3L70H

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l70H00
1EZVH 1PPJH 2IBZH 1NTZH 1KYOF 1SQPH 1BCCH 2BCCH 3H1KH 3CXHF 1SQBH 4D6TH 2FYUH 3H1IH 3L70H 4U3FH 3BCCH 5KLVH 1NU1H 2A06H 1KB9F 1L0NH 3H1LH 1L0LH 3L75H 1PP9H 3L73H 1SQXH 3L72H 1SQQH 3L74H 3H1HH 1P84F 1NTMH 3CX5F 3CWBH 3H1JH 4PD4F 1BE3H 1NTKH 1BGYH 3TGUH 1SQVH 3L71H
chains in the Genus database with same CATH superfamily
3VQWA 2QGNA 2F4VB 5CBHA 5IY5B 2Y69B 1HNWO 2QWOB 5KHJA 1GMGA 2ITCC 3K03A 3UT5B 4DV3B 4B3RO 3K5LA 1Q7YW 1NS1A 1THZA 2XTAA 4JI6B 2UU9O 2Q73A 3JD2A 4U7NA 4AQYB 2DN9A 1VQ5V 3QO5A 2OIGA 4B3RB 3FX7A 5B1NA 5ITZA 5KX5B 4BWAA 1IXMA 4H0LB 5IJ0A 2WLHA 1N33O 5KMGA 4YJ3A 5LYJB 4JYBA 4DR2O 3BHPA 1OJHA 1PKXA 1ROPA 3E8HA 4ICGA 3AG4C 1GN4A 2PGGA 3STLC 3K5NA 1P49A 4EEQA 1SA0A 5KHGA 3D8CA 1WA8B 5DEDA 4WCEV 1I94O 4XDJA 3ZHQA 4JASA 3L70H 2IU3A 3AK1A 4LF4O 3AK3A 5FNVA 2DQ0A 5H5NA 2YIBD 3M7MX 1KUQA 3D36C 1K92A 5DECA 4BIUA 4YXWG 3ETQA 1VQ7V 4EFEA 3RYIA 2F23A 1BMFG 2YUAA 3BA8A 1XHZA 1XILA 4DXWA 1AJNA 1AROP 2HLDG 2AZ2A 5F2VO 5LHHA 1CXZB 1Q81W 2Q0AA 3ZBHA 4FM1A 1Q86W 2CDYA 4LF5O 4E2LA 3W7XA 2X7RB 3OD4A 1GM8A 3JD0A 4LC1A 2LW7A 1KKDA 1TUBA 1U96A 5JQGB 1ZL8B 1NKDA 4DRXA 1IURA 2E5LB 1IX9A 3ZRWA 1GN6A 4R50A 1HWYA 1JPXA 3CB2A 2Y0IA 2WPDG 3H1KH 4I55B 1W0JG 3QO7A 1D5NA 4TV8A 3OR7C 4X88A 5KA5A 1IDSA 1MSDA 3CWBH 1D2DA 5H6RA 3UKMA 3K08A 2YI8A 4LH6A 1F4NA 2ARHA 2A79B 2L6LA 3W7WA 3JAWB 5H2FZ 3F5TA 2OT5A 5L3GA 1K8AW 3K59A 1SQBH 5JCOA 2NLJC 2YDEA 1R6NA 2CE4A 2OIEA 2M6YA 2QSAA 2GSMB 2WSSG 1I5YA 2JEUA 1YEWA 3RVZA 3UM7A 1FJGO 3G4SV 5HFLA 1BL8A 4O4LA 4Q6GA 1Y74A 5CN0A 2QM4A 2IJIA 2ZIOA 4JTAB 1YZBA 1J95A 3FAVB 3HKEA 4CH4A 1WJZA 4WFAV 1Q3EA 3AG3C 4IYHA 3U10A 1CPYA 1I7FA 4TV9A 1QU7A 2RJZA 2ZINA 2OTJV 2W0FC 2CUGA 1VARA 1FFXB 4LNUB 3SR2C 3ABKC 3UO3A 4JYAB 4UVAA 4MVOA 3CCLV 2OTLV 1XREA 2Y48A 2BTOA 2UXNA 4DO2A 2QWRB 4UUJC 2RQ6A 1R73A 3FD9A 4XDLA 1PM9A 1XEQA 4FIPC 2QR4A 5JVDB 4F6RA 3X2QB 1L0LH 4LFAB 1AR5A 3OFNG 1K4CC 5CA0A 4LP8A 4CC6A 4G27B 4K0KB 4Z2WA 1V55B 3D3QA 3ABUA 3APQA 3T2MA 4JV5O 4N21A 3ABTA 1YTFB 1WAZA 3I55V 2JGUA 3DTUB 4JI2O 1OCZB 3ZMSA 1N36B 1LUVA 2JS3A 3JARA 4DV5O 4B3SB 2W6IG 4DR3O 3QO8A 5FL7G 1NVPB 5FPOA 3LSSA 2PTMA 5LOVB 3E22A 5EZYB 3ABLC 4HNAB 4FK5C 5EBWC 2DYSC 4K8ZA 4JI5B 3HKDB 4J10A 2EX3A 4WFHA 4GX1A 4LFBB 2P7TC 4R8CA 1GM7A 2GBOA 2HP8A 2R70A 4TOIA 2QWQB 3SPIA 4O4IB 1GAXA 2KB1A 4DV1B 3B4SA 1HNZB 4IL6Z 3CCVV 4RWUA 3B40A 1NBMG 3WFVA 4PHZA 3QG5A 4LH7A 3CE2A 5JJJB 4JI7O 1R3IC 3ABKB 1XMOO 5B3SC 3FFQA 1OV9A 4IIJA 3CSXA 1Y67A 2ILMA 1G6UA 2LFSA 1IXBA 4F6EA 2XT9A 1VQLV 5BY1A 2Q6AA 4DK0A 4GLXA 4BIOA 5H6QA 3X2QC 4KL1A 3DGEA 3AG4B 3QF7A 5KMGB 4CBCA 4NXMO 3N2GB 1OHHG 2ADQB 1VQPV 4FFBB 1MNGA 4PELA 3ZJZA 3JATA 5LMUB 1DK1A 4MVZA 4PA3A 2QKSA 4X62B 4TQDA 1BS3A 4B3MB 3OMAB 4WFFA 2ZNJA 4Z1VA 1GK9A 4QIWF 2IH1C 1SQXH 2WWWA 2UXCO 1M5IA 5L3EA 2JGDB 4DV2O 1H2LA 2AHYA 2ZCEA 3AG1B 3ETDA 3B8MA 5J9PC 3KCYA 4J41A 1SC5B 2IBZH 4ZHQA 4DV2B 3ASOB 4UB8Z 4DR6B 3T1CA 3WB0A 4KFMA 1TUBB 1UPGA 2QWPB 2PYLA 4ZI7B 3CEIA 2HG5C 1NI8A 2PYJA 5L3BA 4X62O 1KKCA 2QTOA 1DF4A 2YEVA 3OEHG 4DV7B 1EN5A 2F43G 5TISZ 3K57A 1KYOF 3VQYA 3THOA 5IDJA 4MTOA 2Q7HA 5A2QN 1AB3A 5JH7B 3E89A 2Q4PA 2HHHO 1JCHA 1CP9A 3T4DA 3ZMZA 2Y69C 2XNDG 4DR7O 5J2UB 1YJNV 1M4UA 2UUCB 1AP5A 3E83A 4GT1A 5CA0B 3IFXA 4FLYA 2Z0AA 3CCRV 3Q4HA 5E79Z 2M7WA 2UUAO 5B1AC 3SYOA 1W0KG 3E86A 2WA4A 3F5WC 1ZWIC 1VEWA 3L72H 1M56B 1WNSA 1FKAO 3J81N 3EFFK 1XOUA 3ETEA 2N04A 3RYHB 2JRIA 4MT8A 1BE3H 1ENVA 1QQCA 2LW1A 1NVPD 5BMVB 1NTZH 1KECA 1AJQA 3DSQA 5KUMA 2BCCH 5IYCO 2V4DA 2R9IA 3ZHRA 4FLXA 1LNQA 3JALA 3AG3B 1AVMA 3ZHUA 2BSKA 1T5EA 1FXVA 2WLKA 2OWOA 4D7TA 2Q5ZA 2YICA 4NTYA 3JATB 3LNMB 1RSOA 4YHHB 1G1XB 1Q6HA 1Q6UA 4X1IA 1SRYA 1H2GA 2XUMA 4HNAA 3T1YO 1UFIA 4WBNB 1B06A 4QPJA 1TVKB 4KXRA 3APOA 4MVQA 3A2FA 3OW2U 1R3LC 5BXZA 4I4TA 3VBBA 2E74B 4DR4B 2QTSA 1BSMA 5CB4A 4OPAA 2BE3A 2XAFA 4O4HB 1V55C 1RM1C 4WFEA 4NTWA 4O2AB 1QLEC 2JJ1G 1YXBA 1FXHA 4ZIBA 2RMKB 3M8AA 4LF7O 2LFRA 2QJ1A 5LYJA 1QCEA 3TK1A 1ZX3A 1OCOC 4DYLA 2PUSA 2CTRA 2P6JA 3JAMN 3H01A 3N2KB 2FKXA 4HAMA 3BEHA 3OT7A 3K3WA 1S72V 1NR7A 1SKVA 4UCUA 4WFBV 3L75H 2B5UA 3ASNB 3ZMVA 2B1IA 4O2BB 1E1QG 4AQYO 1SQFA 3JYCA 5BR8O 1XDCA 1AI4A 4U7OA 4RAIA 4JGSA 1KD1W 2KQXA 5IE9A 3K04A 4H37A 3RYHA 3E8GA 5C93A 2Q68A 2VQFO 1URFA 4DR5B 1N32B 1OCCC 3ZRWB 2CTPA 4K8XA 3H1HH 5IWAB 1DGSA 3HR0A 4UCSA 2VRZA 4PD4F 5LXTB 1NTKH 2D3OW 3NXSA 4G2KA 3SPCA 4BR6A 1Y76B 2Q69A 3OAAG 1I08A 2N74A 4AHCA 4D7SA 5JH7A 4UB6Z 3MD0A 4JAVA 2ZE7A 2OCCB 5LMNB 4JI8B 2LQTA 3TXQA 4JAAA 4X65B 1YVWA 3DC5A 1S77D 1LUWA 5EC2C 4X20B 5KAIZ 1M90W 2GTSA 4PDVA 3OMNB 4DK1A 1SQPH 4WFGA 1KP2A 4MTFA 1WB7A 1B04A 4FMTA 2ZT9B 4LF7B 3CRRA 4DV0O 1P84F 3B09A 1H8EG 2JVDA 3ETGA 4K35A 5DN6G 3G67A 4ZHQB 1YIJV 1K34A 4GCZA 1G4YB 5GTHZ 4P30A 2H8PC 3ZHVA 1JJ2U 3MHSC 4LFCO 4AI8A 3MAQA 4MSWC 1Q8IA 5B66Z 3K0DA 1K33A 2HKOA 4ZOLB 1COWG 2AW9A 2VQFB 3RYFB 1K5QA 1N34B 5KLVH 2RNBA 5CA1A 3SJBC 2Q67A 4UV8A 3OTOO 4DV6O 1SETA 5JJNB 3FB8C 1F51A 4PA7A 2ODMA 5EYPA 3UT5A 3FKSG 4JZ2A 1FXKC 1V54B 4ABMA 2CGNA 5IYDO 4FLTA 1I0HA 3CHXA 1VF6C 1EN4A 1EM1A 3G6BA 5HFMA 2ZDIA 2EZOA 5J2TB 4UCOA 3SGIA 4X66O 1N8RW 3CPWU 3P30A 2DE0X 3M99B 5EBLC 3JASA 3C3TA 2UU9B 4JI6O 1Z5WA 3JSLA 4YY3B 4LF9O 3CYOA 3SYPA 1YHQV 1SF9A 2YI9A 3CS5A 5FLXN 2HVKC 4MW3A 2UUCO 3SYCA 4UCVA 4I55A 2Q9LA 3W7TA 1P7GA 1GN3A 1IBMO 4UXNA 1AILA 3HKBA 1Q82W 3K5MA 2EIKB 4QNHB 2EZPA 2F95B 2ETNA 2YIAA 4X89A 1JMKC 4RUEA 4O4JA 3RT3C 4O2BA 2IH3C 3Q4HB 2QEXV 3STZC 3E35A 2GDSA 4HZ3A 2FMLA 1F23A 3CX5F 1VQMV 5IYZB 3AG2C 4O4HA 1NT2B 3K0GA 3QNEA 4I9QA 3CCJV 1K9MW 4I5SA 4E4EA 1ZLZA 2EILC 4FPPA 4JZGA 2QE7G 4A5UB 3IJ4A 4DV4O 5B1BC 4JPRA 1JVMA 4L8JA 2UUBB 4TWKA 4KHPB 4BW9A 5IJ9A 4JYCA 4JI1B 4IT5A 4NXNB 2P90A 4X64B 4EB6A 3W7SA 2UUAB 1AI6A 4GKJB 5GONA 1YJ9V 1QLNA 1Y66A 2LP7A 1FFXA 5K1XA 5IT9N 1OCZC 2KSDA 2ZE8A 5JCOC 3BRCA 1JX9A 4LCUC 3F7VC 2CAZC 3R66A 5EZYA 3ZX6A 2HHHB 2O57A 3CMEV 3ZHSA 2VQEO 2OYQA 1GKFA 1UJWB 4ASUG 4QGPA 2F1MA 3S3WA 3RFRA 4U3FH 1VQ6V 3OM3B 1QR9A 2DW4A 4XBFA 3CCSV 2DWDC 2DMXA 1S0VA 4X64O 1OCRB 2ZE6A 3G71V 4B3TB 4JI1O 3J7AU 2YIDA 4B08A 2QM7A 1XUQA 1KBHA 4I7ZB 4DV1O 1M57C 3AK2A 3JCUZ 2UUBO 2GHYA 2EIMB 2F66C 1HR0O 1VQ9V 1SERA 3CRAA 1VP7A 2CTQA 2XAHA 1W2BU 2P5OA 1SQGA 3BAAA 1GH6A 4FFKA 2UXBB 3U11A 3O65A 1WA8A 4O4JB 2HEPA 1H2NA 4MTXA 1J5EB 4NVPA 1K73W 1XNRO 1MABG 3AG2B 3K5OA 1KP3A 5LA6B 3RGBA 3IC7A 4DR3B 2B1GA 2JGDA 4UVCA 3A0BZ 3ABMC 2GV9A 1N36O 1QNMA 3JD3A 4J7JA 1YJWV 1F4MA 1R1BA 4DUZB 1PNKA 4JI2B 4LF6B 4PJ0Z 1BQ0A 4NXMB 1QR8A 3ZN1A 4RQFA 1QLEB 4QJFB 4DR1B 2H3OA 4I50B 3FB7C 2R9RB 3QTCA 2YSUB 3HKEB 3G80A 1XNRB 4LWSB 2DOSA 4FZ1A 4O2AA 1FD9A 1WPXA 4OGQB 2WLMA 2DJVA 2UXBO 1RPRA 4LNUA 3EVKA 3T1HO 5KHKA 4K3AA 2P4VA 1HNZO 4TV8B 2AGAA 4I4TB 3OGCC 2ZKOA 4F6RB 2JDIG 3H1LH 1QVFU 2ZXWC 4X66B 3L74H 4WBNA 5J2TA 2EIKC 5EYPB 4NKGB 4IHJA 4X1KA 2K9PA 3HPLC 4QE9A 4JYYA 2JK5C 3RN4A 4J80A 1YTFD 4I50A 5ITZB 4FZ0A 4X9QA 2EIJB 4FM2A 2UXDB 3LDCA 2ZR2A 3OMIB 4X1YB 3EXAA 1NH2D 3CRQA 4DRXB 1VQ8V 5FPRA 3WB1A 3DXRA 2PI5A 5LXTA 5B3SB 1K3EA 4GUNA 4ZI7A 4TV9B 2JJ2G 5B1AB 1SZXA 4LR3A 1R3JC 1RFYA 4JI0O 4PI0A 3CXHF 3JD4A 1YI2V 2UXXA 5CBFA 2WLIB 2YXYA 2V7QG 3KKYA 3VOUA 1NTMH 4QPKA 4LF8B 4GKJO 1ZSPA 5AG2A 5J2UA 1MSWD 4PDMA 2K1EA 1Q90D 2QWNB 1YCIA 4UFZA 2R72A 2Q8VA 2XASA 2E5LO 1GO3F 2ZR3A 4JTCB 2PI4A 3CC2V 4DV4B 5LL6Y 1WN7A 4F4LA 3UCSC 1TVKA 1ORQC 1Y74B 1OZ0A 4RUFA 1JQ0A 4YIOA 3GWKC 4IHJB 3HKCB 4LF5B 1YF2A 3ZCCA 1XNQB 3RVYA 2ZIMA 3G6EV 4LWSA 2IJHA 5LHIA 4IGGA 2DQ3A 3FB5C 4CS4A 5GW7A 4JI3O 2E75B 4AILC 1Y76A 2DYRC 3A0HZ 1N0JA 5B1BB 1PNMA 1ZL8A 5JWPA 2ZXWB 1RSOB 3DXRB 5GONB 1XQ8A 1IBMB 4G28B 5KUKA 2X6AA 2XAGA 4JF3A 2BTQB 1RM1B 1I94B 2Z3YA 1SQVH 2ZQMA 1XI1A 4P2ZA 4EKWA 4DR5O 4P9PA 4N23A 3ZHTA 1BQZA 1JR9A 3BABA 1XL6A 2Z5UA 1M57B 5FNVB 3PN1A 4EB6B 1NJIW 3BA9A 4YY3O 5LGUA 3HKDA 3TXSA 1Q6IA 4JTDB 1JFFB 1NQTA 3TGUH 1N33B 2QDOA 1FS0G 4YJ2A 2PF4E 5E1AC 2EINB 3P32A 3ZRXA 3HKCA 3ML0A 1BHBA 3JASB 4PI2A 2AHZA 2LGWA 4DUYO 1HP8A 1RP3B 3OTFA 4UCTA 4GZRB 1JOYA 5D5PA 5LGTA 1Y6XA 2ATKC 4DV3O 1VF5B 4X1IB 1QBZA 3L9DA 4J42A 1MZFA 4OX9B 1HNXB 2NNUA 2GUZB 3FYEB 2LJ2A 1N34O 1PL4A 4ZOLA 3A0RA 4GX2A 3C3SA 4J7ZA 2F93B 1NU1H 1ZAUA 4P9OA 4NYKA 5C8YA 3P3NA 1GTOA 1S5HC 1SQQH 1A32A 3H1JH 4RO2A 4LF4B 3TETA 2ZM6B 1TUEB 1GN2A 1Q43A 2YXHA 3ABMB 1JA8A 4U3JB 3ABLB 4H44B 2X6CA 2DYSB 3O9OA 2PZSA 4OX9O 1PP9H 3ZRSA 1IBLB 5IJ0B 1YDXA 2EJRA 2RDCA 2X6BA 3CJHB 3SJCC 4X1YA 4R6ZA 4DV0B 1HNXO 5LP6A 2IM9A 3DC6A 1YITV 1AJPA 4FVMA 5L3FA 1IBKO 5EIBD 1WLEA 4UVBA 2C2AA 4DUYB 2KKWA 1MMMA 1OCOB 1L8DA 1PNLA 1L1FA 4PV1B 4B7KA 1HNWB 3RYFA 1G8MA 2HR3A 1FYJA 2P06A 5CA1B 3BVOA 3CCUV 2A0LA 3SPJA 2IW5A 1IZ3A 2G38A 2ZD9A 3K06A 1OCRC 3LUTB 2PY5A 3OEEG 5KA6A 1PV0A 5IWAO 2CH7A 2RN9A 1VQ4V 1R6KA 5LP6B 3OUFA 4JI3B 4TUYA 3B77A 1MA1A 2VS0A 2A3QA 4DW0A 3GB7C 2QKAA 3JALB 1O9GA 3SPGA 2EIMC 5EK0A 1XNQO 1AI5A 3WU2Z 5B1OA 5BR8B 5BMVA 1TA8A 4GKKO 3JAKB 3K9SA 1IBKB 4WF9V 1AR4A 1HDJA 1K7DA 1N0NA 1IVSA 4UCRA 3NR7A 1E79G 2EJ7A 2MK3A 2X0LA 1M56C 1E1RG 4FJCC 2ZE5A 4DW1A 3MDSA 2DYRB 3CCMV 1XMQB 5B5EZ 5GTIZ 4FLZA 1PPJH 4IYIA 2VWKA 1F7YA 3WG7B 1N4CA 3J80N 1GM9A 4DR4O 3GVMA 4W4KA 1HW7A 1JFFA 1R3KC 3SJQC 1XBLA 3CCQV 2KG7A 2YC0A 3T1YB 2W0XA 5IYBO 5KAFZ 3D36A 3VQXA 4YHHO 3VQVA 1R6TA 4CH5A 4MVUA 3SYAA 2HFEC 2HJDA 2YIBA 3LSQA 1XL4A 4IIJB 4J9YB 3N2KA 4OXSA 2EILB 3RW0A 2MW2B 3ICXA 3RBZA 2UXDO 4B7EA 1M1KW 4O4IA 4TQFA 2W6JG 1H2MA 1I5XA 2XAQA 1PD3A 2HJFC 5KHHA 3OUSA 1H2KA 3RYIB 3C90A 1AR1B 3LDEA 3W7UA 2NR5A 2Q7GA 3JAWA 5D5QA 4HYOA 4BW5A 3CJHA 1MZEA 3RWRD 1SESA 4BAYA 1EZVH 2EBOA 1WB8A 3CD6V 2P22C 1S76D 3CXCU 5CB4B 4DR7B 5IYZA 4J11A 4ZKIA 3HKBB 3FAVA 2OCHA 1WP7A 3BFRA 4DR1O 2Y0PA 3R65A 3N2GA 4RQEA 4HBNA 1K5SA 4LF6O 2IJKA 3E2EA 4DUZO 4DV7O 4TSFG 3ZMUA 3BCCH 4FLUA 2A06H 4MS2A 2YXLA 2GUZA 2BOCC 1H8HG 3JCZA 3LSUA 1RPOA 2WA3A 2GTAA 4CH6A 4JI4O 2Y4UA 4X1KB 4LFAO 3KZIZ 1VQOV 4JAUA 4U3JA 2OCCC 4Q20A 1VQNV 4O4LB 4XDKA 2FTKA 3CRCA 4CS2A 2UXCB 1VF7A 5K1PA 3CMAV 1J5EO 4I0XA 4DR6O 4JYAO 3IC9A 4NR1A 4B3MO 5LOVA 4MVSA 3SDLA 1NR1A 4PA6A 5JJEB 3IGAC 1EFRG 2IJJA 1QVGU 4OPHA 4LF8O 1MOFA 2HVJC 4JI4B 2QA4V 2EULA 2IU0A 2RCVA 1BHAA 4MTGA 2LO1A 2B9ZA 4FFBA 2WLNA 3I56V 2JEXA 1LR1A 1PL0A 5A9GA 3JARB 4JI0B 3A8TA 5LMUO 3OGIB 3E8FA 1QHTA 3JAKA 3ZEDA 2N05A 4NB5A 3LNNA 4H33A 2D2CB 1ZTEA 3UQ8A 1H2SB 1SS3A 2AZ0A 2E76B 4JI7B 2LGQA 3SPHA 2VQEB 5KX5A 1L0NH 4YJ2B 4CC5A 3CC4V 1EN6A 4NTXA 3ZS8C 4NXNO 1X59A 4MVRA 2EINC 4W4LA 5EC1C 3D3IA 1XMOB 1BGYH 3EHBB 1GRJA 3L71H 3P3PA 2XAJA 4L87A 4KP4A 1FXKB 1V54C 1YSCA 3CRMA 4LFBO 2ADPA 5LP6C 1TAEA 3JD1A 2QM8A 1Y4MA 1AP6A 2WAMA 3UO2A 4KHPO 4MW8A 3OR6C 3IAYA 5JQGA 3RYCB 1CEZA 5C8YB 3T1HB 1SA0B 1KMIZ 1AI7A 3ZIAG 3AG1C 5EIBC 4D6TH 3H1IH 1P4RA 3I5DA 4JI5O 1DLBA 2DWEC 2E3CA 4X20A 1NZ6A 3PJSK 4GYCB 4FLWA 4PDLA 4DV5B 4B3SO 3FYIB 2CTWA 4PA9A 1KQSU 1FPOA 2ITDC 1B3QA 4CZZA 5LBQA 2Q7EA 2FYUH 3S3XA 4TUYB 1KB9F 4JV5B 1JJOA 4TT3G 1SZTA 4LBEC 5LHGA 4YJ3B 2ZDIC 4MVMA 1EZJA 4K0KO 4X8AA 3OE7G 1O9HA 4BIZA 2WLLA 5IJ9B 1VF6A 1M93A 3AEIA 1DTOA 3E8BA 4DR2B 4YIPA 1FXKA 4FLVA 3BY6A 5LA6A 4PA4A 3CC7V 4PDRA 1W59A 2CGOA 4Z1MG 4LF9B 1HR0B 3F7YC 1BZKA 2CK3G 3QVNA 3K58A 1VQKV 1FFTB 4B3TO 1X4TA 5KHIA 4R7CA 1WPBA 4DV6B 3LDDA 3AG7A 2F4VO 4CH3A 1S5LZ 3JSNA 3ZRVA 1OCCB 5BZBA 2KG7B 1D5AA 2JS5A 1Q5OA 3SYQA 3T4ZA 2JIZG 3U0ZA 4LFCB 5IY5C 1S3JA 1FJGB 2VWJA 3KG2A 2FB5A 3OTOB 2Q0OC 1TGOA 1H38A 2WLJA 3WB2A 2BSKB 2EIJC 4FM0A 4J7KA 4H13B 4I0XB 3FB6C 4ZBMA 3RYCA 2H94A 3GWOA 3L73H 3H9VA 2WLIA 2Y4TA 5L3CA 3CCEV 1VMGA 3KCXA 2V1DA 1V9PA 1S5JA 2FL4A 5CBGA 1EBOA 5JVDA 1K4DC 2A9HA 1BCCH 2AXTZ 4QE7A 2XHBA 2YEVB 2QKCA 4CS3A 3B8NA 1U97A 1Z5VA 3SJAC 1XMQO 3B2EE 3TCUA 2NN4A 1WP8A 1Z2GA 3K79A 4EFBA 2CH7B 3WG7C 5EBMC 2YS8A 2R9AA 3MHHC 1NH2B 3K9AA 1KU9A 4C7UA 1XHXA 3N27A 5LMNO 4JI8O 4GKKB 5CMUA 1MG1A 5L3DA 1K97A 1VIBA 1M9NA 4UV9A 3ASOC 1IBLO 4I9WA 2WLLB 1ZUQA 2P67A 4X65O 5CA3A 3ZN0A 3ASNC 1P7BA 3ZMTA 1N32O 2ZM6O 1KC8W 2P4KA 2ZNIA 1FAFA 5LGNA 1B6QA 3E22B 3CP1A 1US6A 4GX5A 4J9ZB 1DF5A 2BOBC 1BT8A 5DM6V 4KUMA 2L35A 5H9CA 2XOKG 3TJTA 4GX0A 2A7WA 2BTQA 3HB3B 3BPZA
chains in the Genus database with same CATH topology
1EZVH 1PPJH 2IBZH 1NTZH 1KYOF 1SQPH 1BCCH 2BCCH 3H1KH 3CXHF 1SQBH 4D6TH 2FYUH 3H1IH 3L70H 4U3FH 3BCCH 5KLVH 1NU1H 2A06H 1KB9F 1L0NH 3H1LH 1L0LH 3L75H 1PP9H 3L73H 1SQXH 3L72H 1SQQH 3L74H 3H1HH 1P84F 1NTMH 3CX5F 3CWBH 3H1JH 4PD4F 1BE3H 1NTKH 1BGYH 3TGUH 1SQVH 3L71H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV H;  1PPJ H;  2IBZ H;  1NTZ H;  1KYO F;  1SQP H;  1BCC H;  2BCC H;  3H1K H;  3CXH F;  1SQB H;  4D6T H;  2FYU H;  3H1I H;  3L70 H;  4U3F H;  3BCC H;  5KLV H;  1NU1 H;  2A06 H;  1KB9 F;  1L0N H;  3H1L H;  1L0L H;  3L75 H;  1PP9 H;  3L73 H;  1SQX H;  3L72 H;  1SQQ H;  3L74 H;  3H1H H;  1P84 F;  1NTM H;  3CX5 F;  3CWB H;  3H1J H;  4PD4 F;  1BE3 H;  1NTK H;  1BGY H;  3TGU H;  1SQV H;  3L71 H; 
#chains in the Genus database with same CATH topology
 3VQW A;  2QGN A;  2F4V B;  5CBH A;  5IY5 B;  2Y69 B;  1HNW O;  2QWO B;  5KHJ A;  1GMG A;  2ITC C;  3K03 A;  3UT5 B;  4DV3 B;  4B3R O;  3K5L A;  1Q7Y W;  1NS1 A;  1THZ A;  2XTA A;  4JI6 B;  2UU9 O;  2Q73 A;  3JD2 A;  4U7N A;  4AQY B;  2DN9 A;  1VQ5 V;  3QO5 A;  2OIG A;  4B3R B;  3FX7 A;  5B1N A;  5ITZ A;  5KX5 B;  4BWA A;  1IXM A;  4H0L B;  5IJ0 A;  2WLH A;  1N33 O;  5KMG A;  4YJ3 A;  5LYJ B;  4JYB A;  4DR2 O;  3BHP A;  1OJH A;  1PKX A;  1ROP A;  3E8H A;  4ICG A;  3AG4 C;  1GN4 A;  2PGG A;  3STL C;  3K5N A;  1P49 A;  4EEQ A;  1SA0 A;  5KHG A;  3D8C A;  1WA8 B;  5DED A;  4WCE V;  1I94 O;  4XDJ A;  3ZHQ A;  4JAS A;  3L70 H;  2IU3 A;  3AK1 A;  4LF4 O;  3AK3 A;  5FNV A;  2DQ0 A;  5H5N A;  2YIB D;  3M7M X;  1KUQ A;  3D36 C;  1K92 A;  5DEC A;  4BIU A;  4YXW G;  3ETQ A;  1VQ7 V;  4EFE A;  3RYI A;  2F23 A;  1BMF G;  2YUA A;  3BA8 A;  1XHZ A;  1XIL A;  4DXW A;  1AJN A;  1ARO P;  2HLD G;  2AZ2 A;  5F2V O;  5LHH A;  1CXZ B;  1Q81 W;  2Q0A A;  3ZBH A;  4FM1 A;  1Q86 W;  2CDY A;  4LF5 O;  4E2L A;  3W7X A;  2X7R B;  3OD4 A;  1GM8 A;  3JD0 A;  4LC1 A;  2LW7 A;  1KKD A;  1TUB A;  1U96 A;  5JQG B;  1ZL8 B;  1NKD A;  4DRX A;  1IUR A;  2E5L B;  1IX9 A;  3ZRW A;  1GN6 A;  4R50 A;  1HWY A;  1JPX A;  3CB2 A;  2Y0I A;  2WPD G;  3H1K H;  4I55 B;  1W0J G;  3QO7 A;  1D5N A;  4TV8 A;  3OR7 C;  4X88 A;  5KA5 A;  1IDS A;  1MSD A;  3CWB H;  1D2D A;  5H6R A;  3UKM A;  3K08 A;  2YI8 A;  4LH6 A;  1F4N A;  2ARH A;  2A79 B;  2L6L A;  3W7W A;  3JAW B;  5H2F Z;  3F5T A;  2OT5 A;  5L3G A;  1K8A W;  3K59 A;  1SQB H;  5JCO A;  2NLJ C;  2YDE A;  1R6N A;  2CE4 A;  2OIE A;  2M6Y A;  2QSA A;  2GSM B;  2WSS G;  1I5Y A;  2JEU A;  1YEW A;  3RVZ A;  3UM7 A;  1FJG O;  3G4S V;  5HFL A;  1BL8 A;  4O4L A;  4Q6G A;  1Y74 A;  5CN0 A;  2QM4 A;  2IJI A;  2ZIO A;  4JTA B;  1YZB A;  1J95 A;  3FAV B;  3HKE A;  4CH4 A;  1WJZ A;  4WFA V;  1Q3E A;  3AG3 C;  4IYH A;  3U10 A;  1CPY A;  1I7F A;  4TV9 A;  1QU7 A;  2RJZ A;  2ZIN A;  2OTJ V;  2W0F C;  2CUG A;  1VAR A;  1FFX B;  4LNU B;  3SR2 C;  3ABK C;  3UO3 A;  4JYA B;  4UVA A;  4MVO A;  3CCL V;  2OTL V;  1XRE A;  2Y48 A;  2BTO A;  2UXN A;  4DO2 A;  2QWR B;  4UUJ C;  2RQ6 A;  1R73 A;  3FD9 A;  4XDL A;  1PM9 A;  1XEQ A;  4FIP C;  2QR4 A;  5JVD B;  4F6R A;  3X2Q B;  1L0L H;  4LFA B;  1AR5 A;  3OFN G;  1K4C C;  5CA0 A;  4LP8 A;  4CC6 A;  4G27 B;  4K0K B;  4Z2W A;  1V55 B;  3D3Q A;  3ABU A;  3APQ A;  3T2M A;  4JV5 O;  4N21 A;  3ABT A;  1YTF B;  1WAZ A;  3I55 V;  2JGU A;  3DTU B;  4JI2 O;  1OCZ B;  3ZMS A;  1N36 B;  1LUV A;  2JS3 A;  3JAR A;  4DV5 O;  4B3S B;  2W6I G;  4DR3 O;  3QO8 A;  5FL7 G;  1NVP B;  5FPO A;  3LSS A;  2PTM A;  5LOV B;  3E22 A;  5EZY B;  3ABL C;  4HNA B;  4FK5 C;  5EBW C;  2DYS C;  4K8Z A;  4JI5 B;  3HKD B;  4J10 A;  2EX3 A;  4WFH A;  4GX1 A;  4LFB B;  2P7T C;  4R8C A;  1GM7 A;  2GBO A;  2HP8 A;  2R70 A;  4TOI A;  2QWQ B;  3SPI A;  4O4I B;  1GAX A;  2KB1 A;  4DV1 B;  3B4S A;  1HNZ B;  4IL6 Z;  3CCV V;  4RWU A;  3B40 A;  1NBM G;  3WFV A;  4PHZ A;  3QG5 A;  4LH7 A;  3CE2 A;  5JJJ B;  4JI7 O;  1R3I C;  3ABK B;  1XMO O;  5B3S C;  3FFQ A;  1OV9 A;  4IIJ A;  3CSX A;  1Y67 A;  2ILM A;  1G6U A;  2LFS A;  1IXB A;  4F6E A;  2XT9 A;  1VQL V;  5BY1 A;  2Q6A A;  4DK0 A;  4GLX A;  4BIO A;  5H6Q A;  3X2Q C;  4KL1 A;  3DGE A;  3AG4 B;  3QF7 A;  5KMG B;  4CBC A;  4NXM O;  3N2G B;  1OHH G;  2ADQ B;  1VQP V;  4FFB B;  1MNG A;  4PEL A;  3ZJZ A;  3JAT A;  5LMU B;  1DK1 A;  4MVZ A;  4PA3 A;  2QKS A;  4X62 B;  4TQD A;  1BS3 A;  4B3M B;  3OMA B;  4WFF A;  2ZNJ A;  4Z1V A;  1GK9 A;  4QIW F;  2IH1 C;  1SQX H;  2WWW A;  2UXC O;  1M5I A;  5L3E A;  2JGD B;  4DV2 O;  1H2L A;  2AHY A;  2ZCE A;  3AG1 B;  3ETD A;  3B8M A;  5J9P C;  3KCY A;  4J41 A;  1SC5 B;  2IBZ H;  4ZHQ A;  4DV2 B;  3ASO B;  4UB8 Z;  4DR6 B;  3T1C A;  3WB0 A;  4KFM A;  1TUB B;  1UPG A;  2QWP B;  2PYL A;  4ZI7 B;  3CEI A;  2HG5 C;  1NI8 A;  2PYJ A;  5L3B A;  4X62 O;  1KKC A;  2QTO A;  1DF4 A;  2YEV A;  3OEH G;  4DV7 B;  1EN5 A;  2F43 G;  5TIS Z;  3K57 A;  1KYO F;  3VQY A;  3THO A;  5IDJ A;  4MTO A;  2Q7H A;  5A2Q N;  1AB3 A;  5JH7 B;  3E89 A;  2Q4P A;  2HHH O;  1JCH A;  1CP9 A;  3T4D A;  3ZMZ A;  2Y69 C;  2XND G;  4DR7 O;  5J2U B;  1YJN V;  1M4U A;  2UUC B;  1AP5 A;  3E83 A;  4GT1 A;  5CA0 B;  3IFX A;  4FLY A;  2Z0A A;  3CCR V;  3Q4H A;  5E79 Z;  2M7W A;  2UUA O;  5B1A C;  3SYO A;  1W0K G;  3E86 A;  2WA4 A;  3F5W C;  1ZWI C;  1VEW A;  3L72 H;  1M56 B;  1WNS A;  1FKA O;  3J81 N;  3EFF K;  1XOU A;  3ETE A;  2N04 A;  3RYH B;  2JRI A;  4MT8 A;  1BE3 H;  1ENV A;  1QQC A;  2LW1 A;  1NVP D;  5BMV B;  1NTZ H;  1KEC A;  1AJQ A;  3DSQ A;  5KUM A;  2BCC H;  5IYC O;  2V4D A;  2R9I A;  3ZHR A;  4FLX A;  1LNQ A;  3JAL A;  3AG3 B;  1AVM A;  3ZHU A;  2BSK A;  1T5E A;  1FXV A;  2WLK A;  2OWO A;  4D7T A;  2Q5Z A;  2YIC A;  4NTY A;  3JAT B;  3LNM B;  1RSO A;  4YHH B;  1G1X B;  1Q6H A;  1Q6U A;  4X1I A;  1SRY A;  1H2G A;  2XUM A;  4HNA A;  3T1Y O;  1UFI A;  4WBN B;  1B06 A;  4QPJ A;  1TVK B;  4KXR A;  3APO A;  4MVQ A;  3A2F A;  3OW2 U;  1R3L C;  5BXZ A;  4I4T A;  3VBB A;  2E74 B;  4DR4 B;  2QTS A;  1BSM A;  5CB4 A;  4OPA A;  2BE3 A;  2XAF A;  4O4H B;  1V55 C;  1RM1 C;  4WFE A;  4NTW A;  4O2A B;  1QLE C;  2JJ1 G;  1YXB A;  1FXH A;  4ZIB A;  2RMK B;  3M8A A;  4LF7 O;  2LFR A;  2QJ1 A;  5LYJ A;  1QCE A;  3TK1 A;  1ZX3 A;  1OCO C;  4DYL A;  2PUS A;  2CTR A;  2P6J A;  3JAM N;  3H01 A;  3N2K B;  2FKX A;  4HAM A;  3BEH A;  3OT7 A;  3K3W A;  1S72 V;  1NR7 A;  1SKV A;  4UCU A;  4WFB V;  3L75 H;  2B5U A;  3ASN B;  3ZMV A;  2B1I A;  4O2B B;  1E1Q G;  4AQY O;  1SQF A;  3JYC A;  5BR8 O;  1XDC A;  1AI4 A;  4U7O A;  4RAI A;  4JGS A;  1KD1 W;  2KQX A;  5IE9 A;  3K04 A;  4H37 A;  3RYH A;  3E8G A;  5C93 A;  2Q68 A;  2VQF O;  1URF A;  4DR5 B;  1N32 B;  1OCC C;  3ZRW B;  2CTP A;  4K8X A;  3H1H H;  5IWA B;  1DGS A;  3HR0 A;  4UCS A;  2VRZ A;  4PD4 F;  5LXT B;  1NTK H;  2D3O W;  3NXS A;  4G2K A;  3SPC A;  4BR6 A;  1Y76 B;  2Q69 A;  3OAA G;  1I08 A;  2N74 A;  4AHC A;  4D7S A;  5JH7 A;  4UB6 Z;  3MD0 A;  4JAV A;  2ZE7 A;  2OCC B;  5LMN B;  4JI8 B;  2LQT A;  3TXQ A;  4JAA A;  4X65 B;  1YVW A;  3DC5 A;  1S77 D;  1LUW A;  5EC2 C;  4X20 B;  5KAI Z;  1M90 W;  2GTS A;  4PDV A;  3OMN B;  4DK1 A;  1SQP H;  4WFG A;  1KP2 A;  4MTF A;  1WB7 A;  1B04 A;  4FMT A;  2ZT9 B;  4LF7 B;  3CRR A;  4DV0 O;  1P84 F;  3B09 A;  1H8E G;  2JVD A;  3ETG A;  4K35 A;  5DN6 G;  3G67 A;  4ZHQ B;  1YIJ V;  1K34 A;  4GCZ A;  1G4Y B;  5GTH Z;  4P30 A;  2H8P C;  3ZHV A;  1JJ2 U;  3MHS C;  4LFC O;  4AI8 A;  3MAQ A;  4MSW C;  1Q8I A;  5B66 Z;  3K0D A;  1K33 A;  2HKO A;  4ZOL B;  1COW G;  2AW9 A;  2VQF B;  3RYF B;  1K5Q A;  1N34 B;  5KLV H;  2RNB A;  5CA1 A;  3SJB C;  2Q67 A;  4UV8 A;  3OTO O;  4DV6 O;  1SET A;  5JJN B;  3FB8 C;  1F51 A;  4PA7 A;  2ODM A;  5EYP A;  3UT5 A;  3FKS G;  4JZ2 A;  1FXK C;  1V54 B;  4ABM A;  2CGN A;  5IYD O;  4FLT A;  1I0H A;  3CHX A;  1VF6 C;  1EN4 A;  1EM1 A;  3G6B A;  5HFM A;  2ZDI A;  2EZO A;  5J2T B;  4UCO A;  3SGI A;  4X66 O;  1N8R W;  3CPW U;  3P30 A;  2DE0 X;  3M99 B;  5EBL C;  3JAS A;  3C3T A;  2UU9 B;  4JI6 O;  1Z5W A;  3JSL A;  4YY3 B;  4LF9 O;  3CYO A;  3SYP A;  1YHQ V;  1SF9 A;  2YI9 A;  3CS5 A;  5FLX N;  2HVK C;  4MW3 A;  2UUC O;  3SYC A;  4UCV A;  4I55 A;  2Q9L A;  3W7T A;  1P7G A;  1GN3 A;  1IBM O;  4UXN A;  1AIL A;  3HKB A;  1Q82 W;  3K5M A;  2EIK B;  4QNH B;  2EZP A;  2F95 B;  2ETN A;  2YIA A;  4X89 A;  1JMK C;  4RUE A;  4O4J A;  3RT3 C;  4O2B A;  2IH3 C;  3Q4H B;  2QEX V;  3STZ C;  3E35 A;  2GDS A;  4HZ3 A;  2FML A;  1F23 A;  3CX5 F;  1VQM V;  5IYZ B;  3AG2 C;  4O4H A;  1NT2 B;  3K0G A;  3QNE A;  4I9Q A;  3CCJ V;  1K9M W;  4I5S A;  4E4E A;  1ZLZ A;  2EIL C;  4FPP A;  4JZG A;  2QE7 G;  4A5U B;  3IJ4 A;  4DV4 O;  5B1B C;  4JPR A;  1JVM A;  4L8J A;  2UUB B;  4TWK A;  4KHP B;  4BW9 A;  5IJ9 A;  4JYC A;  4JI1 B;  4IT5 A;  4NXN B;  2P90 A;  4X64 B;  4EB6 A;  3W7S A;  2UUA B;  1AI6 A;  4GKJ B;  5GON A;  1YJ9 V;  1QLN A;  1Y66 A;  2LP7 A;  1FFX A;  5K1X A;  5IT9 N;  1OCZ C;  2KSD A;  2ZE8 A;  5JCO C;  3BRC A;  1JX9 A;  4LCU C;  3F7V C;  2CAZ C;  3R66 A;  5EZY A;  3ZX6 A;  2HHH B;  2O57 A;  3CME V;  3ZHS A;  2VQE O;  2OYQ A;  1GKF A;  1UJW B;  4ASU G;  4QGP A;  2F1M A;  3S3W A;  3RFR A;  4U3F H;  1VQ6 V;  3OM3 B;  1QR9 A;  2DW4 A;  4XBF A;  3CCS V;  2DWD C;  2DMX A;  1S0V A;  4X64 O;  1OCR B;  2ZE6 A;  3G71 V;  4B3T B;  4JI1 O;  3J7A U;  2YID A;  4B08 A;  2QM7 A;  1XUQ A;  1KBH A;  4I7Z B;  4DV1 O;  1M57 C;  3AK2 A;  3JCU Z;  2UUB O;  2GHY A;  2EIM B;  2F66 C;  1HR0 O;  1VQ9 V;  1SER A;  3CRA A;  1VP7 A;  2CTQ A;  2XAH A;  1W2B U;  2P5O A;  1SQG A;  3BAA A;  1GH6 A;  4FFK A;  2UXB B;  3U11 A;  3O65 A;  1WA8 A;  4O4J B;  2HEP A;  1H2N A;  4MTX A;  1J5E B;  4NVP A;  1K73 W;  1XNR O;  1MAB G;  3AG2 B;  3K5O A;  1KP3 A;  5LA6 B;  3RGB A;  3IC7 A;  4DR3 B;  2B1G A;  2JGD A;  4UVC A;  3A0B Z;  3ABM C;  2GV9 A;  1N36 O;  1QNM A;  3JD3 A;  4J7J A;  1YJW V;  1F4M A;  1R1B A;  4DUZ B;  1PNK A;  4JI2 B;  4LF6 B;  4PJ0 Z;  1BQ0 A;  4NXM B;  1QR8 A;  3ZN1 A;  4RQF A;  1QLE B;  4QJF B;  4DR1 B;  2H3O A;  4I50 B;  3FB7 C;  2R9R B;  3QTC A;  2YSU B;  3HKE B;  3G80 A;  1XNR B;  4LWS B;  2DOS A;  4FZ1 A;  4O2A A;  1FD9 A;  1WPX A;  4OGQ B;  2WLM A;  2DJV A;  2UXB O;  1RPR A;  4LNU A;  3EVK A;  3T1H O;  5KHK A;  4K3A A;  2P4V A;  1HNZ O;  4TV8 B;  2AGA A;  4I4T B;  3OGC C;  2ZKO A;  4F6R B;  2JDI G;  3H1L H;  1QVF U;  2ZXW C;  4X66 B;  3L74 H;  4WBN A;  5J2T A;  2EIK C;  5EYP B;  4NKG B;  4IHJ A;  4X1K A;  2K9P A;  3HPL C;  4QE9 A;  4JYY A;  2JK5 C;  3RN4 A;  4J80 A;  1YTF D;  4I50 A;  5ITZ B;  4FZ0 A;  4X9Q A;  2EIJ B;  4FM2 A;  2UXD B;  3LDC A;  2ZR2 A;  3OMI B;  4X1Y B;  3EXA A;  1NH2 D;  3CRQ A;  4DRX B;  1VQ8 V;  5FPR A;  3WB1 A;  3DXR A;  2PI5 A;  5LXT A;  5B3S B;  1K3E A;  4GUN A;  4ZI7 A;  4TV9 B;  2JJ2 G;  5B1A B;  1SZX A;  4LR3 A;  1R3J C;  1RFY A;  4JI0 O;  4PI0 A;  3CXH F;  3JD4 A;  1YI2 V;  2UXX A;  5CBF A;  2WLI B;  2YXY A;  2V7Q G;  3KKY A;  3VOU A;  1NTM H;  4QPK A;  4LF8 B;  4GKJ O;  1ZSP A;  5AG2 A;  5J2U A;  1MSW D;  4PDM A;  2K1E A;  1Q90 D;  2QWN B;  1YCI A;  4UFZ A;  2R72 A;  2Q8V A;  2XAS A;  2E5L O;  1GO3 F;  2ZR3 A;  4JTC B;  2PI4 A;  3CC2 V;  4DV4 B;  5LL6 Y;  1WN7 A;  4F4L A;  3UCS C;  1TVK A;  1ORQ C;  1Y74 B;  1OZ0 A;  4RUF A;  1JQ0 A;  4YIO A;  3GWK C;  4IHJ B;  3HKC B;  4LF5 B;  1YF2 A;  3ZCC A;  1XNQ B;  3RVY A;  2ZIM A;  3G6E V;  4LWS A;  2IJH A;  5LHI A;  4IGG A;  2DQ3 A;  3FB5 C;  4CS4 A;  5GW7 A;  4JI3 O;  2E75 B;  4AIL C;  1Y76 A;  2DYR C;  3A0H Z;  1N0J A;  5B1B B;  1PNM A;  1ZL8 A;  5JWP A;  2ZXW B;  1RSO B;  3DXR B;  5GON B;  1XQ8 A;  1IBM B;  4G28 B;  5KUK A;  2X6A A;  2XAG A;  4JF3 A;  2BTQ B;  1RM1 B;  1I94 B;  2Z3Y A;  1SQV H;  2ZQM A;  1XI1 A;  4P2Z A;  4EKW A;  4DR5 O;  4P9P A;  4N23 A;  3ZHT A;  1BQZ A;  1JR9 A;  3BAB A;  1XL6 A;  2Z5U A;  1M57 B;  5FNV B;  3PN1 A;  4EB6 B;  1NJI W;  3BA9 A;  4YY3 O;  5LGU A;  3HKD A;  3TXS A;  1Q6I A;  4JTD B;  1JFF B;  1NQT A;  3TGU H;  1N33 B;  2QDO A;  1FS0 G;  4YJ2 A;  2PF4 E;  5E1A C;  2EIN B;  3P32 A;  3ZRX A;  3HKC A;  3ML0 A;  1BHB A;  3JAS B;  4PI2 A;  2AHZ A;  2LGW A;  4DUY O;  1HP8 A;  1RP3 B;  3OTF A;  4UCT A;  4GZR B;  1JOY A;  5D5P A;  5LGT A;  1Y6X A;  2ATK C;  4DV3 O;  1VF5 B;  4X1I B;  1QBZ A;  3L9D A;  4J42 A;  1MZF A;  4OX9 B;  1HNX B;  2NNU A;  2GUZ B;  3FYE B;  2LJ2 A;  1N34 O;  1PL4 A;  4ZOL A;  3A0R A;  4GX2 A;  3C3S A;  4J7Z A;  2F93 B;  1NU1 H;  1ZAU A;  4P9O A;  4NYK A;  5C8Y A;  3P3N A;  1GTO A;  1S5H C;  1SQQ H;  1A32 A;  3H1J H;  4RO2 A;  4LF4 B;  3TET A;  2ZM6 B;  1TUE B;  1GN2 A;  1Q43 A;  2YXH A;  3ABM B;  1JA8 A;  4U3J B;  3ABL B;  4H44 B;  2X6C A;  2DYS B;  3O9O A;  2PZS A;  4OX9 O;  1PP9 H;  3ZRS A;  1IBL B;  5IJ0 B;  1YDX A;  2EJR A;  2RDC A;  2X6B A;  3CJH B;  3SJC C;  4X1Y A;  4R6Z A;  4DV0 B;  1HNX O;  5LP6 A;  2IM9 A;  3DC6 A;  1YIT V;  1AJP A;  4FVM A;  5L3F A;  1IBK O;  5EIB D;  1WLE A;  4UVB A;  2C2A A;  4DUY B;  2KKW A;  1MMM A;  1OCO B;  1L8D A;  1PNL A;  1L1F A;  4PV1 B;  4B7K A;  1HNW B;  3RYF A;  1G8M A;  2HR3 A;  1FYJ A;  2P06 A;  5CA1 B;  3BVO A;  3CCU V;  2A0L A;  3SPJ A;  2IW5 A;  1IZ3 A;  2G38 A;  2ZD9 A;  3K06 A;  1OCR C;  3LUT B;  2PY5 A;  3OEE G;  5KA6 A;  1PV0 A;  5IWA O;  2CH7 A;  2RN9 A;  1VQ4 V;  1R6K A;  5LP6 B;  3OUF A;  4JI3 B;  4TUY A;  3B77 A;  1MA1 A;  2VS0 A;  2A3Q A;  4DW0 A;  3GB7 C;  2QKA A;  3JAL B;  1O9G A;  3SPG A;  2EIM C;  5EK0 A;  1XNQ O;  1AI5 A;  3WU2 Z;  5B1O A;  5BR8 B;  5BMV A;  1TA8 A;  4GKK O;  3JAK B;  3K9S A;  1IBK B;  4WF9 V;  1AR4 A;  1HDJ A;  1K7D A;  1N0N A;  1IVS A;  4UCR A;  3NR7 A;  1E79 G;  2EJ7 A;  2MK3 A;  2X0L A;  1M56 C;  1E1R G;  4FJC C;  2ZE5 A;  4DW1 A;  3MDS A;  2DYR B;  3CCM V;  1XMQ B;  5B5E Z;  5GTI Z;  4FLZ A;  1PPJ H;  4IYI A;  2VWK A;  1F7Y A;  3WG7 B;  1N4C A;  3J80 N;  1GM9 A;  4DR4 O;  3GVM A;  4W4K A;  1HW7 A;  1JFF A;  1R3K C;  3SJQ C;  1XBL A;  3CCQ V;  2KG7 A;  2YC0 A;  3T1Y B;  2W0X A;  5IYB O;  5KAF Z;  3D36 A;  3VQX A;  4YHH O;  3VQV A;  1R6T A;  4CH5 A;  4MVU A;  3SYA A;  2HFE C;  2HJD A;  2YIB A;  3LSQ A;  1XL4 A;  4IIJ B;  4J9Y B;  3N2K A;  4OXS A;  2EIL B;  3RW0 A;  2MW2 B;  3ICX A;  3RBZ A;  2UXD O;  4B7E A;  1M1K W;  4O4I A;  4TQF A;  2W6J G;  1H2M A;  1I5X A;  2XAQ A;  1PD3 A;  2HJF C;  5KHH A;  3OUS A;  1H2K A;  3RYI B;  3C90 A;  1AR1 B;  3LDE A;  3W7U A;  2NR5 A;  2Q7G A;  3JAW A;  5D5Q A;  4HYO A;  4BW5 A;  3CJH A;  1MZE A;  3RWR D;  1SES A;  4BAY A;  1EZV H;  2EBO A;  1WB8 A;  3CD6 V;  2P22 C;  1S76 D;  3CXC U;  5CB4 B;  4DR7 B;  5IYZ A;  4J11 A;  4ZKI A;  3HKB B;  3FAV A;  2OCH A;  1WP7 A;  3BFR A;  4DR1 O;  2Y0P A;  3R65 A;  3N2G A;  4RQE A;  4HBN A;  1K5S A;  4LF6 O;  2IJK A;  3E2E A;  4DUZ O;  4DV7 O;  4TSF G;  3ZMU A;  3BCC H;  4FLU A;  2A06 H;  4MS2 A;  2YXL A;  2GUZ A;  2BOC C;  1H8H G;  3JCZ A;  3LSU A;  1RPO A;  2WA3 A;  2GTA A;  4CH6 A;  4JI4 O;  2Y4U A;  4X1K B;  4LFA O;  3KZI Z;  1VQO V;  4JAU A;  4U3J A;  2OCC C;  4Q20 A;  1VQN V;  4O4L B;  4XDK A;  2FTK A;  3CRC A;  4CS2 A;  2UXC B;  1VF7 A;  5K1P A;  3CMA V;  1J5E O;  4I0X A;  4DR6 O;  4JYA O;  3IC9 A;  4NR1 A;  4B3M O;  5LOV A;  4MVS A;  3SDL A;  1NR1 A;  4PA6 A;  5JJE B;  3IGA C;  1EFR G;  2IJJ A;  1QVG U;  4OPH A;  4LF8 O;  1MOF A;  2HVJ C;  4JI4 B;  2QA4 V;  2EUL A;  2IU0 A;  2RCV A;  1BHA A;  4MTG A;  2LO1 A;  2B9Z A;  4FFB A;  2WLN A;  3I56 V;  2JEX A;  1LR1 A;  1PL0 A;  5A9G A;  3JAR B;  4JI0 B;  3A8T A;  5LMU O;  3OGI B;  3E8F A;  1QHT A;  3JAK A;  3ZED A;  2N05 A;  4NB5 A;  3LNN A;  4H33 A;  2D2C B;  1ZTE A;  3UQ8 A;  1H2S B;  1SS3 A;  2AZ0 A;  2E76 B;  4JI7 B;  2LGQ A;  3SPH A;  2VQE B;  5KX5 A;  1L0N H;  4YJ2 B;  4CC5 A;  3CC4 V;  1EN6 A;  4NTX A;  3ZS8 C;  4NXN O;  1X59 A;  4MVR A;  2EIN C;  4W4L A;  5EC1 C;  3D3I A;  1XMO B;  1BGY H;  3EHB B;  1GRJ A;  3L71 H;  3P3P A;  2XAJ A;  4L87 A;  4KP4 A;  1FXK B;  1V54 C;  1YSC A;  3CRM A;  4LFB O;  2ADP A;  5LP6 C;  1TAE A;  3JD1 A;  2QM8 A;  1Y4M A;  1AP6 A;  2WAM A;  3UO2 A;  4KHP O;  4MW8 A;  3OR6 C;  3IAY A;  5JQG A;  3RYC B;  1CEZ A;  5C8Y B;  3T1H B;  1SA0 B;  1KMI Z;  1AI7 A;  3ZIA G;  3AG1 C;  5EIB C;  4D6T H;  3H1I H;  1P4R A;  3I5D A;  4JI5 O;  1DLB A;  2DWE C;  2E3C A;  4X20 A;  1NZ6 A;  3PJS K;  4GYC B;  4FLW A;  4PDL A;  4DV5 B;  4B3S O;  3FYI B;  2CTW A;  4PA9 A;  1KQS U;  1FPO A;  2ITD C;  1B3Q A;  4CZZ A;  5LBQ A;  2Q7E A;  2FYU H;  3S3X A;  4TUY B;  1KB9 F;  4JV5 B;  1JJO A;  4TT3 G;  1SZT A;  4LBE C;  5LHG A;  4YJ3 B;  2ZDI C;  4MVM A;  1EZJ A;  4K0K O;  4X8A A;  3OE7 G;  1O9H A;  4BIZ A;  2WLL A;  5IJ9 B;  1VF6 A;  1M93 A;  3AEI A;  1DTO A;  3E8B A;  4DR2 B;  4YIP A;  1FXK A;  4FLV A;  3BY6 A;  5LA6 A;  4PA4 A;  3CC7 V;  4PDR A;  1W59 A;  2CGO A;  4Z1M G;  4LF9 B;  1HR0 B;  3F7Y C;  1BZK A;  2CK3 G;  3QVN A;  3K58 A;  1VQK V;  1FFT B;  4B3T O;  1X4T A;  5KHI A;  4R7C A;  1WPB A;  4DV6 B;  3LDD A;  3AG7 A;  2F4V O;  4CH3 A;  1S5L Z;  3JSN A;  3ZRV A;  1OCC B;  5BZB A;  2KG7 B;  1D5A A;  2JS5 A;  1Q5O A;  3SYQ A;  3T4Z A;  2JIZ G;  3U0Z A;  4LFC B;  5IY5 C;  1S3J A;  1FJG B;  2VWJ A;  3KG2 A;  2FB5 A;  3OTO B;  2Q0O C;  1TGO A;  1H38 A;  2WLJ A;  3WB2 A;  2BSK B;  2EIJ C;  4FM0 A;  4J7K A;  4H13 B;  4I0X B;  3FB6 C;  4ZBM A;  3RYC A;  2H94 A;  3GWO A;  3L73 H;  3H9V A;  2WLI A;  2Y4T A;  5L3C A;  3CCE V;  1VMG A;  3KCX A;  2V1D A;  1V9P A;  1S5J A;  2FL4 A;  5CBG A;  1EBO A;  5JVD A;  1K4D C;  2A9H A;  1BCC H;  2AXT Z;  4QE7 A;  2XHB A;  2YEV B;  2QKC A;  4CS3 A;  3B8N A;  1U97 A;  1Z5V A;  3SJA C;  1XMQ O;  3B2E E;  3TCU A;  2NN4 A;  1WP8 A;  1Z2G A;  3K79 A;  4EFB A;  2CH7 B;  3WG7 C;  5EBM C;  2YS8 A;  2R9A A;  3MHH C;  1NH2 B;  3K9A A;  1KU9 A;  4C7U A;  1XHX A;  3N27 A;  5LMN O;  4JI8 O;  4GKK B;  5CMU A;  1MG1 A;  5L3D A;  1K97 A;  1VIB A;  1M9N A;  4UV9 A;  3ASO C;  1IBL O;  4I9W A;  2WLL B;  1ZUQ A;  2P67 A;  4X65 O;  5CA3 A;  3ZN0 A;  3ASN C;  1P7B A;  3ZMT A;  1N32 O;  2ZM6 O;  1KC8 W;  2P4K A;  2ZNI A;  1FAF A;  5LGN A;  1B6Q A;  3E22 B;  3CP1 A;  1US6 A;  4GX5 A;  4J9Z B;  1DF5 A;  2BOB C;  1BT8 A;  5DM6 V;  4KUM A;  2L35 A;  5H9C A;  2XOK G;  3TJT A;  4GX0 A;  2A7W A;  2BTQ A;  3HB3 B;  3BPZ A; 
#chains in the Genus database with same CATH homology
 1EZV H;  1PPJ H;  2IBZ H;  1NTZ H;  1KYO F;  1SQP H;  1BCC H;  2BCC H;  3H1K H;  3CXH F;  1SQB H;  4D6T H;  2FYU H;  3H1I H;  3L70 H;  4U3F H;  3BCC H;  5KLV H;  1NU1 H;  2A06 H;  1KB9 F;  1L0N H;  3H1L H;  1L0L H;  3L75 H;  1PP9 H;  3L73 H;  1SQX H;  3L72 H;  1SQQ H;  3L74 H;  3H1H H;  1P84 F;  1NTM H;  3CX5 F;  3CWB H;  3H1J H;  4PD4 F;  1BE3 H;  1NTK H;  1BGY H;  3TGU H;  1SQV H;  3L71 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...