4HZ3A

Mthk pore crystallized in presence of tbsb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
molecule keywords Calcium-gated potassium channel mthK
total genus 32
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hz3A00
3ABLC 2Q68A 3RVYA 3EFFK 3T1CA 5KUMA 2WLIA 2EIKC 3RBZA 2EINC 4RAIA 3SPHA 3OUSA 3T2MA 4MW8A 4H37A 2HVKC 1V55C 2AHYA 2WLLA 2ATKC 3T4ZA 3K0DA 4GX0A 4MTGA 3ZRSA 2EILC 2A9HA 2HJFC 3SYQA 3K0GA 3K06A 4P30A 4WFFA 2YEVA 4J9ZB 1G4YB 2DYRC 4MVOA 5EBLC 1S5HC 3SJQC 2Q67A 2ZD9A 2X6CA 1OCCC 3LNMB 4GX5A 4MTOA 1JVMA 2JK5C 3IFXA 4GX2A 4H33A 4P9PA 2Y69C 3UKMA 4MVMA 3F7YC 1XL6A 4MVQA 3TETA 3KG2A 5EC2C 1R3IC 3FB6C 2DWEC 3PJSK 5EC1C 1KKDA 2QTOA 4PA3A 4R7CA 2WLMA 1J95A 4MVZA 5EBMC 4KFMA 4X89A 1LNQA 3LDDA 3OR6C 2QKSA 3FB8C 1XL4A 4PDMA 3SYAA 4MVSA 4RUFA 4RUEA 4WFHA 4BW5A 4XDKA 4MSWC 3E8GA 4JTCB 4MVUA 3SYOA 2OCCC 1M57C 2DWDC 4MS2A 4HYOA 4X88A 2X6AA 3AG3C 3STZC 2IH1C 3K04A 5CBHA 4R50A 3SPJA 4JTDB 4UUJC 5IY5C 4WFGA 2NLJC 4J9YB 4ZBMA 4QNHB 4OXSA 3OUFA 4P2ZA 4GX1A 2Q6AA 1OCOC 4PDLA 4QE9A 5BZBA 2EIJC 4TWKA 3TCUA 3WG7C 3LDCA 2BOBC 1R3LC 2WLLB 3AG2C 4JTAB 5EK0A 4RO2A 2EIMC 4XDJA 5B1AC 1BL8A 2HFEC 3LUTB 3E89A 3ASOC 4LBEC 4R8CA 4EKWA 2WLIB 3E8BA 4G28B 4G27B 4XDLA 3T4DA 4WFEA 3VOUA 3BEHA 4X8AA 5KUKA 1P7BA 1K4DC 2KB1A 2ITCC 4MTFA 3GB7C 5EBWC 2WLNA 4R6ZA 3STLC 2HVJC 1K4CC 2IH3C 5E1AC 4MW3A 2A0LA 4DXWA 3SPCA 4PA4A 3LDEA 3UM7A 3AG1C 3E8HA 3RVZA 3RW0A 4PDRA 3ABKC 1R3JC 1ZWIC 3ZJZA 2AHZA 4LP8A 1R3KC 3OGCC 4P9OA 2A79B 3K08A 4LCUC 4HZ3A 4I9WA 5CBFA 3HPLC 3R65A 2W0FC 3SPGA 3ABMC 3JYCA 2Q69A 2BOCC 4PA6A 2WLJA 4MVRA 1V54C 1OCRC 2WLKA 4PDVA 4CBCA 5J9PC 3E86A 2ITDC 2DYSC 3X2QC 5B3SC 3SYPA 2X6BA 2H8PC 3E83A 1M56C 2P7TC 5B1BC 3SPIA 3AG4C 3E8FA 5CBGA 2K1EA 4QE7A 1OCZC 4PA9A 4F4LA 3ASNC 3FB5C 2HG5C 2ZXWC 1ORQC 3OR7C 3K03A 3SYCA 3F5WC 2WLHA 3IGAC 4PA7A 1QLEC 3F7VC 2R9RB 3FB7C
chains in the Genus database with same CATH superfamily
4GKKB 1SQPH 3RBZA 1VQ6V 1AI6A 2A7WA 2HVKC 3CB2A 3HKDB 3K0DA 1K8AW 3K0GA 3JALA 3ZHTA 1XHXA 1VP7A 3UQ8A 2E76B 2M7WA 1IBKB 2R9IA 5LP6B 3G80A 3QVNA 4YJ2A 2IM9A 1Z2GA 3K5LA 1SETA 4X65O 3CXHF 1GMGA 1WP7A 1BZKA 2X7RB 4K3AA 4WFAV 4DV5O 5H6RA 4PDMA 4UXNA 3KCYA 1IBMO 4LF8B 4DR1O 1MA1A 4YIPA 1UJWB 4MS2A 1Q6IA 2UXCO 4UB6Z 5KHKA 2ARHA 1S76D 3LSQA 4N21A 4JTAB 4TOIA 4YJ2B 2VRZA 2IJJA 1TAEA 3K5OA 4Z1MG 4LFAB 4E4EA 5B3SB 1YJ9V 1P7BA 3SJCC 2DOSA 2M6YA 5IDJA 2GSMB 1AB3A 2Q0OC 4NVPA 4XBFA 4LH6A 4X66O 4B7EA 3AG1B 1KP3A 1JQ0A 4W4LA 1XOUA 1PP9H 2ZE5A 4TT3G 3JAMN 4DR1B 1GH6A 1MZEA 3SR2C 3UT5A 1W59A 3CC2V 2YSUB 5LOVB 4NKGB 2BE3A 4DYLA 1DLBA 1I7FA 4D6TH 1QCEA 3OR7C 2ZIMA 1ROPA 3AK1A 4J10A 5LGUA 4I5SA 1NS1A 1XNQB 4K35A 2VS0A 2Q0AA 3IAYA 2KQXA 2CGNA 5IYZB 3E22B 3BVOA 4F6RA 4O4LB 1WPBA 4JI4B 1AI4A 2P90A 1X59A 4K8XA 1M93A 1EBOA 4IYIA 3FB6C 3PJSK 2IJHA 3RYIA 2Z5UA 4WCEV 2N74A 3G4SV 4FLTA 1HW7A 4X64O 4L87A 1PL4A 4RUEA 2CTWA 5BR8O 1RSOB 3KZIZ 4WBNB 3JD0A 4TV9A 4JI2B 2FTKA 1VARA 1VQ7V 1VQ9V 4JTDB 2BCCH 2O57A 5KHGA 3ZBHA 4P2ZA 3RWRD 1KQSU 2RN9A 1FXHA 4TWKA 3LDCA 4CS2A 1PV0A 2EJ7A 3AG7A 5GONA 4U3JA 4WFEA 4DV0B 1SQVH 3JCUZ 4R6ZA 1YVWA 5LYJA 2IBZH 3ABMB 2UUAB 2DMXA 3P3NA 2UXXA 3D3QA 3RVZA 2JEUA 5L3FA 4LP8A 2EX3A 4NTYA 4MTXA 1WA8A 4TUYA 5CBFA 3OTFA 1H2GA 2F93B 3CRAA 3K57A 2UUBB 1Z5WA 4JI3B 4X64B 5B1BC 1NU1H 4PA9A 4HNAB 1PNMA 3IGAC 4ZOLA 4LF4B 2R9RB 4H0LB 3C90A 5LHIA 3RVYA 5IWAO 3OFNG 5IYDO 1PPJH 2XUMA 1V55C 4W4KA 3T4ZA 1S3JA 4EFBA 4DRXB 3O65A 3K06A 1PL0A 2D3OW 4J9ZB 3WB2A 1QBZA 3PN1A 2PYJA 1JFFB 4GYCB 3ZRXA 1S5HC 4NXNB 4UV8A 4DV4O 4P9PA 2GHYA 3BY6A 4MVMA 4D7SA 2QWRB 4D7TA 2JJ2G 1YHQV 2HLDG 3IJ4A 2BSKB 4IYHA 1THZA 1QVFU 4KFMA 3CP1A 2BSKA 4I0XA 3JAWB 3HKCB 3AK2A 5EZYB 1DF5A 2LGWA 1YTFD 4RUFA 2IU3A 1GK9A 1G6UA 1CPYA 4JTCB 1RP3B 2OCCC 3MDSA 1JFFA 3SPJA 1KB9F 4LF5B 1HDJA 2EIJC 2W0XA 2E5LB 3CCSV 4I55A 4LBEC 1RPOA 3T4DA 3K3WA 2CH7A 2PY5A 2W6JG 5KAIZ 1K4CC 4HNAA 4FM2A 4ZI7B 3M8AA 4JASA 2Y4UA 3BA8A 2PGGA 3SDLA 2DJVA 2AGAA 1VEWA 3T1YO 4FLXA 2UXBO 1KKCA 5EYPB 2IU0A 2YXLA 5E79Z 2P7TC 1I0HA 1E1RG 1P7GA 4MT8A 3Q4HA 5LYJB 2E74B 2ZDIA 3E2EA 2HKOA 3GVMA 2EIKC 3DGEA 1R6TA 1Q43A 1JX9A 2ATKC 1GO3F 4LH7A 4J7JA 2F4VO 2LGQA 1NJIW 4ZHQB 4NTXA 1N32B 4K8ZA 1KC8W 1SERA 1S77D 1KYOF 5KX5B 1RSOA 3AEIA 2Y69B 4TQDA 3JD2A 2FB5A 3L71H 4JYYA 1AP6A 4X89A 4JV5B 3RYIB 3U10A 2ZCEA 4FLZA 2OCHA 3JASB 1KD1W 1JMKC 1YIJV 4DR4B 1YXBA 2KG7A 5IYZA 2UXBB 3DXRB 3ZHRA 3TK1A 5BZBA 4DR3O 4AHCA 4L8JA 3WG7C 2WLLB 1XNRB 3ASOC 2CE4A 1QQCA 2PUSA 3MD0A 1ZUQA 3OEHG 5KHJA 3FD9A 2VQEB 1Y76A 1Q6HA 2ZINA 4JI7O 4B3SO 4X9QA 3K9SA 4HZ3A 3UT5B 5LMNO 1VQPV 3RYFB 1E1QG 2E3CA 3CS5A 1BQ0A 5B3SC 2X6BA 2ZM6O 1N8RW 5IE9A 2QA4V 1MABG 1SZTA 2E75B 1BGYH 3ZRVA 3N2KB 3QNEA 3F5WC 2JIZG 4PA7A 4ZIBA 3CXCU 4CH5A 4FLWA 1Q81W 3F7VC 1COWG 1H2LA 3TGUH 5LGNA 3AK3A 5KUMA 1Y67A 1M57B 4JF3A 1R6NA 2ADQB 1S0VA 3ZMVA 2WA4A 4FMTA 3HKBB 3CWBH 3L75H 3CJHB 5CB4A 1VQOV 3SJQC 5LBQA 2ZD9A 2Y0PA 1QR8A 1F23A 4K0KO 4DO2A 3JAKA 3CCJV 3B09A 1FJGO 3CCMV 5C8YB 4B3MB 3CCUV 1K9MW 4MVUA 1W0KG 2UUBO 2ZM6B 2FYUH 5IY5C 2YEVB 4WFGA 2NLJC 3RYHB 3ZHSA 2CK3G 5IY5B 5J2UA 3HKDA 4J80A 1N4CA 3C3TA 1K34A 1KUQA 3MHSC 2Q7GA 3LNNA 3G71V 1YSCA 3GB7C 2WLNA 3C3SA 3STLC 5JQGA 4AILC 2ZDIC 4OX9B 4CS3A 3FYIB 2LFSA 4Z2WA 4PDRA 3ABKC 4UCOA 3ZHQA 3OGCC 5GTIZ 1N34B 4JAUA 5GW7A 4KUMA 2ZIOA 5DN6G 1Q7YW 3B2EE 2EIMB 4DR2O 1SESA 2HG5C 2P22C 2WLHA 3EHBB 3VQYA 4NB5A 3EFFK 1J5EO 3OTOB 4DV7O 4DR7B 1JJOA 3ML0A 5LXTB 4P30A 2Q8VA 2HEPA 3FYEB 2RMKB 1H2MA 5H6QA 2V1DA 3F7YC 3P32A 5EC1C 1OCCB 2JJ1G 5KHHA 4I4TA 5JVDB 4B3TO 4AQYO 2YUAA 4TQFA 4DV5B 2QKSA 2UUCB 2A06H 4FZ1A 3JD4A 5EIBD 3SYOA 4RQEA 5B1NA 1QLNA 1TA8A 2D2CB 3WG7B 3STZC 5H9CA 3B77A 1YZBA 2XAJA 4R50A 2QDOA 5A2QN 3UO3A 5BY1A 5JVDA 1GTOA 3AG3B 2EIMC 5KUKA 3K58A 1K97A 3BCCH 2ZR3A 1BMFG 1SRYA 2YIBD 4PA4A 3UM7A 4IIJA 2F1MA 1QR9A 1SQFA 2L6LA 1R3JC 3B40A 4DV2B 4KL1A 4B3RB 2QJ1A 3ABKB 4I9WA 1Q86W 2QM4A 1I5XA 5J9PC 3K5MA 4CBCA 2GV9A 1U96A 5LMUB 5FNVB 2P4VA 5LMUO 4O4JA 4FM1A 5KLVH 4QE7A 3AG2B 1JR9A 1K3EA 2HP8A 5K1PA 5IYBO 3FAVB 3EXAA 4Q20A 4RAIA 1D5NA 5F2VO 2DQ3A 1EN5A 4B08A 3CPWU 5JCOC 3RYHA 1DTOA 1VF5B 1GAXA 2Q73A 3M99B 2YEVA 1XDCA 4I50A 4HAMA 4RWUA 4UCUA 4IHJA 4MTOA 1R73A 2LJ2A 1B06A 1P49A 3TETA 2QEXV 1SA0B 4JI1B 2E5LO 2DYRB 5J2UB 1KMIZ 4X1KA 3OR6C 5TISZ 3F5TA 3ZMZA 4X20A 3QG5A 2YC0A 4JV5O 3JAKB 4XDKA 4H13B 5CA3A 3UCSC 2QE7G 2DWDC 2GDSA 2VWKA 3WB0A 1S5LZ 5CN0A 2EIJB 3U11A 3CJHA 5CB4B 1FXVA 1OCOC 4OPAA 1W2BU 5JH7B 2BOBC 2Q7EA 3T1HB 1IXBA 3T1HO 5DEDA 3E8BA 2WAMA 1K92A 1K4DC 2F66C 1OHHG 3HB3B 2QM7A 1XNQO 3H1IH 2HVJC 3WFVA 3JCZA 3ZS8C 4MW3A 1XNRO 3SPCA 2QWQB 1YEWA 1S5JA 3H9VA 3HKBA 3KKYA 4YHHB 3OM3B 3RYCA 2F43G 2AXTZ 3K08A 3ZHUA 2L35A 1M1KW 3HPLC 3RYFA 5KA6A 1FAFA 3N2KA 4PA6A 3EVKA 1BE3H 1FFTB 2EILB 1MMMA 1HNZO 4WFBV 1CP9A 3W7XA 4O4IB 4B3MO 4DV1O 1Y76B 2LW1A 1TUBB 3ASNC 2PYLA 1S72V 4O2AA 1IZ3A 4DR5B 3SPHA 3H1HH 3UO2A 4H37A 1I08A 3HR0A 2DW4A 2WLLA 3ZN0A 2WPDG 4LFBO 1VQ8V 5FL7G 3DXRA 2XNDG 3QO8A 2LQTA 4DR5O 1DGSA 1YJWV 1OCCC 3G67A 5A9GA 4C7UA 1XEQA 2Y69C 3JASA 3UKMA 4DV0O 1EZJA 4U7OA 3THOA 4CH4A 2ZR2A 2KG7B 1XL4A 4MVSA 3WU2Z 1PM9A 2N05A 1WAZA 4DV1B 1WP8A 5KX5A 1GM9A 4DV6B 5LMNB 1BSMA 3K04A 1K7DA 2KKWA 1EN4A 1SQGA 1QLEB 3L72H 4LF9O 5FPRA 3J7AU 5IT9N 3J80N 4UFZA 5GTHZ 1BCCH 2FKXA 1J5EB 3ZRWA 2WLIB 4G27B 1Y74B 4GUNA 4ZHQA 3JSLA 1CXZB 4DR4O 1FFXB 4TSFG 3K5NA 4EFEA 4O4HB 2A79B 1XMQB 5EYPA 3ZN1A 1IBLB 2DQ0A 3APQA 3CEIA 1HR0B 4CH6A 5L3BA 1IDSA 1FXKC 4FLUA 3FX7A 2WWWA 2R72A 3GWOA 3E86A 1AJQA 3OMAB 3ETQA 4CH3A 3L70H 2JS5A 1M56C 4YHHO 3SPIA 1QHTA 2CTQA 3AG4C 5CA1B 3E8FA 1B04A 2PF4E 1GN6A 4YY3O 3A0BZ 2UU9B 3L9DA 2EJRA 4RQFA 4PHZA 1YDXA 1MNGA 2GUZB 3WB1A 2CH7B 5LL6Y 4FM0A 2Q68A 1XQ8A 3QTCA 2OWOA 5FLXN 2X0LA 2QSAA 5IJ0B 4CC5A 5J2TA 2WA3A 5LHHA 3JATB 1YJNV 3L73H 3HKEA 4X1YB 2JK5C 2OYQA 1SF9A 4I55B 1F4MA 1XI1A 3BABA 3QF7A 3M7MX 5EZYA 4FLYA 3JAWA 1J95A 4J41A 4JYCA 5K1XA 1IURA 4QIWF 3VBBA 4MSWC 4DK0A 1ZL8A 4B3TB 1L1FA 4LF6B 1N33O 4IL6Z 1D2DA 4ZBMA 4YIOA 4QNHB 4DW0A 4OXSA 2XT9A 2PI5A 2RDCA 4GKJO 3APOA 1R6KA 2OCCB 3E89A 1TVKA 4A5UB 2XOKG 1OV9A 4X1YA 4MTFA 2R70A 1SC5B 4YJ3B 1M5IA 3JATA 3QO5A 5J2TB 2RNBA 4DRXA 3L74H 3E8HA 2HHHB 4LCUC 5IWAB 4GKKO 3I56V 4LF4O 3JYCA 4MVRA 1WA8B 5CA0A 3ABUA 3DC6A 2VWJA 3CCEV 3ETDA 1D5AA 5AG2A 4X65B 4LC1A 1ZTEA 1N0NA 2NN4A 2ZXWC 1WN7A 3W7TA 4TUYB 3RGBA 1BHAA 2EINC 2V7QG 3CMEV 3AG4B 4BW9A 2YIBA 1JOYA 1AJPA 4TV8B 3ZMTA 1EM1A 1G8MA 2UU9O 2YI9A 1BT8A 1H8HG 1EN6A 3LSSA 3TXQA 2F95B 3IFXA 4WBNA 1B3QA 3CCRV 4LF5O 4U3JB 5GONB 4MVQA 2P67A 4Z1VA 4DR7O 1ZAUA 2H3OA 4JI8B 1F51A 5FPOA 4B3RO 4UVCA 1YITV 2NR5A 4QPKA 4TV9B 4FLVA 1XILA 1HWYA 3OT7A 2EINB 4F6RB 2A3QA 2XAGA 1SS3A 2OT5A 1FKAO 3R66A 4DR6O 4X66B 4LF7B 2P6JA 3G6EV 1CEZA 1BHBA 1AJNA 1A32A 4JI6O 4O2BA 4X8AA 3J81N 4O4LA 1NH2D 3E22A 4BIZA 1VF6C 2OTLV 5LA6A 3SGIA 3OAAG 2PTMA 4LFBB 1XBLA 1ZWIC 3N2GB 4KHPO 5DM6V 2UXCB 4O2AB 3SPGA 2ODMA 4JI5B 3BFRA 4DV3B 4IGGA 2P4KA 1V54C 1TUBA 1FPOA 1FS0G 1VMGA 1JJ2U 3E83A 1AR4A 1Q5OA 3A8TA 5JJEB 4O4IA 4LR3A 4N23A 3H1JH 1YTFB 3K59A 2AZ0A 1M9NA 4JYAB 3T1CA 4JI1O 4UB8Z 3NXSA 4DV7B 3CCLV 3ETGA 1SQQH 4PELA 4CZZA 1NVPB 3RYCB 2EILC 4OPHA 2FMLA 3ETEA 4E2LA 4FVMA 1HNWB 2IW5A 1JA8A 3E35A 2XAQA 1ZLZA 2Q67A 3B4SA 4FK5C 4GX5A 4H44B 1JVMA 4GX2A 5H5NA 5LP6C 1WJZA 4HBNA 3P30A 5JH7A 4MVZA 4QPJA 3N27A 1SQXH 1LNQA 2BTOA 2LFRA 2KSDA 3FB8C 2UUCO 1JPXA 3ZCCA 1JCHA 1AILA 2QKAA 5LP6A 1V55B 3E8GA 3GWKC 4X20B 4X88A 1NTKH 1YCIA 1R1BA 1OCOB 4J9YB 4BR6A 5JJJB 4X62B 3MAQA 2W6IG 4RO2A 4FFKA 1SA0A 4JAVA 1PNLA 3TJTA 3H01A 4FZ0A 4JYAO 3BA9A 2ITCC 4IHJB 3ZX6A 2ZNJA 2JEXA 4I50B 1FXKB 1IVSA 3OTOO 4DXWA 3JALB 2C2AA 3FAVA 3CX5F 4X1IA 3ABMC 1LUVA 2N04A 1LUWA 3OEEG 5KA5A 1HR0O 4BIOA 2Z3YA 4QJFB 1FD9A 1NT2B 2YXYA 4F6EA 4AQYB 5CMUA 3N2GA 1ENVA 4BWAA 1PKXA 4O4JB 4NXNO 5FNVA 3K79A 3IC9A 5LA6B 4J7KA 4F4LA 1F4NA 2ZQMA 1QLEC 4OGQB 4O2BB 3KCXA 3SJAC 5HFLA 3BRCA 1MZFA 1BQZA 3W7SA 1M56B 1UPGA 3JARA 1URFA 3ZMUA 1FYJA 3K9AA 1H38A 4B3SB 3O9OA 2Y48A 3OD4A 4GX0A 4MTGA 4IIJB 2A9HA 2QGNA 1XMOO 4Q6GA 4JAAA 5H2FZ 1O9GA 4IT5A 3B8NA 4MVOA 2H94A 4DV6O 5JJNB 4JI2O 2ETNA 5EC2C 4DW1A 1MOFA 2QTOA 2Q7HA 4DUYO 1XHZA 1VF6A 1XUQA 3CE2A 5EBMC 1U97A 1I5YA 1N36O 3ABTA 2Y4TA 1OJHA 2LW7A 1UFIA 1AR1B 2K9PA 3CD6V 4DK1A 4DUZO 4CC6A 4DUZB 2LO1A 2X6AA 1NTMH 3DSQA 3AG3C 1GN3A 4UUJC 1FJGB 1NBMG 2G38A 4LFCB 4ABMA 3ASNB 2B1GA 3D36A 3P3PA 4I4TB 3CRQA 4TV8A 4DV4B 5B1AC 4GT1A 4GLXA 5BMVB 4XDLA 2DYSB 3BEHA 1N0JA 3RT3C 4LFCO 2B1IA 2QWOB 2Q5ZA 1AP5A 2HJDA 3D36C 2A0LA 4JGSA 2RJZA 1XMOB 2RQ6A 3AG1C 1Y4MA 3ZJZA 2AHZA 2YDEA 4LWSA 5CA0B 1NR7A 2B5UA 4UCRA 2MK3A 4FFBB 3JD3A 2UXDB 5IJ9B 1L8DA 1N32O 2V4DA 3CCVV 1IBLO 4YJ3A 4EB6A 1XMQO 3SYCA 3CC7V 5KAFZ 3VQXA 1MG1A 3T1YB 1OCZB 3ZIAG 5L3DA 1TVKB 2UUAO 2EBOA 2IJIA 1QNMA 1H2KA 3SYQA 2QM8A 4WFFA 4EEQA 1G4YB 2DYRC 5JQGB 2ZNIA 4LF6O 1N33B 2X6CA 1ZL8B 4UVBA 2QWNB 2WLMA 1Q82W 4JI3O 1P84F 3D8CA 2Z0AA 2UXDO 3LDDA 4KXRA 2QWPB 2JRIA 4BW5A 4JI5O 1B6QA 4JI8O 4LNUA 4HYOA 3S3XA 3HKEB 4BAYA 5B5EZ 1NKDA 1M4UA 1L0NH 2CUGA 2MW2B 1TGOA 3CRMA 4PD4F 2Q6AA 5C8YA 2CTRA 2FL4A 3TCUA 3DC5A 4UCSA 5IJ0A 3AG2C 3ZHVA 1VQNV 2CTPA 4NXMB 3A0HZ 1WB7A 5IYCO 2OIEA 4NTWA 4EKWA 3CMAV 5C93A 2Q4PA 4J7ZA 4JI6B 2GUZA 1NR1A 1HNXO 1MSWD 2VQFO 5KMGA 1RM1C 5EIBC 1HNWO 5JWPA 5LHGA 1SKVA 2EZOA 1AR5A 4GKJB 5CA1A 1SQBH 1IBMB 4LF8O 1R3KC 3CC4V 2EULA 4PV1B 5ITZA 2XHBA 4GCZA 1T5EA 2BOCC 3W7UA 2AZ2A 1RPRA 2ZT9B 1OCRC 4UVAA 3X2QC 3SYPA 3CRCA 2BTQA 1PNKA 2JGDA 2YIDA 3IC7A 4I7ZB 4O4HA 1QVGU 1K5QA 5LGTA 1FFXA 3ABLB 1RFYA 3OMIB 4PI2A 4PI0A 1ORQC 2DE0X 5KHIA 1Y74A 4K0KB 4JI4O 2Y0IA 3FB7C 1IBKO 2WLIA 3ZRWB 1KBHA 4J11A 1VQMV 2AHYA 4JZ2A 1HNXB 4LF9B 3ZRSA 1Y6XA 1Q3EA 2DN9A 2YXHA 4J42A 1Z5VA 3LNMB 1AI5A 4H33A 4ZKIA 1GN4A 4JZGA 1BS3A 2ZE7A 1R3IC 2DWEC 5D5QA 4R7CA 1GM8A 1P4RA 1O9HA 1EFRG 1TUEB 2ZE8A 3NR7A 4JI7B 2P5OA 3ZEDA 3CRRA 2Q9LA 1G1XB 4B7KA 4CS4A 4GX1A 4PDLA 2F4VB 2XASA 1R3LC 1N34O 4XDJA 1BL8A 3VQWA 3LUTB 3H1LH 3VOUA 4G28B 2IJKA 2ADPA 1H2NA 1V9PA 2KB1A 1OCRB 2YS8A 5E1AC 2UXNA 4FPPA 4X62O 1LR1A 4U3FH 5BXZA 2JGDB 2BTQB 3FKSG 3R65A 4BIUA 2W0FC 2YI8A 2NNUA 3CCQV 5ITZB 2WLKA 3Q4HB 1Q90D 3I5DA 3VQVA 2CAZC 5CBGA 3G6BA 2EIKB 3U0ZA 3BPZA 5JCOA 4I9QA 3RN4A 4KHPB 5KMGB 2ZE6A 3K03A 3OMNB 1H2SB 3ABLC 1NI8A 1GKFA 4LFAO 1HP8A 3JSNA 3T2MA 1AROP 2OTJV 4KP4A 1NTZH 4JYBA 4PJ0Z 2AW9A 1EZVH 4ZI7A 3I55V 1WPXA 5L3GA 5EBLC 3ZMSA 1GM7A 2CDYA 3KG2A 1GN2A 2B9ZA 4YY3B 1WLEA 3MHHC 4X1KB 1RM1B 3CHXA 2P06A 2QKCA 1N36B 3SYAA 3B8MA 4LNUB 1YF2A 1NH2B 1VQKV 3H1KH 4DUYB 1M57C 1AI7A 3RFRA 1NVPD 2IH1C 1DK1A 3HKCA 4I0XB 5L3CA 1ZSPA 2JDIG 4NR1A 2HR3A 3BHPA 5EK0A 4NXMO 2ZKOA 2JVDA 3OGIB 1KECA 2EZPA 1QU7A 1KP2A 1US6A 1ZX3A 1NZ6A 4EB6B 2IH3C 2QTSA 3LDEA 1E79G 5D5PA 3W7WA 5DECA 1VQ5V 5IJ9A 4DR2B 1VQ4V 2XTAA 1K33A 1K73W 1W0JG 5BR8B 4ZOLB 4JI0B 1IXMA 3OW2U 4JI0O 2DYSC 1NQTA 2H8PC 2XAFA 2WSSG 3ASOB 1VQLV 2CGOA 1OCZC 1K5SA 4FFBA 4UV9A 3S3WA 1VF7A 3FB5C 4ASUG 1VIBA 4QGPA 2HHHO 5BMVA 2GTAA 3OUSA 4FJCC 4MW8A 4NYKA 5B1BB 4GZRB 5L3EA 4LWSB 2VQFB 4DV2O 3QO7A 4WF9V 2GTSA 4JPRA 2HJFC 1V54B 2ILMA 1PD3A 2PI4A 3LSUA 2QR4A 1F7YA 5B66Z 1XL6A 1KKDA 1X4TA 4PA3A 4U7NA 1I94B 3JD1A 4UCTA 4DR3B 1I94O 3FFQA 4AI8A 1GRJA 5HFMA 3SJBC 1OZ0A 4WFHA 3ICXA 1IX9A 2JS3A 4DV3O 5B1AB 3TXSA 1L0LH 5CBHA 2VQEO 3DTUB 1HNZB 2F23A 3OUFA 4QE9A 1XREA 5LXTA 1Q8IA 4ICGA 1WB8A 1YI2V 2HFEC 4R8CA 3X2QB 3CSXA 5EBWC 2RCVA 4DR6B 2XAHA 3A0RA 4OX9O 1H8EG 4LF7O 3RW0A 2R9AA 3JARB 5B1OA 4G2KA 1WNSA 4P9OA 2YICA 1AVMA 2LP7A 1M90W 1Y66A 2JGUA 2OIGA 1Q6UA 2Q69A 3D3IA 4X1IB 2WLJA 4FIPC 4PDVA 3OE7G 3A2FA 2ITDC 3CYOA 1SZXA 5LOVA 2K1EA 4YXWG 1KU9A 2GBOA 4UCVA 1FXKA 2YIAA 1MSDA 2ZXWB 2PZSA 3BAAA 1DF4A
chains in the Genus database with same CATH topology
1COWG 1OCZB 2Q68A 3ZIAG 5LGNA 5KUMA 1VQ6V 3RBZA 1M57B 4JF3A 1R6NA 5L3DA 2EBOA 1S0VA 1AI6A 2HVKC 2IJIA 2X0LA 3ZMVA 3K0DA 4FMTA 3SYQA 1K8AW 3K0GA 5LHHA 1VQOV 2QM8A 4WFFA 1YJNV 1G4YB 2DYRC 3SJQC 5LBQA 2ZD9A 2X6CA 2M7WA 1QR8A 2JK5C 1F23A 2R9IA 4UVBA 4DO2A 3CCJV 1F4MA 3CCMV 2WLMA 1SETA 1J95A 1GMGA 1Q82W 4JYCA 3LDDA 2X7RB 4WFAV 3CCUV 5H6RA 4PDMA 4UXNA 1K9MW 4BW5A 4QIWF 3VBBA 4MSWC 4MVUA 1B6QA 1W0KG 1UJWB 1L1FA 4MS2A 4HYOA 4BAYA 5IY5C 1NKDA 2YEVB 4WFGA 2NLJC 4ZBMA 4QNHB 4OXSA 1S76D 3LSQA 2Q6AA 5IY5B 2PI5A 2CK3G 4N21A 3TCUA 3AG2C 4JTAB 1VQNV 1R6KA 2OCCB 2IJJA 3E89A 4Z1MG 5IYCO 4EKWA 1K34A 3CMAV 2XOKG 5B3SB 5C93A 3MHSC 1YJ9V 1P7BA 3G71V 1YSCA 1NR1A 3GB7C 2WLNA 4MTFA 3STLC 5IDJA 1MSWD 2ZDIC 2GSMB 3QO5A 1RM1C 3FYIB 2LFSA 5LHGA 3E8HA 2EZOA 4XBFA 4PDRA 3ABKC 1R3KC 3OGCC 3CC4V 4LCUC 3AG1B 1KP3A 4JAUA 5GW7A 1JQ0A 4KUMA 3I56V 5DN6G 3JYCA 4GCZA 2BOCC 4TT3G 3W7UA 1RPRA 4MVRA 1OCRC 3ABUA 4UVAA 3X2QC 3CC2V 3SYPA 3CCEV 2YSUB 1Q7YW 1PNKA 3ETDA 3IC7A 1QVGU 1K5QA 2EIMB 1DLBA 5LGTA 3ABLB 4LC1A 3OMIB 1QCEA 1SESA 2HG5C 2ZXWC 1ORQC 3OR7C 2WLHA 3EHBB 1ROPA 3FB7C 3EFFK 3W7TA 2WLIA 3ZRWB 5LGUA 2EINC 2V7QG 1BHAA 3CMEV 4I5SA 3AG4B 1VQMV 2AHYA 1JOYA 1AJPA 3ML0A 3ZRSA 3ZMTA 4P30A 1G8MA 1H8HG 3FYEB 3LNMB 3LSSA 1AI5A 1AI4A 2P90A 3IFXA 4H33A 4ZKIA 5H6QA 3CCRV 2V1DA 3F7YC 1EBOA 4MVQA 2P67A 3P32A 1R3IC 3FB6C 2DWEC 1OCCB 2JJ1G 3PJSK 5EC1C 2IJHA 4R7CA 1GM8A 2Z5UA 1F51A 4WCEV 1P4RA 3G4SV 4L87A 2QKSA 4UVCA 4RUEA 1YITV 4QPKA 3JD4A 1EFRG 1TUEB 3JD0A 3SYOA 5B1NA 4RQEA 1HWYA 1QLNA 2EINB 2FTKA 2XAGA 3WG7B 3STZC 1VQ7V 2OT5A 5H9CA 3B77A 1VQ9V 4R50A 2XAJA 4JTDB 4P2ZA 4GX1A 4PDLA 1KQSU 1FXHA 4TWKA 1GTOA 3AG3B 3LDCA 2XASA 1R3LC 2P6JA 3G6EV 1CEZA 2EIMC 1BHBA 4XDJA 1BL8A 3LUTB 1AJNA 3VOUA 5KUKA 4G28B 4WFEA 2IJKA 4X8AA 1K97A 2KB1A 1OCRB 1NH2D 4R6ZA 4BIZA 2ZR3A 1BMFG 5E1AC 2OTLV 1SRYA 2UXNA 3ABMB 4FPPA 4PA4A 3OAAG 3UM7A 1QR9A 2UXXA 3RVZA 2JEUA 5L3FA 1R3JC 1ZWIC 4LP8A 5DM6V 3ABKB 3FKSG 4I9WA 4MTXA 5CBFA 1Q86W 3R65A 4BIUA 2W0FC 3SPGA 2NNUA 1H2GA 3CCQV 1I5XA 1V54C 2WLKA 5J9PC 4CBCA 1FS0G 1JJ2U 3E83A 5B1BC 5CBGA 2EIKB 4QE7A 3AG2B 4PA9A 4N23A 1PNMA 1YTFB 1K3EA 3K03A 1M9NA 3IGAC 3OMNB 5IYBO 2R9RB 3ABLC 1GKFA 5LHIA 3RVYA 3T1CA 3OFNG 4Q20A 4RAIA 3NXSA 3T2MA 5IYDO 1AROP 3CCLV 2OTJV 3ETGA 1V55C 2DQ3A 4PELA 4CZZA 1NVPB 4KP4A 3T4ZA 3CPWU 1S3JA 2EILC 4JYBA 1DTOA 4E2LA 3ETEA 3K06A 1PL0A 3M99B 2IW5A 3E35A 1WPXA 2XAQA 3I55V 2YEVA 4J9ZB 2D3OW 1QBZA 4HAMA 5L3GA 5EBLC 1S5HC 3ZRXA 4UV8A 2Q67A 4FK5C 1R73A 4GX5A 4MTOA 1JVMA 4P9PA 3ZMSA 2GHYA 3BY6A 1GM7A 4GX2A 4MVMA 3TETA 2QEXV 3KG2A 2JJ2G 1YHQV 2HLDG 3P30A 1WLEA 3MHHC 2DYRB 1RM1B 1THZA 4MVZA 4QPJA 1QVFU 4KFMA 3CP1A 1LNQA 2LFRA 3OR6C 1DF5A 1YTFD 3FB8C 1JPXA 3SYAA 3ZCCA 1JCHA 3B8MA 2IU3A 1GK9A 4RUFA 3ZMZA 1NH2B 4XDKA 1VQKV 1V55B 1CPYA 3E8GA 4JTCB 5CA3A 2OCCC 2QE7G 1M57C 2DWDC 1AI7A 4X88A 5CN0A 1NVPD 2IH1C 2EIJB 3SPJA 1OCOB 4J9YB 5L3CA 1FXVA 1OCOC 1W2BU 2EIJC 2JDIG 2HR3A 2BOBC 5EK0A 2W6IG 4RO2A 4JAVA 3CCSV 1PNLA 4LBEC 3H01A 3E8BA 1RPOA 1KECA 3T4DA 3K3WA 2EZPA 2WAMA 1K92A 1K4DC 1KP2A 2ITCC 2W6JG 3HB3B 1OHHG 2QM7A 2JEXA 1FXKB 2HVJC 1K4CC 2IH3C 3JCZA 4MW3A 3WFVA 4DXWA 3SPCA 3LDEA 4JASA 1E79G 3OM3B 2C2AA 2F43G 3W7WA 1VQ5V 3K08A 1VQ4V 1M1KW 1K33A 3HPLC 5KA6A 1K73W 1W0JG 3ABMC 4PA6A 3OEEG 5KA5A 1FFTB 2EILB 2Z3YA 1IXMA 4QJFB 3OW2U 2IU0A 2DYSC 1NQTA 4WFBV 2H8PC 2XAFA 2WSSG 1CP9A 3W7XA 3ASOB 2P7TC 5CMUA 1VQLV 1ENVA 1PKXA 1OCZC 1K5SA 3K79A 4UV9A 4F4LA 1E1RG 1F4NA 4MT8A 3ASNC 3FB5C 2ZDIA 2ZQMA 3E2EA 4ASUG 1QLEC 1S72V 2HKOA 5HFLA 2EIKC 3SPHA 3DGEA 3OUSA 4FJCC 4MW8A 4H37A 5B1BB 1M56B 5L3EA 3W7SA 2DW4A 1JX9A 2ATKC 2WLLA 3QO7A 3K9AA 1GO3F 3ZMUA 4WF9V 1H38A 2Y48A 4GX0A 4MTGA 3ZN0A 4JPRA 2WPDG 2A9HA 2HJFC 1V54B 1VQ8V 1NJIW 5FL7G 2XNDG 1PD3A 2PI4A 3QO8A 3B8NA 4MVOA 2H94A 1YJWV 1OCCC 1KC8W 1SERA 1S77D 2Y69C 3UKMA 3AEIA 1XL6A 1EZJA 2Y69B 5EC2C 4U7OA 1MOFA 1KKDA 2QTOA 4PA3A 4U7NA 3JD2A 3JD1A 5EBMC 4X89A 5HFMA 1I5YA 2ZR2A 3ABTA 1AR1B 1XL4A 1OZ0A 4MVSA 3CD6V 4WFHA 1GM9A 1KD1W 5B1AB 1YIJV 5CBHA 2X6AA 3AG3C 3K04A 1K7DA 3DTUB 1QLEB 4UUJC 1NBMG 3OUFA 4QE9A 3ASNB 3TK1A 5BZBA 2B1GA 3D36A 3WG7C 2WLLB 5B1AC 1YI2V 2HFEC 4GT1A 3ASOC 4R8CA 2WLIB 4G27B 3MD0A 4XDLA 3ZRWA 3X2QB 2DYSB 3BEHA 2B1IA 5EBWC 3OEHG 2XAHA 3A0RA 2A0LA 4JGSA 1H8EG 4TSFG 3AG1C 1Y4MA 3RW0A 3ZJZA 2AHZA 5B1OA 4G2KA 4P9OA 2A79B 3ZN1A 4HZ3A 2DQ0A 2LP7A 5L3BA 1M90W 1Y66A 1NR7A 1FXKC 2B5UA 2Q69A 3D3IA 1VQPV 2WWWA 2WLJA 4FIPC 4PDVA 1E1QG 2MK3A 3GWOA 3OE7G 3E86A 2ITDC 1AJQA 3OMAB 3CYOA 3JD3A 5B3SC 2X6BA 1N8RW 1M56C 3SPIA 3AG4C 2QA4V 3E8FA 2K1EA 4YXWG 1MABG 1SZTA 3CCVV 1FXKA 3ZRVA 3SYCA 2EJRA 3F5WC 2JIZG 2ZXWB 3QNEA 4PA7A 4RQFA 3CXCU 3CC7V 1Q81W 1MG1A 3F7VC 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL C;  2Q68 A;  3RVY A;  3EFF K;  3T1C A;  5KUM A;  2WLI A;  2EIK C;  3RBZ A;  2EIN C;  4RAI A;  3SPH A;  3OUS A;  3T2M A;  4MW8 A;  4H37 A;  2HVK C;  1V55 C;  2AHY A;  2WLL A;  2ATK C;  3T4Z A;  3K0D A;  4GX0 A;  4MTG A;  3ZRS A;  2EIL C;  2A9H A;  2HJF C;  3SYQ A;  3K0G A;  3K06 A;  4P30 A;  4WFF A;  2YEV A;  4J9Z B;  1G4Y B;  2DYR C;  4MVO A;  5EBL C;  1S5H C;  3SJQ C;  2Q67 A;  2ZD9 A;  2X6C A;  1OCC C;  3LNM B;  4GX5 A;  4MTO A;  1JVM A;  2JK5 C;  3IFX A;  4GX2 A;  4H33 A;  4P9P A;  2Y69 C;  3UKM A;  4MVM A;  3F7Y C;  1XL6 A;  4MVQ A;  3TET A;  3KG2 A;  5EC2 C;  1R3I C;  3FB6 C;  2DWE C;  3PJS K;  5EC1 C;  1KKD A;  2QTO A;  4PA3 A;  4R7C A;  2WLM A;  1J95 A;  4MVZ A;  5EBM C;  4KFM A;  4X89 A;  1LNQ A;  3LDD A;  3OR6 C;  2QKS A;  3FB8 C;  1XL4 A;  4PDM A;  3SYA A;  4MVS A;  4RUF A;  4RUE A;  4WFH A;  4BW5 A;  4XDK A;  4MSW C;  3E8G A;  4JTC B;  4MVU A;  3SYO A;  2OCC C;  1M57 C;  2DWD C;  4MS2 A;  4HYO A;  4X88 A;  2X6A A;  3AG3 C;  3STZ C;  2IH1 C;  3K04 A;  5CBH A;  4R50 A;  3SPJ A;  4JTD B;  4UUJ C;  5IY5 C;  4WFG A;  2NLJ C;  4J9Y B;  4ZBM A;  4QNH B;  4OXS A;  3OUF A;  4P2Z A;  4GX1 A;  2Q6A A;  1OCO C;  4PDL A;  4QE9 A;  5BZB A;  2EIJ C;  4TWK A;  3TCU A;  3WG7 C;  3LDC A;  2BOB C;  1R3L C;  2WLL B;  3AG2 C;  4JTA B;  5EK0 A;  4RO2 A;  2EIM C;  4XDJ A;  5B1A C;  1BL8 A;  2HFE C;  3LUT B;  3E89 A;  3ASO C;  4LBE C;  4R8C A;  4EKW A;  2WLI B;  3E8B A;  4G28 B;  4G27 B;  4XDL A;  3T4D A;  4WFE A;  3VOU A;  3BEH A;  4X8A A;  5KUK A;  1P7B A;  1K4D C;  2KB1 A;  2ITC C;  4MTF A;  3GB7 C;  5EBW C;  2WLN A;  4R6Z A;  3STL C;  2HVJ C;  1K4C C;  2IH3 C;  5E1A C;  4MW3 A;  2A0L A;  4DXW A;  3SPC A;  4PA4 A;  3LDE A;  3UM7 A;  3AG1 C;  3E8H A;  3RVZ A;  3RW0 A;  4PDR A;  3ABK C;  1R3J C;  1ZWI C;  3ZJZ A;  2AHZ A;  4LP8 A;  1R3K C;  3OGC C;  4P9O A;  2A79 B;  3K08 A;  4LCU C;  4HZ3 A;  4I9W A;  5CBF A;  3HPL C;  3R65 A;  2W0F C;  3SPG A;  3ABM C;  3JYC A;  2Q69 A;  2BOC C;  4PA6 A;  2WLJ A;  4MVR A;  1V54 C;  1OCR C;  2WLK A;  4PDV A;  4CBC A;  5J9P C;  3E86 A;  2ITD C;  2DYS C;  3X2Q C;  5B3S C;  3SYP A;  2X6B A;  2H8P C;  3E83 A;  1M56 C;  2P7T C;  5B1B C;  3SPI A;  3AG4 C;  3E8F A;  5CBG A;  2K1E A;  4QE7 A;  1OCZ C;  4PA9 A;  4F4L A;  3ASN C;  3FB5 C;  2HG5 C;  2ZXW C;  1ORQ C;  3OR7 C;  3K03 A;  3SYC A;  3F5W C;  2WLH A;  3IGA C;  4PA7 A;  1QLE C;  3F7V C;  2R9R B;  3FB7 C; 
#chains in the Genus database with same CATH topology
 4GKK B;  1SQP H;  3RBZ A;  1VQ6 V;  1AI6 A;  2A7W A;  2HVK C;  3CB2 A;  3HKD B;  3K0D A;  1K8A W;  3K0G A;  3JAL A;  3ZHT A;  1XHX A;  1VP7 A;  3UQ8 A;  2E76 B;  2M7W A;  1IBK B;  2R9I A;  5LP6 B;  3G80 A;  3QVN A;  4YJ2 A;  2IM9 A;  1Z2G A;  3K5L A;  1SET A;  4X65 O;  3CXH F;  1GMG A;  1WP7 A;  1BZK A;  2X7R B;  4K3A A;  4WFA V;  4DV5 O;  5H6R A;  4PDM A;  4UXN A;  3KCY A;  1IBM O;  4LF8 B;  4DR1 O;  1MA1 A;  4YIP A;  1UJW B;  4MS2 A;  1Q6I A;  2UXC O;  4UB6 Z;  5KHK A;  2ARH A;  1S76 D;  3LSQ A;  4N21 A;  4JTA B;  4TOI A;  4YJ2 B;  2VRZ A;  2IJJ A;  1TAE A;  3K5O A;  4Z1M G;  4LFA B;  4E4E A;  5B3S B;  1YJ9 V;  1P7B A;  3SJC C;  2DOS A;  2M6Y A;  5IDJ A;  2GSM B;  1AB3 A;  2Q0O C;  4NVP A;  4XBF A;  4LH6 A;  4X66 O;  4B7E A;  3AG1 B;  1KP3 A;  1JQ0 A;  4W4L A;  1XOU A;  1PP9 H;  2ZE5 A;  4TT3 G;  3JAM N;  4DR1 B;  1GH6 A;  1MZE A;  3SR2 C;  3UT5 A;  1W59 A;  3CC2 V;  2YSU B;  5LOV B;  4NKG B;  2BE3 A;  4DYL A;  1DLB A;  1I7F A;  4D6T H;  1QCE A;  3OR7 C;  2ZIM A;  1ROP A;  3AK1 A;  4J10 A;  5LGU A;  4I5S A;  1NS1 A;  1XNQ B;  4K35 A;  2VS0 A;  2Q0A A;  3IAY A;  2KQX A;  2CGN A;  5IYZ B;  3E22 B;  3BVO A;  4F6R A;  4O4L B;  1WPB A;  4JI4 B;  1AI4 A;  2P90 A;  1X59 A;  4K8X A;  1M93 A;  1EBO A;  4IYI A;  3FB6 C;  3PJS K;  2IJH A;  3RYI A;  2Z5U A;  4WCE V;  2N74 A;  3G4S V;  4FLT A;  1HW7 A;  4X64 O;  4L87 A;  1PL4 A;  4RUE A;  2CTW A;  5BR8 O;  1RSO B;  3KZI Z;  4WBN B;  3JD0 A;  4TV9 A;  4JI2 B;  2FTK A;  1VAR A;  1VQ7 V;  1VQ9 V;  4JTD B;  2BCC H;  2O57 A;  5KHG A;  3ZBH A;  4P2Z A;  3RWR D;  1KQS U;  2RN9 A;  1FXH A;  4TWK A;  3LDC A;  4CS2 A;  1PV0 A;  2EJ7 A;  3AG7 A;  5GON A;  4U3J A;  4WFE A;  4DV0 B;  1SQV H;  3JCU Z;  4R6Z A;  1YVW A;  5LYJ A;  2IBZ H;  3ABM B;  2UUA B;  2DMX A;  3P3N A;  2UXX A;  3D3Q A;  3RVZ A;  2JEU A;  5L3F A;  4LP8 A;  2EX3 A;  4NTY A;  4MTX A;  1WA8 A;  4TUY A;  5CBF A;  3OTF A;  1H2G A;  2F93 B;  3CRA A;  3K57 A;  2UUB B;  1Z5W A;  4JI3 B;  4X64 B;  5B1B C;  1NU1 H;  4PA9 A;  4HNA B;  1PNM A;  3IGA C;  4ZOL A;  4LF4 B;  2R9R B;  4H0L B;  3C90 A;  5LHI A;  3RVY A;  5IWA O;  3OFN G;  5IYD O;  1PPJ H;  2XUM A;  1V55 C;  4W4K A;  3T4Z A;  1S3J A;  4EFB A;  4DRX B;  3O65 A;  3K06 A;  1PL0 A;  2D3O W;  4J9Z B;  3WB2 A;  1QBZ A;  3PN1 A;  2PYJ A;  1JFF B;  4GYC B;  3ZRX A;  1S5H C;  4NXN B;  4UV8 A;  4DV4 O;  4P9P A;  2GHY A;  3BY6 A;  4MVM A;  4D7S A;  2QWR B;  4D7T A;  2JJ2 G;  1YHQ V;  2HLD G;  3IJ4 A;  2BSK B;  4IYH A;  1THZ A;  1QVF U;  4KFM A;  3CP1 A;  2BSK A;  4I0X A;  3JAW B;  3HKC B;  3AK2 A;  5EZY B;  1DF5 A;  2LGW A;  1YTF D;  4RUF A;  2IU3 A;  1GK9 A;  1G6U A;  1CPY A;  4JTC B;  1RP3 B;  2OCC C;  3MDS A;  1JFF A;  3SPJ A;  1KB9 F;  4LF5 B;  1HDJ A;  2EIJ C;  2W0X A;  2E5L B;  3CCS V;  4I55 A;  4LBE C;  1RPO A;  3T4D A;  3K3W A;  2CH7 A;  2PY5 A;  2W6J G;  5KAI Z;  1K4C C;  4HNA A;  4FM2 A;  4ZI7 B;  3M8A A;  4JAS A;  2Y4U A;  3BA8 A;  2PGG A;  3SDL A;  2DJV A;  2AGA A;  1VEW A;  3T1Y O;  4FLX A;  2UXB O;  1KKC A;  5EYP B;  2IU0 A;  2YXL A;  5E79 Z;  2P7T C;  1I0H A;  1E1R G;  1P7G A;  4MT8 A;  3Q4H A;  5LYJ B;  2E74 B;  2ZDI A;  3E2E A;  2HKO A;  3GVM A;  2EIK C;  3DGE A;  1R6T A;  1Q43 A;  1JX9 A;  2ATK C;  1GO3 F;  4LH7 A;  4J7J A;  2F4V O;  2LGQ A;  1NJI W;  4ZHQ B;  4NTX A;  1N32 B;  4K8Z A;  1KC8 W;  1SER A;  1S77 D;  1KYO F;  5KX5 B;  1RSO A;  3AEI A;  2Y69 B;  4TQD A;  3JD2 A;  2FB5 A;  3L71 H;  4JYY A;  1AP6 A;  4X89 A;  4JV5 B;  3RYI B;  3U10 A;  2ZCE A;  4FLZ A;  2OCH A;  3JAS B;  1KD1 W;  1JMK C;  1YIJ V;  4DR4 B;  1YXB A;  2KG7 A;  5IYZ A;  2UXB B;  3DXR B;  3ZHR A;  3TK1 A;  5BZB A;  4DR3 O;  4AHC A;  4L8J A;  3WG7 C;  2WLL B;  1XNR B;  3ASO C;  2CE4 A;  1QQC A;  2PUS A;  3MD0 A;  1ZUQ A;  3OEH G;  5KHJ A;  3FD9 A;  2VQE B;  1Y76 A;  1Q6H A;  2ZIN A;  4JI7 O;  4B3S O;  4X9Q A;  3K9S A;  4HZ3 A;  3UT5 B;  5LMN O;  1VQP V;  3RYF B;  1E1Q G;  2E3C A;  3CS5 A;  1BQ0 A;  5B3S C;  2X6B A;  2ZM6 O;  1N8R W;  5IE9 A;  2QA4 V;  1MAB G;  1SZT A;  2E75 B;  1BGY H;  3ZRV A;  3N2K B;  3QNE A;  3F5W C;  2JIZ G;  4PA7 A;  4ZIB A;  3CXC U;  4CH5 A;  4FLW A;  1Q81 W;  3F7V C;  1COW G;  1H2L A;  3TGU H;  5LGN A;  3AK3 A;  5KUM A;  1Y67 A;  1M57 B;  4JF3 A;  1R6N A;  2ADQ B;  1S0V A;  3ZMV A;  2WA4 A;  4FMT A;  3HKB B;  3CWB H;  3L75 H;  3CJH B;  5CB4 A;  1VQO V;  3SJQ C;  5LBQ A;  2ZD9 A;  2Y0P A;  1QR8 A;  1F23 A;  4K0K O;  4DO2 A;  3JAK A;  3CCJ V;  3B09 A;  1FJG O;  3CCM V;  5C8Y B;  4B3M B;  3CCU V;  1K9M W;  4MVU A;  1W0K G;  2UUB O;  2ZM6 B;  2FYU H;  5IY5 C;  2YEV B;  4WFG A;  2NLJ C;  3RYH B;  3ZHS A;  2CK3 G;  5IY5 B;  5J2U A;  3HKD A;  4J80 A;  1N4C A;  3C3T A;  1K34 A;  1KUQ A;  3MHS C;  2Q7G A;  3LNN A;  3G71 V;  1YSC A;  3GB7 C;  2WLN A;  3C3S A;  3STL C;  5JQG A;  4AIL C;  2ZDI C;  4OX9 B;  4CS3 A;  3FYI B;  2LFS A;  4Z2W A;  4PDR A;  3ABK C;  4UCO A;  3ZHQ A;  3OGC C;  5GTI Z;  1N34 B;  4JAU A;  5GW7 A;  4KUM A;  2ZIO A;  5DN6 G;  1Q7Y W;  3B2E E;  2EIM B;  4DR2 O;  1SES A;  2HG5 C;  2P22 C;  2WLH A;  3EHB B;  3VQY A;  4NB5 A;  3EFF K;  1J5E O;  3OTO B;  4DV7 O;  4DR7 B;  1JJO A;  3ML0 A;  5LXT B;  4P30 A;  2Q8V A;  2HEP A;  3FYE B;  2RMK B;  1H2M A;  5H6Q A;  2V1D A;  3F7Y C;  3P32 A;  5EC1 C;  1OCC B;  2JJ1 G;  5KHH A;  4I4T A;  5JVD B;  4B3T O;  4AQY O;  2YUA A;  4TQF A;  4DV5 B;  2QKS A;  2UUC B;  2A06 H;  4FZ1 A;  3JD4 A;  5EIB D;  3SYO A;  4RQE A;  5B1N A;  1QLN A;  1TA8 A;  2D2C B;  3WG7 B;  3STZ C;  5H9C A;  3B77 A;  1YZB A;  2XAJ A;  4R50 A;  2QDO A;  5A2Q N;  3UO3 A;  5BY1 A;  5JVD A;  1GTO A;  3AG3 B;  2EIM C;  5KUK A;  3K58 A;  1K97 A;  3BCC H;  2ZR3 A;  1BMF G;  1SRY A;  2YIB D;  4PA4 A;  3UM7 A;  4IIJ A;  2F1M A;  1QR9 A;  1SQF A;  2L6L A;  1R3J C;  3B40 A;  4DV2 B;  4KL1 A;  4B3R B;  2QJ1 A;  3ABK B;  4I9W A;  1Q86 W;  2QM4 A;  1I5X A;  5J9P C;  3K5M A;  4CBC A;  2GV9 A;  1U96 A;  5LMU B;  5FNV B;  2P4V A;  5LMU O;  4O4J A;  4FM1 A;  5KLV H;  4QE7 A;  3AG2 B;  1JR9 A;  1K3E A;  2HP8 A;  5K1P A;  5IYB O;  3FAV B;  3EXA A;  4Q20 A;  4RAI A;  1D5N A;  5F2V O;  2DQ3 A;  1EN5 A;  4B08 A;  3CPW U;  5JCO C;  3RYH A;  1DTO A;  1VF5 B;  1GAX A;  2Q73 A;  3M99 B;  2YEV A;  1XDC A;  4I50 A;  4HAM A;  4RWU A;  4UCU A;  4IHJ A;  4MTO A;  1R73 A;  2LJ2 A;  1B06 A;  1P49 A;  3TET A;  2QEX V;  1SA0 B;  4JI1 B;  2E5L O;  2DYR B;  5J2U B;  1KMI Z;  4X1K A;  3OR6 C;  5TIS Z;  3F5T A;  3ZMZ A;  4X20 A;  3QG5 A;  2YC0 A;  4JV5 O;  3JAK B;  4XDK A;  4H13 B;  5CA3 A;  3UCS C;  2QE7 G;  2DWD C;  2GDS A;  2VWK A;  3WB0 A;  1S5L Z;  5CN0 A;  2EIJ B;  3U11 A;  3CJH A;  5CB4 B;  1FXV A;  1OCO C;  4OPA A;  1W2B U;  5JH7 B;  2BOB C;  2Q7E A;  3T1H B;  1IXB A;  3T1H O;  5DED A;  3E8B A;  2WAM A;  1K92 A;  1K4D C;  2F66 C;  1OHH G;  3HB3 B;  2QM7 A;  1XNQ O;  3H1I H;  2HVJ C;  3WFV A;  3JCZ A;  3ZS8 C;  4MW3 A;  1XNR O;  3SPC A;  2QWQ B;  1YEW A;  1S5J A;  3H9V A;  3HKB A;  3KKY A;  4YHH B;  3OM3 B;  3RYC A;  2F43 G;  2AXT Z;  3K08 A;  3ZHU A;  2L35 A;  1M1K W;  3HPL C;  3RYF A;  5KA6 A;  1FAF A;  3N2K A;  4PA6 A;  3EVK A;  1BE3 H;  1FFT B;  2EIL B;  1MMM A;  1HNZ O;  4WFB V;  1CP9 A;  3W7X A;  4O4I B;  4B3M O;  4DV1 O;  1Y76 B;  2LW1 A;  1TUB B;  3ASN C;  2PYL A;  1S72 V;  4O2A A;  1IZ3 A;  4DR5 B;  3SPH A;  3H1H H;  3UO2 A;  4H37 A;  1I08 A;  3HR0 A;  2DW4 A;  2WLL A;  3ZN0 A;  2WPD G;  4LFB O;  1VQ8 V;  5FL7 G;  3DXR A;  2XND G;  3QO8 A;  2LQT A;  4DR5 O;  1DGS A;  1YJW V;  1OCC C;  3G67 A;  5A9G A;  4C7U A;  1XEQ A;  2Y69 C;  3JAS A;  3UKM A;  4DV0 O;  1EZJ A;  4U7O A;  3THO A;  4CH4 A;  2ZR2 A;  2KG7 B;  1XL4 A;  4MVS A;  3WU2 Z;  1PM9 A;  2N05 A;  1WAZ A;  4DV1 B;  1WP8 A;  5KX5 A;  1GM9 A;  4DV6 B;  5LMN B;  1BSM A;  3K04 A;  1K7D A;  2KKW A;  1EN4 A;  1SQG A;  1QLE B;  3L72 H;  4LF9 O;  5FPR A;  3J7A U;  5IT9 N;  3J80 N;  4UFZ A;  5GTH Z;  1BCC H;  2FKX A;  1J5E B;  3ZRW A;  2WLI B;  4G27 B;  1Y74 B;  4GUN A;  4ZHQ A;  3JSL A;  1CXZ B;  4DR4 O;  1FFX B;  4TSF G;  3K5N A;  4EFE A;  4O4H B;  2A79 B;  1XMQ B;  5EYP A;  3ZN1 A;  1IBL B;  2DQ0 A;  3APQ A;  3CEI A;  1HR0 B;  4CH6 A;  5L3B A;  1IDS A;  1FXK C;  4FLU A;  3FX7 A;  2WWW A;  2R72 A;  3GWO A;  3E86 A;  1AJQ A;  3OMA B;  3ETQ A;  4CH3 A;  3L70 H;  2JS5 A;  1M56 C;  4YHH O;  3SPI A;  1QHT A;  2CTQ A;  3AG4 C;  5CA1 B;  3E8F A;  1B04 A;  2PF4 E;  1GN6 A;  4YY3 O;  3A0B Z;  2UU9 B;  3L9D A;  2EJR A;  4RQF A;  4PHZ A;  1YDX A;  1MNG A;  2GUZ B;  3WB1 A;  2CH7 B;  5LL6 Y;  4FM0 A;  2Q68 A;  1XQ8 A;  3QTC A;  2OWO A;  5FLX N;  2X0L A;  2QSA A;  5IJ0 B;  4CC5 A;  5J2T A;  2WA3 A;  5LHH A;  3JAT B;  1YJN V;  3L73 H;  3HKE A;  4X1Y B;  2JK5 C;  2OYQ A;  1SF9 A;  4I55 B;  1F4M A;  1XI1 A;  3BAB A;  3QF7 A;  3M7M X;  5EZY A;  4FLY A;  3JAW A;  1J95 A;  4J41 A;  4JYC A;  5K1X A;  1IUR A;  4QIW F;  3VBB A;  4MSW C;  4DK0 A;  1ZL8 A;  4B3T B;  1L1F A;  4LF6 B;  1N33 O;  4IL6 Z;  1D2D A;  4ZBM A;  4YIO A;  4QNH B;  4DW0 A;  4OXS A;  2XT9 A;  2PI5 A;  2RDC A;  4GKJ O;  3APO A;  1R6K A;  2OCC B;  3E89 A;  1TVK A;  4A5U B;  2XOK G;  1OV9 A;  4X1Y A;  4MTF A;  2R70 A;  1SC5 B;  4YJ3 B;  1M5I A;  3JAT A;  3QO5 A;  5J2T B;  2RNB A;  4DRX A;  3L74 H;  3E8H A;  2HHH B;  4LCU C;  5IWA B;  4GKK O;  3I56 V;  4LF4 O;  3JYC A;  4MVR A;  1WA8 B;  5CA0 A;  3ABU A;  3DC6 A;  2VWJ A;  3CCE V;  3ETD A;  1D5A A;  5AG2 A;  4X65 B;  4LC1 A;  1ZTE A;  1N0N A;  2NN4 A;  2ZXW C;  1WN7 A;  3W7T A;  4TUY B;  3RGB A;  1BHA A;  2EIN C;  2V7Q G;  3CME V;  3AG4 B;  4BW9 A;  2YIB A;  1JOY A;  1AJP A;  4TV8 B;  3ZMT A;  1EM1 A;  1G8M A;  2UU9 O;  2YI9 A;  1BT8 A;  1H8H G;  1EN6 A;  3LSS A;  3TXQ A;  2F95 B;  3IFX A;  4WBN A;  1B3Q A;  3CCR V;  4LF5 O;  4U3J B;  5GON B;  4MVQ A;  2P67 A;  4Z1V A;  4DR7 O;  1ZAU A;  2H3O A;  4JI8 B;  1F51 A;  5FPO A;  4B3R O;  4UVC A;  1YIT V;  2NR5 A;  4QPK A;  4TV9 B;  4FLV A;  1XIL A;  1HWY A;  3OT7 A;  2EIN B;  4F6R B;  2A3Q A;  2XAG A;  1SS3 A;  2OT5 A;  1FKA O;  3R66 A;  4DR6 O;  4X66 B;  4LF7 B;  2P6J A;  3G6E V;  1CEZ A;  1BHB A;  1AJN A;  1A32 A;  4JI6 O;  4O2B A;  4X8A A;  3J81 N;  4O4L A;  1NH2 D;  3E22 A;  4BIZ A;  1VF6 C;  2OTL V;  5LA6 A;  3SGI A;  3OAA G;  2PTM A;  4LFB B;  1XBL A;  1ZWI C;  3N2G B;  4KHP O;  5DM6 V;  2UXC B;  4O2A B;  3SPG A;  2ODM A;  4JI5 B;  3BFR A;  4DV3 B;  4IGG A;  2P4K A;  1V54 C;  1TUB A;  1FPO A;  1FS0 G;  1VMG A;  1JJ2 U;  3E83 A;  1AR4 A;  1Q5O A;  3A8T A;  5JJE B;  4O4I A;  4LR3 A;  4N23 A;  3H1J H;  1YTF B;  3K59 A;  2AZ0 A;  1M9N A;  4JYA B;  3T1C A;  4JI1 O;  4UB8 Z;  3NXS A;  4DV7 B;  3CCL V;  3ETG A;  1SQQ H;  4PEL A;  4CZZ A;  1NVP B;  3RYC B;  2EIL C;  4OPH A;  2FML A;  3ETE A;  4E2L A;  4FVM A;  1HNW B;  2IW5 A;  1JA8 A;  3E35 A;  2XAQ A;  1ZLZ A;  2Q67 A;  3B4S A;  4FK5 C;  4GX5 A;  4H44 B;  1JVM A;  4GX2 A;  5H5N A;  5LP6 C;  1WJZ A;  4HBN A;  3P30 A;  5JH7 A;  4MVZ A;  4QPJ A;  3N27 A;  1SQX H;  1LNQ A;  2BTO A;  2LFR A;  2KSD A;  3FB8 C;  2UUC O;  1JPX A;  3ZCC A;  1JCH A;  1AIL A;  2QKA A;  5LP6 A;  1V55 B;  3E8G A;  3GWK C;  4X20 B;  4X88 A;  1NTK H;  1YCI A;  1R1B A;  1OCO B;  4J9Y B;  4BR6 A;  5JJJ B;  4X62 B;  3MAQ A;  2W6I G;  4RO2 A;  4FFK A;  1SA0 A;  4JAV A;  1PNL A;  3TJT A;  3H01 A;  4FZ0 A;  4JYA O;  3BA9 A;  2ITC C;  4IHJ B;  3ZX6 A;  2ZNJ A;  2JEX A;  4I50 B;  1FXK B;  1IVS A;  3OTO O;  4DXW A;  3JAL B;  2C2A A;  3FAV A;  3CX5 F;  4X1I A;  3ABM C;  1LUV A;  2N04 A;  1LUW A;  3OEE G;  5KA5 A;  1HR0 O;  4BIO A;  2Z3Y A;  4QJF B;  1FD9 A;  1NT2 B;  2YXY A;  4F6E A;  4AQY B;  5CMU A;  3N2G A;  1ENV A;  4BWA A;  1PKX A;  4O4J B;  4NXN O;  5FNV A;  3K79 A;  3IC9 A;  5LA6 B;  4J7K A;  4F4L A;  1F4N A;  2ZQM A;  1QLE C;  4OGQ B;  4O2B B;  3KCX A;  3SJA C;  5HFL A;  3BRC A;  1MZF A;  1BQZ A;  3W7S A;  1M56 B;  1UPG A;  3JAR A;  1URF A;  3ZMU A;  1FYJ A;  3K9A A;  1H38 A;  4B3S B;  3O9O A;  2Y48 A;  3OD4 A;  4GX0 A;  4MTG A;  4IIJ B;  2A9H A;  2QGN A;  1XMO O;  4Q6G A;  4JAA A;  5H2F Z;  1O9G A;  4IT5 A;  3B8N A;  4MVO A;  2H94 A;  4DV6 O;  5JJN B;  4JI2 O;  2ETN A;  5EC2 C;  4DW1 A;  1MOF A;  2QTO A;  2Q7H A;  4DUY O;  1XHZ A;  1VF6 A;  1XUQ A;  3CE2 A;  5EBM C;  1U97 A;  1I5Y A;  1N36 O;  3ABT A;  2Y4T A;  1OJH A;  2LW7 A;  1UFI A;  1AR1 B;  2K9P A;  3CD6 V;  4DK1 A;  4DUZ O;  4CC6 A;  4DUZ B;  2LO1 A;  2X6A A;  1NTM H;  3DSQ A;  3AG3 C;  1GN3 A;  4UUJ C;  1FJG B;  1NBM G;  2G38 A;  4LFC B;  4ABM A;  3ASN B;  2B1G A;  3D36 A;  3P3P A;  4I4T B;  3CRQ A;  4TV8 A;  4DV4 B;  5B1A C;  4GT1 A;  4GLX A;  5BMV B;  4XDL A;  2DYS B;  3BEH A;  1N0J A;  3RT3 C;  4LFC O;  2B1I A;  2QWO B;  2Q5Z A;  1AP5 A;  2HJD A;  3D36 C;  2A0L A;  4JGS A;  2RJZ A;  1XMO B;  2RQ6 A;  3AG1 C;  1Y4M A;  3ZJZ A;  2AHZ A;  2YDE A;  4LWS A;  5CA0 B;  1NR7 A;  2B5U A;  4UCR A;  2MK3 A;  4FFB B;  3JD3 A;  2UXD B;  5IJ9 B;  1L8D A;  1N32 O;  2V4D A;  3CCV V;  1IBL O;  4YJ3 A;  4EB6 A;  1XMQ O;  3SYC A;  3CC7 V;  5KAF Z;  3VQX A;  1MG1 A;  3T1Y B;  1OCZ B;  3ZIA G;  5L3D A;  1TVK B;  2UUA O;  2EBO A;  2IJI A;  1QNM A;  1H2K A;  3SYQ A;  2QM8 A;  4WFF A;  4EEQ A;  1G4Y B;  2DYR C;  5JQG B;  2ZNI A;  4LF6 O;  1N33 B;  2X6C A;  1ZL8 B;  4UVB A;  2QWN B;  2WLM A;  1Q82 W;  4JI3 O;  1P84 F;  3D8C A;  2Z0A A;  2UXD O;  3LDD A;  4KXR A;  2QWP B;  2JRI A;  4BW5 A;  4JI5 O;  1B6Q A;  4JI8 O;  4LNU A;  4HYO A;  3S3X A;  3HKE B;  4BAY A;  5B5E Z;  1NKD A;  1M4U A;  1L0N H;  2CUG A;  2MW2 B;  1TGO A;  3CRM A;  4PD4 F;  2Q6A A;  5C8Y A;  2CTR A;  2FL4 A;  3TCU A;  3DC5 A;  4UCS A;  5IJ0 A;  3AG2 C;  3ZHV A;  1VQN V;  2CTP A;  4NXM B;  3A0H Z;  1WB7 A;  5IYC O;  2OIE A;  4NTW A;  4EKW A;  3CMA V;  5C93 A;  2Q4P A;  4J7Z A;  4JI6 B;  2GUZ A;  1NR1 A;  1HNX O;  1MSW D;  2VQF O;  5KMG A;  1RM1 C;  5EIB C;  1HNW O;  5JWP A;  5LHG A;  1SKV A;  2EZO A;  1AR5 A;  4GKJ B;  5CA1 A;  1SQB H;  1IBM B;  4LF8 O;  1R3K C;  3CC4 V;  2EUL A;  4PV1 B;  5ITZ A;  2XHB A;  4GCZ A;  1T5E A;  2BOC C;  3W7U A;  2AZ2 A;  1RPR A;  2ZT9 B;  1OCR C;  4UVA A;  3X2Q C;  3SYP A;  3CRC A;  2BTQ A;  1PNK A;  2JGD A;  2YID A;  3IC7 A;  4I7Z B;  4O4H A;  1QVG U;  1K5Q A;  5LGT A;  1FFX A;  3ABL B;  1RFY A;  3OMI B;  4PI2 A;  4PI0 A;  1ORQ C;  2DE0 X;  5KHI A;  1Y74 A;  4K0K B;  4JI4 O;  2Y0I A;  3FB7 C;  1IBK O;  2WLI A;  3ZRW B;  1KBH A;  4J11 A;  1VQM V;  2AHY A;  4JZ2 A;  1HNX B;  4LF9 B;  3ZRS A;  1Y6X A;  1Q3E A;  2DN9 A;  2YXH A;  4J42 A;  1Z5V A;  3LNM B;  1AI5 A;  4H33 A;  4ZKI A;  1GN4 A;  4JZG A;  1BS3 A;  2ZE7 A;  1R3I C;  2DWE C;  5D5Q A;  4R7C A;  1GM8 A;  1P4R A;  1O9H A;  1EFR G;  1TUE B;  2ZE8 A;  3NR7 A;  4JI7 B;  2P5O A;  3ZED A;  3CRR A;  2Q9L A;  1G1X B;  4B7K A;  4CS4 A;  4GX1 A;  4PDL A;  2F4V B;  2XAS A;  1R3L C;  1N34 O;  4XDJ A;  1BL8 A;  3VQW A;  3LUT B;  3H1L H;  3VOU A;  4G28 B;  2IJK A;  2ADP A;  1H2N A;  1V9P A;  2KB1 A;  1OCR B;  2YS8 A;  5E1A C;  2UXN A;  4FPP A;  4X62 O;  1LR1 A;  4U3F H;  5BXZ A;  2JGD B;  2BTQ B;  3FKS G;  3R65 A;  4BIU A;  2W0F C;  2YI8 A;  2NNU A;  3CCQ V;  5ITZ B;  2WLK A;  3Q4H B;  1Q90 D;  3I5D A;  3VQV A;  2CAZ C;  5CBG A;  3G6B A;  2EIK B;  3U0Z A;  3BPZ A;  5JCO A;  4I9Q A;  3RN4 A;  4KHP B;  5KMG B;  2ZE6 A;  3K03 A;  3OMN B;  1H2S B;  3ABL C;  1NI8 A;  1GKF A;  4LFA O;  1HP8 A;  3JSN A;  3T2M A;  1ARO P;  2OTJ V;  4KP4 A;  1NTZ H;  4JYB A;  4PJ0 Z;  2AW9 A;  1EZV H;  4ZI7 A;  3I55 V;  1WPX A;  5L3G A;  5EBL C;  3ZMS A;  1GM7 A;  2CDY A;  3KG2 A;  1GN2 A;  2B9Z A;  4YY3 B;  1WLE A;  3MHH C;  4X1K B;  1RM1 B;  3CHX A;  2P06 A;  2QKC A;  1N36 B;  3SYA A;  3B8M A;  4LNU B;  1YF2 A;  1NH2 B;  1VQK V;  3H1K H;  4DUY B;  1M57 C;  1AI7 A;  3RFR A;  1NVP D;  2IH1 C;  1DK1 A;  3HKC A;  4I0X B;  5L3C A;  1ZSP A;  2JDI G;  4NR1 A;  2HR3 A;  3BHP A;  5EK0 A;  4NXM O;  2ZKO A;  2JVD A;  3OGI B;  1KEC A;  2EZP A;  1QU7 A;  1KP2 A;  1US6 A;  1ZX3 A;  1NZ6 A;  4EB6 B;  2IH3 C;  2QTS A;  3LDE A;  1E79 G;  5D5P A;  3W7W A;  5DEC A;  1VQ5 V;  5IJ9 A;  4DR2 B;  1VQ4 V;  2XTA A;  1K33 A;  1K73 W;  1W0J G;  5BR8 B;  4ZOL B;  4JI0 B;  1IXM A;  3OW2 U;  4JI0 O;  2DYS C;  1NQT A;  2H8P C;  2XAF A;  2WSS G;  3ASO B;  1VQL V;  2CGO A;  1OCZ C;  1K5S A;  4FFB A;  4UV9 A;  3S3W A;  1VF7 A;  3FB5 C;  4ASU G;  1VIB A;  4QGP A;  2HHH O;  5BMV A;  2GTA A;  3OUS A;  4FJC C;  4MW8 A;  4NYK A;  5B1B B;  4GZR B;  5L3E A;  4LWS B;  2VQF B;  4DV2 O;  3QO7 A;  4WF9 V;  2GTS A;  4JPR A;  2HJF C;  1V54 B;  2ILM A;  1PD3 A;  2PI4 A;  3LSU A;  2QR4 A;  1F7Y A;  5B66 Z;  1XL6 A;  1KKD A;  1X4T A;  4PA3 A;  4U7N A;  1I94 B;  3JD1 A;  4UCT A;  4DR3 B;  1I94 O;  3FFQ A;  4AI8 A;  1GRJ A;  5HFM A;  3SJB C;  1OZ0 A;  4WFH A;  3ICX A;  1IX9 A;  2JS3 A;  4DV3 O;  5B1A B;  3TXS A;  1L0L H;  5CBH A;  2VQE O;  3DTU B;  1HNZ B;  2F23 A;  3OUF A;  4QE9 A;  1XRE A;  5LXT A;  1Q8I A;  4ICG A;  1WB8 A;  1YI2 V;  2HFE C;  4R8C A;  3X2Q B;  3CSX A;  5EBW C;  2RCV A;  4DR6 B;  2XAH A;  3A0R A;  4OX9 O;  1H8E G;  4LF7 O;  3RW0 A;  2R9A A;  3JAR B;  5B1O A;  4G2K A;  1WNS A;  4P9O A;  2YIC A;  1AVM A;  2LP7 A;  1M90 W;  1Y66 A;  2JGU A;  2OIG A;  1Q6U A;  2Q69 A;  3D3I A;  4X1I B;  2WLJ A;  4FIP C;  4PDV A;  3OE7 G;  3A2F A;  2ITD C;  3CYO A;  1SZX A;  5LOV A;  2K1E A;  4YXW G;  1KU9 A;  2GBO A;  4UCV A;  1FXK A;  2YIA A;  1MSD A;  2ZXW B;  2PZS A;  3BAA A;  1DF4 A; 
#chains in the Genus database with same CATH homology
 1COW G;  1OCZ B;  2Q68 A;  3ZIA G;  5LGN A;  5KUM A;  1VQ6 V;  3RBZ A;  1M57 B;  4JF3 A;  1R6N A;  5L3D A;  2EBO A;  1S0V A;  1AI6 A;  2HVK C;  2IJI A;  2X0L A;  3ZMV A;  3K0D A;  4FMT A;  3SYQ A;  1K8A W;  3K0G A;  5LHH A;  1VQO V;  2QM8 A;  4WFF A;  1YJN V;  1G4Y B;  2DYR C;  3SJQ C;  5LBQ A;  2ZD9 A;  2X6C A;  2M7W A;  1QR8 A;  2JK5 C;  1F23 A;  2R9I A;  4UVB A;  4DO2 A;  3CCJ V;  1F4M A;  3CCM V;  2WLM A;  1SET A;  1J95 A;  1GMG A;  1Q82 W;  4JYC A;  3LDD A;  2X7R B;  4WFA V;  3CCU V;  5H6R A;  4PDM A;  4UXN A;  1K9M W;  4BW5 A;  4QIW F;  3VBB A;  4MSW C;  4MVU A;  1B6Q A;  1W0K G;  1UJW B;  1L1F A;  4MS2 A;  4HYO A;  4BAY A;  5IY5 C;  1NKD A;  2YEV B;  4WFG A;  2NLJ C;  4ZBM A;  4QNH B;  4OXS A;  1S76 D;  3LSQ A;  2Q6A A;  5IY5 B;  2PI5 A;  2CK3 G;  4N21 A;  3TCU A;  3AG2 C;  4JTA B;  1VQN V;  1R6K A;  2OCC B;  2IJJ A;  3E89 A;  4Z1M G;  5IYC O;  4EKW A;  1K34 A;  3CMA V;  2XOK G;  5B3S B;  5C93 A;  3MHS C;  1YJ9 V;  1P7B A;  3G71 V;  1YSC A;  1NR1 A;  3GB7 C;  2WLN A;  4MTF A;  3STL C;  5IDJ A;  1MSW D;  2ZDI C;  2GSM B;  3QO5 A;  1RM1 C;  3FYI B;  2LFS A;  5LHG A;  3E8H A;  2EZO A;  4XBF A;  4PDR A;  3ABK C;  1R3K C;  3OGC C;  3CC4 V;  4LCU C;  3AG1 B;  1KP3 A;  4JAU A;  5GW7 A;  1JQ0 A;  4KUM A;  3I56 V;  5DN6 G;  3JYC A;  4GCZ A;  2BOC C;  4TT3 G;  3W7U A;  1RPR A;  4MVR A;  1OCR C;  3ABU A;  4UVA A;  3X2Q C;  3CC2 V;  3SYP A;  3CCE V;  2YSU B;  1Q7Y W;  1PNK A;  3ETD A;  3IC7 A;  1QVG U;  1K5Q A;  2EIM B;  1DLB A;  5LGT A;  3ABL B;  4LC1 A;  3OMI B;  1QCE A;  1SES A;  2HG5 C;  2ZXW C;  1ORQ C;  3OR7 C;  2WLH A;  3EHB B;  1ROP A;  3FB7 C;  3EFF K;  3W7T A;  2WLI A;  3ZRW B;  5LGU A;  2EIN C;  2V7Q G;  1BHA A;  3CME V;  4I5S A;  3AG4 B;  1VQM V;  2AHY A;  1JOY A;  1AJP A;  3ML0 A;  3ZRS A;  3ZMT A;  4P30 A;  1G8M A;  1H8H G;  3FYE B;  3LNM B;  3LSS A;  1AI5 A;  1AI4 A;  2P90 A;  3IFX A;  4H33 A;  4ZKI A;  5H6Q A;  3CCR V;  2V1D A;  3F7Y C;  1EBO A;  4MVQ A;  2P67 A;  3P32 A;  1R3I C;  3FB6 C;  2DWE C;  1OCC B;  2JJ1 G;  3PJS K;  5EC1 C;  2IJH A;  4R7C A;  1GM8 A;  2Z5U A;  1F51 A;  4WCE V;  1P4R A;  3G4S V;  4L87 A;  2QKS A;  4UVC A;  4RUE A;  1YIT V;  4QPK A;  3JD4 A;  1EFR G;  1TUE B;  3JD0 A;  3SYO A;  5B1N A;  4RQE A;  1HWY A;  1QLN A;  2EIN B;  2FTK A;  2XAG A;  3WG7 B;  3STZ C;  1VQ7 V;  2OT5 A;  5H9C A;  3B77 A;  1VQ9 V;  4R50 A;  2XAJ A;  4JTD B;  4P2Z A;  4GX1 A;  4PDL A;  1KQS U;  1FXH A;  4TWK A;  1GTO A;  3AG3 B;  3LDC A;  2XAS A;  1R3L C;  2P6J A;  3G6E V;  1CEZ A;  2EIM C;  1BHB A;  4XDJ A;  1BL8 A;  3LUT B;  1AJN A;  3VOU A;  5KUK A;  4G28 B;  4WFE A;  2IJK A;  4X8A A;  1K97 A;  2KB1 A;  1OCR B;  1NH2 D;  4R6Z A;  4BIZ A;  2ZR3 A;  1BMF G;  5E1A C;  2OTL V;  1SRY A;  2UXN A;  3ABM B;  4FPP A;  4PA4 A;  3OAA G;  3UM7 A;  1QR9 A;  2UXX A;  3RVZ A;  2JEU A;  5L3F A;  1R3J C;  1ZWI C;  4LP8 A;  5DM6 V;  3ABK B;  3FKS G;  4I9W A;  4MTX A;  5CBF A;  1Q86 W;  3R65 A;  4BIU A;  2W0F C;  3SPG A;  2NNU A;  1H2G A;  3CCQ V;  1I5X A;  1V54 C;  2WLK A;  5J9P C;  4CBC A;  1FS0 G;  1JJ2 U;  3E83 A;  5B1B C;  5CBG A;  2EIK B;  4QE7 A;  3AG2 B;  4PA9 A;  4N23 A;  1PNM A;  1YTF B;  1K3E A;  3K03 A;  1M9N A;  3IGA C;  3OMN B;  5IYB O;  2R9R B;  3ABL C;  1GKF A;  5LHI A;  3RVY A;  3T1C A;  3OFN G;  4Q20 A;  4RAI A;  3NXS A;  3T2M A;  5IYD O;  1ARO P;  3CCL V;  2OTJ V;  3ETG A;  1V55 C;  2DQ3 A;  4PEL A;  4CZZ A;  1NVP B;  4KP4 A;  3T4Z A;  3CPW U;  1S3J A;  2EIL C;  4JYB A;  1DTO A;  4E2L A;  3ETE A;  3K06 A;  1PL0 A;  3M99 B;  2IW5 A;  3E35 A;  1WPX A;  2XAQ A;  3I55 V;  2YEV A;  4J9Z B;  2D3O W;  1QBZ A;  4HAM A;  5L3G A;  5EBL C;  1S5H C;  3ZRX A;  4UV8 A;  2Q67 A;  4FK5 C;  1R73 A;  4GX5 A;  4MTO A;  1JVM A;  4P9P A;  3ZMS A;  2GHY A;  3BY6 A;  1GM7 A;  4GX2 A;  4MVM A;  3TET A;  2QEX V;  3KG2 A;  2JJ2 G;  1YHQ V;  2HLD G;  3P30 A;  1WLE A;  3MHH C;  2DYR B;  1RM1 B;  1THZ A;  4MVZ A;  4QPJ A;  1QVF U;  4KFM A;  3CP1 A;  1LNQ A;  2LFR A;  3OR6 C;  1DF5 A;  1YTF D;  3FB8 C;  1JPX A;  3SYA A;  3ZCC A;  1JCH A;  3B8M A;  2IU3 A;  1GK9 A;  4RUF A;  3ZMZ A;  1NH2 B;  4XDK A;  1VQK V;  1V55 B;  1CPY A;  3E8G A;  4JTC B;  5CA3 A;  2OCC C;  2QE7 G;  1M57 C;  2DWD C;  1AI7 A;  4X88 A;  5CN0 A;  1NVP D;  2IH1 C;  2EIJ B;  3SPJ A;  1OCO B;  4J9Y B;  5L3C A;  1FXV A;  1OCO C;  1W2B U;  2EIJ C;  2JDI G;  2HR3 A;  2BOB C;  5EK0 A;  2W6I G;  4RO2 A;  4JAV A;  3CCS V;  1PNL A;  4LBE C;  3H01 A;  3E8B A;  1RPO A;  1KEC A;  3T4D A;  3K3W A;  2EZP A;  2WAM A;  1K92 A;  1K4D C;  1KP2 A;  2ITC C;  2W6J G;  3HB3 B;  1OHH G;  2QM7 A;  2JEX A;  1FXK B;  2HVJ C;  1K4C C;  2IH3 C;  3JCZ A;  4MW3 A;  3WFV A;  4DXW A;  3SPC A;  3LDE A;  4JAS A;  1E79 G;  3OM3 B;  2C2A A;  2F43 G;  3W7W A;  1VQ5 V;  3K08 A;  1VQ4 V;  1M1K W;  1K33 A;  3HPL C;  5KA6 A;  1K73 W;  1W0J G;  3ABM C;  4PA6 A;  3OEE G;  5KA5 A;  1FFT B;  2EIL B;  2Z3Y A;  1IXM A;  4QJF B;  3OW2 U;  2IU0 A;  2DYS C;  1NQT A;  4WFB V;  2H8P C;  2XAF A;  2WSS G;  1CP9 A;  3W7X A;  3ASO B;  2P7T C;  5CMU A;  1VQL V;  1ENV A;  1PKX A;  1OCZ C;  1K5S A;  3K79 A;  4UV9 A;  4F4L A;  1E1R G;  1F4N A;  4MT8 A;  3ASN C;  3FB5 C;  2ZDI A;  2ZQM A;  3E2E A;  4ASU G;  1QLE C;  1S72 V;  2HKO A;  5HFL A;  2EIK C;  3SPH A;  3DGE A;  3OUS A;  4FJC C;  4MW8 A;  4H37 A;  5B1B B;  1M56 B;  5L3E A;  3W7S A;  2DW4 A;  1JX9 A;  2ATK C;  2WLL A;  3QO7 A;  3K9A A;  1GO3 F;  3ZMU A;  4WF9 V;  1H38 A;  2Y48 A;  4GX0 A;  4MTG A;  3ZN0 A;  4JPR A;  2WPD G;  2A9H A;  2HJF C;  1V54 B;  1VQ8 V;  1NJI W;  5FL7 G;  2XND G;  1PD3 A;  2PI4 A;  3QO8 A;  3B8N A;  4MVO A;  2H94 A;  1YJW V;  1OCC C;  1KC8 W;  1SER A;  1S77 D;  2Y69 C;  3UKM A;  3AEI A;  1XL6 A;  1EZJ A;  2Y69 B;  5EC2 C;  4U7O A;  1MOF A;  1KKD A;  2QTO A;  4PA3 A;  4U7N A;  3JD2 A;  3JD1 A;  5EBM C;  4X89 A;  5HFM A;  1I5Y A;  2ZR2 A;  3ABT A;  1AR1 B;  1XL4 A;  1OZ0 A;  4MVS A;  3CD6 V;  4WFH A;  1GM9 A;  1KD1 W;  5B1A B;  1YIJ V;  5CBH A;  2X6A A;  3AG3 C;  3K04 A;  1K7D A;  3DTU B;  1QLE B;  4UUJ C;  1NBM G;  3OUF A;  4QE9 A;  3ASN B;  3TK1 A;  5BZB A;  2B1G A;  3D36 A;  3WG7 C;  2WLL B;  5B1A C;  1YI2 V;  2HFE C;  4GT1 A;  3ASO C;  4R8C A;  2WLI B;  4G27 B;  3MD0 A;  4XDL A;  3ZRW A;  3X2Q B;  2DYS B;  3BEH A;  2B1I A;  5EBW C;  3OEH G;  2XAH A;  3A0R A;  2A0L A;  4JGS A;  1H8E G;  4TSF G;  3AG1 C;  1Y4M A;  3RW0 A;  3ZJZ A;  2AHZ A;  5B1O A;  4G2K A;  4P9O A;  2A79 B;  3ZN1 A;  4HZ3 A;  2DQ0 A;  2LP7 A;  5L3B A;  1M90 W;  1Y66 A;  1NR7 A;  1FXK C;  2B5U A;  2Q69 A;  3D3I A;  1VQP V;  2WWW A;  2WLJ A;  4FIP C;  4PDV A;  1E1Q G;  2MK3 A;  3GWO A;  3OE7 G;  3E86 A;  2ITD C;  1AJQ A;  3OMA B;  3CYO A;  3JD3 A;  5B3S C;  2X6B A;  1N8R W;  1M56 C;  3SPI A;  3AG4 C;  2QA4 V;  3E8F A;  2K1E A;  4YXW G;  1MAB G;  1SZT A;  3CCV V;  1FXK A;  3ZRV A;  3SYC A;  2EJR A;  3F5W C;  2JIZ G;  2ZXW B;  3QNE A;  4PA7 A;  4RQF A;  3CXC U;  3CC7 V;  1Q81 W;  1MG1 A;  3F7V C;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...