3L70H

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l70H00
1BE3H 1P84F 3CXHF 3CX5F 1KYOF 1SQQH 3L75H 1SQXH 3BCCH 1L0NH 2A06H 3L74H 1PPJH 3H1HH 3H1KH 3H1JH 3CWBH 1PP9H 3H1LH 4PD4F 1SQBH 1SQVH 3L70H 3L72H 5KLVH 3L73H 1NTKH 1EZVH 4U3FH 1NU1H 2IBZH 4D6TH 2FYUH 1BCCH 1NTZH 1KB9F 1L0LH 3L71H 1NTMH 2BCCH 3H1IH 1BGYH 3TGUH 1SQPH
chains in the Genus database with same CATH superfamily
2A7WA 1RM1B 1WPBA 3OR6C 3CCUV 3T1HO 4W4LA 1DGSA 2FTKA 4I0XB 4AILC 1F4MA 5L3EA 1ZTEA 1FYJA 1U97A 1SA0A 1O9GA 3QNEA 3K5NA 2Y0IA 5CBHA 1I5XA 1YDXA 2WSSG 1VQLV 4CZZA 4LF4O 1ZSPA 2XAQA 1AROP 4JYYA 2Z3YA 4PA9A 2P5OA 4X1YA 3SYQA 1YHQV 3MD0A 4J9ZB 3JD3A 3BCCH 2WLJA 3JARB 1H2KA 2VS0A 1IXMA 1AP5A 1AILA 3NR7A 3M99B 4FM0A 1WA8B 1IDSA 2IBZH 4JI7B 3N2GA 3HR0A 4DV2O 3CCQV 1YZBA 1I08A 2ETNA 4LFCB 3QG5A 3SPHA 1PPJH 1RM1C 3H01A 3EFFK 2UUAB 2WLHA 1H38A 1NH2D 1JCHA 2JVDA 2VQEO 1D5AA 4MVSA 4JF3A 3SPGA 2JS3A 2RQ6A 3B40A 1IBLO 2P4KA 1PNKA 2JIZG 1SQFA 1QVGU 3D8CA 4TQFA 4TUYA 4X20B 1VMGA 2IJJA 1BL8A 3GB7C 1W0JG 4PD4F 1K34A 1KUQA 3LNNA 2XOKG 3ZMZA 2N05A 4PA4A 3O65A 1R6TA 3CCJV 5K1PA 3PN1A 3W7XA 3W7WA 4I50B 3OM3B 1VEWA 3M7MX 1KP2A 1I94B 3SYPA 1HP8A 3ZBHA 4RQFA 4I9QA 1S5HC 1M93A 1RPOA 2X6BA 2E75B 5LOVA 1MNGA 3G6BA 2P06A 1BE3H 3C3SA 5IDJA 1OCCB 4JI7O 3L75H 5E79Z 3E83A 5JH7B 2QTSA 1JOYA 4UFZA 1Q5OA 3AK1A 2WWWA 5BXZA 2QDOA 2JRIA 1DK1A 1IVSA 5KA6A 4LFCO 4MS2A 2FL4A 2L6LA 2DQ0A 4O4LA 5FL7G 2P6JA 4DRXA 3A0BZ 1BHAA 5EC2C 2HEPA 4PA3A 3K08A 2HLDG 2PF4E 2QSAA 5LA6B 2HKOA 1K92A 5LXTA 1YJ9V 4J9YB 3I56V 2Z5UA 1H2NA 4H0LB 3N2KA 4QPKA 4JI2O 4IGGA 4TSFG 4LC1A 4FLZA 1XNRB 3CD6V 3K9AA 1P4RA 4I9WA 5GONB 1KKDA 3BRCA 2PTMA 3QTCA 1EBOA 3EXAA 2GUZA 2OT5A 5J2TA 4CC6A 3HKBA 1WAZA 1OCCC 4O2AB 4OXSA 3H1JH 4UXNA 3L70H 4O4IB 1Q7YW 4O4HA 4FZ0A 4LF9O 4EKWA 1YITV 4O4JA 1VF5B 1KKCA 4Z1VA 1I94O 2ADQB 1P84F 2YC0A 4LWSB 2YS8A 3W7TA 1RSOA 2IH3C 1ZL8A 4IYIA 1B06A 2CGOA 4CH3A 3L71H 4B7EA 2IU3A 1Y4MA 3CEIA 4MTXA 5L3GA 3K06A 2IM9A 2VWKA 2WLIA 4UCOA 1WPXA 4MSWC 4YHHO 5LYJA 4B3SO 4JYAB 2ZCEA 5IYCO 1XNRO 2Q0OC 3P32A 3E8HA 3UCSC 1PKXA 2JGUA 4RUFA 3AG3C 4H33A 4JI5B 5BMVA 3T4ZA 1Y74B 3SGIA 3ZRXA 4EFEA 2A79B 3J80N 2H3OA 5JJJB 4KL1A 2ZIOA 1GN3A 1QR8A 4EB6B 3K9SA 1B6QA 1E1RG 2O57A 5FPOA 5GTIZ 2DOSA 4FJCC 4JI1O 4DV0B 2CTWA 2WA3A 4J10A 2UXCB 5FNVA 1QCEA 1SQBH 2B5UA 1VP7A 1TUBB 1G1XB 1J5EB 1SZTA 1PL4A 1KQSU 4TQDA 3BA8A 3KG2A 4XDLA 3OR7C 4PI2A 4JZGA 4DV6B 2P22C 1X4TA 3OFNG 4P2ZA 1PNMA 1GH6A 2RJZA 2AHZA 4K3AA 5LP6A 1Q82W 2F95B 3WB0A 1SERA 2EJ7A 1HWYA 2PGGA 3RYFB 2UUCB 5B1AC 4P9PA 3ZN1A 1DTOA 3ZHUA 3NXSA 3X2QC 2R9AA 2CAZC 2WLKA 4DR7B 1Q8IA 2VRZA 1R3KC 3JATB 3QO7A 3CMEV 1E1QG 3LUTB 4GX0A 1FFXB 2LFSA 2PI5A 2IH1C 1VQ6V 5BY1A 4JYAO 4CS2A 4FM1A 3L72H 1FXHA 2ZR3A 5F2VO 4LF5B 1E79G 2ITCC 1JFFB 1H2SB 5JVDB 2LW1A 2QWNB 5B1OA 5IJ0B 3ABKC 4ABMA 4K35A 4U3JA 3WU2Z 1XMQB 5LBQA 2ADPA 4GX5A 4I5SA 4MTGA 4LF7B 1NH2B 3G6EV 3ZHTA 1G6UA 1B04A 1LNQA 4JPRA 4FFBB 4F4LA 1OHHG 5H9CA 1VQMV 1N36O 2QA4V 2F93B 3SPIA 3K5LA 2UXCO 2DYSB 3K59A 1Q6UA 2ITDC 3R66A 4A5UB 2Y69B 3BVOA 2LJ2A 3T1YB 1MABG 1GN6A 3K04A 3SJAC 1NT2B 2OWOA 3ASOB 4DV7B 3KCXA 2QM7A 4B7KA 2W6IG 4QNHB 1LUVA 4QE7A 5H2FZ 2NNUA 2WPDG 4KHPB 1I5YA 3OUFA 2YIBD 4I4TB 5CB4A 5H5NA 4IYHA 2RCVA 3E86A 2X7RB 5C93A 3ZS8C 2AW9A 4XDKA 2QKCA 4OGQB 4DR7O 1M57C 3JSLA 5KA5A 1MG1A 2YXYA 3FKSG 5AG2A 1N34B 2NR5A 4ICGA 3CE2A 4GT1A 1XMOB 4LF6O 1CPYA 3ABLB 1N0NA 5L3FA 3ZMSA 5DECA 2LGQA 2CH7B 4LF5O 4E4EA 3OT7A 2Y69C 5IY5C 2EZOA 4GCZA 5EBLC 3A0HZ 3ZIAG 1XMQO 4BR6A 4EFBA 4ZBMA 3ASOC 3SDLA 1F51A 4LF7O 3CCLV 1AJQA 3HPLC 3B09A 1F23A 1T5EA 2QE7G 5IJ9B 2UXDO 1COWG 1VQOV 3U0ZA 4C7UA 4R8CA 1L8DA 3T1YO 3HKDA 2UXNA 3THOA 3MAQA 1K97A 4FVMA 1X59A 4DUZB 4DV7O 2Y4TA 1GN4A 2QWRB 2GSMB 2XAJA 1AI5A 3P30A 5C8YA 5CA1B 1RPRA 4KHPO 4FM2A 1PNLA 2YICA 4JAVA 3APOA 4PA6A 4IIJB 3CJHA 2JGDB 1JJ2U 3ZMTA 1M56B 4QGPA 1D5NA 2Q7GA 1FXKC 4X1KB 4CBCA 2DN9A 4GYCB 3HB3B 2EIKC 1SF9A 3UT5A 3STLC 4J42A 2DMXA 2BSKA 1GTOA 4BIZA 2JS5A 2P90A 4WBNA 2ZINA 5FPRA 5CBFA 5J2UB 1WN7A 4QE9A 2HG5C 3FAVB 2EILB 2RN9A 4F6EA 5EZYA 2HJDA 1XI1A 1N32B 1HNWB 1QU7A 2ZNJA 3JALB 2WLLA 2EBOA 4JYCA 2YSUB 3CX5F 1ZAUA 2E74B 3RVZA 4QPJA 1QNMA 5LMNB 3TXSA 3ZRVA 1XHXA 2YEVB 3CYOA 1KECA 2ATKC 3E22B 1M56C 2Y0PA 1IXBA 4YIPA 5EIBC 3RYHA 1K9MW 3B8MA 2F4VB 1IBMO 1L0NH 4YJ2B 4DUZO 2P7TC 2IU0A 1NR1A 4WFBV 3UO3A 4BIOA 3AEIA 4RWUA 1V55B 5KLVH 4JI0B 4MW8A 4FPPA 4DW0A 1OCZB 1NU1H 3L9DA 4D6TH 2YIAA 1YF2A 3A0RA 4I50A 1N8RW 3CCSV 1NKDA 2EILC 3ZN0A 1MMMA 4PDLA 3VQYA 5KHIA 3TK1A 1P7BA 1P49A 4IHJA 1QLNA 3K3WA 4DR1B 1XEQA 5B66Z 1LR1A 4DR4B 5BR8O 3Q4HB 1JVMA 2EJRA 1ZX3A 4D7TA 4NR1A 1JX9A 2HJFC 1S77D 3OEHG 2G38A 1W0KG 1XILA 1XNQB 1R1BA 1VQ4V 2Q73A 2CTRA 2D2CB 4O2BB 1GRJA 4QIWF 3AG4B 5EYPB 3LSQA 1N32O 1HNWO 3K03A 4LF8O 1H8EG 1BSMA 3ZRSA 3SYCA 1YEWA 3JD0A 2GBOA 1V55C 3G71V 5L3CA 1SA0B 4JI4B 1OCZC 4B3MB 1EFRG 3JD1A 4LR3A 1OCOB 3J7AU 2H94A 1SQQH 1S0VA 2QM8A 3SPJA 3U10A 1L1FA 2DE0X 3SYAA 4X1YB 2Q4PA 2D3OW 5A9GA 3AG7A 2F4VO 4JTDB 5HFMA 2BTQA 1ZUQA 3JCZA 4CS4A 4NYKA 5K1XA 3OMNB 4JI0O 1N33B 4LFAB 3C3TA 3CP1A 4O4IA 1CP9A 2QTOA 3LDCA 4KFMA 1D2DA 3N2GB 1S5LZ 2X0LA 3RYCA 4DR5B 3AG4C 1TAEA 2KG7A 5A2QN 2VWJA 4DR1O 2UXXA 1GM8A 2XAGA 2ZDIA 2Q7EA 3STZC 2UUAO 1GM7A 4J7JA 1OCOC 2X6AA 3ABMB 4HNAA 2BTOA 3FYIB 1XL4A 4H13B 4JI8B 1NVPB 3OD4A 3APQA 1SETA 5DN6G 2DW4A 1JA8A 1YIJV 1ZWIC 1FPOA 4WFEA 1R3LC 4GUNA 2EZPA 3DXRA 1NTMH 2A0LA 2Q0AA 2BOCC 4WFHA 1XBLA 3OAAG 4DUYB 1QLEB 2UUBB 3UM7A 4JI4O 4B3MO 2DJVA 2LP7A 1QR9A 3ZRWA 1JMKC 3OMAB 3CCEV 4X1IA 1Y74A 2ZM6B 4R6ZA 5LOVB 5IE9A 1AP6A 5EIBD 1Q6HA 5KMGA 1N33O 4FLYA 2PY5A 5GW7A 1BQZA 1OV9A 4ZIBA 2KSDA 2XTAA 4DR5O 4I55A 1XQ8A 3E35A 2LW7A 3RVYA 4ZI7A 4GKKB 4Z2WA 1Q3EA 4O4LB 4DRXB 1M1KW 2OCHA 4RQEA 1QLEC 3RYIA 1K5SA 2GTSA 4H44B 3JAMN 4OPHA 1XDCA 5LXTB 2XHBA 4DV5B 1Q81W 4JI8O 1MSWD 5CA3A 1UJWB 4MT8A 3N2KB 1YTFB 2P67A 4J80A 1GK9A 2W0FC 4LP8A 4X89A 4ZOLA 2CTQA 4X9QA 4FFKA 1BZKA 4ZHQA 3H1LH 5ITZB 5B1NA 5JJEB 4DUYO 2UUBO 2GUZB 5J2TB 3HKBB 3SJBC 2QWQB 1R6KA 1J95A 4O4HB 3ZX6A 1M4UA 1EM1A 1QBZA 4O4JB 3G80A 1NI8A 2QGNA 5JQGA 3T1CA 1QVFU 2LO1A 5KX5A 2AHYA 4NTYA 1FJGB 2IJKA 3OMIB 4LH7A 1K73W 3K79A 1RSOB 1Z5WA 3K5MA 4Q6GA 1K4CC 4B3TB 3TGUH 1XOUA 1ZL8B 2XT9A 2LQTA 3S3WA 2K1EA 3HKCA 3OTFA 2AGAA 4WFFA 2A9HA 1XL6A 5LGNA 4XBFA 2M7WA 3H1HH 3ETEA 5CBGA 3ZCCA 3GVMA 4WCEV 3OUSA 3WG7B 1FAFA 2FKXA 3SYOA 3FFQA 2WLIB 3IC7A 1VARA 4MVOA 2V1DA 1VF6A 3F5WC 1VQPV 2QWPB 2OIEA 2JDIG 1U96A 1GN2A 5LYJB 1GAXA 5CA0A 1YI2V 4WFAV 4LNUA 1NJIW 4JZ2A 2Q67A 1G8MA 2JJ2G 3JASA 2XAFA 4LH6A 2AXTZ 4FLTA 5BMVB 4JI5O 4TV8A 2KKWA 2DYRB 2WAMA 3DSQA 3CXCU 1SQPH 3CCVV 2QJ1A 4JAAA 2L35A 4G27B 1BQ0A 1HDJA 3MHSC 4BW9A 4DO2A 1UPGA 2Y48A 1KBHA 3CRAA 2Q8VA 4MTFA 5IYZB 3VOUA 3WB1A 4X62B 1JJOA 3ZHSA 3OE7G 3WG7C 1M5IA 5FNVB 4DV0O 1KP3A 1FJGO 1KC8W 1ROPA 3ICXA 3E2EA 3VQVA 1M90W 1J5EO 1FXKA 3CCMV 4B3TO 3TJTA 2OIGA 5KHGA 5L3BA 4DV6O 2YUAA 1NVPD 1RP3B 4DR6B 5KAIZ 1IX9A 5LP6B 3BA9A 1HNZB 1TVKB 1URFA 3KZIZ 1HW7A 3M8AA 1BT8A 2RMKB 5KAFZ 2AZ0A 2UUCO 2E5LB 2GV9A 2DYRC 4ASUG 1WNSA 2R9RB 4YJ3A 3JD4A 2EINB 1JPXA 4GX2A 1MZEA 4YY3B 1EN6A 5KUMA 3BY6A 1Y76A 4PDMA 1K4DC 4UCVA 1KU9A 3DTUB 4J7ZA 3FX7A 3K5OA 4PI0A 2DYSC 1BHBA 5J9PC 2UXBB 4JAUA 4U3JB 4TT3G 2ZNIA 4JGSA 3FB5C 2VQFB 2F23A 3ZHRA 1WP7A 2HHHB 4AHCA 4DV1B 5DM6V 4TOIA 3QO5A 2DWDC 5GTHZ 3JAWA 3VBBA 3JCUZ 5LP6C 3JAKA 3BHPA 1MZFA 4DV3B 2P4VA 1I0HA 4X62O 2UU9B 1YCIA 4F6RA 3HKEA 2LGWA 4J7KA 4GLXA 3RFRA 1XREA 3OTOB 4UB8Z 2R72A 1I7FA 2CDYA 5LHIA 2EINC 4DR2B 3RWRD 3SR2C 4LBEC 2N04A 3T1HB 1N4CA 4I0XA 4Q20A 5LHHA 4DR6O 1NBMG 2Q5ZA 3LNMB 3ABLC 4LF4B 1YTFD 1AI6A 1HNZO 5D5QA 1FKAO 5CB4B 1OJHA 4P30A 2EIMB 2CK3G 5DEDA 1WB7A 1SKVA 1BS3A 2E76B 2XUMA 1YJWV 1SQGA 4YY3O 3JARA 3BFRA 3ZEDA 1N34O 2MK3A 2Y4UA 1WA8A 2PZSA 1XMOO 4J41A 1FXVA 1ZLZA 2XASA 5IYBO 2UXBO 5JCOC 2WLNA 1AI7A 4KXRA 2VQFO 1PV0A 5LL6Y 4OX9B 4JI3B 2HHHO 1H2MA 4CH4A 3EVKA 2HVJC 2Q9LA 4QJFB 2QM4A 2EULA 2K9PA 5E1AC 4DV3O 4PDVA 1AVMA 2UU9O 4AI8A 2ZE8A 2NN4A 4KUMA 1EN5A 4U7OA 1IBLB 4J11A 3IFXA 3OTOO 5EC1C 3LSSA 2NLJC 4X20A 2E3CA 2OTLV 4K8ZA 1G4YB 1XUQA 3HKDB 4LCUC 2KB1A 3ETQA 1A32A 4CS3A 4MTOA 2X6CA 4UCTA 4E2LA 1AR1B 2QEXV 3ZMUA 5C8YB 4B08A 5CMUA 2V7QG 1NZ6A 2ARHA 5B5EZ 3BEHA 4TV9B 1DF5A 1Z5VA 3JD2A 2PYLA 3C90A 4UCRA 3CJHB 1YJNV 2F1MA 1H2GA 3JSNA 1TGOA 1WP8A 1GMGA 3UT5B 2Z0AA 2M6YA 5KHJA 4FLWA 2BSKB 3GWOA 1S5JA 1NR7A 4WBNB 5JH7A 2R9IA 3T2MA 1AR5A 5EZYB 3LDEA 4OX9O 4JI3O 2WLLB 1R6NA 1JQ0A 2Q7HA 1O9HA 1NTKH 3E89A 2FMLA 3D36C 5EK0A 5LGUA 5LA6A 1L0LH 3ETDA 3H1IH 5LMNO 4JI2B 1YXBA 1K33A 1Y6XA 1VIBA 3IC9A 3IJ4A 3UQ8A 2YIBA 3ETGA 3E8BA 1BMFG 2W6JG 5B3SB 3EHBB 4X66B 1PL0A 4G28B 4U7NA 1NQTA 5GONA 4XDJA 3K57A 3RYHB 3TXQA 5BZBA 4I7ZB 3SJCC 3CRRA 4FLUA 2F66C 2CUGA 2KQXA 4MVRA 3AG1B 4IT5A 3W7UA 1FS0G 4PELA 3FD9A 4O2AA 1VF7A 3RGBA 3D3QA 3K58A 5L3DA 1R73A 4LF9B 1H2LA 2ZD9A 3UO2A 2FB5A 2H8PC 1PP9H 3I5DA 3BABA 4IHJB 1EZVH 5KUKA 1HNXB 3CC7V 3CC4V 4FK5C 1NTZH 3RT3C 4DR4O 1VQNV 4LWSA 1B3QA 4EEQA 3AK3A 4BW5A 4DV4B 3CSXA 1VQKV 3WFVA 1XNQO 2PUSA 5B3SC 3LSUA 3CHXA 4X65B 3AG2B 3S3XA 1SESA 2GDSA 3KCYA 4TUYB 3TETA 1Q86W 4NB5A 1FFTB 1KB9F 4HBNA 3AG1C 3G67A 1K8AW 1TA8A 2CGNA 4NTXA 4YHHB 3K0GA 1RFYA 4H37A 1AR4A 4MVUA 1K5QA 1NS1A 3FB7C 4B3SB 1KD1W 3A2FA 3H9VA 4X66O 1AJNA 5H6RA 4Z1MG 3CCRV 2OCCB 1Y67A 4D7SA 2BCCH 2GTAA 1BGYH 1M9NA 1CXZB 3R65A 2ZE5A 5LMUB 5ITZA 2V4DA 2QKSA 2BTQB 4FZ1A 3SPCA 4P9OA 4NXNB 1GKFA 3ABMC 4HAMA 4NXMB 1H8HG 4G2KA 4LFAO 2YIDA 4JASA 4EB6A 3AG2C 3ZJZA 3RYCB 2RNBA 1THZA 4CC5A 4FLXA 1K7DA 2KG7B 4JI1B 3ASNB 4K8XA 3I55V 2Q69A 3WB2A 1V54B 4HYOA 3AG3B 1HNXO 2N74A 4NVPA 1TUBA 4UVBA 2QWOB 3CWBH 3BAAA 4DV4O 4HNAB 1YVWA 2W0XA 1R3IC 3B77A 4JV5B 1VQ8V 1F7YA 2OCCC 4X65O 3CB2A 1Z2GA 5LGTA 4X88A 3P3PA 3DXRB 1SQXH 5TISZ 4DXWA 3RYFA 4LFBB 4KP4A 1SRYA 1QHTA 3VQXA 1IBKB 3OEEG 4NTWA 4L8JA 3JATA 4YIOA 3G4SV 4B3RB 1FFXA 2ZE6A 3ZRWB 3ASNC 1V54C 4X8AA 3IGAC 3CC2V 1YSCA 4X1IB 1UFIA 4JTCB 1JFFA 1W2BU 5B1AB 5JVDA 2ZDIC 5LMUO 5IJ0A 1S3JA 3CS5A 5FLXN 4DR3B 2ZM6O 4NXNO 3X2QB 2YDEA 4WFGA 1SZXA 2JEXA 4TWKA 1BCCH 3QO8A 5KMGB 1OCRB 4NXMO 3ZHQA 2MW2B 2HR3A 3CRQA 3B2EE 4BIUA 5IYZA 2ILMA 3MDSA 5B1BB 1EN4A 3LDDA 4FFBA 1HR0B 1N36B 4I55B 3DGEA 1EZJA 2JK5C 3JYCA 4ZI7B 2OTJV 3B8NA 3UKMA 1ENVA 4GKKO 5JWPA 4OPAA 3ABKB 5IYDO 4RUEA 3RYIB 2PI4A 1P7GA 4JI6B 5D5PA 4ZKIA 4DK0A 1PM9A 1Q90D 2Q6AA 4DK1A 3F5TA 4DV5O 1SC5B 1DF4A 3CRCA 3CXHF 2XAHA 3U11A 3TCUA 4FIPC 3SJQC 1ORQC 2JJ1G 4JV5O 3B4SA 2WLMA 4K0KB 1TVKA 2OYQA 3A8TA 1AJPA 2YI9A 4I4TA 1PD3A 3CPWU 4ZOLB 4LFBO 1MOFA 4ZHQB 3ABUA 2XNDG 2ZXWB 3RBZA 2A3QA 1IBKO 2DWEC 3IAYA 1OCRC 1K3EA 2EIJB 1KYOF 4CH6A 4GX1A 1MSDA 1US6A 2HFEC 5B1BC 5CN0A 2QKAA 4PV1B 4B3RO 4LF6B 5IWAB 4AQYB 2QR4A 4UV9A 2CH7A 5JQGB 2PYJA 4HZ3A 5KX5B 4R7CA 4GZRB 4DR3O 4PJ0Z 3ML0A 2Q68A 1M57B 2A06H 2AZ2A 3RN4A 4YXWG 1WJZA 2R70A 2WA4A 2EX3A 3FYEB 1SQVH 4X64B 3HKCB 3MHHC 1HR0O 4UVAA 2UXDB 4RAIA 5IJ9A 1KMIZ 5IY5B 2ZXWC 2ZE7A 4FMTA 4MW3A 1VQ5V 5JCOA 5KHHA 3QVNA 3DC5A 4JI6O 1AB3A 2EIJC 5EBWC 1GO3F 3FB6C 1IZ3A 3OW2U 1TUEB 4L87A 1JR9A 1S72V 5LHGA 1WB8A 5CA1A 4K0KO 2B1GA 5CA0B 4LNUB 1WLEA 1MA1A 1FD9A 3QF7A 4N21A 3OGIB 4IIJA 3JASB 4GKJB 5EBMC 2JGDA 4TV8B 3AK2A 2B9ZA 1XHZA 3F7YC 1IURA 2YI8A 3DC6A 4BWAA 3T4DA 4X1KA 2BOBC 4UCUA 2HP8A 3ZHVA 3CMAV 3CRMA 2F43G 3GWKC 5IWAO 4AQYO 2IJHA 1V9PA 2B1IA 1VQ7V 5J2UA 3FAVA 4PA7A 1VF6C 2IW5A 4UV8A 3L73H 1FXKB 1F4NA 3JALA 4PHZA 2FYUH 4CH5A 2GHYA 4UUJC 2EIKB 4X64O 3D3IA 4UCSA 5JJNB 4NKGB 2IJIA 5KHKA 4MVZA 2YEVA 3L74H 2JEUA 3H1KH 3KKYA 2ODMA 3K0DA 2ZKOA 1AI4A 2BE3A 3E22A 2E5LO 1S76D 4YJ3B 4MVMA 2RDCA 5HFLA 1R3JC 1IBMB 1N0JA 1DLBA 4YJ2A 1LUWA 3VQWA 2YXHA 1Y76B 3BPZA 3D36A 3W7SA 2ZQMA 4TV9A 5H6QA 2HVKC 4DV2B 4JTAB 2DQ3A 4GKJO 4FLVA 4UVCA 1VQ9V 4RO2A 3OGCC 3P3NA 4UB6Z 1OZ0A 5BR8B 1GM9A 5IT9N 3PJSK 3FB8C 3Q4HA 2C2AA 1SS3A 3ZMVA 3JAWB 3ABTA 4DV1O 4R50A 1QQCA 3O9OA 4W4KA 3JAKB 4WF9V 4N23A 2CE4A 3E8GA 3N27A 2VQEB 2ZIMA 4IL6Z 4JYBA 3J81N 2CTPA 1W59A 4F6RB 1Q43A 3HKEB 1CEZA 4PDRA 4U3FH 3F7VC 2LFRA 4O2BA 2ZT9B 1Y66A 3RW0A 5EYPA 2EIMC 4MVQA 4DW1A 4LF8B 4BAYA 2ZR2A 1Q6IA 3E8FA 2YXLA 4DYLA 4DR2O
chains in the Genus database with same CATH topology
1BE3H 1P84F 3CXHF 3CX5F 1KYOF 1SQQH 3L75H 1SQXH 3BCCH 1L0NH 2A06H 3L74H 1PPJH 3H1HH 3H1KH 3H1JH 3CWBH 1PP9H 3H1LH 4PD4F 1SQBH 1SQVH 3L70H 3L72H 5KLVH 3L73H 1NTKH 1EZVH 4U3FH 1NU1H 2IBZH 4D6TH 2FYUH 1BCCH 1NTZH 1KB9F 1L0LH 3L71H 1NTMH 2BCCH 3H1IH 1BGYH 3TGUH 1SQPH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  1P84 F;  3CXH F;  3CX5 F;  1KYO F;  1SQQ H;  3L75 H;  1SQX H;  3BCC H;  1L0N H;  2A06 H;  3L74 H;  1PPJ H;  3H1H H;  3H1K H;  3H1J H;  3CWB H;  1PP9 H;  3H1L H;  4PD4 F;  1SQB H;  1SQV H;  3L70 H;  3L72 H;  5KLV H;  3L73 H;  1NTK H;  1EZV H;  4U3F H;  1NU1 H;  2IBZ H;  4D6T H;  2FYU H;  1BCC H;  1NTZ H;  1KB9 F;  1L0L H;  3L71 H;  1NTM H;  2BCC H;  3H1I H;  1BGY H;  3TGU H;  1SQP H; 
#chains in the Genus database with same CATH topology
 2A7W A;  1RM1 B;  1WPB A;  3OR6 C;  3CCU V;  3T1H O;  4W4L A;  1DGS A;  2FTK A;  4I0X B;  4AIL C;  1F4M A;  5L3E A;  1ZTE A;  1FYJ A;  1U97 A;  1SA0 A;  1O9G A;  3QNE A;  3K5N A;  2Y0I A;  5CBH A;  1I5X A;  1YDX A;  2WSS G;  1VQL V;  4CZZ A;  4LF4 O;  1ZSP A;  2XAQ A;  1ARO P;  4JYY A;  2Z3Y A;  4PA9 A;  2P5O A;  4X1Y A;  3SYQ A;  1YHQ V;  3MD0 A;  4J9Z B;  3JD3 A;  3BCC H;  2WLJ A;  3JAR B;  1H2K A;  2VS0 A;  1IXM A;  1AP5 A;  1AIL A;  3NR7 A;  3M99 B;  4FM0 A;  1WA8 B;  1IDS A;  2IBZ H;  4JI7 B;  3N2G A;  3HR0 A;  4DV2 O;  3CCQ V;  1YZB A;  1I08 A;  2ETN A;  4LFC B;  3QG5 A;  3SPH A;  1PPJ H;  1RM1 C;  3H01 A;  3EFF K;  2UUA B;  2WLH A;  1H38 A;  1NH2 D;  1JCH A;  2JVD A;  2VQE O;  1D5A A;  4MVS A;  4JF3 A;  3SPG A;  2JS3 A;  2RQ6 A;  3B40 A;  1IBL O;  2P4K A;  1PNK A;  2JIZ G;  1SQF A;  1QVG U;  3D8C A;  4TQF A;  4TUY A;  4X20 B;  1VMG A;  2IJJ A;  1BL8 A;  3GB7 C;  1W0J G;  4PD4 F;  1K34 A;  1KUQ A;  3LNN A;  2XOK G;  3ZMZ A;  2N05 A;  4PA4 A;  3O65 A;  1R6T A;  3CCJ V;  5K1P A;  3PN1 A;  3W7X A;  3W7W A;  4I50 B;  3OM3 B;  1VEW A;  3M7M X;  1KP2 A;  1I94 B;  3SYP A;  1HP8 A;  3ZBH A;  4RQF A;  4I9Q A;  1S5H C;  1M93 A;  1RPO A;  2X6B A;  2E75 B;  5LOV A;  1MNG A;  3G6B A;  2P06 A;  1BE3 H;  3C3S A;  5IDJ A;  1OCC B;  4JI7 O;  3L75 H;  5E79 Z;  3E83 A;  5JH7 B;  2QTS A;  1JOY A;  4UFZ A;  1Q5O A;  3AK1 A;  2WWW A;  5BXZ A;  2QDO A;  2JRI A;  1DK1 A;  1IVS A;  5KA6 A;  4LFC O;  4MS2 A;  2FL4 A;  2L6L A;  2DQ0 A;  4O4L A;  5FL7 G;  2P6J A;  4DRX A;  3A0B Z;  1BHA A;  5EC2 C;  2HEP A;  4PA3 A;  3K08 A;  2HLD G;  2PF4 E;  2QSA A;  5LA6 B;  2HKO A;  1K92 A;  5LXT A;  1YJ9 V;  4J9Y B;  3I56 V;  2Z5U A;  1H2N A;  4H0L B;  3N2K A;  4QPK A;  4JI2 O;  4IGG A;  4TSF G;  4LC1 A;  4FLZ A;  1XNR B;  3CD6 V;  3K9A A;  1P4R A;  4I9W A;  5GON B;  1KKD A;  3BRC A;  2PTM A;  3QTC A;  1EBO A;  3EXA A;  2GUZ A;  2OT5 A;  5J2T A;  4CC6 A;  3HKB A;  1WAZ A;  1OCC C;  4O2A B;  4OXS A;  3H1J H;  4UXN A;  3L70 H;  4O4I B;  1Q7Y W;  4O4H A;  4FZ0 A;  4LF9 O;  4EKW A;  1YIT V;  4O4J A;  1VF5 B;  1KKC A;  4Z1V A;  1I94 O;  2ADQ B;  1P84 F;  2YC0 A;  4LWS B;  2YS8 A;  3W7T A;  1RSO A;  2IH3 C;  1ZL8 A;  4IYI A;  1B06 A;  2CGO A;  4CH3 A;  3L71 H;  4B7E A;  2IU3 A;  1Y4M A;  3CEI A;  4MTX A;  5L3G A;  3K06 A;  2IM9 A;  2VWK A;  2WLI A;  4UCO A;  1WPX A;  4MSW C;  4YHH O;  5LYJ A;  4B3S O;  4JYA B;  2ZCE A;  5IYC O;  1XNR O;  2Q0O C;  3P32 A;  3E8H A;  3UCS C;  1PKX A;  2JGU A;  4RUF A;  3AG3 C;  4H33 A;  4JI5 B;  5BMV A;  3T4Z A;  1Y74 B;  3SGI A;  3ZRX A;  4EFE A;  2A79 B;  3J80 N;  2H3O A;  5JJJ B;  4KL1 A;  2ZIO A;  1GN3 A;  1QR8 A;  4EB6 B;  3K9S A;  1B6Q A;  1E1R G;  2O57 A;  5FPO A;  5GTI Z;  2DOS A;  4FJC C;  4JI1 O;  4DV0 B;  2CTW A;  2WA3 A;  4J10 A;  2UXC B;  5FNV A;  1QCE A;  1SQB H;  2B5U A;  1VP7 A;  1TUB B;  1G1X B;  1J5E B;  1SZT A;  1PL4 A;  1KQS U;  4TQD A;  3BA8 A;  3KG2 A;  4XDL A;  3OR7 C;  4PI2 A;  4JZG A;  4DV6 B;  2P22 C;  1X4T A;  3OFN G;  4P2Z A;  1PNM A;  1GH6 A;  2RJZ A;  2AHZ A;  4K3A A;  5LP6 A;  1Q82 W;  2F95 B;  3WB0 A;  1SER A;  2EJ7 A;  1HWY A;  2PGG A;  3RYF B;  2UUC B;  5B1A C;  4P9P A;  3ZN1 A;  1DTO A;  3ZHU A;  3NXS A;  3X2Q C;  2R9A A;  2CAZ C;  2WLK A;  4DR7 B;  1Q8I A;  2VRZ A;  1R3K C;  3JAT B;  3QO7 A;  3CME V;  1E1Q G;  3LUT B;  4GX0 A;  1FFX B;  2LFS A;  2PI5 A;  2IH1 C;  1VQ6 V;  5BY1 A;  4JYA O;  4CS2 A;  4FM1 A;  3L72 H;  1FXH A;  2ZR3 A;  5F2V O;  4LF5 B;  1E79 G;  2ITC C;  1JFF B;  1H2S B;  5JVD B;  2LW1 A;  2QWN B;  5B1O A;  5IJ0 B;  3ABK C;  4ABM A;  4K35 A;  4U3J A;  3WU2 Z;  1XMQ B;  5LBQ A;  2ADP A;  4GX5 A;  4I5S A;  4MTG A;  4LF7 B;  1NH2 B;  3G6E V;  3ZHT A;  1G6U A;  1B04 A;  1LNQ A;  4JPR A;  4FFB B;  4F4L A;  1OHH G;  5H9C A;  1VQM V;  1N36 O;  2QA4 V;  2F93 B;  3SPI A;  3K5L A;  2UXC O;  2DYS B;  3K59 A;  1Q6U A;  2ITD C;  3R66 A;  4A5U B;  2Y69 B;  3BVO A;  2LJ2 A;  3T1Y B;  1MAB G;  1GN6 A;  3K04 A;  3SJA C;  1NT2 B;  2OWO A;  3ASO B;  4DV7 B;  3KCX A;  2QM7 A;  4B7K A;  2W6I G;  4QNH B;  1LUV A;  4QE7 A;  5H2F Z;  2NNU A;  2WPD G;  4KHP B;  1I5Y A;  3OUF A;  2YIB D;  4I4T B;  5CB4 A;  5H5N A;  4IYH A;  2RCV A;  3E86 A;  2X7R B;  5C93 A;  3ZS8 C;  2AW9 A;  4XDK A;  2QKC A;  4OGQ B;  4DR7 O;  1M57 C;  3JSL A;  5KA5 A;  1MG1 A;  2YXY A;  3FKS G;  5AG2 A;  1N34 B;  2NR5 A;  4ICG A;  3CE2 A;  4GT1 A;  1XMO B;  4LF6 O;  1CPY A;  3ABL B;  1N0N A;  5L3F A;  3ZMS A;  5DEC A;  2LGQ A;  2CH7 B;  4LF5 O;  4E4E A;  3OT7 A;  2Y69 C;  5IY5 C;  2EZO A;  4GCZ A;  5EBL C;  3A0H Z;  3ZIA G;  1XMQ O;  4BR6 A;  4EFB A;  4ZBM A;  3ASO C;  3SDL A;  1F51 A;  4LF7 O;  3CCL V;  1AJQ A;  3HPL C;  3B09 A;  1F23 A;  1T5E A;  2QE7 G;  5IJ9 B;  2UXD O;  1COW G;  1VQO V;  3U0Z A;  4C7U A;  4R8C A;  1L8D A;  3T1Y O;  3HKD A;  2UXN A;  3THO A;  3MAQ A;  1K97 A;  4FVM A;  1X59 A;  4DUZ B;  4DV7 O;  2Y4T A;  1GN4 A;  2QWR B;  2GSM B;  2XAJ A;  1AI5 A;  3P30 A;  5C8Y A;  5CA1 B;  1RPR A;  4KHP O;  4FM2 A;  1PNL A;  2YIC A;  4JAV A;  3APO A;  4PA6 A;  4IIJ B;  3CJH A;  2JGD B;  1JJ2 U;  3ZMT A;  1M56 B;  4QGP A;  1D5N A;  2Q7G A;  1FXK C;  4X1K B;  4CBC A;  2DN9 A;  4GYC B;  3HB3 B;  2EIK C;  1SF9 A;  3UT5 A;  3STL C;  4J42 A;  2DMX A;  2BSK A;  1GTO A;  4BIZ A;  2JS5 A;  2P90 A;  4WBN A;  2ZIN A;  5FPR A;  5CBF A;  5J2U B;  1WN7 A;  4QE9 A;  2HG5 C;  3FAV B;  2EIL B;  2RN9 A;  4F6E A;  5EZY A;  2HJD A;  1XI1 A;  1N32 B;  1HNW B;  1QU7 A;  2ZNJ A;  3JAL B;  2WLL A;  2EBO A;  4JYC A;  2YSU B;  3CX5 F;  1ZAU A;  2E74 B;  3RVZ A;  4QPJ A;  1QNM A;  5LMN B;  3TXS A;  3ZRV A;  1XHX A;  2YEV B;  3CYO A;  1KEC A;  2ATK C;  3E22 B;  1M56 C;  2Y0P A;  1IXB A;  4YIP A;  5EIB C;  3RYH A;  1K9M W;  3B8M A;  2F4V B;  1IBM O;  1L0N H;  4YJ2 B;  4DUZ O;  2P7T C;  2IU0 A;  1NR1 A;  4WFB V;  3UO3 A;  4BIO A;  3AEI A;  4RWU A;  1V55 B;  5KLV H;  4JI0 B;  4MW8 A;  4FPP A;  4DW0 A;  1OCZ B;  1NU1 H;  3L9D A;  4D6T H;  2YIA A;  1YF2 A;  3A0R A;  4I50 A;  1N8R W;  3CCS V;  1NKD A;  2EIL C;  3ZN0 A;  1MMM A;  4PDL A;  3VQY A;  5KHI A;  3TK1 A;  1P7B A;  1P49 A;  4IHJ A;  1QLN A;  3K3W A;  4DR1 B;  1XEQ A;  5B66 Z;  1LR1 A;  4DR4 B;  5BR8 O;  3Q4H B;  1JVM A;  2EJR A;  1ZX3 A;  4D7T A;  4NR1 A;  1JX9 A;  2HJF C;  1S77 D;  3OEH G;  2G38 A;  1W0K G;  1XIL A;  1XNQ B;  1R1B A;  1VQ4 V;  2Q73 A;  2CTR A;  2D2C B;  4O2B B;  1GRJ A;  4QIW F;  3AG4 B;  5EYP B;  3LSQ A;  1N32 O;  1HNW O;  3K03 A;  4LF8 O;  1H8E G;  1BSM A;  3ZRS A;  3SYC A;  1YEW A;  3JD0 A;  2GBO A;  1V55 C;  3G71 V;  5L3C A;  1SA0 B;  4JI4 B;  1OCZ C;  4B3M B;  1EFR G;  3JD1 A;  4LR3 A;  1OCO B;  3J7A U;  2H94 A;  1SQQ H;  1S0V A;  2QM8 A;  3SPJ A;  3U10 A;  1L1F A;  2DE0 X;  3SYA A;  4X1Y B;  2Q4P A;  2D3O W;  5A9G A;  3AG7 A;  2F4V O;  4JTD B;  5HFM A;  2BTQ A;  1ZUQ A;  3JCZ A;  4CS4 A;  4NYK A;  5K1X A;  3OMN B;  4JI0 O;  1N33 B;  4LFA B;  3C3T A;  3CP1 A;  4O4I A;  1CP9 A;  2QTO A;  3LDC A;  4KFM A;  1D2D A;  3N2G B;  1S5L Z;  2X0L A;  3RYC A;  4DR5 B;  3AG4 C;  1TAE A;  2KG7 A;  5A2Q N;  2VWJ A;  4DR1 O;  2UXX A;  1GM8 A;  2XAG A;  2ZDI A;  2Q7E A;  3STZ C;  2UUA O;  1GM7 A;  4J7J A;  1OCO C;  2X6A A;  3ABM B;  4HNA A;  2BTO A;  3FYI B;  1XL4 A;  4H13 B;  4JI8 B;  1NVP B;  3OD4 A;  3APQ A;  1SET A;  5DN6 G;  2DW4 A;  1JA8 A;  1YIJ V;  1ZWI C;  1FPO A;  4WFE A;  1R3L C;  4GUN A;  2EZP A;  3DXR A;  1NTM H;  2A0L A;  2Q0A A;  2BOC C;  4WFH A;  1XBL A;  3OAA G;  4DUY B;  1QLE B;  2UUB B;  3UM7 A;  4JI4 O;  4B3M O;  2DJV A;  2LP7 A;  1QR9 A;  3ZRW A;  1JMK C;  3OMA B;  3CCE V;  4X1I A;  1Y74 A;  2ZM6 B;  4R6Z A;  5LOV B;  5IE9 A;  1AP6 A;  5EIB D;  1Q6H A;  5KMG A;  1N33 O;  4FLY A;  2PY5 A;  5GW7 A;  1BQZ A;  1OV9 A;  4ZIB A;  2KSD A;  2XTA A;  4DR5 O;  4I55 A;  1XQ8 A;  3E35 A;  2LW7 A;  3RVY A;  4ZI7 A;  4GKK B;  4Z2W A;  1Q3E A;  4O4L B;  4DRX B;  1M1K W;  2OCH A;  4RQE A;  1QLE C;  3RYI A;  1K5S A;  2GTS A;  4H44 B;  3JAM N;  4OPH A;  1XDC A;  5LXT B;  2XHB A;  4DV5 B;  1Q81 W;  4JI8 O;  1MSW D;  5CA3 A;  1UJW B;  4MT8 A;  3N2K B;  1YTF B;  2P67 A;  4J80 A;  1GK9 A;  2W0F C;  4LP8 A;  4X89 A;  4ZOL A;  2CTQ A;  4X9Q A;  4FFK A;  1BZK A;  4ZHQ A;  3H1L H;  5ITZ B;  5B1N A;  5JJE B;  4DUY O;  2UUB O;  2GUZ B;  5J2T B;  3HKB B;  3SJB C;  2QWQ B;  1R6K A;  1J95 A;  4O4H B;  3ZX6 A;  1M4U A;  1EM1 A;  1QBZ A;  4O4J B;  3G80 A;  1NI8 A;  2QGN A;  5JQG A;  3T1C A;  1QVF U;  2LO1 A;  5KX5 A;  2AHY A;  4NTY A;  1FJG B;  2IJK A;  3OMI B;  4LH7 A;  1K73 W;  3K79 A;  1RSO B;  1Z5W A;  3K5M A;  4Q6G A;  1K4C C;  4B3T B;  3TGU H;  1XOU A;  1ZL8 B;  2XT9 A;  2LQT A;  3S3W A;  2K1E A;  3HKC A;  3OTF A;  2AGA A;  4WFF A;  2A9H A;  1XL6 A;  5LGN A;  4XBF A;  2M7W A;  3H1H H;  3ETE A;  5CBG A;  3ZCC A;  3GVM A;  4WCE V;  3OUS A;  3WG7 B;  1FAF A;  2FKX A;  3SYO A;  3FFQ A;  2WLI B;  3IC7 A;  1VAR A;  4MVO A;  2V1D A;  1VF6 A;  3F5W C;  1VQP V;  2QWP B;  2OIE A;  2JDI G;  1U96 A;  1GN2 A;  5LYJ B;  1GAX A;  5CA0 A;  1YI2 V;  4WFA V;  4LNU A;  1NJI W;  4JZ2 A;  2Q67 A;  1G8M A;  2JJ2 G;  3JAS A;  2XAF A;  4LH6 A;  2AXT Z;  4FLT A;  5BMV B;  4JI5 O;  4TV8 A;  2KKW A;  2DYR B;  2WAM A;  3DSQ A;  3CXC U;  1SQP H;  3CCV V;  2QJ1 A;  4JAA A;  2L35 A;  4G27 B;  1BQ0 A;  1HDJ A;  3MHS C;  4BW9 A;  4DO2 A;  1UPG A;  2Y48 A;  1KBH A;  3CRA A;  2Q8V A;  4MTF A;  5IYZ B;  3VOU A;  3WB1 A;  4X62 B;  1JJO A;  3ZHS A;  3OE7 G;  3WG7 C;  1M5I A;  5FNV B;  4DV0 O;  1KP3 A;  1FJG O;  1KC8 W;  1ROP A;  3ICX A;  3E2E A;  3VQV A;  1M90 W;  1J5E O;  1FXK A;  3CCM V;  4B3T O;  3TJT A;  2OIG A;  5KHG A;  5L3B A;  4DV6 O;  2YUA A;  1NVP D;  1RP3 B;  4DR6 B;  5KAI Z;  1IX9 A;  5LP6 B;  3BA9 A;  1HNZ B;  1TVK B;  1URF A;  3KZI Z;  1HW7 A;  3M8A A;  1BT8 A;  2RMK B;  5KAF Z;  2AZ0 A;  2UUC O;  2E5L B;  2GV9 A;  2DYR C;  4ASU G;  1WNS A;  2R9R B;  4YJ3 A;  3JD4 A;  2EIN B;  1JPX A;  4GX2 A;  1MZE A;  4YY3 B;  1EN6 A;  5KUM A;  3BY6 A;  1Y76 A;  4PDM A;  1K4D C;  4UCV A;  1KU9 A;  3DTU B;  4J7Z A;  3FX7 A;  3K5O A;  4PI0 A;  2DYS C;  1BHB A;  5J9P C;  2UXB B;  4JAU A;  4U3J B;  4TT3 G;  2ZNI A;  4JGS A;  3FB5 C;  2VQF B;  2F23 A;  3ZHR A;  1WP7 A;  2HHH B;  4AHC A;  4DV1 B;  5DM6 V;  4TOI A;  3QO5 A;  2DWD C;  5GTH Z;  3JAW A;  3VBB A;  3JCU Z;  5LP6 C;  3JAK A;  3BHP A;  1MZF A;  4DV3 B;  2P4V A;  1I0H A;  4X62 O;  2UU9 B;  1YCI A;  4F6R A;  3HKE A;  2LGW A;  4J7K A;  4GLX A;  3RFR A;  1XRE A;  3OTO B;  4UB8 Z;  2R72 A;  1I7F A;  2CDY A;  5LHI A;  2EIN C;  4DR2 B;  3RWR D;  3SR2 C;  4LBE C;  2N04 A;  3T1H B;  1N4C A;  4I0X A;  4Q20 A;  5LHH A;  4DR6 O;  1NBM G;  2Q5Z A;  3LNM B;  3ABL C;  4LF4 B;  1YTF D;  1AI6 A;  1HNZ O;  5D5Q A;  1FKA O;  5CB4 B;  1OJH A;  4P30 A;  2EIM B;  2CK3 G;  5DED A;  1WB7 A;  1SKV A;  1BS3 A;  2E76 B;  2XUM A;  1YJW V;  1SQG A;  4YY3 O;  3JAR A;  3BFR A;  3ZED A;  1N34 O;  2MK3 A;  2Y4U A;  1WA8 A;  2PZS A;  1XMO O;  4J41 A;  1FXV A;  1ZLZ A;  2XAS A;  5IYB O;  2UXB O;  5JCO C;  2WLN A;  1AI7 A;  4KXR A;  2VQF O;  1PV0 A;  5LL6 Y;  4OX9 B;  4JI3 B;  2HHH O;  1H2M A;  4CH4 A;  3EVK A;  2HVJ C;  2Q9L A;  4QJF B;  2QM4 A;  2EUL A;  2K9P A;  5E1A C;  4DV3 O;  4PDV A;  1AVM A;  2UU9 O;  4AI8 A;  2ZE8 A;  2NN4 A;  4KUM A;  1EN5 A;  4U7O A;  1IBL B;  4J11 A;  3IFX A;  3OTO O;  5EC1 C;  3LSS A;  2NLJ C;  4X20 A;  2E3C A;  2OTL V;  4K8Z A;  1G4Y B;  1XUQ A;  3HKD B;  4LCU C;  2KB1 A;  3ETQ A;  1A32 A;  4CS3 A;  4MTO A;  2X6C A;  4UCT A;  4E2L A;  1AR1 B;  2QEX V;  3ZMU A;  5C8Y B;  4B08 A;  5CMU A;  2V7Q G;  1NZ6 A;  2ARH A;  5B5E Z;  3BEH A;  4TV9 B;  1DF5 A;  1Z5V A;  3JD2 A;  2PYL A;  3C90 A;  4UCR A;  3CJH B;  1YJN V;  2F1M A;  1H2G A;  3JSN A;  1TGO A;  1WP8 A;  1GMG A;  3UT5 B;  2Z0A A;  2M6Y A;  5KHJ A;  4FLW A;  2BSK B;  3GWO A;  1S5J A;  1NR7 A;  4WBN B;  5JH7 A;  2R9I A;  3T2M A;  1AR5 A;  5EZY B;  3LDE A;  4OX9 O;  4JI3 O;  2WLL B;  1R6N A;  1JQ0 A;  2Q7H A;  1O9H A;  1NTK H;  3E89 A;  2FML A;  3D36 C;  5EK0 A;  5LGU A;  5LA6 A;  1L0L H;  3ETD A;  3H1I H;  5LMN O;  4JI2 B;  1YXB A;  1K33 A;  1Y6X A;  1VIB A;  3IC9 A;  3IJ4 A;  3UQ8 A;  2YIB A;  3ETG A;  3E8B A;  1BMF G;  2W6J G;  5B3S B;  3EHB B;  4X66 B;  1PL0 A;  4G28 B;  4U7N A;  1NQT A;  5GON A;  4XDJ A;  3K57 A;  3RYH B;  3TXQ A;  5BZB A;  4I7Z B;  3SJC C;  3CRR A;  4FLU A;  2F66 C;  2CUG A;  2KQX A;  4MVR A;  3AG1 B;  4IT5 A;  3W7U A;  1FS0 G;  4PEL A;  3FD9 A;  4O2A A;  1VF7 A;  3RGB A;  3D3Q A;  3K58 A;  5L3D A;  1R73 A;  4LF9 B;  1H2L A;  2ZD9 A;  3UO2 A;  2FB5 A;  2H8P C;  1PP9 H;  3I5D A;  3BAB A;  4IHJ B;  1EZV H;  5KUK A;  1HNX B;  3CC7 V;  3CC4 V;  4FK5 C;  1NTZ H;  3RT3 C;  4DR4 O;  1VQN V;  4LWS A;  1B3Q A;  4EEQ A;  3AK3 A;  4BW5 A;  4DV4 B;  3CSX A;  1VQK V;  3WFV A;  1XNQ O;  2PUS A;  5B3S C;  3LSU A;  3CHX A;  4X65 B;  3AG2 B;  3S3X A;  1SES A;  2GDS A;  3KCY A;  4TUY B;  3TET A;  1Q86 W;  4NB5 A;  1FFT B;  1KB9 F;  4HBN A;  3AG1 C;  3G67 A;  1K8A W;  1TA8 A;  2CGN A;  4NTX A;  4YHH B;  3K0G A;  1RFY A;  4H37 A;  1AR4 A;  4MVU A;  1K5Q A;  1NS1 A;  3FB7 C;  4B3S B;  1KD1 W;  3A2F A;  3H9V A;  4X66 O;  1AJN A;  5H6R A;  4Z1M G;  3CCR V;  2OCC B;  1Y67 A;  4D7S A;  2BCC H;  2GTA A;  1BGY H;  1M9N A;  1CXZ B;  3R65 A;  2ZE5 A;  5LMU B;  5ITZ A;  2V4D A;  2QKS A;  2BTQ B;  4FZ1 A;  3SPC A;  4P9O A;  4NXN B;  1GKF A;  3ABM C;  4HAM A;  4NXM B;  1H8H G;  4G2K A;  4LFA O;  2YID A;  4JAS A;  4EB6 A;  3AG2 C;  3ZJZ A;  3RYC B;  2RNB A;  1THZ A;  4CC5 A;  4FLX A;  1K7D A;  2KG7 B;  4JI1 B;  3ASN B;  4K8X A;  3I55 V;  2Q69 A;  3WB2 A;  1V54 B;  4HYO A;  3AG3 B;  1HNX O;  2N74 A;  4NVP A;  1TUB A;  4UVB A;  2QWO B;  3CWB H;  3BAA A;  4DV4 O;  4HNA B;  1YVW A;  2W0X A;  1R3I C;  3B77 A;  4JV5 B;  1VQ8 V;  1F7Y A;  2OCC C;  4X65 O;  3CB2 A;  1Z2G A;  5LGT A;  4X88 A;  3P3P A;  3DXR B;  1SQX H;  5TIS Z;  4DXW A;  3RYF A;  4LFB B;  4KP4 A;  1SRY A;  1QHT A;  3VQX A;  1IBK B;  3OEE G;  4NTW A;  4L8J A;  3JAT A;  4YIO A;  3G4S V;  4B3R B;  1FFX A;  2ZE6 A;  3ZRW B;  3ASN C;  1V54 C;  4X8A A;  3IGA C;  3CC2 V;  1YSC A;  4X1I B;  1UFI A;  4JTC B;  1JFF A;  1W2B U;  5B1A B;  5JVD A;  2ZDI C;  5LMU O;  5IJ0 A;  1S3J A;  3CS5 A;  5FLX N;  4DR3 B;  2ZM6 O;  4NXN O;  3X2Q B;  2YDE A;  4WFG A;  1SZX A;  2JEX A;  4TWK A;  1BCC H;  3QO8 A;  5KMG B;  1OCR B;  4NXM O;  3ZHQ A;  2MW2 B;  2HR3 A;  3CRQ A;  3B2E E;  4BIU A;  5IYZ A;  2ILM A;  3MDS A;  5B1B B;  1EN4 A;  3LDD A;  4FFB A;  1HR0 B;  1N36 B;  4I55 B;  3DGE A;  1EZJ A;  2JK5 C;  3JYC A;  4ZI7 B;  2OTJ V;  3B8N A;  3UKM A;  1ENV A;  4GKK O;  5JWP A;  4OPA A;  3ABK B;  5IYD O;  4RUE A;  3RYI B;  2PI4 A;  1P7G A;  4JI6 B;  5D5P A;  4ZKI A;  4DK0 A;  1PM9 A;  1Q90 D;  2Q6A A;  4DK1 A;  3F5T A;  4DV5 O;  1SC5 B;  1DF4 A;  3CRC A;  3CXH F;  2XAH A;  3U11 A;  3TCU A;  4FIP C;  3SJQ C;  1ORQ C;  2JJ1 G;  4JV5 O;  3B4S A;  2WLM A;  4K0K B;  1TVK A;  2OYQ A;  3A8T A;  1AJP A;  2YI9 A;  4I4T A;  1PD3 A;  3CPW U;  4ZOL B;  4LFB O;  1MOF A;  4ZHQ B;  3ABU A;  2XND G;  2ZXW B;  3RBZ A;  2A3Q A;  1IBK O;  2DWE C;  3IAY A;  1OCR C;  1K3E A;  2EIJ B;  1KYO F;  4CH6 A;  4GX1 A;  1MSD A;  1US6 A;  2HFE C;  5B1B C;  5CN0 A;  2QKA A;  4PV1 B;  4B3R O;  4LF6 B;  5IWA B;  4AQY B;  2QR4 A;  4UV9 A;  2CH7 A;  5JQG B;  2PYJ A;  4HZ3 A;  5KX5 B;  4R7C A;  4GZR B;  4DR3 O;  4PJ0 Z;  3ML0 A;  2Q68 A;  1M57 B;  2A06 H;  2AZ2 A;  3RN4 A;  4YXW G;  1WJZ A;  2R70 A;  2WA4 A;  2EX3 A;  3FYE B;  1SQV H;  4X64 B;  3HKC B;  3MHH C;  1HR0 O;  4UVA A;  2UXD B;  4RAI A;  5IJ9 A;  1KMI Z;  5IY5 B;  2ZXW C;  2ZE7 A;  4FMT A;  4MW3 A;  1VQ5 V;  5JCO A;  5KHH A;  3QVN A;  3DC5 A;  4JI6 O;  1AB3 A;  2EIJ C;  5EBW C;  1GO3 F;  3FB6 C;  1IZ3 A;  3OW2 U;  1TUE B;  4L87 A;  1JR9 A;  1S72 V;  5LHG A;  1WB8 A;  5CA1 A;  4K0K O;  2B1G A;  5CA0 B;  4LNU B;  1WLE A;  1MA1 A;  1FD9 A;  3QF7 A;  4N21 A;  3OGI B;  4IIJ A;  3JAS B;  4GKJ B;  5EBM C;  2JGD A;  4TV8 B;  3AK2 A;  2B9Z A;  1XHZ A;  3F7Y C;  1IUR A;  2YI8 A;  3DC6 A;  4BWA A;  3T4D A;  4X1K A;  2BOB C;  4UCU A;  2HP8 A;  3ZHV A;  3CMA V;  3CRM A;  2F43 G;  3GWK C;  5IWA O;  4AQY O;  2IJH A;  1V9P A;  2B1I A;  1VQ7 V;  5J2U A;  3FAV A;  4PA7 A;  1VF6 C;  2IW5 A;  4UV8 A;  3L73 H;  1FXK B;  1F4N A;  3JAL A;  4PHZ A;  2FYU H;  4CH5 A;  2GHY A;  4UUJ C;  2EIK B;  4X64 O;  3D3I A;  4UCS A;  5JJN B;  4NKG B;  2IJI A;  5KHK A;  4MVZ A;  2YEV A;  3L74 H;  2JEU A;  3H1K H;  3KKY A;  2ODM A;  3K0D A;  2ZKO A;  1AI4 A;  2BE3 A;  3E22 A;  2E5L O;  1S76 D;  4YJ3 B;  4MVM A;  2RDC A;  5HFL A;  1R3J C;  1IBM B;  1N0J A;  1DLB A;  4YJ2 A;  1LUW A;  3VQW A;  2YXH A;  1Y76 B;  3BPZ A;  3D36 A;  3W7S A;  2ZQM A;  4TV9 A;  5H6Q A;  2HVK C;  4DV2 B;  4JTA B;  2DQ3 A;  4GKJ O;  4FLV A;  4UVC A;  1VQ9 V;  4RO2 A;  3OGC C;  3P3N A;  4UB6 Z;  1OZ0 A;  5BR8 B;  1GM9 A;  5IT9 N;  3PJS K;  3FB8 C;  3Q4H A;  2C2A A;  1SS3 A;  3ZMV A;  3JAW B;  3ABT A;  4DV1 O;  4R50 A;  1QQC A;  3O9O A;  4W4K A;  3JAK B;  4WF9 V;  4N23 A;  2CE4 A;  3E8G A;  3N27 A;  2VQE B;  2ZIM A;  4IL6 Z;  4JYB A;  3J81 N;  2CTP A;  1W59 A;  4F6R B;  1Q43 A;  3HKE B;  1CEZ A;  4PDR A;  4U3F H;  3F7V C;  2LFR A;  4O2B A;  2ZT9 B;  1Y66 A;  3RW0 A;  5EYP A;  2EIM C;  4MVQ A;  4DW1 A;  4LF8 B;  4BAY A;  2ZR2 A;  1Q6I A;  3E8F A;  2YXL A;  4DYL A;  4DR2 O; 
#chains in the Genus database with same CATH homology
 1BE3 H;  1P84 F;  3CXH F;  3CX5 F;  1KYO F;  1SQQ H;  3L75 H;  1SQX H;  3BCC H;  1L0N H;  2A06 H;  3L74 H;  1PPJ H;  3H1H H;  3H1K H;  3H1J H;  3CWB H;  1PP9 H;  3H1L H;  4PD4 F;  1SQB H;  1SQV H;  3L70 H;  3L72 H;  5KLV H;  3L73 H;  1NTK H;  1EZV H;  4U3F H;  1NU1 H;  2IBZ H;  4D6T H;  2FYU H;  1BCC H;  1NTZ H;  1KB9 F;  1L0L H;  3L71 H;  1NTM H;  2BCC H;  3H1I H;  1BGY H;  3TGU H;  1SQP H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...