3L70H

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l70H00
1BCCH 1P84F 3CX5F 3H1JH 2BCCH 2A06H 3L72H 1PPJH 1NTZH 3H1IH 1SQPH 3CWBH 1BGYH 1KYOF 1BE3H 3L71H 3L74H 3L75H 1NTKH 1SQQH 5KLVH 1NU1H 4D6TH 3H1KH 3TGUH 3CXHF 3L73H 1SQVH 2IBZH 3L70H 1SQBH 1EZVH 1PP9H 1KB9F 1L0LH 3H1HH 2FYUH 4U3FH 1L0NH 1NTMH 3H1LH 4PD4F 3BCCH 1SQXH
chains in the Genus database with same CATH superfamily
4JYCA 1WLEA 2OIEA 3F7VC 2DMXA 4BIZA 3UKMA 3Q4HA 4D7TA 4PA7A 2WPDG 4GUNA 3JATB 5KA6A 1K9MW 3A0HZ 2WLHA 4EB6B 5L3GA 4CH5A 1XREA 4O2BB 1V54C 4PA6A 4U3FH 3OAAG 2HR3A 2YIBA 1FYJA 2VS0A 1VQ5V 2A0LA 1NS1A 5DECA 5LP6B 2YXHA 5BZBA 4X88A 2DJVA 1D5NA 2A3QA 1IXMA 1NR1A 2O57A 3K79A 5CA3A 4PA3A 4TUYB 5LP6A 3ASOC 2HHHO 2JRIA 4CC6A 5J9PC 4J9YB 5JJJB 3BPZA 3STZC 1F4MA 1JFFB 4DUZO 1VMGA 1KQSU 3K3WA 2CH7A 4TUYA 1FJGO 1W0KG 1KC8W 4FFBB 2PY5A 4DK1A 3QO7A 4MVQA 2YIDA 4J80A 1NI8A 1H2NA 4QGPA 1JFFA 2BSKA 2ZD9A 1FS0G 3I56V 3LSUA 5EK0A 1S3JA 5AG2A 3UQ8A 1VARA 1JOYA 4FFBA 3GWOA 3E35A 4H0LB 1PL4A 4G2KA 3RT3C 1HNWO 5KHHA 1SQBH 2WLKA 5LBQA 3HB3B 4NTYA 2RQ6A 4ZI7A 1OHHG 3K03A 3LDDA 2OCHA 5L3DA 4RWUA 3OGIB 3TXQA 3DC5A 3DC6A 4JTAB 1QCEA 1V9PA 2GUZB 3G80A 2IJJA 4NB5A 3QF7A 2AZ0A 1QNMA 1BT8A 1O9GA 3H9VA 1XHXA 3OTOB 4FVMA 4U3JB 4RAIA 1OCRB 1Y6XA 2VQFO 1YHQV 1NJIW 2GUZA 2YUAA 4QPKA 1HNZB 5B1OA 1D2DA 4I4TB 3HKEB 1DF4A 4OX9B 2PUSA 3K5OA 1N33O 2IJKA 1R6NA 4LF8B 1AILA 4JPRA 4U3JA 2IJHA 4KUMA 1NU1H 1VQMV 2YDEA 3H1KH 2P7TC 3ZN1A 2CTRA 4DR6B 2Q5ZA 4X66O 5CBFA 3G6EV 2QKCA 1ZLZA 3E83A 3HKEA 4I4TA 4ZHQA 3JD3A 5EC1C 4LF5O 2UUCO 5JH7B 2DE0X 1XMOO 3FB7C 2X6AA 2WLLB 4O4LB 2D3OW 3MDSA 4DW0A 2R9RB 4DR1O 1OCRC 3IC9A 5LMUB 2AW9A 1YITV 3A2FA 5JH7A 4IL6Z 4O4LA 2BOCC 3QNEA 5LMNB 5IYDO 5CA0B 4MT8A 2PI5A 4AQYO 1CPYA 1SQGA 1Q43A 4KHPB 1JCHA 5BMVB 3RYIA 1YJNV 4WFGA 2QWPB 1GK9A 3SPIA 5CA0A 1DF5A 5B3SB 5FNVB 3CCRV 1QVGU 4JI7B 3MD0A 1IZ3A 2Q0OC 2YICA 1SZXA 4LFBO 3OMIB 2UXNA 5B66Z 4O4JB 5BMVA 1GN2A 2EJRA 1ZTEA 1XDCA 4GX2A 2HJDA 1HDJA 5IWAB 2P4VA 1MABG 2W6JG 5FNVA 5JVDB 5CA1B 1S76D 1SESA 3E8BA 3T4ZA 4R6ZA 4B3TB 1AR4A 4O4JA 3QO5A 1FAFA 3GWKC 2Q68A 4YIOA 2UXBB 4QIWF 2QTSA 3IC7A 2CUGA 5JVDA 5CA1A 4LP8A 3SPCA 1PM9A 2GDSA 4YIPA 3VOUA 4D7SA 2UUAB 1NH2B 2Y4UA 2ZE5A 3F7YC 2B1IA 5B3SC 1KP2A 1SERA 2RCVA 3RW0A 4O4IB 1AR5A 2ITCC 3BEHA 1H8EG 1GM9A 4I7ZB 2LJ2A 4NTXA 4JI4B 1WA8B 5K1XA 1FKAO 1OZ0A 1QU7A 1BQ0A 1RFYA 4O4IA 3JCUZ 1E79G 4K0KB 4DO2A 4YY3O 4R50A 4AI8A 3E8HA 3RWRD 4CH6A 1ORQC 4DV2B 3FKSG 3BA8A 3OR7C 4JI1B 4P30A 5FLXN 1TUBB 1WA8A 3UO3A 5DEDA 3K0GA 4ZIBA 2OT5A 1YDXA 3OM3B 1COWG 1FFXB 1XEQA 1N32B 3ZX6A 2NN4A 3ZHSA 2HEPA 1W0JG 2HVKC 5HFMA 2JS5A 4GYCB 1TUBA 2ZIOA 4IT5A 4MVMA 5KAFZ 4K35A 3MHHC 4P9PA 3OTOO 3CS5A 3E8GA 2RN9A 2UUBO 4UCTA 1FFXA 2ADQB 3RN4A 2RNBA 1HNZO 2XAHA 1S0VA 2HLDG 4OX9O 1S77D 1BCCH 4LNUA 2VWKA 5IYBO 1S5HC 5A2QN 5JQGB 2F95B 4J9ZB 1GM7A 4IHJB 4DR6O 3KZIZ 2VQEB 4JYAO 3PN1A 3CB2A 3LSQA 3ZMZA 1PV0A 3LUTB 4GKKO 3KKYA 2YSUB 4CS4A 1BMFG 1M93A 3F5WC 2XOKG 2A79B 3ZHRA 5JQGA 3T1CA 2YI9A 3KCXA 4Z2WA 4FK5C 3CX5F 1WPBA 2GV9A 3G71V 3B4SA 2CE4A 3EXAA 1N36O 1BGYH 4BR6A 5LMUO 2P06A 2RJZA 5H6QA 2CGNA 5H9CA 3X2QB 2EINB 5LMNO 1N4CA 1YZBA 3W7SA 3M8AA 2EZOA 4Q20A 2AXTZ 1O9HA 3I55V 3I5DA 4KHPO 2W0XA 3A8TA 4U7NA 2ZE8A 4UVBA 1WN7A 1SQQH 1IX9A 4NVPA 2BOBC 5GONB 4X20A 2CTWA 3CCUV 3ABLB 2QM8A 1L0NH 4FLVA 4UCSA 1NZ6A 1SC5B 3S3WA 2F66C 4FMTA 4MTGA 3CMEV 1ROPA 2WLIB 5GONA 3JCZA 4KL1A 3CYOA 4DR2B 3AG3B 1YIJV 2IU3A 2XUMA 3SYAA 3HKBB 4B3TO 3CCMV 3RFRA 1IBLB 4FFKA 2WLIA 3APQA 2EBOA 2CTQA 4DV1B 2UXBO 1YXBA 4CH3A 1GN6A 1S72V 5KMGA 5E1AC 1JJ2U 2KB1A 2A7WA 2F4VB 2W6IG 4IIJA 3HKBA 2UUAO 3ABLC 2QA4V 4LF9B 3BFRA 2KKWA 2XAQA 2AHYA 1Q86W 4H44B 3ASNB 1NTZH 2HJFC 3JALB 3E89A 1JA8A 1DGSA 4JI4O 3AG3C 4FM1A 4HNAB 3VQWA 1SS3A 4MVRA 4DR5B 4JAAA 1U96A 4K0KO 3OE7G 1BHBA 4DUYB 3SYQA 4DV2O 4E2LA 1M1KW 4X1IB 1YTFB 4JI1O 5A9GA 3JALA 1RPRA 3U0ZA 4LFAB 1KMIZ 4HNAA 1MOFA 2Y0IA 3CC4V 4H33A 1CP9A 5C93A 2OTLV 4PJ0Z 1ZWIC 2PGGA 2ZNIA 3ZS8C 4X1IA 3BA9A 4B08A 3S3XA 4BW5A 1R73A 3ASNC 3AG1B 1NTMH 5LL6Y 1PL0A 1OCOC 1R3JC 1VQ7V 2B5UA 5KAIZ 1IURA 3CWBH 1QQCA 4X64B 4JI3B 1YEWA 1Q90D 3FAVB 1SA0B 1S5LZ 1RM1B 5EIBD 1H2LA 1OCZB 3EHBB 2DYSB 1N34B 1BSMA 3C3SA 3RYHA 4NXNB 4JI0O 3FAVA 1SA0A 2CGOA 1P7GA 3ZCCA 5L3CA 1UJWB 1JX9A 3SJAC 2NR5A 1F7YA 2QWQB 3ZHUA 3AG1C 1VQLV 2BE3A 1VQ8V 4N21A 2Z3YA 4JI2B 3QVNA 1SQXH 2FKXA 4LF6B 1KP3A 2QSAA 2Q6AA 4R7CA 5FPOA 3CPWU 3G6BA 3K9AA 5IYCO 4UCVA 1TUEB 5DN6G 1RM1C 3M99B 3CD6V 3CCQV 1GN3A 1OCZC 2DYSC 1MSWD 1Y66A 2ADPA 2CH7B 2F23A 1VQKV 1RSOA 4JI8B 3H01A 4BIOA 2ZR2A 2E74B 1EFRG 3J81N 1KBHA 3L9DA 4LH7A 1K5SA 5IY5B 2BSKB 2P5OA 1K97A 3VQYA 4NR1A 3L75H 2Y4TA 3FYEB 3K0DA 2Q0AA 1H2GA 4PI0A 1IBKO 2B1GA 2E76B 4FLTA 3CXCU 5LP6C 2JEUA 5KUKA 3B40A 1FXHA 1XMQB 1QBZA 4ZI7B 3FB5C 2ZDIA 2UU9B 3LNMB 4WF9V 3IAYA 1XNQB 3W7XA 3B8MA 2QDOA 4DR2O 1VF7A 1SF9A 1WB8A 5DM6V 3CXHF 1XBLA 1VF5B 5F2VO 2K1EA 1IBLO 2UXDB 1YSCA 3W7UA 1JPXA 4JV5B 3BHPA 1SRYA 5IY5C 4JYYA 3A0BZ 2ZDIC 2F4VO 2V1DA 4FJCC 2BTOA 2JVDA 2G38A 1Q6UA 4YXWG 2YIAA 1PNLA 5LA6B 1QHTA 4LF9O 4X1YB 1R3KC 2IH3C 1Z2GA 1SQFA 2EIKB 2GSMB 3CHXA 3UT5B 4JI6B 3WU2Z 1HNXB 4LR3A 4YHHB 3B09A 3LDEA 2JS3A 3O65A 5LA6A 4ZHQB 3HR0A 3JD4A 1URFA 4UUJC 1B6QA 4X1YA 2DQ0A 2WSSG 4HBNA 4FZ0A 4FM0A 3K57A 2M6YA 3UT5A 3BVOA 4DUYO 2HVJC 1VEWA 1Y74B 3WB1A 4MTXA 3ABTA 2QWRB 5B1NA 4FLUA 1VQ4V 4LFAO 3IFXA 1HR0B 4DR7B 1GRJA 3JYCA 4UV9A 3RBZA 2QWNB 1KKCA 3SJBC 1G4YB 5D5QA 3K06A 4GLXA 2D2CB 3JD0A 2EIMB 5L3EA 1AI7A 4LF7O 1GAXA 5FPRA 2F93B 4GZRB 1Y74A 4PHZA 4B7EA 2EIKC 2OIGA 2LGQA 3ICXA 1FXKB 2EILB 3RYIB 1DK1A 1KUQA 2WLNA 3HKDB 4LFCB 2YIBD 3N2KB 1EN4A 4DV4O 2FB5A 3ZN0A 2L6LA 3WFVA 1D5AA 2PF4E 4LH6A 1F23A 1FXKA 4UXNA 4Z1VA 4I0XA 3EFFK 1TAEA 2GTAA 3HKDA 1F4NA 3C3TA 4RQFA 2E3CA 3N2KA 2EIMC 2ZQMA 1X59A 3B8NA 1AJNA 1GN4A 4L8JA 2AZ2A 3KCYA 4B3SB 4RQEA 2RDCA 2Q73A 1I94B 5L3FA 4J7JA 2EILC 3TJTA 2EULA 4DV6B 4TV8A 1QVFU 4KFMA 2X6CA 3BABA 4WFBV 2PYLA 4YJ2B 1MA1A 3UCSC 2Z5UA 3OMAB 4JI8O 1AI6A 4IYIA 1K73W 2OCCB 1P84F 4RO2A 4YJ2A 1WP7A 2WAMA 2ZINA 1H38A 3JD2A 3JAWB 1MG1A 3H1IH 2QM4A 2QGNA 1Y4MA 1KYOF 4QE9A 1X4TA 3K9SA 1A32A 1Q81W 3QTCA 4H37A 4P9OA 5KHGA 4JZ2A 3SPJA 3T1YB 1PD3A 2HKOA 2UU9O 3JAWA 1XNQO 4MVZA 4UCUA 3UM7A 3OEHG 2BCCH 3LDCA 5IE9A 4LF4B 3L71H 4JI5B 3WG7B 1VQOV 2ZM6B 3P32A 3FB6C 4JV5O 1MMMA 3CP1A 4K8XA 2OCCC 3M7MX 2ZE7A 4GX5A 4PV1B 3AK3A 4JTDB 3CE2A 5EBLC 3O9OA 4F6RB 3VQXA 1NBMG 1I5XA 4LNUB 4I55B 1Y76B 2P67A 4JAUA 3ETQA 4PELA 2VRZA 3P30A 2Q4PA 2PI4A 2YXLA 1OJHA 2GHYA 4QPJA 3J7AU 3ML0A 2GBOA 4F6RA 3K5MA 4I55A 1Y76A 2Y0PA 5J2UA 4LF8O 4Q6GA 5L3BA 4HYOA 3WG7C 4OPHA 3ETEA 4CBCA 4DV5B 3CRQA 5H2FZ 5IJ0B 2LFRA 2QM7A 2P22C 1BHAA 2ZIMA 3SYPA 4PD4F 1IBMB 4HAMA 4MS2A 1EN5A 4CH4A 5KHIA 1Y67A 4DR3B 3L72H 5EBMC 5IJ0A 2H8PC 2KQXA 1NR7A 1K4CC 5LXTB 2P90A 3CRCA 4TSFG 3AK1A 2AGAA 1B06A 5IT9N 5GTHZ 1M4UA 4O4HA 1RPOA 2QWOB 3WB0A 1L0LH 1K7DA 3SDLA 4PA9A 4LFCO 1K92A 4DV3B 3U10A 4X20B 4MVUA 4UVAA 1M90W 1R3LC 5LXTA 3K5NA 3F5TA 3U11A 4B3MB 4TQFA 2AHZA 4L87A 1BQZA 1VIBA 3ABUA 3K58A 2ZE6A 4JASA 5LGTA 3ZRXA 3ZEDA 1XL6A 3THOA 4FLXA 3BCCH 4JI7O 3AG2B 2H94A 1E1QG 2YEVB 2HHHB 4B3RB 1PNKA 4WFAV 4NXMB 2K9PA 1I94O 4DUZB 3X2QC 5HFLA 5IWAO 3T1HB 4DV6O 2L35A 3K08A 1LUWA 2GTSA 2XNDG 4DYLA 2EINC 3FB8C 1EM1A 5KMGB 3RVYA 2UXCB 1FJGB 1XHZA 4IIJB 2ZCEA 2XTAA 1W59A 2YEVA 1NH2D 3K59A 1HW7A 3BRCA 4B7KA 4J10A 5JJEB 4FIPC 1LR1A 1H2MA 4I9QA 2WWWA 4W4LA 1J5EB 2JGUA 4J42A 2YS8A 1B3QA 1G8MA 3AG2C 1ENVA 1M57B 3UO2A 4X62B 2W0FC 3E2EA 2LP7A 3D3QA 2LO1A 3CEIA 2WA3A 1PPJH 2DYRB 4NKGB 5JJNB 3L74H 4F6EA 4TWKA 3EVKA 2ETNA 1JR9A 4P2ZA 4NTWA 3K5LA 4QE7A 3G4SV 5CBHA 3HPLC 2QE7G 2BTQB 5IYZB 4OPAA 1QR9A 4GKJB 4BWAA 1FFTB 2ZM6O 2Q7EA 1N33B 4TV9A 1L1FA 5CN0A 1R1BA 4IGGA 2EZPA 4FLYA 1N32O 1S5JA 3CCEV 1I0HA 1XL4A 2BTQA 2Y69B 3L70H 2B9ZA 2Q69A 1EZVH 5IYZA 3R65A 1I7FA 2YXYA 3MHSC 4UB8Z 2QKAA 3ZMVA 4X66B 3OUFA 2N04A 2V7QG 2FMLA 4GX1A 4LCUC 2JJ2G 2LQTA 1AJQA 3RYHB 4LWSB 3JASB 1Z5VA 1JQ0A 1QLEB 4DR4B 2JIZG 1DLBA 5LHHA 4UCRA 4CS2A 5KHJA 4JYBA 1THZA 5TISZ 5B1AB 1E1RG 1QR8A 3JD1A 1GKFA 1JJOA 2XHBA 4LWSA 3JASA 5KX5B 4DV5O 2IJIA 1K5QA 1V55B 3B77A 2WA4A 2VQEO 2MW2B 5FL7G 4AQYB 2Y69C 3WB2A 2OYQA 1Q6HA 2F1MA 2FYUH 5J2TB 4UV8A 3NXSA 4N23A 4DR3O 5KX5A 1M9NA 2MK3A 1RSOB 2A06H 4X1KB 2ZR3A 3OMNB 4J7ZA 1VP7A 1QLEC 4LFBB 4EFEA 5J2TA 4F4LA 2IM9A 5B1AC 4DV3O 3MAQA 4X1KA 3E86A 4R8CA 1V55C 2Q7GA 3ZRWB 2LFSA 4A5UB 4B3MO 1I5YA 1SQPH 2XT9A 3JATA 3LSSA 4EB6A 2DWDC 4I50B 4O2BA 4J7KA 2V4DA 4CS3A 2IW5A 5GTIZ 5JCOA 4B3RO 1VF6A 3ZRWA 4NXMO 2FTKA 2XAJA 4MTOA 1KU9A 3CCVV 4ABMA 1Q6IA 2CTPA 3D3IA 4I50A 3T1HO 3VBBA 1YJWV 3AEIA 2UXCO 5IDJA 4LC1A 2XAGA 2KSDA 1AJPA 2YI8A 2JDIG 4AILC 1SETA 1R6KA 1AI5A 5JCOC 1VF6C 2Q67A 5JWPA 1AI4A 3G67A 2KG7B 4DRXB 4DV1O 2CK3G 1AVMA 4YY3B 1VQPV 1J5EO 1HP8A 2IH1C 2QEXV 1N0JA 4DV0B 2XAFA 5BY1A 5H6RA 3IGAC 3OR6C 2ZXWB 2CDYA 4X62O 1M56B 2YC0A 2KG7A 1PP9H 3H1HH 4DRXA 1Q5OA 2F43G 4H13B 1K8AW 1L8DA 1TVKB 3FFQA 1YTFD 3H1JH 3ZMSA 3HKCB 2R72A 3CC7V 2EX3A 3CSXA 4WFEA 4DR5O 4E4EA 2PTMA 3ZHTA 2QJ1A 4QJFB 2UUBB 4X8AA 1F51A 1TVKA 2P6JA 4Z1MG 2A9HA 5ITZB 4GKJO 4TT3G 3N2GB 2ITDC 3HKCA 3OEEG 4DV7B 3NR7A 2OWOA 1U97A 3RGBA 4K3AA 4TOIA 3P3NA 1BE3H 2HG5C 3QG5A 4EEQA 3OW2U 2ZXWC 1M56C 4MSWC 1P49A 4O2AB 5IJ9B 3ETDA 3STLC 5ITZA 2R70A 3GB7C 4JYAB 3N2GA 5D5PA 3JSNA 2ILMA 1MNGA 1US6A 3ETGA 4I0XB 4GKKB 3SJCC 1ZAUA 4UVCA 3BAAA 4X64O 1Q8IA 4JI3O 2ZNJA 1NQTA 1YCIA 4DR4O 4X65B 4O2AA 3AG7A 5IJ9A 3AG4B 1N36B 2NLJC 1K33A 1W2BU 3TETA 2DOSA 4D6TH 3JAMN 1BL8A 1N34O 4EKWA 4NXNO 1SKVA 1RP3B 2WLLA 1Q3EA 5LGNA 2Q7HA 4TV8B 4PDLA 1VQ9V 4LBEC 4G28B 3OT7A 3GVMA 3VQVA 1OCCB 2NNUA 1XNRB 4C7UA 1BS3A 1FXKC 4NYKA 5KA5A 3OD4A 3PJSK 4JI2O 2R9IA 4LF6O 4GT1A 1PKXA 2IU0A 3CMAV 1EZJA 4AHCA 2H3OA 1IVSA 3AG4C 4JGSA 5E79Z 2P4KA 5C8YB 3DTUB 2ATKC 5KUMA 3KG2A 3SPHA 1HWYA 4I9WA 1MZEA 2DQ3A 3CRMA 4IYHA 2IBZH 1LNQA 3AK2A 2X0LA 3IJ4A 1ZUQA 4WFFA 5LHGA 1XILA 5C8YA 4XBFA 2Z0AA 4DK0A 1OCCC 3SYCA 2ODMA 4ASUG 4W4KA 3ZRVA 1DTOA 5KLVH 4RUFA 1VQNV 2OTJV 3L73H 1J95A 1XQ8A 1LUVA 1GH6A 2QR4A 4XDKA 1JVMA 3H1LH 1XMQO 4JF3A 2Q8VA 1NVPB 2R9AA 3SGIA 4WFHA 1H2SB 3TXSA 5CBGA 2UXXA 1UFIA 1CEZA 2C2AA 5EYPB 5LGUA 3BY6A 5B1BB 4PDVA 1MSDA 3ZRSA 2UXDO 3P3PA 5KHKA 1WPXA 3CCSV 4QNHB 3CCJV 3JAKB 3C90A 4XDJA 1IDSA 3W7TA 5EYPA 4KP4A 4UFZA 3TK1A 4JTCB 4DV0O 4PI2A 4G27B 5EZYB 5J2UB 1XUQA 3SJQC 1NT2B 1ZX3A 2N74A 4JI6O 1HNXO 3JAKA 4BAYA 1JMKC 4HZ3A 4YHHO 3T2MA 2Y48A 5BR8B 3RYFB 4TQDA 5B1BC 2WLJA 1AROP 2E75B 3ABMB 5EZYA 1R3IC 3TCUA 1I08A 2LGWA 4YJ3B 4OXSA 1ZSPA 2E5LB 3OUSA 1KD1W 3D36A 3CRRA 1Z5WA 2ZT9B 1G6UA 2XASA 1HR0O 3RYFA 4DR7O 4DV7O 2VWJA 4FZ1A 4O4HB 4YJ3A 1FD9A 4MW8A 3ABKB 3W7WA 4JI0B 5GW7A 3K04A 3E22B 1KKDA 1NTKH 3QO8A 4K8ZA 4PDRA 3D36C 1AP6A 5LHIA 1NKDA 3RVZA 1SQVH 5K1PA 1XOUA 1CXZB 1R6TA 3ABMC 1YJ9V 1YI2V 1WP8A 3E22A 4X65O 4IHJA 4FM2A 4UB6Z 3DSQA 1GM8A 3ZMTA 2WLMA 4CZZA 4MVSA 1WJZA 4ZBMA 5BXZA 3TGUH 2PYJA 1GTOA 1OV9A 2QTOA 3SR2C 1ZL8B 1KB9F 1N0NA 1EN6A 3ABKC 3CRAA 4XDLA 5CB4B 2Q9LA 1XNRO 5EIBC 2ARHA 4B3SO 1KECA 2DWEC 3SYOA 4WBNB 3LNNA 1K3EA 3D8CA 1ZL8A 3FYIB 3DGEA 2HFEC 4X89A 5B5EZ 2LW7A 2PZSA 1IBKB 3DXRB 5CB4A 4CC5A 2N05A 4ZOLB 1G1XB 1Q7YW 1EBOA 4WBNA 3RYCB 1VQ6V 1XI1A 2M7WA 5EBWC 3ZIAG 1P4RA 1MZFA 3T4DA 4EFBA 2DN9A 3ZMUA 3B2EE 1YF2A 2DW4A 3DXRA 4DXWA 4ZOLA 4KXRA 1YVWA 4OGQB 4FLWA 1HNWB 3RYCA 4FLZA 1FXVA 3FD9A 1T5EA 1NVPD 4GX0A 5LOVB 3ZHVA 3OGCC 1GO3F 3R66A 4UCOA 4WCEV 1AB3A 3OFNG 5H5NA 1SZTA 2JEXA 3ZHQA 3A0RA 2JGDB 1P7BA 1QLNA 3T1YO 4TV9B 1WAZA 3JSLA 5LOVA 1BZKA 2X6BA 4MVOA 4LF4O 2VQFB 2EIJB 4ICGA 1OCOB 3N27A 1H8HG 2HP8A 4JI5O 1K34A 2JGDA 3ZJZA 5EC2C 4GCZA 4MW3A 2X7RB 3J80N 1M57C 1WB7A 1WNSA 4X9QA 1TA8A 3JARB 2QKSA 2FL4A 5CMUA 2DYRC 3E8FA 1H2KA 4LF5B 2UUCB 3CJHB 4PDMA 4J11A 4ZKIA 1M5IA 1PNMA 1XMOB 1TGOA 1FPOA 4BIUA 4RUEA 4LF7B 3APOA 2EJ7A 3FX7A 3ZBHA 3JARA 4PA4A 4JAVA 4DR1B 5LYJB 3CCLV 4J41A 4BW9A 5BR8O 2EIJC 3SPGA 4DW1A 2ZKOA 3CJHA 2JJ1G 1V54B 2CAZC 1AP5A 4JZGA 2E5LO 4FPPA 1UPGA 1N8RW 2LW1A 2JK5C 2RMKB 1GMGA 4U7OA 5LYJA 4DV4B 1AR1B 3OTFA 1IXBA 1K4DC 3CC2V 1Q82W 3Q4HB 1IBMO 4I5SA 1B04A 4MTFA 3ASOB
chains in the Genus database with same CATH topology
1BCCH 1P84F 3CX5F 3H1JH 2BCCH 2A06H 3L72H 1PPJH 1NTZH 3H1IH 1SQPH 3CWBH 1BGYH 1KYOF 1BE3H 3L71H 3L74H 3L75H 1NTKH 1SQQH 5KLVH 1NU1H 4D6TH 3H1KH 3TGUH 3CXHF 3L73H 1SQVH 2IBZH 3L70H 1SQBH 1EZVH 1PP9H 1KB9F 1L0LH 3H1HH 2FYUH 4U3FH 1L0NH 1NTMH 3H1LH 4PD4F 3BCCH 1SQXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC H;  1P84 F;  3CX5 F;  3H1J H;  2BCC H;  2A06 H;  3L72 H;  1PPJ H;  1NTZ H;  3H1I H;  1SQP H;  3CWB H;  1BGY H;  1KYO F;  1BE3 H;  3L71 H;  3L74 H;  3L75 H;  1NTK H;  1SQQ H;  5KLV H;  1NU1 H;  4D6T H;  3H1K H;  3TGU H;  3CXH F;  3L73 H;  1SQV H;  2IBZ H;  3L70 H;  1SQB H;  1EZV H;  1PP9 H;  1KB9 F;  1L0L H;  3H1H H;  2FYU H;  4U3F H;  1L0N H;  1NTM H;  3H1L H;  4PD4 F;  3BCC H;  1SQX H; 
#chains in the Genus database with same CATH topology
 4JYC A;  1WLE A;  2OIE A;  3F7V C;  2DMX A;  4BIZ A;  3UKM A;  3Q4H A;  4D7T A;  4PA7 A;  2WPD G;  4GUN A;  3JAT B;  5KA6 A;  1K9M W;  3A0H Z;  2WLH A;  4EB6 B;  5L3G A;  4CH5 A;  1XRE A;  4O2B B;  1V54 C;  4PA6 A;  4U3F H;  3OAA G;  2HR3 A;  2YIB A;  1FYJ A;  2VS0 A;  1VQ5 V;  2A0L A;  1NS1 A;  5DEC A;  5LP6 B;  2YXH A;  5BZB A;  4X88 A;  2DJV A;  1D5N A;  2A3Q A;  1IXM A;  1NR1 A;  2O57 A;  3K79 A;  5CA3 A;  4PA3 A;  4TUY B;  5LP6 A;  3ASO C;  2HHH O;  2JRI A;  4CC6 A;  5J9P C;  4J9Y B;  5JJJ B;  3BPZ A;  3STZ C;  1F4M A;  1JFF B;  4DUZ O;  1VMG A;  1KQS U;  3K3W A;  2CH7 A;  4TUY A;  1FJG O;  1W0K G;  1KC8 W;  4FFB B;  2PY5 A;  4DK1 A;  3QO7 A;  4MVQ A;  2YID A;  4J80 A;  1NI8 A;  1H2N A;  4QGP A;  1JFF A;  2BSK A;  2ZD9 A;  1FS0 G;  3I56 V;  3LSU A;  5EK0 A;  1S3J A;  5AG2 A;  3UQ8 A;  1VAR A;  1JOY A;  4FFB A;  3GWO A;  3E35 A;  4H0L B;  1PL4 A;  4G2K A;  3RT3 C;  1HNW O;  5KHH A;  1SQB H;  2WLK A;  5LBQ A;  3HB3 B;  4NTY A;  2RQ6 A;  4ZI7 A;  1OHH G;  3K03 A;  3LDD A;  2OCH A;  5L3D A;  4RWU A;  3OGI B;  3TXQ A;  3DC5 A;  3DC6 A;  4JTA B;  1QCE A;  1V9P A;  2GUZ B;  3G80 A;  2IJJ A;  4NB5 A;  3QF7 A;  2AZ0 A;  1QNM A;  1BT8 A;  1O9G A;  3H9V A;  1XHX A;  3OTO B;  4FVM A;  4U3J B;  4RAI A;  1OCR B;  1Y6X A;  2VQF O;  1YHQ V;  1NJI W;  2GUZ A;  2YUA A;  4QPK A;  1HNZ B;  5B1O A;  1D2D A;  4I4T B;  3HKE B;  1DF4 A;  4OX9 B;  2PUS A;  3K5O A;  1N33 O;  2IJK A;  1R6N A;  4LF8 B;  1AIL A;  4JPR A;  4U3J A;  2IJH A;  4KUM A;  1NU1 H;  1VQM V;  2YDE A;  3H1K H;  2P7T C;  3ZN1 A;  2CTR A;  4DR6 B;  2Q5Z A;  4X66 O;  5CBF A;  3G6E V;  2QKC A;  1ZLZ A;  3E83 A;  3HKE A;  4I4T A;  4ZHQ A;  3JD3 A;  5EC1 C;  4LF5 O;  2UUC O;  5JH7 B;  2DE0 X;  1XMO O;  3FB7 C;  2X6A A;  2WLL B;  4O4L B;  2D3O W;  3MDS A;  4DW0 A;  2R9R B;  4DR1 O;  1OCR C;  3IC9 A;  5LMU B;  2AW9 A;  1YIT V;  3A2F A;  5JH7 A;  4IL6 Z;  4O4L A;  2BOC C;  3QNE A;  5LMN B;  5IYD O;  5CA0 B;  4MT8 A;  2PI5 A;  4AQY O;  1CPY A;  1SQG A;  1Q43 A;  4KHP B;  1JCH A;  5BMV B;  3RYI A;  1YJN V;  4WFG A;  2QWP B;  1GK9 A;  3SPI A;  5CA0 A;  1DF5 A;  5B3S B;  5FNV B;  3CCR V;  1QVG U;  4JI7 B;  3MD0 A;  1IZ3 A;  2Q0O C;  2YIC A;  1SZX A;  4LFB O;  3OMI B;  2UXN A;  5B66 Z;  4O4J B;  5BMV A;  1GN2 A;  2EJR A;  1ZTE A;  1XDC A;  4GX2 A;  2HJD A;  1HDJ A;  5IWA B;  2P4V A;  1MAB G;  2W6J G;  5FNV A;  5JVD B;  5CA1 B;  1S76 D;  1SES A;  3E8B A;  3T4Z A;  4R6Z A;  4B3T B;  1AR4 A;  4O4J A;  3QO5 A;  1FAF A;  3GWK C;  2Q68 A;  4YIO A;  2UXB B;  4QIW F;  2QTS A;  3IC7 A;  2CUG A;  5JVD A;  5CA1 A;  4LP8 A;  3SPC A;  1PM9 A;  2GDS A;  4YIP A;  3VOU A;  4D7S A;  2UUA B;  1NH2 B;  2Y4U A;  2ZE5 A;  3F7Y C;  2B1I A;  5B3S C;  1KP2 A;  1SER A;  2RCV A;  3RW0 A;  4O4I B;  1AR5 A;  2ITC C;  3BEH A;  1H8E G;  1GM9 A;  4I7Z B;  2LJ2 A;  4NTX A;  4JI4 B;  1WA8 B;  5K1X A;  1FKA O;  1OZ0 A;  1QU7 A;  1BQ0 A;  1RFY A;  4O4I A;  3JCU Z;  1E79 G;  4K0K B;  4DO2 A;  4YY3 O;  4R50 A;  4AI8 A;  3E8H A;  3RWR D;  4CH6 A;  1ORQ C;  4DV2 B;  3FKS G;  3BA8 A;  3OR7 C;  4JI1 B;  4P30 A;  5FLX N;  1TUB B;  1WA8 A;  3UO3 A;  5DED A;  3K0G A;  4ZIB A;  2OT5 A;  1YDX A;  3OM3 B;  1COW G;  1FFX B;  1XEQ A;  1N32 B;  3ZX6 A;  2NN4 A;  3ZHS A;  2HEP A;  1W0J G;  2HVK C;  5HFM A;  2JS5 A;  4GYC B;  1TUB A;  2ZIO A;  4IT5 A;  4MVM A;  5KAF Z;  4K35 A;  3MHH C;  4P9P A;  3OTO O;  3CS5 A;  3E8G A;  2RN9 A;  2UUB O;  4UCT A;  1FFX A;  2ADQ B;  3RN4 A;  2RNB A;  1HNZ O;  2XAH A;  1S0V A;  2HLD G;  4OX9 O;  1S77 D;  1BCC H;  4LNU A;  2VWK A;  5IYB O;  1S5H C;  5A2Q N;  5JQG B;  2F95 B;  4J9Z B;  1GM7 A;  4IHJ B;  4DR6 O;  3KZI Z;  2VQE B;  4JYA O;  3PN1 A;  3CB2 A;  3LSQ A;  3ZMZ A;  1PV0 A;  3LUT B;  4GKK O;  3KKY A;  2YSU B;  4CS4 A;  1BMF G;  1M93 A;  3F5W C;  2XOK G;  2A79 B;  3ZHR A;  5JQG A;  3T1C A;  2YI9 A;  3KCX A;  4Z2W A;  4FK5 C;  3CX5 F;  1WPB A;  2GV9 A;  3G71 V;  3B4S A;  2CE4 A;  3EXA A;  1N36 O;  1BGY H;  4BR6 A;  5LMU O;  2P06 A;  2RJZ A;  5H6Q A;  2CGN A;  5H9C A;  3X2Q B;  2EIN B;  5LMN O;  1N4C A;  1YZB A;  3W7S A;  3M8A A;  2EZO A;  4Q20 A;  2AXT Z;  1O9H A;  3I55 V;  3I5D A;  4KHP O;  2W0X A;  3A8T A;  4U7N A;  2ZE8 A;  4UVB A;  1WN7 A;  1SQQ H;  1IX9 A;  4NVP A;  2BOB C;  5GON B;  4X20 A;  2CTW A;  3CCU V;  3ABL B;  2QM8 A;  1L0N H;  4FLV A;  4UCS A;  1NZ6 A;  1SC5 B;  3S3W A;  2F66 C;  4FMT A;  4MTG A;  3CME V;  1ROP A;  2WLI B;  5GON A;  3JCZ A;  4KL1 A;  3CYO A;  4DR2 B;  3AG3 B;  1YIJ V;  2IU3 A;  2XUM A;  3SYA A;  3HKB B;  4B3T O;  3CCM V;  3RFR A;  1IBL B;  4FFK A;  2WLI A;  3APQ A;  2EBO A;  2CTQ A;  4DV1 B;  2UXB O;  1YXB A;  4CH3 A;  1GN6 A;  1S72 V;  5KMG A;  5E1A C;  1JJ2 U;  2KB1 A;  2A7W A;  2F4V B;  2W6I G;  4IIJ A;  3HKB A;  2UUA O;  3ABL C;  2QA4 V;  4LF9 B;  3BFR A;  2KKW A;  2XAQ A;  2AHY A;  1Q86 W;  4H44 B;  3ASN B;  1NTZ H;  2HJF C;  3JAL B;  3E89 A;  1JA8 A;  1DGS A;  4JI4 O;  3AG3 C;  4FM1 A;  4HNA B;  3VQW A;  1SS3 A;  4MVR A;  4DR5 B;  4JAA A;  1U96 A;  4K0K O;  3OE7 G;  1BHB A;  4DUY B;  3SYQ A;  4DV2 O;  4E2L A;  1M1K W;  4X1I B;  1YTF B;  4JI1 O;  5A9G A;  3JAL A;  1RPR A;  3U0Z A;  4LFA B;  1KMI Z;  4HNA A;  1MOF A;  2Y0I A;  3CC4 V;  4H33 A;  1CP9 A;  5C93 A;  2OTL V;  4PJ0 Z;  1ZWI C;  2PGG A;  2ZNI A;  3ZS8 C;  4X1I A;  3BA9 A;  4B08 A;  3S3X A;  4BW5 A;  1R73 A;  3ASN C;  3AG1 B;  1NTM H;  5LL6 Y;  1PL0 A;  1OCO C;  1R3J C;  1VQ7 V;  2B5U A;  5KAI Z;  1IUR A;  3CWB H;  1QQC A;  4X64 B;  4JI3 B;  1YEW A;  1Q90 D;  3FAV B;  1SA0 B;  1S5L Z;  1RM1 B;  5EIB D;  1H2L A;  1OCZ B;  3EHB B;  2DYS B;  1N34 B;  1BSM A;  3C3S A;  3RYH A;  4NXN B;  4JI0 O;  3FAV A;  1SA0 A;  2CGO A;  1P7G A;  3ZCC A;  5L3C A;  1UJW B;  1JX9 A;  3SJA C;  2NR5 A;  1F7Y A;  2QWQ B;  3ZHU A;  3AG1 C;  1VQL V;  2BE3 A;  1VQ8 V;  4N21 A;  2Z3Y A;  4JI2 B;  3QVN A;  1SQX H;  2FKX A;  4LF6 B;  1KP3 A;  2QSA A;  2Q6A A;  4R7C A;  5FPO A;  3CPW U;  3G6B A;  3K9A A;  5IYC O;  4UCV A;  1TUE B;  5DN6 G;  1RM1 C;  3M99 B;  3CD6 V;  3CCQ V;  1GN3 A;  1OCZ C;  2DYS C;  1MSW D;  1Y66 A;  2ADP A;  2CH7 B;  2F23 A;  1VQK V;  1RSO A;  4JI8 B;  3H01 A;  4BIO A;  2ZR2 A;  2E74 B;  1EFR G;  3J81 N;  1KBH A;  3L9D A;  4LH7 A;  1K5S A;  5IY5 B;  2BSK B;  2P5O A;  1K97 A;  3VQY A;  4NR1 A;  3L75 H;  2Y4T A;  3FYE B;  3K0D A;  2Q0A A;  1H2G A;  4PI0 A;  1IBK O;  2B1G A;  2E76 B;  4FLT A;  3CXC U;  5LP6 C;  2JEU A;  5KUK A;  3B40 A;  1FXH A;  1XMQ B;  1QBZ A;  4ZI7 B;  3FB5 C;  2ZDI A;  2UU9 B;  3LNM B;  4WF9 V;  3IAY A;  1XNQ B;  3W7X A;  3B8M A;  2QDO A;  4DR2 O;  1VF7 A;  1SF9 A;  1WB8 A;  5DM6 V;  3CXH F;  1XBL A;  1VF5 B;  5F2V O;  2K1E A;  1IBL O;  2UXD B;  1YSC A;  3W7U A;  1JPX A;  4JV5 B;  3BHP A;  1SRY A;  5IY5 C;  4JYY A;  3A0B Z;  2ZDI C;  2F4V O;  2V1D A;  4FJC C;  2BTO A;  2JVD A;  2G38 A;  1Q6U A;  4YXW G;  2YIA A;  1PNL A;  5LA6 B;  1QHT A;  4LF9 O;  4X1Y B;  1R3K C;  2IH3 C;  1Z2G A;  1SQF A;  2EIK B;  2GSM B;  3CHX A;  3UT5 B;  4JI6 B;  3WU2 Z;  1HNX B;  4LR3 A;  4YHH B;  3B09 A;  3LDE A;  2JS3 A;  3O65 A;  5LA6 A;  4ZHQ B;  3HR0 A;  3JD4 A;  1URF A;  4UUJ C;  1B6Q A;  4X1Y A;  2DQ0 A;  2WSS G;  4HBN A;  4FZ0 A;  4FM0 A;  3K57 A;  2M6Y A;  3UT5 A;  3BVO A;  4DUY O;  2HVJ C;  1VEW A;  1Y74 B;  3WB1 A;  4MTX A;  3ABT A;  2QWR B;  5B1N A;  4FLU A;  1VQ4 V;  4LFA O;  3IFX A;  1HR0 B;  4DR7 B;  1GRJ A;  3JYC A;  4UV9 A;  3RBZ A;  2QWN B;  1KKC A;  3SJB C;  1G4Y B;  5D5Q A;  3K06 A;  4GLX A;  2D2C B;  3JD0 A;  2EIM B;  5L3E A;  1AI7 A;  4LF7 O;  1GAX A;  5FPR A;  2F93 B;  4GZR B;  1Y74 A;  4PHZ A;  4B7E A;  2EIK C;  2OIG A;  2LGQ A;  3ICX A;  1FXK B;  2EIL B;  3RYI B;  1DK1 A;  1KUQ A;  2WLN A;  3HKD B;  4LFC B;  2YIB D;  3N2K B;  1EN4 A;  4DV4 O;  2FB5 A;  3ZN0 A;  2L6L A;  3WFV A;  1D5A A;  2PF4 E;  4LH6 A;  1F23 A;  1FXK A;  4UXN A;  4Z1V A;  4I0X A;  3EFF K;  1TAE A;  2GTA A;  3HKD A;  1F4N A;  3C3T A;  4RQF A;  2E3C A;  3N2K A;  2EIM C;  2ZQM A;  1X59 A;  3B8N A;  1AJN A;  1GN4 A;  4L8J A;  2AZ2 A;  3KCY A;  4B3S B;  4RQE A;  2RDC A;  2Q73 A;  1I94 B;  5L3F A;  4J7J A;  2EIL C;  3TJT A;  2EUL A;  4DV6 B;  4TV8 A;  1QVF U;  4KFM A;  2X6C A;  3BAB A;  4WFB V;  2PYL A;  4YJ2 B;  1MA1 A;  3UCS C;  2Z5U A;  3OMA B;  4JI8 O;  1AI6 A;  4IYI A;  1K73 W;  2OCC B;  1P84 F;  4RO2 A;  4YJ2 A;  1WP7 A;  2WAM A;  2ZIN A;  1H38 A;  3JD2 A;  3JAW B;  1MG1 A;  3H1I H;  2QM4 A;  2QGN A;  1Y4M A;  1KYO F;  4QE9 A;  1X4T A;  3K9S A;  1A32 A;  1Q81 W;  3QTC A;  4H37 A;  4P9O A;  5KHG A;  4JZ2 A;  3SPJ A;  3T1Y B;  1PD3 A;  2HKO A;  2UU9 O;  3JAW A;  1XNQ O;  4MVZ A;  4UCU A;  3UM7 A;  3OEH G;  2BCC H;  3LDC A;  5IE9 A;  4LF4 B;  3L71 H;  4JI5 B;  3WG7 B;  1VQO V;  2ZM6 B;  3P32 A;  3FB6 C;  4JV5 O;  1MMM A;  3CP1 A;  4K8X A;  2OCC C;  3M7M X;  2ZE7 A;  4GX5 A;  4PV1 B;  3AK3 A;  4JTD B;  3CE2 A;  5EBL C;  3O9O A;  4F6R B;  3VQX A;  1NBM G;  1I5X A;  4LNU B;  4I55 B;  1Y76 B;  2P67 A;  4JAU A;  3ETQ A;  4PEL A;  2VRZ A;  3P30 A;  2Q4P A;  2PI4 A;  2YXL A;  1OJH A;  2GHY A;  4QPJ A;  3J7A U;  3ML0 A;  2GBO A;  4F6R A;  3K5M A;  4I55 A;  1Y76 A;  2Y0P A;  5J2U A;  4LF8 O;  4Q6G A;  5L3B A;  4HYO A;  3WG7 C;  4OPH A;  3ETE A;  4CBC A;  4DV5 B;  3CRQ A;  5H2F Z;  5IJ0 B;  2LFR A;  2QM7 A;  2P22 C;  1BHA A;  2ZIM A;  3SYP A;  4PD4 F;  1IBM B;  4HAM A;  4MS2 A;  1EN5 A;  4CH4 A;  5KHI A;  1Y67 A;  4DR3 B;  3L72 H;  5EBM C;  5IJ0 A;  2H8P C;  2KQX A;  1NR7 A;  1K4C C;  5LXT B;  2P90 A;  3CRC A;  4TSF G;  3AK1 A;  2AGA A;  1B06 A;  5IT9 N;  5GTH Z;  1M4U A;  4O4H A;  1RPO A;  2QWO B;  3WB0 A;  1L0L H;  1K7D A;  3SDL A;  4PA9 A;  4LFC O;  1K92 A;  4DV3 B;  3U10 A;  4X20 B;  4MVU A;  4UVA A;  1M90 W;  1R3L C;  5LXT A;  3K5N A;  3F5T A;  3U11 A;  4B3M B;  4TQF A;  2AHZ A;  4L87 A;  1BQZ A;  1VIB A;  3ABU A;  3K58 A;  2ZE6 A;  4JAS A;  5LGT A;  3ZRX A;  3ZED A;  1XL6 A;  3THO A;  4FLX A;  3BCC H;  4JI7 O;  3AG2 B;  2H94 A;  1E1Q G;  2YEV B;  2HHH B;  4B3R B;  1PNK A;  4WFA V;  4NXM B;  2K9P A;  1I94 O;  4DUZ B;  3X2Q C;  5HFL A;  5IWA O;  3T1H B;  4DV6 O;  2L35 A;  3K08 A;  1LUW A;  2GTS A;  2XND G;  4DYL A;  2EIN C;  3FB8 C;  1EM1 A;  5KMG B;  3RVY A;  2UXC B;  1FJG B;  1XHZ A;  4IIJ B;  2ZCE A;  2XTA A;  1W59 A;  2YEV A;  1NH2 D;  3K59 A;  1HW7 A;  3BRC A;  4B7K A;  4J10 A;  5JJE B;  4FIP C;  1LR1 A;  1H2M A;  4I9Q A;  2WWW A;  4W4L A;  1J5E B;  2JGU A;  4J42 A;  2YS8 A;  1B3Q A;  1G8M A;  3AG2 C;  1ENV A;  1M57 B;  3UO2 A;  4X62 B;  2W0F C;  3E2E A;  2LP7 A;  3D3Q A;  2LO1 A;  3CEI A;  2WA3 A;  1PPJ H;  2DYR B;  4NKG B;  5JJN B;  3L74 H;  4F6E A;  4TWK A;  3EVK A;  2ETN A;  1JR9 A;  4P2Z A;  4NTW A;  3K5L A;  4QE7 A;  3G4S V;  5CBH A;  3HPL C;  2QE7 G;  2BTQ B;  5IYZ B;  4OPA A;  1QR9 A;  4GKJ B;  4BWA A;  1FFT B;  2ZM6 O;  2Q7E A;  1N33 B;  4TV9 A;  1L1F A;  5CN0 A;  1R1B A;  4IGG A;  2EZP A;  4FLY A;  1N32 O;  1S5J A;  3CCE V;  1I0H A;  1XL4 A;  2BTQ A;  2Y69 B;  3L70 H;  2B9Z A;  2Q69 A;  1EZV H;  5IYZ A;  3R65 A;  1I7F A;  2YXY A;  3MHS C;  4UB8 Z;  2QKA A;  3ZMV A;  4X66 B;  3OUF A;  2N04 A;  2V7Q G;  2FML A;  4GX1 A;  4LCU C;  2JJ2 G;  2LQT A;  1AJQ A;  3RYH B;  4LWS B;  3JAS B;  1Z5V A;  1JQ0 A;  1QLE B;  4DR4 B;  2JIZ G;  1DLB A;  5LHH A;  4UCR A;  4CS2 A;  5KHJ A;  4JYB A;  1THZ A;  5TIS Z;  5B1A B;  1E1R G;  1QR8 A;  3JD1 A;  1GKF A;  1JJO A;  2XHB A;  4LWS A;  3JAS A;  5KX5 B;  4DV5 O;  2IJI A;  1K5Q A;  1V55 B;  3B77 A;  2WA4 A;  2VQE O;  2MW2 B;  5FL7 G;  4AQY B;  2Y69 C;  3WB2 A;  2OYQ A;  1Q6H A;  2F1M A;  2FYU H;  5J2T B;  4UV8 A;  3NXS A;  4N23 A;  4DR3 O;  5KX5 A;  1M9N A;  2MK3 A;  1RSO B;  2A06 H;  4X1K B;  2ZR3 A;  3OMN B;  4J7Z A;  1VP7 A;  1QLE C;  4LFB B;  4EFE A;  5J2T A;  4F4L A;  2IM9 A;  5B1A C;  4DV3 O;  3MAQ A;  4X1K A;  3E86 A;  4R8C A;  1V55 C;  2Q7G A;  3ZRW B;  2LFS A;  4A5U B;  4B3M O;  1I5Y A;  1SQP H;  2XT9 A;  3JAT A;  3LSS A;  4EB6 A;  2DWD C;  4I50 B;  4O2B A;  4J7K A;  2V4D A;  4CS3 A;  2IW5 A;  5GTI Z;  5JCO A;  4B3R O;  1VF6 A;  3ZRW A;  4NXM O;  2FTK A;  2XAJ A;  4MTO A;  1KU9 A;  3CCV V;  4ABM A;  1Q6I A;  2CTP A;  3D3I A;  4I50 A;  3T1H O;  3VBB A;  1YJW V;  3AEI A;  2UXC O;  5IDJ A;  4LC1 A;  2XAG A;  2KSD A;  1AJP A;  2YI8 A;  2JDI G;  4AIL C;  1SET A;  1R6K A;  1AI5 A;  5JCO C;  1VF6 C;  2Q67 A;  5JWP A;  1AI4 A;  3G67 A;  2KG7 B;  4DRX B;  4DV1 O;  2CK3 G;  1AVM A;  4YY3 B;  1VQP V;  1J5E O;  1HP8 A;  2IH1 C;  2QEX V;  1N0J A;  4DV0 B;  2XAF A;  5BY1 A;  5H6R A;  3IGA C;  3OR6 C;  2ZXW B;  2CDY A;  4X62 O;  1M56 B;  2YC0 A;  2KG7 A;  1PP9 H;  3H1H H;  4DRX A;  1Q5O A;  2F43 G;  4H13 B;  1K8A W;  1L8D A;  1TVK B;  3FFQ A;  1YTF D;  3H1J H;  3ZMS A;  3HKC B;  2R72 A;  3CC7 V;  2EX3 A;  3CSX A;  4WFE A;  4DR5 O;  4E4E A;  2PTM A;  3ZHT A;  2QJ1 A;  4QJF B;  2UUB B;  4X8A A;  1F51 A;  1TVK A;  2P6J A;  4Z1M G;  2A9H A;  5ITZ B;  4GKJ O;  4TT3 G;  3N2G B;  2ITD C;  3HKC A;  3OEE G;  4DV7 B;  3NR7 A;  2OWO A;  1U97 A;  3RGB A;  4K3A A;  4TOI A;  3P3N A;  1BE3 H;  2HG5 C;  3QG5 A;  4EEQ A;  3OW2 U;  2ZXW C;  1M56 C;  4MSW C;  1P49 A;  4O2A B;  5IJ9 B;  3ETD A;  3STL C;  5ITZ A;  2R70 A;  3GB7 C;  4JYA B;  3N2G A;  5D5P A;  3JSN A;  2ILM A;  1MNG A;  1US6 A;  3ETG A;  4I0X B;  4GKK B;  3SJC C;  1ZAU A;  4UVC A;  3BAA A;  4X64 O;  1Q8I A;  4JI3 O;  2ZNJ A;  1NQT A;  1YCI A;  4DR4 O;  4X65 B;  4O2A A;  3AG7 A;  5IJ9 A;  3AG4 B;  1N36 B;  2NLJ C;  1K33 A;  1W2B U;  3TET A;  2DOS A;  4D6T H;  3JAM N;  1BL8 A;  1N34 O;  4EKW A;  4NXN O;  1SKV A;  1RP3 B;  2WLL A;  1Q3E A;  5LGN A;  2Q7H A;  4TV8 B;  4PDL A;  1VQ9 V;  4LBE C;  4G28 B;  3OT7 A;  3GVM A;  3VQV A;  1OCC B;  2NNU A;  1XNR B;  4C7U A;  1BS3 A;  1FXK C;  4NYK A;  5KA5 A;  3OD4 A;  3PJS K;  4JI2 O;  2R9I A;  4LF6 O;  4GT1 A;  1PKX A;  2IU0 A;  3CMA V;  1EZJ A;  4AHC A;  2H3O A;  1IVS A;  3AG4 C;  4JGS A;  5E79 Z;  2P4K A;  5C8Y B;  3DTU B;  2ATK C;  5KUM A;  3KG2 A;  3SPH A;  1HWY A;  4I9W A;  1MZE A;  2DQ3 A;  3CRM A;  4IYH A;  2IBZ H;  1LNQ A;  3AK2 A;  2X0L A;  3IJ4 A;  1ZUQ A;  4WFF A;  5LHG A;  1XIL A;  5C8Y A;  4XBF A;  2Z0A A;  4DK0 A;  1OCC C;  3SYC A;  2ODM A;  4ASU G;  4W4K A;  3ZRV A;  1DTO A;  5KLV H;  4RUF A;  1VQN V;  2OTJ V;  3L73 H;  1J95 A;  1XQ8 A;  1LUV A;  1GH6 A;  2QR4 A;  4XDK A;  1JVM A;  3H1L H;  1XMQ O;  4JF3 A;  2Q8V A;  1NVP B;  2R9A A;  3SGI A;  4WFH A;  1H2S B;  3TXS A;  5CBG A;  2UXX A;  1UFI A;  1CEZ A;  2C2A A;  5EYP B;  5LGU A;  3BY6 A;  5B1B B;  4PDV A;  1MSD A;  3ZRS A;  2UXD O;  3P3P A;  5KHK A;  1WPX A;  3CCS V;  4QNH B;  3CCJ V;  3JAK B;  3C90 A;  4XDJ A;  1IDS A;  3W7T A;  5EYP A;  4KP4 A;  4UFZ A;  3TK1 A;  4JTC B;  4DV0 O;  4PI2 A;  4G27 B;  5EZY B;  5J2U B;  1XUQ A;  3SJQ C;  1NT2 B;  1ZX3 A;  2N74 A;  4JI6 O;  1HNX O;  3JAK A;  4BAY A;  1JMK C;  4HZ3 A;  4YHH O;  3T2M A;  2Y48 A;  5BR8 B;  3RYF B;  4TQD A;  5B1B C;  2WLJ A;  1ARO P;  2E75 B;  3ABM B;  5EZY A;  1R3I C;  3TCU A;  1I08 A;  2LGW A;  4YJ3 B;  4OXS A;  1ZSP A;  2E5L B;  3OUS A;  1KD1 W;  3D36 A;  3CRR A;  1Z5W A;  2ZT9 B;  1G6U A;  2XAS A;  1HR0 O;  3RYF A;  4DR7 O;  4DV7 O;  2VWJ A;  4FZ1 A;  4O4H B;  4YJ3 A;  1FD9 A;  4MW8 A;  3ABK B;  3W7W A;  4JI0 B;  5GW7 A;  3K04 A;  3E22 B;  1KKD A;  1NTK H;  3QO8 A;  4K8Z A;  4PDR A;  3D36 C;  1AP6 A;  5LHI A;  1NKD A;  3RVZ A;  1SQV H;  5K1P A;  1XOU A;  1CXZ B;  1R6T A;  3ABM C;  1YJ9 V;  1YI2 V;  1WP8 A;  3E22 A;  4X65 O;  4IHJ A;  4FM2 A;  4UB6 Z;  3DSQ A;  1GM8 A;  3ZMT A;  2WLM A;  4CZZ A;  4MVS A;  1WJZ A;  4ZBM A;  5BXZ A;  3TGU H;  2PYJ A;  1GTO A;  1OV9 A;  2QTO A;  3SR2 C;  1ZL8 B;  1KB9 F;  1N0N A;  1EN6 A;  3ABK C;  3CRA A;  4XDL A;  5CB4 B;  2Q9L A;  1XNR O;  5EIB C;  2ARH A;  4B3S O;  1KEC A;  2DWE C;  3SYO A;  4WBN B;  3LNN A;  1K3E A;  3D8C A;  1ZL8 A;  3FYI B;  3DGE A;  2HFE C;  4X89 A;  5B5E Z;  2LW7 A;  2PZS A;  1IBK B;  3DXR B;  5CB4 A;  4CC5 A;  2N05 A;  4ZOL B;  1G1X B;  1Q7Y W;  1EBO A;  4WBN A;  3RYC B;  1VQ6 V;  1XI1 A;  2M7W A;  5EBW C;  3ZIA G;  1P4R A;  1MZF A;  3T4D A;  4EFB A;  2DN9 A;  3ZMU A;  3B2E E;  1YF2 A;  2DW4 A;  3DXR A;  4DXW A;  4ZOL A;  4KXR A;  1YVW A;  4OGQ B;  4FLW A;  1HNW B;  3RYC A;  4FLZ A;  1FXV A;  3FD9 A;  1T5E A;  1NVP D;  4GX0 A;  5LOV B;  3ZHV A;  3OGC C;  1GO3 F;  3R66 A;  4UCO A;  4WCE V;  1AB3 A;  3OFN G;  5H5N A;  1SZT A;  2JEX A;  3ZHQ A;  3A0R A;  2JGD B;  1P7B A;  1QLN A;  3T1Y O;  4TV9 B;  1WAZ A;  3JSL A;  5LOV A;  1BZK A;  2X6B A;  4MVO A;  4LF4 O;  2VQF B;  2EIJ B;  4ICG A;  1OCO B;  3N27 A;  1H8H G;  2HP8 A;  4JI5 O;  1K34 A;  2JGD A;  3ZJZ A;  5EC2 C;  4GCZ A;  4MW3 A;  2X7R B;  3J80 N;  1M57 C;  1WB7 A;  1WNS A;  4X9Q A;  1TA8 A;  3JAR B;  2QKS A;  2FL4 A;  5CMU A;  2DYR C;  3E8F A;  1H2K A;  4LF5 B;  2UUC B;  3CJH B;  4PDM A;  4J11 A;  4ZKI A;  1M5I A;  1PNM A;  1XMO B;  1TGO A;  1FPO A;  4BIU A;  4RUE A;  4LF7 B;  3APO A;  2EJ7 A;  3FX7 A;  3ZBH A;  3JAR A;  4PA4 A;  4JAV A;  4DR1 B;  5LYJ B;  3CCL V;  4J41 A;  4BW9 A;  5BR8 O;  2EIJ C;  3SPG A;  4DW1 A;  2ZKO A;  3CJH A;  2JJ1 G;  1V54 B;  2CAZ C;  1AP5 A;  4JZG A;  2E5L O;  4FPP A;  1UPG A;  1N8R W;  2LW1 A;  2JK5 C;  2RMK B;  1GMG A;  4U7O A;  5LYJ A;  4DV4 B;  1AR1 B;  3OTF A;  1IXB A;  1K4D C;  3CC2 V;  1Q82 W;  3Q4H B;  1IBM O;  4I5S A;  1B04 A;  4MTF A;  3ASO B; 
#chains in the Genus database with same CATH homology
 1BCC H;  1P84 F;  3CX5 F;  3H1J H;  2BCC H;  2A06 H;  3L72 H;  1PPJ H;  1NTZ H;  3H1I H;  1SQP H;  3CWB H;  1BGY H;  1KYO F;  1BE3 H;  3L71 H;  3L74 H;  3L75 H;  1NTK H;  1SQQ H;  5KLV H;  1NU1 H;  4D6T H;  3H1K H;  3TGU H;  3CXH F;  3L73 H;  1SQV H;  2IBZ H;  3L70 H;  1SQB H;  1EZV H;  1PP9 H;  1KB9 F;  1L0L H;  3H1H H;  2FYU H;  4U3F H;  1L0N H;  1NTM H;  3H1L H;  4PD4 F;  3BCC H;  1SQX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...