4HZ3A

Mthk pore crystallized in presence of tbsb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
molecule keywords Calcium-gated potassium channel mthK
total genus 32
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hz3A00
1J95A 2ITDC 2Q67A 1BL8A 3LDCA 3SYOA 2Y69C 4GX5A 2A0LA 3JYCA 2BOCC 4MVZA 4RAIA 4XDKA 1LNQA 2Q6AA 4BW5A 3AG3C 5KUKA 2HG5C 4R6ZA 2ZXWC 3OGCC 4JTCB 4PDRA 4F4LA 4JTDB 2X6AA 2WLLA 3F7YC 1V54C 4XDLA 1M56C 4MVOA 4WFGA 4QNHB 3IGAC 4R50A 1R3IC 4G28B 5J9PC 3SYCA 4RO2A 3BEHA 3SPIA 4RUEA 4H33A 3EFFK 2A9HA 3SJQC 2WLIB 2YEVA 1OCZC 5EC2C 3E86A 2EIMC 4MVRA 4PA6A 1P7BA 3TETA 5CBGA 4PA7A 4X89A 2DWDC 4LCUC 3ASOC 5B1BC 4KFMA 2IH1C 3PJSK 3STLC 5EBMC 3SPGA 4TWKA 3LDDA 3AG4C 2WLJA 4MW3A 4PA3A 3E8FA 2ZD9A 3LDEA 2HJFC 2R9RB 3ASNC 3FB6C 4PDMA 5CBFA 1QLEC 2DYRC 5E1AC 4MSWC 1G4YB 1XL4A 2WLNA 3K04A 2W0FC 1R3LC 2X6CA 3F5WC 4PDVA 5EBLC 2X6BA 3E83A 4HYOA 2WLKA 3AG1C 1OCCC 2Q69A 3E8HA 4WFHA 1M57C 2AHZA 4LP8A 4I9WA 1K4DC 4GX1A 5B3SC 1V55C 2KB1A 4QE9A 3F7VC 3VOUA 4WFFA 4MW8A 3AG2C 3UM7A 2QKSA 4G27B 1ZWIC 3RW0A 3ZRSA 4H37A 2DYSC 5EC1C 3R65A 1R3KC 2QTOA 3LNMB 4XDJA 3T4ZA 2OCCC 3SYPA 4LBEC 2ATKC 2HFEC 4P30A 3KG2A 4UUJC 3FB5C 1JVMA 3X2QC 2P7TC 5EK0A 2K1EA 4WFEA 4ZBMA 5B1AC 2JK5C 3OR6C 4MVMA 3K08A 3ABMC 4J9ZB 2EINC 2EIJC 3IFXA 2IH3C 4QE7A 3E89A 3RBZA 3LUTB 2WLMA 1OCOC 1R3JC 3FB8C 5KUMA 2ITCC 3UKMA 4DXWA 3T1CA 2EIKC 4GX2A 4MTOA 4PA4A 4PDLA 3HPLC 5EBWC 4MTGA 3T4DA 2A79B 3T2MA 4X88A 3K06A 4MTFA 2HVJC 2EILC 3SYQA 3OR7C 3RVZA 2DWEC 3ABLC 3OUFA 1S5HC 1OCRC 4P9PA 3SPHA 2H8PC 1KKDA 3FB7C 3ABKC 4HZ3A 2WLHA 2AHYA 2Q68A 3SPJA 4MVSA 4CBCA 1K4CC 5BZBA 4EKWA 5IY5C 4P9OA 3WG7C 4R8CA 4J9YB 3SYAA 2BOBC 3RVYA 4PA9A 3K0DA 3TCUA 4MS2A 4MVUA 3STZC 3K0GA 2NLJC 1ORQC 4X8AA 4P2ZA 3K03A 2WLIA 3SPCA 1XL6A 3GB7C 4MVQA 3E8GA 3ZJZA 4R7CA 4OXSA 2WLLB 3OUSA 5CBHA 3E8BA 2HVKC 4RUFA 4JTAB 4GX0A
chains in the Genus database with same CATH superfamily
2B1GA 1THZA 3SYOA 2UUAB 4RAIA 3TXSA 2VWKA 4XDKA 3J80N 1NVPD 1H2SB 1B6QA 4JI2B 4XDLA 1JJOA 1VQNV 4JI7B 2IJHA 4G28B 1BQZA 1PM9A 5B1BB 3ZMVA 4RO2A 4U7OA 1JFFA 3RYIA 1BGYH 3IJ4A 5J2TA 3CP1A 1WAZA 1WLEA 2A3QA 3MDSA 2IH1C 5CBFA 2KKWA 5LP6B 1OCCC 4IIJA 4JI4B 4L8JA 2R72A 2ZQMA 3QNEA 1ROPA 3BHPA 1R6TA 1AB3A 3CYOA 1URFA 3R65A 5B1NA 2A06H 1YSCA 4FIPC 3CEIA 1W59A 3E22A 3CCQV 1NTZH 2VRZA 4MVMA 1H2MA 4JPRA 4J10A 5TISZ 2PY5A 1LUWA 4JYBA 2FKXA 2HP8A 1HNWB 3T4DA 2VWJA 3CCSV 3OGIB 1PNMA 1FXVA 1PNKA 3U11A 4B3RB 1XBLA 2DWEC 4NR1A 3ZS8C 1XHZA 3N27A 4H13B 1SC5B 3TJTA 3K3WA 4YHHO 3LSUA 3X2QB 3ABLB 3RT3C 1GM8A 3JASA 1AR1B 3TCUA 4YY3B 4O4HA 1GN2A 3K0GA 4X8AA 4UCUA 1H2LA 1WNSA 3K03A 4DRXB 5IYCO 3CRCA 1ZUQA 1IXMA 1JPXA 1N0NA 2B1IA 4JYAB 4O2BA 4NYKA 4KHPO 4BR6A 2RCVA 2LP7A 2HR3A 2NR5A 3AG1B 1FJGB 1QVFU 4TOIA 1QNMA 2ZCEA 1CEZA 2GUZA 5LXTB 4R50A 3BABA 3RYFA 4GUNA 3RN4A 2YEVA 4K8ZA 4BIZA 2A7WA 4BAYA 5FL7G 3CCVV 1U96A 1H2KA 3L71H 2LFRA 1NR7A 2GV9A 3LDDA 1YHQV 3QTCA 3RGBA 1AR4A 1YTFB 1MMMA 3QVNA 3SJCC 1YF2A 2ZIOA 5H5NA 5C93A 3A0BZ 5LBQA 4B7KA 2FMLA 2H94A 1W0JG 1HDJA 5B1AB 4YJ3B 1SQBH 1U97A 2Y4UA 4UUJC 5C8YB 5KX5A 4JI3B 5EYPA 2K1EA 1XMOB 3D36A 1L8DA 5JVDB 3S3WA 2ITCC 3UKMA 1OCCB 1K3EA 4PA4A 4NXNO 1H8EG 5LP6A 3K06A 4AI8A 3HKDB 5J2TB 2LGWA 4CS2A 3RYHB 2ZE6A 5K1XA 3N2KB 4I0XA 1I5YA 2GTAA 4MVSA 3ETQA 3BAAA 3VBBA 3OTOO 4DV3B 1WA8B 3SJAC 1K8AW 4B3SB 1NR1A 2JDIG 2P22C 5EIBC 1SQQH 1AP6A 1G1XB 1DF4A 4QGPA 5D5QA 1S76D 4ZHQB 3HKCA 2Q6AA 5KHIA 1YZBA 1UPGA 2YC0A 4DV7B 1E1QG 3SYCA 3JAKA 4IYHA 3ZHVA 3SGIA 2E5LO 2CH7A 1GM9A 2ZDIA 3ASOC 2UXDO 4X65B 5CA1B 4CC5A 1J5EO 5KHJA 5KAFZ 1G4YB 4X1IA 1S77D 1R3LC 1SZXA 4JI2O 2GSMB 3AG1C 2JIZG 2AHZA 5JQGB 3ZHUA 1Q6UA 4D6TH 1AVMA 2XOKG 3ZHQA 4ZI7A 2N05A 3PN1A 4QE7A 4O4IB 1EN4A 1OCOC 2CAZC 1L1FA 4QPJA 4JAAA 5EZYA 2QWNB 1NU1H 2DQ0A 4JZ2A 1QHTA 3CCEV 1TUBA 5CB4B 4LF4O 1Q90D 3RWRD 1Q3EA 4HNAB 3OT7A 3K5NA 3G80A 1VEWA 5A2QN 1L0NH 1V9PA 4JYYA 2VQEB 1VF5B 3M8AA 1IBLB 4KXRA 3HR0A 1F7YA 1GAXA 3AK2A 1KUQA 4K0KO 4F6RB 4NXNB 3STZC 2NLJC 2XAQA 5IDJA 4UFZA 5H6RA 3E8GA 1Q82W 1VP7A 1RP3B 3L70H 3TXQA 4OXSA 4KL1A 4EB6B 4GX0A 1NH2D 4ZHQA 4I7ZB 3O9OA 4O2AA 2IJKA 4YY3O 1SQXH 2FTKA 1D5AA 1MG1A 3CWBH 4TV8A 3ZHSA 3IGAC 5IJ0A 4J42A 3HKBA 4RUEA 2V4DA 3Q4HB 5CMUA 4JI6O 4LFCO 1SERA 4UB8Z 4TQFA 3TETA 3C3TA 2YXYA 5JCOC 2JGUA 1Q81W 3AG2B 4JYAO 2VS0A 4U3FH 2DMXA 4GX1A 4JYCA 3CXCU 1DGSA 1BMFG 3OE7G 2XAGA 1K34A 3H1IH 3BVOA 4Z2WA 2N04A 1H2GA 2EIKB 3RYCB 5IY5B 1I5XA 1Y76B 1NZ6A 2DJVA 2Q7GA 2UXCB 3CC7V 1N34O 1LUVA 3RVZA 2ZE7A 4RQFA 4K3AA 3BCCH 4AQYO 2ZINA 2QEXV 2WWWA 1XMOO 5KX5B 4DUZO 1XDCA 1K4CC 1DK1A 2QTSA 1YITV 3ZX6A 5IJ9A 3L72H 5LXTA 1OCOB 1QBZA 1F4MA 3TGUH 1WJZA 4GKKO 2CGOA 1XL6A 2QWRB 2UUAO 2YUAA 2QA4V 3OMAB 4PV1B 3L75H 2HHHO 2VQFB 4DR5B 4DR6B 4AQYB 4GX5A 1SQGA 1IX9A 4X1KB 2A0LA 4X64O 4UVBA 1PV0A 1MA1A 2QDOA 1M56C 4MVOA 4O4JB 1QR9A 1Y67A 2A9HA 3SJQC 2WLIB 3AG4B 1WB8A 4FPPA 3B2EE 5EC2C 2KSDA 4CH3A 4O4HB 3OTOB 1BHBA 2JVDA 1Q7YW 3MAQA 1GRJA 1VF6A 2R9RB 1QLNA 5B3SB 3ZMTA 4DO2A 2NN4A 3CCMV 1FFXB 4JGSA 2QWQB 3H1JH 3CS5A 2IJJA 4ZOLB 1XREA 2YIDA 5IYDO 2OIEA 3K59A 2QKSA 4I9QA 3FKSG 1I08A 5LYJA 3KZIZ 1Q6HA 4AHCA 5BY1A 4UXNA 1VQOV 1S5JA 4X1IB 3ZN1A 1IBKO 4DV5O 4PDLA 5HFMA 3IAYA 3MHHC 4X65O 1IBMB 4IGGA 4UCOA 2XAFA 3I55V 1EZJA 3CRRA 4LFBO 4TUYA 3FYEB 1KD1W 1GN4A 3K9SA 4HZ3A 1Q43A 4I55B 1S0VA 4X64B 1WPBA 4X1YB 1V54B 5IY5C 4PD4F 2G38A 2QM4A 3CC2V 4K8XA 1XNQO 1M90W 3SPCA 1KKCA 1XNRO 2Q4PA 2E76B 1FPOA 1OV9A 4OX9B 4JI5B 3KCXA 2YICA 2ITDC 1JR9A 1DTOA 2Y69C 3N2GB 1VARA 2XAJA 1LNQA 2F4VB 3ML0A 4PDRA 2D3OW 4K0KB 3IC9A 5L3CA 5LYJB 5J9PC 1EBOA 1R3IC 1IURA 3O65A 4YXWG 4DR4O 4IYIA 1VQ9V 4UCRA 3HKDA 5B5EZ 5JVDA 1FFXA 4FLUA 1F51A 4JI0B 2OIGA 3E8FA 2HJFC 2QKAA 3FB6C 4I50A 2X0LA 4X9QA 3P30A 4JAVA 1B04A 1ZSPA 2WLKA 2IW5A 3A8TA 2F1MA 3JATB 4LP8A 2UXXA 5CA0A 5KA6A 1TAEA 3HKEB 1FD9A 4JI6B 4G27B 1ZAUA 2BTQA 5EC1C 2QWPB 1EFRG 1FXKB 3G4SV 1TUEB 3T1YB 1HNZO 2P06A 4X1KA 4FZ1A 2PI4A 3IFXA 4CH5A 4LF8O 3ZEDA 4B3MB 4KP4A 3DC5A 3AK3A 4HNAA 3ZMUA 4MTFA 1VQPV 1CXZB 2ZM6O 3OR7C 3ABLC 3DXRB 3OUFA 5JJJB 3FAVB 3FFQA 4P9PA 2QR4A 4FVMA 4O4JA 4WF9V 2Q68A 1YDXA 2ZR2A 1TVKB 4P9OA 4GLXA 4ASUG 5JJEB 3K0DA 4DV5B 3K5MA 2XT9A 4UV8A 4B3TB 4WBNA 4O2BB 3EVKA 1VMGA 4YJ2A 1FXKA 4MVQA 4FLXA 4JI8B 2K9PA 4DV6O 3E8BA 1CP9A 2YXHA 4RUFA 2C2AA 4X66B 3JAWB 4XBFA 4FLWA 4FFBA 1N34B 2BTOA 1E1RG 4JTCB 4PHZA 1V54C 4NKGB 1UFIA 1M5IA 4BIOA 3ETEA 1GKFA 1HR0O 1P7BA 4PA7A 3CX5F 3STLC 4TWKA 4Z1VA 3ABMB 2BSKB 3B8MA 5DECA 1XL4A 2WLNA 2Y69B 5A9GA 5DM6V 4HYOA 4WFHA 4LF6O 1NS1A 2P90A 2QSAA 4I9WA 2EZPA 3AEIA 5IYBO 3M99B 2YIBD 5BR8O 1WA8A 1N36B 4FM1A 2DYSC 2F93B 2QM7A 5GTHZ 4JV5O 3UQ8A 3UCSC 2JEXA 4DR1B 4U3JA 1P7GA 5EK0A 1JA8A 5J2UB 4EFEA 3RBZA 1Q5OA 3L74H 1NH2B 3H1LH 2LW1A 1ENVA 1YVWA 4OPAA 5EBWC 4WCEV 1KB9F 1J5EB 4DV2B 2L6LA 3SYQA 2QM8A 3JARB 1N32O 3CMAV 1FXKC 3KCYA 3D36C 1EN6A 3A0RA 1D2DA 1KKDA 3FB7C 3ZRWB 4E2LA 2UXBB 5C8YA 4U3JB 2BOBC 1EM1A 3CCJV 3DSQA 2CE4A 5LHHA 4MVUA 3P32A 5JJNB 1YCIA 3CC4V 1K97A 2WLLB 1AR5A 2CUGA 4ZOLA 3D3IA 2XUMA 3ZHTA 3BPZA 5GONA 3IC7A 1M93A 5L3BA 5DEDA 4DR3O 4J80A 2GDSA 5B66Z 1E79G 5KMGA 3ASOB 1RM1B 2MW2B 3FYIB 3JD4A 3ABTA 4LF5B 3WB2A 5CB4A 1AP5A 1MABG 2ILMA 3PJSK 5EBMC 2YSUB 5D5PA 1RPOA 4JI1B 1K5SA 4IT5A 1BS3A 2ARHA 2RJZA 4FLVA 4DR3B 2RN9A 1I94O 1AJQA 4NXMB 4O4LB 1XEQA 4JI4O 1QLEB 1V55C 4LWSA 4IL6Z 5IYZB 2QE7G 4H0LB 2E75B 1US6A 4CH6A 2AXTZ 1SQPH 1JOYA 3WFVA 5K1PA 1VQ5V 3D8CA 2ZKOA 3ABMC 2EINC 1A32A 2EIJC 3E89A 3F5TA 1I7FA 1UJWB 3W7UA 3A0HZ 3JATA 2CTPA 3CXHF 2OCHA 1YI2V 1KP3A 1QVGU 3E35A 3HKEA 1F23A 2CH7B 2WA4A 2Z3YA 3OM3B 4FM0A 1COWG 1Y6XA 5BMVB 3E22B 3DGEA 3H1KH 3FX7A 1KBHA 1G6UA 3UO3A 4R8CA 3C3SA 2W6JG 3RYHA 3SYAA 3T1YO 1P84F 5JCOA 1DF5A 4X62O 1D5NA 5LMUO 3CCLV 3G71V 4DW1A 4KUMA 3OD4A 4JF3A 3CMEV 1AI6A 2Q67A 3LDCA 1Y4MA 3APOA 5J2UA 2JS3A 1PPJH 3JYCA 1N0JA 2IU0A 1K9MW 4FK5C 3F7YC 2ADPA 4QNHB 2Q7EA 4LF7B 3R66A 4X1YA 1JQ0A 4H33A 4DUZB 1P49A 4X89A 3HB3B 3QO7A 2LW7A 2QGNA 3BY6A 5IJ0B 1OCZB 4FZ0A 5EBLC 2W0FC 2X6CA 2X6BA 1NTKH 5BMVA 3GWKC 2P4KA 1W2BU 2WPDG 3G6EV 1K92A 2Q0AA 1K7DA 4QE9A 4UB6Z 3GVMA 5GW7A 3RYFB 1RM1C 4YJ3A 2KQXA 2XASA 4H37A 1YTFD 2Q0OC 3CSXA 3D3QA 4EB6A 1IDSA 5LMNB 4X20A 2JJ2G 4ZBMA 3NXSA 3K08A 1L0LH 4J9ZB 4DR7O 2W6IG 1I0HA 3LUTB 1S3JA 4NTWA 3T1CA 4BW9A 2YS8A 1YJNV 1V55B 4UVAA 4N21A 1NI8A 4LR3A 4O2AB 3DXRA 2GUZB 2ZE8A 2XTAA 2AHYA 5BZBA 2PZSA 1WB7A 4UV9A 3VQWA 4FM2A 2EINB 1ORQC 1SQVH 4TV9A 2IU3A 3JCUZ 4FLZA 1KU9A 4UCSA 5CBHA 2UUCB 4DW0A 1GN6A 1AJPA 1M56B 5CA3A 3RFRA 5LL6Y 2N74A 3AG3C 3OGCC 3ABUA 2WLLA 3OMNB 5IJ9B 5FPRA 1NQTA 3SPIA 1N8RW 3E86A 4MVRA 3LSSA 5CBGA 2IBZH 1TGOA 4LCUC 4LF9B 5KAIZ 5KHKA 2M7WA 2B9ZA 3LSQA 3ZRXA 2ZD9A 3OEEG 3ASNC 4DR7B 1QR8A 1M1KW 1XUQA 3E83A 1QCEA 2Q69A 4DV6B 2DOSA 1B3QA 4DYLA 3WB1A 2PGGA 2LFSA 1MNGA 2LQTA 2V1DA 1Y74A 4WFFA 4MW8A 4Q20A 5ITZA 3W7SA 2F4VO 2JGDB 1FYJA 4LF8B 2ATKC 2ETNA 3KG2A 3OR6C 4LFAO 1Q86W 1WPXA 2ZDIC 1R3JC 3FB8C 4JZGA 3DC6A 2ADQB 4AILC 1G8MA 3I56V 3B09A 2XAHA 4FLYA 5LGUA 1QQCA 1Z2GA 3N2GA 1Y66A 2ZNJA 3ABKC 3K58A 2BSKA 3HKBB 3J81N 1ZL8B 4DR5O 4JI5O 1SA0B 1DLBA 2ZT9B 4IHJA 3K57A 3VQYA 1SA0A 1S5LZ 1YXBA 3ICXA 2HVKC 1HNXO 4JTAB 1BZKA 4J7KA 4UVCA 3JAWA 1RSOB 2LJ2A 3CPWU 4GT1A 4JTDB 2ZIMA 3AK1A 2AZ2A 3JSNA 4X62B 1K33A 2ZXWB 4B3RO 2M6YA 4WBNB 2FYUH 2EIMC 3H01A 2DWDC 4JASA 5IT9N 2V7QG 1I94B 3SPGA 5AG2A 5EYPB 4TSFG 2PUSA 2YXLA 5KA5A 2Z5UA 5KLVH 4DV4O 3BFRA 1PKXA 3B4SA 2UU9B 4FJCC 4JI8O 5EIBD 4LF7O 2DYRB 5IE9A 3CRQA 4DK0A 3ZRSA 4RQEA 5H9CA 3JD2A 3LNMB 1IBKB 3WB0A 1NKDA 2Y0IA 1SRYA 4JI3O 2IM9A 4FMTA 1PL4A 2WLMA 5L3EA 1N32B 4ICGA 2CTRA 5JQGA 4MTOA 4A5UB 2R9AA 3HPLC 4J7JA 3U10A 3SR2C 1BQ0A 2E5LB 4QIWF 4LFCB 4DV1O 1SS3A 4LF6B 4LF4B 5FPOA 2GHYA 1CPYA 3LNNA 2EJ7A 1R6KA 5KMGB 1AI4A 4I50B 5L3FA 3ZRWA 1YEWA 2JEUA 3WG7C 4JV5B 4PA9A 1VQKV 1XQ8A 4P2ZA 1YJ9V 1FFTB 2JRIA 3VQVA 5LGNA 1B06A 2BTQB 3JASB 2HHHB 2QJ1A 2BE3A 3ZIAG 1Z5VA 2OTLV 1BL8A 2P5OA 2GBOA 2JS5A 1ZLZA 1VQLV 4GKJB 2LO1A 2UU9O 1P4RA 4R6ZA 2F43G 5LHIA 2P6JA 3P3NA 3OFNG 3BEHA 1XILA 3EFFK 3JALB 2UXBO 2YDEA 1T5EA 1ZX3A 2OCCB 2QKCA 1MOFA 2EULA 1FXHA 1ZL8A 1AILA 2OYQA 5B1BC 4KFMA 1K73W 3BA8A 4ZIBA 4CS3A 3A2FA 4MW3A 3OTFA 5FNVB 3N2KA 4I0XB 1GMGA 5KHGA 4MSWC 1MZFA 3F5WC 2PYLA 1VIBA 2DYSB 4DR1O 1JJ2U 3APQA 2P4VA 4IHJB 4F6EA 2Q5ZA 3F7VC 1XNRB 2GTSA 1XMQO 3AG7A 4B3MO 4BIUA 2ZNIA 2EIMB 2Q73A 4LBEC 3B77A 2VQFO 2P7TC 1N4CA 3JD3A 2UUBB 5ITZB 3MHSC 1NBMG 1GH6A 5IWAO 2PI5A 1SETA 4F6RA 4GYCB 4YJ2B 4MTGA 1RFYA 3T2MA 4LNUB 3T1HO 2Y4TA 2PTMA 1S5HC 1OCRC 5JWPA 4TQDA 4ABMA 2RQ6A 3MD0A 4LFAB 3ZRVA 2LGQA 1SESA 3FAVA 3JCZA 5H6QA 1RPRA 4RWUA 5JH7A 2OTJV 1Y74B 2WLIA 4I4TB 3ZBHA 1Q8IA 4LH7A 3H1HH 4CH4A 4H44B 5L3DA 3OUSA 1N33O 5LA6B 4DV0O 4O4IA 1J95A 2CDYA 4DUYO 3B40A 5KHHA 4MVZA 2H3OA 4BW5A 3CJHB 5KUKA 4D7TA 3WG7B 2Y0PA 1KYOF 4D7SA 3WU2Z 3P3PA 5GTIZ 2KG7B 1BHAA 4DRXA 1IBMO 4PA6A 5LHGA 1TUBB 3CCUV 4OPHA 1F4NA 4NXMO 1PP9H 2WLJA 4PA3A 2VQEO 3JSLA 1QLEC 4QPKA 3K04A 4PDVA 1IZ3A 4UCVA 4GCZA 2UUCO 4PJ0Z 2X7RB 1OZ0A 5LMNO 1VQMV 4I4TA 4EEQA 2AZ0A 1RSOA 1PNLA 2AW9A 3JAKB 4J41A 3S3XA 2NNUA 2OCCC 2F66C 2WSSG 2EIJB 5CA0B 4C7UA 1JVMA 1X4TA 5B1AC 4DV4B 3EHBB 4X20B 2IH3C 3QO5A 4LH6A 4GX2A 2DN9A 4E4EA 2UXCO 3BRCA 3W7XA 5CN0A 2XHBA 2AGAA 3UT5B 1AI5A 4JI7O 4DUYB 3SDLA 1JMKC 1LR1A 1WN7A 3OAAG 1YJWV 1IXBA 2EX3A 2RDCA 1Y76A 4CBCA 1H2NA 3UT5A 1KMIZ 4J9YB 1M9NA 1PL0A 2RNBA 3BA9A 1OHHG 3JD1A 4WFAV 4B3TO 1SQFA 1JFFB 3RYIB 4PELA 2Y48A 1GTOA 1VQ7V 1FAFA 1KQSU 1PD3A 1BT8A 1R73A 5L3GA 4OX9O 4FFKA 4UCTA 2R70A 1OCRB 3VQXA 2WA3A 2XNDG 2BOCC 3ZHRA 3CRMA 4NTYA 4LF9O 3ZN0A 4W4LA 4GZRB 2DW4A 5LGTA 3CRAA 3QG5A 1OCZC 1BSMA 3Q4HA 1QU7A 2ZE5A 2EBOA 4JI0O 2CK3G 4CS4A 3C90A 4FLTA 4PDMA 4PI0A 1BE3H 1JX9A 3K9AA 3NR7A 4FFBB 4NB5A 5H2FZ 1O9GA 4MT8A 3VOUA 4I5SA 3UM7A 3RW0A 1R3KC 2P67A 5FLXN 1H38A 3K5LA 4DV3O 1HNZB 1K5QA 2HFEC 3W7TA 4DR6O 4WFEA 4B3SO 2E3CA 4CC6A 1HWYA 2F23A 4YIOA 4MTXA 4JAUA 1ZTEA 2HLDG 4TV9B 4N23A 3JAMN 1H8HG 4LWSB 1KC8W 2CGNA 2HVJC 2EILC 4B7EA 3ZMSA 2ZM6B 3CD6V 1Z5WA 1MSWD 2H8PC 3M7MX 3QF7A 2UUBO 5CA1A 2KG7A 3OW2U 1KP2A 2YI9A 3DTUB 3ZCCA 1O9HA 3CHXA 4Q6GA 2RMKB 1XNQB 1M4UA 4OGQB 3THOA 2L35A 2ODMA 5GONB 1IVSA 1NT2B 3QO8A 4R7CA 3AG3B 5JH7B 3U0ZA 4K35A 4X66O 2UXNA 2MK3A 1M57B 3T1HB 3G67A 4F4LA 2X6AA 4TT3G 4WFGA 2Q8VA 4QJFB 4DR4B 3SJBC 4DV2O 3ASNB 2W0XA 3FD9A 1SF9A 3GWOA 1HR0B 4LFBB 1HP8A 3W7WA 3B8NA 2DQ3A 3ZMZA 2EJRA 3LDEA 1NJIW 1X59A 4HAMA 4LNUA 2IJIA 1GO3F 3HKCB 1BCCH 1GK9A 3E8HA 2UXDB 4J7ZA 3OMIB 2KB1A 1WP8A 1HNWO 3AG2C 1N36O 3RYCA 4XDJA 4B08A 4TV8B 4LC1A 5IWAB 2ZR3A 1AROP 2HKOA 3TK1A 1W0KG 4DR2B 4YHHB 1S72V 3JARA 1MZEA 2CTQA 5FNVA 5DN6G 1XOUA 4DK1A 2EIKC 1SKVA 4TUYB 5F2VO 3H9VA 2OWOA 3ABKB 4I55A 1FJGO 2DE0X 2Q7HA 3OEHG 4EFBA 1XHXA 3SPHA 4DV7O 1AJNA 1KECA 3EXAA 4KHPB 2WLHA 4CZZA 3SPJA 3JALA 4EKWA 1XI1A 2E74B 2YIAA 3RVYA 1R1BA 1HNXB 5HFLA 3E2EA 1VF6C 2YEVB 3J7AU 1NVPB 3GB7C 4GKJO 2JGDA 1IBLO 3ZJZA 2PF4E 5EZYB 2EILB 1EZVH 3KKYA 3UO2A 2FB5A 3CB2A 5LOVB 4Z1MG 1R6NA 5LP6C 4L87A 1MSDA 4G2KA 2HJDA 2HG5C 2ZXWC 4DV1B 4U7NA 4HBNA 2Q9LA 2QWOB 2JJ1G 5IYZA 1FS0G 2F95B 3G6BA 1TVKA 2Z0AA 3L9DA 4DR2O 2CTWA 3AG4C 4JI1O 2DYRC 5E1AC 1OJHA 2WAMA 1JCHA 1XMQB 1EN5A 4PI2A 1N33B 1M57C 2YI8A 1K4DC 4ZI7B 5B3SC 4J11A 1ZWIC 5BR8B 1AI7A 2QTOA 1VQ4V 1NTMH 3T4ZA 2BCCH 3SYPA 5BXZA 5LOVA 5LA6A 3FB5C 3X2QC 4O4LA 4GKKB 1SZTA 2JK5C 1GN3A 4W4KA 3CCRV 5KUMA 4BWAA 4DXWA 1TA8A 3I5DA 1VQ6V 2R9IA 2A79B 2FL4A 2EZOA 4X88A 1YIJV 4LF5O 3CE2A 4IIJB 3CJHA 4NTXA 5B1OA 3L73H 1GM7A 4YIPA 1Q6IA 2HEPA 3JD0A 2YIBA 5E79Z 3K79A 4NVPA 1VQ8V 3ETDA 3ETGA 4DV0B 4MS2A 1HW7A 1VF7A 2D2CB 1FKAO 2O57A 2OT5A 5LMUB 4WFBV 3K5OA 1WP7A 2B5UA 4ZKIA 2PYJA 4P30A
chains in the Genus database with same CATH topology
1J95A 1THZA 2B1GA 1AI6A 2Q67A 3LDCA 1Y4MA 4GX5A 3SYOA 2A0LA 3JYCA 4MVZA 4RAIA 4XDKA 1NVPD 4BW5A 1B6QA 2IU0A 4UVBA 5KUKA 1K9MW 4FK5C 4XDLA 3F7YC 1VQNV 1M56C 4MVOA 3WG7B 4QNHB 2IJHA 4G28B 1QR9A 5B1BB 3ZMVA 4RO2A 4U7OA 1JQ0A 4H33A 2A9HA 1BHAA 3SJQC 2WLIB 3AG4B 4FPPA 5EC2C 4PA6A 5LHGA 3CP1A 4X89A 3CCUV 3HB3B 3QO7A 1F4NA 1WLEA 3BY6A 1BHBA 1Q7YW 2IH1C 2WLJA 4PA3A 1OCZB 5CBFA 2R9RB 1QLNA 1QLEC 5B3SB 3ZMTA 4DO2A 4QPKA 3K04A 5EBLC 2W0FC 2X6CA 4PDVA 2X6BA 3CCMV 1OCCC 4GCZA 4JGSA 1W2BU 2WPDG 2X7RB 3G6EV 1OZ0A 2IJJA 1VQMV 5IYDO 1K92A 1K7DA 4QE9A 2ZQMA 1RM1C 3QNEA 5GW7A 1PNLA 1ROPA 2QKSA 2XASA 4H37A 3CYOA 1YTFD 3R65A 3FKSG 2NNUA 2OCCC 2WSSG 2EIJB 5B1NA 1YSCA 4FIPC 1JVMA 2JJ2G 3CCQV 4ZBMA 3NXSA 5B1AC 4MVMA 3K08A 3EHBB 4JPRA 4UXNA 1VQOV 4J9ZB 2W6IG 2IH3C 3ZN1A 3LUTB 3QO5A 4JYBA 1S3JA 3T1CA 4GX2A 4PDLA 5HFMA 3T4DA 3CCSV 3MHHC 1YJNV 1PNMA 1FXVA 1V55B 1PNKA 4UVAA 3W7XA 2XAFA 5CN0A 2DWEC 4N21A 3I55V 1EZJA 1AI5A 3FYEB 1KD1W 3OAAG 3K3WA 4HZ3A 3X2QB 1S0VA 3ABLB 2AHYA 1YJWV 4CBCA 1GM8A 5BZBA 1V54B 5IY5C 4UV9A 4J9YB 2EINB 1M9NA 1PL0A 1AR1B 3TCUA 3CC2V 1OHHG 3JD1A 4WFAV 3K0GA 1ORQC 1M90W 4X8AA 3SPCA 3K03A 5IYCO 4PELA 2Y48A 1GTOA 1VQ7V 1IXMA 2IU3A 1JPXA 1KQSU 1PD3A 2B1IA 5CBHA 1R73A 1AJPA 5L3GA 2ITDC 1OCRB 1M56B 1DTOA 2Y69C 2XNDG 2LP7A 5CA3A 2HR3A 2BOCC 2XAJA 3AG1B 1LNQA 3AG3C 1QVFU 3OGCC 3ABUA 3ML0A 4PDRA 2D3OW 3ZN0A 2WLLA 1CEZA 3OMNB 5L3CA 5J9PC 1EBOA 1R3IC 4R50A 2DW4A 1NQTA 4YXWG 3SPIA 5LGTA 1N8RW 2YEVA 1OCZC 1VQ9V 4BIZA 3E86A 4MVRA 3LSSA 4BAYA 5CBGA 4LCUC 5FL7G 3CCVV 2EBOA 2M7WA 2LFRA 2CK3G 1F51A 1NR7A 3LDDA 3LSQA 3E8FA 2ZD9A 3OEEG 2HJFC 4PDMA 3ASNC 3FB6C 3ZRXA 2X0LA 1YHQV 1YTFB 3P30A 1JX9A 3K9AA 1QR8A 1M1KW 4JAVA 3E83A 1QCEA 2WLKA 2IW5A 2Q69A 4LP8A 4MT8A 2UXXA 2LFSA 5C93A 5KA6A 5LBQA 2V1DA 3VOUA 4I5SA 4WFFA 2H94A 4MW8A 4Q20A 3UM7A 3W7SA 4G27B 3RW0A 1W0JG 5B1AB 5EC1C 1EFRG 1FXKB 1R3KC 2P67A 3G4SV 1TUEB 1H38A 2ATKC 1K5QA 2HFEC 3W7TA 3KG2A 4UUJC 2K1EA 4WFEA 3OR6C 2PI4A 3D36A 1Q86W 3IFXA 1HWYA 1WPXA 2ZDIC 1R3JC 3FB8C 4MTXA 2ITCC 3UKMA 4JAUA 4KP4A 1OCCB 1K3EA 2HLDG 4PA4A 1G8MA 1H8EG 4N23A 3I56V 1H8HG 3K06A 1KC8W 3ZMUA 2XAHA 4MTFA 2HVJC 1VQPV 2EILC 3OR7C 3ABLC 3ZMSA 5LGUA 3OUFA 3CD6V 4P9PA 1MSWD 2H8PC 1Y66A 3ABKC 1I5YA 4WF9V 2Q68A 4MVSA 2ZR2A 3OW2U 1KP2A 4P9OA 3VBBA 3DTUB 3ZCCA 4ASUG 3K0DA 4UV8A 1DLBA 1K8AW 1FXKA 4MVQA 3QO8A 1NR1A 2JDIG 4R7CA 3AG3B 3E8BA 1CP9A 2HVKC 4RUFA 2C2AA 4JTAB 1DF4A 4XBFA 2UXNA 2MK3A 4UVCA 1S76D 2Q6AA 1M57B 3CPWU 4GT1A 1E1RG 4JTCB 4F4LA 4JTDB 2X6AA 1V54C 4TT3G 1E1QG 4WFGA 3SYCA 4QJFB 1K33A 2ZXWB 3ETEA 2EIMC 1GKFA 3ASNB 3H01A 1P7BA 4PA7A 2DWDC 4JASA 1GM9A 2ZDIA 3ASOC 3GWOA 3W7WA 2V7QG 3B8NA 3STLC 3SPGA 4TWKA 2DQ3A 3ZMZA 3ABMB 2EJRA 3LDEA 1NJIW 3B8MA 4TSFG 5KA5A 1G4YB 1XL4A 2IJIA 2Z5UA 2WLNA 1R3LC 2Y69B 1GO3F 4HAMA 1S77D 5DM6V 4HYOA 2GSMB 3AG1C 3E8HA 1GK9A 1PKXA 2JIZG 4WFHA 4FJCC 2AHZA 2P90A 4I9WA 2EZPA 3AEIA 2DYRB 3OMIB 5IYBO 2KB1A 3M99B 3AG2C 3ZRSA 4RQEA 2DYSC 5H9CA 3JD2A 3LNMB 4XDJA 2QM7A 2XOKG 4LC1A 2ZR3A 1AROP 2HKOA 1NKDA 2JEXA 3TK1A 1SRYA 1W0KG 5EK0A 4FMTA 1S72V 3RBZA 4QE7A 2WLMA 1OCOC 5L3EA 1L1FA 1NH2B 4QPJA 1ENVA 5DN6G 2EIKC 4MTOA 2DQ0A 3HPLC 5EBWC 4WCEV 3ABKB 4QIWF 3CCEV 3SYQA 2QM8A 2GHYA 3OEHG 1CPYA 3CMAV 1FXKC 3SPHA 3A0RA 1AJNA 1R6KA 1KKDA 1KECA 3FB7C 3ZRWB 1AI4A 2WLHA 4E2LA 5L3FA 3ZRWA 3SPJA 4CZZA 4EKWA 2JEUA 3WG7C 2BOBC 3RVYA 4PA9A 3CCJV 1VQKV 5LHHA 4MVUA 3STZC 5HFLA 3E2EA 2NLJC 2XAQA 5IDJA 3P32A 4P2ZA 2YEVB 1YJ9V 1FFTB 1NVPB 3CC4V 3GB7C 5H6RA 5LGNA 3E8GA 1Q82W 3ZJZA 4OXSA 1K97A 2EILB 2WLLB 4GX0A 3ZIAG 1NH2D 3D3IA 2OTLV 1BL8A 4Z1MG 1R6NA 1VQLV 4L87A 3IC7A 2IJKA 5L3BA 4G2KA 2HG5C 1P4RA 2ZXWC 4R6ZA 2F43G 4U7NA 5LHIA 2P6JA 1E79G 1MG1A 2FTKA 3ASOB 3IGAC 1RM1B 3OFNG 2JJ1G 3BEHA 4RUEA 3EFFK 3FYIB 3JD4A 5CMUA 3ABTA 1SERA 1FS0G 2OCCB 1MOFA 3TETA 1FXHA 1MABG 5B1BC 4KFMA 1K73W 3PJSK 5EBMC 3AG4C 4MW3A 2YSUB 2DYRC 1GMGA 5E1AC 1RPOA 4MSWC 1K5SA 2WAMA 3F5WC 1JCHA 1Q81W 3AG2B 1M57C 2DYSB 1AJQA 1JJ2U 1K4DC 4GX1A 1QLEB 4JYCA 5B3SC 3CXCU 1V55C 1BMFG 3OE7G 3F7VC 2XAGA 1K34A 1ZWIC 2QE7G 1AI7A 2QTOA 1VQ4V 3T4ZA 4BIUA 2EIMB 3SYPA 1JOYA 4LBEC 3WFVA 3B77A 3FB5C 3X2QC 2P7TC 1VQ5V 1H2GA 2EIKB 3JD3A 1SZTA 2JK5C 5IY5B 3ABMC 1I5XA 2EINC 3MHSC 1NBMG 2EIJC 3E89A 3CCRV 2PI5A 1UJWB 3W7UA 5KUMA 1SETA 4DXWA 1YI2V 1VQ6V 1KP3A 2R9IA 4MTGA 2A79B 1QVGU 3T2MA 2EZOA 3E35A 4X88A 1YIJV 3CC7V 1F23A 3RVZA 4RQFA 2Z3YA 3OM3B 1S5HC 1OCRC 1GM7A 1COWG 5B1OA 2QEXV 3MD0A 2WWWA 3JD0A 3DGEA 3ZRVA 1K4CC 3K79A 1SESA 4R8CA 1YITV 2W6JG 3JCZA 3SYAA 1VQ8V 3ETDA 5H6QA 3ETGA 1OCOB 1QBZA 1RPRA 4MS2A 2OTJV 1F4MA 1DF5A 2WLIA 1XL6A 2OT5A 2QA4V 3OMAB 4WFBV 3CCLV 3G71V 5L3DA 3OUSA 4KUMA 2B5UA 4JF3A 3CMEV 4ZKIA 4P30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J95 A;  2ITD C;  2Q67 A;  1BL8 A;  3LDC A;  3SYO A;  2Y69 C;  4GX5 A;  2A0L A;  3JYC A;  2BOC C;  4MVZ A;  4RAI A;  4XDK A;  1LNQ A;  2Q6A A;  4BW5 A;  3AG3 C;  5KUK A;  2HG5 C;  4R6Z A;  2ZXW C;  3OGC C;  4JTC B;  4PDR A;  4F4L A;  4JTD B;  2X6A A;  2WLL A;  3F7Y C;  1V54 C;  4XDL A;  1M56 C;  4MVO A;  4WFG A;  4QNH B;  3IGA C;  4R50 A;  1R3I C;  4G28 B;  5J9P C;  3SYC A;  4RO2 A;  3BEH A;  3SPI A;  4RUE A;  4H33 A;  3EFF K;  2A9H A;  3SJQ C;  2WLI B;  2YEV A;  1OCZ C;  5EC2 C;  3E86 A;  2EIM C;  4MVR A;  4PA6 A;  1P7B A;  3TET A;  5CBG A;  4PA7 A;  4X89 A;  2DWD C;  4LCU C;  3ASO C;  5B1B C;  4KFM A;  2IH1 C;  3PJS K;  3STL C;  5EBM C;  3SPG A;  4TWK A;  3LDD A;  3AG4 C;  2WLJ A;  4MW3 A;  4PA3 A;  3E8F A;  2ZD9 A;  3LDE A;  2HJF C;  2R9R B;  3ASN C;  3FB6 C;  4PDM A;  5CBF A;  1QLE C;  2DYR C;  5E1A C;  4MSW C;  1G4Y B;  1XL4 A;  2WLN A;  3K04 A;  2W0F C;  1R3L C;  2X6C A;  3F5W C;  4PDV A;  5EBL C;  2X6B A;  3E83 A;  4HYO A;  2WLK A;  3AG1 C;  1OCC C;  2Q69 A;  3E8H A;  4WFH A;  1M57 C;  2AHZ A;  4LP8 A;  4I9W A;  1K4D C;  4GX1 A;  5B3S C;  1V55 C;  2KB1 A;  4QE9 A;  3F7V C;  3VOU A;  4WFF A;  4MW8 A;  3AG2 C;  3UM7 A;  2QKS A;  4G27 B;  1ZWI C;  3RW0 A;  3ZRS A;  4H37 A;  2DYS C;  5EC1 C;  3R65 A;  1R3K C;  2QTO A;  3LNM B;  4XDJ A;  3T4Z A;  2OCC C;  3SYP A;  4LBE C;  2ATK C;  2HFE C;  4P30 A;  3KG2 A;  4UUJ C;  3FB5 C;  1JVM A;  3X2Q C;  2P7T C;  5EK0 A;  2K1E A;  4WFE A;  4ZBM A;  5B1A C;  2JK5 C;  3OR6 C;  4MVM A;  3K08 A;  3ABM C;  4J9Z B;  2EIN C;  2EIJ C;  3IFX A;  2IH3 C;  4QE7 A;  3E89 A;  3RBZ A;  3LUT B;  2WLM A;  1OCO C;  1R3J C;  3FB8 C;  5KUM A;  2ITC C;  3UKM A;  4DXW A;  3T1C A;  2EIK C;  4GX2 A;  4MTO A;  4PA4 A;  4PDL A;  3HPL C;  5EBW C;  4MTG A;  3T4D A;  2A79 B;  3T2M A;  4X88 A;  3K06 A;  4MTF A;  2HVJ C;  2EIL C;  3SYQ A;  3OR7 C;  3RVZ A;  2DWE C;  3ABL C;  3OUF A;  1S5H C;  1OCR C;  4P9P A;  3SPH A;  2H8P C;  1KKD A;  3FB7 C;  3ABK C;  4HZ3 A;  2WLH A;  2AHY A;  2Q68 A;  3SPJ A;  4MVS A;  4CBC A;  1K4C C;  5BZB A;  4EKW A;  5IY5 C;  4P9O A;  3WG7 C;  4R8C A;  4J9Y B;  3SYA A;  2BOB C;  3RVY A;  4PA9 A;  3K0D A;  3TCU A;  4MS2 A;  4MVU A;  3STZ C;  3K0G A;  2NLJ C;  1ORQ C;  4X8A A;  4P2Z A;  3K03 A;  2WLI A;  3SPC A;  1XL6 A;  3GB7 C;  4MVQ A;  3E8G A;  3ZJZ A;  4R7C A;  4OXS A;  2WLL B;  3OUS A;  5CBH A;  3E8B A;  2HVK C;  4RUF A;  4JTA B;  4GX0 A; 
#chains in the Genus database with same CATH topology
 2B1G A;  1THZ A;  3SYO A;  2UUA B;  4RAI A;  3TXS A;  2VWK A;  4XDK A;  3J80 N;  1NVP D;  1H2S B;  1B6Q A;  4JI2 B;  4XDL A;  1JJO A;  1VQN V;  4JI7 B;  2IJH A;  4G28 B;  1BQZ A;  1PM9 A;  5B1B B;  3ZMV A;  4RO2 A;  4U7O A;  1JFF A;  3RYI A;  1BGY H;  3IJ4 A;  5J2T A;  3CP1 A;  1WAZ A;  1WLE A;  2A3Q A;  3MDS A;  2IH1 C;  5CBF A;  2KKW A;  5LP6 B;  1OCC C;  4IIJ A;  4JI4 B;  4L8J A;  2R72 A;  2ZQM A;  3QNE A;  1ROP A;  3BHP A;  1R6T A;  1AB3 A;  3CYO A;  1URF A;  3R65 A;  5B1N A;  2A06 H;  1YSC A;  4FIP C;  3CEI A;  1W59 A;  3E22 A;  3CCQ V;  1NTZ H;  2VRZ A;  4MVM A;  1H2M A;  4JPR A;  4J10 A;  5TIS Z;  2PY5 A;  1LUW A;  4JYB A;  2FKX A;  2HP8 A;  1HNW B;  3T4D A;  2VWJ A;  3CCS V;  3OGI B;  1PNM A;  1FXV A;  1PNK A;  3U11 A;  4B3R B;  1XBL A;  2DWE C;  4NR1 A;  3ZS8 C;  1XHZ A;  3N27 A;  4H13 B;  1SC5 B;  3TJT A;  3K3W A;  4YHH O;  3LSU A;  3X2Q B;  3ABL B;  3RT3 C;  1GM8 A;  3JAS A;  1AR1 B;  3TCU A;  4YY3 B;  4O4H A;  1GN2 A;  3K0G A;  4X8A A;  4UCU A;  1H2L A;  1WNS A;  3K03 A;  4DRX B;  5IYC O;  3CRC A;  1ZUQ A;  1IXM A;  1JPX A;  1N0N A;  2B1I A;  4JYA B;  4O2B A;  4NYK A;  4KHP O;  4BR6 A;  2RCV A;  2LP7 A;  2HR3 A;  2NR5 A;  3AG1 B;  1FJG B;  1QVF U;  4TOI A;  1QNM A;  2ZCE A;  1CEZ A;  2GUZ A;  5LXT B;  4R50 A;  3BAB A;  3RYF A;  4GUN A;  3RN4 A;  2YEV A;  4K8Z A;  4BIZ A;  2A7W A;  4BAY A;  5FL7 G;  3CCV V;  1U96 A;  1H2K A;  3L71 H;  2LFR A;  1NR7 A;  2GV9 A;  3LDD A;  1YHQ V;  3QTC A;  3RGB A;  1AR4 A;  1YTF B;  1MMM A;  3QVN A;  3SJC C;  1YF2 A;  2ZIO A;  5H5N A;  5C93 A;  3A0B Z;  5LBQ A;  4B7K A;  2FML A;  2H94 A;  1W0J G;  1HDJ A;  5B1A B;  4YJ3 B;  1SQB H;  1U97 A;  2Y4U A;  4UUJ C;  5C8Y B;  5KX5 A;  4JI3 B;  5EYP A;  2K1E A;  1XMO B;  3D36 A;  1L8D A;  5JVD B;  3S3W A;  2ITC C;  3UKM A;  1OCC B;  1K3E A;  4PA4 A;  4NXN O;  1H8E G;  5LP6 A;  3K06 A;  4AI8 A;  3HKD B;  5J2T B;  2LGW A;  4CS2 A;  3RYH B;  2ZE6 A;  5K1X A;  3N2K B;  4I0X A;  1I5Y A;  2GTA A;  4MVS A;  3ETQ A;  3BAA A;  3VBB A;  3OTO O;  4DV3 B;  1WA8 B;  3SJA C;  1K8A W;  4B3S B;  1NR1 A;  2JDI G;  2P22 C;  5EIB C;  1SQQ H;  1AP6 A;  1G1X B;  1DF4 A;  4QGP A;  5D5Q A;  1S76 D;  4ZHQ B;  3HKC A;  2Q6A A;  5KHI A;  1YZB A;  1UPG A;  2YC0 A;  4DV7 B;  1E1Q G;  3SYC A;  3JAK A;  4IYH A;  3ZHV A;  3SGI A;  2E5L O;  2CH7 A;  1GM9 A;  2ZDI A;  3ASO C;  2UXD O;  4X65 B;  5CA1 B;  4CC5 A;  1J5E O;  5KHJ A;  5KAF Z;  1G4Y B;  4X1I A;  1S77 D;  1R3L C;  1SZX A;  4JI2 O;  2GSM B;  3AG1 C;  2JIZ G;  2AHZ A;  5JQG B;  3ZHU A;  1Q6U A;  4D6T H;  1AVM A;  2XOK G;  3ZHQ A;  4ZI7 A;  2N05 A;  3PN1 A;  4QE7 A;  4O4I B;  1EN4 A;  1OCO C;  2CAZ C;  1L1F A;  4QPJ A;  4JAA A;  5EZY A;  2QWN B;  1NU1 H;  2DQ0 A;  4JZ2 A;  1QHT A;  3CCE V;  1TUB A;  5CB4 B;  4LF4 O;  1Q90 D;  3RWR D;  1Q3E A;  4HNA B;  3OT7 A;  3K5N A;  3G80 A;  1VEW A;  5A2Q N;  1L0N H;  1V9P A;  4JYY A;  2VQE B;  1VF5 B;  3M8A A;  1IBL B;  4KXR A;  3HR0 A;  1F7Y A;  1GAX A;  3AK2 A;  1KUQ A;  4K0K O;  4F6R B;  4NXN B;  3STZ C;  2NLJ C;  2XAQ A;  5IDJ A;  4UFZ A;  5H6R A;  3E8G A;  1Q82 W;  1VP7 A;  1RP3 B;  3L70 H;  3TXQ A;  4OXS A;  4KL1 A;  4EB6 B;  4GX0 A;  1NH2 D;  4ZHQ A;  4I7Z B;  3O9O A;  4O2A A;  2IJK A;  4YY3 O;  1SQX H;  2FTK A;  1D5A A;  1MG1 A;  3CWB H;  4TV8 A;  3ZHS A;  3IGA C;  5IJ0 A;  4J42 A;  3HKB A;  4RUE A;  2V4D A;  3Q4H B;  5CMU A;  4JI6 O;  4LFC O;  1SER A;  4UB8 Z;  4TQF A;  3TET A;  3C3T A;  2YXY A;  5JCO C;  2JGU A;  1Q81 W;  3AG2 B;  4JYA O;  2VS0 A;  4U3F H;  2DMX A;  4GX1 A;  4JYC A;  3CXC U;  1DGS A;  1BMF G;  3OE7 G;  2XAG A;  1K34 A;  3H1I H;  3BVO A;  4Z2W A;  2N04 A;  1H2G A;  2EIK B;  3RYC B;  5IY5 B;  1I5X A;  1Y76 B;  1NZ6 A;  2DJV A;  2Q7G A;  2UXC B;  3CC7 V;  1N34 O;  1LUV A;  3RVZ A;  2ZE7 A;  4RQF A;  4K3A A;  3BCC H;  4AQY O;  2ZIN A;  2QEX V;  2WWW A;  1XMO O;  5KX5 B;  4DUZ O;  1XDC A;  1K4C C;  1DK1 A;  2QTS A;  1YIT V;  3ZX6 A;  5IJ9 A;  3L72 H;  5LXT A;  1OCO B;  1QBZ A;  1F4M A;  3TGU H;  1WJZ A;  4GKK O;  2CGO A;  1XL6 A;  2QWR B;  2UUA O;  2YUA A;  2QA4 V;  3OMA B;  4PV1 B;  3L75 H;  2HHH O;  2VQF B;  4DR5 B;  4DR6 B;  4AQY B;  4GX5 A;  1SQG A;  1IX9 A;  4X1K B;  2A0L A;  4X64 O;  4UVB A;  1PV0 A;  1MA1 A;  2QDO A;  1M56 C;  4MVO A;  4O4J B;  1QR9 A;  1Y67 A;  2A9H A;  3SJQ C;  2WLI B;  3AG4 B;  1WB8 A;  4FPP A;  3B2E E;  5EC2 C;  2KSD A;  4CH3 A;  4O4H B;  3OTO B;  1BHB A;  2JVD A;  1Q7Y W;  3MAQ A;  1GRJ A;  1VF6 A;  2R9R B;  1QLN A;  5B3S B;  3ZMT A;  4DO2 A;  2NN4 A;  3CCM V;  1FFX B;  4JGS A;  2QWQ B;  3H1J H;  3CS5 A;  2IJJ A;  4ZOL B;  1XRE A;  2YID A;  5IYD O;  2OIE A;  3K59 A;  2QKS A;  4I9Q A;  3FKS G;  1I08 A;  5LYJ A;  3KZI Z;  1Q6H A;  4AHC A;  5BY1 A;  4UXN A;  1VQO V;  1S5J A;  4X1I B;  3ZN1 A;  1IBK O;  4DV5 O;  4PDL A;  5HFM A;  3IAY A;  3MHH C;  4X65 O;  1IBM B;  4IGG A;  4UCO A;  2XAF A;  3I55 V;  1EZJ A;  3CRR A;  4LFB O;  4TUY A;  3FYE B;  1KD1 W;  1GN4 A;  3K9S A;  4HZ3 A;  1Q43 A;  4I55 B;  1S0V A;  4X64 B;  1WPB A;  4X1Y B;  1V54 B;  5IY5 C;  4PD4 F;  2G38 A;  2QM4 A;  3CC2 V;  4K8X A;  1XNQ O;  1M90 W;  3SPC A;  1KKC A;  1XNR O;  2Q4P A;  2E76 B;  1FPO A;  1OV9 A;  4OX9 B;  4JI5 B;  3KCX A;  2YIC A;  2ITD C;  1JR9 A;  1DTO A;  2Y69 C;  3N2G B;  1VAR A;  2XAJ A;  1LNQ A;  2F4V B;  3ML0 A;  4PDR A;  2D3O W;  4K0K B;  3IC9 A;  5L3C A;  5LYJ B;  5J9P C;  1EBO A;  1R3I C;  1IUR A;  3O65 A;  4YXW G;  4DR4 O;  4IYI A;  1VQ9 V;  4UCR A;  3HKD A;  5B5E Z;  5JVD A;  1FFX A;  4FLU A;  1F51 A;  4JI0 B;  2OIG A;  3E8F A;  2HJF C;  2QKA A;  3FB6 C;  4I50 A;  2X0L A;  4X9Q A;  3P30 A;  4JAV A;  1B04 A;  1ZSP A;  2WLK A;  2IW5 A;  3A8T A;  2F1M A;  3JAT B;  4LP8 A;  2UXX A;  5CA0 A;  5KA6 A;  1TAE A;  3HKE B;  1FD9 A;  4JI6 B;  4G27 B;  1ZAU A;  2BTQ A;  5EC1 C;  2QWP B;  1EFR G;  1FXK B;  3G4S V;  1TUE B;  3T1Y B;  1HNZ O;  2P06 A;  4X1K A;  4FZ1 A;  2PI4 A;  3IFX A;  4CH5 A;  4LF8 O;  3ZED A;  4B3M B;  4KP4 A;  3DC5 A;  3AK3 A;  4HNA A;  3ZMU A;  4MTF A;  1VQP V;  1CXZ B;  2ZM6 O;  3OR7 C;  3ABL C;  3DXR B;  3OUF A;  5JJJ B;  3FAV B;  3FFQ A;  4P9P A;  2QR4 A;  4FVM A;  4O4J A;  4WF9 V;  2Q68 A;  1YDX A;  2ZR2 A;  1TVK B;  4P9O A;  4GLX A;  4ASU G;  5JJE B;  3K0D A;  4DV5 B;  3K5M A;  2XT9 A;  4UV8 A;  4B3T B;  4WBN A;  4O2B B;  3EVK A;  1VMG A;  4YJ2 A;  1FXK A;  4MVQ A;  4FLX A;  4JI8 B;  2K9P A;  4DV6 O;  3E8B A;  1CP9 A;  2YXH A;  4RUF A;  2C2A A;  4X66 B;  3JAW B;  4XBF A;  4FLW A;  4FFB A;  1N34 B;  2BTO A;  1E1R G;  4JTC B;  4PHZ A;  1V54 C;  4NKG B;  1UFI A;  1M5I A;  4BIO A;  3ETE A;  1GKF A;  1HR0 O;  1P7B A;  4PA7 A;  3CX5 F;  3STL C;  4TWK A;  4Z1V A;  3ABM B;  2BSK B;  3B8M A;  5DEC A;  1XL4 A;  2WLN A;  2Y69 B;  5A9G A;  5DM6 V;  4HYO A;  4WFH A;  4LF6 O;  1NS1 A;  2P90 A;  2QSA A;  4I9W A;  2EZP A;  3AEI A;  5IYB O;  3M99 B;  2YIB D;  5BR8 O;  1WA8 A;  1N36 B;  4FM1 A;  2DYS C;  2F93 B;  2QM7 A;  5GTH Z;  4JV5 O;  3UQ8 A;  3UCS C;  2JEX A;  4DR1 B;  4U3J A;  1P7G A;  5EK0 A;  1JA8 A;  5J2U B;  4EFE A;  3RBZ A;  1Q5O A;  3L74 H;  1NH2 B;  3H1L H;  2LW1 A;  1ENV A;  1YVW A;  4OPA A;  5EBW C;  4WCE V;  1KB9 F;  1J5E B;  4DV2 B;  2L6L A;  3SYQ A;  2QM8 A;  3JAR B;  1N32 O;  3CMA V;  1FXK C;  3KCY A;  3D36 C;  1EN6 A;  3A0R A;  1D2D A;  1KKD A;  3FB7 C;  3ZRW B;  4E2L A;  2UXB B;  5C8Y A;  4U3J B;  2BOB C;  1EM1 A;  3CCJ V;  3DSQ A;  2CE4 A;  5LHH A;  4MVU A;  3P32 A;  5JJN B;  1YCI A;  3CC4 V;  1K97 A;  2WLL B;  1AR5 A;  2CUG A;  4ZOL A;  3D3I A;  2XUM A;  3ZHT A;  3BPZ A;  5GON A;  3IC7 A;  1M93 A;  5L3B A;  5DED A;  4DR3 O;  4J80 A;  2GDS A;  5B66 Z;  1E79 G;  5KMG A;  3ASO B;  1RM1 B;  2MW2 B;  3FYI B;  3JD4 A;  3ABT A;  4LF5 B;  3WB2 A;  5CB4 A;  1AP5 A;  1MAB G;  2ILM A;  3PJS K;  5EBM C;  2YSU B;  5D5P A;  1RPO A;  4JI1 B;  1K5S A;  4IT5 A;  1BS3 A;  2ARH A;  2RJZ A;  4FLV A;  4DR3 B;  2RN9 A;  1I94 O;  1AJQ A;  4NXM B;  4O4L B;  1XEQ A;  4JI4 O;  1QLE B;  1V55 C;  4LWS A;  4IL6 Z;  5IYZ B;  2QE7 G;  4H0L B;  2E75 B;  1US6 A;  4CH6 A;  2AXT Z;  1SQP H;  1JOY A;  3WFV A;  5K1P A;  1VQ5 V;  3D8C A;  2ZKO A;  3ABM C;  2EIN C;  1A32 A;  2EIJ C;  3E89 A;  3F5T A;  1I7F A;  1UJW B;  3W7U A;  3A0H Z;  3JAT A;  2CTP A;  3CXH F;  2OCH A;  1YI2 V;  1KP3 A;  1QVG U;  3E35 A;  3HKE A;  1F23 A;  2CH7 B;  2WA4 A;  2Z3Y A;  3OM3 B;  4FM0 A;  1COW G;  1Y6X A;  5BMV B;  3E22 B;  3DGE A;  3H1K H;  3FX7 A;  1KBH A;  1G6U A;  3UO3 A;  4R8C A;  3C3S A;  2W6J G;  3RYH A;  3SYA A;  3T1Y O;  1P84 F;  5JCO A;  1DF5 A;  4X62 O;  1D5N A;  5LMU O;  3CCL V;  3G71 V;  4DW1 A;  4KUM A;  3OD4 A;  4JF3 A;  3CME V;  1AI6 A;  2Q67 A;  3LDC A;  1Y4M A;  3APO A;  5J2U A;  2JS3 A;  1PPJ H;  3JYC A;  1N0J A;  2IU0 A;  1K9M W;  4FK5 C;  3F7Y C;  2ADP A;  4QNH B;  2Q7E A;  4LF7 B;  3R66 A;  4X1Y A;  1JQ0 A;  4H33 A;  4DUZ B;  1P49 A;  4X89 A;  3HB3 B;  3QO7 A;  2LW7 A;  2QGN A;  3BY6 A;  5IJ0 B;  1OCZ B;  4FZ0 A;  5EBL C;  2W0F C;  2X6C A;  2X6B A;  1NTK H;  5BMV A;  3GWK C;  2P4K A;  1W2B U;  2WPD G;  3G6E V;  1K92 A;  2Q0A A;  1K7D A;  4QE9 A;  4UB6 Z;  3GVM A;  5GW7 A;  3RYF B;  1RM1 C;  4YJ3 A;  2KQX A;  2XAS A;  4H37 A;  1YTF D;  2Q0O C;  3CSX A;  3D3Q A;  4EB6 A;  1IDS A;  5LMN B;  4X20 A;  2JJ2 G;  4ZBM A;  3NXS A;  3K08 A;  1L0L H;  4J9Z B;  4DR7 O;  2W6I G;  1I0H A;  3LUT B;  1S3J A;  4NTW A;  3T1C A;  4BW9 A;  2YS8 A;  1YJN V;  1V55 B;  4UVA A;  4N21 A;  1NI8 A;  4LR3 A;  4O2A B;  3DXR A;  2GUZ B;  2ZE8 A;  2XTA A;  2AHY A;  5BZB A;  2PZS A;  1WB7 A;  4UV9 A;  3VQW A;  4FM2 A;  2EIN B;  1ORQ C;  1SQV H;  4TV9 A;  2IU3 A;  3JCU Z;  4FLZ A;  1KU9 A;  4UCS A;  5CBH A;  2UUC B;  4DW0 A;  1GN6 A;  1AJP A;  1M56 B;  5CA3 A;  3RFR A;  5LL6 Y;  2N74 A;  3AG3 C;  3OGC C;  3ABU A;  2WLL A;  3OMN B;  5IJ9 B;  5FPR A;  1NQT A;  3SPI A;  1N8R W;  3E86 A;  4MVR A;  3LSS A;  5CBG A;  2IBZ H;  1TGO A;  4LCU C;  4LF9 B;  5KAI Z;  5KHK A;  2M7W A;  2B9Z A;  3LSQ A;  3ZRX A;  2ZD9 A;  3OEE G;  3ASN C;  4DR7 B;  1QR8 A;  1M1K W;  1XUQ A;  3E83 A;  1QCE A;  2Q69 A;  4DV6 B;  2DOS A;  1B3Q A;  4DYL A;  3WB1 A;  2PGG A;  2LFS A;  1MNG A;  2LQT A;  2V1D A;  1Y74 A;  4WFF A;  4MW8 A;  4Q20 A;  5ITZ A;  3W7S A;  2F4V O;  2JGD B;  1FYJ A;  4LF8 B;  2ATK C;  2ETN A;  3KG2 A;  3OR6 C;  4LFA O;  1Q86 W;  1WPX A;  2ZDI C;  1R3J C;  3FB8 C;  4JZG A;  3DC6 A;  2ADQ B;  4AIL C;  1G8M A;  3I56 V;  3B09 A;  2XAH A;  4FLY A;  5LGU A;  1QQC A;  1Z2G A;  3N2G A;  1Y66 A;  2ZNJ A;  3ABK C;  3K58 A;  2BSK A;  3HKB B;  3J81 N;  1ZL8 B;  4DR5 O;  4JI5 O;  1SA0 B;  1DLB A;  2ZT9 B;  4IHJ A;  3K57 A;  3VQY A;  1SA0 A;  1S5L Z;  1YXB A;  3ICX A;  2HVK C;  1HNX O;  4JTA B;  1BZK A;  4J7K A;  4UVC A;  3JAW A;  1RSO B;  2LJ2 A;  3CPW U;  4GT1 A;  4JTD B;  2ZIM A;  3AK1 A;  2AZ2 A;  3JSN A;  4X62 B;  1K33 A;  2ZXW B;  4B3R O;  2M6Y A;  4WBN B;  2FYU H;  2EIM C;  3H01 A;  2DWD C;  4JAS A;  5IT9 N;  2V7Q G;  1I94 B;  3SPG A;  5AG2 A;  5EYP B;  4TSF G;  2PUS A;  2YXL A;  5KA5 A;  2Z5U A;  5KLV H;  4DV4 O;  3BFR A;  1PKX A;  3B4S A;  2UU9 B;  4FJC C;  4JI8 O;  5EIB D;  4LF7 O;  2DYR B;  5IE9 A;  3CRQ A;  4DK0 A;  3ZRS A;  4RQE A;  5H9C A;  3JD2 A;  3LNM B;  1IBK B;  3WB0 A;  1NKD A;  2Y0I A;  1SRY A;  4JI3 O;  2IM9 A;  4FMT A;  1PL4 A;  2WLM A;  5L3E A;  1N32 B;  4ICG A;  2CTR A;  5JQG A;  4MTO A;  4A5U B;  2R9A A;  3HPL C;  4J7J A;  3U10 A;  3SR2 C;  1BQ0 A;  2E5L B;  4QIW F;  4LFC B;  4DV1 O;  1SS3 A;  4LF6 B;  4LF4 B;  5FPO A;  2GHY A;  1CPY A;  3LNN A;  2EJ7 A;  1R6K A;  5KMG B;  1AI4 A;  4I50 B;  5L3F A;  3ZRW A;  1YEW A;  2JEU A;  3WG7 C;  4JV5 B;  4PA9 A;  1VQK V;  1XQ8 A;  4P2Z A;  1YJ9 V;  1FFT B;  2JRI A;  3VQV A;  5LGN A;  1B06 A;  2BTQ B;  3JAS B;  2HHH B;  2QJ1 A;  2BE3 A;  3ZIA G;  1Z5V A;  2OTL V;  1BL8 A;  2P5O A;  2GBO A;  2JS5 A;  1ZLZ A;  1VQL V;  4GKJ B;  2LO1 A;  2UU9 O;  1P4R A;  4R6Z A;  2F43 G;  5LHI A;  2P6J A;  3P3N A;  3OFN G;  3BEH A;  1XIL A;  3EFF K;  3JAL B;  2UXB O;  2YDE A;  1T5E A;  1ZX3 A;  2OCC B;  2QKC A;  1MOF A;  2EUL A;  1FXH A;  1ZL8 A;  1AIL A;  2OYQ A;  5B1B C;  4KFM A;  1K73 W;  3BA8 A;  4ZIB A;  4CS3 A;  3A2F A;  4MW3 A;  3OTF A;  5FNV B;  3N2K A;  4I0X B;  1GMG A;  5KHG A;  4MSW C;  1MZF A;  3F5W C;  2PYL A;  1VIB A;  2DYS B;  4DR1 O;  1JJ2 U;  3APQ A;  2P4V A;  4IHJ B;  4F6E A;  2Q5Z A;  3F7V C;  1XNR B;  2GTS A;  1XMQ O;  3AG7 A;  4B3M O;  4BIU A;  2ZNI A;  2EIM B;  2Q73 A;  4LBE C;  3B77 A;  2VQF O;  2P7T C;  1N4C A;  3JD3 A;  2UUB B;  5ITZ B;  3MHS C;  1NBM G;  1GH6 A;  5IWA O;  2PI5 A;  1SET A;  4F6R A;  4GYC B;  4YJ2 B;  4MTG A;  1RFY A;  3T2M A;  4LNU B;  3T1H O;  2Y4T A;  2PTM A;  1S5H C;  1OCR C;  5JWP A;  4TQD A;  4ABM A;  2RQ6 A;  3MD0 A;  4LFA B;  3ZRV A;  2LGQ A;  1SES A;  3FAV A;  3JCZ A;  5H6Q A;  1RPR A;  4RWU A;  5JH7 A;  2OTJ V;  1Y74 B;  2WLI A;  4I4T B;  3ZBH A;  1Q8I A;  4LH7 A;  3H1H H;  4CH4 A;  4H44 B;  5L3D A;  3OUS A;  1N33 O;  5LA6 B;  4DV0 O;  4O4I A;  1J95 A;  2CDY A;  4DUY O;  3B40 A;  5KHH A;  4MVZ A;  2H3O A;  4BW5 A;  3CJH B;  5KUK A;  4D7T A;  3WG7 B;  2Y0P A;  1KYO F;  4D7S A;  3WU2 Z;  3P3P A;  5GTI Z;  2KG7 B;  1BHA A;  4DRX A;  1IBM O;  4PA6 A;  5LHG A;  1TUB B;  3CCU V;  4OPH A;  1F4N A;  4NXM O;  1PP9 H;  2WLJ A;  4PA3 A;  2VQE O;  3JSL A;  1QLE C;  4QPK A;  3K04 A;  4PDV A;  1IZ3 A;  4UCV A;  4GCZ A;  2UUC O;  4PJ0 Z;  2X7R B;  1OZ0 A;  5LMN O;  1VQM V;  4I4T A;  4EEQ A;  2AZ0 A;  1RSO A;  1PNL A;  2AW9 A;  3JAK B;  4J41 A;  3S3X A;  2NNU A;  2OCC C;  2F66 C;  2WSS G;  2EIJ B;  5CA0 B;  4C7U A;  1JVM A;  1X4T A;  5B1A C;  4DV4 B;  3EHB B;  4X20 B;  2IH3 C;  3QO5 A;  4LH6 A;  4GX2 A;  2DN9 A;  4E4E A;  2UXC O;  3BRC A;  3W7X A;  5CN0 A;  2XHB A;  2AGA A;  3UT5 B;  1AI5 A;  4JI7 O;  4DUY B;  3SDL A;  1JMK C;  1LR1 A;  1WN7 A;  3OAA G;  1YJW V;  1IXB A;  2EX3 A;  2RDC A;  1Y76 A;  4CBC A;  1H2N A;  3UT5 A;  1KMI Z;  4J9Y B;  1M9N A;  1PL0 A;  2RNB A;  3BA9 A;  1OHH G;  3JD1 A;  4WFA V;  4B3T O;  1SQF A;  1JFF B;  3RYI B;  4PEL A;  2Y48 A;  1GTO A;  1VQ7 V;  1FAF A;  1KQS U;  1PD3 A;  1BT8 A;  1R73 A;  5L3G A;  4OX9 O;  4FFK A;  4UCT A;  2R70 A;  1OCR B;  3VQX A;  2WA3 A;  2XND G;  2BOC C;  3ZHR A;  3CRM A;  4NTY A;  4LF9 O;  3ZN0 A;  4W4L A;  4GZR B;  2DW4 A;  5LGT A;  3CRA A;  3QG5 A;  1OCZ C;  1BSM A;  3Q4H A;  1QU7 A;  2ZE5 A;  2EBO A;  4JI0 O;  2CK3 G;  4CS4 A;  3C90 A;  4FLT A;  4PDM A;  4PI0 A;  1BE3 H;  1JX9 A;  3K9A A;  3NR7 A;  4FFB B;  4NB5 A;  5H2F Z;  1O9G A;  4MT8 A;  3VOU A;  4I5S A;  3UM7 A;  3RW0 A;  1R3K C;  2P67 A;  5FLX N;  1H38 A;  3K5L A;  4DV3 O;  1HNZ B;  1K5Q A;  2HFE C;  3W7T A;  4DR6 O;  4WFE A;  4B3S O;  2E3C A;  4CC6 A;  1HWY A;  2F23 A;  4YIO A;  4MTX A;  4JAU A;  1ZTE A;  2HLD G;  4TV9 B;  4N23 A;  3JAM N;  1H8H G;  4LWS B;  1KC8 W;  2CGN A;  2HVJ C;  2EIL C;  4B7E A;  3ZMS A;  2ZM6 B;  3CD6 V;  1Z5W A;  1MSW D;  2H8P C;  3M7M X;  3QF7 A;  2UUB O;  5CA1 A;  2KG7 A;  3OW2 U;  1KP2 A;  2YI9 A;  3DTU B;  3ZCC A;  1O9H A;  3CHX A;  4Q6G A;  2RMK B;  1XNQ B;  1M4U A;  4OGQ B;  3THO A;  2L35 A;  2ODM A;  5GON B;  1IVS A;  1NT2 B;  3QO8 A;  4R7C A;  3AG3 B;  5JH7 B;  3U0Z A;  4K35 A;  4X66 O;  2UXN A;  2MK3 A;  1M57 B;  3T1H B;  3G67 A;  4F4L A;  2X6A A;  4TT3 G;  4WFG A;  2Q8V A;  4QJF B;  4DR4 B;  3SJB C;  4DV2 O;  3ASN B;  2W0X A;  3FD9 A;  1SF9 A;  3GWO A;  1HR0 B;  4LFB B;  1HP8 A;  3W7W A;  3B8N A;  2DQ3 A;  3ZMZ A;  2EJR A;  3LDE A;  1NJI W;  1X59 A;  4HAM A;  4LNU A;  2IJI A;  1GO3 F;  3HKC B;  1BCC H;  1GK9 A;  3E8H A;  2UXD B;  4J7Z A;  3OMI B;  2KB1 A;  1WP8 A;  1HNW O;  3AG2 C;  1N36 O;  3RYC A;  4XDJ A;  4B08 A;  4TV8 B;  4LC1 A;  5IWA B;  2ZR3 A;  1ARO P;  2HKO A;  3TK1 A;  1W0K G;  4DR2 B;  4YHH B;  1S72 V;  3JAR A;  1MZE A;  2CTQ A;  5FNV A;  5DN6 G;  1XOU A;  4DK1 A;  2EIK C;  1SKV A;  4TUY B;  5F2V O;  3H9V A;  2OWO A;  3ABK B;  4I55 A;  1FJG O;  2DE0 X;  2Q7H A;  3OEH G;  4EFB A;  1XHX A;  3SPH A;  4DV7 O;  1AJN A;  1KEC A;  3EXA A;  4KHP B;  2WLH A;  4CZZ A;  3SPJ A;  3JAL A;  4EKW A;  1XI1 A;  2E74 B;  2YIA A;  3RVY A;  1R1B A;  1HNX B;  5HFL A;  3E2E A;  1VF6 C;  2YEV B;  3J7A U;  1NVP B;  3GB7 C;  4GKJ O;  2JGD A;  1IBL O;  3ZJZ A;  2PF4 E;  5EZY B;  2EIL B;  1EZV H;  3KKY A;  3UO2 A;  2FB5 A;  3CB2 A;  5LOV B;  4Z1M G;  1R6N A;  5LP6 C;  4L87 A;  1MSD A;  4G2K A;  2HJD A;  2HG5 C;  2ZXW C;  4DV1 B;  4U7N A;  4HBN A;  2Q9L A;  2QWO B;  2JJ1 G;  5IYZ A;  1FS0 G;  2F95 B;  3G6B A;  1TVK A;  2Z0A A;  3L9D A;  4DR2 O;  2CTW A;  3AG4 C;  4JI1 O;  2DYR C;  5E1A C;  1OJH A;  2WAM A;  1JCH A;  1XMQ B;  1EN5 A;  4PI2 A;  1N33 B;  1M57 C;  2YI8 A;  1K4D C;  4ZI7 B;  5B3S C;  4J11 A;  1ZWI C;  5BR8 B;  1AI7 A;  2QTO A;  1VQ4 V;  1NTM H;  3T4Z A;  2BCC H;  3SYP A;  5BXZ A;  5LOV A;  5LA6 A;  3FB5 C;  3X2Q C;  4O4L A;  4GKK B;  1SZT A;  2JK5 C;  1GN3 A;  4W4K A;  3CCR V;  5KUM A;  4BWA A;  4DXW A;  1TA8 A;  3I5D A;  1VQ6 V;  2R9I A;  2A79 B;  2FL4 A;  2EZO A;  4X88 A;  1YIJ V;  4LF5 O;  3CE2 A;  4IIJ B;  3CJH A;  4NTX A;  5B1O A;  3L73 H;  1GM7 A;  4YIP A;  1Q6I A;  2HEP A;  3JD0 A;  2YIB A;  5E79 Z;  3K79 A;  4NVP A;  1VQ8 V;  3ETD A;  3ETG A;  4DV0 B;  4MS2 A;  1HW7 A;  1VF7 A;  2D2C B;  1FKA O;  2O57 A;  2OT5 A;  5LMU B;  4WFB V;  3K5O A;  1WP7 A;  2B5U A;  4ZKI A;  2PYJ A;  4P30 A; 
#chains in the Genus database with same CATH homology
 1J95 A;  1THZ A;  2B1G A;  1AI6 A;  2Q67 A;  3LDC A;  1Y4M A;  4GX5 A;  3SYO A;  2A0L A;  3JYC A;  4MVZ A;  4RAI A;  4XDK A;  1NVP D;  4BW5 A;  1B6Q A;  2IU0 A;  4UVB A;  5KUK A;  1K9M W;  4FK5 C;  4XDL A;  3F7Y C;  1VQN V;  1M56 C;  4MVO A;  3WG7 B;  4QNH B;  2IJH A;  4G28 B;  1QR9 A;  5B1B B;  3ZMV A;  4RO2 A;  4U7O A;  1JQ0 A;  4H33 A;  2A9H A;  1BHA A;  3SJQ C;  2WLI B;  3AG4 B;  4FPP A;  5EC2 C;  4PA6 A;  5LHG A;  3CP1 A;  4X89 A;  3CCU V;  3HB3 B;  3QO7 A;  1F4N A;  1WLE A;  3BY6 A;  1BHB A;  1Q7Y W;  2IH1 C;  2WLJ A;  4PA3 A;  1OCZ B;  5CBF A;  2R9R B;  1QLN A;  1QLE C;  5B3S B;  3ZMT A;  4DO2 A;  4QPK A;  3K04 A;  5EBL C;  2W0F C;  2X6C A;  4PDV A;  2X6B A;  3CCM V;  1OCC C;  4GCZ A;  4JGS A;  1W2B U;  2WPD G;  2X7R B;  3G6E V;  1OZ0 A;  2IJJ A;  1VQM V;  5IYD O;  1K92 A;  1K7D A;  4QE9 A;  2ZQM A;  1RM1 C;  3QNE A;  5GW7 A;  1PNL A;  1ROP A;  2QKS A;  2XAS A;  4H37 A;  3CYO A;  1YTF D;  3R65 A;  3FKS G;  2NNU A;  2OCC C;  2WSS G;  2EIJ B;  5B1N A;  1YSC A;  4FIP C;  1JVM A;  2JJ2 G;  3CCQ V;  4ZBM A;  3NXS A;  5B1A C;  4MVM A;  3K08 A;  3EHB B;  4JPR A;  4UXN A;  1VQO V;  4J9Z B;  2W6I G;  2IH3 C;  3ZN1 A;  3LUT B;  3QO5 A;  4JYB A;  1S3J A;  3T1C A;  4GX2 A;  4PDL A;  5HFM A;  3T4D A;  3CCS V;  3MHH C;  1YJN V;  1PNM A;  1FXV A;  1V55 B;  1PNK A;  4UVA A;  3W7X A;  2XAF A;  5CN0 A;  2DWE C;  4N21 A;  3I55 V;  1EZJ A;  1AI5 A;  3FYE B;  1KD1 W;  3OAA G;  3K3W A;  4HZ3 A;  3X2Q B;  1S0V A;  3ABL B;  2AHY A;  1YJW V;  4CBC A;  1GM8 A;  5BZB A;  1V54 B;  5IY5 C;  4UV9 A;  4J9Y B;  2EIN B;  1M9N A;  1PL0 A;  1AR1 B;  3TCU A;  3CC2 V;  1OHH G;  3JD1 A;  4WFA V;  3K0G A;  1ORQ C;  1M90 W;  4X8A A;  3SPC A;  3K03 A;  5IYC O;  4PEL A;  2Y48 A;  1GTO A;  1VQ7 V;  1IXM A;  2IU3 A;  1JPX A;  1KQS U;  1PD3 A;  2B1I A;  5CBH A;  1R73 A;  1AJP A;  5L3G A;  2ITD C;  1OCR B;  1M56 B;  1DTO A;  2Y69 C;  2XND G;  2LP7 A;  5CA3 A;  2HR3 A;  2BOC C;  2XAJ A;  3AG1 B;  1LNQ A;  3AG3 C;  1QVF U;  3OGC C;  3ABU A;  3ML0 A;  4PDR A;  2D3O W;  3ZN0 A;  2WLL A;  1CEZ A;  3OMN B;  5L3C A;  5J9P C;  1EBO A;  1R3I C;  4R50 A;  2DW4 A;  1NQT A;  4YXW G;  3SPI A;  5LGT A;  1N8R W;  2YEV A;  1OCZ C;  1VQ9 V;  4BIZ A;  3E86 A;  4MVR A;  3LSS A;  4BAY A;  5CBG A;  4LCU C;  5FL7 G;  3CCV V;  2EBO A;  2M7W A;  2LFR A;  2CK3 G;  1F51 A;  1NR7 A;  3LDD A;  3LSQ A;  3E8F A;  2ZD9 A;  3OEE G;  2HJF C;  4PDM A;  3ASN C;  3FB6 C;  3ZRX A;  2X0L A;  1YHQ V;  1YTF B;  3P30 A;  1JX9 A;  3K9A A;  1QR8 A;  1M1K W;  4JAV A;  3E83 A;  1QCE A;  2WLK A;  2IW5 A;  2Q69 A;  4LP8 A;  4MT8 A;  2UXX A;  2LFS A;  5C93 A;  5KA6 A;  5LBQ A;  2V1D A;  3VOU A;  4I5S A;  4WFF A;  2H94 A;  4MW8 A;  4Q20 A;  3UM7 A;  3W7S A;  4G27 B;  3RW0 A;  1W0J G;  5B1A B;  5EC1 C;  1EFR G;  1FXK B;  1R3K C;  2P67 A;  3G4S V;  1TUE B;  1H38 A;  2ATK C;  1K5Q A;  2HFE C;  3W7T A;  3KG2 A;  4UUJ C;  2K1E A;  4WFE A;  3OR6 C;  2PI4 A;  3D36 A;  1Q86 W;  3IFX A;  1HWY A;  1WPX A;  2ZDI C;  1R3J C;  3FB8 C;  4MTX A;  2ITC C;  3UKM A;  4JAU A;  4KP4 A;  1OCC B;  1K3E A;  2HLD G;  4PA4 A;  1G8M A;  1H8E G;  4N23 A;  3I56 V;  1H8H G;  3K06 A;  1KC8 W;  3ZMU A;  2XAH A;  4MTF A;  2HVJ C;  1VQP V;  2EIL C;  3OR7 C;  3ABL C;  3ZMS A;  5LGU A;  3OUF A;  3CD6 V;  4P9P A;  1MSW D;  2H8P C;  1Y66 A;  3ABK C;  1I5Y A;  4WF9 V;  2Q68 A;  4MVS A;  2ZR2 A;  3OW2 U;  1KP2 A;  4P9O A;  3VBB A;  3DTU B;  3ZCC A;  4ASU G;  3K0D A;  4UV8 A;  1DLB A;  1K8A W;  1FXK A;  4MVQ A;  3QO8 A;  1NR1 A;  2JDI G;  4R7C A;  3AG3 B;  3E8B A;  1CP9 A;  2HVK C;  4RUF A;  2C2A A;  4JTA B;  1DF4 A;  4XBF A;  2UXN A;  2MK3 A;  4UVC A;  1S76 D;  2Q6A A;  1M57 B;  3CPW U;  4GT1 A;  1E1R G;  4JTC B;  4F4L A;  4JTD B;  2X6A A;  1V54 C;  4TT3 G;  1E1Q G;  4WFG A;  3SYC A;  4QJF B;  1K33 A;  2ZXW B;  3ETE A;  2EIM C;  1GKF A;  3ASN B;  3H01 A;  1P7B A;  4PA7 A;  2DWD C;  4JAS A;  1GM9 A;  2ZDI A;  3ASO C;  3GWO A;  3W7W A;  2V7Q G;  3B8N A;  3STL C;  3SPG A;  4TWK A;  2DQ3 A;  3ZMZ A;  3ABM B;  2EJR A;  3LDE A;  1NJI W;  3B8M A;  4TSF G;  5KA5 A;  1G4Y B;  1XL4 A;  2IJI A;  2Z5U A;  2WLN A;  1R3L C;  2Y69 B;  1GO3 F;  4HAM A;  1S77 D;  5DM6 V;  4HYO A;  2GSM B;  3AG1 C;  3E8H A;  1GK9 A;  1PKX A;  2JIZ G;  4WFH A;  4FJC C;  2AHZ A;  2P90 A;  4I9W A;  2EZP A;  3AEI A;  2DYR B;  3OMI B;  5IYB O;  2KB1 A;  3M99 B;  3AG2 C;  3ZRS A;  4RQE A;  2DYS C;  5H9C A;  3JD2 A;  3LNM B;  4XDJ A;  2QM7 A;  2XOK G;  4LC1 A;  2ZR3 A;  1ARO P;  2HKO A;  1NKD A;  2JEX A;  3TK1 A;  1SRY A;  1W0K G;  5EK0 A;  4FMT A;  1S72 V;  3RBZ A;  4QE7 A;  2WLM A;  1OCO C;  5L3E A;  1L1F A;  1NH2 B;  4QPJ A;  1ENV A;  5DN6 G;  2EIK C;  4MTO A;  2DQ0 A;  3HPL C;  5EBW C;  4WCE V;  3ABK B;  4QIW F;  3CCE V;  3SYQ A;  2QM8 A;  2GHY A;  3OEH G;  1CPY A;  3CMA V;  1FXK C;  3SPH A;  3A0R A;  1AJN A;  1R6K A;  1KKD A;  1KEC A;  3FB7 C;  3ZRW B;  1AI4 A;  2WLH A;  4E2L A;  5L3F A;  3ZRW A;  3SPJ A;  4CZZ A;  4EKW A;  2JEU A;  3WG7 C;  2BOB C;  3RVY A;  4PA9 A;  3CCJ V;  1VQK V;  5LHH A;  4MVU A;  3STZ C;  5HFL A;  3E2E A;  2NLJ C;  2XAQ A;  5IDJ A;  3P32 A;  4P2Z A;  2YEV B;  1YJ9 V;  1FFT B;  1NVP B;  3CC4 V;  3GB7 C;  5H6R A;  5LGN A;  3E8G A;  1Q82 W;  3ZJZ A;  4OXS A;  1K97 A;  2EIL B;  2WLL B;  4GX0 A;  3ZIA G;  1NH2 D;  3D3I A;  2OTL V;  1BL8 A;  4Z1M G;  1R6N A;  1VQL V;  4L87 A;  3IC7 A;  2IJK A;  5L3B A;  4G2K A;  2HG5 C;  1P4R A;  2ZXW C;  4R6Z A;  2F43 G;  4U7N A;  5LHI A;  2P6J A;  1E79 G;  1MG1 A;  2FTK A;  3ASO B;  3IGA C;  1RM1 B;  3OFN G;  2JJ1 G;  3BEH A;  4RUE A;  3EFF K;  3FYI B;  3JD4 A;  5CMU A;  3ABT A;  1SER A;  1FS0 G;  2OCC B;  1MOF A;  3TET A;  1FXH A;  1MAB G;  5B1B C;  4KFM A;  1K73 W;  3PJS K;  5EBM C;  3AG4 C;  4MW3 A;  2YSU B;  2DYR C;  1GMG A;  5E1A C;  1RPO A;  4MSW C;  1K5S A;  2WAM A;  3F5W C;  1JCH A;  1Q81 W;  3AG2 B;  1M57 C;  2DYS B;  1AJQ A;  1JJ2 U;  1K4D C;  4GX1 A;  1QLE B;  4JYC A;  5B3S C;  3CXC U;  1V55 C;  1BMF G;  3OE7 G;  3F7V C;  2XAG A;  1K34 A;  1ZWI C;  2QE7 G;  1AI7 A;  2QTO A;  1VQ4 V;  3T4Z A;  4BIU A;  2EIM B;  3SYP A;  1JOY A;  4LBE C;  3WFV A;  3B77 A;  3FB5 C;  3X2Q C;  2P7T C;  1VQ5 V;  1H2G A;  2EIK B;  3JD3 A;  1SZT A;  2JK5 C;  5IY5 B;  3ABM C;  1I5X A;  2EIN C;  3MHS C;  1NBM G;  2EIJ C;  3E89 A;  3CCR V;  2PI5 A;  1UJW B;  3W7U A;  5KUM A;  1SET A;  4DXW A;  1YI2 V;  1VQ6 V;  1KP3 A;  2R9I A;  4MTG A;  2A79 B;  1QVG U;  3T2M A;  2EZO A;  3E35 A;  4X88 A;  1YIJ V;  3CC7 V;  1F23 A;  3RVZ A;  4RQF A;  2Z3Y A;  3OM3 B;  1S5H C;  1OCR C;  1GM7 A;  1COW G;  5B1O A;  2QEX V;  3MD0 A;  2WWW A;  3JD0 A;  3DGE A;  3ZRV A;  1K4C C;  3K79 A;  1SES A;  4R8C A;  1YIT V;  2W6J G;  3JCZ A;  3SYA A;  1VQ8 V;  3ETD A;  5H6Q A;  3ETG A;  1OCO B;  1QBZ A;  1RPR A;  4MS2 A;  2OTJ V;  1F4M A;  1DF5 A;  2WLI A;  1XL6 A;  2OT5 A;  2QA4 V;  3OMA B;  4WFB V;  3CCL V;  3G71 V;  5L3D A;  3OUS A;  4KUM A;  2B5U A;  4JF3 A;  3CME V;  4ZKI A;  4P30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...