4HZ3A

Mthk pore crystallized in presence of tbsb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
b'VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
total genus 32
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hz3A00
4ZBMA 5J9PC 4R6ZA 3LDCA 5BZBA 1K4DC 1OCRC 1OCOC 5EBWC 2EIJC 3RVZA 3SPCA 1BL8A 2QKSA 3SPIA 4GX2A 3LDDA 4HZ3A 3AG3C 1S5HC 3ABKC 4LCUC 5KUMA 3OGCC 4MTOA 3HPLC 3ABLC 3SPGA 3OR6C 2BOBC 2AHZA 4WFGA 3WG7C 1V54C 2K1EA 4MVRA 1P7BA 3SYPA 4MSWC 3ZRSA 2WLLB 5CBGA 4PA4A 3RBZA 4F4LA 4P30A 4GX0A 2WLIA 4EKWA 4X89A 4PA6A 4RUEA 3KG2A 2BOCC 2HVJC 2EILC 2H8PC 3FB7C 3SYQA 3T4DA 3UM7A 2ZXWC 3K0DA 4JTAB 3SJQC 4P9PA 3EFFK 4WFHA 3T1CA 1V55C 4X8AA 4P9OA 4XDLA 5KUKA 2YEVA 3IGAC 2ZD9A 3FB6C 4JTCB 3ASOC 4PDRA 4R50A 1G4YB 3F7VC 2ITCC 3LDEA 2EIKC 2OCCC 2Q69A 2R9RB 5EC1C 4HYOA 3SPHA 2WLJA 4G28B 4MVQA 3PJSK 2A9HA 1XL6A 3K03A 2Q67A 3E8HA 5CBHA 2X6AA 4JTDB 5E1AC 2P7TC 1R3IC 3SYOA 2HVKC 3RW0A 4QE9A 4TWKA 3E89A 2A0LA 4RAIA 4QNHB 3IFXA 1OCCC 2DWEC 4P2ZA 4BW5A 4R8CA 1QLEC 4MTFA 2DYSC 5CBFA 5IY5C 3TETA 3K0GA 2W0FC 2HJFC 3LNMB 3RVYA 2WLIB 2WLHA 3LUTB 2Y69C 3OUFA 4J9ZB 4PA9A 3T2MA 5B3SC 3E8FA 5EBMC 2DWDC 3SYCA 3STZC 2ITDC 1R3LC 3E86A 1J95A 3OUSA 2ATKC 2WLNA 4MVSA 4J9YB 3VOUA 3E8GA 4G27B 1XL4A 4X88A 4MW3A 4CBCA 3AG4C 1ORQC 2IH1C 4MW8A 2NLJC 2X6BA 3FB8C 4MVMA 3SPJA 3AG1C 5B1AC 1KKDA 4KFMA 4XDJA 4H33A 4LBEC 2HG5C 4RO2A 4OXSA 4GX5A 4LP8A 2QTOA 2A79B 2WLMA 4QE7A 3ABMC 4UUJC 3ASNC 3E83A 2EINC 3F7YC 2HFEC 3OR7C 2WLKA 4PDLA 2EIMC 3K04A 3R65A 4XDKA 3FB5C 4MVOA 4RUFA 4I9WA 1R3JC 3ZJZA 2KB1A 4MS2A 4PA7A 3UKMA 1M56C 2WLLA 1R3KC 3T4ZA 2Q6AA 2X6CA 4GX1A 1M57C 5EBLC 3GB7C 4MTGA 3BEHA 4DXWA 4PDVA 3AG2C 3JYCA 2IH3C 3K08A 4WFEA 3SYAA 1K4CC 1LNQA 2AHYA 3F5WC 3K06A 1OCZC 1JVMA 4H37A 3X2QC 2DYRC 4MVUA 2JK5C 4MVZA 4R7CA 4WFFA 2Q68A 3E8BA 5EK0A 3TCUA 3STLC 5EC2C 5B1BC 1ZWIC 4PA3A 4PDMA
chains in the Genus database with same CATH superfamily
3AG3B 4UFZA 2UXXA 1PNKA 3LDCA 1KP3A 1XOUA 1NTKH 2FMLA 4HZ3A 1S5HC 2KQXA 1AP5A 4X64O 2IW5A 1R6KA 3ABLC 4NXMB 4X66O 4NTWA 1EZJA 2YXYA 3CPWU 4F4LA 4X65B 1M5IA 4JI8B 3C3SA 4B3MB 2LW7A 1X59A 4I0XB 1VQKV 3OE7G 4DV1B 3IGAC 2XAJA 3I5DA 1GKFA 1YSCA 3W7UA 4MVQA 4K8ZA 4D7SA 1N33O 1NTZH 1H2GA 1ZAUA 4TWKA 3RW0A 2IU3A 1XBLA 2A0LA 2EZOA 4KL1A 1MSWD 1K97A 1MZEA 2WLHA 3B40A 3ZCCA 3CB2A 4JI6B 2QWRB 4JI7O 3CCUV 1M4UA 3AG7A 1J5EB 4MW3A 5B1AB 1AI7A 2IH1C 1BSMA 5IYZA 3JALB 1MSDA 2Q7GA 2HKOA 4X1KB 4D6TH 4YHHB 2PF4E 1HR0O 1FJGB 3FB5C 1XNQO 2ZDIA 4RUFA 3CEIA 1NR1A 2X6CA 4U3FH 2ILMA 3X2QB 1AR1B 1VQ5V 2DOSA 5B1BB 5ITZB 1XUQA 4DUZO 2Q68A 3MHSC 3TCUA 1N36O 3QG5A 4FFBA 1JFFB 3CWBH 1GN2A 2RMKB 3G67A 4HAMA 3O9OA 5CA1A 5K1PA 3J80N 2ODMA 1RSOB 2BOBC 1WA8B 2V7QG 2DMXA 2ZM6O 3MD0A 4MSWC 2BCCH 4FK5C 1XMOB 1Q7YW 2WAMA 2WWWA 3OTFA 4DR2B 3BRCA 3EFFK 4WFHA 5JH7A 5C8YA 4XDLA 2B9ZA 2HJDA 1YTFB 2LW1A 1KC8W 1K33A 3ETEA 3F7VC 3KCYA 3AEIA 2OCCC 3APQA 5BR8B 3CHXA 2JDIG 2XASA 3PJSK 1N4CA 2JVDA 3E8HA 5LHGA 2KG7A 2HVKC 5J2TA 2DW4A 5B3SB 4JASA 3K9AA 2PI4A 5EYPA 3HKDB 5GW7A 4KHPO 3K5OA 3JAKA 1V9PA 4J41A 1OCZB 5CB4A 3RWRD 1SQPH 2CUGA 3H01A 3B8MA 2OT5A 1FS0G 5KX5B 2EIJB 4H13B 2C2AA 4LP8A 1NQTA 3ASNC 2GBOA 2VQEO 1IURA 1SKVA 4I9WA 2JJ1G 1M56C 3T1YB 4AQYO 1HNZO 4X20B 2YIBA 3RYHB 4UCSA 4LFAO 3OTOO 4MVZA 2Q0OC 2F95B 4NVPA 4PJ0Z 3RYIA 1DTOA 1SS3A 1BL8A 3JSNA 2XAHA 3OEEG 3H1KH 4LF7O 1PV0A 2HEPA 1GAXA 1RM1B 1AJNA 4MVRA 1EM1A 1P7BA 1F4NA 3ICXA 2YIDA 4QPKA 5IE9A 1OJHA 1FXKB 4O4HB 2H8PC 2CTRA 1GMGA 1XMQO 1TUEB 4U3JA 3K0DA 3SJQC 3HKBB 1THZA 2ZNIA 3OM3B 1G4YB 3D3IA 4BIOA 5FNVA 1PKXA 2JEUA 1FFXA 1IX9A 1L0LH 1AR5A 3HR0A 3JATB 5GONA 3C90A 1VQMV 1IBLO 2P22C 3WB1A 1Y6XA 4R8CA 3CS5A 3QO5A 5CBFA 5LOVA 1XEQA 1VARA 5JQGB 4BIUA 4YXWG 1XNRB 4BW9A 2QTSA 4G27B 4TQDA 2LFSA 3HKCB 2WPDG 1ORQC 3RT3C 1VQPV 3SPJA 4WCEV 4IIJA 2QWNB 4UV8A 4O4JB 4GX5A 4AHCA 4F6EA 2Z5UA 4JPRA 2WLKA 1I0HA 3R65A 3ZHTA 1COWG 3CC2V 1BZKA 4YY3B 1TUBB 2WLLA 4JI0O 2EZPA 4GX1A 1QBZA 1R6TA 2DN9A 2QA4V 4J7JA 1N0JA 1B04A 4X1IB 2YXLA 3CRCA 2P06A 1XHXA 2YC0A 2VS0A 3OMNB 4L87A 4N23A 1PNMA 3ABLB 1ZTEA 4BIZA 1KECA 2QEXV 4DRXA 2BSKA 1LUVA 3T1HO 1K7DA 2K1EA 1WJZA 3N2KB 1VQ9V 2DYSB 1SQGA 1ZL8B 3JD0A 2IJHA 1S5LZ 3JCUZ 4FIPC 1BE3H 1RPOA 3ZN0A 4DV3O 2HVJC 1NR7A 1QHTA 1XQ8A 1VF7A 5LXTA 4J10A 1FD9A 4RQFA 3ZHVA 2G38A 5JVDA 2EIKC 3WFVA 4EFBA 3JAMN 4JI2B 1Q5OA 4DV2B 4QPJA 2QJ1A 1VQ4V 2Q73A 1H2KA 2F1MA 4JI5O 1JJOA 4U7NA 3TGUH 3OW2U 4NTXA 2Q5ZA 5IYBO 3M99B 1XILA 1WPXA 4DUYO 1SZTA 3K59A 2UUCB 1M57B 4IHJA 2HHHO 2WLNA 3SJAC 5GTHZ 1XL4A 2YEVB 4H44B 5IDJA 3BA8A 3UT5B 2F4VO 4DV7O 2OTLV 1AI4A 3M8AA 2E75B 1KKDA 3IC7A 1FXVA 2MW2B 4NYKA 5KMGB 3U0ZA 2HG5C 1K9MW 4LF4B 3EVKA 3GWOA 1S76D 3ABKB 4QGPA 3ZS8C 2VQFO 4FZ0A 1SQVH 4Q6GA 1DGSA 4B3SB 1SRYA 3WB0A 4MS2A 1GM8A 4JI4B 4GT1A 3BA9A 2QM7A 1OCZC 1CPYA 4I0XA 3QO8A 4ICGA 2Y0PA 2JK5C 2Q9LA 5EC2C 3P30A 2XAFA 5BZBA 4DR5B 2GHYA 2EIJC 3OGCC 4O2AB 2Q7EA 3K5LA 4DV0B 3SYPA 4QIWF 4JI3B 3ZRSA 2UUBO 3UM7A 3G71V 3QNEA 3LSQA 4UCTA 3ASOC 1AJQA 3TK1A 4CS2A 2WLJA 3EHBB 1LUWA 3G6BA 3JALA 4K35A 4X1KA 1QR8A 3OD4A 2JJ2G 3IAYA 4UCUA 3M7MX 3CCVV 4LF9B 1HNXB 3RGBA 3HKEB 1N34B 2CH7B 2BTQB 1IZ3A 4DV6B 1O9GA 4LFCB 3K9SA 3GVMA 3B2EE 3E35A 2W6JG 1F7YA 2EJ7A 3BHPA 3JD4A 1W2BU 3TJTA 4CH3A 1WP8A 1W0JG 4MW8A 5IT9N 3D3QA 4LNUB 1JFFA 3RYFB 1KU9A 1Y76B 5B1OA 3GWKC 3W7WA 2E3CA 3LSUA 3CCJV 3CCMV 5LYJB 5LGTA 1RSOA 1WP7A 5B5EZ 1Q3EA 1MABG 1IBMO 2FTKA 1F23A 1BCCH 3B4SA 5LHHA 2LQTA 5LMNO 4GLXA 2RQ6A 1X4TA 4EEQA 1YJ9V 2IJIA 5EZYB 1JCHA 4ASUG 3BAAA 2NR5A 5LGNA 4ZBMA 4NXNB 3SDLA 4EB6B 1SQQH 3RVZA 5A9GA 5L3BA 3SPCA 2XHBA 4O4IB 4LFBB 3WB2A 5KUMA 2IBZH 3HPLC 4JI1B 1K73W 1VQ7V 3DC5A 2UUAB 4LF5B 1Q6IA 4CS4A 2CTWA 1PD3A 4J7ZA 3G6EV 4OX9B 5IWAB 4PA6A 1HNWB 4RUEA 1RPRA 2BOCC 3ZHUA 3FB7C 1S3JA 2JS5A 1D5AA 3HKDA 1WNSA 2PI5A 3CCEV 3T1CA 2XOKG 2P5OA 1ZLZA 4DR1O 4GZRB 3TXSA 2OYQA 5LMUO 3UO2A 4B7EA 3SPHA 5LBQA 2V4DA 5KX5A 2QSAA 3H1LH 3CX5F 2OWOA 1Z5VA 3ETQA 2CK3G 3SYOA 4NB5A 4WBNB 3P3NA 2CTPA 2EX3A 3A8TA 1OCCC 1FPOA 2DYSC 5DEDA 4DR7B 4DR4B 3CJHB 1JA8A 2QKAA 5HFLA 2QKCA 1O9HA 3OGIB 4X20A 1NZ6A 2B1GA 4X1YB 3RYHA 5BY1A 2H94A 3AG4C 3D36C 1YCIA 1CXZB 4XDJA 3G80A 1J5EO 3B8NA 4X64B 5IJ0B 4ZKIA 4OXSA 1JOYA 2DQ3A 2UXBO 4F6RB 1BHAA 4CC5A 5IYCO 2ARHA 1UFIA 4IGGA 1FJGO 1GH6A 1M57C 2DJVA 1MMMA 1FXKA 1L8DA 4WFEA 1SESA 1BS3A 2AW9A 3HKBA 4YJ2B 4WFFA 2Q8VA 2L35A 5FLXN 4MT8A 2VWKA 2V1DA 5EBWC 2XAQA 2YSUB 3DXRB 5KLVH 3LDDA 3ABKC 1N33B 4JAUA 3S3WA 1AR4A 3JATA 3K3WA 4TQFA 4WFGA 4UCRA 5L3EA 1PL4A 1IXMA 4DR3O 4B3RO 1URFA 2GDSA 1BQ0A 4W4KA 4CH6A 4JI7B 1R6NA 1VQLV 5JQGA 1E79G 2ZE7A 2FKXA 4TV8B 3ZBHA 2EIKB 4B08A 3TXQA 1GN6A 1M9NA 3FB6C 3HKCA 2YS8A 4JTCB 4PHZA 1KMIZ 4CH4A 4I50B 5TISZ 4X62O 4TT3G 1IDSA 1HR0B 3BFRA 4DV4B 4O4JA 3B77A 3CRRA 1XNQB 3E22B 2Z3YA 4JV5O 3RFRA 1E1RG 2PUSA 1N32O 2WLIB 4TUYB 4TV9B 1QLNA 1G8MA 2JIZG 4JGSA 4MTXA 4O2BB 4X1IA 4DUZB 4YJ3B 2UXCO 3ZMUA 2D2CB 1ENVA 2EULA 4ZHQB 2CAZC 4ZOLB 4RO2A 1W0KG 1M93A 3L70H 4RQEA 4JAVA 2B5UA 3N2KA 3ZJZA 3UKMA 4FFKA 1ZL8A 1PM9A 5DN6G 4DXWA 2HR3A 2AHYA 1JVMA 2B1IA 1Q86W 1JR9A 2JGDB 2K9PA 1W59A 5J9PC 1KP2A 2YXHA 3D36A 4GUNA 2FL4A 4J80A 4LCUC 3J81N 3L75H 3DGEA 2OIGA 4B3TO 3RN4A 4DV5O 1V54C 2EJRA 2FYUH 1EBOA 3JCZA 2YICA 1YEWA 1SETA 4LF8O 5L3CA 1N8RW 4JYAB 4KHPB 1SQFA 5JJEB 2H3OA 5D5PA 3ASOB 1P7GA 2YEVA 4HBNA 4FLXA 2YI9A 2ITCC 1PL0A 3OT7A 3JAWB 3J7AU 1NH2D 1LR1A 5D5QA 5KMGA 5BMVB 4LWSB 2VQEB 4GKJB 5L3FA 4RAIA 2RNBA 1UJWB 2W0FC 2UXNA 3LNMB 2QGNA 4AQYB 1HNZB 5FL7G 4LFAB 1WN7A 4J9YB 3OTOB 3L74H 4AI8A 2BE3A 2P67A 4FLTA 2NLJC 3CCQV 4MVMA 5LP6C 1FXHA 1OCOB 3CRMA 1KD1W 1NVPD 4LF7B 1AI5A 3DTUB 1ZSPA 4NR1A 4O2AA 3JD3A 2F43G 4I4TB 5KAFZ 1M90W 1TA8A 3ZRWB 4FJCC 2AGAA 3LSSA 1I7FA 2BTOA 1JX9A 3OAAG 3ZMVA 5KHJA 1XMQB 2O57A 2EILB 1H8EG 2Q7HA 1YVWA 4PV1B 1Q8IA 1P4RA 4PDMA 4FLYA 2HLDG 2QKSA 2YIBD 1QR9A 5IYDO 1AVMA 2NNUA 1VEWA 1I5XA 1EN6A 1A32A 1QVFU 3L73H 1RFYA 4LH7A 5FPOA 5IY5B 1ZUQA 4I7ZB 5GTIZ 4P30A 4GX0A 2CH7A 2BTQA 1I94O 1HW7A 3A2FA 3U11A 3JASB 4FM2A 4DYLA 3RYCB 3JD2A 2Q69A 2WSSG 2KKWA 2N05A 1YJWV 4LNUA 3RYFA 2CE4A 1SERA 1Y76A 1Z5WA 1HWYA 2Q67A 2LGWA 1YF2A 1OCCB 1R3IC 2JS3A 5LYJA 5EIBC 3CSXA 4P2ZA 5K1XA 4UVBA 1G6UA 2E5LO 3K0GA 3FAVB 4PI0A 2MK3A 1KBHA 3E8FA 4GKKO 3E86A 1G1XB 3AG4B 2RJZA 5EZYA 1GM9A 2DYRB 1U97A 1IVSA 2YUAA 4FLWA 1OHHG 3KZIZ 4OGQB 4EB6A 3SGIA 5H5NA 2E76B 1FYJA 4O4IA 4QE7A 5IJ9B 5JWPA 4FLUA 3T1HB 3K04A 4LF4O 2ETNA 1H8HG 3AK3A 2QM8A 1VP7A 3LNNA 3ZHSA 5L3DA 3CCSV 4DV3B 3I56V 1WAZA 5J2UB 2P4VA 3B09A 1AB3A 5JCOC 3K58A 4I9QA 4TSFG 4FLVA 1K92A 1VF6C 4CC6A 4IYHA 3SPGA 4PELA 1OZ0A 1Q6UA 4JI5B 4WBNA 1IBKO 4PA4A 2GUZB 4DUYB 1PNLA 2CGNA 3CJHA 3VQWA 2HHHB 5AG2A 4JI3O 1K8AW 1VMGA 4P9PA 1Q82W 2F4VB 3EXAA 1H2LA 4DR6O 4X1YA 1DF5A 3LDEA 2WA3A 2Y48A 3NR7A 4HNAB 4HYOA 1MNGA 5H9CA 2VQFB 1SF9A 4G2KA 3ZX6A 2ZE8A 4YIPA 4F6RA 2UU9B 3A0HZ 3CRAA 3ABUA 2Y69C 1WLEA 3K5NA 3CCLV 2QWQB 1J95A 3E8GA 4X88A 3K79A 4CZZA 4YJ2A 2X6BA 4LFCO 3VBBA 3CE2A 1B06A 1R1BA 4KFMA 3FYEB 2AZ2A 2Y4TA 3DXRA 3ZN1A 4MVOA 4JAAA 1MZFA 2UUBB 4K0KO 1NU1H 1Y74B 2GTSA 1BGYH 5ITZA 1H2MA 2L6LA 5A2QN 2IH3C 5E79Z 2PYLA 3AK1A 1K4CC 2F66C 4DK0A 1BT8A 4H37A 4ABMA 1HDJA 4TV8A 1V55B 2RDCA 2YDEA 3MDSA 3PN1A 1K4DC 2UXDO 1OCOC 5LA6B 1BHBA 4I50A 2FB5A 1WA8A 1V54B 3I55V 1VQNV 3ZEDA 3WU2Z 3IJ4A 3E22A 1GK9A 4OPHA 4LF6O 2BSKB 2UUAO 2WLIA 4TUYA 1N0NA 3DC6A 1AJPA 4TV9A 2EILC 5CA0B 2Y4UA 4OX9O 4BR6A 4JTAB 1VQOV 1ROPA 3JARB 4O2BA 2ZINA 3QO7A 4FM0A 4YJ3A 1WPBA 3CXHF 4J7KA 3Q4HB 1EFRG 5EC1C 2M7WA 1Y4MA 1S5JA 4CS3A 3BVOA 4ZHQA 3BPZA 3THOA 1KKCA 2ZT9B 4FPPA 4ZOLA 4NKGB 2HP8A 3ZHQA 1MOFA 4NXMO 1IBMB 1K5QA 5IY5C 3W7TA 5LMNB 3RVYA 1IXBA 1TAEA 4X65O 2A7WA 1FFTB 2GV9A 4I5SA 5KHKA 4JI8O 3AK2A 1R3LC 4JF3A 5CA3A 4B3MO 3VOUA 3P3PA 3UCSC 1H2NA 4CBCA 5LP6B 4DV1O 1XDCA 1PP9H 1NKDA 3FB8C 1UPGA 4UV9A 2LP7A 4ZI7B 2A79B 2XAGA 4KXRA 3NXSA 3F7YC 4QJFB 2HFEC 2EIMC 4GCZA 4XDKA 1GM7A 4UB8Z 4YIOA 5LHIA 1GN3A 1Q90D 1R3KC 5JJNB 3BEHA 4JI6O 4J11A 3K06A 2ZXWB 5FPRA 2DYRC 2RN9A 1F4MA 4DR1B 4R7CA 4H0LB 2NN4A 4L8JA 5LMUB 3JAWA 4X66B 4WF9V 4K8XA 4YHHO 5LL6Y 5BMVA 2AHZA 4LWSA 3CMEV 1YTFD 3ZRXA 4FZ1A 3H1HH 1S0VA 4O4HA 3ETGA 3A0RA 2IM9A 1SQBH 3CD6V 2XUMA 1KYOF 5H6QA 4R50A 4UVAA 4XBFA 3C3TA 2A9HA 2PYJA 2R72A 2X6AA 2UXBB 3CXCU 2ZIMA 4LR3A 3E89A 1YJNV 4I4TA 4Q20A 1WB8A 2XNDG 4DV4O 3ZRWA 4FMTA 4PA9A 4B7KA 4Z2WA 5F2VO 4ZIBA 2A3QA 1XMOO 2ITDC 3N2GB 4MVSA 2P90A 4DR2O 4FVMA 3ABTA 2OTJV 3IC9A 5KHGA 3SJCC 1K5SA 1R73A 3FD9A 3F5TA 3QVNA 4JZGA 5BR8O 1GRJA 4I55B 4RWUA 3E83A 3OR7C 4DR3B 1TUBA 1CEZA 4B3RB 2KB1A 3MAQA 5H6RA 3JD1A 1N36B 4O4LB 1BMFG 3W7XA 3SYAA 4LC1A 3S3XA 4GYCB 4MVUA 4PD4F 1RP3B 1AROP 3JASA 2ZR2A 4EFEA 1OCRC 4X62B 3RYCA 3SPIA 1Q6HA 2ZM6B 1YXBA 2M6YA 3MHHC 1JPXA 1HP8A 1NS1A 3QTCA 4JV5B 1N32B 1YI2V 3FAVA 4W4LA 2ZKOA 4DW0A 2P4KA 5DECA 2N04A 3T1YO 5C93A 1K3EA 4DW1A 1TVKB 1SA0B 3BCCH 2UXCB 1V55C 2Z0AA 4X8AA 5KA6A 4X9QA 4JYAO 2VWJA 4LH6A 3H1JH 3KKYA 1U96A 3FYIB 3K03A 3JSLA 5E1AC 2PTMA 2P7TC 4Z1VA 5IJ9A 2XTAA 2LO1A 1YZBA 1KB9F 1DLBA 2Y69B 3SR2C 1QLEC 2HJFC 4TOIA 3TETA 3OUFA 3T2MA 2N74A 4GKJO 1DF4A 1QNMA 3UT5A 2ZE6A 1MA1A 5J2UA 1I5YA 3R66A 5H2FZ 1QCEA 1GN4A 2F93B 4KP4A 4JYYA 2WLMA 1CP9A 4B3TB 2EINC 4DV5B 3ZMSA 2ADPA 4PDLA 2RCVA 3WG7B 1R3JC 4LF8B 2F23A 2ZE5A 2GUZA 3GB7C 5JJJB 4NTYA 3VQXA 1XNRO 1SQXH 2PZSA 1LNQA 3F5WC 3W7SA 3G4SV 4C7UA 2W6IG 3FKSG 5KHIA 5LGUA 1Q81W 2X7RB 1P49A 2Q0AA 5CN0A 3SJBC 1ZWIC 5IYZB 1XHZA 1JMKC 1D2DA 3DSQA 4HNAA 3AG3C 3FX7A 1M1KW 4FLZA 2KSDA 2XT9A 1DK1A 1VF5B 2JRIA 4BWAA 2QR4A 2LJ2A 3L9DA 4YY3O 2ZXWC 3H1IH 3CP1A 2PGGA 3CC4V 4FFBB 1P84F 3KCXA 1IBLB 3AG1B 2ZNJA 4DO2A 4G28B 5CA1B 5BXZA 2R9AA 4JYBA 1XL6A 2DE0X 3UO3A 5CBHA 4WFAV 5KA5A 2QM4A 3ABMB 2QE7G 3HKEA 3ETDA 1QU7A 4QNHB 4BW5A 1NJIW 3UQ8A 4A5UB 4BAYA 1Z2GA 2PY5A 1VQ6V 2CDYA 2DWDC 4JYCA 3SYCA 1JQ0A 1PPJH 3STZC 1Y74A 3APOA 3VQVA 1NH2B 2YI8A 2X0LA 3AG2B 3U10A 5JH7B 3H9VA 5C8YB 2QDOA 2IU0A 4FM1A 5B1AC 4H33A 3K5MA 5LA6A 1ZX3A 2QWPB 4JI2O 2OCHA 1BQZA 2KG7B 2EIMB 2AZ0A 2QTOA 5KHHA 5J2TB 1EZVH 4DV2O 4UUJC 1F51A 2Q4PA 4JI0B 1YHQV 1JJ2U 2ADQB 2IJJA 2Q6AA 2A06H 5EBLC 1I94B 5EYPB 4KUMA 2UUCO 2YIAA 3JYCA 3K08A 3JAKB 1NVPB 4AILC 5CA0A 4J42A 4OPAA 3X2QC 5CB4B 1QQCA 3JARA 1OV9A 3STLC 5B1BC 1WB7A 4PA3A 4R6ZA 1US6A 3Q4HA 2D3OW 4GX2A 2JGUA 5HFMA 1EN5A 2ZR3A 4UXNA 4B3SO 2E5LB 1YDXA 3D8CA 3ZMTA 1TGOA 5CBGA 4GKKB 4EKWA 4X89A 1XREA 4UCVA 1NTMH 4JI4O 3T4DA 2LGQA 3ZIAG 1SZXA 2VRZA 2ZIOA 3CRQA 4DK1A 2ZD9A 3RYIB 4PDRA 4UB6Z 5LP6A 1YIJV 4N21A 1AP6A 4Z1MG 4IL6Z 4DR5O 4ZI7A 4JTDB 3HB3B 3BABA 4WFBV 3VQYA 4DV0O 3IFXA 3FFQA 1L1FA 3LUTB 5B3SC 5EBMC 3ML0A 2GSMB 3ZMZA 2DQ0A 4U3JB 4DV7B 3OUSA 2UU9O 1FAFA 3N27A 2R70A 1Q43A 5FNVB 4CH5A 1KUQA 3E2EA 5IJ0A 1GTOA 1FFXB 2CTQA 4LBEC 5GONB 4PI2A 2LFRA 2CGOA 1NBMG 3CYOA 1B3QA 1XI1A 1L0NH 4D7TA 4JZ2A 5LOVB 5B66Z 4LF9O 1HNXO 1IBKB 3ZRVA 2AXTZ 3A0BZ 1N34O 4IYIA 1QVGU 3CMAV 1YITV 3OEHG 4DV6O 2QWOB 4DR6B 2EBOA 1OCRB 3E8BA 1NI8A 4E2LA 1VQ8V 1MG1A 2GTAA 4IIJB 3CCRV 2OCCB 3BY6A 5DM6V 5B1NA 4MTOA 1S72V 3OR6C 3WG7C 2ZQMA 2OIEA 2WLLB 3OMAB 1RM1C 3RBZA 4K3AA 3CC7V 3KG2A 3SYQA 1S77D 3N2GA 4U7OA 1FXKC 1H2SB 1NT2B 4P9OA 4UCOA 5KUKA 3K57A 1GO3F 5L3GA 4NXNO 2R9RB 3O65A 3P32A 3L71H 1B6QA 4LFBO 4DRXB 4I55A 1D5NA 4JI1O 1QLEB 2ZDIC 4QE9A 1SC5B 3ASNB 4LF5O 1I08A 2DWEC 4MTFA 3OFNG 2R9IA 5KAIZ 1E1QG 3OMIB 4K0KB 4E4EA 4J9ZB 1M56B 5IWAO 2IJKA 1HNWO 1K34A 1AILA 5LXTB 2ATKC 1Y67A 4O4LA 5JCOA 2JEXA 5JVDB 2Y0IA 2P6JA 2UXDB 3AG1C 1VF6A 2W0XA 2EINB 3ABMC 1FKAO 2ZCEA 3QF7A 4UVCA 1T5EA 4LF6B 1KQSU 4PA7A 4DR7O 4DR4O 3T4ZA 1AI6A 4IHJB 4MTGA 3ZHRA 2WA4A 4PDVA 3AG2C 3L72H 1H38A 2E74B 1EN4A 2JGDA 1TVKA 1SA0A 5EIBD 5EK0A 4IT5A 1VIBA 1Y66A 5CMUA
chains in the Genus database with same CATH topology
2XAFA 3AG3B 2UXXA 1AROP 1PNKA 3LDCA 1KP3A 2ZR2A 5BZBA 1OCRC 2GHYA 2EIJC 2HLDG 2QKSA 3SPIA 4HZ3A 1S5HC 1QR9A 2IW5A 1R6KA 5IYDO 3OGCC 3ABLC 3MHHC 1JPXA 2NNUA 1I5XA 1EZJA 1QVFU 3SYPA 4QIWF 3ZRSA 5IY5B 3CPWU 1YI2V 4F4LA 4P30A 4GX0A 5C93A 1K3EA 3UM7A 3G71V 3QNEA 3LSQA 1VQKV 3OE7G 1V55C 4X8AA 5KA6A 3IGAC 2XAJA 3ASOC 3JD2A 1AJQA 3TK1A 2Q69A 2WLJA 2WSSG 3EHBB 3FYIB 1YJWV 1GKFA 1YSCA 3W7UA 4MVQA 1SERA 3K03A 1HWYA 2Q67A 5E1AC 1QR8A 1OCCB 2P7TC 1R3IC 1H2GA 4TWKA 3RW0A 2JJ2G 2IU3A 2A0LA 3CCVV 2EZOA 1DLBA 2Y69B 4P2ZA 1QLEC 4UVBA 1MSWD 3K0GA 2MK3A 2HJFC 1K97A 3TETA 2WLHA 3OUFA 3T2MA 3ZCCA 3E8FA 3CCUV 1DF4A 3E86A 3AG4B 3E35A 2W6JG 4MW3A 5B1AB 1GM9A 2DYRB 3JD4A 1W2BU 1AI7A 2IH1C 1W0JG 1I5YA 4MW8A 1OHHG 1QCEA 5B1OA 2HKOA 4KP4A 3W7WA 4QE7A 2WLMA 1CP9A 3CCJV 3CCMV 2EINC 5LGTA 3ZMSA 4PDLA 1MABG 3K04A 3WG7B 2FTKA 3FB5C 2ZDIA 4RUFA 1H8HG 1F23A 1R3JC 2QM8A 1NR1A 5LHHA 2X6CA 5L3DA 3CCSV 3GB7C 3I56V 3X2QB 1AR1B 1VQ5V 1LNQA 3F5WC 3W7SA 2IJIA 3G4SV 1YJ9V 5B1BB 2W6IG 1JCHA 3FKSG 5LGUA 1Q81W 2X7RB 2Q68A 4ASUG 3MHSC 5CN0A 3TCUA 1ZWIC 5LGNA 4ZBMA 4TSFG 5L3BA 3RVZA 3SPCA 1K92A 3AG3C 1M1KW 4HAMA 5KUMA 3HPLC 1K73W 3SPGA 1VQ7V 2BOBC 4PELA 1OZ0A 2V7QG 1PD3A 3MD0A 4MSWC 3G6EV 4PA4A 1PNLA 4FK5C 4PA6A 4RUEA 2WAMA 1Q7YW 1RPRA 2BOCC 2WWWA 3FB7C 1S3JA 2ZXWC 1K8AW 3CP1A 2PI5A 4P9PA 3CCEV 3EFFK 4WFHA 1Q82W 3T1CA 2XOKG 4XDLA 3CC4V 1YTFB 1KC8W 1K33A 3ETEA 3F7VC 1DF5A 3LDEA 2Y48A 3AEIA 2OCCC 3SPHA 4HYOA 3AG1B 4DO2A 4G28B 5LBQA 2JDIG 2XASA 3PJSK 4JYBA 1XL6A 5LHGA 3E8HA 5H9CA 5CBHA 4WFAV 2CK3G 3SYOA 2HVKC 3ABMB 2QE7G 5KA5A 4G2KA 2DW4A 5CMUA 3ETDA 4QNHB 5B3SB 1OCCC 4BW5A 1NJIW 4JASA 2DYSC 4BAYA 1VQ6V 3ABUA 2Y69C 1WLEA 3K9AA 2DWDC 5HFLA 4JYCA 3SYCA 1JQ0A 3CCLV 3STZC 2PI4A 1J95A 5GW7A 1NH2B 2X0LA 3AG2B 3E8GA 4X88A 1OCZB 2B1GA 3K79A 2IU0A 4CZZA 2H94A 3AG4C 2X6BA 3H01A 3VBBA 3B8MA 5B1AC 2OT5A 1FS0G 4KFMA 4XDJA 4H33A 3FYEB 3B8NA 2EIJB 2C2AA 4ZKIA 4OXSA 2EIMB 4LP8A 2QTOA 1JOYA 1NQTA 4UUJC 2DQ3A 3ASNC 1F51A 3ZN1A 1BHAA 1YHQV 4MVOA 1JJ2U 4I9WA 5IYCO 2IJJA 2JJ1G 1M56C 2Q6AA 1M57C 5EBLC 4KUMA 1FXKA 2IH3C 3JYCA 3K08A 4WFEA 1K4CC 1NVPB 4H37A 3X2QC 1SESA 4MVZA 4WFFA 1V55B 3STLC 5B1BC 4PA3A 4MT8A 1DTOA 4R6ZA 1K4DC 1OCOC 2V1DA 2YSUB 2XAQA 5EBWC 1BHBA 1BL8A 2D3OW 2XAHA 4GX2A 3LDDA 3ABKC 3OEEG 5HFMA 4JAUA 1V54B 3I55V 2ZR3A 3K3WA 1VQNV 4WFGA 5L3EA 4UXNA 1IXMA 1RM1B 1AJNA 4MVRA 1GK9A 1P7BA 1F4NA 3ZMTA 5CBGA 4QPKA 2WLIA 4EKWA 4X89A 1R6NA 1FXKB 1AJPA 2H8PC 2EILC 1GMGA 3T4DA 1VQLV 1TUEB 1E79G 3K0DA 3ZIAG 1VQOV 4JTAB 3SJQC 1ROPA 1THZA 2EIKB 3OM3B 1M9NA 2ZD9A 3FB6C 3QO7A 4JTCB 4PDRA 1YIJV 1G4YB 3D3IA 4N21A 4Z1MG 1EFRG 1PKXA 5EC1C 2M7WA 4TT3G 1Y4MA 2JEUA 4FPPA 1VQMV 4JTDB 3HB3B 3B77A 1MOFA 4WFBV 2Z3YA 1K5QA 3IFXA 5IY5C 4R8CA 5CBFA 3QO5A 1E1RG 1L1FA 3W7TA 3RVYA 2WLIB 3LUTB 5B3SC 5EBMC 1QLNA 3ML0A 1FFTB 1G8MA 2GSMB 3ZMZA 2JIZG 4I5SA 2DQ0A 4YXWG 4BIUA 1R3LC 4JGSA 3OUSA 4MTXA 4JF3A 5CA3A 3VOUA 4G27B 2LFSA 3ZMUA 4CBCA 2WPDG 1ORQC 3E2EA 1VQPV 1NKDA 3FB8C 1ENVA 3SPJA 4UV9A 2LP7A 1GTOA 4WCEV 4LBEC 4RO2A 4UV8A 1W0KG 2LFRA 4GX5A 2A79B 2XAGA 2Z5UA 3NXSA 3F7YC 4QJFB 2HFEC 1NBMG 4JPRA 2WLKA 3CYOA 2EIMC 3R65A 4GCZA 4XDKA 4RQEA 1GM7A 4JAVA 1COWG 3CC2V 5LHIA 2B5UA 3ZJZA 3ZRVA 3UKMA 2WLLA 1R3KC 2EZPA 4GX1A 5DN6G 1QVGU 1QBZA 3CMAV 1YITV 3OEHG 3BEHA 2QA4V 4DXWA 2HR3A 2AHYA 3K06A 2ZXWB 1JVMA 2B1IA 2DYRC 1F4MA 4R7CA 2EBOA 1Q86W 1OCRB 3E8BA 3OMNB 4L87A 4E2LA 5J9PC 1KP2A 1VQ8V 4N23A 3D36A 1MG1A 1PNMA 3ABLB 4BIZA 3CCRV 2OCCB 3BY6A 1KECA 2QEXV 5DM6V 4WF9V 4LCUC 5B1NA 4MTOA 1S72V 3DGEA 3OR6C 2AHZA 3WG7C 2ZQMA 3CMEV 1YTFD 1V54C 1K7DA 2K1EA 3ZRXA 2EJRA 1VQ9V 2WLLB 1S0VA 2DYSB 3OMAB 1RM1C 1EBOA 3JD0A 2IJHA 3JCZA 3RBZA 4FIPC 3CC7V 1SETA 1RPOA 3KG2A 3ETGA 3A0RA 3ZN0A 2HVJC 1NR7A 3SYQA 5L3CA 1N8RW 1S77D 4U7OA 3ASOB 1FXKC 4RQFA 3CD6V 4P9OA 5KUKA 2YEVA 5H6QA 4R50A 1GO3F 4UVAA 2ITCC 5L3GA 2EIKC 1PL0A 4XBFA 3WFVA 2R9RB 3P32A 1NH2D 1B6QA 2A9HA 4QPJA 2X6AA 1VQ4V 1QLEB 2ZDIC 4QE9A 3CXCU 3ASNB 3E89A 5L3FA 1YJNV 4RAIA 2DWEC 4Q20A 4U7NA 1UJWB 3OW2U 4MTFA 3OFNG 2R9IA 2XNDG 2W0FC 1E1QG 3ZRWA 2UXNA 3LNMB 3OMIB 4FMTA 4J9ZB 3M99B 4PA9A 5IYBO 1M56B 1WPXA 1SZTA 2IJKA 1M57B 5EC2C 1K34A 2ITDC 5FL7G 2ATKC 2WLNA 4MVSA 2P90A 4J9YB 1XL4A 2YEVB 2JEXA 3ABTA 2OTJV 5IDJA 2OTLV 2P6JA 2P67A 1K5SA 2NLJC 1AI4A 1R73A 4MVMA 3CCQV 3AG1C 1KKDA 1FXHA 3IC7A 1FXVA 1OCOB 2HG5C 2EINB 1K9MW 3GWOA 1S76D 1KD1W 1NVPD 1AI5A 3ABKB 3DTUB 3ABMC 3E83A 3OR7C 3JD3A 2F43G 4UVCA 1M90W 1SRYA 3ZRWB 4FJCC 1CEZA 1KQSU 3LSSA 2KB1A 4MS2A 4PA7A 1JX9A 3OAAG 1GM8A 3T4ZA 3ZMVA 5H6RA 3JD1A 1AI6A 4GT1A 4MTGA 4PDVA 3AG2C 1BMFG 2QM7A 3W7XA 2EILB 3SYAA 1H8EG 1H38A 4LC1A 1OCZC 1CPYA 3QO8A 4MVUA 2JK5C 5EK0A 1P4RA 1Y66A 3P30A 4PDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBM A;  5J9P C;  4R6Z A;  3LDC A;  5BZB A;  1K4D C;  1OCR C;  1OCO C;  5EBW C;  2EIJ C;  3RVZ A;  3SPC A;  1BL8 A;  2QKS A;  3SPI A;  4GX2 A;  3LDD A;  4HZ3 A;  3AG3 C;  1S5H C;  3ABK C;  4LCU C;  5KUM A;  3OGC C;  4MTO A;  3HPL C;  3ABL C;  3SPG A;  3OR6 C;  2BOB C;  2AHZ A;  4WFG A;  3WG7 C;  1V54 C;  2K1E A;  4MVR A;  1P7B A;  3SYP A;  4MSW C;  3ZRS A;  2WLL B;  5CBG A;  4PA4 A;  3RBZ A;  4F4L A;  4P30 A;  4GX0 A;  2WLI A;  4EKW A;  4X89 A;  4PA6 A;  4RUE A;  3KG2 A;  2BOC C;  2HVJ C;  2EIL C;  2H8P C;  3FB7 C;  3SYQ A;  3T4D A;  3UM7 A;  2ZXW C;  3K0D A;  4JTA B;  3SJQ C;  4P9P A;  3EFF K;  4WFH A;  3T1C A;  1V55 C;  4X8A A;  4P9O A;  4XDL A;  5KUK A;  2YEV A;  3IGA C;  2ZD9 A;  3FB6 C;  4JTC B;  3ASO C;  4PDR A;  4R50 A;  1G4Y B;  3F7V C;  2ITC C;  3LDE A;  2EIK C;  2OCC C;  2Q69 A;  2R9R B;  5EC1 C;  4HYO A;  3SPH A;  2WLJ A;  4G28 B;  4MVQ A;  3PJS K;  2A9H A;  1XL6 A;  3K03 A;  2Q67 A;  3E8H A;  5CBH A;  2X6A A;  4JTD B;  5E1A C;  2P7T C;  1R3I C;  3SYO A;  2HVK C;  3RW0 A;  4QE9 A;  4TWK A;  3E89 A;  2A0L A;  4RAI A;  4QNH B;  3IFX A;  1OCC C;  2DWE C;  4P2Z A;  4BW5 A;  4R8C A;  1QLE C;  4MTF A;  2DYS C;  5CBF A;  5IY5 C;  3TET A;  3K0G A;  2W0F C;  2HJF C;  3LNM B;  3RVY A;  2WLI B;  2WLH A;  3LUT B;  2Y69 C;  3OUF A;  4J9Z B;  4PA9 A;  3T2M A;  5B3S C;  3E8F A;  5EBM C;  2DWD C;  3SYC A;  3STZ C;  2ITD C;  1R3L C;  3E86 A;  1J95 A;  3OUS A;  2ATK C;  2WLN A;  4MVS A;  4J9Y B;  3VOU A;  3E8G A;  4G27 B;  1XL4 A;  4X88 A;  4MW3 A;  4CBC A;  3AG4 C;  1ORQ C;  2IH1 C;  4MW8 A;  2NLJ C;  2X6B A;  3FB8 C;  4MVM A;  3SPJ A;  3AG1 C;  5B1A C;  1KKD A;  4KFM A;  4XDJ A;  4H33 A;  4LBE C;  2HG5 C;  4RO2 A;  4OXS A;  4GX5 A;  4LP8 A;  2QTO A;  2A79 B;  2WLM A;  4QE7 A;  3ABM C;  4UUJ C;  3ASN C;  3E83 A;  2EIN C;  3F7Y C;  2HFE C;  3OR7 C;  2WLK A;  4PDL A;  2EIM C;  3K04 A;  3R65 A;  4XDK A;  3FB5 C;  4MVO A;  4RUF A;  4I9W A;  1R3J C;  3ZJZ A;  2KB1 A;  4MS2 A;  4PA7 A;  3UKM A;  1M56 C;  2WLL A;  1R3K C;  3T4Z A;  2Q6A A;  2X6C A;  4GX1 A;  1M57 C;  5EBL C;  3GB7 C;  4MTG A;  3BEH A;  4DXW A;  4PDV A;  3AG2 C;  3JYC A;  2IH3 C;  3K08 A;  4WFE A;  3SYA A;  1K4C C;  1LNQ A;  2AHY A;  3F5W C;  3K06 A;  1OCZ C;  1JVM A;  4H37 A;  3X2Q C;  2DYR C;  4MVU A;  2JK5 C;  4MVZ A;  4R7C A;  4WFF A;  2Q68 A;  3E8B A;  5EK0 A;  3TCU A;  3STL C;  5EC2 C;  5B1B C;  1ZWI C;  4PA3 A;  4PDM A; 
#chains in the Genus database with same CATH topology
 3AG3 B;  4UFZ A;  2UXX A;  1PNK A;  3LDC A;  1KP3 A;  1XOU A;  1NTK H;  2FML A;  4HZ3 A;  1S5H C;  2KQX A;  1AP5 A;  4X64 O;  2IW5 A;  1R6K A;  3ABL C;  4NXM B;  4X66 O;  4NTW A;  1EZJ A;  2YXY A;  3CPW U;  4F4L A;  4X65 B;  1M5I A;  4JI8 B;  3C3S A;  4B3M B;  2LW7 A;  1X59 A;  4I0X B;  1VQK V;  3OE7 G;  4DV1 B;  3IGA C;  2XAJ A;  3I5D A;  1GKF A;  1YSC A;  3W7U A;  4MVQ A;  4K8Z A;  4D7S A;  1N33 O;  1NTZ H;  1H2G A;  1ZAU A;  4TWK A;  3RW0 A;  2IU3 A;  1XBL A;  2A0L A;  2EZO A;  4KL1 A;  1MSW D;  1K97 A;  1MZE A;  2WLH A;  3B40 A;  3ZCC A;  3CB2 A;  4JI6 B;  2QWR B;  4JI7 O;  3CCU V;  1M4U A;  3AG7 A;  1J5E B;  4MW3 A;  5B1A B;  1AI7 A;  2IH1 C;  1BSM A;  5IYZ A;  3JAL B;  1MSD A;  2Q7G A;  2HKO A;  4X1K B;  4D6T H;  4YHH B;  2PF4 E;  1HR0 O;  1FJG B;  3FB5 C;  1XNQ O;  2ZDI A;  4RUF A;  3CEI A;  1NR1 A;  2X6C A;  4U3F H;  2ILM A;  3X2Q B;  1AR1 B;  1VQ5 V;  2DOS A;  5B1B B;  5ITZ B;  1XUQ A;  4DUZ O;  2Q68 A;  3MHS C;  3TCU A;  1N36 O;  3QG5 A;  4FFB A;  1JFF B;  3CWB H;  1GN2 A;  2RMK B;  3G67 A;  4HAM A;  3O9O A;  5CA1 A;  5K1P A;  3J80 N;  2ODM A;  1RSO B;  2BOB C;  1WA8 B;  2V7Q G;  2DMX A;  2ZM6 O;  3MD0 A;  4MSW C;  2BCC H;  4FK5 C;  1XMO B;  1Q7Y W;  2WAM A;  2WWW A;  3OTF A;  4DR2 B;  3BRC A;  3EFF K;  4WFH A;  5JH7 A;  5C8Y A;  4XDL A;  2B9Z A;  2HJD A;  1YTF B;  2LW1 A;  1KC8 W;  1K33 A;  3ETE A;  3F7V C;  3KCY A;  3AEI A;  2OCC C;  3APQ A;  5BR8 B;  3CHX A;  2JDI G;  2XAS A;  3PJS K;  1N4C A;  2JVD A;  3E8H A;  5LHG A;  2KG7 A;  2HVK C;  5J2T A;  2DW4 A;  5B3S B;  4JAS A;  3K9A A;  2PI4 A;  5EYP A;  3HKD B;  5GW7 A;  4KHP O;  3K5O A;  3JAK A;  1V9P A;  4J41 A;  1OCZ B;  5CB4 A;  3RWR D;  1SQP H;  2CUG A;  3H01 A;  3B8M A;  2OT5 A;  1FS0 G;  5KX5 B;  2EIJ B;  4H13 B;  2C2A A;  4LP8 A;  1NQT A;  3ASN C;  2GBO A;  2VQE O;  1IUR A;  1SKV A;  4I9W A;  2JJ1 G;  1M56 C;  3T1Y B;  4AQY O;  1HNZ O;  4X20 B;  2YIB A;  3RYH B;  4UCS A;  4LFA O;  3OTO O;  4MVZ A;  2Q0O C;  2F95 B;  4NVP A;  4PJ0 Z;  3RYI A;  1DTO A;  1SS3 A;  1BL8 A;  3JSN A;  2XAH A;  3OEE G;  3H1K H;  4LF7 O;  1PV0 A;  2HEP A;  1GAX A;  1RM1 B;  1AJN A;  4MVR A;  1EM1 A;  1P7B A;  1F4N A;  3ICX A;  2YID A;  4QPK A;  5IE9 A;  1OJH A;  1FXK B;  4O4H B;  2H8P C;  2CTR A;  1GMG A;  1XMQ O;  1TUE B;  4U3J A;  3K0D A;  3SJQ C;  3HKB B;  1THZ A;  2ZNI A;  3OM3 B;  1G4Y B;  3D3I A;  4BIO A;  5FNV A;  1PKX A;  2JEU A;  1FFX A;  1IX9 A;  1L0L H;  1AR5 A;  3HR0 A;  3JAT B;  5GON A;  3C90 A;  1VQM V;  1IBL O;  2P22 C;  3WB1 A;  1Y6X A;  4R8C A;  3CS5 A;  3QO5 A;  5CBF A;  5LOV A;  1XEQ A;  1VAR A;  5JQG B;  4BIU A;  4YXW G;  1XNR B;  4BW9 A;  2QTS A;  4G27 B;  4TQD A;  2LFS A;  3HKC B;  2WPD G;  1ORQ C;  3RT3 C;  1VQP V;  3SPJ A;  4WCE V;  4IIJ A;  2QWN B;  4UV8 A;  4O4J B;  4GX5 A;  4AHC A;  4F6E A;  2Z5U A;  4JPR A;  2WLK A;  1I0H A;  3R65 A;  3ZHT A;  1COW G;  3CC2 V;  1BZK A;  4YY3 B;  1TUB B;  2WLL A;  4JI0 O;  2EZP A;  4GX1 A;  1QBZ A;  1R6T A;  2DN9 A;  2QA4 V;  4J7J A;  1N0J A;  1B04 A;  4X1I B;  2YXL A;  3CRC A;  2P06 A;  1XHX A;  2YC0 A;  2VS0 A;  3OMN B;  4L87 A;  4N23 A;  1PNM A;  3ABL B;  1ZTE A;  4BIZ A;  1KEC A;  2QEX V;  4DRX A;  2BSK A;  1LUV A;  3T1H O;  1K7D A;  2K1E A;  1WJZ A;  3N2K B;  1VQ9 V;  2DYS B;  1SQG A;  1ZL8 B;  3JD0 A;  2IJH A;  1S5L Z;  3JCU Z;  4FIP C;  1BE3 H;  1RPO A;  3ZN0 A;  4DV3 O;  2HVJ C;  1NR7 A;  1QHT A;  1XQ8 A;  1VF7 A;  5LXT A;  4J10 A;  1FD9 A;  4RQF A;  3ZHV A;  2G38 A;  5JVD A;  2EIK C;  3WFV A;  4EFB A;  3JAM N;  4JI2 B;  1Q5O A;  4DV2 B;  4QPJ A;  2QJ1 A;  1VQ4 V;  2Q73 A;  1H2K A;  2F1M A;  4JI5 O;  1JJO A;  4U7N A;  3TGU H;  3OW2 U;  4NTX A;  2Q5Z A;  5IYB O;  3M99 B;  1XIL A;  1WPX A;  4DUY O;  1SZT A;  3K59 A;  2UUC B;  1M57 B;  4IHJ A;  2HHH O;  2WLN A;  3SJA C;  5GTH Z;  1XL4 A;  2YEV B;  4H44 B;  5IDJ A;  3BA8 A;  3UT5 B;  2F4V O;  4DV7 O;  2OTL V;  1AI4 A;  3M8A A;  2E75 B;  1KKD A;  3IC7 A;  1FXV A;  2MW2 B;  4NYK A;  5KMG B;  3U0Z A;  2HG5 C;  1K9M W;  4LF4 B;  3EVK A;  3GWO A;  1S76 D;  3ABK B;  4QGP A;  3ZS8 C;  2VQF O;  4FZ0 A;  1SQV H;  4Q6G A;  1DGS A;  4B3S B;  1SRY A;  3WB0 A;  4MS2 A;  1GM8 A;  4JI4 B;  4GT1 A;  3BA9 A;  2QM7 A;  1OCZ C;  1CPY A;  4I0X A;  3QO8 A;  4ICG A;  2Y0P A;  2JK5 C;  2Q9L A;  5EC2 C;  3P30 A;  2XAF A;  5BZB A;  4DR5 B;  2GHY A;  2EIJ C;  3OGC C;  4O2A B;  2Q7E A;  3K5L A;  4DV0 B;  3SYP A;  4QIW F;  4JI3 B;  3ZRS A;  2UUB O;  3UM7 A;  3G71 V;  3QNE A;  3LSQ A;  4UCT A;  3ASO C;  1AJQ A;  3TK1 A;  4CS2 A;  2WLJ A;  3EHB B;  1LUW A;  3G6B A;  3JAL A;  4K35 A;  4X1K A;  1QR8 A;  3OD4 A;  2JJ2 G;  3IAY A;  4UCU A;  3M7M X;  3CCV V;  4LF9 B;  1HNX B;  3RGB A;  3HKE B;  1N34 B;  2CH7 B;  2BTQ B;  1IZ3 A;  4DV6 B;  1O9G A;  4LFC B;  3K9S A;  3GVM A;  3B2E E;  3E35 A;  2W6J G;  1F7Y A;  2EJ7 A;  3BHP A;  3JD4 A;  1W2B U;  3TJT A;  4CH3 A;  1WP8 A;  1W0J G;  4MW8 A;  5IT9 N;  3D3Q A;  4LNU B;  1JFF A;  3RYF B;  1KU9 A;  1Y76 B;  5B1O A;  3GWK C;  3W7W A;  2E3C A;  3LSU A;  3CCJ V;  3CCM V;  5LYJ B;  5LGT A;  1RSO A;  1WP7 A;  5B5E Z;  1Q3E A;  1MAB G;  1IBM O;  2FTK A;  1F23 A;  1BCC H;  3B4S A;  5LHH A;  2LQT A;  5LMN O;  4GLX A;  2RQ6 A;  1X4T A;  4EEQ A;  1YJ9 V;  2IJI A;  5EZY B;  1JCH A;  4ASU G;  3BAA A;  2NR5 A;  5LGN A;  4ZBM A;  4NXN B;  3SDL A;  4EB6 B;  1SQQ H;  3RVZ A;  5A9G A;  5L3B A;  3SPC A;  2XHB A;  4O4I B;  4LFB B;  3WB2 A;  5KUM A;  2IBZ H;  3HPL C;  4JI1 B;  1K73 W;  1VQ7 V;  3DC5 A;  2UUA B;  4LF5 B;  1Q6I A;  4CS4 A;  2CTW A;  1PD3 A;  4J7Z A;  3G6E V;  4OX9 B;  5IWA B;  4PA6 A;  1HNW B;  4RUE A;  1RPR A;  2BOC C;  3ZHU A;  3FB7 C;  1S3J A;  2JS5 A;  1D5A A;  3HKD A;  1WNS A;  2PI5 A;  3CCE V;  3T1C A;  2XOK G;  2P5O A;  1ZLZ A;  4DR1 O;  4GZR B;  3TXS A;  2OYQ A;  5LMU O;  3UO2 A;  4B7E A;  3SPH A;  5LBQ A;  2V4D A;  5KX5 A;  2QSA A;  3H1L H;  3CX5 F;  2OWO A;  1Z5V A;  3ETQ A;  2CK3 G;  3SYO A;  4NB5 A;  4WBN B;  3P3N A;  2CTP A;  2EX3 A;  3A8T A;  1OCC C;  1FPO A;  2DYS C;  5DED A;  4DR7 B;  4DR4 B;  3CJH B;  1JA8 A;  2QKA A;  5HFL A;  2QKC A;  1O9H A;  3OGI B;  4X20 A;  1NZ6 A;  2B1G A;  4X1Y B;  3RYH A;  5BY1 A;  2H94 A;  3AG4 C;  3D36 C;  1YCI A;  1CXZ B;  4XDJ A;  3G80 A;  1J5E O;  3B8N A;  4X64 B;  5IJ0 B;  4ZKI A;  4OXS A;  1JOY A;  2DQ3 A;  2UXB O;  4F6R B;  1BHA A;  4CC5 A;  5IYC O;  2ARH A;  1UFI A;  4IGG A;  1FJG O;  1GH6 A;  1M57 C;  2DJV A;  1MMM A;  1FXK A;  1L8D A;  4WFE A;  1SES A;  1BS3 A;  2AW9 A;  3HKB A;  4YJ2 B;  4WFF A;  2Q8V A;  2L35 A;  5FLX N;  4MT8 A;  2VWK A;  2V1D A;  5EBW C;  2XAQ A;  2YSU B;  3DXR B;  5KLV H;  3LDD A;  3ABK C;  1N33 B;  4JAU A;  3S3W A;  1AR4 A;  3JAT A;  3K3W A;  4TQF A;  4WFG A;  4UCR A;  5L3E A;  1PL4 A;  1IXM A;  4DR3 O;  4B3R O;  1URF A;  2GDS A;  1BQ0 A;  4W4K A;  4CH6 A;  4JI7 B;  1R6N A;  1VQL V;  5JQG A;  1E79 G;  2ZE7 A;  2FKX A;  4TV8 B;  3ZBH A;  2EIK B;  4B08 A;  3TXQ A;  1GN6 A;  1M9N A;  3FB6 C;  3HKC A;  2YS8 A;  4JTC B;  4PHZ A;  1KMI Z;  4CH4 A;  4I50 B;  5TIS Z;  4X62 O;  4TT3 G;  1IDS A;  1HR0 B;  3BFR A;  4DV4 B;  4O4J A;  3B77 A;  3CRR A;  1XNQ B;  3E22 B;  2Z3Y A;  4JV5 O;  3RFR A;  1E1R G;  2PUS A;  1N32 O;  2WLI B;  4TUY B;  4TV9 B;  1QLN A;  1G8M A;  2JIZ G;  4JGS A;  4MTX A;  4O2B B;  4X1I A;  4DUZ B;  4YJ3 B;  2UXC O;  3ZMU A;  2D2C B;  1ENV A;  2EUL A;  4ZHQ B;  2CAZ C;  4ZOL B;  4RO2 A;  1W0K G;  1M93 A;  3L70 H;  4RQE A;  4JAV A;  2B5U A;  3N2K A;  3ZJZ A;  3UKM A;  4FFK A;  1ZL8 A;  1PM9 A;  5DN6 G;  4DXW A;  2HR3 A;  2AHY A;  1JVM A;  2B1I A;  1Q86 W;  1JR9 A;  2JGD B;  2K9P A;  1W59 A;  5J9P C;  1KP2 A;  2YXH A;  3D36 A;  4GUN A;  2FL4 A;  4J80 A;  4LCU C;  3J81 N;  3L75 H;  3DGE A;  2OIG A;  4B3T O;  3RN4 A;  4DV5 O;  1V54 C;  2EJR A;  2FYU H;  1EBO A;  3JCZ A;  2YIC A;  1YEW A;  1SET A;  4LF8 O;  5L3C A;  1N8R W;  4JYA B;  4KHP B;  1SQF A;  5JJE B;  2H3O A;  5D5P A;  3ASO B;  1P7G A;  2YEV A;  4HBN A;  4FLX A;  2YI9 A;  2ITC C;  1PL0 A;  3OT7 A;  3JAW B;  3J7A U;  1NH2 D;  1LR1 A;  5D5Q A;  5KMG A;  5BMV B;  4LWS B;  2VQE B;  4GKJ B;  5L3F A;  4RAI A;  2RNB A;  1UJW B;  2W0F C;  2UXN A;  3LNM B;  2QGN A;  4AQY B;  1HNZ B;  5FL7 G;  4LFA B;  1WN7 A;  4J9Y B;  3OTO B;  3L74 H;  4AI8 A;  2BE3 A;  2P67 A;  4FLT A;  2NLJ C;  3CCQ V;  4MVM A;  5LP6 C;  1FXH A;  1OCO B;  3CRM A;  1KD1 W;  1NVP D;  4LF7 B;  1AI5 A;  3DTU B;  1ZSP A;  4NR1 A;  4O2A A;  3JD3 A;  2F43 G;  4I4T B;  5KAF Z;  1M90 W;  1TA8 A;  3ZRW B;  4FJC C;  2AGA A;  3LSS A;  1I7F A;  2BTO A;  1JX9 A;  3OAA G;  3ZMV A;  5KHJ A;  1XMQ B;  2O57 A;  2EIL B;  1H8E G;  2Q7H A;  1YVW A;  4PV1 B;  1Q8I A;  1P4R A;  4PDM A;  4FLY A;  2HLD G;  2QKS A;  2YIB D;  1QR9 A;  5IYD O;  1AVM A;  2NNU A;  1VEW A;  1I5X A;  1EN6 A;  1A32 A;  1QVF U;  3L73 H;  1RFY A;  4LH7 A;  5FPO A;  5IY5 B;  1ZUQ A;  4I7Z B;  5GTI Z;  4P30 A;  4GX0 A;  2CH7 A;  2BTQ A;  1I94 O;  1HW7 A;  3A2F A;  3U11 A;  3JAS B;  4FM2 A;  4DYL A;  3RYC B;  3JD2 A;  2Q69 A;  2WSS G;  2KKW A;  2N05 A;  1YJW V;  4LNU A;  3RYF A;  2CE4 A;  1SER A;  1Y76 A;  1Z5W A;  1HWY A;  2Q67 A;  2LGW A;  1YF2 A;  1OCC B;  1R3I C;  2JS3 A;  5LYJ A;  5EIB C;  3CSX A;  4P2Z A;  5K1X A;  4UVB A;  1G6U A;  2E5L O;  3K0G A;  3FAV B;  4PI0 A;  2MK3 A;  1KBH A;  3E8F A;  4GKK O;  3E86 A;  1G1X B;  3AG4 B;  2RJZ A;  5EZY A;  1GM9 A;  2DYR B;  1U97 A;  1IVS A;  2YUA A;  4FLW A;  1OHH G;  3KZI Z;  4OGQ B;  4EB6 A;  3SGI A;  5H5N A;  2E76 B;  1FYJ A;  4O4I A;  4QE7 A;  5IJ9 B;  5JWP A;  4FLU A;  3T1H B;  3K04 A;  4LF4 O;  2ETN A;  1H8H G;  3AK3 A;  2QM8 A;  1VP7 A;  3LNN A;  3ZHS A;  5L3D A;  3CCS V;  4DV3 B;  3I56 V;  1WAZ A;  5J2U B;  2P4V A;  3B09 A;  1AB3 A;  5JCO C;  3K58 A;  4I9Q A;  4TSF G;  4FLV A;  1K92 A;  1VF6 C;  4CC6 A;  4IYH A;  3SPG A;  4PEL A;  1OZ0 A;  1Q6U A;  4JI5 B;  4WBN A;  1IBK O;  4PA4 A;  2GUZ B;  4DUY B;  1PNL A;  2CGN A;  3CJH A;  3VQW A;  2HHH B;  5AG2 A;  4JI3 O;  1K8A W;  1VMG A;  4P9P A;  1Q82 W;  2F4V B;  3EXA A;  1H2L A;  4DR6 O;  4X1Y A;  1DF5 A;  3LDE A;  2WA3 A;  2Y48 A;  3NR7 A;  4HNA B;  4HYO A;  1MNG A;  5H9C A;  2VQF B;  1SF9 A;  4G2K A;  3ZX6 A;  2ZE8 A;  4YIP A;  4F6R A;  2UU9 B;  3A0H Z;  3CRA A;  3ABU A;  2Y69 C;  1WLE A;  3K5N A;  3CCL V;  2QWQ B;  1J95 A;  3E8G A;  4X88 A;  3K79 A;  4CZZ A;  4YJ2 A;  2X6B A;  4LFC O;  3VBB A;  3CE2 A;  1B06 A;  1R1B A;  4KFM A;  3FYE B;  2AZ2 A;  2Y4T A;  3DXR A;  3ZN1 A;  4MVO A;  4JAA A;  1MZF A;  2UUB B;  4K0K O;  1NU1 H;  1Y74 B;  2GTS A;  1BGY H;  5ITZ A;  1H2M A;  2L6L A;  5A2Q N;  2IH3 C;  5E79 Z;  2PYL A;  3AK1 A;  1K4C C;  2F66 C;  4DK0 A;  1BT8 A;  4H37 A;  4ABM A;  1HDJ A;  4TV8 A;  1V55 B;  2RDC A;  2YDE A;  3MDS A;  3PN1 A;  1K4D C;  2UXD O;  1OCO C;  5LA6 B;  1BHB A;  4I50 A;  2FB5 A;  1WA8 A;  1V54 B;  3I55 V;  1VQN V;  3ZED A;  3WU2 Z;  3IJ4 A;  3E22 A;  1GK9 A;  4OPH A;  4LF6 O;  2BSK B;  2UUA O;  2WLI A;  4TUY A;  1N0N A;  3DC6 A;  1AJP A;  4TV9 A;  2EIL C;  5CA0 B;  2Y4U A;  4OX9 O;  4BR6 A;  4JTA B;  1VQO V;  1ROP A;  3JAR B;  4O2B A;  2ZIN A;  3QO7 A;  4FM0 A;  4YJ3 A;  1WPB A;  3CXH F;  4J7K A;  3Q4H B;  1EFR G;  5EC1 C;  2M7W A;  1Y4M A;  1S5J A;  4CS3 A;  3BVO A;  4ZHQ A;  3BPZ A;  3THO A;  1KKC A;  2ZT9 B;  4FPP A;  4ZOL A;  4NKG B;  2HP8 A;  3ZHQ A;  1MOF A;  4NXM O;  1IBM B;  1K5Q A;  5IY5 C;  3W7T A;  5LMN B;  3RVY A;  1IXB A;  1TAE A;  4X65 O;  2A7W A;  1FFT B;  2GV9 A;  4I5S A;  5KHK A;  4JI8 O;  3AK2 A;  1R3L C;  4JF3 A;  5CA3 A;  4B3M O;  3VOU A;  3P3P A;  3UCS C;  1H2N A;  4CBC A;  5LP6 B;  4DV1 O;  1XDC A;  1PP9 H;  1NKD A;  3FB8 C;  1UPG A;  4UV9 A;  2LP7 A;  4ZI7 B;  2A79 B;  2XAG A;  4KXR A;  3NXS A;  3F7Y C;  4QJF B;  2HFE C;  2EIM C;  4GCZ A;  4XDK A;  1GM7 A;  4UB8 Z;  4YIO A;  5LHI A;  1GN3 A;  1Q90 D;  1R3K C;  5JJN B;  3BEH A;  4JI6 O;  4J11 A;  3K06 A;  2ZXW B;  5FPR A;  2DYR C;  2RN9 A;  1F4M A;  4DR1 B;  4R7C A;  4H0L B;  2NN4 A;  4L8J A;  5LMU B;  3JAW A;  4X66 B;  4WF9 V;  4K8X A;  4YHH O;  5LL6 Y;  5BMV A;  2AHZ A;  4LWS A;  3CME V;  1YTF D;  3ZRX A;  4FZ1 A;  3H1H H;  1S0V A;  4O4H A;  3ETG A;  3A0R A;  2IM9 A;  1SQB H;  3CD6 V;  2XUM A;  1KYO F;  5H6Q A;  4R50 A;  4UVA A;  4XBF A;  3C3T A;  2A9H A;  2PYJ A;  2R72 A;  2X6A A;  2UXB B;  3CXC U;  2ZIM A;  4LR3 A;  3E89 A;  1YJN V;  4I4T A;  4Q20 A;  1WB8 A;  2XND G;  4DV4 O;  3ZRW A;  4FMT A;  4PA9 A;  4B7K A;  4Z2W A;  5F2V O;  4ZIB A;  2A3Q A;  1XMO O;  2ITD C;  3N2G B;  4MVS A;  2P90 A;  4DR2 O;  4FVM A;  3ABT A;  2OTJ V;  3IC9 A;  5KHG A;  3SJC C;  1K5S A;  1R73 A;  3FD9 A;  3F5T A;  3QVN A;  4JZG A;  5BR8 O;  1GRJ A;  4I55 B;  4RWU A;  3E83 A;  3OR7 C;  4DR3 B;  1TUB A;  1CEZ A;  4B3R B;  2KB1 A;  3MAQ A;  5H6R A;  3JD1 A;  1N36 B;  4O4L B;  1BMF G;  3W7X A;  3SYA A;  4LC1 A;  3S3X A;  4GYC B;  4MVU A;  4PD4 F;  1RP3 B;  1ARO P;  3JAS A;  2ZR2 A;  4EFE A;  1OCR C;  4X62 B;  3RYC A;  3SPI A;  1Q6H A;  2ZM6 B;  1YXB A;  2M6Y A;  3MHH C;  1JPX A;  1HP8 A;  1NS1 A;  3QTC A;  4JV5 B;  1N32 B;  1YI2 V;  3FAV A;  4W4L A;  2ZKO A;  4DW0 A;  2P4K A;  5DEC A;  2N04 A;  3T1Y O;  5C93 A;  1K3E A;  4DW1 A;  1TVK B;  1SA0 B;  3BCC H;  2UXC B;  1V55 C;  2Z0A A;  4X8A A;  5KA6 A;  4X9Q A;  4JYA O;  2VWJ A;  4LH6 A;  3H1J H;  3KKY A;  1U96 A;  3FYI B;  3K03 A;  3JSL A;  5E1A C;  2PTM A;  2P7T C;  4Z1V A;  5IJ9 A;  2XTA A;  2LO1 A;  1YZB A;  1KB9 F;  1DLB A;  2Y69 B;  3SR2 C;  1QLE C;  2HJF C;  4TOI A;  3TET A;  3OUF A;  3T2M A;  2N74 A;  4GKJ O;  1DF4 A;  1QNM A;  3UT5 A;  2ZE6 A;  1MA1 A;  5J2U A;  1I5Y A;  3R66 A;  5H2F Z;  1QCE A;  1GN4 A;  2F93 B;  4KP4 A;  4JYY A;  2WLM A;  1CP9 A;  4B3T B;  2EIN C;  4DV5 B;  3ZMS A;  2ADP A;  4PDL A;  2RCV A;  3WG7 B;  1R3J C;  4LF8 B;  2F23 A;  2ZE5 A;  2GUZ A;  3GB7 C;  5JJJ B;  4NTY A;  3VQX A;  1XNR O;  1SQX H;  2PZS A;  1LNQ A;  3F5W C;  3W7S A;  3G4S V;  4C7U A;  2W6I G;  3FKS G;  5KHI A;  5LGU A;  1Q81 W;  2X7R B;  1P49 A;  2Q0A A;  5CN0 A;  3SJB C;  1ZWI C;  5IYZ B;  1XHZ A;  1JMK C;  1D2D A;  3DSQ A;  4HNA A;  3AG3 C;  3FX7 A;  1M1K W;  4FLZ A;  2KSD A;  2XT9 A;  1DK1 A;  1VF5 B;  2JRI A;  4BWA A;  2QR4 A;  2LJ2 A;  3L9D A;  4YY3 O;  2ZXW C;  3H1I H;  3CP1 A;  2PGG A;  3CC4 V;  4FFB B;  1P84 F;  3KCX A;  1IBL B;  3AG1 B;  2ZNJ A;  4DO2 A;  4G28 B;  5CA1 B;  5BXZ A;  2R9A A;  4JYB A;  1XL6 A;  2DE0 X;  3UO3 A;  5CBH A;  4WFA V;  5KA5 A;  2QM4 A;  3ABM B;  2QE7 G;  3HKE A;  3ETD A;  1QU7 A;  4QNH B;  4BW5 A;  1NJI W;  3UQ8 A;  4A5U B;  4BAY A;  1Z2G A;  2PY5 A;  1VQ6 V;  2CDY A;  2DWD C;  4JYC A;  3SYC A;  1JQ0 A;  1PPJ H;  3STZ C;  1Y74 A;  3APO A;  3VQV A;  1NH2 B;  2YI8 A;  2X0L A;  3AG2 B;  3U10 A;  5JH7 B;  3H9V A;  5C8Y B;  2QDO A;  2IU0 A;  4FM1 A;  5B1A C;  4H33 A;  3K5M A;  5LA6 A;  1ZX3 A;  2QWP B;  4JI2 O;  2OCH A;  1BQZ A;  2KG7 B;  2EIM B;  2AZ0 A;  2QTO A;  5KHH A;  5J2T B;  1EZV H;  4DV2 O;  4UUJ C;  1F51 A;  2Q4P A;  4JI0 B;  1YHQ V;  1JJ2 U;  2ADQ B;  2IJJ A;  2Q6A A;  2A06 H;  5EBL C;  1I94 B;  5EYP B;  4KUM A;  2UUC O;  2YIA A;  3JYC A;  3K08 A;  3JAK B;  1NVP B;  4AIL C;  5CA0 A;  4J42 A;  4OPA A;  3X2Q C;  5CB4 B;  1QQC A;  3JAR A;  1OV9 A;  3STL C;  5B1B C;  1WB7 A;  4PA3 A;  4R6Z A;  1US6 A;  3Q4H A;  2D3O W;  4GX2 A;  2JGU A;  5HFM A;  1EN5 A;  2ZR3 A;  4UXN A;  4B3S O;  2E5L B;  1YDX A;  3D8C A;  3ZMT A;  1TGO A;  5CBG A;  4GKK B;  4EKW A;  4X89 A;  1XRE A;  4UCV A;  1NTM H;  4JI4 O;  3T4D A;  2LGQ A;  3ZIA G;  1SZX A;  2VRZ A;  2ZIO A;  3CRQ A;  4DK1 A;  2ZD9 A;  3RYI B;  4PDR A;  4UB6 Z;  5LP6 A;  1YIJ V;  4N21 A;  1AP6 A;  4Z1M G;  4IL6 Z;  4DR5 O;  4ZI7 A;  4JTD B;  3HB3 B;  3BAB A;  4WFB V;  3VQY A;  4DV0 O;  3IFX A;  3FFQ A;  1L1F A;  3LUT B;  5B3S C;  5EBM C;  3ML0 A;  2GSM B;  3ZMZ A;  2DQ0 A;  4U3J B;  4DV7 B;  3OUS A;  2UU9 O;  1FAF A;  3N27 A;  2R70 A;  1Q43 A;  5FNV B;  4CH5 A;  1KUQ A;  3E2E A;  5IJ0 A;  1GTO A;  1FFX B;  2CTQ A;  4LBE C;  5GON B;  4PI2 A;  2LFR A;  2CGO A;  1NBM G;  3CYO A;  1B3Q A;  1XI1 A;  1L0N H;  4D7T A;  4JZ2 A;  5LOV B;  5B66 Z;  4LF9 O;  1HNX O;  1IBK B;  3ZRV A;  2AXT Z;  3A0B Z;  1N34 O;  4IYI A;  1QVG U;  3CMA V;  1YIT V;  3OEH G;  4DV6 O;  2QWO B;  4DR6 B;  2EBO A;  1OCR B;  3E8B A;  1NI8 A;  4E2L A;  1VQ8 V;  1MG1 A;  2GTA A;  4IIJ B;  3CCR V;  2OCC B;  3BY6 A;  5DM6 V;  5B1N A;  4MTO A;  1S72 V;  3OR6 C;  3WG7 C;  2ZQM A;  2OIE A;  2WLL B;  3OMA B;  1RM1 C;  3RBZ A;  4K3A A;  3CC7 V;  3KG2 A;  3SYQ A;  1S77 D;  3N2G A;  4U7O A;  1FXK C;  1H2S B;  1NT2 B;  4P9O A;  4UCO A;  5KUK A;  3K57 A;  1GO3 F;  5L3G A;  4NXN O;  2R9R B;  3O65 A;  3P32 A;  3L71 H;  1B6Q A;  4LFB O;  4DRX B;  4I55 A;  1D5N A;  4JI1 O;  1QLE B;  2ZDI C;  4QE9 A;  1SC5 B;  3ASN B;  4LF5 O;  1I08 A;  2DWE C;  4MTF A;  3OFN G;  2R9I A;  5KAI Z;  1E1Q G;  3OMI B;  4K0K B;  4E4E A;  4J9Z B;  1M56 B;  5IWA O;  2IJK A;  1HNW O;  1K34 A;  1AIL A;  5LXT B;  2ATK C;  1Y67 A;  4O4L A;  5JCO A;  2JEX A;  5JVD B;  2Y0I A;  2P6J A;  2UXD B;  3AG1 C;  1VF6 A;  2W0X A;  2EIN B;  3ABM C;  1FKA O;  2ZCE A;  3QF7 A;  4UVC A;  1T5E A;  4LF6 B;  1KQS U;  4PA7 A;  4DR7 O;  4DR4 O;  3T4Z A;  1AI6 A;  4IHJ B;  4MTG A;  3ZHR A;  2WA4 A;  4PDV A;  3AG2 C;  3L72 H;  1H38 A;  2E74 B;  1EN4 A;  2JGD A;  1TVK A;  1SA0 A;  5EIB D;  5EK0 A;  4IT5 A;  1VIB A;  1Y66 A;  5CMU A; 
#chains in the Genus database with same CATH homology
 2XAF A;  3AG3 B;  2UXX A;  1ARO P;  1PNK A;  3LDC A;  1KP3 A;  2ZR2 A;  5BZB A;  1OCR C;  2GHY A;  2EIJ C;  2HLD G;  2QKS A;  3SPI A;  4HZ3 A;  1S5H C;  1QR9 A;  2IW5 A;  1R6K A;  5IYD O;  3OGC C;  3ABL C;  3MHH C;  1JPX A;  2NNU A;  1I5X A;  1EZJ A;  1QVF U;  3SYP A;  4QIW F;  3ZRS A;  5IY5 B;  3CPW U;  1YI2 V;  4F4L A;  4P30 A;  4GX0 A;  5C93 A;  1K3E A;  3UM7 A;  3G71 V;  3QNE A;  3LSQ A;  1VQK V;  3OE7 G;  1V55 C;  4X8A A;  5KA6 A;  3IGA C;  2XAJ A;  3ASO C;  3JD2 A;  1AJQ A;  3TK1 A;  2Q69 A;  2WLJ A;  2WSS G;  3EHB B;  3FYI B;  1YJW V;  1GKF A;  1YSC A;  3W7U A;  4MVQ A;  1SER A;  3K03 A;  1HWY A;  2Q67 A;  5E1A C;  1QR8 A;  1OCC B;  2P7T C;  1R3I C;  1H2G A;  4TWK A;  3RW0 A;  2JJ2 G;  2IU3 A;  2A0L A;  3CCV V;  2EZO A;  1DLB A;  2Y69 B;  4P2Z A;  1QLE C;  4UVB A;  1MSW D;  3K0G A;  2MK3 A;  2HJF C;  1K97 A;  3TET A;  2WLH A;  3OUF A;  3T2M A;  3ZCC A;  3E8F A;  3CCU V;  1DF4 A;  3E86 A;  3AG4 B;  3E35 A;  2W6J G;  4MW3 A;  5B1A B;  1GM9 A;  2DYR B;  3JD4 A;  1W2B U;  1AI7 A;  2IH1 C;  1W0J G;  1I5Y A;  4MW8 A;  1OHH G;  1QCE A;  5B1O A;  2HKO A;  4KP4 A;  3W7W A;  4QE7 A;  2WLM A;  1CP9 A;  3CCJ V;  3CCM V;  2EIN C;  5LGT A;  3ZMS A;  4PDL A;  1MAB G;  3K04 A;  3WG7 B;  2FTK A;  3FB5 C;  2ZDI A;  4RUF A;  1H8H G;  1F23 A;  1R3J C;  2QM8 A;  1NR1 A;  5LHH A;  2X6C A;  5L3D A;  3CCS V;  3GB7 C;  3I56 V;  3X2Q B;  1AR1 B;  1VQ5 V;  1LNQ A;  3F5W C;  3W7S A;  2IJI A;  3G4S V;  1YJ9 V;  5B1B B;  2W6I G;  1JCH A;  3FKS G;  5LGU A;  1Q81 W;  2X7R B;  2Q68 A;  4ASU G;  3MHS C;  5CN0 A;  3TCU A;  1ZWI C;  5LGN A;  4ZBM A;  4TSF G;  5L3B A;  3RVZ A;  3SPC A;  1K92 A;  3AG3 C;  1M1K W;  4HAM A;  5KUM A;  3HPL C;  1K73 W;  3SPG A;  1VQ7 V;  2BOB C;  4PEL A;  1OZ0 A;  2V7Q G;  1PD3 A;  3MD0 A;  4MSW C;  3G6E V;  4PA4 A;  1PNL A;  4FK5 C;  4PA6 A;  4RUE A;  2WAM A;  1Q7Y W;  1RPR A;  2BOC C;  2WWW A;  3FB7 C;  1S3J A;  2ZXW C;  1K8A W;  3CP1 A;  2PI5 A;  4P9P A;  3CCE V;  3EFF K;  4WFH A;  1Q82 W;  3T1C A;  2XOK G;  4XDL A;  3CC4 V;  1YTF B;  1KC8 W;  1K33 A;  3ETE A;  3F7V C;  1DF5 A;  3LDE A;  2Y48 A;  3AEI A;  2OCC C;  3SPH A;  4HYO A;  3AG1 B;  4DO2 A;  4G28 B;  5LBQ A;  2JDI G;  2XAS A;  3PJS K;  4JYB A;  1XL6 A;  5LHG A;  3E8H A;  5H9C A;  5CBH A;  4WFA V;  2CK3 G;  3SYO A;  2HVK C;  3ABM B;  2QE7 G;  5KA5 A;  4G2K A;  2DW4 A;  5CMU A;  3ETD A;  4QNH B;  5B3S B;  1OCC C;  4BW5 A;  1NJI W;  4JAS A;  2DYS C;  4BAY A;  1VQ6 V;  3ABU A;  2Y69 C;  1WLE A;  3K9A A;  2DWD C;  5HFL A;  4JYC A;  3SYC A;  1JQ0 A;  3CCL V;  3STZ C;  2PI4 A;  1J95 A;  5GW7 A;  1NH2 B;  2X0L A;  3AG2 B;  3E8G A;  4X88 A;  1OCZ B;  2B1G A;  3K79 A;  2IU0 A;  4CZZ A;  2H94 A;  3AG4 C;  2X6B A;  3H01 A;  3VBB A;  3B8M A;  5B1A C;  2OT5 A;  1FS0 G;  4KFM A;  4XDJ A;  4H33 A;  3FYE B;  3B8N A;  2EIJ B;  2C2A A;  4ZKI A;  4OXS A;  2EIM B;  4LP8 A;  2QTO A;  1JOY A;  1NQT A;  4UUJ C;  2DQ3 A;  3ASN C;  1F51 A;  3ZN1 A;  1BHA A;  1YHQ V;  4MVO A;  1JJ2 U;  4I9W A;  5IYC O;  2IJJ A;  2JJ1 G;  1M56 C;  2Q6A A;  1M57 C;  5EBL C;  4KUM A;  1FXK A;  2IH3 C;  3JYC A;  3K08 A;  4WFE A;  1K4C C;  1NVP B;  4H37 A;  3X2Q C;  1SES A;  4MVZ A;  4WFF A;  1V55 B;  3STL C;  5B1B C;  4PA3 A;  4MT8 A;  1DTO A;  4R6Z A;  1K4D C;  1OCO C;  2V1D A;  2YSU B;  2XAQ A;  5EBW C;  1BHB A;  1BL8 A;  2D3O W;  2XAH A;  4GX2 A;  3LDD A;  3ABK C;  3OEE G;  5HFM A;  4JAU A;  1V54 B;  3I55 V;  2ZR3 A;  3K3W A;  1VQN V;  4WFG A;  5L3E A;  4UXN A;  1IXM A;  1RM1 B;  1AJN A;  4MVR A;  1GK9 A;  1P7B A;  1F4N A;  3ZMT A;  5CBG A;  4QPK A;  2WLI A;  4EKW A;  4X89 A;  1R6N A;  1FXK B;  1AJP A;  2H8P C;  2EIL C;  1GMG A;  3T4D A;  1VQL V;  1TUE B;  1E79 G;  3K0D A;  3ZIA G;  1VQO V;  4JTA B;  3SJQ C;  1ROP A;  1THZ A;  2EIK B;  3OM3 B;  1M9N A;  2ZD9 A;  3FB6 C;  3QO7 A;  4JTC B;  4PDR A;  1YIJ V;  1G4Y B;  3D3I A;  4N21 A;  4Z1M G;  1EFR G;  1PKX A;  5EC1 C;  2M7W A;  4TT3 G;  1Y4M A;  2JEU A;  4FPP A;  1VQM V;  4JTD B;  3HB3 B;  3B77 A;  1MOF A;  4WFB V;  2Z3Y A;  1K5Q A;  3IFX A;  5IY5 C;  4R8C A;  5CBF A;  3QO5 A;  1E1R G;  1L1F A;  3W7T A;  3RVY A;  2WLI B;  3LUT B;  5B3S C;  5EBM C;  1QLN A;  3ML0 A;  1FFT B;  1G8M A;  2GSM B;  3ZMZ A;  2JIZ G;  4I5S A;  2DQ0 A;  4YXW G;  4BIU A;  1R3L C;  4JGS A;  3OUS A;  4MTX A;  4JF3 A;  5CA3 A;  3VOU A;  4G27 B;  2LFS A;  3ZMU A;  4CBC A;  2WPD G;  1ORQ C;  3E2E A;  1VQP V;  1NKD A;  3FB8 C;  1ENV A;  3SPJ A;  4UV9 A;  2LP7 A;  1GTO A;  4WCE V;  4LBE C;  4RO2 A;  4UV8 A;  1W0K G;  2LFR A;  4GX5 A;  2A79 B;  2XAG A;  2Z5U A;  3NXS A;  3F7Y C;  4QJF B;  2HFE C;  1NBM G;  4JPR A;  2WLK A;  3CYO A;  2EIM C;  3R65 A;  4GCZ A;  4XDK A;  4RQE A;  1GM7 A;  4JAV A;  1COW G;  3CC2 V;  5LHI A;  2B5U A;  3ZJZ A;  3ZRV A;  3UKM A;  2WLL A;  1R3K C;  2EZP A;  4GX1 A;  5DN6 G;  1QVG U;  1QBZ A;  3CMA V;  1YIT V;  3OEH G;  3BEH A;  2QA4 V;  4DXW A;  2HR3 A;  2AHY A;  3K06 A;  2ZXW B;  1JVM A;  2B1I A;  2DYR C;  1F4M A;  4R7C A;  2EBO A;  1Q86 W;  1OCR B;  3E8B A;  3OMN B;  4L87 A;  4E2L A;  5J9P C;  1KP2 A;  1VQ8 V;  4N23 A;  3D36 A;  1MG1 A;  1PNM A;  3ABL B;  4BIZ A;  3CCR V;  2OCC B;  3BY6 A;  1KEC A;  2QEX V;  5DM6 V;  4WF9 V;  4LCU C;  5B1N A;  4MTO A;  1S72 V;  3DGE A;  3OR6 C;  2AHZ A;  3WG7 C;  2ZQM A;  3CME V;  1YTF D;  1V54 C;  1K7D A;  2K1E A;  3ZRX A;  2EJR A;  1VQ9 V;  2WLL B;  1S0V A;  2DYS B;  3OMA B;  1RM1 C;  1EBO A;  3JD0 A;  2IJH A;  3JCZ A;  3RBZ A;  4FIP C;  3CC7 V;  1SET A;  1RPO A;  3KG2 A;  3ETG A;  3A0R A;  3ZN0 A;  2HVJ C;  1NR7 A;  3SYQ A;  5L3C A;  1N8R W;  1S77 D;  4U7O A;  3ASO B;  1FXK C;  4RQF A;  3CD6 V;  4P9O A;  5KUK A;  2YEV A;  5H6Q A;  4R50 A;  1GO3 F;  4UVA A;  2ITC C;  5L3G A;  2EIK C;  1PL0 A;  4XBF A;  3WFV A;  2R9R B;  3P32 A;  1NH2 D;  1B6Q A;  2A9H A;  4QPJ A;  2X6A A;  1VQ4 V;  1QLE B;  2ZDI C;  4QE9 A;  3CXC U;  3ASN B;  3E89 A;  5L3F A;  1YJN V;  4RAI A;  2DWE C;  4Q20 A;  4U7N A;  1UJW B;  3OW2 U;  4MTF A;  3OFN G;  2R9I A;  2XND G;  2W0F C;  1E1Q G;  3ZRW A;  2UXN A;  3LNM B;  3OMI B;  4FMT A;  4J9Z B;  3M99 B;  4PA9 A;  5IYB O;  1M56 B;  1WPX A;  1SZT A;  2IJK A;  1M57 B;  5EC2 C;  1K34 A;  2ITD C;  5FL7 G;  2ATK C;  2WLN A;  4MVS A;  2P90 A;  4J9Y B;  1XL4 A;  2YEV B;  2JEX A;  3ABT A;  2OTJ V;  5IDJ A;  2OTL V;  2P6J A;  2P67 A;  1K5S A;  2NLJ C;  1AI4 A;  1R73 A;  4MVM A;  3CCQ V;  3AG1 C;  1KKD A;  1FXH A;  3IC7 A;  1FXV A;  1OCO B;  2HG5 C;  2EIN B;  1K9M W;  3GWO A;  1S76 D;  1KD1 W;  1NVP D;  1AI5 A;  3ABK B;  3DTU B;  3ABM C;  3E83 A;  3OR7 C;  3JD3 A;  2F43 G;  4UVC A;  1M90 W;  1SRY A;  3ZRW B;  4FJC C;  1CEZ A;  1KQS U;  3LSS A;  2KB1 A;  4MS2 A;  4PA7 A;  1JX9 A;  3OAA G;  1GM8 A;  3T4Z A;  3ZMV A;  5H6R A;  3JD1 A;  1AI6 A;  4GT1 A;  4MTG A;  4PDV A;  3AG2 C;  1BMF G;  2QM7 A;  3W7X A;  2EIL B;  3SYA A;  1H8E G;  1H38 A;  4LC1 A;  1OCZ C;  1CPY A;  3QO8 A;  4MVU A;  2JK5 C;  5EK0 A;  1P4R A;  1Y66 A;  3P30 A;  4PDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...