B1G A;  3SYA A;  3BAA A;  5KUK A;  4UV8 A;  1M56 B;  1D5A A;  4EB6 A;  1Q81 W;  1SQX H;  4AQY O;  1YVW A;  4ZI7 B;  3CEI A;  1AR4 A;  4YHH B;  1GTO A;  2PF4 E;  4R8C A;  1GMG A;  4PEL A;  4JI5 B;  2DQ0 A;  4LFA B;  4WBN A;  1QBZ A;  1M57 C;  4JYA O;  4JI8 O;  2Q7E A;  5B1N A;  4UVB A;  3UO3 A;  5GTI Z;  4JI2 O;  2Q67 A;  2AGA A;  1ARO P;  2KG7 A;  2GUZ A;  2XAG A;  2W6I G;  3ETE A;  2M7W A;  2CUG A;  1NJI W;  2IJJ A;  3D3Q A;  3LDD A;  3P3N A;  3SPJ A;  5KHI A;  5EZY A;  1OCZ C;  2EIK B;  5LGU A;  1FJG O;  3QNE A;  2KB1 A;  2CGN A;  2ADP A;  1HR0 B;  1DGS A;  5JJN B;  4O4H B;  1I5Y A;  1AR1 B;  1N4C A;  1XHZ A;  3JAS A;  1XOU A;  4PDM A;  2GSM B;  4I0X B;  4LFB O;  3N2K B;  2UXD B;  3ZMT A;  3P32 A;  3KCY A;  5H6R A;  2VS0 A;  1XMQ O;  3WG7 C;  5LYJ A;  5KMG A;  3FAV B;  4DR6 B;  3JAW B;  4J42 A;  1IZ3 A;  3AG1 C;  4NTY A;  4UFZ A;  1EZJ A;  3SYP A;  1P7G A;  4FLX A;  5B5E Z;  1XEQ A;  4YJ3 A;  5LP6 B;  5FNV A;  3APQ A;  2IJK A;  4TQF A;  3WU2 Z;  2QTS A;  3C3S A;  1KKD A;  5EC1 C;  5IE9 A;  3E86 A;  2DYR B;  4YY3 B;  5BMV A;  2JGD A;  1M90 W;  4GUN A;  1W0K G;  4UB6 Z;  2P4K A;  4Z1V A;  4Q6G A;  1AJQ A;  2WAM A;  1TUE B;  2WLM A;  2Q5Z A;  1HNZ O;  4I55 A;  5J2T A;  5BR8 O;  4LF5 B;  2HJD A;  3B09 A;  1WPB A;  1SER A;  1Q43 A;  1HWY A;  1SZX A;  1P49 A;  1NH2 D;  1W0J G;  3K0G A;  1WP8 A;  1GM7 A;  3L73 H;  2HVJ C;  4DXW A;  5FLX N;  2RN9 A;  4RWU A;  3K58 A;  5KA5 A;  2EIL B;  4P2Z A;  3QG5 A;  2Z3Y A;  2JIZ G;  3BVO A;  2BTQ B;  1YHQ V;  3TJT A;  4OGQ B;  2P5O A;  4ZBM A;  5LBQ A;  1I08 A;  3JCZ A;  2F4V O;  3UO2 A;  4JI1 O;  4HAM A;  4HNA A;  5IYZ B;  2H3O A;  5KA6 A;  3T1H O;  3CCM V;  1AIL A;  3FB7 C;  1VP7 A;  5IJ0 A;  1LNQ A;  1M93 A;  2Q73 A;  3AK2 A;  2VQE O;  3KCX A;  1N34 B;  2BCC H;  3LDC A;  3X2Q C;  1LR1 A;  2EBO A;  2F1M A;  2HKO A;  1FXV A;  2B9Z A;  4KUM A;  2BE3 A;  2QWO B;  2EIN C;  2JRI A;  3TXS A;  1ZL8 A;  2W0X A;  2VQF O;  3JD0 A;  4AIL C;  2ZM6 O;  5J2U A;  4DUZ B;  2LJ2 A;  5CA1 B;  4FLT A;  1SET A;  4U3J A;  1QVG U;  3FB5 C;  3RGB A;  2QM4 A;  2ZXW B;  3OR7 C;  1IBM O;  2XAJ A;  3OMI B;  2Y0I A;  5DEC A;  3S3X A;  2Y48 A;  4DUY O;  1WB7 A;  2RJZ A;  5KLV H;  1V54 C;  2ZT9 B;  1WN7 A;  2Q9L A;  1XRE A;  4IIJ B;  2V7Q G;  4DV5 O;  1MSD A;  4GX1 A;  1EN6 A;  4DV3 B;  1FS0 G;  1K8A W;  4ZI7 A;  1RPR A;  1J5E O;  4DW1 A;  3LUT B;  4LF8 O;  2PI5 A;  4EEQ A;  4JI6 O;  3R65 A;  2CDY A;  3ZMU A;  5BY1 A;  3T1Y B;  2ZR2 A;  4I4T B;  2UXC O;  4DV0 B;  3HR0 A;  2PYJ A;  1JOY A;  1O9G A;  3RVZ A;  3GVM A;  4X9Q A;  1Y66 A;  4A5U B;  2H8P C;  3T1C A;  4PHZ A;  1JMK C;  2YXY A;  5E79 Z;  4B7K A;  1JQ0 A;  3CC7 V;  5EYP B;  3VQY A;  4LWS B;  1HDJ A;  1KQS U;  2ZKO A;  4FZ0 A;  2PTM A;  1QVF U;  1BQ0 A;  2E76 B;  3L71 H;  2WLH A;  4DV1 B;  2RDC A;  2WSS G;  4DR7 B;  3G6B A;  4NXM O;  1L8D A;  4J7K A;  2CTP A;  2ZDI C;  4DV4 B;  3HKB B;  1VQ8 V;  3E22 A;  2BOC C;  1G1X B;  4F6R A;  4O4H A;  1E1Q G;  3AK1 A;  2WLL B;  2BSK B;  5D5Q A;  4OXS A;  2AHZ A;  4I0X A;  5KHG A;  1XNQ B;  1E79 G;  3ZN1 A;  1TVK A;  3QF7 A;  3THO A;  4XDL A;  2X6C A;  1KMI Z;  1BGY H;  1VQN V;  3CJH B;  1M1K W;  1O9H A;  1M5I A;  1MMM A;  2N05 A;  2LQT A;  4QE7 A;  5LP6 A;  2ARH A;  2XTA A;  1S5J A;  2F95 B;  4UCT A;  1COW G;  1VF6 A;  3B4S A;  3CD6 V;  3EVK A;  4EFE A;  2GV9 A;  3OW2 U;  3ZN0 A;  1JA8 A;  2CGO A;  2WLJ A;  1QHT A;  2DYS C;  1Z5V A;  1XIL A;  2UXX A;  4JTC B;  1QU7 A;  3FD9 A;  3OUS A;  3JAK B;  2GHY A;  4JF3 A;  1SRY A;  4P30 A;  4PA3 A;  4B3M B;  2F43 G;  2YEV B;  2L6L A;  1GRJ A;  4B3S O;  5LHH A;  1R3I C;  4TOI A;  5CBF A;  3ETG A;  1JFF B;  2AZ2 A;  1YXB A;  3OD4 A;  3ABL C;  1Q7Y W;  1V55 C;  4JV5 B;  1EN5 A;  3F5W C;  2UU9 O;  1FXK C;  4W4K A;  1E1R G;  2BTQ A;  4HZ3 A;  3PN1 A;  4DV2 B;  1JJO A;  5KX5 B;  5KAI Z;  1N0J A;  3ASN B;  4FJC C;  3M8A A;  4X65 B;  3MAQ A;  1YJ9 V;  4IGG A;  1DF4 A;  2IH1 C;  4B3T B;  3PJS K;  5IYZ A;  3ZRV A;  1U96 A;  4CH5 A;  3F7Y C;  3CCQ V;  2IJI A;  3Q4H B;  1VQ5 V;  1VQP V;  2W6J G;  4CC5 A;  3E8H A;  3W7T A;  2CK3 G;  4LFC B;  3DC6 A;  2YXL A;  2ITD C;  2XAH A;  2YI8 A;  1WB8 A;  2ZE7 A;  3K5M A;  1H8E G;  4XBF A;  4K0K B;  1SS3 A;  1SQV H;  2ZE8 A;  2DMX A;  3IGA C;  3RYH A;  3AEI A;  1K5S A;  1AI6 A;  1XNR O;  4GKJ B;  4DW0 A;  4KHP B;  4X1Y B;  2HFE C;  3T2M A;  2PYL A;  2X7R B;  2AZ0 A;  4FFB B;  2Q0O C;  3G4S V;  5CA1 A;  3ZHS A;  2GDS A;  3FX7 A;  4OX9 O;  3ZIA G;  1XBL A;  4JYC A;  2ODM A;  3NXS A;  3JAT B;  4PDV A;  1US6 A;  1Q8I A;  4LF6 O;  4NR1 A;  3KKY A;  1R6K A;  1UFI A;  1YTF B;  2OCC B;  3OAA G;  2JK5 C;  2GTS A;  3BCC H;  2OYQ A;  1UPG A;  1NVP D;  1F4N A;  4X88 A;  2ZE5 A;  1TUB A;  1P7B A;  2HHH B;  1FFX B;  1R73 A;  4KFM A;  4MTO A;  4MTF A;  3OFN G;  3OMN B;  1MG1 A;  3U0Z A;  3C3T A;  1IBL B;  5LA6 B;  3CCL V;  1L0N H;  2Y4U A;  4I4T A;  4K35 A;  2OIE A;  4LFA O;  3IC7 A;  2XAQ A;  1SZT A;  3FFQ A;  4TT3 G;  4FM0 A;  4LWS A;  1GAX A;  1QLN A;  1OHH G;  2ZNJ A;  4XDJ A;  1RM1 B;  5IY5 B;  3BFR A;  4DV7 B;  1WPX A;  5ITZ B;  3ZBH A;  4WFA V;  3SJQ C;  4ZHQ B;  2Y69 C;  3CYO A;  4X64 O;  4EFB A;  5H6Q A;  3HKB A;  4MVM A;  3E8F A;  5D5P A;  2Q69 A;  1N36 B;  4UXN A;  2A0L A;  2QM7 A;  1HR0 O;  1GN3 A;  2OWO A;  1FXH A;  2Q7H A;  5A9G A;  1SF9 A;  5GON A;  5GTH Z;  1HP8 A;  1WJZ A;  3SYO A;  3AG2 B;  2YI9 A;  1RPO A;  5DN6 G;  3OGC C;  1KBH A;  3H1H H;  1XQ8 A;  2OT5 A;  3DSQ A;  3UKM A;  1KU9 A;  5B3S B;  1PNM A;  4DR6 O;  3CJH A;  5JCO C;  1FFT B;  1W2B U;  1S0V A;  3L75 H;  4TV8 B;  1YCI A;  2WA3 A;  3AG3 B;  1FPO A;  2B1I A;  3ABM C;  4LF4 B;  2ZQM A;  5JWP A;  3A8T A;  4BW5 A;  4QPJ A;  3CCS V;  1HNW B;  3I5D A;  4DR4 B;  3CSX A;  1QQC A;  2P22 C;  5B1A B;  4MVO A;  4I50 A;  3JD4 A;  5CB4 A;  4YY3 O;  5DED A;  2YID A;  1F7Y A;  3LNM B;  1W59 A;  1BQZ A;  1Z2G A;  3K5O A;  2GBO A;  4DK0 A;  3FYI B;  3LSS A;  3JAK A;  3K08 A;  1F23 A;  4LF5 O;  5J9P C;  2YEV A;  1BE3 H;  3WB0 A;  1K34 A;  5LMN B;  1JFF A;  2HP8 A;  3VBB A;  4DRX A;  4UCO A;  1VIB A;  4D6T H;  5HFL A;  5CN0 A;  1X59 A;  5BXZ A;  2ILM A;  3CXC U;  4JZ2 A;  5KX5 A;  5IT9 N;  4UV9 A;  2ZR3 A;  4LR3 A;  5IJ9 B;  5E1A C;  1OCO B;  3FB6 C;  1Y76 B;  2QKS A;  4JI4 B;  1SQQ H;  2YC0 A;  3ETD A;  2FB5 A;  3J7A U;  1JX9 A;  1Y74 A;  4FVM A;  3LDE A;  4YXW G;  3T4D A;  4LCU C;  1N34 O;  1M4U A;  5IYB O;  2JVD A;  3H1J H;  1ROP A;  3BA9 A;  1ZTE A;  1FD9 A;  5EBM C;  4JI3 B;  4MTX A;  2JEX A;  1H2L A;  2DWE C;  1M57 B;  1QNM A;  3CCU V;  4ASU G;  3ZHT A;  1VF6 C;  3R66 A;  2P7T C;  3AG4 C;  3G67 A;  3RBZ A;  3W7W A;  4MVS A;  1YEW A;  3OTO B;  4ZOL B;  4X1Y A;  4FFB A;  4DUZ O;  4JAA A;  1K33 A;  1SES A;  2WPD G;  4QJF B;  1ENV A;  1G8M A;  5KUM A;  3E89 A;  1OCZ B;  4OPA A;  3S3W A;  1I94 B;  4CH4 A;  2CAZ C;  2K9P A;  3JAT A;  2YSU B;  4DR5 B;  3OMA B;  1GO3 F;  3QO7 A;  4H0L B;  1DF5 A;  4P9P A;  1H8H G;  4KL1 A;  3ZHR A;  1EFR G;  3E83 A;  3WG7 B;  4TQD A;  4O4I B;  2V4D A;  4PDL A;  4WFF A;  4DO2 A;  5L3F A;  3CCE V;  4JTA B;  3DC5 A;  1OV9 A;  4NTW A;  4R6Z A;  4OPH A;  2LGQ A;  4DV3 O;  1RFY A;  4QIW F;  4UVA A;  3AG1 B;  1FFX A;  1QCE A;  1OCC C;  3I55 V;  3KG2 A;  4PDR A;  5LA6 A;  4YJ2 B;  5L3G A;  3T1Y O;  3W7S A;  2X6A A;  3VQV A;  4FPP A;  4O2B B;  1AI4 A;  4GCZ A;  4DV0 O;  1BSM A;  1CPY A;  5LOV B;  3P3P A;  3CX5 F;  2YS8 A;  4MVZ A;  4LF7 B;  3F7V C;  3BY6 A;  1SKV A;  5B66 Z;  4ZHQ A;  2UUB B;  4DV1 O;  5IYC O;  4DR7 O;  3A2F A;  3HKD A;  2YXH A;  4X62 B;  4DV4 O;  2CE4 A;  4TV9 B;  1S5H C;  1OCR C;  1NBM G;  3A0R A;  3D36 C;  1KB9 F;  1S77 D;  4CZZ A;  4O4L A;  4Z2W A;  4X1I A;  2FKX A;  2DJV A;  1LUV A;  1JCH A;  3WFV A;  1XNQ O;  5LMU B;  3CRR A;  2NNU A;  5HFM A;  4C7U A;  4O2A B;  3K5N A;  5IYD O;  1Q3E A;  2O57 A;  4DR1 B;  1KKC A;  4WFB V;  4K8X A;  1D5N A;  1B06 A;  1NH2 B;  1JVM A;  4HYO A;  3STL C;  5CA0 B;  2HG5 C;  2AHY A;  3DXR B;  4N21 A;  4RQE A;  1KC8 W;  3P30 A;  3HB3 B;  3ASO C;  1VQL V;  5L3B A;  1F4M A;  5JJJ B;  1K4D C;  4QE9 A;  3MD0 A;  1GM8 A;  4IHJ B;  2ATK C;  5CA3 A;  1Q6I A;  1R1B A;  2EIM B;  1PL4 A;  4B3M O;  1H2M A;  1K97 A;  4LH7 A;  1PM9 A;  2QKA A;  2X6B A;  2UXB B;  3O9O A;  2UUA B;  4PA6 A;  3CXH F;  3F5T A;  3A0H Z;  4GKK B;  2P67 A;  4JYB A;  4JV5 O;  1L0L H;  3FB8 C;  4DV2 O;  1V54 B;  3QO5 A;  3SGI A;  3K03 A;  2IJH A;  4Q20 A;  1WNS A;  4X65 O;  1XUQ A;  1Y76 A;  2ZCE A;  3BRC A;  4DR2 O;  4MVR A;  2LW1 A;  4B3T O;  4KP4 A;  2P90 A;  2A7W A;  1GK9 A;  4JZG A;  1EN4 A;  2IM9 A;  3QO8 A;  4NTX A;  1ZX3 A;  5K1X A;  2XOK G;  2JDI G;  2PGG A;  4QGP A;  5CMU A;  4B3R B;  3SPC A;  4JAU A;  2EZP A;  1NS1 A;  1GM9 A;  1Q6U A;  1B3Q A;  2YIB A;  4LFC O;  4PD4 F;  3IC9 A;  4RAI A;  4H44 B;  1NTM H;  1THZ A;  3N2K A; 
#chains in the Genus database with same CATH homology
 1S5L Z;  5B66 Z;  5GTI Z;  5B5E Z;  2AXT Z;  3KZI Z;  5E79 Z;  3WU2 Z;  5GTH Z;  5KAF Z;  3A0B Z;  3A0H Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  5KAI Z;  5TIS Z;  4UB8 Z;  4UB6 Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...