4HZ3A

Mthk pore crystallized in presence of tbsb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 32
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hz3A00
2ITDC 3ASNC 5CBHA 2A9HA 2KB1A 3LUTB 3SJQC 4KFMA 4BW5A 4GX1A 5EBLC 4RAIA 3RVYA 4J9ZB 3SPCA 5BZBA 2P7TC 3RVZA 3LNMB 3HPLC 1R3JC 2ITCC 4ZBMA 2ATKC 3K04A 3AG2C 3JYCA 4LCUC 3ABKC 3SYAA 4R50A 3LDEA 2H8PC 1P7BA 3ZRSA 2WLMA 3ABLC 3E8HA 2QKSA 4CBCA 3TCUA 3SYPA 2YEVA 2EIMC 4P9OA 4RO2A 4RUFA 3FB5C 2ZXWC 2WLHA 4MVOA 2Y69C 3T1CA 4XDJA 5KUKA 2R9RB 3E83A 3FB7C 3OUSA 5CBFA 3FB8C 1XL6A 4MVZA 3RBZA 4MS2A 4MVRA 3VOUA 2EILC 3EFFK 3E8BA 4PDVA 3E89A 3F5WC 5EBMC 3AG1C 4QE9A 2Q69A 4H33A 4WFHA 3OR7C 1OCOC 2HG5C 4MTOA 4MW3A 2HJFC 3UM7A 3LDCA 2OCCC 1V55C 4MSWC 4GX2A 3TETA 2EINC 3K06A 3OGCC 4MVQA 1XL4A 3AG4C 2W0FC 3KG2A 2K1EA 4GX0A 2BOBC 4UUJC 1K4CC 1JVMA 1J95A 2DYSC 2HVKC 4G27B 4P9PA 4H37A 4MVSA 2JK5C 3PJSK 2A79B 4MTFA 4R7CA 4TWKA 2Q6AA 2X6AA 4X89A 5EBWC 4G28B 2WLIB 4HZ3A 3SYQA 4DXWA 4EKWA 2QTOA 4LP8A 3GB7C 5EK0A 4JTAB 5IY5C 2X6BA 3K08A 2WLLA 4P30A 3SYOA 3T4DA 2DYRC 2WLNA 4PDLA 5EC1C 1KKDA 3K0GA 1OCRC 2HFEC 4LBEC 5E1AC 3RW0A 3BEHA 3ASOC 3T4ZA 2X6CA 3SPGA 4PA6A 4QE7A 4MTGA 3SYCA 3ABMC 3SPIA 5B1AC 3LDDA 1QLEC 3F7VC 4J9YB 3F7YC 3OUFA 2WLJA 3T2MA 5EC2C 4RUEA 4WFGA 2DWEC 4HYOA 2EIKC 5B1BC 4R8CA 3STZC 3AG3C 1M56C 1ORQC 1G4YB 2WLLB 3IGAC 4JTCB 1OCCC 3SPJA 2NLJC 4P2ZA 4PA7A 4PA3A 4WFEA 3E8GA 1R3LC 1V54C 1ZWIC 2Q68A 3K03A 1S5HC 2EIJC 2DWDC 5KUMA 3E86A 3X2QC 3UKMA 3FB6C 4MW8A 4PDRA 4XDLA 5B3SC 4PA4A 1BL8A 4XDKA 2HVJC 2A0LA 3IFXA 2AHZA 1M57C 1R3KC 2Q67A 1K4DC 2AHYA 2IH1C 3K0DA 4GX5A 4MVUA 4OXSA 5CBGA 3STLC 2ZD9A 1OCZC 1R3IC 2WLKA 4R6ZA 4WFFA 3E8FA 3ZJZA 4X88A 4MVMA 3OR6C 2BOCC 3R65A 4JTDB 3WG7C 1LNQA 4I9WA 4PA9A 2IH3C 2WLIA 4F4LA 5J9PC 4PDMA 4QNHB 4X8AA 3SPHA
chains in the Genus database with same CATH superfamily
2R9IA 1MNGA 4DW1A 1IBMB 3RVYA 3RYHB 2P7TC 2HP8A 2A06H 4DV2O 1A32A 2XAGA 2JJ1G 2QWNB 4DUZO 1VEWA 1EBOA 4UVAA 3ABLC 3CWBH 3OMAB 1JFFA 2QKSA 3CC2V 5CA1A 1XEQA 5LMUB 2JGDB 4LF8O 2F93B 1NVPD 2WWWA 2P90A 4DRXB 1AI5A 3QNEA 1VQLV 4H33A 1GRJA 3B40A 3JARA 4B7EA 3UM7A 1N8RW 1M5IA 2FTKA 2QKCA 3ZHQA 2HVKC 4P9PA 4QJFB 2GHYA 1I94O 1GTOA 2W0XA 5IJ0A 4EKWA 3OFNG 3W7UA 5EZYB 3HKCB 2KG7A 4O4HB 3T4DA 2WLNA 1XNRO 2Z3YA 3M8AA 3K5LA 4LFAB 5D5PA 3BEHA 5F2VO 4LNUB 1YHQV 1U96A 3CRRA 3T1YB 3JD4A 3L73H 3SYCA 4IT5A 3CCUV 5LOVA 4ZI7A 4FM1A 3F7YC 4JZ2A 3WFVA 3MHHC 2DWEC 4D7SA 4NTYA 4KHPO 5DECA 1IURA 3MD0A 2CAZC 4UVBA 1K7DA 1Z2GA 3H1JH 2VWJA 4LH6A 5BR8O 1MSWD 1NH2D 4DW0A 2P06A 2ZCEA 5LHGA 4GX5A 2EX3A 3ICXA 2VQFO 1RFYA 3OD4A 1IXBA 4X1IB 2F95B 4CS3A 4LWSB 3E8FA 5CMUA 3I56V 1I5XA 2JGUA 4MVMA 4NYKA 4JTDB 1P4RA 4JI8O 1AROP 3EXAA 3EHBB 3CP1A 1QVFU 3DSQA 1VQ8V 2YIBA 1JQ0A 4RAIA 2UXBO 3B77A 4MT8A 5B1BB 1Q82W 1FFXA 3CCVV 5LXTB 3P30A 4OPAA 2ATKC 5DM6V 3K5NA 4U7OA 4Z1MG 1SC5B 4AILC 1YZBA 3IC7A 3ABTA 2EIMC 3H1IH 2AGAA 5IYZA 3RBZA 1JMKC 4H44B 1GO3F 3KKYA 1M1KW 1YCIA 3AG1C 5CB4B 3ABUA 3H1KH 5A2QN 1YTFD 3CJHA 4EFEA 3RT3C 2OCCC 4MSWC 5BMVB 3TETA 3FX7A 1XL4A 3DXRA 3JASA 1XOUA 4MVSA 4DXWA 2GSMB 4DR5O 2X6BA 1U97A 1QHTA 4PDLA 4X1KA 4I50A 5JH7A 4JI2B 3HKDB 5CN0A 1NTKH 4AQYO 1S0VA 1FXVA 2E5LB 4QE7A 1XNQO 4EB6A 1AILA 3JAWB 4DO2A 5IJ9A 2UXCO 1FXKC 1G4YB 5LHHA 1ZTEA 5L3FA 2GTAA 5A9GA 2LGWA 1IBKB 3O9OA 1R3KC 2VQEB 1S3JA 4YHHO 4A5UB 4BW9A 4ZHQA 3QG5A 1Y76B 4WFFA 3DC5A 3ZJZA 1QQCA 3T1HO 2RMKB 4O4LB 1OV9A 2IW5A 3LUTB 3AG4B 1DK1A 4KL1A 1E1QG 1W59A 4J7JA 4JAAA 3CSXA 4TSFG 5LP6C 5JCOC 2UUBO 3ABKC 1LUWA 1GN2A 2F66C 2UUCB 2R70A 2ZNIA 4IYHA 3SYPA 4X64B 3FB5C 1NI8A 1PP9H 2F23A 1Q7YW 1IBMO 4TOIA 4Z2WA 4JI5B 4LF6B 4QE9A 1OCOC 1K97A 1RM1C 1THZA 1HNXB 3O65A 2P5OA 1Q6IA 1V55C 5GONA 3D3IA 1JFFB 5LMUO 5CA1B 2PYJA 2ZINA 3A8TA 4LH7A 3AK3A 3K9AA 3CCJV 1S5LZ 1YDXA 2IJHA 1WB7A 1EN5A 3JARB 3BFRA 2LJ2A 2JEXA 2JDIG 3SPIA 4GYCB 1NKDA 2WLJA 1KUQA 1JR9A 3OGIB 1JPXA 5IJ0B 4BIOA 2EINB 2KG7B 1B04A 4B3RB 1XHXA 3R66A 4PA3A 4NXMB 4LFAO 1S5HC 2E75B 3CD6V 3OT7A 3T1YO 4N21A 1AJQA 3UKMA 4XDLA 4JYAB 1VF5B 2HVJC 2ZE6A 1PV0A 3L70H 4RQEA 1NT2B 5LOVB 1OCZC 3APOA 2LP7A 3JAKA 2AW9A 3CC7V 1I7FA 1OZ0A 3ASNC 5H6QA 5J2UA 3IC9A 2JIZG 4OPHA 1F7YA 3AG3B 5HFMA 1TUEB 3JYCA 2ZR2A 2B1GA 4TUYA 3RYIA 4UXNA 1MG1A 4CS2A 3JD2A 5IYCO 4RO2A 1GKFA 5KUKA 4O2AA 1HP8A 3F5WC 1VIBA 2KQXA 3CYOA 2HJFC 4LR3A 1N32B 2JS5A 1Y67A 4E4EA 3CX5F 1D5NA 2GUZA 1Q6HA 4TWKA 1OJHA 5IYZB 5DEDA 5KAFZ 5IY5C 2WLLA 2LQTA 3RGBA 2EZPA 5LHIA 3W7WA 2IU0A 5KHKA 1NR7A 5E1AC 1I08A 2AZ2A 2LO1A 3CRMA 5FLXN 1GH6A 3DXRB 3JASB 3B8NA 4J10A 1TA8A 5EYPA 3MHSC 2RDCA 3EVKA 3ZX6A 4CH3A 4JI2O 4X1KB 4I50B 1SA0B 2IM9A 5JH7B 2Q68A 2XUMA 2E5LO 2A7WA 4X62B 2GDSA 4MW8A 1YIJV 1W2BU 5L3BA 1FXKA 2AHYA 4EB6B 4JI1B 3G71V 5DN6G 5IJ9B 1ZAUA 1RPRA 4BAYA 1Q43A 4DV7B 4AHCA 2UU9B 4J41A 5J2TA 2AXTZ 4LF5B 1IBKO 4LF4B 2VQEO 4K0KB 3RVZA 3CCEV 4FM0A 4TV8A 5GTIZ 1OCCB 1BMFG 4PI0A 1NQTA 3JSLA 1GMGA 2YEVA 3TCUA 5B5EZ 3OW2U 1LR1A 4GKJB 3CCLV 5LP6A 3H1LH 2XNDG 5JCOA 1M9NA 1GN3A 2DW4A 3FB8C 1Y74A 4NB5A 4JAUA 1QLEB 4DK1A 4UV9A 4UCOA 5GW7A 4RWUA 4MTOA 2UUCO 3A0HZ 2QM8A 1R73A 4X64O 4D6TH 3E35A 2P4VA 5EIBD 5EK0A 4JTAB 4JI5O 4LF6O 1B3QA 1Q86W 3ABLB 3BABA 1HNXO 3WU2Z 4TV9A 2CH7A 3K59A 5GONB 3W7SA 1BS3A 5JVDA 4I0XB 1ZUQA 1F23A 4XBFA 4FPPA 4FM2A 1KYOF 2FMLA 3CMAV 4DV1B 1PM9A 1Q81W 1PL0A 4FLTA 3BHPA 4PD4F 2QEXV 4HNAA 2PI4A 4E2LA 1R3LC 1N34O 3BPZA 1RP3B 2MW2B 2V4DA 3FB6C 5B3SC 1K34A 3IFXA 3WG7C 3P3PA 4K3AA 1VQ5V 1VQ9V 2JS3A 1LNQA 4I9WA 5KHHA 4DV6B 4B3RO 2PZSA 4NXMO 1COWG 2OTLV 1WB8A 2ITDC 3BAAA 3CHXA 2CTRA 1D5AA 1ZL8A 4JYAO 1J5EB 2YICA 4QIWF 4ZBMA 1NJIW 1XBLA 1Q8IA 4EFBA 2NNUA 2H8PC 2GV9A 3JAKB 5L3GA 5IDJA 4ZKIA 3LSUA 2ZXWC 4FMTA 1AR5A 3AK2A 3RN4A 5J2UB 2FKXA 3G80A 2X7RB 2YXHA 2QWRB 2EULA 1HNZB 2QTSA 3DC6A 3LDCA 4TUYB 3RYIB 2WSSG 2W0FC 1V54B 1BSMA 1JVMA 1XMQB 3SYQA 3CRCA 5IYBO 4O2AB 1W0KG 1IBLB 1CXZB 1F51A 3TK1A 2DYRC 1K33A 2Y4TA 3CC4V 1OCRC 2EIMB 3CMEV 3CCSV 1N32O 1H2SB 4O2BB 3SPGA 1K92A 3ABMC 4GZRB 5ITZB 1KBHA 3FKSG 1KQSU 5EC2C 3AG1B 4RUEA 2IU3A 1G6UA 4R8CA 2YXLA 2OCCB 1R1BA 2WLLB 1TUBA 1XILA 4CH5A 4UB8Z 1NBMG 5KMGA 3ETDA 1Q90D 2LW7A 2K9PA 1K5SA 1DGSA 5KHIA 4PA4A 2BTQA 2AHZA 1M57C 3L72H 4DUYB 1HR0B 1K9MW 4B08A 2IJIA 3OR6C 5EYPB 2XAJA 1XDCA 4KP4A 3K3WA 4I7ZB 1PNMA 4PDMA 1MOFA 5KX5A 3D8CA 2A9HA 2ZM6O 5LGNA 2P67A 5IWAB 4X62O 3ZEDA 3MAQA 1XREA 1P7GA 3JCZA 2D2CB 4JI1O 2N04A 1EN6A 4IGGA 4DV7O 1AI7A 2UU9O 3T1CA 2WLHA 5CA0A 4PELA 5J2TB 4LF5O 4X66B 4EEQA 4LF4O 4K0KO 2EILC 1SZXA 1FS0G 5EBMC 4WFHA 4TV8B 5FL7G 4DV4B 4GX2A 2F43G 1DTOA 2NN4A 3KG2A 5D5QA 4GKJO 2YEVB 1VQNV 5LP6B 2IJKA 2WLIB 4LP8A 3ABKB 5IE9A 4UB6Z 2EBOA 4P30A 3SYOA 3K0GA 3UT5A 2CUGA 1RSOA 5E79Z 1BCCH 5H9CA 1AR1B 4UVCA 4J9YB 2WA3A 4X20A 3OMIB 1RM1B 3WB2A 3STZC 1V55B 3SPJA 1AJPA 2ODMA 2HEPA 4WFEA 2M7WA 4JI0O 1DF5A 3TGUH 4TV9B 1BQ0A 2L35A 4CC5A 1G1XB 4JF3A 2YIAA 3Q4HA 2LFSA 2ZD9A 2ZE5A 2OT5A 4DV1O 3QO5A 1TVKA 4IHJA 1NVPB 2OIGA 5J9PC 3UO3A 2ZNJA 1NS1A 4YY3B 2R9AA 2N05A 2HHHO 1VQ6V 1KD1W 4U3JA 3LDEA 3A2FA 1P7BA 4DV6O 5LL6Y 3BRCA 2BTOA 1P84F 4CBCA 3J80N 3OM3B 1SQVH 2X0LA 4JPRA 4JYCA 4YXWG 1J5EO 1OCZB 2Q8VA 3DGEA 5B1AB 1ZL8B 4I4TA 1GM7A 2RJZA 1EM1A 2ZT9B 3WB0A 3OR7C 5B66Z 2HG5C 3ML0A 1SQBH 3SJCC 1M56B 3ASNB 3ZN1A 4DV0B 3K06A 3HB3B 1SS3A 3B2EE 2CDYA 4J7KA 2ZIOA 2E3CA 4X89A 4FK5C 5EBWC 2HKOA 2DJVA 4FJCC 1NTZH 2CTPA 3E22A 1HNZO 3I55V 3OEHG 3OE7G 3J81N 4DR7B 2Q5ZA 4JASA 3ASOC 3N2KA 3RWRD 2LW1A 2YXYA 4MTGA 5GTHZ 2OWOA 4JI3B 1S77D 1XMQO 2FYUH 1YJ9V 2R72A 4WFGA 1KMIZ 1IBLO 4J80A 3VQWA 1WP7A 3FD9A 1ORQC 4DV3B 3IGAC 3L9DA 2NLJC 1I5YA 2CTWA 3GWOA 3RYCA 4LFCB 2F4VB 4JI4B 1PNLA 2YSUB 4JYYA 3B4SA 1MMMA 2WPDG 3KZIZ 2YUAA 1SF9A 2G38A 1EZJA 3D3QA 4X8AA 1TUBB 1SESA 4FFBA 5FPOA 2E74B 5KMGB 4IL6Z 4CZZA 4J9ZB 4DUYO 1ZX3A 1HR0O 2BTQB 1BHBA 3AG2C 4FLUA 1L0NH 2P4KA 4ZI7B 1BE3H 4K8ZA 3JCUZ 1YJWV 4MTXA 5IWAO 3HKBA 4ZOLA 4B3MB 4JI6B 4MS2A 3CPWU 4NVPA 4DV5B 2ZQMA 1AVMA 1IDSA 2P22C 1Z5WA 1IX9A 4UV8A 2OTJV 3AG4C 4UCVA 4KXRA 1M93A 2DYSC 1J95A 4NTWA 4X66O 2XHBA 2QWOB 4G28B 4PV1B 1N4CA 4IIJA 1KKDA 1FAFA 1PL4A 1JCHA 3OAAG 1FFXB 1JOYA 4BWAA 1SQPH 5JWPA 1HWYA 1H2KA 2EIKC 3THOA 1ROPA 2B9ZA 4PA7A 3CEIA 4W4LA 3HKEA 1RSOB 1WN7A 1N33B 3X2QC 4JI7B 2CGNA 4PDRA 2YI9A 2EZOA 3CJHB 2Y69B 1QU7A 2IH1C 3K0DA 4OXSA 3OTFA 1BGYH 3JD3A 4LF7B 4X20B 4X88A 3IJ4A 1VQOV 1BT8A 3BA8A 1HNWB 3ZN0A 5CA3A 1Y66A 4O4HA 3SJQC 1I0HA 2VS0A 3VQVA 3H01A 2DOSA 4WF9V 5JJJB 3P32A 1YI2V 3QO7A 3LNMB 3PN1A 2QA4V 4FVMA 2XAFA 3I5DA 3JALA 4C7UA 3CCQV 1TVKB 2QSAA 4IHJB 5B3SB 3WG7B 4XDJA 4YY3O 4B3SB 1S76D 3CE2A 4MVZA 3E8BA 1M90W 1UJWB 3BCCH 4LFBB 5LYJA 4ZIBA 1MZEA 2DMXA 1QR8A 3AEIA 5BR8B 1H38A 4U3JB 4ZHQB 1SQQH 1NTMH 4LWSA 1N0NA 2Z5UA 4YIOA 4H37A 5JJNB 2JK5C 3PJSK 2UXNA 2Q6AA 2X6AA 4PJ0Z 2Y48A 1JA8A 3K08A 4I4TB 2KKWA 3J7AU 4W4KA 2HFEC 1US6A 4GCZA 2ZXWB 4DV0O 2V1DA 4QGPA 3ZMUA 2Q73A 3U11A 2BSKA 2UXDB 4PA6A 4DR3B 1H2GA 3LDDA 1EFRG 1GM9A 4NR1A 3C90A 2E76B 5KHJA 1H2NA 4O4JA 1KP2A 2XAQA 4FZ0A 4B7KA 4DR7O 4X9QA 3SJBC 3SJAC 3E8GA 1ZWIC 2QR4A 1L8DA 2EIJC 2DWDC 5KUMA 4OGQB 4OX9B 1BL8A 3N2KB 3K9SA 4JI3O 2JVDA 1O9GA 2Q67A 1URFA 3U10A 5B1OA 4RQFA 1L0LH 2DYRB 4AI8A 3OMNB 1X59A 3FAVA 4DV3O 5BXZA 4U3FH 3K58A 4QNHB 1B6QA 2W6JG 3SPHA 3ABMB 5CBHA 2KB1A 3UO2A 1WPXA 4BW5A 4GX1A 5EBLC 3W7TA 3SPCA 3HKDA 4YIPA 4UCUA 4LFCO 1H2MA 1GN4A 2IBZH 2F4VO 2DE0X 4JI4O 5AG2A 5IT9N 3CS5A 2LFRA 4J7ZA 1XUQA 3E8HA 1FPOA 4ASUG 1R6KA 2RN9A 5H6RA 1VP7A 3K79A 4FFBB 3FB7C 5CBFA 2H3OA 1K73W 1MABG 3S3WA 4GUNA 3A0BZ 1IXMA 2PI5A 4FLVA 4WFAV 1Q3EA 2QWQB 2UUAB 5L3CA 3GWKC 3L74H 5LGUA 1TGOA 3TXSA 3ZMZA 4B3MO 4JI6O 1YITV 3HKBB 4ZOLB 3T1HB 1O9HA 4Q6GA 1VF7A 1S72V 2ETNA 5EC1C 2RNBA 4DV5O 1T5EA 3UCSC 2X6CA 3ZIAG 2EILB 3MDSA 1QLEC 3JATA 2ADPA 4YJ2A 2H94A 4DR4B 4WBNA 2ZE7A 4IIJB 4G2KA 1AI6A 4O4IA 1WJZA 2Q0OC 4JYBA 4I55A 1XQ8A 2HLDG 3OTOB 3B8MA 4GKKB 1CP9A 2EJRA 1R6TA 1R3IC 1WLEA 1FYJA 4R6ZA 1X4TA 4CC6A 2BE3A 2NR5A 2GUZB 1WNSA 4U7NA 1EN4A 4PA9A 2OIEA 2WAMA 3ETQA 4HBNA 3ZRWA 1WAZA 2ILMA 1N33O 3HKEB 4JI7O 4B3TB 4DR6B 3FYEB 1QR9A 2HJDA 4WCEV 2B1IA 3BY6A 3HPLC 2ITCC 1FD9A 3K04A 5LGTA 4LF7O 2YDEA 1XHZA 3ZRSA 2WLMA 3VQYA 2RCVA 1HNWO 4X65B 1SKVA 4P9OA 1N0JA 5FNVA 3CCRV 2XTAA 4MVOA 3C3TA 3OUSA 4UCTA 2YC0A 2JRIA 2DQ0A 1KB9F 4IYIA 1SZTA 4JV5B 2MK3A 5KAIZ 4MW3A 1FXKB 3JALB 4B3SO 4G27B 4R7CA 2QTOA 2DN9A 2W6IG 4LFBO 5TISZ 2YS8A 4L87A 2XAHA 5LYJB 3ZMTA 3S3XA 1XMOB 3P3NA 3T4ZA 1IZ3A 3ZCCA 2L6LA 1GM8A 3LSSA 1YF2A 3QTCA 1SQGA 2Q9LA 4CH6A 3GVMA 3D36C 1Y74B 2QM7A 1V54C 1AI4A 3K03A 1GK9A 2UXDO 4DR3O 2XOKG 1VQ7V 1UFIA 2BSKB 3TXQA 3AG7A 3STLC 1P49A 4X1YA 4GT1A 4J11A 1CEZA 2GTSA 3SR2C 4NXNB 4FLWA 1OCOB 3ASOB 4F4LA 3K5MA 2PY5A 4O4JB 2P6JA 3NXSA 1W0JG 2YIDA 3WB1A 1DF4A 1WA8A 4OX9O 1SERA 3B09A 4KUMA 2Q7GA 1V9PA 5EIBC 2CH7B 2A3QA 2V7QG 4LCUC 3SYAA 1Q5OA 2BCCH 5JVDB 3FAVB 1KC8W 1FJGB 2PYLA 4RUFA 3RYFA 1VQPV 1FFTB 4WFBV 4NKGB 1XL6A 2HR3A 4HNAB 3VOUA 1SA0A 1K5QA 4F6RA 3APQA 3NR7A 5JQGA 2XT9A 2EJ7A 1F4MA 1NZ6A 4FLXA 4MTFA 1QLNA 5LMNB 3AG2B 1PPJH 3ETGA 2ZKOA 1PKXA 1MA1A 1AJNA 2YIBD 1EZVH 1QCEA 2Q0AA 1DLBA 4DK0A 4LBEC 2UUAO 4J42A 3BA9A 3CXHF 1VARA 3JD1A 3F7VC 3T2MA 2Q7EA 3CB2A 4YJ3A 4LC1A 2PF4E 5B1BC 1K8AW 3L71H 1VF6C 1QBZA 3ZBHA 2ZDIC 3E2EA 3ZRVA 4L8JA 1PD3A 2DYSB 2F1MA 3H9VA 5K1PA 4QPJA 3KCYA 2CGOA 1NH2B 4TQDA 5LA6A 4CH4A 5LBQA 1K4DC 3M99B 2CK3G 2KSDA 4TQFA 2WLKA 3JATB 4JGSA 4FZ1A 3W7XA 4DR4O 3CXCU 3FYIB 4YJ2B 3SGIA 3R65A 2JJ2G 4WBNB 4DYLA 3L75H 3C3SA 4O4IB 1YXBA 1D2DA 5H2FZ 3TJTA 4FLYA 1KKCA 1N36B 4N23A 3ZRXA 4DR1B 4I55B 3OTOO 1JX9A 3U0ZA 4GKKO 2EIKB 1R3JC 4BR6A 5IY5B 3BVOA 1JJ2U 4DR2B 3ETEA 5FPRA 3JAMN 4I0XA 2UXXA 3X2QB 3CRAA 5C8YA 3ZRWB 1WPBA 4B3TO 4DR6O 2R9RB 3E83A 4PHZA 2ZIMA 2OYQA 4CS4A 4PDVA 3IAYA 3E89A 2QE7G 2Q69A 1YTFB 1N34B 4I9QA 1K3EA 2YI8A 2VRZA 3AK1A 4UCSA 4X65O 2OCHA 3N2GA 4LF9B 2K1EA 4GX0A 5FNVB 5IYDO 2A79B 5C93A 1VMGA 5KX5B 3GB7C 1MSDA 5B1NA 4JV5O 3QO8A 3H1HH 3RW0A 1Z5VA 3QVNA 1S5JA 4H13B 2IJJA 4K35A 3UQ8A 5B1AC 3K5OA 4K8XA 5BY1A 3OUFA 2AZ0A 1JJOA 1B06A 4HYOA 5CA0B 1PNKA 3RFRA 1Q6UA 1M56C 1L1FA 1SQFA 5KHGA 2Y0PA 2PGGA 4Q20A 1ZLZA 1XMOO 2C2AA 4DV4O 1VQKV 3E86A 2QGNA 3RYHA 3M7MX 2JEUA 2XASA 4MVUA 5CBGA 1M4UA 4DV2B 1HW7A 2ZR3A 1CPYA 3D36A 4DUZB 2PUSA 1Y4MA 2Y0IA 3A0RA 2JGDA 5HFLA 4I5SA 4LF8B 1MZFA 4DRXA 3UT5B 5L3EA 1UPGA 5BZBA 2PTMA 3K57A 2Y4UA 1WP8A 3DTUB 4O2BA 3LSQA 1TAEA 4R50A 5ITZA 3ZHRA 4NXNO 4X1YB 1H8EG 2EIJB 1QNMA 5K1XA 1IVSA 1FKAO 2QKAA 4Z1VA 3VBBA 1I94B 1R6NA 5EZYA 3HKCA 1WA8B 2VWKA 4F6EA 2O57A 4BIZA 1AR4A 5KLVH 1XNRB 1NR1A 3Q4HB 4LNUA 2EINC 4ABMA 1FJGO 3OGCC 3ZHVA 2Z0AA 2BOBC 1K4CC 1E79G 2ZE8A 2M6YA 3RYFB 1YVWA 1NU1H 1YJNV 5H5NA 3KCXA 2GBOA 1SRYA 3ZHTA 1KU9A 4BIUA 4F6RB 2DQ3A 4KHPB 5JQGB 2ZM6B 3SDLA 3CCMV 2QWPB 5KA6A 1AB3A 1VQMV 2ADQB 3VQXA 4X1IA 2FL4A 1G8MA 1FXHA 2VQFB 5LMNO 2LGQA 1YSCA 3LNNA 4PI2A 1RPOA 1QVGU 3AG3C 4JI8B 3ZHSA 4UFZA 3G6BA 4JZGA 4TT3G 1XI1A 2QM4A 4XDKA 5L3DA 2A0LA 2UXBB 5LXTA 4FLZA 1VF6A 1Y6XA 2ZDIA 2D3OW 1BHAA 3F5TA 4YJ3B 3G6EV 2BOCC 2ARHA 2IH3C 2WLIA 4FIPC 2CTQA 1AP6A 2Q7HA 2RQ6A 3OEEG 1GAXA 1KP3A 3E22B 4KFMA 3ZMSA 2Q4PA 5LA6B 5CB4A 2N74A 3N27A 4H0LB 4ICGA 3G67A 5BMVA 4JAVA 1E1RG 2FB5A 1OCRB 3FFQA 2Y69C 1N36O 4DR1O 3ZS8C 1F4NA 2WA4A 4DR5B 4MVRA 3EFFK 3JSNA 4UCRA 3ZHUA 1BZKA 4JI0B 4DR2O 1SQXH 3RYCB 4FFKA 4AQYB 1SETA 3CRQA 1ZSPA 4MVQA 3HR0A 4UUJC 3JAWA 1XNQB 5C8YB 5KA5A 4HZ3A 1VQ4V 1HDJA 1M57B 1OHHG 1H2LA 2UXCB 2B5UA 4GLXA 1ENVA 4HAMA 4D7TA 4LF9O 2HHHB 1AP5A 3N2GB 1H8HG 1Y76A 4YHHB 1LUVA 4O4LA 4JTCB 1OCCC 2QDOA 3QF7A 2CE4A 4P2ZA 4QPKA 1BQZA 3JD0A 1GN6A 4NTXA 3G4SV 5JJEB 2QJ1A 2UUBB 1KECA 1YEWA 3ZMVA
chains in the Genus database with same CATH topology
2R9IA 1SESA 3NXSA 1W0JG 1DF4A 4CZZA 1SERA 3RVYA 4J9ZB 4KUMA 2P7TC 3RVZA 3CCEV 2XAGA 2JJ1G 2V7QG 1BHBA 3AG2C 1OCCB 4LCUC 1EBOA 4UVAA 3SYAA 1BMFG 3ABLC 3OMAB 2QKSA 1KC8W 3CC2V 1NQTA 1YJWV 4MTXA 1GMGA 2YEVA 3TCUA 3OW2U 4RUFA 3CCLV 1VQPV 2XNDG 1M9NA 1NVPD 1FFTB 2WWWA 2DW4A 2P90A 4WFBV 3FB8C 1XL6A 2HR3A 4MS2A 1AI5A 3VOUA 3QNEA 4JAUA 1VQLV 1QLEB 1K5QA 3CPWU 4UV9A 4H33A 5GW7A 2ZQMA 4MTOA 3UM7A 1N8RW 2QM8A 1F4MA 2FTKA 4UV8A 3AG4C 2OTJV 1R73A 2DYSC 1J95A 2HVKC 4P9PA 4QJFB 2GHYA 4MTFA 3E35A 1GTOA 4G28B 1QLNA 4EKWA 3AG2B 3OFNG 5EK0A 4JTAB 3W7UA 3ETGA 1PKXA 3T4DA 1Q86W 3ABLB 1AJNA 2WLNA 1KKDA 1QCEA 1DLBA 2Z3YA 1JCHA 4LBEC 3OAAG 3BEHA 1JOYA 1YHQV 3JD4A 3W7SA 3SYCA 3JD1A 3CCUV 3F7VC 3T2MA 3F7YC 1HWYA 3WFVA 1F23A 4LC1A 4XBFA 3MHHC 2DWEC 4FPPA 2EIKC 5B1BC 1ROPA 3CMAV 1K8AW 1Q81W 1QBZA 1PL0A 2ZDIC 3E2EA 3MD0A 2QEXV 3ZRVA 4PA7A 4UVBA 1K7DA 1PD3A 4E2LA 2PI4A 2DYSB 1R3LC 4QPJA 1NH2B 3X2QC 1MSWD 1NH2D 3FB6C 4PDRA 5B3SC 2EZOA 2Y69B 1K34A 3IFXA 3WG7C 5LBQA 5LHGA 1K4DC 2IH1C 3K0DA 4GX5A 4OXSA 3M99B 2CK3G 2WLKA 4JGSA 3W7XA 3E8FA 5CMUA 3FYIB 3JD3A 3I56V 1I5XA 4X88A 3CXCU 4MVMA 1VQ5V 1VQ9V 3R65A 1P4RA 4JTDB 1AROP 2JJ2G 1VQOV 1LNQA 4I9WA 3EHBB 1COWG 3CP1A 2OTLV 2ITDC 3ZN0A 5CA3A 1QVFU 1Y66A 4N23A 3SJQC 3ZRXA 1VQ8V 3H01A 4WF9V 1JQ0A 4RAIA 3B77A 3P32A 1JX9A 1YI2V 4MT8A 2EIKB 5B1BB 1Q82W 3CCVV 3QO7A 3LNMB 4QIWF 3P30A 4ZBMA 1R3JC 2ATKC 1NJIW 5DM6V 5IY5B 1JJ2U 2QA4V 2NNUA 2XAFA 2H8PC 4U7OA 4Z1MG 3ETEA 3CCQV 5L3GA 3IC7A 2UXXA 3X2QB 5IDJA 3ABTA 2EIMC 4X8AA 4ZKIA 5B3SB 2ZXWC 4FMTA 3WG7B 3ZRWB 4XDJA 2R9RB 3E83A 1S76D 3RBZA 4MVZA 1GO3F 2X7RB 3E8BA 4PDVA 1M90W 3E89A 1M1KW 1UJWB 2QE7G 3AG1C 2Q69A 3ABUA 1YTFB 1YTFD 1QR8A 1K3EA 3AEIA 3LDCA 1H38A 2OCCC 4MSWC 3TETA 1XL4A 2WSSG 2W0FC 2K1EA 4GX0A 1V54B 1JVMA 2Z5UA 4H37A 5IYDO 4MVSA 2JK5C 3PJSK 2A79B 2UXNA 5C93A 2Q6AA 2GSMB 2X6AA 3SYQA 4DXWA 2Y48A 5IYBO 3GB7C 1W0KG 2X6BA 3K08A 1F51A 3TK1A 2DYRC 1K33A 4PDLA 5B1NA 3QO8A 3CC4V 1OCRC 2EIMB 2HFEC 3CMEV 5CN0A 3CCSV 4GCZA 2ZXWB 3RW0A 2V1DA 3ZMUA 1FXVA 3SPGA 1S0VA 1K92A 4PA6A 4QE7A 2IJJA 1H2GA 3ABMC 5B1AC 3LDDA 3OUFA 3FKSG 4DO2A 5EC2C 1KQSU 3AG1B 1EFRG 4RUEA 1GM9A 2IU3A 4HYOA 4R8CA 1PNKA 2OCCB 1FXKC 1M56C 1L1FA 1G4YB 2WLLB 5LHHA 1KP2A 2XAQA 5L3FA 4Q20A 3E8GA 1ZWIC 1NBMG 2C2AA 3ETDA 1VQKV 2EIJC 2DWDC 5KUMA 3E86A 1K5SA 2JEUA 4PA4A 1BL8A 2XASA 2AHZA 1M57C 1R3KC 2Q67A 4MVUA 5CBGA 1S3JA 5B1OA 4RQFA 2ZR3A 2DYRB 1CPYA 3D36A 1K9MW 4WFFA 2IJIA 3OMNB 3ZJZA 3OR6C 2XAJA 4KP4A 3K3WA 1Y4MA 3A0RA 1PNMA 5HFLA 4PDMA 1MOFA 4QNHB 1B6QA 2W6JG 4I5SA 3SPHA 3ABMB 2IW5A 2A9HA 5CBHA 2KB1A 3LUTB 3AG4B 5LGNA 1WPXA 2P67A 1E1QG 4BW5A 4GX1A 5EBLC 3W7TA 3SPCA 5L3EA 3JCZA 5BZBA 4TSFG 3DTUB 3LSQA 3ABKC 4R50A 2LFRA 3E8HA 1AI7A 1H8EG 2EIJB 4ASUG 1R6KA 3SYPA 5H6RA 3FB5C 3T1CA 2WLHA 1Q7YW 3K79A 4PELA 3FB7C 5CBFA 3VBBA 1R6NA 1K73W 2EILC 1FS0G 5EBMC 4QE9A 4WFHA 1MABG 4BIZA 1OCOC 1K97A 5FL7G 1IXMA 1RM1C 2PI5A 1THZA 1NR1A 4WFAV 1V55C 4GX2A 2EINC 2F43G 1DTOA 3OGCC 3D3IA 5L3CA 3KG2A 2BOBC 5LGUA 1K4CC 1E79G 2YEVB 1VQNV 3ZMZA 1YJNV 2IJKA 1YITV 2WLIB 4LP8A 3ABKB 3K9AA 3CCJV 1S72V 2EBOA 4P30A 3SYOA 1SRYA 4BIUA 5EC1C 2DQ3A 3K0GA 2IJHA 3CCMV 5KA6A 2X6CA 2JEXA 5H9CA 2JDIG 3ZIAG 1VQMV 1AR1B 3SPIA 2EILB 4UVCA 1QLEC 4J9YB 1G8MA 1FXHA 1NKDA 2WLJA 3OMIB 1JPXA 1YSCA 2H94A 1RM1B 3STZC 1RPOA 1QVGU 3AG3C 1V55B 2EINB 4G2KA 3SPJA 1AJPA 1AI6A 4WFEA 4PA3A 2M7WA 1DF5A 1S5HC 3CD6V 4JYBA 4TT3G 4N21A 1AJQA 3UKMA 4XDLA 4JF3A 4XDKA 2HVJC 2A0LA 2HLDG 5L3DA 3B8MA 4RQEA 1CP9A 2EJRA 2LFSA 2ZDIA 2ZD9A 1OCZC 1R3IC 1WLEA 2LP7A 2OT5A 4R6ZA 2D3OW 1BHAA 3G6EV 2BOCC 3QO5A 4U7NA 4PA9A 3CC7V 1NVPB 2IH3C 2WLIA 2WAMA 5J9PC 4FIPC 3ZRWA 1OZ0A 3ASNC 3OEEG 5H6QA 1KP3A 4KFMA 3ZMSA 2JIZG 3FYEB 1QR9A 4WCEV 2B1IA 3BY6A 3AG3B 2ITCC 3HPLC 1VQ6V 5HFMA 1TUEB 3K04A 5LGTA 3JYCA 1KD1W 2ZR2A 2B1GA 3LDEA 1P7BA 4JAVA 3ZRSA 2WLMA 4UXNA 1MG1A 1E1RG 3JD2A 1OCRB 4CBCA 5IYCO 4P9OA 3CCRV 4RO2A 1GKFA 3OM3B 4MVOA 2Y69C 5KUKA 2X0LA 1F4NA 4JPRA 3OUSA 4JYCA 4YXWG 1OCZB 4MVRA 3DGEA 5B1AB 3EFFK 1GM7A 2DQ0A 3F5WC 1SZTA 3OR7C 2MK3A 2HG5C 4MW3A 3CYOA 2HJFC 3ML0A 1FXKB 1M56B 3ASNB 3ZN1A 3K06A 1SETA 3HB3B 4MVQA 4UUJC 4G27B 4R7CA 4TWKA 4X89A 4FK5C 5KA5A 5EBWC 4HZ3A 2HKOA 1VQ4V 2QTOA 4FJCC 1M57B 5IY5C 1OHHG 2W6IG 2WLLA 2B5UA 2EZPA 5LHIA 3W7WA 4L87A 2IU0A 2XAHA 1ENVA 4HAMA 3I55V 3ZMTA 3OEHG 3OE7G 1NR7A 5E1AC 4JASA 3ASOC 3T4ZA 4MTGA 3ZCCA 1H8HG 1S77D 1GM8A 3LSSA 1YJ9V 3B8NA 4WFGA 3MHSC 1ORQC 3IGAC 4JTCB 1OCCC 2NLJC 4P2ZA 2QM7A 4QPKA 2Q68A 1V54C 1AI4A 3K03A 3JD0A 1GK9A 1I5YA 2XOKG 1VQ7V 4MW8A 1YIJV 3GWOA 3G4SV 1W2BU 5L3BA 1FXKA 2AHYA 3G71V 3STLC 5DN6G 1PNLA 2YSUB 1KECA 2WPDG 4GT1A 1RPRA 4BAYA 1CEZA 1OCOB 3ASOB 1EZJA 4F4LA 3ZMVA 2P6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITD C;  3ASN C;  5CBH A;  2A9H A;  2KB1 A;  3LUT B;  3SJQ C;  4KFM A;  4BW5 A;  4GX1 A;  5EBL C;  4RAI A;  3RVY A;  4J9Z B;  3SPC A;  5BZB A;  2P7T C;  3RVZ A;  3LNM B;  3HPL C;  1R3J C;  2ITC C;  4ZBM A;  2ATK C;  3K04 A;  3AG2 C;  3JYC A;  4LCU C;  3ABK C;  3SYA A;  4R50 A;  3LDE A;  2H8P C;  1P7B A;  3ZRS A;  2WLM A;  3ABL C;  3E8H A;  2QKS A;  4CBC A;  3TCU A;  3SYP A;  2YEV A;  2EIM C;  4P9O A;  4RO2 A;  4RUF A;  3FB5 C;  2ZXW C;  2WLH A;  4MVO A;  2Y69 C;  3T1C A;  4XDJ A;  5KUK A;  2R9R B;  3E83 A;  3FB7 C;  3OUS A;  5CBF A;  3FB8 C;  1XL6 A;  4MVZ A;  3RBZ A;  4MS2 A;  4MVR A;  3VOU A;  2EIL C;  3EFF K;  3E8B A;  4PDV A;  3E89 A;  3F5W C;  5EBM C;  3AG1 C;  4QE9 A;  2Q69 A;  4H33 A;  4WFH A;  3OR7 C;  1OCO C;  2HG5 C;  4MTO A;  4MW3 A;  2HJF C;  3UM7 A;  3LDC A;  2OCC C;  1V55 C;  4MSW C;  4GX2 A;  3TET A;  2EIN C;  3K06 A;  3OGC C;  4MVQ A;  1XL4 A;  3AG4 C;  2W0F C;  3KG2 A;  2K1E A;  4GX0 A;  2BOB C;  4UUJ C;  1K4C C;  1JVM A;  1J95 A;  2DYS C;  2HVK C;  4G27 B;  4P9P A;  4H37 A;  4MVS A;  2JK5 C;  3PJS K;  2A79 B;  4MTF A;  4R7C A;  4TWK A;  2Q6A A;  2X6A A;  4X89 A;  5EBW C;  4G28 B;  2WLI B;  4HZ3 A;  3SYQ A;  4DXW A;  4EKW A;  2QTO A;  4LP8 A;  3GB7 C;  5EK0 A;  4JTA B;  5IY5 C;  2X6B A;  3K08 A;  2WLL A;  4P30 A;  3SYO A;  3T4D A;  2DYR C;  2WLN A;  4PDL A;  5EC1 C;  1KKD A;  3K0G A;  1OCR C;  2HFE C;  4LBE C;  5E1A C;  3RW0 A;  3BEH A;  3ASO C;  3T4Z A;  2X6C A;  3SPG A;  4PA6 A;  4QE7 A;  4MTG A;  3SYC A;  3ABM C;  3SPI A;  5B1A C;  3LDD A;  1QLE C;  3F7V C;  4J9Y B;  3F7Y C;  3OUF A;  2WLJ A;  3T2M A;  5EC2 C;  4RUE A;  4WFG A;  2DWE C;  4HYO A;  2EIK C;  5B1B C;  4R8C A;  3STZ C;  3AG3 C;  1M56 C;  1ORQ C;  1G4Y B;  2WLL B;  3IGA C;  4JTC B;  1OCC C;  3SPJ A;  2NLJ C;  4P2Z A;  4PA7 A;  4PA3 A;  4WFE A;  3E8G A;  1R3L C;  1V54 C;  1ZWI C;  2Q68 A;  3K03 A;  1S5H C;  2EIJ C;  2DWD C;  5KUM A;  3E86 A;  3X2Q C;  3UKM A;  3FB6 C;  4MW8 A;  4PDR A;  4XDL A;  5B3S C;  4PA4 A;  1BL8 A;  4XDK A;  2HVJ C;  2A0L A;  3IFX A;  2AHZ A;  1M57 C;  1R3K C;  2Q67 A;  1K4D C;  2AHY A;  2IH1 C;  3K0D A;  4GX5 A;  4MVU A;  4OXS A;  5CBG A;  3STL C;  2ZD9 A;  1OCZ C;  1R3I C;  2WLK A;  4R6Z A;  4WFF A;  3E8F A;  3ZJZ A;  4X88 A;  4MVM A;  3OR6 C;  2BOC C;  3R65 A;  4JTD B;  3WG7 C;  1LNQ A;  4I9W A;  4PA9 A;  2IH3 C;  2WLI A;  4F4L A;  5J9P C;  4PDM A;  4QNH B;  4X8A A;  3SPH A; 
#chains in the Genus database with same CATH topology
 2R9I A;  1MNG A;  4DW1 A;  1IBM B;  3RVY A;  3RYH B;  2P7T C;  2HP8 A;  2A06 H;  4DV2 O;  1A32 A;  2XAG A;  2JJ1 G;  2QWN B;  4DUZ O;  1VEW A;  1EBO A;  4UVA A;  3ABL C;  3CWB H;  3OMA B;  1JFF A;  2QKS A;  3CC2 V;  5CA1 A;  1XEQ A;  5LMU B;  2JGD B;  4LF8 O;  2F93 B;  1NVP D;  2WWW A;  2P90 A;  4DRX B;  1AI5 A;  3QNE A;  1VQL V;  4H33 A;  1GRJ A;  3B40 A;  3JAR A;  4B7E A;  3UM7 A;  1N8R W;  1M5I A;  2FTK A;  2QKC A;  3ZHQ A;  2HVK C;  4P9P A;  4QJF B;  2GHY A;  1I94 O;  1GTO A;  2W0X A;  5IJ0 A;  4EKW A;  3OFN G;  3W7U A;  5EZY B;  3HKC B;  2KG7 A;  4O4H B;  3T4D A;  2WLN A;  1XNR O;  2Z3Y A;  3M8A A;  3K5L A;  4LFA B;  5D5P A;  3BEH A;  5F2V O;  4LNU B;  1YHQ V;  1U96 A;  3CRR A;  3T1Y B;  3JD4 A;  3L73 H;  3SYC A;  4IT5 A;  3CCU V;  5LOV A;  4ZI7 A;  4FM1 A;  3F7Y C;  4JZ2 A;  3WFV A;  3MHH C;  2DWE C;  4D7S A;  4NTY A;  4KHP O;  5DEC A;  1IUR A;  3MD0 A;  2CAZ C;  4UVB A;  1K7D A;  1Z2G A;  3H1J H;  2VWJ A;  4LH6 A;  5BR8 O;  1MSW D;  1NH2 D;  4DW0 A;  2P06 A;  2ZCE A;  5LHG A;  4GX5 A;  2EX3 A;  3ICX A;  2VQF O;  1RFY A;  3OD4 A;  1IXB A;  4X1I B;  2F95 B;  4CS3 A;  4LWS B;  3E8F A;  5CMU A;  3I56 V;  1I5X A;  2JGU A;  4MVM A;  4NYK A;  4JTD B;  1P4R A;  4JI8 O;  1ARO P;  3EXA A;  3EHB B;  3CP1 A;  1QVF U;  3DSQ A;  1VQ8 V;  2YIB A;  1JQ0 A;  4RAI A;  2UXB O;  3B77 A;  4MT8 A;  5B1B B;  1Q82 W;  1FFX A;  3CCV V;  5LXT B;  3P30 A;  4OPA A;  2ATK C;  5DM6 V;  3K5N A;  4U7O A;  4Z1M G;  1SC5 B;  4AIL C;  1YZB A;  3IC7 A;  3ABT A;  2EIM C;  3H1I H;  2AGA A;  5IYZ A;  3RBZ A;  1JMK C;  4H44 B;  1GO3 F;  3KKY A;  1M1K W;  1YCI A;  3AG1 C;  5CB4 B;  3ABU A;  3H1K H;  5A2Q N;  1YTF D;  3CJH A;  4EFE A;  3RT3 C;  2OCC C;  4MSW C;  5BMV B;  3TET A;  3FX7 A;  1XL4 A;  3DXR A;  3JAS A;  1XOU A;  4MVS A;  4DXW A;  2GSM B;  4DR5 O;  2X6B A;  1U97 A;  1QHT A;  4PDL A;  4X1K A;  4I50 A;  5JH7 A;  4JI2 B;  3HKD B;  5CN0 A;  1NTK H;  4AQY O;  1S0V A;  1FXV A;  2E5L B;  4QE7 A;  1XNQ O;  4EB6 A;  1AIL A;  3JAW B;  4DO2 A;  5IJ9 A;  2UXC O;  1FXK C;  1G4Y B;  5LHH A;  1ZTE A;  5L3F A;  2GTA A;  5A9G A;  2LGW A;  1IBK B;  3O9O A;  1R3K C;  2VQE B;  1S3J A;  4YHH O;  4A5U B;  4BW9 A;  4ZHQ A;  3QG5 A;  1Y76 B;  4WFF A;  3DC5 A;  3ZJZ A;  1QQC A;  3T1H O;  2RMK B;  4O4L B;  1OV9 A;  2IW5 A;  3LUT B;  3AG4 B;  1DK1 A;  4KL1 A;  1E1Q G;  1W59 A;  4J7J A;  4JAA A;  3CSX A;  4TSF G;  5LP6 C;  5JCO C;  2UUB O;  3ABK C;  1LUW A;  1GN2 A;  2F66 C;  2UUC B;  2R70 A;  2ZNI A;  4IYH A;  3SYP A;  4X64 B;  3FB5 C;  1NI8 A;  1PP9 H;  2F23 A;  1Q7Y W;  1IBM O;  4TOI A;  4Z2W A;  4JI5 B;  4LF6 B;  4QE9 A;  1OCO C;  1K97 A;  1RM1 C;  1THZ A;  1HNX B;  3O65 A;  2P5O A;  1Q6I A;  1V55 C;  5GON A;  3D3I A;  1JFF B;  5LMU O;  5CA1 B;  2PYJ A;  2ZIN A;  3A8T A;  4LH7 A;  3AK3 A;  3K9A A;  3CCJ V;  1S5L Z;  1YDX A;  2IJH A;  1WB7 A;  1EN5 A;  3JAR B;  3BFR A;  2LJ2 A;  2JEX A;  2JDI G;  3SPI A;  4GYC B;  1NKD A;  2WLJ A;  1KUQ A;  1JR9 A;  3OGI B;  1JPX A;  5IJ0 B;  4BIO A;  2EIN B;  2KG7 B;  1B04 A;  4B3R B;  1XHX A;  3R66 A;  4PA3 A;  4NXM B;  4LFA O;  1S5H C;  2E75 B;  3CD6 V;  3OT7 A;  3T1Y O;  4N21 A;  1AJQ A;  3UKM A;  4XDL A;  4JYA B;  1VF5 B;  2HVJ C;  2ZE6 A;  1PV0 A;  3L70 H;  4RQE A;  1NT2 B;  5LOV B;  1OCZ C;  3APO A;  2LP7 A;  3JAK A;  2AW9 A;  3CC7 V;  1I7F A;  1OZ0 A;  3ASN C;  5H6Q A;  5J2U A;  3IC9 A;  2JIZ G;  4OPH A;  1F7Y A;  3AG3 B;  5HFM A;  1TUE B;  3JYC A;  2ZR2 A;  2B1G A;  4TUY A;  3RYI A;  4UXN A;  1MG1 A;  4CS2 A;  3JD2 A;  5IYC O;  4RO2 A;  1GKF A;  5KUK A;  4O2A A;  1HP8 A;  3F5W C;  1VIB A;  2KQX A;  3CYO A;  2HJF C;  4LR3 A;  1N32 B;  2JS5 A;  1Y67 A;  4E4E A;  3CX5 F;  1D5N A;  2GUZ A;  1Q6H A;  4TWK A;  1OJH A;  5IYZ B;  5DED A;  5KAF Z;  5IY5 C;  2WLL A;  2LQT A;  3RGB A;  2EZP A;  5LHI A;  3W7W A;  2IU0 A;  5KHK A;  1NR7 A;  5E1A C;  1I08 A;  2AZ2 A;  2LO1 A;  3CRM A;  5FLX N;  1GH6 A;  3DXR B;  3JAS B;  3B8N A;  4J10 A;  1TA8 A;  5EYP A;  3MHS C;  2RDC A;  3EVK A;  3ZX6 A;  4CH3 A;  4JI2 O;  4X1K B;  4I50 B;  1SA0 B;  2IM9 A;  5JH7 B;  2Q68 A;  2XUM A;  2E5L O;  2A7W A;  4X62 B;  2GDS A;  4MW8 A;  1YIJ V;  1W2B U;  5L3B A;  1FXK A;  2AHY A;  4EB6 B;  4JI1 B;  3G71 V;  5DN6 G;  5IJ9 B;  1ZAU A;  1RPR A;  4BAY A;  1Q43 A;  4DV7 B;  4AHC A;  2UU9 B;  4J41 A;  5J2T A;  2AXT Z;  4LF5 B;  1IBK O;  4LF4 B;  2VQE O;  4K0K B;  3RVZ A;  3CCE V;  4FM0 A;  4TV8 A;  5GTI Z;  1OCC B;  1BMF G;  4PI0 A;  1NQT A;  3JSL A;  1GMG A;  2YEV A;  3TCU A;  5B5E Z;  3OW2 U;  1LR1 A;  4GKJ B;  3CCL V;  5LP6 A;  3H1L H;  2XND G;  5JCO A;  1M9N A;  1GN3 A;  2DW4 A;  3FB8 C;  1Y74 A;  4NB5 A;  4JAU A;  1QLE B;  4DK1 A;  4UV9 A;  4UCO A;  5GW7 A;  4RWU A;  4MTO A;  2UUC O;  3A0H Z;  2QM8 A;  1R73 A;  4X64 O;  4D6T H;  3E35 A;  2P4V A;  5EIB D;  5EK0 A;  4JTA B;  4JI5 O;  4LF6 O;  1B3Q A;  1Q86 W;  3ABL B;  3BAB A;  1HNX O;  3WU2 Z;  4TV9 A;  2CH7 A;  3K59 A;  5GON B;  3W7S A;  1BS3 A;  5JVD A;  4I0X B;  1ZUQ A;  1F23 A;  4XBF A;  4FPP A;  4FM2 A;  1KYO F;  2FML A;  3CMA V;  4DV1 B;  1PM9 A;  1Q81 W;  1PL0 A;  4FLT A;  3BHP A;  4PD4 F;  2QEX V;  4HNA A;  2PI4 A;  4E2L A;  1R3L C;  1N34 O;  3BPZ A;  1RP3 B;  2MW2 B;  2V4D A;  3FB6 C;  5B3S C;  1K34 A;  3IFX A;  3WG7 C;  3P3P A;  4K3A A;  1VQ5 V;  1VQ9 V;  2JS3 A;  1LNQ A;  4I9W A;  5KHH A;  4DV6 B;  4B3R O;  2PZS A;  4NXM O;  1COW G;  2OTL V;  1WB8 A;  2ITD C;  3BAA A;  3CHX A;  2CTR A;  1D5A A;  1ZL8 A;  4JYA O;  1J5E B;  2YIC A;  4QIW F;  4ZBM A;  1NJI W;  1XBL A;  1Q8I A;  4EFB A;  2NNU A;  2H8P C;  2GV9 A;  3JAK B;  5L3G A;  5IDJ A;  4ZKI A;  3LSU A;  2ZXW C;  4FMT A;  1AR5 A;  3AK2 A;  3RN4 A;  5J2U B;  2FKX A;  3G80 A;  2X7R B;  2YXH A;  2QWR B;  2EUL A;  1HNZ B;  2QTS A;  3DC6 A;  3LDC A;  4TUY B;  3RYI B;  2WSS G;  2W0F C;  1V54 B;  1BSM A;  1JVM A;  1XMQ B;  3SYQ A;  3CRC A;  5IYB O;  4O2A B;  1W0K G;  1IBL B;  1CXZ B;  1F51 A;  3TK1 A;  2DYR C;  1K33 A;  2Y4T A;  3CC4 V;  1OCR C;  2EIM B;  3CME V;  3CCS V;  1N32 O;  1H2S B;  4O2B B;  3SPG A;  1K92 A;  3ABM C;  4GZR B;  5ITZ B;  1KBH A;  3FKS G;  1KQS U;  5EC2 C;  3AG1 B;  4RUE A;  2IU3 A;  1G6U A;  4R8C A;  2YXL A;  2OCC B;  1R1B A;  2WLL B;  1TUB A;  1XIL A;  4CH5 A;  4UB8 Z;  1NBM G;  5KMG A;  3ETD A;  1Q90 D;  2LW7 A;  2K9P A;  1K5S A;  1DGS A;  5KHI A;  4PA4 A;  2BTQ A;  2AHZ A;  1M57 C;  3L72 H;  4DUY B;  1HR0 B;  1K9M W;  4B08 A;  2IJI A;  3OR6 C;  5EYP B;  2XAJ A;  1XDC A;  4KP4 A;  3K3W A;  4I7Z B;  1PNM A;  4PDM A;  1MOF A;  5KX5 A;  3D8C A;  2A9H A;  2ZM6 O;  5LGN A;  2P67 A;  5IWA B;  4X62 O;  3ZED A;  3MAQ A;  1XRE A;  1P7G A;  3JCZ A;  2D2C B;  4JI1 O;  2N04 A;  1EN6 A;  4IGG A;  4DV7 O;  1AI7 A;  2UU9 O;  3T1C A;  2WLH A;  5CA0 A;  4PEL A;  5J2T B;  4LF5 O;  4X66 B;  4EEQ A;  4LF4 O;  4K0K O;  2EIL C;  1SZX A;  1FS0 G;  5EBM C;  4WFH A;  4TV8 B;  5FL7 G;  4DV4 B;  4GX2 A;  2F43 G;  1DTO A;  2NN4 A;  3KG2 A;  5D5Q A;  4GKJ O;  2YEV B;  1VQN V;  5LP6 B;  2IJK A;  2WLI B;  4LP8 A;  3ABK B;  5IE9 A;  4UB6 Z;  2EBO A;  4P30 A;  3SYO A;  3K0G A;  3UT5 A;  2CUG A;  1RSO A;  5E79 Z;  1BCC H;  5H9C A;  1AR1 B;  4UVC A;  4J9Y B;  2WA3 A;  4X20 A;  3OMI B;  1RM1 B;  3WB2 A;  3STZ C;  1V55 B;  3SPJ A;  1AJP A;  2ODM A;  2HEP A;  4WFE A;  2M7W A;  4JI0 O;  1DF5 A;  3TGU H;  4TV9 B;  1BQ0 A;  2L35 A;  4CC5 A;  1G1X B;  4JF3 A;  2YIA A;  3Q4H A;  2LFS A;  2ZD9 A;  2ZE5 A;  2OT5 A;  4DV1 O;  3QO5 A;  1TVK A;  4IHJ A;  1NVP B;  2OIG A;  5J9P C;  3UO3 A;  2ZNJ A;  1NS1 A;  4YY3 B;  2R9A A;  2N05 A;  2HHH O;  1VQ6 V;  1KD1 W;  4U3J A;  3LDE A;  3A2F A;  1P7B A;  4DV6 O;  5LL6 Y;  3BRC A;  2BTO A;  1P84 F;  4CBC A;  3J80 N;  3OM3 B;  1SQV H;  2X0L A;  4JPR A;  4JYC A;  4YXW G;  1J5E O;  1OCZ B;  2Q8V A;  3DGE A;  5B1A B;  1ZL8 B;  4I4T A;  1GM7 A;  2RJZ A;  1EM1 A;  2ZT9 B;  3WB0 A;  3OR7 C;  5B66 Z;  2HG5 C;  3ML0 A;  1SQB H;  3SJC C;  1M56 B;  3ASN B;  3ZN1 A;  4DV0 B;  3K06 A;  3HB3 B;  1SS3 A;  3B2E E;  2CDY A;  4J7K A;  2ZIO A;  2E3C A;  4X89 A;  4FK5 C;  5EBW C;  2HKO A;  2DJV A;  4FJC C;  1NTZ H;  2CTP A;  3E22 A;  1HNZ O;  3I55 V;  3OEH G;  3OE7 G;  3J81 N;  4DR7 B;  2Q5Z A;  4JAS A;  3ASO C;  3N2K A;  3RWR D;  2LW1 A;  2YXY A;  4MTG A;  5GTH Z;  2OWO A;  4JI3 B;  1S77 D;  1XMQ O;  2FYU H;  1YJ9 V;  2R72 A;  4WFG A;  1KMI Z;  1IBL O;  4J80 A;  3VQW A;  1WP7 A;  3FD9 A;  1ORQ C;  4DV3 B;  3IGA C;  3L9D A;  2NLJ C;  1I5Y A;  2CTW A;  3GWO A;  3RYC A;  4LFC B;  2F4V B;  4JI4 B;  1PNL A;  2YSU B;  4JYY A;  3B4S A;  1MMM A;  2WPD G;  3KZI Z;  2YUA A;  1SF9 A;  2G38 A;  1EZJ A;  3D3Q A;  4X8A A;  1TUB B;  1SES A;  4FFB A;  5FPO A;  2E74 B;  5KMG B;  4IL6 Z;  4CZZ A;  4J9Z B;  4DUY O;  1ZX3 A;  1HR0 O;  2BTQ B;  1BHB A;  3AG2 C;  4FLU A;  1L0N H;  2P4K A;  4ZI7 B;  1BE3 H;  4K8Z A;  3JCU Z;  1YJW V;  4MTX A;  5IWA O;  3HKB A;  4ZOL A;  4B3M B;  4JI6 B;  4MS2 A;  3CPW U;  4NVP A;  4DV5 B;  2ZQM A;  1AVM A;  1IDS A;  2P22 C;  1Z5W A;  1IX9 A;  4UV8 A;  2OTJ V;  3AG4 C;  4UCV A;  4KXR A;  1M93 A;  2DYS C;  1J95 A;  4NTW A;  4X66 O;  2XHB A;  2QWO B;  4G28 B;  4PV1 B;  1N4C A;  4IIJ A;  1KKD A;  1FAF A;  1PL4 A;  1JCH A;  3OAA G;  1FFX B;  1JOY A;  4BWA A;  1SQP H;  5JWP A;  1HWY A;  1H2K A;  2EIK C;  3THO A;  1ROP A;  2B9Z A;  4PA7 A;  3CEI A;  4W4L A;  3HKE A;  1RSO B;  1WN7 A;  1N33 B;  3X2Q C;  4JI7 B;  2CGN A;  4PDR A;  2YI9 A;  2EZO A;  3CJH B;  2Y69 B;  1QU7 A;  2IH1 C;  3K0D A;  4OXS A;  3OTF A;  1BGY H;  3JD3 A;  4LF7 B;  4X20 B;  4X88 A;  3IJ4 A;  1VQO V;  1BT8 A;  3BA8 A;  1HNW B;  3ZN0 A;  5CA3 A;  1Y66 A;  4O4H A;  3SJQ C;  1I0H A;  2VS0 A;  3VQV A;  3H01 A;  2DOS A;  4WF9 V;  5JJJ B;  3P32 A;  1YI2 V;  3QO7 A;  3LNM B;  3PN1 A;  2QA4 V;  4FVM A;  2XAF A;  3I5D A;  3JAL A;  4C7U A;  3CCQ V;  1TVK B;  2QSA A;  4IHJ B;  5B3S B;  3WG7 B;  4XDJ A;  4YY3 O;  4B3S B;  1S76 D;  3CE2 A;  4MVZ A;  3E8B A;  1M90 W;  1UJW B;  3BCC H;  4LFB B;  5LYJ A;  4ZIB A;  1MZE A;  2DMX A;  1QR8 A;  3AEI A;  5BR8 B;  1H38 A;  4U3J B;  4ZHQ B;  1SQQ H;  1NTM H;  4LWS A;  1N0N A;  2Z5U A;  4YIO A;  4H37 A;  5JJN B;  2JK5 C;  3PJS K;  2UXN A;  2Q6A A;  2X6A A;  4PJ0 Z;  2Y48 A;  1JA8 A;  3K08 A;  4I4T B;  2KKW A;  3J7A U;  4W4K A;  2HFE C;  1US6 A;  4GCZ A;  2ZXW B;  4DV0 O;  2V1D A;  4QGP A;  3ZMU A;  2Q73 A;  3U11 A;  2BSK A;  2UXD B;  4PA6 A;  4DR3 B;  1H2G A;  3LDD A;  1EFR G;  1GM9 A;  4NR1 A;  3C90 A;  2E76 B;  5KHJ A;  1H2N A;  4O4J A;  1KP2 A;  2XAQ A;  4FZ0 A;  4B7K A;  4DR7 O;  4X9Q A;  3SJB C;  3SJA C;  3E8G A;  1ZWI C;  2QR4 A;  1L8D A;  2EIJ C;  2DWD C;  5KUM A;  4OGQ B;  4OX9 B;  1BL8 A;  3N2K B;  3K9S A;  4JI3 O;  2JVD A;  1O9G A;  2Q67 A;  1URF A;  3U10 A;  5B1O A;  4RQF A;  1L0L H;  2DYR B;  4AI8 A;  3OMN B;  1X59 A;  3FAV A;  4DV3 O;  5BXZ A;  4U3F H;  3K58 A;  4QNH B;  1B6Q A;  2W6J G;  3SPH A;  3ABM B;  5CBH A;  2KB1 A;  3UO2 A;  1WPX A;  4BW5 A;  4GX1 A;  5EBL C;  3W7T A;  3SPC A;  3HKD A;  4YIP A;  4UCU A;  4LFC O;  1H2M A;  1GN4 A;  2IBZ H;  2F4V O;  2DE0 X;  4JI4 O;  5AG2 A;  5IT9 N;  3CS5 A;  2LFR A;  4J7Z A;  1XUQ A;  3E8H A;  1FPO A;  4ASU G;  1R6K A;  2RN9 A;  5H6R A;  1VP7 A;  3K79 A;  4FFB B;  3FB7 C;  5CBF A;  2H3O A;  1K73 W;  1MAB G;  3S3W A;  4GUN A;  3A0B Z;  1IXM A;  2PI5 A;  4FLV A;  4WFA V;  1Q3E A;  2QWQ B;  2UUA B;  5L3C A;  3GWK C;  3L74 H;  5LGU A;  1TGO A;  3TXS A;  3ZMZ A;  4B3M O;  4JI6 O;  1YIT V;  3HKB B;  4ZOL B;  3T1H B;  1O9H A;  4Q6G A;  1VF7 A;  1S72 V;  2ETN A;  5EC1 C;  2RNB A;  4DV5 O;  1T5E A;  3UCS C;  2X6C A;  3ZIA G;  2EIL B;  3MDS A;  1QLE C;  3JAT A;  2ADP A;  4YJ2 A;  2H94 A;  4DR4 B;  4WBN A;  2ZE7 A;  4IIJ B;  4G2K A;  1AI6 A;  4O4I A;  1WJZ A;  2Q0O C;  4JYB A;  4I55 A;  1XQ8 A;  2HLD G;  3OTO B;  3B8M A;  4GKK B;  1CP9 A;  2EJR A;  1R6T A;  1R3I C;  1WLE A;  1FYJ A;  4R6Z A;  1X4T A;  4CC6 A;  2BE3 A;  2NR5 A;  2GUZ B;  1WNS A;  4U7N A;  1EN4 A;  4PA9 A;  2OIE A;  2WAM A;  3ETQ A;  4HBN A;  3ZRW A;  1WAZ A;  2ILM A;  1N33 O;  3HKE B;  4JI7 O;  4B3T B;  4DR6 B;  3FYE B;  1QR9 A;  2HJD A;  4WCE V;  2B1I A;  3BY6 A;  3HPL C;  2ITC C;  1FD9 A;  3K04 A;  5LGT A;  4LF7 O;  2YDE A;  1XHZ A;  3ZRS A;  2WLM A;  3VQY A;  2RCV A;  1HNW O;  4X65 B;  1SKV A;  4P9O A;  1N0J A;  5FNV A;  3CCR V;  2XTA A;  4MVO A;  3C3T A;  3OUS A;  4UCT A;  2YC0 A;  2JRI A;  2DQ0 A;  1KB9 F;  4IYI A;  1SZT A;  4JV5 B;  2MK3 A;  5KAI Z;  4MW3 A;  1FXK B;  3JAL B;  4B3S O;  4G27 B;  4R7C A;  2QTO A;  2DN9 A;  2W6I G;  4LFB O;  5TIS Z;  2YS8 A;  4L87 A;  2XAH A;  5LYJ B;  3ZMT A;  3S3X A;  1XMO B;  3P3N A;  3T4Z A;  1IZ3 A;  3ZCC A;  2L6L A;  1GM8 A;  3LSS A;  1YF2 A;  3QTC A;  1SQG A;  2Q9L A;  4CH6 A;  3GVM A;  3D36 C;  1Y74 B;  2QM7 A;  1V54 C;  1AI4 A;  3K03 A;  1GK9 A;  2UXD O;  4DR3 O;  2XOK G;  1VQ7 V;  1UFI A;  2BSK B;  3TXQ A;  3AG7 A;  3STL C;  1P49 A;  4X1Y A;  4GT1 A;  4J11 A;  1CEZ A;  2GTS A;  3SR2 C;  4NXN B;  4FLW A;  1OCO B;  3ASO B;  4F4L A;  3K5M A;  2PY5 A;  4O4J B;  2P6J A;  3NXS A;  1W0J G;  2YID A;  3WB1 A;  1DF4 A;  1WA8 A;  4OX9 O;  1SER A;  3B09 A;  4KUM A;  2Q7G A;  1V9P A;  5EIB C;  2CH7 B;  2A3Q A;  2V7Q G;  4LCU C;  3SYA A;  1Q5O A;  2BCC H;  5JVD B;  3FAV B;  1KC8 W;  1FJG B;  2PYL A;  4RUF A;  3RYF A;  1VQP V;  1FFT B;  4WFB V;  4NKG B;  1XL6 A;  2HR3 A;  4HNA B;  3VOU A;  1SA0 A;  1K5Q A;  4F6R A;  3APQ A;  3NR7 A;  5JQG A;  2XT9 A;  2EJ7 A;  1F4M A;  1NZ6 A;  4FLX A;  4MTF A;  1QLN A;  5LMN B;  3AG2 B;  1PPJ H;  3ETG A;  2ZKO A;  1PKX A;  1MA1 A;  1AJN A;  2YIB D;  1EZV H;  1QCE A;  2Q0A A;  1DLB A;  4DK0 A;  4LBE C;  2UUA O;  4J42 A;  3BA9 A;  3CXH F;  1VAR A;  3JD1 A;  3F7V C;  3T2M A;  2Q7E A;  3CB2 A;  4YJ3 A;  4LC1 A;  2PF4 E;  5B1B C;  1K8A W;  3L71 H;  1VF6 C;  1QBZ A;  3ZBH A;  2ZDI C;  3E2E A;  3ZRV A;  4L8J A;  1PD3 A;  2DYS B;  2F1M A;  3H9V A;  5K1P A;  4QPJ A;  3KCY A;  2CGO A;  1NH2 B;  4TQD A;  5LA6 A;  4CH4 A;  5LBQ A;  1K4D C;  3M99 B;  2CK3 G;  2KSD A;  4TQF A;  2WLK A;  3JAT B;  4JGS A;  4FZ1 A;  3W7X A;  4DR4 O;  3CXC U;  3FYI B;  4YJ2 B;  3SGI A;  3R65 A;  2JJ2 G;  4WBN B;  4DYL A;  3L75 H;  3C3S A;  4O4I B;  1YXB A;  1D2D A;  5H2F Z;  3TJT A;  4FLY A;  1KKC A;  1N36 B;  4N23 A;  3ZRX A;  4DR1 B;  4I55 B;  3OTO O;  1JX9 A;  3U0Z A;  4GKK O;  2EIK B;  1R3J C;  4BR6 A;  5IY5 B;  3BVO A;  1JJ2 U;  4DR2 B;  3ETE A;  5FPR A;  3JAM N;  4I0X A;  2UXX A;  3X2Q B;  3CRA A;  5C8Y A;  3ZRW B;  1WPB A;  4B3T O;  4DR6 O;  2R9R B;  3E83 A;  4PHZ A;  2ZIM A;  2OYQ A;  4CS4 A;  4PDV A;  3IAY A;  3E89 A;  2QE7 G;  2Q69 A;  1YTF B;  1N34 B;  4I9Q A;  1K3E A;  2YI8 A;  2VRZ A;  3AK1 A;  4UCS A;  4X65 O;  2OCH A;  3N2G A;  4LF9 B;  2K1E A;  4GX0 A;  5FNV B;  5IYD O;  2A79 B;  5C93 A;  1VMG A;  5KX5 B;  3GB7 C;  1MSD A;  5B1N A;  4JV5 O;  3QO8 A;  3H1H H;  3RW0 A;  1Z5V A;  3QVN A;  1S5J A;  4H13 B;  2IJJ A;  4K35 A;  3UQ8 A;  5B1A C;  3K5O A;  4K8X A;  5BY1 A;  3OUF A;  2AZ0 A;  1JJO A;  1B06 A;  4HYO A;  5CA0 B;  1PNK A;  3RFR A;  1Q6U A;  1M56 C;  1L1F A;  1SQF A;  5KHG A;  2Y0P A;  2PGG A;  4Q20 A;  1ZLZ A;  1XMO O;  2C2A A;  4DV4 O;  1VQK V;  3E86 A;  2QGN A;  3RYH A;  3M7M X;  2JEU A;  2XAS A;  4MVU A;  5CBG A;  1M4U A;  4DV2 B;  1HW7 A;  2ZR3 A;  1CPY A;  3D36 A;  4DUZ B;  2PUS A;  1Y4M A;  2Y0I A;  3A0R A;  2JGD A;  5HFL A;  4I5S A;  4LF8 B;  1MZF A;  4DRX A;  3UT5 B;  5L3E A;  1UPG A;  5BZB A;  2PTM A;  3K57 A;  2Y4U A;  1WP8 A;  3DTU B;  4O2B A;  3LSQ A;  1TAE A;  4R50 A;  5ITZ A;  3ZHR A;  4NXN O;  4X1Y B;  1H8E G;  2EIJ B;  1QNM A;  5K1X A;  1IVS A;  1FKA O;  2QKA A;  4Z1V A;  3VBB A;  1I94 B;  1R6N A;  5EZY A;  3HKC A;  1WA8 B;  2VWK A;  4F6E A;  2O57 A;  4BIZ A;  1AR4 A;  5KLV H;  1XNR B;  1NR1 A;  3Q4H B;  4LNU A;  2EIN C;  4ABM A;  1FJG O;  3OGC C;  3ZHV A;  2Z0A A;  2BOB C;  1K4C C;  1E79 G;  2ZE8 A;  2M6Y A;  3RYF B;  1YVW A;  1NU1 H;  1YJN V;  5H5N A;  3KCX A;  2GBO A;  1SRY A;  3ZHT A;  1KU9 A;  4BIU A;  4F6R B;  2DQ3 A;  4KHP B;  5JQG B;  2ZM6 B;  3SDL A;  3CCM V;  2QWP B;  5KA6 A;  1AB3 A;  1VQM V;  2ADQ B;  3VQX A;  4X1I A;  2FL4 A;  1G8M A;  1FXH A;  2VQF B;  5LMN O;  2LGQ A;  1YSC A;  3LNN A;  4PI2 A;  1RPO A;  1QVG U;  3AG3 C;  4JI8 B;  3ZHS A;  4UFZ A;  3G6B A;  4JZG A;  4TT3 G;  1XI1 A;  2QM4 A;  4XDK A;  5L3D A;  2A0L A;  2UXB B;  5LXT A;  4FLZ A;  1VF6 A;  1Y6X A;  2ZDI A;  2D3O W;  1BHA A;  3F5T A;  4YJ3 B;  3G6E V;  2BOC C;  2ARH A;  2IH3 C;  2WLI A;  4FIP C;  2CTQ A;  1AP6 A;  2Q7H A;  2RQ6 A;  3OEE G;  1GAX A;  1KP3 A;  3E22 B;  4KFM A;  3ZMS A;  2Q4P A;  5LA6 B;  5CB4 A;  2N74 A;  3N27 A;  4H0L B;  4ICG A;  3G67 A;  5BMV A;  4JAV A;  1E1R G;  2FB5 A;  1OCR B;  3FFQ A;  2Y69 C;  1N36 O;  4DR1 O;  3ZS8 C;  1F4N A;  2WA4 A;  4DR5 B;  4MVR A;  3EFF K;  3JSN A;  4UCR A;  3ZHU A;  1BZK A;  4JI0 B;  4DR2 O;  1SQX H;  3RYC B;  4FFK A;  4AQY B;  1SET A;  3CRQ A;  1ZSP A;  4MVQ A;  3HR0 A;  4UUJ C;  3JAW A;  1XNQ B;  5C8Y B;  5KA5 A;  4HZ3 A;  1VQ4 V;  1HDJ A;  1M57 B;  1OHH G;  1H2L A;  2UXC B;  2B5U A;  4GLX A;  1ENV A;  4HAM A;  4D7T A;  4LF9 O;  2HHH B;  1AP5 A;  3N2G B;  1H8H G;  1Y76 A;  4YHH B;  1LUV A;  4O4L A;  4JTC B;  1OCC C;  2QDO A;  3QF7 A;  2CE4 A;  4P2Z A;  4QPK A;  1BQZ A;  3JD0 A;  1GN6 A;  4NTX A;  3G4S V;  5JJE B;  2QJ1 A;  2UUB B;  1KEC A;  1YEW A;  3ZMV A; 
#chains in the Genus database with same CATH homology
 2R9I A;  1SES A;  3NXS A;  1W0J G;  1DF4 A;  4CZZ A;  1SER A;  3RVY A;  4J9Z B;  4KUM A;  2P7T C;  3RVZ A;  3CCE V;  2XAG A;  2JJ1 G;  2V7Q G;  1BHB A;  3AG2 C;  1OCC B;  4LCU C;  1EBO A;  4UVA A;  3SYA A;  1BMF G;  3ABL C;  3OMA B;  2QKS A;  1KC8 W;  3CC2 V;  1NQT A;  1YJW V;  4MTX A;  1GMG A;  2YEV A;  3TCU A;  3OW2 U;  4RUF A;  3CCL V;  1VQP V;  2XND G;  1M9N A;  1NVP D;  1FFT B;  2WWW A;  2DW4 A;  2P90 A;  4WFB V;  3FB8 C;  1XL6 A;  2HR3 A;  4MS2 A;  1AI5 A;  3VOU A;  3QNE A;  4JAU A;  1VQL V;  1QLE B;  1K5Q A;  3CPW U;  4UV9 A;  4H33 A;  5GW7 A;  2ZQM A;  4MTO A;  3UM7 A;  1N8R W;  2QM8 A;  1F4M A;  2FTK A;  4UV8 A;  3AG4 C;  2OTJ V;  1R73 A;  2DYS C;  1J95 A;  2HVK C;  4P9P A;  4QJF B;  2GHY A;  4MTF A;  3E35 A;  1GTO A;  4G28 B;  1QLN A;  4EKW A;  3AG2 B;  3OFN G;  5EK0 A;  4JTA B;  3W7U A;  3ETG A;  1PKX A;  3T4D A;  1Q86 W;  3ABL B;  1AJN A;  2WLN A;  1KKD A;  1QCE A;  1DLB A;  2Z3Y A;  1JCH A;  4LBE C;  3OAA G;  3BEH A;  1JOY A;  1YHQ V;  3JD4 A;  3W7S A;  3SYC A;  3JD1 A;  3CCU V;  3F7V C;  3T2M A;  3F7Y C;  1HWY A;  3WFV A;  1F23 A;  4LC1 A;  4XBF A;  3MHH C;  2DWE C;  4FPP A;  2EIK C;  5B1B C;  1ROP A;  3CMA V;  1K8A W;  1Q81 W;  1QBZ A;  1PL0 A;  2ZDI C;  3E2E A;  3MD0 A;  2QEX V;  3ZRV A;  4PA7 A;  4UVB A;  1K7D A;  1PD3 A;  4E2L A;  2PI4 A;  2DYS B;  1R3L C;  4QPJ A;  1NH2 B;  3X2Q C;  1MSW D;  1NH2 D;  3FB6 C;  4PDR A;  5B3S C;  2EZO A;  2Y69 B;  1K34 A;  3IFX A;  3WG7 C;  5LBQ A;  5LHG A;  1K4D C;  2IH1 C;  3K0D A;  4GX5 A;  4OXS A;  3M99 B;  2CK3 G;  2WLK A;  4JGS A;  3W7X A;  3E8F A;  5CMU A;  3FYI B;  3JD3 A;  3I56 V;  1I5X A;  4X88 A;  3CXC U;  4MVM A;  1VQ5 V;  1VQ9 V;  3R65 A;  1P4R A;  4JTD B;  1ARO P;  2JJ2 G;  1VQO V;  1LNQ A;  4I9W A;  3EHB B;  1COW G;  3CP1 A;  2OTL V;  2ITD C;  3ZN0 A;  5CA3 A;  1QVF U;  1Y66 A;  4N23 A;  3SJQ C;  3ZRX A;  1VQ8 V;  3H01 A;  4WF9 V;  1JQ0 A;  4RAI A;  3B77 A;  3P32 A;  1JX9 A;  1YI2 V;  4MT8 A;  2EIK B;  5B1B B;  1Q82 W;  3CCV V;  3QO7 A;  3LNM B;  4QIW F;  3P30 A;  4ZBM A;  1R3J C;  2ATK C;  1NJI W;  5DM6 V;  5IY5 B;  1JJ2 U;  2QA4 V;  2NNU A;  2XAF A;  2H8P C;  4U7O A;  4Z1M G;  3ETE A;  3CCQ V;  5L3G A;  3IC7 A;  2UXX A;  3X2Q B;  5IDJ A;  3ABT A;  2EIM C;  4X8A A;  4ZKI A;  5B3S B;  2ZXW C;  4FMT A;  3WG7 B;  3ZRW B;  4XDJ A;  2R9R B;  3E83 A;  1S76 D;  3RBZ A;  4MVZ A;  1GO3 F;  2X7R B;  3E8B A;  4PDV A;  1M90 W;  3E89 A;  1M1K W;  1UJW B;  2QE7 G;  3AG1 C;  2Q69 A;  3ABU A;  1YTF B;  1YTF D;  1QR8 A;  1K3E A;  3AEI A;  3LDC A;  1H38 A;  2OCC C;  4MSW C;  3TET A;  1XL4 A;  2WSS G;  2W0F C;  2K1E A;  4GX0 A;  1V54 B;  1JVM A;  2Z5U A;  4H37 A;  5IYD O;  4MVS A;  2JK5 C;  3PJS K;  2A79 B;  2UXN A;  5C93 A;  2Q6A A;  2GSM B;  2X6A A;  3SYQ A;  4DXW A;  2Y48 A;  5IYB O;  3GB7 C;  1W0K G;  2X6B A;  3K08 A;  1F51 A;  3TK1 A;  2DYR C;  1K33 A;  4PDL A;  5B1N A;  3QO8 A;  3CC4 V;  1OCR C;  2EIM B;  2HFE C;  3CME V;  5CN0 A;  3CCS V;  4GCZ A;  2ZXW B;  3RW0 A;  2V1D A;  3ZMU A;  1FXV A;  3SPG A;  1S0V A;  1K92 A;  4PA6 A;  4QE7 A;  2IJJ A;  1H2G A;  3ABM C;  5B1A C;  3LDD A;  3OUF A;  3FKS G;  4DO2 A;  5EC2 C;  1KQS U;  3AG1 B;  1EFR G;  4RUE A;  1GM9 A;  2IU3 A;  4HYO A;  4R8C A;  1PNK A;  2OCC B;  1FXK C;  1M56 C;  1L1F A;  1G4Y B;  2WLL B;  5LHH A;  1KP2 A;  2XAQ A;  5L3F A;  4Q20 A;  3E8G A;  1ZWI C;  1NBM G;  2C2A A;  3ETD A;  1VQK V;  2EIJ C;  2DWD C;  5KUM A;  3E86 A;  1K5S A;  2JEU A;  4PA4 A;  1BL8 A;  2XAS A;  2AHZ A;  1M57 C;  1R3K C;  2Q67 A;  4MVU A;  5CBG A;  1S3J A;  5B1O A;  4RQF A;  2ZR3 A;  2DYR B;  1CPY A;  3D36 A;  1K9M W;  4WFF A;  2IJI A;  3OMN B;  3ZJZ A;  3OR6 C;  2XAJ A;  4KP4 A;  3K3W A;  1Y4M A;  3A0R A;  1PNM A;  5HFL A;  4PDM A;  1MOF A;  4QNH B;  1B6Q A;  2W6J G;  4I5S A;  3SPH A;  3ABM B;  2IW5 A;  2A9H A;  5CBH A;  2KB1 A;  3LUT B;  3AG4 B;  5LGN A;  1WPX A;  2P67 A;  1E1Q G;  4BW5 A;  4GX1 A;  5EBL C;  3W7T A;  3SPC A;  5L3E A;  3JCZ A;  5BZB A;  4TSF G;  3DTU B;  3LSQ A;  3ABK C;  4R50 A;  2LFR A;  3E8H A;  1AI7 A;  1H8E G;  2EIJ B;  4ASU G;  1R6K A;  3SYP A;  5H6R A;  3FB5 C;  3T1C A;  2WLH A;  1Q7Y W;  3K79 A;  4PEL A;  3FB7 C;  5CBF A;  3VBB A;  1R6N A;  1K73 W;  2EIL C;  1FS0 G;  5EBM C;  4QE9 A;  4WFH A;  1MAB G;  4BIZ A;  1OCO C;  1K97 A;  5FL7 G;  1IXM A;  1RM1 C;  2PI5 A;  1THZ A;  1NR1 A;  4WFA V;  1V55 C;  4GX2 A;  2EIN C;  2F43 G;  1DTO A;  3OGC C;  3D3I A;  5L3C A;  3KG2 A;  2BOB C;  5LGU A;  1K4C C;  1E79 G;  2YEV B;  1VQN V;  3ZMZ A;  1YJN V;  2IJK A;  1YIT V;  2WLI B;  4LP8 A;  3ABK B;  3K9A A;  3CCJ V;  1S72 V;  2EBO A;  4P30 A;  3SYO A;  1SRY A;  4BIU A;  5EC1 C;  2DQ3 A;  3K0G A;  2IJH A;  3CCM V;  5KA6 A;  2X6C A;  2JEX A;  5H9C A;  2JDI G;  3ZIA G;  1VQM V;  1AR1 B;  3SPI A;  2EIL B;  4UVC A;  1QLE C;  4J9Y B;  1G8M A;  1FXH A;  1NKD A;  2WLJ A;  3OMI B;  1JPX A;  1YSC A;  2H94 A;  1RM1 B;  3STZ C;  1RPO A;  1QVG U;  3AG3 C;  1V55 B;  2EIN B;  4G2K A;  3SPJ A;  1AJP A;  1AI6 A;  4WFE A;  4PA3 A;  2M7W A;  1DF5 A;  1S5H C;  3CD6 V;  4JYB A;  4TT3 G;  4N21 A;  1AJQ A;  3UKM A;  4XDL A;  4JF3 A;  4XDK A;  2HVJ C;  2A0L A;  2HLD G;  5L3D A;  3B8M A;  4RQE A;  1CP9 A;  2EJR A;  2LFS A;  2ZDI A;  2ZD9 A;  1OCZ C;  1R3I C;  1WLE A;  2LP7 A;  2OT5 A;  4R6Z A;  2D3O W;  1BHA A;  3G6E V;  2BOC C;  3QO5 A;  4U7N A;  4PA9 A;  3CC7 V;  1NVP B;  2IH3 C;  2WLI A;  2WAM A;  5J9P C;  4FIP C;  3ZRW A;  1OZ0 A;  3ASN C;  3OEE G;  5H6Q A;  1KP3 A;  4KFM A;  3ZMS A;  2JIZ G;  3FYE B;  1QR9 A;  4WCE V;  2B1I A;  3BY6 A;  3AG3 B;  2ITC C;  3HPL C;  1VQ6 V;  5HFM A;  1TUE B;  3K04 A;  5LGT A;  3JYC A;  1KD1 W;  2ZR2 A;  2B1G A;  3LDE A;  1P7B A;  4JAV A;  3ZRS A;  2WLM A;  4UXN A;  1MG1 A;  1E1R G;  3JD2 A;  1OCR B;  4CBC A;  5IYC O;  4P9O A;  3CCR V;  4RO2 A;  1GKF A;  3OM3 B;  4MVO A;  2Y69 C;  5KUK A;  2X0L A;  1F4N A;  4JPR A;  3OUS A;  4JYC A;  4YXW G;  1OCZ B;  4MVR A;  3DGE A;  5B1A B;  3EFF K;  1GM7 A;  2DQ0 A;  3F5W C;  1SZT A;  3OR7 C;  2MK3 A;  2HG5 C;  4MW3 A;  3CYO A;  2HJF C;  3ML0 A;  1FXK B;  1M56 B;  3ASN B;  3ZN1 A;  3K06 A;  1SET A;  3HB3 B;  4MVQ A;  4UUJ C;  4G27 B;  4R7C A;  4TWK A;  4X89 A;  4FK5 C;  5KA5 A;  5EBW C;  4HZ3 A;  2HKO A;  1VQ4 V;  2QTO A;  4FJC C;  1M57 B;  5IY5 C;  1OHH G;  2W6I G;  2WLL A;  2B5U A;  2EZP A;  5LHI A;  3W7W A;  4L87 A;  2IU0 A;  2XAH A;  1ENV A;  4HAM A;  3I55 V;  3ZMT A;  3OEH G;  3OE7 G;  1NR7 A;  5E1A C;  4JAS A;  3ASO C;  3T4Z A;  4MTG A;  3ZCC A;  1H8H G;  1S77 D;  1GM8 A;  3LSS A;  1YJ9 V;  3B8N A;  4WFG A;  3MHS C;  1ORQ C;  3IGA C;  4JTC B;  1OCC C;  2NLJ C;  4P2Z A;  2QM7 A;  4QPK A;  2Q68 A;  1V54 C;  1AI4 A;  3K03 A;  3JD0 A;  1GK9 A;  1I5Y A;  2XOK G;  1VQ7 V;  4MW8 A;  1YIJ V;  3GWO A;  3G4S V;  1W2B U;  5L3B A;  1FXK A;  2AHY A;  3G71 V;  3STL C;  5DN6 G;  1PNL A;  2YSU B;  1KEC A;  2WPD G;  4GT1 A;  1RPR A;  4BAY A;  1CEZ A;  1OCO B;  3ASO B;  1EZJ A;  4F4L A;  3ZMV A;  2P6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...