3L70H

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l70H00
5KLVH 3CX5F 3H1LH 1SQBH 3CWBH 4PD4F 3L75H 3H1HH 1NTZH 1SQQH 2A06H 1BGYH 1SQXH 2IBZH 4U3FH 1PP9H 3H1KH 1BCCH 1NTKH 1NTMH 1PPJH 2BCCH 1L0NH 3L73H 3CXHF 4D6TH 3H1JH 3L72H 1KYOF 3H1IH 3L71H 1KB9F 1BE3H 1SQPH 1P84F 1SQVH 1NU1H 3TGUH 3L74H 1EZVH 3L70H 2FYUH 3BCCH 1L0LH
chains in the Genus database with same CATH superfamily
3DXRA 1OCZC 1AILA 1H2LA 4GLXA 4I55B 1LNQA 3DC5A 2JEXA 1QBZA 1PP9H 3ABUA 1PL0A 1ORQC 3IFXA 1BZKA 3CCMV 1WAZA 4GCZA 2IH1C 2WLIB 3FB6C 1MZFA 4FFKA 3ZHTA 2BOCC 2OWOA 3CEIA 2LQTA 4LH6A 3A2FA 1KP3A 4OGQB 4KXRA 4JI8O 4O4HA 4WBNB 1ZTEA 3UM7A 4BAYA 5H9CA 4PI2A 2ZKOA 5JWPA 1H2GA 4W4LA 3WB2A 5KMGB 1Y67A 2N74A 1OCCB 4ZHQA 1I5XA 4X64O 2GUZA 4WFGA 1EFRG 1QVFU 5BMVB 3E2EA 4KHPB 5BZBA 2BTQB 2KG7B 4DR5B 4IT5A 1HW7A 4PDRA 4ZIBA 2FMLA 2YICA 3MDSA 2EBOA 4B7EA 3SGIA 2AZ0A 5LBQA 3HKEA 4R6ZA 4MVMA 4NXMO 4I50B 1KB9F 1TUBB 2R72A 2ZNJA 3CC2V 3E8HA 3JAKB 5KHJA 4UCUA 3X2QB 4X62B 1YITV 4YIPA 1OZ0A 3AG2B 3STZC 5JJJB 2Q7GA 4X8AA 1V9PA 4DR3O 1M93A 1I94B 2JDIG 5TISZ 1F7YA 3JALB 5LL6Y 4ZBMA 5J2UB 3L72H 2YEVA 4NTXA 1PNMA 1VQLV 1Q43A 2B1IA 3KG2A 4B3MO 2NLJC 4YY3O 1VQNV 3ASNC 1HWYA 5CA1B 1A32A 1EZVH 4DW1A 2H3OA 4B3TO 4HAMA 3DTUB 1YCIA 1Q82W 1SS3A 1NKDA 1N34O 3U0ZA 3M99B 4B3SO 3CP1A 1AI5A 3T4ZA 2PYJA 3AG1B 1GM8A 3OUFA 3ZBHA 2UXBO 4OPHA 1JFFA 3CCRV 3K04A 3RYCA 4JTCB 2PYLA 4LF8B 1Y66A 2EILB 3BAAA 3LDDA 1X59A 4MTXA 2DW4A 2H94A 1HNZB 5JCOC 4I0XB 1NI8A 1W59A 4LFBB 2JGDA 4NB5A 4I4TA 3TXQA 4YHHO 4BR6A 3AEIA 4DR2O 1WN7A 3ZMZA 2UUCO 1Q6IA 4Z1VA 3K79A 3F5WC 1AP5A 1BE3H 2BTOA 4BIOA 1E1RG 4X89A 5B1BB 1URFA 5EC1C 4JI1O 4X1KA 3DXRB 3R65A 2V1DA 1BHAA 2GBOA 5H5NA 3K58A 1Q6HA 3HKDA 1NR1A 1Q6UA 1WA8A 1BS3A 1VQ7V 5B1AC 3QTCA 4CH6A 3CJHA 2OTJV 1PV0A 5LGUA 1WNSA 1BL8A 4IYIA 4O4HB 3APOA 4D7TA 2WSSG 2UXCB 2ZCEA 4J11A 2A0LA 2HEPA 1KD1W 2H8PC 4DUYB 2ZE8A 2HVKC 4ZHQB 1K34A 2QR4A 3AG7A 2GUZB 2W0XA 3L74H 5GW7A 2QKAA 4MVQA 4RO2A 1K4CC 2QWNB 1AR1B 4JYAO 1PM9A 3CSXA 5EC2C 3K5NA 3BEHA 4JAUA 5D5PA 5FLXN 3HKEB 1Y74A 3T4DA 1AI6A 3CCVV 5C8YA 4MTGA 4MTFA 3SYCA 2ADPA 3ETQA 4DV2O 2P90A 3H1HH 2YIAA 3D3QA 3ZHUA 3B2EE 2PZSA 1JOYA 2IJKA 4G2KA 1KKCA 1F4NA 1AROP 5EBMC 3CCLV 2YSUB 2YEVB 3CCUV 3ZJZA 1S5HC 3SYAA 5KUKA 1EZJA 1K4DC 3DC6A 2Q4PA 1WB8A 3ABLB 2Y69B 2DQ0A 1K33A 1BHBA 4W4KA 5KHHA 1N33B 5LMNB 2EULA 4NKGB 2R9IA 1LUWA 1NBMG 1G8MA 3FKSG 3MHSC 3G4SV 1S72V 3H1KH 3ICXA 3LNMB 1K3EA 2GTSA 3D3IA 4U3JA 1JFFB 3FAVA 3RYCB 5IWAO 1THZA 1VF7A 5B5EZ 4GX2A 4YJ2A 3JD2A 3ZHQA 3SPJA 2AW9A 2JGDB 3T1HO 3THOA 1KC8W 4I4TB 4CS4A 2XHBA 3AG4B 4EFBA 1RSOA 3ABKC 2HG5C 3FX7A 4RUFA 3LSQA 2DOSA 3K5OA 4QPJA 5CMUA 3G6EV 1NVPB 1N0JA 3GVMA 3RVZA 2CK3G 4H13B 3AK1A 4TQFA 1UFIA 2RDCA 1UPGA 2EIKB 2Y4UA 2UUAO 2A9HA 4TV9A 2IJHA 4X1KB 1TVKA 5LP6A 1SQXH 4GYCB 3CYOA 1JX9A 1LR1A 2E3CA 4FLWA 3HKDB 1KYOF 1WA8B 2JIZG 3CJHB 2F23A 5LHHA 2CGNA 4O4IA 1I0HA 1QVGU 2R9RB 2F4VO 3FB5C 4HZ3A 1BT8A 4MSWC 3ZS8C 4QNHB 1VMGA 5GONA 5JCOA 4TV8A 5EIBC 3K3WA 5EYPB 1XI1A 5CA3A 1XHXA 1GN6A 2GDSA 1IXBA 3T2MA 1SC5B 4RAIA 3ZRWA 1W0KG 3FYIB 4IIJA 3SJQC 2VWKA 3PJSK 4JI2B 4ICGA 1FFXA 5KUMA 3K0GA 3ZIAG 4X66O 2W0FC 3W7WA 1Y74B 2WLNA 1OCOC 4CH4A 4EKWA 2ILMA 3JD3A 1GK9A 2Q68A 4G28B 5C8YB 1H38A 4UFZA 2QM8A 3TGUH 2E76B 1F23A 4LF5B 1TUEB 1ZL8A 3JARA 4DR6B 4JZ2A 3AG3B 4JYCA 1CP9A 5IJ0A 4WFFA 2Q8VA 4BW5A 2P5OA 3OMNB 4UCSA 2YUAA 4JAVA 4JI8B 2F93B 1SRYA 2OIEA 3CD6V 4GUNA 2QTOA 1VQ5V 3T1YB 4FM2A 4Q6GA 1UJWB 1YZBA 2AHZA 3OMIB 3JAMN 4R8CA 2XAHA 5CN0A 1BMFG 2VQFO 4X64B 5LHGA 3QG5A 4O2AA 3N2KA 4TWKA 4U3JB 3LNNA 2BE3A 3RW0A 3FAVB 3SPGA 4UVBA 1K7DA 4IL6Z 2AZ2A 1Z5VA 4YJ2B 2ITCC 1GM7A 2XASA 1KKDA 1VARA 2R70A 3SJCC 4O4LA 3A8TA 2E5LO 2YIBD 4PA6A 3K03A 2HKOA 1RSOB 3BFRA 4NTWA 1T5EA 1WPBA 4LF7O 4DR3B 4FLXA 1HP8A 1ZSPA 3J81N 5A2QN 3ASNB 2UXXA 3EXAA 3SDLA 4TV9B 1IZ3A 1IBLO 3JD4A 1TVKB 4B3MB 5LP6B 1Q81W 1N8RW 4K35A 4YY3B 5IE9A 2ADQB 3HKCA 1L0NH 5LYJA 2QM7A 3E22A 4X1IA 1FAFA 4B3TB 1IBMO 1MG1A 4HYOA 1NS1A 1N34B 2VQEO 4B3SB 4O4IB 1Y76A 2EINC 4DV5B 2CH7A 2UXBB 1QHTA 2HVJC 1VQ8V 1Q8IA 5GONB 2DQ3A 1DK1A 4JI0O 4JF3A 4TV8B 3DGEA 2FL4A 3FB7C 1K9MW 1NT2B 1F4MA 1QCEA 4K3AA 3ZRWB 1XQ8A 3ETDA 4IIJB 4E2LA 2PY5A 4L8JA 3R66A 1XMQB 4DR2B 4MVSA 1FFXB 4JPRA 4RUEA 3H9VA 2UUCB 4I5SA 3SPIA 1N36O 4AI8A 3B8NA 4HNAA 5CB4A 3HKBA 3K59A 5B3SB 3L71H 2Z3YA 4DO2A 5IJ9A 3LSSA 4NTYA 1HDJA 3ZN0A 5B1AB 2E75B 4LR3A 3U11A 5KA5A 5IT9N 1AI4A 1ZL8B 2LO1A 3JARB 4Z2WA 4LWSA 1R3KC 2QWQB 4RWUA 2QM4A 5LA6A 5IJ0B 2YDEA 1H2NA 3JD1A 3L73H 1MMMA 3E89A 3G6BA 3ZMSA 2UUBB 4GX1A 4E4EA 1JA8A 1GH6A 5KX5A 3PN1A 3KKYA 4QJFB 1EN4A 3ETEA 2XTAA 4X1YA 1QLEC 2XT9A 4O2AB 3N2KB 2P4KA 5GTIZ 1OCRC 3OAAG 5KAFZ 2DYRC 1HNXO 3UO3A 4PHZA 3OM3B 4LH7A 4LF6O 4UV9A 5F2VO 3UCSC 2JS5A 2N04A 1MNGA 1D2DA 2KSDA 3BVOA 3IC9A 4U7NA 4O4LB 4OPAA 5KA6A 2CE4A 2WLMA 3IAYA 1VP7A 2OCCC 3C90A 2IW5A 1XEQA 2ZIMA 4B7KA 2Y0PA 4DXWA 4AQYO 1S5JA 5ITZA 3RYIA 4LP8A 1V54B 3BCCH 3OW2U 1Y6XA 1GN2A 1G6UA 2WPDG 1JQ0A 2EIJC 1PPJH 1ROPA 2F1MA 3HKCB 5LYJB 1COWG 1X4TA 4X1IB 3E22B 2E74B 3JYCA 1Q90D 5L3CA 2GSMB 3GWKC 2FKXA 1QR8A 4JI5O 3G80A 3BABA 1Y76B 4BW9A 2Y48A 1DF5A 5GTHZ 2CH7B 4JZGA 1NTZH 1SZTA 3RFRA 5IWAB 3ZCCA 1ZLZA 4J10A 1PD3A 4JI3O 2CTWA 4UVAA 1SQVH 2RMKB 5DN6G 3BA8A 4DUZO 2UXDO 1EN6A 3ASOB 3ABKB 3T1HB 4K0KO 3EVKA 5BXZA 4LFAO 2LW1A 1EN5A 1EM1A 2LJ2A 2ITDC 2A3QA 3NXSA 1CXZB 1IVSA 3OR7C 4HNAB 5CB4B 3HKBB 1SF9A 4D7SA 2DN9A 4X65O 1VIBA 2AHYA 3SR2C 1KP2A 3U10A 1SQPH 2WLLA 4AHCA 3E83A 5IJ9B 3CC4V 2QWPB 2UXNA 4PELA 4MVOA 2Q7EA 1BSMA 1R1BA 2Q7HA 4IHJA 2QWRB 2JJ2G 4WFAV 2FTKA 3OE7G 4LWSB 3UT5A 3BHPA 5LA6B 4H33A 2ATKC 2Q69A 4JI6O 2F4VB 2JS3A 1RM1C 3SPCA 4LBEC 1ENVA 3I56V 5IYZA 1GN4A 4DV0O 4WFHA 3OTOO 3TXSA 4TT3G 5KX5B 4DV6B 2LGWA 2FB5A 4DV1O 3KCYA 3L9DA 4K8ZA 4X1YB 5EYPA 2P4VA 2WA3A 1I5YA 3CRQA 3CMAV 1V55C 3UO2A 2Q0OC 3I5DA 3TK1A 2ZM6B 2X6BA 1M56B 3WFVA 2DYSC 1S0VA 1K97A 5IYDO 4PI0A 4X66B 2W6IG 2JVDA 4DRXA 1RFYA 1QU7A 3JATA 2PTMA 1XL4A 1NTKH 3WG7B 3OD4A 1TA8A 2ZNIA 2IH3C 2B5UA 1Q86W 4GZRB 1SKVA 3IGAC 3BA9A 2WLJA 5ITZB 3RYIB 2OT5A 3D36C 4KHPO 1OCCC 2Q67A 5EBWC 3QVNA 1CEZA 2CGOA 3JCUZ 4H37A 4TUYA 4UXNA 3EHBB 3CS5A 3P3NA 2OIGA 2YI8A 4DV3O 5L3GA 3FB8C 1BQZA 2EIMC 1S5LZ 4UCRA 5HFLA 3FYEB 1PNLA 4PDMA 1VQ6V 3A0HZ 3RN4A 3LSUA 4IGGA 1US6A 4JV5B 1S3JA 3AG2C 4PV1B 1M9NA 4MS2A 3CCJV 4DR4O 4JYYA 4UUJC 4X20A 4LFCO 1SQBH 1YSCA 1PL4A 4UV8A 3F7YC 3ZRXA 2ZIOA 3ABMC 2RJZA 4FZ0A 2HR3A 4LF7B 4GX5A 1SETA 5JJEB 2WLLB 2NR5A 3B8MA 3MHHC 5C93A 1IBLB 3I55V 4FM1A 4U7OA 3KZIZ 2CTQA 4LF8O 3AG1C 4DW0A 1AB3A 3S3XA 2O57A 4X9QA 4PD4F 2OCHA 2EINB 1FXHA 1P7GA 4IHJB 3QNEA 4PDVA 1IBMB 4U3FH 1XNQO 3UT5B 2EILC 3QO7A 2WAMA 3N2GA 1IBKO 1FJGO 3K5MA 3VQXA 1YTFB 5FL7G 5IYZB 5JJNB 1N32O 3OEHG 4BWAA 5KHIA 4JI0B 2P6JA 1KUQA 1MSDA 3ZX6A 2CAZC 4LNUA 3VQVA 2IJIA 2D3OW 1XL6A 1R6NA 2IU0A 5B1BC 4J9YB 1P7BA 1MOFA 3JASA 4J80A 3W7TA 2LGQA 1HNWO 2GHYA 1N36B 1AJQA 1GAXA 1SQFA 3S3WA 3STLC 4OX9B 4DRXB 4ABMA 4C7UA 3JATB 1VQMV 1YJ9V 2X6CA 2DWEC 4J7ZA 3OEEG 2BCCH 2OTLV 1OCZB 1M57C 1XHZA 4ZOLA 3J7AU 4FLTA 1JR9A 1F51A 3A0BZ 3Q4HA 4DUYO 1QLNA 2XNDG 1JVMA 2ZDIC 1Q5OA 1K8AW 3ZN1A 3J80N 4PJ0Z 4MT8A 5CA0A 4AILC 1SQQH 3CHXA 1JJ2U 2ODMA 4WFEA 1D5AA 1YHQV 4NR1A 4NXNO 4GKKO 1QLEB 4TUYB 1J5EO 4P9PA 3ZMUA 4JTAB 1OCRB 2Q73A 5JVDA 1YI2V 5IY5C 2IBZH 2GTAA 4F6RA 1HNXB 2BOBC 3AK2A 4B3RO 4UB6Z 4ASUG 3K0DA 1CPYA 1YJNV 4WCEV 1I7FA 1H8EG 3UKMA 4LF6B 5K1XA 4EEQA 2EJRA 2V4DA 1VQ9V 1R6TA 5B66Z 4QPKA 3LDEA 4BIUA 3APQA 1R3JC 3ETGA 3TJTA 4FPPA 2ZR3A 4DR7O 5LMUO 4X20B 2WA4A 2ZE7A 3CWBH 4NXMB 1SERA 1DTOA 1L1FA 2GV9A 2QGNA 3ML0A 4QE9A 4AQYB 1ZX3A 2YC0A 3ABLC 2Y69C 2V7QG 1MSWD 5AG2A 3ZMTA 3OFNG 2Y0IA 3KCXA 1M1KW 3MD0A 3B40A 1YJWV 2VRZA 1P49A 1HR0O 4J9ZB 4ZI7A 1PNKA 5KLVH 4EB6A 3AK3A 5LGNA 4G27B 2BSKA 2M7WA 3N2GB 3VQYA 3CC7V 4JI5B 1JPXA 1SA0A 1XREA 5FPOA 2WWWA 4P9OA 1NZ6A 1XUQA 5JQGA 2P06A 1XNRO 1QNMA 4PA7A 4I7ZB 5E1AC 1K73W 1FD9A 3G67A 2JEUA 3K9SA 3B09A 3F7VC 2UU9O 4LNUB 1LUVA 2P22C 2YXLA 1IX9A 1NQTA 4QGPA 2UXDB 5FNVA 3BRCA 3JASB 4K0KB 4LFAB 2MK3A 2LFRA 5FPRA 5CBGA 4P2ZA 3OGIB 3P32A 4YHHB 4FLUA 4UVCA 5HFMA 4CC5A 4RQEA 1NVPD 2HJDA 3E8GA 1JMKC 2IU3A 1NTMH 3IJ4A 4CZZA 2DMXA 3A0RA 3M8AA 4ZOLB 4JI1B 1B6QA 3Q4HB 4QE7A 3OMAB 1AJNA 1Q3EA 4LF9O 2P67A 5L3EA 4LCUC 2YS8A 1K92A 2RN9A 1W2BU 2ZXWC 4B08A 1VQKV 5CA0B 2A06H 3EFFK 1B3QA 2XUMA 2QJ1A 1IDSA 3K5LA 5LGTA 2ARHA 1Q7YW 5LOVA 4DV0B 2KKWA 2JRIA 3OTOB 4N21A 4FLYA 1L8DA 2ZE6A 5H6QA 1H2SB 2F95B 1YVWA 4MTOA 2RNBA 2ZD9A 1WLEA 2DYSB 5EZYA 1KMIZ 5JVDB 2Z5UA 4MW3A 4DV7O 4FMTA 3C3SA 4F6RB 4H44B 4JTDB 2ZT9B 4L87A 2ZE5A 2K9PA 4LF5O 2ZINA 4DR6O 2PGGA 4JI4O 1S76D 3W7SA 4JYAB 3AG3C 1P4RA 1GM9A 2Q0AA 3CX5F 2ZDIA 3NR7A 4DV4O 5DEDA 2XAFA 2PI5A 3T1YO 5J2TA 3CRCA 2XAGA 2X6AA 4DV2B 1XDCA 2X0LA 4KP4A 3RBZA 3ABTA 4PA3A 1SZXA 5H6RA 3B4SA 4ZI7B 3HPLC 1JCHA 4RQFA 4EB6B 1O9HA 2EIMB 1AR4A 1M4UA 1XMOO 2BSKB 4JI7O 3OTFA 5L3BA 1R73A 4FJCC 2EJ7A 4DV3B 1SA0B 1EBOA 1FXVA 5JQGB 2YIBA 1AVMA 5IYCO 4GKJO 1DF4A 1IURA 2RCVA 1G4YB 4J42A 3LUTB 3BPZA 3ZRSA 2QKSA 5FNVB 2D2CB 2WLKA 3DSQA 4DR4B 3ABMB 3LDCA 2YIDA 4LF4O 3OR6C 4LFCB 4DK1A 3JAWA 5LP6C 4DR1O 1H2KA 4JASA 1QQCA 1VF6C 5B1OA 2NNUA 3JSLA 2PI4A 4DV5O 4FM0A 2DWDC 3H1JH 4UB8Z 1ZWIC 4Q20A 1WB7A 1FXKC 4KL1A 2UUAB 3E8FA 1KBHA 2VWJA 3RVYA 5BR8O 4IYHA 1R3IC 1XNQB 4MVUA 1U97A 1IBKB 1FJGB 5LHIA 3L75H 1XMQO 4CC6A 3TETA 1N32B 1JJOA 3H01A 1Z5WA 5LOVB 3CPWU 5JH7A 4O2BA 2HHHO 3RYFA 4P30A 1VQOV 2C2AA 2X7RB 1NU1H 3M7MX 5CBHA 4A5UB 1IXMA 3JD0A 5EK0A 5EZYB 2K1EA 4JGSA 1BQ0A 1W0JG 3CRMA 3N27A 5B3SC 1FKAO 2JGUA 2HFEC 3RWRD 1HNWB 1G1XB 1H2MA 2YXHA 1GO3F 4YJ3A 4XDKA 5DECA 1M57B 4FIPC 1OCOB 2DJVA 1R6KA 1TAEA 1VF5B 3UQ8A 2UUBO 3GWOA 3CMEV 2PF4E 3RT3C 3SPHA 1WP8A 5J2TB 1M5IA 1B06A 1OHHG 4LC1A 4FVMA 4CH5A 4YIOA 4OXSA 2CUGA 1VQPV 3CE2A 1KU9A 4NXNB 3ZHSA 4GKKB 1DGSA 4N23A 1J5EB 5IY5B 4DYLA 2F66C 4DR5O 2QTSA 4D6TH 4TQDA 2WLHA 4F6EA 2B9ZA 5H2FZ 2JJ1G 3SYOA 2HLDG 1RP3B 1YF2A 4KUMA 3ZHVA 1SESA 3W7UA 1H8HG 4B3RB 2VQFB 1GTOA 3QO5A 3RYHA 4XDLA 4CS3A 2Q9LA 4FFBA 4F4LA 3OUSA 4X62O 3CCQV 2VS0A 1TGOA 4UCVA 1I94O 3X2QC 4DR7B 2A7WA 5KHGA 1V54C 2W6JG 5LMUB 3E8BA 5D5QA 2F43G 3JAWB 1OV9A 2AXTZ 2QWOB 3FD9A 1AJPA 1MA1A 1XILA 2E5LB 3HR0A 1FS0G 1NH2B 3D8CA 2HJFC 1U96A 1WP7A 1OJHA 1YDXA 3H1IH 4J7JA 1GRJA 4BIZA 1R3LC 1HR0B 3C3TA 4QIWF 5KHKA 2LFSA 1DLBA 2OYQA 2FYUH 2QDOA 2Q5ZA 2IJJA 2YXYA 3VQWA 1HNZO 2A79B 4LFBO 1XNRB 3ASOC 2VQEB 5JH7B 2QEXV 2KB1A 4O2BB 2L35A 2QKCA 3QF7A 3RYFB 4ZKIA 4GT1A 2UU9B 1E79G 3O9OA 4NVPA 3L70H 4PDLA 1XOUA 3CXCU 3WU2Z 1M90W 3K06A 4O4JA 2P7TC 3SJBC 3O65A 1VF6A 3P30A 2EZPA 2NN4A 1Y4MA 2LP7A 4YJ3B 3WB1A 5BY1A 2PUSA 1FXKA 4WF9V 3QO8A 2G38A 5CBFA 1NJIW 2IM9A 2L6LA 4Z1MG 1I08A 2XOKG 5IDJA 2XAJA 1Z2GA 5E79Z 3GB7C 4CS2A 4DV6O 3VBBA 2ZXWB 5B1NA 4FZ1A 1AR5A 4LF9B 2UXCO 1GMGA 5KAIZ 2CTPA 3K08A 4UCOA 2ZM6O 1RPOA 1MZEA 5LXTA 5EIBD 1FPOA 3SJAC 1M56C 4J7KA 1WPXA 1S77D 4CBCA 3E86A 1P84F 3CCSV 3FFQA 2QE7G 5L3DA 4DK0A 2RQ6A 1RPRA 4DV7B 3E35A 2HP8A 2DYRB 4X88A 4HBNA 1FFTB 3RYHB 2MW2B 1L0LH 3WG7C 4MW8A 3H1LH 3W7XA 4FFBB 4JI4B 4I55A 2B1GA 4JAAA 1BCCH 1XBLA 3CXHF 3K9AA 3OGCC 2WLIA 2CDYA 3ZEDA 4DV4B 3JSNA 1K5QA 2EX3A 1PKXA 4R50A 2XAQA 1KECA 2OCCB 3IC7A 4WBNA 5EBLC 4MVRA 1J95A 4EFEA 1SQGA 3SYPA 4WFBV 3ZHRA 3D36A 5KMGA 3CRRA 5K1PA 1YIJV 1N33O 5LMNO 4I9QA 5DM6V 3WB0A 4YXWG 2EIJB 2ETNA 5BMVA 1KQSU 4K8XA 1WJZA 2BTQA 2KG7A 4JV5O 2Y4TA 3MAQA 1XMOB 4JI7B 2Q6AA 4H0LB 2QSAA 2KQXA 2QA4V 3K57A 1BGYH 1N4CA 3OT7A 3CB2A 1D5NA 4MVZA 5IYBO 4I50A 1TUBA 1VQ4V 4GKJB 1FYJA 4R7CA 4GX0A 4XBFA 3JAKA 5L3FA 2R9AA 3ZMVA 2AGAA 1AP6A 1NR7A 4JI3B 3AG4C 4CH3A 4PA4A 3JCZA 1O9GA 3JALA 1ZAUA 4LF4B 1YEWA 4O4JB 3ZRVA 4NYKA 5J2UA 4DUZB 1NH2D 2JK5C 3P3PA 2EIKC 4DR1B 4J41A 5CA1A 3RGBA 1FXKB 4X65B 3SYQA 4FK5C 1GKFA 3B77A 3HB3B 4PA9A 1B04A 3G71V 4I9WA 1QR9A 2N05A 3CCEV 5BR8B 5J9PC 2CTRA 3CRAA 1N0NA 1AI7A 1E1QG 5A9GA 3BY6A 4KFMA 1YXBA 1RM1B 4I0XA 1ZUQA 2EZOA 2M6YA 5LXTB 3T1CA 2LW7A 4TSFG 1MABG 4JI6B 4FLZA 1YTFD 1K5SA 2HHHB 2YI9A 4OX9O 4TOIA 2ZR2A 4UCTA 4JI2O 4JYBA 3VOUA 3F5TA 2DE0X 1GN3A 3TCUA 4DV1B 1V55B 2Z0AA 4XDJA 2ZQMA 4FLVA 1VEWA
chains in the Genus database with same CATH topology
5KLVH 3CX5F 3H1LH 1SQBH 3CWBH 4PD4F 3L75H 3H1HH 1NTZH 1SQQH 2A06H 1BGYH 1SQXH 2IBZH 4U3FH 1PP9H 3H1KH 1BCCH 1NTKH 1NTMH 1PPJH 2BCCH 1L0NH 3L73H 3CXHF 4D6TH 3H1JH 3L72H 1KYOF 3H1IH 3L71H 1KB9F 1BE3H 1SQPH 1P84F 1SQVH 1NU1H 3TGUH 3L74H 1EZVH 3L70H 2FYUH 3BCCH 1L0LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV H;  3CX5 F;  3H1L H;  1SQB H;  3CWB H;  4PD4 F;  3L75 H;  3H1H H;  1NTZ H;  1SQQ H;  2A06 H;  1BGY H;  1SQX H;  2IBZ H;  4U3F H;  1PP9 H;  3H1K H;  1BCC H;  1NTK H;  1NTM H;  1PPJ H;  2BCC H;  1L0N H;  3L73 H;  3CXH F;  4D6T H;  3H1J H;  3L72 H;  1KYO F;  3H1I H;  3L71 H;  1KB9 F;  1BE3 H;  1SQP H;  1P84 F;  1SQV H;  1NU1 H;  3TGU H;  3L74 H;  1EZV H;  3L70 H;  2FYU H;  3BCC H;  1L0L H; 
#chains in the Genus database with same CATH topology
 3DXR A;  1OCZ C;  1AIL A;  1H2L A;  4GLX A;  4I55 B;  1LNQ A;  3DC5 A;  2JEX A;  1QBZ A;  1PP9 H;  3ABU A;  1PL0 A;  1ORQ C;  3IFX A;  1BZK A;  3CCM V;  1WAZ A;  4GCZ A;  2IH1 C;  2WLI B;  3FB6 C;  1MZF A;  4FFK A;  3ZHT A;  2BOC C;  2OWO A;  3CEI A;  2LQT A;  4LH6 A;  3A2F A;  1KP3 A;  4OGQ B;  4KXR A;  4JI8 O;  4O4H A;  4WBN B;  1ZTE A;  3UM7 A;  4BAY A;  5H9C A;  4PI2 A;  2ZKO A;  5JWP A;  1H2G A;  4W4L A;  3WB2 A;  5KMG B;  1Y67 A;  2N74 A;  1OCC B;  4ZHQ A;  1I5X A;  4X64 O;  2GUZ A;  4WFG A;  1EFR G;  1QVF U;  5BMV B;  3E2E A;  4KHP B;  5BZB A;  2BTQ B;  2KG7 B;  4DR5 B;  4IT5 A;  1HW7 A;  4PDR A;  4ZIB A;  2FML A;  2YIC A;  3MDS A;  2EBO A;  4B7E A;  3SGI A;  2AZ0 A;  5LBQ A;  3HKE A;  4R6Z A;  4MVM A;  4NXM O;  4I50 B;  1KB9 F;  1TUB B;  2R72 A;  2ZNJ A;  3CC2 V;  3E8H A;  3JAK B;  5KHJ A;  4UCU A;  3X2Q B;  4X62 B;  1YIT V;  4YIP A;  1OZ0 A;  3AG2 B;  3STZ C;  5JJJ B;  2Q7G A;  4X8A A;  1V9P A;  4DR3 O;  1M93 A;  1I94 B;  2JDI G;  5TIS Z;  1F7Y A;  3JAL B;  5LL6 Y;  4ZBM A;  5J2U B;  3L72 H;  2YEV A;  4NTX A;  1PNM A;  1VQL V;  1Q43 A;  2B1I A;  3KG2 A;  4B3M O;  2NLJ C;  4YY3 O;  1VQN V;  3ASN C;  1HWY A;  5CA1 B;  1A32 A;  1EZV H;  4DW1 A;  2H3O A;  4B3T O;  4HAM A;  3DTU B;  1YCI A;  1Q82 W;  1SS3 A;  1NKD A;  1N34 O;  3U0Z A;  3M99 B;  4B3S O;  3CP1 A;  1AI5 A;  3T4Z A;  2PYJ A;  3AG1 B;  1GM8 A;  3OUF A;  3ZBH A;  2UXB O;  4OPH A;  1JFF A;  3CCR V;  3K04 A;  3RYC A;  4JTC B;  2PYL A;  4LF8 B;  1Y66 A;  2EIL B;  3BAA A;  3LDD A;  1X59 A;  4MTX A;  2DW4 A;  2H94 A;  1HNZ B;  5JCO C;  4I0X B;  1NI8 A;  1W59 A;  4LFB B;  2JGD A;  4NB5 A;  4I4T A;  3TXQ A;  4YHH O;  4BR6 A;  3AEI A;  4DR2 O;  1WN7 A;  3ZMZ A;  2UUC O;  1Q6I A;  4Z1V A;  3K79 A;  3F5W C;  1AP5 A;  1BE3 H;  2BTO A;  4BIO A;  1E1R G;  4X89 A;  5B1B B;  1URF A;  5EC1 C;  4JI1 O;  4X1K A;  3DXR B;  3R65 A;  2V1D A;  1BHA A;  2GBO A;  5H5N A;  3K58 A;  1Q6H A;  3HKD A;  1NR1 A;  1Q6U A;  1WA8 A;  1BS3 A;  1VQ7 V;  5B1A C;  3QTC A;  4CH6 A;  3CJH A;  2OTJ V;  1PV0 A;  5LGU A;  1WNS A;  1BL8 A;  4IYI A;  4O4H B;  3APO A;  4D7T A;  2WSS G;  2UXC B;  2ZCE A;  4J11 A;  2A0L A;  2HEP A;  1KD1 W;  2H8P C;  4DUY B;  2ZE8 A;  2HVK C;  4ZHQ B;  1K34 A;  2QR4 A;  3AG7 A;  2GUZ B;  2W0X A;  3L74 H;  5GW7 A;  2QKA A;  4MVQ A;  4RO2 A;  1K4C C;  2QWN B;  1AR1 B;  4JYA O;  1PM9 A;  3CSX A;  5EC2 C;  3K5N A;  3BEH A;  4JAU A;  5D5P A;  5FLX N;  3HKE B;  1Y74 A;  3T4D A;  1AI6 A;  3CCV V;  5C8Y A;  4MTG A;  4MTF A;  3SYC A;  2ADP A;  3ETQ A;  4DV2 O;  2P90 A;  3H1H H;  2YIA A;  3D3Q A;  3ZHU A;  3B2E E;  2PZS A;  1JOY A;  2IJK A;  4G2K A;  1KKC A;  1F4N A;  1ARO P;  5EBM C;  3CCL V;  2YSU B;  2YEV B;  3CCU V;  3ZJZ A;  1S5H C;  3SYA A;  5KUK A;  1EZJ A;  1K4D C;  3DC6 A;  2Q4P A;  1WB8 A;  3ABL B;  2Y69 B;  2DQ0 A;  1K33 A;  1BHB A;  4W4K A;  5KHH A;  1N33 B;  5LMN B;  2EUL A;  4NKG B;  2R9I A;  1LUW A;  1NBM G;  1G8M A;  3FKS G;  3MHS C;  3G4S V;  1S72 V;  3H1K H;  3ICX A;  3LNM B;  1K3E A;  2GTS A;  3D3I A;  4U3J A;  1JFF B;  3FAV A;  3RYC B;  5IWA O;  1THZ A;  1VF7 A;  5B5E Z;  4GX2 A;  4YJ2 A;  3JD2 A;  3ZHQ A;  3SPJ A;  2AW9 A;  2JGD B;  3T1H O;  3THO A;  1KC8 W;  4I4T B;  4CS4 A;  2XHB A;  3AG4 B;  4EFB A;  1RSO A;  3ABK C;  2HG5 C;  3FX7 A;  4RUF A;  3LSQ A;  2DOS A;  3K5O A;  4QPJ A;  5CMU A;  3G6E V;  1NVP B;  1N0J A;  3GVM A;  3RVZ A;  2CK3 G;  4H13 B;  3AK1 A;  4TQF A;  1UFI A;  2RDC A;  1UPG A;  2EIK B;  2Y4U A;  2UUA O;  2A9H A;  4TV9 A;  2IJH A;  4X1K B;  1TVK A;  5LP6 A;  1SQX H;  4GYC B;  3CYO A;  1JX9 A;  1LR1 A;  2E3C A;  4FLW A;  3HKD B;  1KYO F;  1WA8 B;  2JIZ G;  3CJH B;  2F23 A;  5LHH A;  2CGN A;  4O4I A;  1I0H A;  1QVG U;  2R9R B;  2F4V O;  3FB5 C;  4HZ3 A;  1BT8 A;  4MSW C;  3ZS8 C;  4QNH B;  1VMG A;  5GON A;  5JCO A;  4TV8 A;  5EIB C;  3K3W A;  5EYP B;  1XI1 A;  5CA3 A;  1XHX A;  1GN6 A;  2GDS A;  1IXB A;  3T2M A;  1SC5 B;  4RAI A;  3ZRW A;  1W0K G;  3FYI B;  4IIJ A;  3SJQ C;  2VWK A;  3PJS K;  4JI2 B;  4ICG A;  1FFX A;  5KUM A;  3K0G A;  3ZIA G;  4X66 O;  2W0F C;  3W7W A;  1Y74 B;  2WLN A;  1OCO C;  4CH4 A;  4EKW A;  2ILM A;  3JD3 A;  1GK9 A;  2Q68 A;  4G28 B;  5C8Y B;  1H38 A;  4UFZ A;  2QM8 A;  3TGU H;  2E76 B;  1F23 A;  4LF5 B;  1TUE B;  1ZL8 A;  3JAR A;  4DR6 B;  4JZ2 A;  3AG3 B;  4JYC A;  1CP9 A;  5IJ0 A;  4WFF A;  2Q8V A;  4BW5 A;  2P5O A;  3OMN B;  4UCS A;  2YUA A;  4JAV A;  4JI8 B;  2F93 B;  1SRY A;  2OIE A;  3CD6 V;  4GUN A;  2QTO A;  1VQ5 V;  3T1Y B;  4FM2 A;  4Q6G A;  1UJW B;  1YZB A;  2AHZ A;  3OMI B;  3JAM N;  4R8C A;  2XAH A;  5CN0 A;  1BMF G;  2VQF O;  4X64 B;  5LHG A;  3QG5 A;  4O2A A;  3N2K A;  4TWK A;  4U3J B;  3LNN A;  2BE3 A;  3RW0 A;  3FAV B;  3SPG A;  4UVB A;  1K7D A;  4IL6 Z;  2AZ2 A;  1Z5V A;  4YJ2 B;  2ITC C;  1GM7 A;  2XAS A;  1KKD A;  1VAR A;  2R70 A;  3SJC C;  4O4L A;  3A8T A;  2E5L O;  2YIB D;  4PA6 A;  3K03 A;  2HKO A;  1RSO B;  3BFR A;  4NTW A;  1T5E A;  1WPB A;  4LF7 O;  4DR3 B;  4FLX A;  1HP8 A;  1ZSP A;  3J81 N;  5A2Q N;  3ASN B;  2UXX A;  3EXA A;  3SDL A;  4TV9 B;  1IZ3 A;  1IBL O;  3JD4 A;  1TVK B;  4B3M B;  5LP6 B;  1Q81 W;  1N8R W;  4K35 A;  4YY3 B;  5IE9 A;  2ADQ B;  3HKC A;  1L0N H;  5LYJ A;  2QM7 A;  3E22 A;  4X1I A;  1FAF A;  4B3T B;  1IBM O;  1MG1 A;  4HYO A;  1NS1 A;  1N34 B;  2VQE O;  4B3S B;  4O4I B;  1Y76 A;  2EIN C;  4DV5 B;  2CH7 A;  2UXB B;  1QHT A;  2HVJ C;  1VQ8 V;  1Q8I A;  5GON B;  2DQ3 A;  1DK1 A;  4JI0 O;  4JF3 A;  4TV8 B;  3DGE A;  2FL4 A;  3FB7 C;  1K9M W;  1NT2 B;  1F4M A;  1QCE A;  4K3A A;  3ZRW B;  1XQ8 A;  3ETD A;  4IIJ B;  4E2L A;  2PY5 A;  4L8J A;  3R66 A;  1XMQ B;  4DR2 B;  4MVS A;  1FFX B;  4JPR A;  4RUE A;  3H9V A;  2UUC B;  4I5S A;  3SPI A;  1N36 O;  4AI8 A;  3B8N A;  4HNA A;  5CB4 A;  3HKB A;  3K59 A;  5B3S B;  3L71 H;  2Z3Y A;  4DO2 A;  5IJ9 A;  3LSS A;  4NTY A;  1HDJ A;  3ZN0 A;  5B1A B;  2E75 B;  4LR3 A;  3U11 A;  5KA5 A;  5IT9 N;  1AI4 A;  1ZL8 B;  2LO1 A;  3JAR B;  4Z2W A;  4LWS A;  1R3K C;  2QWQ B;  4RWU A;  2QM4 A;  5LA6 A;  5IJ0 B;  2YDE A;  1H2N A;  3JD1 A;  3L73 H;  1MMM A;  3E89 A;  3G6B A;  3ZMS A;  2UUB B;  4GX1 A;  4E4E A;  1JA8 A;  1GH6 A;  5KX5 A;  3PN1 A;  3KKY A;  4QJF B;  1EN4 A;  3ETE A;  2XTA A;  4X1Y A;  1QLE C;  2XT9 A;  4O2A B;  3N2K B;  2P4K A;  5GTI Z;  1OCR C;  3OAA G;  5KAF Z;  2DYR C;  1HNX O;  3UO3 A;  4PHZ A;  3OM3 B;  4LH7 A;  4LF6 O;  4UV9 A;  5F2V O;  3UCS C;  2JS5 A;  2N04 A;  1MNG A;  1D2D A;  2KSD A;  3BVO A;  3IC9 A;  4U7N A;  4O4L B;  4OPA A;  5KA6 A;  2CE4 A;  2WLM A;  3IAY A;  1VP7 A;  2OCC C;  3C90 A;  2IW5 A;  1XEQ A;  2ZIM A;  4B7K A;  2Y0P A;  4DXW A;  4AQY O;  1S5J A;  5ITZ A;  3RYI A;  4LP8 A;  1V54 B;  3BCC H;  3OW2 U;  1Y6X A;  1GN2 A;  1G6U A;  2WPD G;  1JQ0 A;  2EIJ C;  1PPJ H;  1ROP A;  2F1M A;  3HKC B;  5LYJ B;  1COW G;  1X4T A;  4X1I B;  3E22 B;  2E74 B;  3JYC A;  1Q90 D;  5L3C A;  2GSM B;  3GWK C;  2FKX A;  1QR8 A;  4JI5 O;  3G80 A;  3BAB A;  1Y76 B;  4BW9 A;  2Y48 A;  1DF5 A;  5GTH Z;  2CH7 B;  4JZG A;  1NTZ H;  1SZT A;  3RFR A;  5IWA B;  3ZCC A;  1ZLZ A;  4J10 A;  1PD3 A;  4JI3 O;  2CTW A;  4UVA A;  1SQV H;  2RMK B;  5DN6 G;  3BA8 A;  4DUZ O;  2UXD O;  1EN6 A;  3ASO B;  3ABK B;  3T1H B;  4K0K O;  3EVK A;  5BXZ A;  4LFA O;  2LW1 A;  1EN5 A;  1EM1 A;  2LJ2 A;  2ITD C;  2A3Q A;  3NXS A;  1CXZ B;  1IVS A;  3OR7 C;  4HNA B;  5CB4 B;  3HKB B;  1SF9 A;  4D7S A;  2DN9 A;  4X65 O;  1VIB A;  2AHY A;  3SR2 C;  1KP2 A;  3U10 A;  1SQP H;  2WLL A;  4AHC A;  3E83 A;  5IJ9 B;  3CC4 V;  2QWP B;  2UXN A;  4PEL A;  4MVO A;  2Q7E A;  1BSM A;  1R1B A;  2Q7H A;  4IHJ A;  2QWR B;  2JJ2 G;  4WFA V;  2FTK A;  3OE7 G;  4LWS B;  3UT5 A;  3BHP A;  5LA6 B;  4H33 A;  2ATK C;  2Q69 A;  4JI6 O;  2F4V B;  2JS3 A;  1RM1 C;  3SPC A;  4LBE C;  1ENV A;  3I56 V;  5IYZ A;  1GN4 A;  4DV0 O;  4WFH A;  3OTO O;  3TXS A;  4TT3 G;  5KX5 B;  4DV6 B;  2LGW A;  2FB5 A;  4DV1 O;  3KCY A;  3L9D A;  4K8Z A;  4X1Y B;  5EYP A;  2P4V A;  2WA3 A;  1I5Y A;  3CRQ A;  3CMA V;  1V55 C;  3UO2 A;  2Q0O C;  3I5D A;  3TK1 A;  2ZM6 B;  2X6B A;  1M56 B;  3WFV A;  2DYS C;  1S0V A;  1K97 A;  5IYD O;  4PI0 A;  4X66 B;  2W6I G;  2JVD A;  4DRX A;  1RFY A;  1QU7 A;  3JAT A;  2PTM A;  1XL4 A;  1NTK H;  3WG7 B;  3OD4 A;  1TA8 A;  2ZNI A;  2IH3 C;  2B5U A;  1Q86 W;  4GZR B;  1SKV A;  3IGA C;  3BA9 A;  2WLJ A;  5ITZ B;  3RYI B;  2OT5 A;  3D36 C;  4KHP O;  1OCC C;  2Q67 A;  5EBW C;  3QVN A;  1CEZ A;  2CGO A;  3JCU Z;  4H37 A;  4TUY A;  4UXN A;  3EHB B;  3CS5 A;  3P3N A;  2OIG A;  2YI8 A;  4DV3 O;  5L3G A;  3FB8 C;  1BQZ A;  2EIM C;  1S5L Z;  4UCR A;  5HFL A;  3FYE B;  1PNL A;  4PDM A;  1VQ6 V;  3A0H Z;  3RN4 A;  3LSU A;  4IGG A;  1US6 A;  4JV5 B;  1S3J A;  3AG2 C;  4PV1 B;  1M9N A;  4MS2 A;  3CCJ V;  4DR4 O;  4JYY A;  4UUJ C;  4X20 A;  4LFC O;  1SQB H;  1YSC A;  1PL4 A;  4UV8 A;  3F7Y C;  3ZRX A;  2ZIO A;  3ABM C;  2RJZ A;  4FZ0 A;  2HR3 A;  4LF7 B;  4GX5 A;  1SET A;  5JJE B;  2WLL B;  2NR5 A;  3B8M A;  3MHH C;  5C93 A;  1IBL B;  3I55 V;  4FM1 A;  4U7O A;  3KZI Z;  2CTQ A;  4LF8 O;  3AG1 C;  4DW0 A;  1AB3 A;  3S3X A;  2O57 A;  4X9Q A;  4PD4 F;  2OCH A;  2EIN B;  1FXH A;  1P7G A;  4IHJ B;  3QNE A;  4PDV A;  1IBM B;  4U3F H;  1XNQ O;  3UT5 B;  2EIL C;  3QO7 A;  2WAM A;  3N2G A;  1IBK O;  1FJG O;  3K5M A;  3VQX A;  1YTF B;  5FL7 G;  5IYZ B;  5JJN B;  1N32 O;  3OEH G;  4BWA A;  5KHI A;  4JI0 B;  2P6J A;  1KUQ A;  1MSD A;  3ZX6 A;  2CAZ C;  4LNU A;  3VQV A;  2IJI A;  2D3O W;  1XL6 A;  1R6N A;  2IU0 A;  5B1B C;  4J9Y B;  1P7B A;  1MOF A;  3JAS A;  4J80 A;  3W7T A;  2LGQ A;  1HNW O;  2GHY A;  1N36 B;  1AJQ A;  1GAX A;  1SQF A;  3S3W A;  3STL C;  4OX9 B;  4DRX B;  4ABM A;  4C7U A;  3JAT B;  1VQM V;  1YJ9 V;  2X6C A;  2DWE C;  4J7Z A;  3OEE G;  2BCC H;  2OTL V;  1OCZ B;  1M57 C;  1XHZ A;  4ZOL A;  3J7A U;  4FLT A;  1JR9 A;  1F51 A;  3A0B Z;  3Q4H A;  4DUY O;  1QLN A;  2XND G;  1JVM A;  2ZDI C;  1Q5O A;  1K8A W;  3ZN1 A;  3J80 N;  4PJ0 Z;  4MT8 A;  5CA0 A;  4AIL C;  1SQQ H;  3CHX A;  1JJ2 U;  2ODM A;  4WFE A;  1D5A A;  1YHQ V;  4NR1 A;  4NXN O;  4GKK O;  1QLE B;  4TUY B;  1J5E O;  4P9P A;  3ZMU A;  4JTA B;  1OCR B;  2Q73 A;  5JVD A;  1YI2 V;  5IY5 C;  2IBZ H;  2GTA A;  4F6R A;  1HNX B;  2BOB C;  3AK2 A;  4B3R O;  4UB6 Z;  4ASU G;  3K0D A;  1CPY A;  1YJN V;  4WCE V;  1I7F A;  1H8E G;  3UKM A;  4LF6 B;  5K1X A;  4EEQ A;  2EJR A;  2V4D A;  1VQ9 V;  1R6T A;  5B66 Z;  4QPK A;  3LDE A;  4BIU A;  3APQ A;  1R3J C;  3ETG A;  3TJT A;  4FPP A;  2ZR3 A;  4DR7 O;  5LMU O;  4X20 B;  2WA4 A;  2ZE7 A;  3CWB H;  4NXM B;  1SER A;  1DTO A;  1L1F A;  2GV9 A;  2QGN A;  3ML0 A;  4QE9 A;  4AQY B;  1ZX3 A;  2YC0 A;  3ABL C;  2Y69 C;  2V7Q G;  1MSW D;  5AG2 A;  3ZMT A;  3OFN G;  2Y0I A;  3KCX A;  1M1K W;  3MD0 A;  3B40 A;  1YJW V;  2VRZ A;  1P49 A;  1HR0 O;  4J9Z B;  4ZI7 A;  1PNK A;  5KLV H;  4EB6 A;  3AK3 A;  5LGN A;  4G27 B;  2BSK A;  2M7W A;  3N2G B;  3VQY A;  3CC7 V;  4JI5 B;  1JPX A;  1SA0 A;  1XRE A;  5FPO A;  2WWW A;  4P9O A;  1NZ6 A;  1XUQ A;  5JQG A;  2P06 A;  1XNR O;  1QNM A;  4PA7 A;  4I7Z B;  5E1A C;  1K73 W;  1FD9 A;  3G67 A;  2JEU A;  3K9S A;  3B09 A;  3F7V C;  2UU9 O;  4LNU B;  1LUV A;  2P22 C;  2YXL A;  1IX9 A;  1NQT A;  4QGP A;  2UXD B;  5FNV A;  3BRC A;  3JAS B;  4K0K B;  4LFA B;  2MK3 A;  2LFR A;  5FPR A;  5CBG A;  4P2Z A;  3OGI B;  3P32 A;  4YHH B;  4FLU A;  4UVC A;  5HFM A;  4CC5 A;  4RQE A;  1NVP D;  2HJD A;  3E8G A;  1JMK C;  2IU3 A;  1NTM H;  3IJ4 A;  4CZZ A;  2DMX A;  3A0R A;  3M8A A;  4ZOL B;  4JI1 B;  1B6Q A;  3Q4H B;  4QE7 A;  3OMA B;  1AJN A;  1Q3E A;  4LF9 O;  2P67 A;  5L3E A;  4LCU C;  2YS8 A;  1K92 A;  2RN9 A;  1W2B U;  2ZXW C;  4B08 A;  1VQK V;  5CA0 B;  2A06 H;  3EFF K;  1B3Q A;  2XUM A;  2QJ1 A;  1IDS A;  3K5L A;  5LGT A;  2ARH A;  1Q7Y W;  5LOV A;  4DV0 B;  2KKW A;  2JRI A;  3OTO B;  4N21 A;  4FLY A;  1L8D A;  2ZE6 A;  5H6Q A;  1H2S B;  2F95 B;  1YVW A;  4MTO A;  2RNB A;  2ZD9 A;  1WLE A;  2DYS B;  5EZY A;  1KMI Z;  5JVD B;  2Z5U A;  4MW3 A;  4DV7 O;  4FMT A;  3C3S A;  4F6R B;  4H44 B;  4JTD B;  2ZT9 B;  4L87 A;  2ZE5 A;  2K9P A;  4LF5 O;  2ZIN A;  4DR6 O;  2PGG A;  4JI4 O;  1S76 D;  3W7S A;  4JYA B;  3AG3 C;  1P4R A;  1GM9 A;  2Q0A A;  3CX5 F;  2ZDI A;  3NR7 A;  4DV4 O;  5DED A;  2XAF A;  2PI5 A;  3T1Y O;  5J2T A;  3CRC A;  2XAG A;  2X6A A;  4DV2 B;  1XDC A;  2X0L A;  4KP4 A;  3RBZ A;  3ABT A;  4PA3 A;  1SZX A;  5H6R A;  3B4S A;  4ZI7 B;  3HPL C;  1JCH A;  4RQF A;  4EB6 B;  1O9H A;  2EIM B;  1AR4 A;  1M4U A;  1XMO O;  2BSK B;  4JI7 O;  3OTF A;  5L3B A;  1R73 A;  4FJC C;  2EJ7 A;  4DV3 B;  1SA0 B;  1EBO A;  1FXV A;  5JQG B;  2YIB A;  1AVM A;  5IYC O;  4GKJ O;  1DF4 A;  1IUR A;  2RCV A;  1G4Y B;  4J42 A;  3LUT B;  3BPZ A;  3ZRS A;  2QKS A;  5FNV B;  2D2C B;  2WLK A;  3DSQ A;  4DR4 B;  3ABM B;  3LDC A;  2YID A;  4LF4 O;  3OR6 C;  4LFC B;  4DK1 A;  3JAW A;  5LP6 C;  4DR1 O;  1H2K A;  4JAS A;  1QQC A;  1VF6 C;  5B1O A;  2NNU A;  3JSL A;  2PI4 A;  4DV5 O;  4FM0 A;  2DWD C;  3H1J H;  4UB8 Z;  1ZWI C;  4Q20 A;  1WB7 A;  1FXK C;  4KL1 A;  2UUA B;  3E8F A;  1KBH A;  2VWJ A;  3RVY A;  5BR8 O;  4IYH A;  1R3I C;  1XNQ B;  4MVU A;  1U97 A;  1IBK B;  1FJG B;  5LHI A;  3L75 H;  1XMQ O;  4CC6 A;  3TET A;  1N32 B;  1JJO A;  3H01 A;  1Z5W A;  5LOV B;  3CPW U;  5JH7 A;  4O2B A;  2HHH O;  3RYF A;  4P30 A;  1VQO V;  2C2A A;  2X7R B;  1NU1 H;  3M7M X;  5CBH A;  4A5U B;  1IXM A;  3JD0 A;  5EK0 A;  5EZY B;  2K1E A;  4JGS A;  1BQ0 A;  1W0J G;  3CRM A;  3N27 A;  5B3S C;  1FKA O;  2JGU A;  2HFE C;  3RWR D;  1HNW B;  1G1X B;  1H2M A;  2YXH A;  1GO3 F;  4YJ3 A;  4XDK A;  5DEC A;  1M57 B;  4FIP C;  1OCO B;  2DJV A;  1R6K A;  1TAE A;  1VF5 B;  3UQ8 A;  2UUB O;  3GWO A;  3CME V;  2PF4 E;  3RT3 C;  3SPH A;  1WP8 A;  5J2T B;  1M5I A;  1B06 A;  1OHH G;  4LC1 A;  4FVM A;  4CH5 A;  4YIO A;  4OXS A;  2CUG A;  1VQP V;  3CE2 A;  1KU9 A;  4NXN B;  3ZHS A;  4GKK B;  1DGS A;  4N23 A;  1J5E B;  5IY5 B;  4DYL A;  2F66 C;  4DR5 O;  2QTS A;  4D6T H;  4TQD A;  2WLH A;  4F6E A;  2B9Z A;  5H2F Z;  2JJ1 G;  3SYO A;  2HLD G;  1RP3 B;  1YF2 A;  4KUM A;  3ZHV A;  1SES A;  3W7U A;  1H8H G;  4B3R B;  2VQF B;  1GTO A;  3QO5 A;  3RYH A;  4XDL A;  4CS3 A;  2Q9L A;  4FFB A;  4F4L A;  3OUS A;  4X62 O;  3CCQ V;  2VS0 A;  1TGO A;  4UCV A;  1I94 O;  3X2Q C;  4DR7 B;  2A7W A;  5KHG A;  1V54 C;  2W6J G;  5LMU B;  3E8B A;  5D5Q A;  2F43 G;  3JAW B;  1OV9 A;  2AXT Z;  2QWO B;  3FD9 A;  1AJP A;  1MA1 A;  1XIL A;  2E5L B;  3HR0 A;  1FS0 G;  1NH2 B;  3D8C A;  2HJF C;  1U96 A;  1WP7 A;  1OJH A;  1YDX A;  3H1I H;  4J7J A;  1GRJ A;  4BIZ A;  1R3L C;  1HR0 B;  3C3T A;  4QIW F;  5KHK A;  2LFS A;  1DLB A;  2OYQ A;  2FYU H;  2QDO A;  2Q5Z A;  2IJJ A;  2YXY A;  3VQW A;  1HNZ O;  2A79 B;  4LFB O;  1XNR B;  3ASO C;  2VQE B;  5JH7 B;  2QEX V;  2KB1 A;  4O2B B;  2L35 A;  2QKC A;  3QF7 A;  3RYF B;  4ZKI A;  4GT1 A;  2UU9 B;  1E79 G;  3O9O A;  4NVP A;  3L70 H;  4PDL A;  1XOU A;  3CXC U;  3WU2 Z;  1M90 W;  3K06 A;  4O4J A;  2P7T C;  3SJB C;  3O65 A;  1VF6 A;  3P30 A;  2EZP A;  2NN4 A;  1Y4M A;  2LP7 A;  4YJ3 B;  3WB1 A;  5BY1 A;  2PUS A;  1FXK A;  4WF9 V;  3QO8 A;  2G38 A;  5CBF A;  1NJI W;  2IM9 A;  2L6L A;  4Z1M G;  1I08 A;  2XOK G;  5IDJ A;  2XAJ A;  1Z2G A;  5E79 Z;  3GB7 C;  4CS2 A;  4DV6 O;  3VBB A;  2ZXW B;  5B1N A;  4FZ1 A;  1AR5 A;  4LF9 B;  2UXC O;  1GMG A;  5KAI Z;  2CTP A;  3K08 A;  4UCO A;  2ZM6 O;  1RPO A;  1MZE A;  5LXT A;  5EIB D;  1FPO A;  3SJA C;  1M56 C;  4J7K A;  1WPX A;  1S77 D;  4CBC A;  3E86 A;  1P84 F;  3CCS V;  3FFQ A;  2QE7 G;  5L3D A;  4DK0 A;  2RQ6 A;  1RPR A;  4DV7 B;  3E35 A;  2HP8 A;  2DYR B;  4X88 A;  4HBN A;  1FFT B;  3RYH B;  2MW2 B;  1L0L H;  3WG7 C;  4MW8 A;  3H1L H;  3W7X A;  4FFB B;  4JI4 B;  4I55 A;  2B1G A;  4JAA A;  1BCC H;  1XBL A;  3CXH F;  3K9A A;  3OGC C;  2WLI A;  2CDY A;  3ZED A;  4DV4 B;  3JSN A;  1K5Q A;  2EX3 A;  1PKX A;  4R50 A;  2XAQ A;  1KEC A;  2OCC B;  3IC7 A;  4WBN A;  5EBL C;  4MVR A;  1J95 A;  4EFE A;  1SQG A;  3SYP A;  4WFB V;  3ZHR A;  3D36 A;  5KMG A;  3CRR A;  5K1P A;  1YIJ V;  1N33 O;  5LMN O;  4I9Q A;  5DM6 V;  3WB0 A;  4YXW G;  2EIJ B;  2ETN A;  5BMV A;  1KQS U;  4K8X A;  1WJZ A;  2BTQ A;  2KG7 A;  4JV5 O;  2Y4T A;  3MAQ A;  1XMO B;  4JI7 B;  2Q6A A;  4H0L B;  2QSA A;  2KQX A;  2QA4 V;  3K57 A;  1BGY H;  1N4C A;  3OT7 A;  3CB2 A;  1D5N A;  4MVZ A;  5IYB O;  4I50 A;  1TUB A;  1VQ4 V;  4GKJ B;  1FYJ A;  4R7C A;  4GX0 A;  4XBF A;  3JAK A;  5L3F A;  2R9A A;  3ZMV A;  2AGA A;  1AP6 A;  1NR7 A;  4JI3 B;  3AG4 C;  4CH3 A;  4PA4 A;  3JCZ A;  1O9G A;  3JAL A;  1ZAU A;  4LF4 B;  1YEW A;  4O4J B;  3ZRV A;  4NYK A;  5J2U A;  4DUZ B;  1NH2 D;  2JK5 C;  3P3P A;  2EIK C;  4DR1 B;  4J41 A;  5CA1 A;  3RGB A;  1FXK B;  4X65 B;  3SYQ A;  4FK5 C;  1GKF A;  3B77 A;  3HB3 B;  4PA9 A;  1B04 A;  3G71 V;  4I9W A;  1QR9 A;  2N05 A;  3CCE V;  5BR8 B;  5J9P C;  2CTR A;  3CRA A;  1N0N A;  1AI7 A;  1E1Q G;  5A9G A;  3BY6 A;  4KFM A;  1YXB A;  1RM1 B;  4I0X A;  1ZUQ A;  2EZO A;  2M6Y A;  5LXT B;  3T1C A;  2LW7 A;  4TSF G;  1MAB G;  4JI6 B;  4FLZ A;  1YTF D;  1K5S A;  2HHH B;  2YI9 A;  4OX9 O;  4TOI A;  2ZR2 A;  4UCT A;  4JI2 O;  4JYB A;  3VOU A;  3F5T A;  2DE0 X;  1GN3 A;  3TCU A;  4DV1 B;  1V55 B;  2Z0A A;  4XDJ A;  2ZQM A;  4FLV A;  1VEW A; 
#chains in the Genus database with same CATH homology
 5KLV H;  3CX5 F;  3H1L H;  1SQB H;  3CWB H;  4PD4 F;  3L75 H;  3H1H H;  1NTZ H;  1SQQ H;  2A06 H;  1BGY H;  1SQX H;  2IBZ H;  4U3F H;  1PP9 H;  3H1K H;  1BCC H;  1NTK H;  1NTM H;  1PPJ H;  2BCC H;  1L0N H;  3L73 H;  3CXH F;  4D6T H;  3H1J H;  3L72 H;  1KYO F;  3H1I H;  3L71 H;  1KB9 F;  1BE3 H;  1SQP H;  1P84 F;  1SQV H;  1NU1 H;  3TGU H;  3L74 H;  1EZV H;  3L70 H;  2FYU H;  3BCC H;  1L0L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...