4HZ3A

Mthk pore crystallized in presence of tbsb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title The voltage-dependent gate in MthK potassium channels is located at the selectivity filter.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport
total genus 32
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hz3A00
2ATKC 2W0FC 3E8HA 3LDCA 4P30A 3K06A 3UKMA 4ZBMA 2OCCC 3ABKC 3FB7C 4JTAB 4RUFA 3K04A 3E83A 4HYOA 4MVZA 2WLKA 3SJQC 3WG7C 5EBMC 3AG3C 4KFMA 4R50A 3EFFK 3SPJA 3IFXA 4R7CA 5J9PC 2A79B 4J9YB 3OR6C 2HG5C 3SYPA 3SYOA 1OCOC 4PA9A 3AG2C 2EIMC 4MTOA 4MW8A 4WFGA 2YEVA 5B1BC 1BL8A 1M56C 4X8AA 3TETA 4DXWA 4PA6A 5E1AC 3RVYA 4MVMA 4MVUA 1K4CC 2EINC 2HVKC 5EBWC 3T2MA 2EIJC 3JYCA 4WFFA 2R9RB 2BOCC 3LUTB 3SYQA 3T4DA 3F5WC 4P9OA 3UM7A 3PJSK 4LP8A 3RW0A 4WFHA 3VOUA 2WLHA 2WLJA 1ORQC 4GX1A 4PA4A 2WLNA 2HJFC 4GX0A 4I9WA 4PDVA 3SPCA 5EBLC 4JTCB 4EKWA 3AG1C 2WLIB 3K03A 4P9PA 4G27B 1LNQA 4QNHB 1R3IC 2WLLA 3STLC 3ZRSA 4PDMA 4TWKA 2AHYA 3SPGA 1KKDA 2A0LA 4XDJA 3OGCC 3STZC 2IH1C 3HPLC 3LDDA 1XL4A 3SYAA 1R3KC 4MVRA 5B3SC 1OCCC 1JVMA 3E8FA 3F7YC 5BZBA 2IH3C 2DYRC 1OCZC 2K1EA 4R6ZA 4WFEA 3F7VC 1S5HC 2X6BA 2DWEC 3ASNC 5B1AC 2DYSC 2Q68A 2WLMA 3FB8C 5IY5C 2QKSA 2ZD9A 1K4DC 1XL6A 4P2ZA 4XDLA 5EC1C 3X2QC 4MTGA 4QE9A 1P7BA 2DWDC 3ABLC 4PA7A 2NLJC 3E89A 4MS2A 2ITCC 2ZXWC 4JTDB 4MW3A 3IGAC 4MVOA 2QTOA 3T4ZA 1R3LC 4XDKA 3LDEA 4J9ZB 1QLEC 2JK5C 3OUSA 4GX2A 2WLLB 1J95A 3LNMB 1ZWIC 1V55C 4PA3A 3SYCA 2WLIA 2EIKC 1M57C 2EILC 4HZ3A 2X6AA 2Y69C 4MSWC 4MVSA 4MTFA 4UUJC 4OXSA 3ZJZA 3K0DA 3FB5C 4LCUC 3RVZA 3R65A 4H33A 3T1CA 2X6CA 3AG4C 3OUFA 3RBZA 3ASOC 3K08A 5CBFA 2A9HA 2Q69A 3SPIA 2ITDC 2H8PC 1V54C 2Q6AA 3TCUA 5KUKA 5CBGA 1R3JC 4PDRA 5CBHA 2BOBC 3E86A 4BW5A 3OR7C 2KB1A 4QE7A 3SPHA 3FB6C 4RAIA 4RUEA 4MVQA 2Q67A 4GX5A 4PDLA 4CBCA 2HVJC 4G28B 4X89A 3K0GA 1G4YB 3ABMC 2AHZA 3BEHA 3E8BA 3E8GA 2P7TC 3GB7C 4R8CA 4LBEC 4RO2A 1OCRC 3KG2A 5EC2C 4F4LA 5KUMA 2HFEC 4X88A 4H37A 5EK0A
chains in the Genus database with same CATH superfamily
4U7OA 5LGNA 3UKMA 2OCCC 3L72H 2ZE5A 1XUQA 2Q7EA 2UUAB 1M4UA 3CMEV 1TGOA 5KHGA 3HKBA 1Q6IA 1BMFG 2HP8A 1N34O 1Z5VA 4QGPA 4UFZA 4WFBV 5C8YA 4MVMA 1Y67A 3T2MA 4CH4A 1D5AA 2Q4PA 1NKDA 4CC5A 4X20B 1X4TA 4FM2A 5IY5B 4DV1O 5LP6B 2XTAA 2Q0AA 1F23A 5KAFZ 4OX9O 3AG1C 5L3BA 5IJ9B 4K0KO 4W4KA 1BGYH 2AHYA 2RCVA 1GN4A 1N36B 4MVRA 1OCCC 2HR3A 2RDCA 2UXBB 2YUAA 2AW9A 4I7ZB 2V7QG 3KKYA 4PI2A 1VF6A 2JS3A 4J7ZA 1FAFA 1Y4MA 2QR4A 3AK3A 2ARHA 2G38A 2E3CA 1P7BA 1SZTA 2GTSA 4PA7A 4XBFA 3CPWU 1XHZA 1P49A 5KHHA 1FJGB 3ZHTA 3J80N 3WU2Z 4LR3A 3CRRA 3H1HH 2ZCEA 4DV7B 1KU9A 2ZKOA 4GKJO 4PI0A 2WLLB 5IWAB 2DOSA 4NR1A 3SJBC 2PF4E 4DR5B 1M90W 3D3IA 3OE7G 2E5LB 2UXCO 1YJNV 3K3WA 5IT9N 2XUMA 1W0JG 2A9HA 2HEPA 3KCYA 2XT9A 1UJWB 1CXZB 4F6RB 4HNAB 2GV9A 4QE7A 4TUYA 4JF3A 4FM1A 1N33O 3GVMA 1QR9A 4JI5O 1N32B 3CCMV 2FKXA 2RNBA 1YVWA 2ATKC 4EFBA 1Q7YW 2F43G 3ABKC 4A5UB 4I5SA 3ABLB 1SQFA 4AQYO 3RWRD 1I0HA 1QR8A 3ZHUA 2AZ0A 4FVMA 1T5EA 1YJ9V 1M56C 2VWKA 1GO3F 3EVKA 2JRIA 3JD3A 1EM1A 5H6QA 3CRQA 1KD1W 2V4DA 4FLUA 1W59A 2CAZC 3B4SA 5IDJA 2VQFB 1SA0A 4DV5B 2QJ1A 1L0NH 4NTYA 5IYZB 3G71V 4WF9V 4I50B 5BXZA 2GSMB 4TSFG 4I0XA 4NKGB 3ZRVA 2B1IA 3T1HB 1PL4A 4AI8A 1YHQV 2WLMA 4AILC 2CH7B 4DR1O 4LF8B 3CXHF 4MTGA 2N74A 3IGAC 4TV8A 1FYJA 1VMGA 2BSKB 5E79Z 1J5EO 2QE7G 1QLEC 1QNMA 2P6JA 5L3CA 1GM9A 2JK5C 2PUSA 1ZWIC 1V55C 1VQ6V 4O4LA 4ZI7B 1IX9A 3K9SA 2Q73A 4X1KA 4DV0B 1R1BA 4B3SB 3W7UA 3MHSC 1ZUQA 1E1RG 4W4LA 2OWOA 2DN9A 2P4KA 1AJPA 3A0HZ 2YSUB 1AJNA 3JD4A 4PHZA 3HB3B 3K0GA 4B3RB 1VQ8V 4DR7O 1JJOA 1VQOV 2GHYA 4E4EA 3K04A 1V9PA 1JCHA 4R50A 4JYAB 3HKEB 3JAKA 1IXBA 1M93A 3EHBB 1RP3B 3H1IH 1MG1A 5CA0B 5ITZB 5CA1B 4RQEA 1WP7A 1EN4A 4WBNB 1WPXA 2CTQA 3CCRV 1I5XA 2QM8A 3I56V 2D3OW 3VOUA 1WA8A 3AG4B 4JI7O 2UXDB 4I9WA 4TV9A 1BE3H 1K92A 1DK1A 1M1KW 3N2KA 1R3IC 1YSCA 4PDMA 4LF7O 1U96A 2KQXA 5L3GA 5BZBA 1HR0B 1QBZA 4X66B 2Y0PA 1YTFD 1BS3A 3JASB 4JV5B 5L3DA 1SQQH 1MA1A 1B06A 4JI4B 4YIOA 3OEHG 3T4ZA 4L87A 2RMKB 3MAQA 1G1XB 3OMNB 4NTXA 3OUSA 4ABMA 1WB8A 2WLIA 2X0LA 2FYUH 3BAAA 4OXSA 5GONA 5IE9A 3JCUZ 4UCTA 4DR6O 3CX5F 5KLVH 3ZCCA 1AB3A 5LGTA 5H9CA 3OR7C 2ZINA 1S5JA 1RM1B 2Q67A 5B5EZ 4CBCA 4NXNB 1SQVH 1FXKA 1G4YB 2P7TC 3GB7C 4QJFB 2KKWA 1OCZB 1OCRC 3M8AA 1GAXA 3RT3C 4K3AA 3BA9A 2B5UA 1K5SA 3K06A 4IL6Z 1RPOA 2ZE8A 3OW2U 3ZIAG 1VARA 3IFXA 4YJ3A 5D5PA 1EZVH 5J2TA 1LR1A 3H1LH 3OEEG 1SRYA 3BY6A 4MTOA 5JJEB 2EULA 1ZL8B 2MK3A 2V1DA 1XHXA 4WFFA 1EFRG 1AVMA 3RYHA 5JJNB 2UXBO 3RYFA 2ZQMA 1PNKA 4J11A 1ZX3A 2KSDA 1K73W 1O9HA 3BCCH 4J10A 3VQYA 5CB4B 4DV6B 5BMVA 4LF9B 4BWAA 1IBKB 3C3TA 3SYAA 1FJGO 1JA8A 3HKBB 2ZT9B 1CP9A 1GH6A 1U97A 2XAJA 4DV7O 2QGNA 5C8YB 3ETDA 4P2ZA 4DR5O 2E5LO 2NLJC 3RYIB 2IBZH 2ITCC 4JTDB 1XMQB 2UXXA 1TVKA 3WB2A 2XNDG 3SYCA 3W7TA 4PV1B 3K0DA 3ZHQA 5CBFA 1MABG 1N32O 4IYIA 3CCJV 2BOBC 2HJDA 1US6A 2PY5A 2GBOA 2LQTA 1DF4A 3F5TA 1QLNA 5KAIZ 2EINB 1QQCA 4J42A 3ASNB 4X88A 1MNGA 3LDCA 2PGGA 1G6UA 1PNLA 3B40A 3GWKC 1RFYA 2A79B 2OYQA 1OCOC 2P90A 1VQPV 4DR4B 2QA4V 4X8AA 4FFBA 1Q6UA 3CCSV 2JEXA 4TUYB 4FLZA 3PJSK 3FYIB 4ASUG 4YXWG 1N8RW 2WLJA 1AI4A 2DYSB 1H38A 3ASOB 3DSQA 5IJ0B 3W7SA 3T1HO 1RSOA 3JATA 2OT5A 2WAMA 3ZRSA 1I7FA 5HFMA 4XDJA 4LF8O 2OTLV 4DO2A 2WA4A 2JS5A 5IY5C 4CH3A 2QKSA 2ZD9A 3T1YB 5LP6C 3APQA 2HHHB 3HKDA 3LSSA 1AI7A 5JVDA 1Z2GA 4YIPA 2QM4A 1FS0G 2CTPA 3E89A 1SQBH 3CRAA 5BR8B 4B3SO 2EJ7A 4UCRA 3SJAC 1J95A 4YHHO 3LNMB 1AR5A 1UPGA 3K5MA 3CD6V 2Q7GA 1Q86W 3ZS8C 3OUFA 4I0XB 4JZ2A 1DGSA 3JAWA 3RBZA 1FFXA 4B3RO 1AILA 1XMOB 4YY3B 3FYEB 4KXRA 3SDLA 1TUBB 1GM7A 4RAIA 1HDJA 4UCSA 2ZNIA 4GX5A 2QWOB 1AROP 4JYAO 1HNXB 3E8BA 3B8NA 4TV8B 5EC2C 1IBMB 3J7AU 4LF5O 1L8DA 5EIBD 4DW1A 4P30A 3ZMUA 2ZR3A 4MVZA 1NU1H 3DC6A 4ICGA 4J9YB 4FMTA 2BTQA 1Z5WA 1KB9F 4X1KB 2UXDO 2QWQB 4WFGA 5B1BC 5LL6Y 2W6IG 3S3XA 5BY1A 4RQFA 1SS3A 5D5QA 2EIJC 2HKOA 3UM7A 1XREA 4K8XA 5FLXN 4FLVA 4PA4A 4GX1A 4LFCB 2WA3A 1VQ9V 4TOIA 1S72V 1Q3EA 4DR2B 1YTFB 4X66O 4JV5O 2ZE7A 1MZEA 2UUCB 3LSUA 2OTJV 3CB2A 1SQPH 1XNQB 4IT5A 5LMUB 3JAKB 2ZIMA 4DV4B 2QWPB 4JI4O 2IH3C 2LP7A 2AGAA 1QU7A 1JX9A 4Z2WA 3FB8C 3MD0A 4X62B 1HNWB 1I94O 2VS0A 2UU9B 3H9VA 3EXAA 1G8MA 2ZIOA 2GTAA 3D36C 4DV2B 1LUVA 2EIMB 4TV9B 3OMIB 3D3QA 2Y48A 1L1FA 4IGGA 3RFRA 3OTFA 4FLYA 2FTKA 1M57C 5K1XA 1F4NA 4NXNO 3OGIB 2IJKA 1GMGA 1YF2A 3AG3B 5CBHA 1Y66A 1IDSA 4TQDA 2VRZA 4JAAA 2CK3G 1TUEB 4X1IA 5B3SB 2Z0AA 3ABMC 4IIJB 5FNVA 4R8CA 3ZMSA 3AG2C 1XNRB 1B6QA 2ADPA 3E83A 3WG7C 3WFVA 3X2QB 2GDSA 5FL7G 1AI5A 4ZKIA 3KZIZ 4MW8A 3QO8A 3QNEA 1S3JA 3G67A 4ZOLA 4DXWA 4PA6A 4J7JA 2OCHA 1ZAUA 4DV6O 2Y69B 3JALB 4LF9O 1IBKO 4Q20A 3UO2A 1PKXA 1FXKB 3IC9A 3SPCA 4PDVA 4O4JA 2CTWA 4EKWA 1V54B 1NTZH 4ZIBA 3CCQV 1VEWA 1B04A 5KHIA 1XL4A 2DMXA 4YJ3B 4OPHA 5J2TB 2F93B 1YCIA 1XMQO 3F7VC 2MW2B 1TA8A 4UCOA 4X1YA 4AHCA 1JPXA 2OCCB 4XDLA 3WB0A 2JVDA 4I4TA 4NVPA 2ZXWC 4JI2B 4LNUA 4O4IB 2DQ0A 3RYFB 2Q7HA 2FL4A 3ZX6A 2EIKC 5JJJB 2EILC 5BMVB 1SERA 1BZKA 3QG5A 5IYBO 3K58A 2YIDA 4H33A 4QPJA 4BW9A 4D6TH 2E74B 1K8AW 4NTWA 3AG1B 4Z1MG 2YIBA 3ZBHA 4N21A 4YJ2A 4BW5A 3G4SV 4UB6Z 3FB6C 4J80A 2WWWA 4JYCA 4CS3A 1BCCH 1OCCB 4U3FH 1GRJA 5DEDA 2AHZA 1WN7A 5LYJA 1TVKB 2BCCH 1YIJV 4ZBMA 1XOUA 2DW4A 2PZSA 5J9PC 3SYOA 1YZBA 1RM1C 1PM9A 3QF7A 1BSMA 1QCEA 1M9NA 4WCEV 3RN4A 3JYCA 5K1PA 3CJHA 4P9OA 2XAHA 4RWUA 1IBLB 2CUGA 5LA6A 4E2LA 4UV9A 1FXVA 1EZJA 1KP2A 4H0LB 3T1YO 2QEXV 2HHHO 5HFLA 1RPRA 5KX5A 2EJRA 4JI3O 5LMNO 2IW5A 2DYRC 4WFEA 5BR8O 5JQGA 2DWEC 2H94A 3CMAV 4FFBB 1K4DC 2F95B 3ABKB 3ZHRA 3N2GA 5DM6V 4KL1A 4DW0A 4DUZB 3CC7V 4X20A 4JASA 1RSOB 3JATB 1NI8A 1YDXA 2VQEB 1M56B 3RYCA 1XMOO 2Q0OC 5LP6A 4YY3O 1M5IA 2FB5A 2D2CB 2A06H 4JI8O 2K9PA 2JIZG 3M99B 4LCUC 1HNZB 1HNXO 3SPIA 1A32A 2H8PC 4B3TB 2Q6AA 1IBMO 1FPOA 3S3WA 1R3JC 3CE2A 3ZHVA 5C93A 3HKDB 4H44B 5JVDB 1PNMA 2LO1A 4MVQA 1JR9A 4F4LA 4LBEC 2ZE6A 2XASA 5EK0A 1D5NA 2B9ZA 3E8HA 1CEZA 2WLKA 4KFMA 4KHPO 3BVOA 2QSAA 3JAWB 3E22B 1FFXB 4FM0A 4DV1B 2UUAO 1K4CC 1P4RA 2EINC 2HVKC 1F4MA 2O57A 5EBWC 1V55B 3SYQA 2R9RB 2BOCC 3TK1A 1NVPD 2UUCO 2ZDIC 3LSQA 1MOFA 1XNQO 4DV4O 3D8CA 1BQZA 1AP5A 2P22C 4P9PA 4D7SA 4X62O 1VQKV 4TWKA 1E1QG 2A0LA 2LGWA 2BTQB 4DV2O 1S5HC 1SQXH 2E76B 2EZOA 2DYSC 1NT2B 3VBBA 1NBMG 1BQ0A 1N36O 3PN1A 4JYBA 3CRMA 4CS2A 5CA3A 4QIWF 3O65A 3JAMN 1ZSPA 5DN6G 3K57A 2YXLA 3L71H 1R3LC 5JCOC 4LF6B 5AG2A 4Q6GA 4LFAB 2JJ2G 1NH2D 2R9AA 1K7DA 2X6AA 4MSWC 4MVSA 4UCUA 3ZJZA 1GM8A 5IYZA 2H3OA 2R9IA 3L73H 3D36A 4EB6A 5JH7A 1WPBA 5IWAO 3TCUA 2M6YA 1XNRO 3CXCU 4PELA 2KG7A 2A3QA 2KB1A 3W7XA 4PDLA 4LH6A 3N27A 4AQYB 2F4VB 5KUMA 4ZHQA 1P84F 2IJHA 4FLWA 2BSKA 3UT5A 3RGBA 1PD3A 2DQ3A 3H01A 5EBMC 1X59A 3TXQA 5FPRA 5IYCO 3OTOB 5F2VO 1YI2V 4ZI7A 2XHBA 3CCLV 2Q8VA 3CC4V 2LW1A 2JJ1G 1COWG 3R66A 5LOVA 2QDOA 4G2KA 4X1IB 5FNVB 5KA6A 1ROPA 2GUZA 4IHJA 3OM3B 1IZ3A 1HP8A 1XQ8A 3QO7A 4DV3B 3G6EV 1K5QA 2VQFO 4DV5O 4UVBA 1AP6A 1YJWV 4JI2O 2YI8A 4JZGA 1H2NA 4NB5A 5FPOA 4ZOLB 1XBLA 5KA5A 3UCSC 2B1GA 1J5EB 5CA1A 5GW7A 4BIZA 2RQ6A 3P32A 1AI6A 1FFTB 1HWYA 1Q90D 3KCXA 1W2BU 3FFQA 4DK0A 1H8HG 4X9QA 3IC7A 4O4JB 3TJTA 4QPKA 1KBHA 1LUWA 4D7TA 2YXHA 4HZ3A 4MTFA 4KP4A 1R73A 1NTMH 2QM7A 1I5YA 1QHTA 3OD4A 4DRXA 4MTXA 1N0JA 4UCVA 3DTUB 4GCZA 1FXHA 4X1YB 4DV0O 4DR3B 4RUEA 1SA0B 4OPAA 4X89A 1VP7A 3ZMVA 4I4TB 4X64B 5L3FA 5B1OA 2BE3A 4DK1A 2YICA 3VQWA 2CTRA 3AG3C 3EFFK 2QTSA 2PTMA 3B09A 1SQGA 4JI6B 4B08A 1AR4A 4PA9A 3VQXA 1Y76A 1JQ0A 1SESA 2LFSA 3ABUA 4O2BA 4YJ2B 1MMMA 3F5WC 1PL0A 5B1AB 3TGUH 2XAGA 3WB1A 5EBLC 1JMKC 3P30A 3A2FA 5LYJB 4GKKB 4O4LB 3SJCC 3FD9A 1Y74A 1XEQA 4DUYB 2IM9A 4JPRA 3DC5A 2IU0A 3STZC 1Q82W 2N04A 2Q9LA 4FFKA 3F7YC 5CN0A 2K1EA 4DUZO 4HAMA 3ETGA 4LC1A 3MDSA 3P3NA 2Q68A 3IAYA 3W7WA 5TISZ 1WNSA 1HR0O 3CJHB 3ABLC 4GYCB 4BIUA 4FLXA 1K34A 5LGUA 1OCOB 2Z5UA 4Z1VA 2WPDG 2Z3YA 5LA6B 1NQTA 1P7GA 1KYOF 4O2AA 3LDEA 1N0NA 3FAVA 5EYPA 4B7EA 5KMGA 5KX5B 1R6NA 2Y4TA 5LBQA 3BFRA 1VQ7V 3R65A 5CB4A 1GK9A 4CZZA 3C90A 2OIGA 3Q4HA 5LXTA 4K8ZA 5JQGB 4B3MB 4LWSA 3ML0A 1WA8B 3G6BA 3AK2A 4UVAA 3N2GB 4FJCC 4J7KA 4LF4B 3A8TA 3E8GA 3N2KB 4U7NA 2PI5A 1EN6A 3RYIA 3RYCB 1KECA 3FB7C 4H13B 1NVPB 3IJ4A 1VF5B 4FZ1A 4CS4A 1ZTEA 4OGQB 2EZPA 4R7CA 2E75B 3QVNA 1JFFA 4FPPA 3QO5A 1AJQA 1BL8A 2JGDA 3TETA 3ZN0A 5IYDO 4K35A 4LP8A 1Q5OA 4NXMB 3BABA 3ETQA 1XDCA 4JTCB 2WLIB 1YXBA 3HKCA 5GONB 5CMUA 1E79G 2ZDIA 4MT8A 1H2GA 1UFIA 1JVMA 5EZYA 1BHBA 3GWOA 4O4HA 3JCZA 2X6BA 4UB8Z 5J2UA 2CGNA 4LF6O 3E35A 2AXTZ 2YC0A 1NH2B 3CC2V 4IYHA 2DE0X 4LFAO 1NTKH 1R6KA 3JARA 4L8JA 2Y0IA 4I9QA 3JD2A 5B1BB 5DECA 4F6EA 2LW7A 1MZFA 5IJ0A 1GKFA 4UXNA 4GX2A 1QVFU 2EIJB 1OJHA 4UUJC 2YI9A 1F7YA 1KMIZ 4NYKA 1FD9A 3FB5C 3RVZA 2X6CA 3AG4C 1GTOA 2W0XA 1CPYA 1H2MA 5JCOA 2F4VO 4JYYA 2QWRB 4PDRA 1SF9A 1Q8IA 3UO3A 5KHKA 2F66C 3SPHA 3CHXA 3RYHB 3CP1A 3OTOO 3BEHA 3NR7A 3OMAB 3DGEA 3KG2A 4TT3G 1S76D 4UV8A 3ETEA 4U3JA 1YITV 2QKAA 3BRCA 5EIBC 2PYJA 3HR0A 2P06A 1IVSA 3OR6C 1ZLZA 2NR5A 4JAVA 2RN9A 5JH7B 4EB6B 2YEVA 3SR2C 3AG7A 1VQMV 3C3SA 3T4DA 3LUTB 2JEUA 1PV0A 2KG7B 1M57B 2OIEA 4EFEA 1VQ4V 1THZA 3L74H 3RW0A 2ZM6B 4DV3O 2ZNJA 2WLHA 4DR4O 1BHAA 3B77A 1TUBA 2UUBB 3APOA 3LNNA 1KKCA 2X7RB 3K03A 4BIOA 4ZHQB 4JGSA 1LNQA 1JOYA 3ZEDA 3UT5B 4LFBB 1OHHG 1K33A 3ZRWA 4I55A 1KKDA 4GZRB 3DXRA 2P4VA 4X65B 3ABMB 2IJIA 1OCZC 1HW7A 2YXYA 2ETNA 2FMLA 2XAFA 1DTOA 3AG2B 5GTHZ 3U11A 3WG7B 3G80A 4YHHB 1KP3A 5LOVB 2XAQA 2RJZA 4MW3A 5GTIZ 2YIBD 3L75H 2GUZB 4IHJB 3M7MX 3AEIA 2NN4A 3CCUV 2F23A 4DR3O 1NJIW 3ZRXA 1XILA 2F1MA 4WFAV 5A2QN 4X64O 2WSSG 1OV9A 1YEWA 5CBGA 1K3EA 5B1NA 4LF5B 1PPJH 4JI1B 3ZN1A 3CYOA 1GN3A 3ZMTA 1GN2A 4JI6O 1SKVA 3K59A 4RO2A 2HLDG 4B7KA 1D2DA 1Q81W 2HFEC 5H5NA 4H37A 5IJ9A 4N23A 1H2KA 2XOKG 1EBOA 2HG5C 3JSNA 3A0RA 4JI0B 2ZXWB 1Q43A 4DRXB 4FIPC 2A7WA 3BPZA 4GKKO 4PJ0Z 2LGQA 2EIKB 5H2FZ 2EILB 4DUYO 4WFHA 3OFNG 4FK5C 2WLNA 1N34B 2BTOA 1H8EG 3K5LA 1VQNV 1I08A 4FZ0A 4IIJA 1VF6C 2WLLA 3STLC 4FLTA 5KHJA 4J41A 4LFCO 3I55V 3OGCC 2IH1C 4DR2O 1I94B 3I5DA 1QLEB 2QKCA 3E8FA 1QVGU 4OX9B 1Y76B 2ADQB 3ASNC 3CSXA 4JAUA 4K0KB 2ODMA 4F6RA 2NNUA 4HNAA 1SETA 4CH6A 1ENVA 4O2BB 5LMUO 5H6RA 3THOA 4BAYA 2DWDC 2PI4A 1MSDA 3U10A 4MS2A 4PD4F 3FX7A 4MVOA 1NZ6A 3JALA 1H2SB 1HNWO 1MSWD 2UU9O 3O9OA 4B3MO 1Y74B 4GUNA 1URFA 3JSLA 3T1CA 3ZHSA 2JDIG 3ASOC 4LF4O 3K5OA 1PP9H 1L0LH 2R72A 4GKJB 1K97A 2W6JG 1IURA 2UXCB 3E2EA 2YS8A 4G28B 4C7UA 3B2EE 1N4CA 2DYRB 2L6LA 4O2AB 3L70H 3CS5A 2W0FC 5JWPA 1VQ5V 1XI1A 3FAVB 5EYPB 1AR1B 4I50A 4O4IA 5KMGB 3SJQC 1N33B 2UXNA 1DLBA 1O9GA 3SPJA 4BR6A 4JI5B 4NXMO 3Q4HB 5LXTB 3U0ZA 5E1AC 2CH7A 3RVYA 4LWSB 1WLEA 1NR7A 1NR1A 3ABTA 1VIBA 2L35A 1S77D 1KUQA 3CCVV 4GX0A 4UVCA 4EEQA 1SC5B 4QNHB 3UQ8A 2LFRA 3SPGA 3HPLC 1R3KC 4TQFA 1GN6A 3J81N 3ZMZA 1JFFB 5B1AC 2YDEA 1IXMA 2JGDB 2P67A 3SGIA 2DJVA 1XL6A 4QE9A 3CRCA 1WP8A 1H2LA 4HBNA 1SZXA 4XDKA 1S0VA 5LHIA 4J9ZB 3HKCB 4DR1B 2YIAA 1OCRB 3HKEA 3FKSG 2LJ2A 3K5NA 1WB7A 4CH5A 5EZYB 2Q69A 5CA0A 5ITZA 2IJJA 2QWNB 4O4HB 5LHGA 5KUKA 2CDYA 2ZR2A 5J2UB 4WBNA 2CE4A 1FKAO 2HVJC 3JD0A 3JARB 1DF5A 1R6TA 5LHHA 1VF7A 2M7WA 4JTAB 4RUFA 4HYOA 1OZ0A 1F51A 2ZM6O 2IU3A 3SYPA 3K9AA 3QTCA 4DR7B 2EIMC 2UUBO 3CCEV 3JASA 1KC8W 1B3QA 3L9DA 2Y4UA 4MVUA 3OT7A 1BT8A 4LNUB 4LFBO 5A9GA 1K9MW 1ORQC 1WJZA 2HJFC 3A0BZ 4X65O 3P3PA 2EBOA 3AK1A 1TAEA 4JI3B 5LMNB 4G27B 1JJ2U 3ICXA 4LH7A 1IBLO 4U3JB 3VQVA 1Q6HA 1W0KG 4GLXA 3LDDA 4JI7B 4KUMA 5B3SC 1EN5A 1Y6XA 2C2AA 2ILMA 4R6ZA 2YEVB 3H1KH 5B66Z 2R70A 3B8MA 3E22A 1WAZA 2EX3A 4LF7B 5EC1C 3X2QC 3NXSA 4GT1A 3H1JH 4JI8B 5L3EA 3MHHC 2QTOA 2P5OA 4DYLA 2AZ2A 3BHPA 4CC6A 4PA3A 3K79A 2Y69C 3ZRWB 4I55B 4JI1O 3DXRB 2N05A 2VQEO 1FXKC 3K08A 1NS1A 1VQLV 2ITDC 1V54C 1ZL8A 2PYLA 2JGUA 3JD1A 3E86A 3CEIA 3BA8A 1HNZO 2CGOA 2VWJA 3TXSA 4B3TO 2Q5ZA 4JI0O 1S5LZ 4DR6B 4KHPB 3OAAG 1KQSU 3CWBH
chains in the Genus database with same CATH topology
4U7OA 5LGNA 3E8HA 3LDCA 3UKMA 1YITV 2OCCC 1CEZA 1PNLA 2WLKA 4KFMA 3CMEV 2A79B 3OR6C 1OCOC 4JAVA 1BMFG 2P90A 1VQPV 2YEVA 2QA4V 4WFBV 4X8AA 1VQMV 4MVMA 3CCSV 1K4CC 1P4RA 2EINC 2HVKC 1F4MA 5EBWC 3T2MA 1V55B 1NKDA 2R9RB 2BOCC 2JEXA 2JEUA 3LUTB 1M57B 3SYQA 3T4DA 3TK1A 3PJSK 1THZA 3FYIB 3RW0A 4ASUG 2ZDIC 3LSQA 4YXWG 2WLHA 2WLJA 5IY5B 1AI4A 2DYSB 1N8RW 1MOFA 1BHAA 1H38A 3B77A 3ASOB 3W7SA 1F23A 2X7RB 3AG1C 3K03A 5L3BA 2OT5A 2WAMA 4P9PA 4JGSA 1LNQA 1JOYA 3ZRSA 1VQKV 4TWKA 5HFMA 2AHYA 1OHHG 1K33A 3ZRWA 1E1QG 2A0LA 4XDJA 1KKDA 4MVRA 1OCCC 2HR3A 2OTLV 3ABMB 4DO2A 2IJIA 1OCZC 2V7QG 1S5HC 2XAFA 2EZOA 1DTOA 2DYSC 3AG2B 3VBBA 5IY5C 1NBMG 2QKSA 2ZD9A 1Y4MA 4JYBA 3LSSA 5CA3A 1AI7A 4QIWF 3WG7B 1P7BA 1SZTA 4PA7A 4XBFA 3CPWU 1FS0G 1KP3A 3E89A 2XAQA 4MW3A 5DN6G 1R3LC 3AEIA 1J95A 2WLLB 3LNMB 3CCUV 2JJ2G 1NH2D 1K7DA 1M90W 2X6AA 3CD6V 3D3IA 4MSWC 3OE7G 4MVSA 1YJNV 3K3WA 1Q86W 3ZJZA 1NJIW 3ZRXA 1GM8A 4WFAV 3OUFA 3RBZA 2R9IA 3D36A 1W0JG 2A9HA 2WSSG 3TCUA 5CBGA 1K3EA 3FYEB 5B1NA 1UJWB 3CXCU 4PELA 2KB1A 4QE7A 3W7XA 3ZN1A 3CYOA 1GM7A 4JF3A 4RAIA 4GX5A 1AROP 4PDLA 3ZMTA 1QR9A 3E8BA 3B8NA 4RO2A 2HLDG 1VQ4V 5EC2C 5KUMA 1Q81W 3CCMV 2HFEC 4H37A 2IJHA 2ATKC 4P30A 3ZMUA 2F43G 2ZR3A 3ABKC 4N23A 1Q7YW 4MVZA 1PD3A 2DQ3A 3H01A 5EBMC 4I5SA 3ABLB 5IYCO 2XOKG 1EBOA 2HG5C 1QR8A 3A0RA 4FMTA 4J9YB 1YI2V 2ZXWB 4FIPC 4WFGA 5B1BC 1YJ9V 1M56C 3CCLV 1GO3F 2W6IG 3JD3A 4RQFA 3CC4V 2EIJC 5H6QA 2EIKB 2EILB 2HKOA 2JJ1G 3UM7A 1KD1W 4WFHA 1COWG 3OFNG 4FK5C 4PA4A 4GX1A 4G2KA 2WLNA 1VQ9V 5IDJA 5KA6A 1S72V 1H8EG 1ROPA 1YTFB 1VQNV 3OM3B 2WLLA 3STLC 3G71V 4WF9V 3I55V 2OTJV 3QO7A 3G6EV 1K5QA 3OGCC 2IH1C 2GSMB 4UVBA 4TSFG 3ZRVA 1YJWV 1QLEB 3E8FA 2B1IA 1QVGU 2IH3C 2LP7A 3ASNC 1YHQV 1JX9A 4JAUA 2WLMA 3FB8C 2NNUA 3MD0A 1SETA 1ENVA 5KA5A 2B1GA 5H6RA 5GW7A 4MTGA 4BAYA 4BIZA 2DWDC 3P32A 1G8MA 2PI4A 1AI6A 1FFTB 1HWYA 4MS2A 1W2BU 3IGAC 4MVOA 2EIMB 1H8HG 3IC7A 3OMIB 4QPKA 2QE7G 1MSWD 2Y48A 1L1FA 1QLEC 2P6JA 5L3CA 1GM9A 2JK5C 1ZWIC 1V55C 1VQ6V 2FTKA 4HZ3A 1M57C 4MTFA 4KP4A 1R73A 1F4NA 3T1CA 2QM7A 2JDIG 3ASOC 2IJKA 1I5YA 1GMGA 4MTXA 3W7UA 3MHSC 3AG3B 1E1RG 3DTUB 4GCZA 1K97A 5CBHA 1FXHA 1Y66A 2W6JG 3E2EA 1AJPA 2CK3G 4RUEA 2YSUB 1AJNA 1TUEB 4G28B 4X89A 3ZMVA 3JD4A 5B3SB 3HB3B 3K0GA 3ABMC 4R8CA 2DYRB 1VQ8V 3ZMSA 5L3FA 3AG2C 5B1OA 1B6QA 1VQOV 2W0FC 2GHYA 1VQ5V 1AR1B 3K04A 3E83A 3WG7C 3SJQC 3WFVA 2UXNA 1JCHA 3AG3C 1DLBA 3EFFK 4R50A 3SPJA 3X2QB 5FL7G 1AI5A 4ZKIA 4PA9A 3EHBB 1MG1A 1JQ0A 4MW8A 3QO8A 3QNEA 1S3JA 1SESA 2LFSA 4RQEA 4DXWA 4PA6A 5E1AC 3RVYA 1WLEA 3ABUA 1NR7A 1WPXA 3CCRV 1NR1A 3ABTA 1I5XA 2QM8A 3F5WC 3I56V 1PL0A 2Y69B 2D3OW 1S77D 4Q20A 3VOUA 5B1AB 1PKXA 3CCVV 3AG4B 1FXKB 2XAGA 4GX0A 4I9WA 4PDVA 4UVCA 5EBLC 3SPCA 1K92A 4EKWA 1V54B 3P30A 1M1KW 3CCQV 4QNHB 1R3IC 1YSCA 4PDMA 4JPRA 2LFRA 3SPGA 2IU0A 3STZC 3HPLC 1XL4A 1R3KC 1Q82W 5L3GA 3F7YC 5BZBA 1QBZA 5CN0A 2K1EA 4HAMA 3ZMZA 3ETGA 4LC1A 3F7VC 5B1AC 1YTFD 2Q68A 5L3DA 3W7WA 1IXMA 2P67A 1JPXA 2OCCB 1XL6A 4XDLA 4QE9A 3ABLC 4BIUA 1K34A 5LGUA 1OCOB 2Z5UA 2ZXWC 2WPDG 2Z3YA 1NQTA 3OEHG 3T4ZA 4L87A 2DQ0A 4XDKA 1S0VA 5LHIA 3LDEA 4J9ZB 3OMNB 3OUSA 2WLIA 2EIKC 1SERA 2EILC 1R6NA 1OCRB 2X0LA 5IYBO 4OXSA 5LBQA 3FKSG 1VQ7V 3R65A 4H33A 1GK9A 4QPJA 4CZZA 2Q69A 2IJJA 1NVPD 1K8AW 3AG1B 5LHGA 5KUKA 4Z1MG 3ZCCA 2ZR2A 3ML0A 4N21A 5LGTA 4BW5A 5H9CA 3G4SV 3OR7C 4UVAA 3FB6C 1RM1B 2Q67A 2WWWA 4FJCC 4JYCA 4CBCA 2HVJC 3JD0A 1FXKA 1OCCB 1G4YB 3E8GA 2AHZA 2P7TC 1DF5A 3GB7C 4U7NA 4QJFB 1OCZB 1OCRC 2PI5A 2B5UA 1K5SA 1YIJV 3K06A 1KECA 4ZBMA 5LHHA 1RPOA 2M7WA 3FB7C 4JTAB 4RUFA 1NVPB 4HYOA 3OW2U 1OZ0A 3ZIAG 3IFXA 2DW4A 1F51A 2EZPA 4R7CA 5J9PC 2IU3A 3SYPA 3SYOA 3K9AA 3OEEG 2EIMC 1SRYA 4FPPA 3BY6A 4MTOA 3QO5A 3CCEV 1RM1C 1AJQA 1KC8W 1BL8A 1QCEA 1M9NA 3TETA 3ZN0A 4WCEV 2MK3A 2V1DA 4MVUA 4WFFA 3JYCA 4P9OA 5IYDO 2XAHA 4LP8A 1K9MW 1ORQC 1EFRG 2HJFC 2EBOA 4E2LA 4JTCB 4UV9A 1S76D 1FXVA 1EZJA 1KP2A 1PNKA 2WLIB 2ZQMA 1K73W 4G27B 1JJ2U 5CMUA 2QEXV 5HFLA 1RPRA 1E79G 1W0KG 2ZDIA 3SYAA 3LDDA 4MT8A 1H2GA 2EJRA 4KUMA 5B3SC 1JVMA 2IW5A 2C2AA 2DYRC 1BHBA 3GWOA 4R6ZA 4WFEA 3JCZA 1CP9A 2X6BA 2DWEC 2YEVB 2XAJA 2H94A 3CMAV 1K4DC 3B8MA 3ETDA 3E35A 1NH2B 3CC2V 3ABKB 4P2ZA 5EC1C 5DM6V 3X2QC 1R6KA 3NXSA 4GT1A 2NLJC 2ITCC 4JTDB 3CC7V 5L3EA 3MHHC 4JASA 2QTOA 2UXXA 3JD2A 5B1BB 1M56B 2XNDG 1GKFA 4UXNA 4GX2A 3SYCA 4PA3A 1QVFU 2EIJB 3K79A 4UUJC 2Y69C 3ZRWB 2JIZG 3W7TA 3M99B 3K0DA 3FB5C 4LCUC 3RVZA 2X6CA 3AG4C 1GTOA 1CPYA 1FXKC 3K08A 1VQLV 5CBFA 3SPIA 1MABG 2ITDC 2H8PC 1V54C 2Q6AA 3JD1A 1R3JC 4PDRA 3CCJV 2BOBC 3E86A 5C93A 1PNMA 3SPHA 4MVQA 3CP1A 1DF4A 3BEHA 4F4LA 1QLNA 2EINB 3DGEA 3OMAB 3KG2A 4LBEC 4TT3G 2XASA 3OAAG 1KQSU 3ASNB 4UV8A 4X88A 5EK0A 3ETEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  2W0F C;  3E8H A;  3LDC A;  4P30 A;  3K06 A;  3UKM A;  4ZBM A;  2OCC C;  3ABK C;  3FB7 C;  4JTA B;  4RUF A;  3K04 A;  3E83 A;  4HYO A;  4MVZ A;  2WLK A;  3SJQ C;  3WG7 C;  5EBM C;  3AG3 C;  4KFM A;  4R50 A;  3EFF K;  3SPJ A;  3IFX A;  4R7C A;  5J9P C;  2A79 B;  4J9Y B;  3OR6 C;  2HG5 C;  3SYP A;  3SYO A;  1OCO C;  4PA9 A;  3AG2 C;  2EIM C;  4MTO A;  4MW8 A;  4WFG A;  2YEV A;  5B1B C;  1BL8 A;  1M56 C;  4X8A A;  3TET A;  4DXW A;  4PA6 A;  5E1A C;  3RVY A;  4MVM A;  4MVU A;  1K4C C;  2EIN C;  2HVK C;  5EBW C;  3T2M A;  2EIJ C;  3JYC A;  4WFF A;  2R9R B;  2BOC C;  3LUT B;  3SYQ A;  3T4D A;  3F5W C;  4P9O A;  3UM7 A;  3PJS K;  4LP8 A;  3RW0 A;  4WFH A;  3VOU A;  2WLH A;  2WLJ A;  1ORQ C;  4GX1 A;  4PA4 A;  2WLN A;  2HJF C;  4GX0 A;  4I9W A;  4PDV A;  3SPC A;  5EBL C;  4JTC B;  4EKW A;  3AG1 C;  2WLI B;  3K03 A;  4P9P A;  4G27 B;  1LNQ A;  4QNH B;  1R3I C;  2WLL A;  3STL C;  3ZRS A;  4PDM A;  4TWK A;  2AHY A;  3SPG A;  1KKD A;  2A0L A;  4XDJ A;  3OGC C;  3STZ C;  2IH1 C;  3HPL C;  3LDD A;  1XL4 A;  3SYA A;  1R3K C;  4MVR A;  5B3S C;  1OCC C;  1JVM A;  3E8F A;  3F7Y C;  5BZB A;  2IH3 C;  2DYR C;  1OCZ C;  2K1E A;  4R6Z A;  4WFE A;  3F7V C;  1S5H C;  2X6B A;  2DWE C;  3ASN C;  5B1A C;  2DYS C;  2Q68 A;  2WLM A;  3FB8 C;  5IY5 C;  2QKS A;  2ZD9 A;  1K4D C;  1XL6 A;  4P2Z A;  4XDL A;  5EC1 C;  3X2Q C;  4MTG A;  4QE9 A;  1P7B A;  2DWD C;  3ABL C;  4PA7 A;  2NLJ C;  3E89 A;  4MS2 A;  2ITC C;  2ZXW C;  4JTD B;  4MW3 A;  3IGA C;  4MVO A;  2QTO A;  3T4Z A;  1R3L C;  4XDK A;  3LDE A;  4J9Z B;  1QLE C;  2JK5 C;  3OUS A;  4GX2 A;  2WLL B;  1J95 A;  3LNM B;  1ZWI C;  1V55 C;  4PA3 A;  3SYC A;  2WLI A;  2EIK C;  1M57 C;  2EIL C;  4HZ3 A;  2X6A A;  2Y69 C;  4MSW C;  4MVS A;  4MTF A;  4UUJ C;  4OXS A;  3ZJZ A;  3K0D A;  3FB5 C;  4LCU C;  3RVZ A;  3R65 A;  4H33 A;  3T1C A;  2X6C A;  3AG4 C;  3OUF A;  3RBZ A;  3ASO C;  3K08 A;  5CBF A;  2A9H A;  2Q69 A;  3SPI A;  2ITD C;  2H8P C;  1V54 C;  2Q6A A;  3TCU A;  5KUK A;  5CBG A;  1R3J C;  4PDR A;  5CBH A;  2BOB C;  3E86 A;  4BW5 A;  3OR7 C;  2KB1 A;  4QE7 A;  3SPH A;  3FB6 C;  4RAI A;  4RUE A;  4MVQ A;  2Q67 A;  4GX5 A;  4PDL A;  4CBC A;  2HVJ C;  4G28 B;  4X89 A;  3K0G A;  1G4Y B;  3ABM C;  2AHZ A;  3BEH A;  3E8B A;  3E8G A;  2P7T C;  3GB7 C;  4R8C A;  4LBE C;  4RO2 A;  1OCR C;  3KG2 A;  5EC2 C;  4F4L A;  5KUM A;  2HFE C;  4X88 A;  4H37 A;  5EK0 A; 
#chains in the Genus database with same CATH topology
 4U7O A;  5LGN A;  3UKM A;  2OCC C;  3L72 H;  2ZE5 A;  1XUQ A;  2Q7E A;  2UUA B;  1M4U A;  3CME V;  1TGO A;  5KHG A;  3HKB A;  1Q6I A;  1BMF G;  2HP8 A;  1N34 O;  1Z5V A;  4QGP A;  4UFZ A;  4WFB V;  5C8Y A;  4MVM A;  1Y67 A;  3T2M A;  4CH4 A;  1D5A A;  2Q4P A;  1NKD A;  4CC5 A;  4X20 B;  1X4T A;  4FM2 A;  5IY5 B;  4DV1 O;  5LP6 B;  2XTA A;  2Q0A A;  1F23 A;  5KAF Z;  4OX9 O;  3AG1 C;  5L3B A;  5IJ9 B;  4K0K O;  4W4K A;  1BGY H;  2AHY A;  2RCV A;  1GN4 A;  1N36 B;  4MVR A;  1OCC C;  2HR3 A;  2RDC A;  2UXB B;  2YUA A;  2AW9 A;  4I7Z B;  2V7Q G;  3KKY A;  4PI2 A;  1VF6 A;  2JS3 A;  4J7Z A;  1FAF A;  1Y4M A;  2QR4 A;  3AK3 A;  2ARH A;  2G38 A;  2E3C A;  1P7B A;  1SZT A;  2GTS A;  4PA7 A;  4XBF A;  3CPW U;  1XHZ A;  1P49 A;  5KHH A;  1FJG B;  3ZHT A;  3J80 N;  3WU2 Z;  4LR3 A;  3CRR A;  3H1H H;  2ZCE A;  4DV7 B;  1KU9 A;  2ZKO A;  4GKJ O;  4PI0 A;  2WLL B;  5IWA B;  2DOS A;  4NR1 A;  3SJB C;  2PF4 E;  4DR5 B;  1M90 W;  3D3I A;  3OE7 G;  2E5L B;  2UXC O;  1YJN V;  3K3W A;  5IT9 N;  2XUM A;  1W0J G;  2A9H A;  2HEP A;  3KCY A;  2XT9 A;  1UJW B;  1CXZ B;  4F6R B;  4HNA B;  2GV9 A;  4QE7 A;  4TUY A;  4JF3 A;  4FM1 A;  1N33 O;  3GVM A;  1QR9 A;  4JI5 O;  1N32 B;  3CCM V;  2FKX A;  2RNB A;  1YVW A;  2ATK C;  4EFB A;  1Q7Y W;  2F43 G;  3ABK C;  4A5U B;  4I5S A;  3ABL B;  1SQF A;  4AQY O;  3RWR D;  1I0H A;  1QR8 A;  3ZHU A;  2AZ0 A;  4FVM A;  1T5E A;  1YJ9 V;  1M56 C;  2VWK A;  1GO3 F;  3EVK A;  2JRI A;  3JD3 A;  1EM1 A;  5H6Q A;  3CRQ A;  1KD1 W;  2V4D A;  4FLU A;  1W59 A;  2CAZ C;  3B4S A;  5IDJ A;  2VQF B;  1SA0 A;  4DV5 B;  2QJ1 A;  1L0N H;  4NTY A;  5IYZ B;  3G71 V;  4WF9 V;  4I50 B;  5BXZ A;  2GSM B;  4TSF G;  4I0X A;  4NKG B;  3ZRV A;  2B1I A;  3T1H B;  1PL4 A;  4AI8 A;  1YHQ V;  2WLM A;  4AIL C;  2CH7 B;  4DR1 O;  4LF8 B;  3CXH F;  4MTG A;  2N74 A;  3IGA C;  4TV8 A;  1FYJ A;  1VMG A;  2BSK B;  5E79 Z;  1J5E O;  2QE7 G;  1QLE C;  1QNM A;  2P6J A;  5L3C A;  1GM9 A;  2JK5 C;  2PUS A;  1ZWI C;  1V55 C;  1VQ6 V;  4O4L A;  4ZI7 B;  1IX9 A;  3K9S A;  2Q73 A;  4X1K A;  4DV0 B;  1R1B A;  4B3S B;  3W7U A;  3MHS C;  1ZUQ A;  1E1R G;  4W4L A;  2OWO A;  2DN9 A;  2P4K A;  1AJP A;  3A0H Z;  2YSU B;  1AJN A;  3JD4 A;  4PHZ A;  3HB3 B;  3K0G A;  4B3R B;  1VQ8 V;  4DR7 O;  1JJO A;  1VQO V;  2GHY A;  4E4E A;  3K04 A;  1V9P A;  1JCH A;  4R50 A;  4JYA B;  3HKE B;  3JAK A;  1IXB A;  1M93 A;  3EHB B;  1RP3 B;  3H1I H;  1MG1 A;  5CA0 B;  5ITZ B;  5CA1 B;  4RQE A;  1WP7 A;  1EN4 A;  4WBN B;  1WPX A;  2CTQ A;  3CCR V;  1I5X A;  2QM8 A;  3I56 V;  2D3O W;  3VOU A;  1WA8 A;  3AG4 B;  4JI7 O;  2UXD B;  4I9W A;  4TV9 A;  1BE3 H;  1K92 A;  1DK1 A;  1M1K W;  3N2K A;  1R3I C;  1YSC A;  4PDM A;  4LF7 O;  1U96 A;  2KQX A;  5L3G A;  5BZB A;  1HR0 B;  1QBZ A;  4X66 B;  2Y0P A;  1YTF D;  1BS3 A;  3JAS B;  4JV5 B;  5L3D A;  1SQQ H;  1MA1 A;  1B06 A;  4JI4 B;  4YIO A;  3OEH G;  3T4Z A;  4L87 A;  2RMK B;  3MAQ A;  1G1X B;  3OMN B;  4NTX A;  3OUS A;  4ABM A;  1WB8 A;  2WLI A;  2X0L A;  2FYU H;  3BAA A;  4OXS A;  5GON A;  5IE9 A;  3JCU Z;  4UCT A;  4DR6 O;  3CX5 F;  5KLV H;  3ZCC A;  1AB3 A;  5LGT A;  5H9C A;  3OR7 C;  2ZIN A;  1S5J A;  1RM1 B;  2Q67 A;  5B5E Z;  4CBC A;  4NXN B;  1SQV H;  1FXK A;  1G4Y B;  2P7T C;  3GB7 C;  4QJF B;  2KKW A;  1OCZ B;  1OCR C;  3M8A A;  1GAX A;  3RT3 C;  4K3A A;  3BA9 A;  2B5U A;  1K5S A;  3K06 A;  4IL6 Z;  1RPO A;  2ZE8 A;  3OW2 U;  3ZIA G;  1VAR A;  3IFX A;  4YJ3 A;  5D5P A;  1EZV H;  5J2T A;  1LR1 A;  3H1L H;  3OEE G;  1SRY A;  3BY6 A;  4MTO A;  5JJE B;  2EUL A;  1ZL8 B;  2MK3 A;  2V1D A;  1XHX A;  4WFF A;  1EFR G;  1AVM A;  3RYH A;  5JJN B;  2UXB O;  3RYF A;  2ZQM A;  1PNK A;  4J11 A;  1ZX3 A;  2KSD A;  1K73 W;  1O9H A;  3BCC H;  4J10 A;  3VQY A;  5CB4 B;  4DV6 B;  5BMV A;  4LF9 B;  4BWA A;  1IBK B;  3C3T A;  3SYA A;  1FJG O;  1JA8 A;  3HKB B;  2ZT9 B;  1CP9 A;  1GH6 A;  1U97 A;  2XAJ A;  4DV7 O;  2QGN A;  5C8Y B;  3ETD A;  4P2Z A;  4DR5 O;  2E5L O;  2NLJ C;  3RYI B;  2IBZ H;  2ITC C;  4JTD B;  1XMQ B;  2UXX A;  1TVK A;  3WB2 A;  2XND G;  3SYC A;  3W7T A;  4PV1 B;  3K0D A;  3ZHQ A;  5CBF A;  1MAB G;  1N32 O;  4IYI A;  3CCJ V;  2BOB C;  2HJD A;  1US6 A;  2PY5 A;  2GBO A;  2LQT A;  1DF4 A;  3F5T A;  1QLN A;  5KAI Z;  2EIN B;  1QQC A;  4J42 A;  3ASN B;  4X88 A;  1MNG A;  3LDC A;  2PGG A;  1G6U A;  1PNL A;  3B40 A;  3GWK C;  1RFY A;  2A79 B;  2OYQ A;  1OCO C;  2P90 A;  1VQP V;  4DR4 B;  2QA4 V;  4X8A A;  4FFB A;  1Q6U A;  3CCS V;  2JEX A;  4TUY B;  4FLZ A;  3PJS K;  3FYI B;  4ASU G;  4YXW G;  1N8R W;  2WLJ A;  1AI4 A;  2DYS B;  1H38 A;  3ASO B;  3DSQ A;  5IJ0 B;  3W7S A;  3T1H O;  1RSO A;  3JAT A;  2OT5 A;  2WAM A;  3ZRS A;  1I7F A;  5HFM A;  4XDJ A;  4LF8 O;  2OTL V;  4DO2 A;  2WA4 A;  2JS5 A;  5IY5 C;  4CH3 A;  2QKS A;  2ZD9 A;  3T1Y B;  5LP6 C;  3APQ A;  2HHH B;  3HKD A;  3LSS A;  1AI7 A;  5JVD A;  1Z2G A;  4YIP A;  2QM4 A;  1FS0 G;  2CTP A;  3E89 A;  1SQB H;  3CRA A;  5BR8 B;  4B3S O;  2EJ7 A;  4UCR A;  3SJA C;  1J95 A;  4YHH O;  3LNM B;  1AR5 A;  1UPG A;  3K5M A;  3CD6 V;  2Q7G A;  1Q86 W;  3ZS8 C;  3OUF A;  4I0X B;  4JZ2 A;  1DGS A;  3JAW A;  3RBZ A;  1FFX A;  4B3R O;  1AIL A;  1XMO B;  4YY3 B;  3FYE B;  4KXR A;  3SDL A;  1TUB B;  1GM7 A;  4RAI A;  1HDJ A;  4UCS A;  2ZNI A;  4GX5 A;  2QWO B;  1ARO P;  4JYA O;  1HNX B;  3E8B A;  3B8N A;  4TV8 B;  5EC2 C;  1IBM B;  3J7A U;  4LF5 O;  1L8D A;  5EIB D;  4DW1 A;  4P30 A;  3ZMU A;  2ZR3 A;  4MVZ A;  1NU1 H;  3DC6 A;  4ICG A;  4J9Y B;  4FMT A;  2BTQ A;  1Z5W A;  1KB9 F;  4X1K B;  2UXD O;  2QWQ B;  4WFG A;  5B1B C;  5LL6 Y;  2W6I G;  3S3X A;  5BY1 A;  4RQF A;  1SS3 A;  5D5Q A;  2EIJ C;  2HKO A;  3UM7 A;  1XRE A;  4K8X A;  5FLX N;  4FLV A;  4PA4 A;  4GX1 A;  4LFC B;  2WA3 A;  1VQ9 V;  4TOI A;  1S72 V;  1Q3E A;  4DR2 B;  1YTF B;  4X66 O;  4JV5 O;  2ZE7 A;  1MZE A;  2UUC B;  3LSU A;  2OTJ V;  3CB2 A;  1SQP H;  1XNQ B;  4IT5 A;  5LMU B;  3JAK B;  2ZIM A;  4DV4 B;  2QWP B;  4JI4 O;  2IH3 C;  2LP7 A;  2AGA A;  1QU7 A;  1JX9 A;  4Z2W A;  3FB8 C;  3MD0 A;  4X62 B;  1HNW B;  1I94 O;  2VS0 A;  2UU9 B;  3H9V A;  3EXA A;  1G8M A;  2ZIO A;  2GTA A;  3D36 C;  4DV2 B;  1LUV A;  2EIM B;  4TV9 B;  3OMI B;  3D3Q A;  2Y48 A;  1L1F A;  4IGG A;  3RFR A;  3OTF A;  4FLY A;  2FTK A;  1M57 C;  5K1X A;  1F4N A;  4NXN O;  3OGI B;  2IJK A;  1GMG A;  1YF2 A;  3AG3 B;  5CBH A;  1Y66 A;  1IDS A;  4TQD A;  2VRZ A;  4JAA A;  2CK3 G;  1TUE B;  4X1I A;  5B3S B;  2Z0A A;  3ABM C;  4IIJ B;  5FNV A;  4R8C A;  3ZMS A;  3AG2 C;  1XNR B;  1B6Q A;  2ADP A;  3E83 A;  3WG7 C;  3WFV A;  3X2Q B;  2GDS A;  5FL7 G;  1AI5 A;  4ZKI A;  3KZI Z;  4MW8 A;  3QO8 A;  3QNE A;  1S3J A;  3G67 A;  4ZOL A;  4DXW A;  4PA6 A;  4J7J A;  2OCH A;  1ZAU A;  4DV6 O;  2Y69 B;  3JAL B;  4LF9 O;  1IBK O;  4Q20 A;  3UO2 A;  1PKX A;  1FXK B;  3IC9 A;  3SPC A;  4PDV A;  4O4J A;  2CTW A;  4EKW A;  1V54 B;  1NTZ H;  4ZIB A;  3CCQ V;  1VEW A;  1B04 A;  5KHI A;  1XL4 A;  2DMX A;  4YJ3 B;  4OPH A;  5J2T B;  2F93 B;  1YCI A;  1XMQ O;  3F7V C;  2MW2 B;  1TA8 A;  4UCO A;  4X1Y A;  4AHC A;  1JPX A;  2OCC B;  4XDL A;  3WB0 A;  2JVD A;  4I4T A;  4NVP A;  2ZXW C;  4JI2 B;  4LNU A;  4O4I B;  2DQ0 A;  3RYF B;  2Q7H A;  2FL4 A;  3ZX6 A;  2EIK C;  5JJJ B;  2EIL C;  5BMV B;  1SER A;  1BZK A;  3QG5 A;  5IYB O;  3K58 A;  2YID A;  4H33 A;  4QPJ A;  4BW9 A;  4D6T H;  2E74 B;  1K8A W;  4NTW A;  3AG1 B;  4Z1M G;  2YIB A;  3ZBH A;  4N21 A;  4YJ2 A;  4BW5 A;  3G4S V;  4UB6 Z;  3FB6 C;  4J80 A;  2WWW A;  4JYC A;  4CS3 A;  1BCC H;  1OCC B;  4U3F H;  1GRJ A;  5DED A;  2AHZ A;  1WN7 A;  5LYJ A;  1TVK B;  2BCC H;  1YIJ V;  4ZBM A;  1XOU A;  2DW4 A;  2PZS A;  5J9P C;  3SYO A;  1YZB A;  1RM1 C;  1PM9 A;  3QF7 A;  1BSM A;  1QCE A;  1M9N A;  4WCE V;  3RN4 A;  3JYC A;  5K1P A;  3CJH A;  4P9O A;  2XAH A;  4RWU A;  1IBL B;  2CUG A;  5LA6 A;  4E2L A;  4UV9 A;  1FXV A;  1EZJ A;  1KP2 A;  4H0L B;  3T1Y O;  2QEX V;  2HHH O;  5HFL A;  1RPR A;  5KX5 A;  2EJR A;  4JI3 O;  5LMN O;  2IW5 A;  2DYR C;  4WFE A;  5BR8 O;  5JQG A;  2DWE C;  2H94 A;  3CMA V;  4FFB B;  1K4D C;  2F95 B;  3ABK B;  3ZHR A;  3N2G A;  5DM6 V;  4KL1 A;  4DW0 A;  4DUZ B;  3CC7 V;  4X20 A;  4JAS A;  1RSO B;  3JAT B;  1NI8 A;  1YDX A;  2VQE B;  1M56 B;  3RYC A;  1XMO O;  2Q0O C;  5LP6 A;  4YY3 O;  1M5I A;  2FB5 A;  2D2C B;  2A06 H;  4JI8 O;  2K9P A;  2JIZ G;  3M99 B;  4LCU C;  1HNZ B;  1HNX O;  3SPI A;  1A32 A;  2H8P C;  4B3T B;  2Q6A A;  1IBM O;  1FPO A;  3S3W A;  1R3J C;  3CE2 A;  3ZHV A;  5C93 A;  3HKD B;  4H44 B;  5JVD B;  1PNM A;  2LO1 A;  4MVQ A;  1JR9 A;  4F4L A;  4LBE C;  2ZE6 A;  2XAS A;  5EK0 A;  1D5N A;  2B9Z A;  3E8H A;  1CEZ A;  2WLK A;  4KFM A;  4KHP O;  3BVO A;  2QSA A;  3JAW B;  3E22 B;  1FFX B;  4FM0 A;  4DV1 B;  2UUA O;  1K4C C;  1P4R A;  2EIN C;  2HVK C;  1F4M A;  2O57 A;  5EBW C;  1V55 B;  3SYQ A;  2R9R B;  2BOC C;  3TK1 A;  1NVP D;  2UUC O;  2ZDI C;  3LSQ A;  1MOF A;  1XNQ O;  4DV4 O;  3D8C A;  1BQZ A;  1AP5 A;  2P22 C;  4P9P A;  4D7S A;  4X62 O;  1VQK V;  4TWK A;  1E1Q G;  2A0L A;  2LGW A;  2BTQ B;  4DV2 O;  1S5H C;  1SQX H;  2E76 B;  2EZO A;  2DYS C;  1NT2 B;  3VBB A;  1NBM G;  1BQ0 A;  1N36 O;  3PN1 A;  4JYB A;  3CRM A;  4CS2 A;  5CA3 A;  4QIW F;  3O65 A;  3JAM N;  1ZSP A;  5DN6 G;  3K57 A;  2YXL A;  3L71 H;  1R3L C;  5JCO C;  4LF6 B;  5AG2 A;  4Q6G A;  4LFA B;  2JJ2 G;  1NH2 D;  2R9A A;  1K7D A;  2X6A A;  4MSW C;  4MVS A;  4UCU A;  3ZJZ A;  1GM8 A;  5IYZ A;  2H3O A;  2R9I A;  3L73 H;  3D36 A;  4EB6 A;  5JH7 A;  1WPB A;  5IWA O;  3TCU A;  2M6Y A;  1XNR O;  3CXC U;  4PEL A;  2KG7 A;  2A3Q A;  2KB1 A;  3W7X A;  4PDL A;  4LH6 A;  3N27 A;  4AQY B;  2F4V B;  5KUM A;  4ZHQ A;  1P84 F;  2IJH A;  4FLW A;  2BSK A;  3UT5 A;  3RGB A;  1PD3 A;  2DQ3 A;  3H01 A;  5EBM C;  1X59 A;  3TXQ A;  5FPR A;  5IYC O;  3OTO B;  5F2V O;  1YI2 V;  4ZI7 A;  2XHB A;  3CCL V;  2Q8V A;  3CC4 V;  2LW1 A;  2JJ1 G;  1COW G;  3R66 A;  5LOV A;  2QDO A;  4G2K A;  4X1I B;  5FNV B;  5KA6 A;  1ROP A;  2GUZ A;  4IHJ A;  3OM3 B;  1IZ3 A;  1HP8 A;  1XQ8 A;  3QO7 A;  4DV3 B;  3G6E V;  1K5Q A;  2VQF O;  4DV5 O;  4UVB A;  1AP6 A;  1YJW V;  4JI2 O;  2YI8 A;  4JZG A;  1H2N A;  4NB5 A;  5FPO A;  4ZOL B;  1XBL A;  5KA5 A;  3UCS C;  2B1G A;  1J5E B;  5CA1 A;  5GW7 A;  4BIZ A;  2RQ6 A;  3P32 A;  1AI6 A;  1FFT B;  1HWY A;  1Q90 D;  3KCX A;  1W2B U;  3FFQ A;  4DK0 A;  1H8H G;  4X9Q A;  3IC7 A;  4O4J B;  3TJT A;  4QPK A;  1KBH A;  1LUW A;  4D7T A;  2YXH A;  4HZ3 A;  4MTF A;  4KP4 A;  1R73 A;  1NTM H;  2QM7 A;  1I5Y A;  1QHT A;  3OD4 A;  4DRX A;  4MTX A;  1N0J A;  4UCV A;  3DTU B;  4GCZ A;  1FXH A;  4X1Y B;  4DV0 O;  4DR3 B;  4RUE A;  1SA0 B;  4OPA A;  4X89 A;  1VP7 A;  3ZMV A;  4I4T B;  4X64 B;  5L3F A;  5B1O A;  2BE3 A;  4DK1 A;  2YIC A;  3VQW A;  2CTR A;  3AG3 C;  3EFF K;  2QTS A;  2PTM A;  3B09 A;  1SQG A;  4JI6 B;  4B08 A;  1AR4 A;  4PA9 A;  3VQX A;  1Y76 A;  1JQ0 A;  1SES A;  2LFS A;  3ABU A;  4O2B A;  4YJ2 B;  1MMM A;  3F5W C;  1PL0 A;  5B1A B;  3TGU H;  2XAG A;  3WB1 A;  5EBL C;  1JMK C;  3P30 A;  3A2F A;  5LYJ B;  4GKK B;  4O4L B;  3SJC C;  3FD9 A;  1Y74 A;  1XEQ A;  4DUY B;  2IM9 A;  4JPR A;  3DC5 A;  2IU0 A;  3STZ C;  1Q82 W;  2N04 A;  2Q9L A;  4FFK A;  3F7Y C;  5CN0 A;  2K1E A;  4DUZ O;  4HAM A;  3ETG A;  4LC1 A;  3MDS A;  3P3N A;  2Q68 A;  3IAY A;  3W7W A;  5TIS Z;  1WNS A;  1HR0 O;  3CJH B;  3ABL C;  4GYC B;  4BIU A;  4FLX A;  1K34 A;  5LGU A;  1OCO B;  2Z5U A;  4Z1V A;  2WPD G;  2Z3Y A;  5LA6 B;  1NQT A;  1P7G A;  1KYO F;  4O2A A;  3LDE A;  1N0N A;  3FAV A;  5EYP A;  4B7E A;  5KMG A;  5KX5 B;  1R6N A;  2Y4T A;  5LBQ A;  3BFR A;  1VQ7 V;  3R65 A;  5CB4 A;  1GK9 A;  4CZZ A;  3C90 A;  2OIG A;  3Q4H A;  5LXT A;  4K8Z A;  5JQG B;  4B3M B;  4LWS A;  3ML0 A;  1WA8 B;  3G6B A;  3AK2 A;  4UVA A;  3N2G B;  4FJC C;  4J7K A;  4LF4 B;  3A8T A;  3E8G A;  3N2K B;  4U7N A;  2PI5 A;  1EN6 A;  3RYI A;  3RYC B;  1KEC A;  3FB7 C;  4H13 B;  1NVP B;  3IJ4 A;  1VF5 B;  4FZ1 A;  4CS4 A;  1ZTE A;  4OGQ B;  2EZP A;  4R7C A;  2E75 B;  3QVN A;  1JFF A;  4FPP A;  3QO5 A;  1AJQ A;  1BL8 A;  2JGD A;  3TET A;  3ZN0 A;  5IYD O;  4K35 A;  4LP8 A;  1Q5O A;  4NXM B;  3BAB A;  3ETQ A;  1XDC A;  4JTC B;  2WLI B;  1YXB A;  3HKC A;  5GON B;  5CMU A;  1E79 G;  2ZDI A;  4MT8 A;  1H2G A;  1UFI A;  1JVM A;  5EZY A;  1BHB A;  3GWO A;  4O4H A;  3JCZ A;  2X6B A;  4UB8 Z;  5J2U A;  2CGN A;  4LF6 O;  3E35 A;  2AXT Z;  2YC0 A;  1NH2 B;  3CC2 V;  4IYH A;  2DE0 X;  4LFA O;  1NTK H;  1R6K A;  3JAR A;  4L8J A;  2Y0I A;  4I9Q A;  3JD2 A;  5B1B B;  5DEC A;  4F6E A;  2LW7 A;  1MZF A;  5IJ0 A;  1GKF A;  4UXN A;  4GX2 A;  1QVF U;  2EIJ B;  1OJH A;  4UUJ C;  2YI9 A;  1F7Y A;  1KMI Z;  4NYK A;  1FD9 A;  3FB5 C;  3RVZ A;  2X6C A;  3AG4 C;  1GTO A;  2W0X A;  1CPY A;  1H2M A;  5JCO A;  2F4V O;  4JYY A;  2QWR B;  4PDR A;  1SF9 A;  1Q8I A;  3UO3 A;  5KHK A;  2F66 C;  3SPH A;  3CHX A;  3RYH B;  3CP1 A;  3OTO O;  3BEH A;  3NR7 A;  3OMA B;  3DGE A;  3KG2 A;  4TT3 G;  1S76 D;  4UV8 A;  3ETE A;  4U3J A;  1YIT V;  2QKA A;  3BRC A;  5EIB C;  2PYJ A;  3HR0 A;  2P06 A;  1IVS A;  3OR6 C;  1ZLZ A;  2NR5 A;  4JAV A;  2RN9 A;  5JH7 B;  4EB6 B;  2YEV A;  3SR2 C;  3AG7 A;  1VQM V;  3C3S A;  3T4D A;  3LUT B;  2JEU A;  1PV0 A;  2KG7 B;  1M57 B;  2OIE A;  4EFE A;  1VQ4 V;  1THZ A;  3L74 H;  3RW0 A;  2ZM6 B;  4DV3 O;  2ZNJ A;  2WLH A;  4DR4 O;  1BHA A;  3B77 A;  1TUB A;  2UUB B;  3APO A;  3LNN A;  1KKC A;  2X7R B;  3K03 A;  4BIO A;  4ZHQ B;  4JGS A;  1LNQ A;  1JOY A;  3ZED A;  3UT5 B;  4LFB B;  1OHH G;  1K33 A;  3ZRW A;  4I55 A;  1KKD A;  4GZR B;  3DXR A;  2P4V A;  4X65 B;  3ABM B;  2IJI A;  1OCZ C;  1HW7 A;  2YXY A;  2ETN A;  2FML A;  2XAF A;  1DTO A;  3AG2 B;  5GTH Z;  3U11 A;  3WG7 B;  3G80 A;  4YHH B;  1KP3 A;  5LOV B;  2XAQ A;  2RJZ A;  4MW3 A;  5GTI Z;  2YIB D;  3L75 H;  2GUZ B;  4IHJ B;  3M7M X;  3AEI A;  2NN4 A;  3CCU V;  2F23 A;  4DR3 O;  1NJI W;  3ZRX A;  1XIL A;  2F1M A;  4WFA V;  5A2Q N;  4X64 O;  2WSS G;  1OV9 A;  1YEW A;  5CBG A;  1K3E A;  5B1N A;  4LF5 B;  1PPJ H;  4JI1 B;  3ZN1 A;  3CYO A;  1GN3 A;  3ZMT A;  1GN2 A;  4JI6 O;  1SKV A;  3K59 A;  4RO2 A;  2HLD G;  4B7K A;  1D2D A;  1Q81 W;  2HFE C;  5H5N A;  4H37 A;  5IJ9 A;  4N23 A;  1H2K A;  2XOK G;  1EBO A;  2HG5 C;  3JSN A;  3A0R A;  4JI0 B;  2ZXW B;  1Q43 A;  4DRX B;  4FIP C;  2A7W A;  3BPZ A;  4GKK O;  4PJ0 Z;  2LGQ A;  2EIK B;  5H2F Z;  2EIL B;  4DUY O;  4WFH A;  3OFN G;  4FK5 C;  2WLN A;  1N34 B;  2BTO A;  1H8E G;  3K5L A;  1VQN V;  1I08 A;  4FZ0 A;  4IIJ A;  1VF6 C;  2WLL A;  3STL C;  4FLT A;  5KHJ A;  4J41 A;  4LFC O;  3I55 V;  3OGC C;  2IH1 C;  4DR2 O;  1I94 B;  3I5D A;  1QLE B;  2QKC A;  3E8F A;  1QVG U;  4OX9 B;  1Y76 B;  2ADQ B;  3ASN C;  3CSX A;  4JAU A;  4K0K B;  2ODM A;  4F6R A;  2NNU A;  4HNA A;  1SET A;  4CH6 A;  1ENV A;  4O2B B;  5LMU O;  5H6R A;  3THO A;  4BAY A;  2DWD C;  2PI4 A;  1MSD A;  3U10 A;  4MS2 A;  4PD4 F;  3FX7 A;  4MVO A;  1NZ6 A;  3JAL A;  1H2S B;  1HNW O;  1MSW D;  2UU9 O;  3O9O A;  4B3M O;  1Y74 B;  4GUN A;  1URF A;  3JSL A;  3T1C A;  3ZHS A;  2JDI G;  3ASO C;  4LF4 O;  3K5O A;  1PP9 H;  1L0L H;  2R72 A;  4GKJ B;  1K97 A;  2W6J G;  1IUR A;  2UXC B;  3E2E A;  2YS8 A;  4G28 B;  4C7U A;  3B2E E;  1N4C A;  2DYR B;  2L6L A;  4O2A B;  3L70 H;  3CS5 A;  2W0F C;  5JWP A;  1VQ5 V;  1XI1 A;  3FAV B;  5EYP B;  1AR1 B;  4I50 A;  4O4I A;  5KMG B;  3SJQ C;  1N33 B;  2UXN A;  1DLB A;  1O9G A;  3SPJ A;  4BR6 A;  4JI5 B;  4NXM O;  3Q4H B;  5LXT B;  3U0Z A;  5E1A C;  2CH7 A;  3RVY A;  4LWS B;  1WLE A;  1NR7 A;  1NR1 A;  3ABT A;  1VIB A;  2L35 A;  1S77 D;  1KUQ A;  3CCV V;  4GX0 A;  4UVC A;  4EEQ A;  1SC5 B;  4QNH B;  3UQ8 A;  2LFR A;  3SPG A;  3HPL C;  1R3K C;  4TQF A;  1GN6 A;  3J81 N;  3ZMZ A;  1JFF B;  5B1A C;  2YDE A;  1IXM A;  2JGD B;  2P67 A;  3SGI A;  2DJV A;  1XL6 A;  4QE9 A;  3CRC A;  1WP8 A;  1H2L A;  4HBN A;  1SZX A;  4XDK A;  1S0V A;  5LHI A;  4J9Z B;  3HKC B;  4DR1 B;  2YIA A;  1OCR B;  3HKE A;  3FKS G;  2LJ2 A;  3K5N A;  1WB7 A;  4CH5 A;  5EZY B;  2Q69 A;  5CA0 A;  5ITZ A;  2IJJ A;  2QWN B;  4O4H B;  5LHG A;  5KUK A;  2CDY A;  2ZR2 A;  5J2U B;  4WBN A;  2CE4 A;  1FKA O;  2HVJ C;  3JD0 A;  3JAR B;  1DF5 A;  1R6T A;  5LHH A;  1VF7 A;  2M7W A;  4JTA B;  4RUF A;  4HYO A;  1OZ0 A;  1F51 A;  2ZM6 O;  2IU3 A;  3SYP A;  3K9A A;  3QTC A;  4DR7 B;  2EIM C;  2UUB O;  3CCE V;  3JAS A;  1KC8 W;  1B3Q A;  3L9D A;  2Y4U A;  4MVU A;  3OT7 A;  1BT8 A;  4LNU B;  4LFB O;  5A9G A;  1K9M W;  1ORQ C;  1WJZ A;  2HJF C;  3A0B Z;  4X65 O;  3P3P A;  2EBO A;  3AK1 A;  1TAE A;  4JI3 B;  5LMN B;  4G27 B;  1JJ2 U;  3ICX A;  4LH7 A;  1IBL O;  4U3J B;  3VQV A;  1Q6H A;  1W0K G;  4GLX A;  3LDD A;  4JI7 B;  4KUM A;  5B3S C;  1EN5 A;  1Y6X A;  2C2A A;  2ILM A;  4R6Z A;  2YEV B;  3H1K H;  5B66 Z;  2R70 A;  3B8M A;  3E22 A;  1WAZ A;  2EX3 A;  4LF7 B;  5EC1 C;  3X2Q C;  3NXS A;  4GT1 A;  3H1J H;  4JI8 B;  5L3E A;  3MHH C;  2QTO A;  2P5O A;  4DYL A;  2AZ2 A;  3BHP A;  4CC6 A;  4PA3 A;  3K79 A;  2Y69 C;  3ZRW B;  4I55 B;  4JI1 O;  3DXR B;  2N05 A;  2VQE O;  1FXK C;  3K08 A;  1NS1 A;  1VQL V;  2ITD C;  1V54 C;  1ZL8 A;  2PYL A;  2JGU A;  3JD1 A;  3E86 A;  3CEI A;  3BA8 A;  1HNZ O;  2CGO A;  2VWJ A;  3TXS A;  4B3T O;  2Q5Z A;  4JI0 O;  1S5L Z;  4DR6 B;  4KHP B;  3OAA G;  1KQS U;  3CWB H; 
#chains in the Genus database with same CATH homology
 4U7O A;  5LGN A;  3E8H A;  3LDC A;  3UKM A;  1YIT V;  2OCC C;  1CEZ A;  1PNL A;  2WLK A;  4KFM A;  3CME V;  2A79 B;  3OR6 C;  1OCO C;  4JAV A;  1BMF G;  2P90 A;  1VQP V;  2YEV A;  2QA4 V;  4WFB V;  4X8A A;  1VQM V;  4MVM A;  3CCS V;  1K4C C;  1P4R A;  2EIN C;  2HVK C;  1F4M A;  5EBW C;  3T2M A;  1V55 B;  1NKD A;  2R9R B;  2BOC C;  2JEX A;  2JEU A;  3LUT B;  1M57 B;  3SYQ A;  3T4D A;  3TK1 A;  3PJS K;  1THZ A;  3FYI B;  3RW0 A;  4ASU G;  2ZDI C;  3LSQ A;  4YXW G;  2WLH A;  2WLJ A;  5IY5 B;  1AI4 A;  2DYS B;  1N8R W;  1MOF A;  1BHA A;  1H38 A;  3B77 A;  3ASO B;  3W7S A;  1F23 A;  2X7R B;  3AG1 C;  3K03 A;  5L3B A;  2OT5 A;  2WAM A;  4P9P A;  4JGS A;  1LNQ A;  1JOY A;  3ZRS A;  1VQK V;  4TWK A;  5HFM A;  2AHY A;  1OHH G;  1K33 A;  3ZRW A;  1E1Q G;  2A0L A;  4XDJ A;  1KKD A;  4MVR A;  1OCC C;  2HR3 A;  2OTL V;  3ABM B;  4DO2 A;  2IJI A;  1OCZ C;  2V7Q G;  1S5H C;  2XAF A;  2EZO A;  1DTO A;  2DYS C;  3AG2 B;  3VBB A;  5IY5 C;  1NBM G;  2QKS A;  2ZD9 A;  1Y4M A;  4JYB A;  3LSS A;  5CA3 A;  1AI7 A;  4QIW F;  3WG7 B;  1P7B A;  1SZT A;  4PA7 A;  4XBF A;  3CPW U;  1FS0 G;  1KP3 A;  3E89 A;  2XAQ A;  4MW3 A;  5DN6 G;  1R3L C;  3AEI A;  1J95 A;  2WLL B;  3LNM B;  3CCU V;  2JJ2 G;  1NH2 D;  1K7D A;  1M90 W;  2X6A A;  3CD6 V;  3D3I A;  4MSW C;  3OE7 G;  4MVS A;  1YJN V;  3K3W A;  1Q86 W;  3ZJZ A;  1NJI W;  3ZRX A;  1GM8 A;  4WFA V;  3OUF A;  3RBZ A;  2R9I A;  3D36 A;  1W0J G;  2A9H A;  2WSS G;  3TCU A;  5CBG A;  1K3E A;  3FYE B;  5B1N A;  1UJW B;  3CXC U;  4PEL A;  2KB1 A;  4QE7 A;  3W7X A;  3ZN1 A;  3CYO A;  1GM7 A;  4JF3 A;  4RAI A;  4GX5 A;  1ARO P;  4PDL A;  3ZMT A;  1QR9 A;  3E8B A;  3B8N A;  4RO2 A;  2HLD G;  1VQ4 V;  5EC2 C;  5KUM A;  1Q81 W;  3CCM V;  2HFE C;  4H37 A;  2IJH A;  2ATK C;  4P30 A;  3ZMU A;  2F43 G;  2ZR3 A;  3ABK C;  4N23 A;  1Q7Y W;  4MVZ A;  1PD3 A;  2DQ3 A;  3H01 A;  5EBM C;  4I5S A;  3ABL B;  5IYC O;  2XOK G;  1EBO A;  2HG5 C;  1QR8 A;  3A0R A;  4FMT A;  4J9Y B;  1YI2 V;  2ZXW B;  4FIP C;  4WFG A;  5B1B C;  1YJ9 V;  1M56 C;  3CCL V;  1GO3 F;  2W6I G;  3JD3 A;  4RQF A;  3CC4 V;  2EIJ C;  5H6Q A;  2EIK B;  2EIL B;  2HKO A;  2JJ1 G;  3UM7 A;  1KD1 W;  4WFH A;  1COW G;  3OFN G;  4FK5 C;  4PA4 A;  4GX1 A;  4G2K A;  2WLN A;  1VQ9 V;  5IDJ A;  5KA6 A;  1S72 V;  1H8E G;  1ROP A;  1YTF B;  1VQN V;  3OM3 B;  2WLL A;  3STL C;  3G71 V;  4WF9 V;  3I55 V;  2OTJ V;  3QO7 A;  3G6E V;  1K5Q A;  3OGC C;  2IH1 C;  2GSM B;  4UVB A;  4TSF G;  3ZRV A;  1YJW V;  1QLE B;  3E8F A;  2B1I A;  1QVG U;  2IH3 C;  2LP7 A;  3ASN C;  1YHQ V;  1JX9 A;  4JAU A;  2WLM A;  3FB8 C;  2NNU A;  3MD0 A;  1SET A;  1ENV A;  5KA5 A;  2B1G A;  5H6R A;  5GW7 A;  4MTG A;  4BAY A;  4BIZ A;  2DWD C;  3P32 A;  1G8M A;  2PI4 A;  1AI6 A;  1FFT B;  1HWY A;  4MS2 A;  1W2B U;  3IGA C;  4MVO A;  2EIM B;  1H8H G;  3IC7 A;  3OMI B;  4QPK A;  2QE7 G;  1MSW D;  2Y48 A;  1L1F A;  1QLE C;  2P6J A;  5L3C A;  1GM9 A;  2JK5 C;  1ZWI C;  1V55 C;  1VQ6 V;  2FTK A;  4HZ3 A;  1M57 C;  4MTF A;  4KP4 A;  1R73 A;  1F4N A;  3T1C A;  2QM7 A;  2JDI G;  3ASO C;  2IJK A;  1I5Y A;  1GMG A;  4MTX A;  3W7U A;  3MHS C;  3AG3 B;  1E1R G;  3DTU B;  4GCZ A;  1K97 A;  5CBH A;  1FXH A;  1Y66 A;  2W6J G;  3E2E A;  1AJP A;  2CK3 G;  4RUE A;  2YSU B;  1AJN A;  1TUE B;  4G28 B;  4X89 A;  3ZMV A;  3JD4 A;  5B3S B;  3HB3 B;  3K0G A;  3ABM C;  4R8C A;  2DYR B;  1VQ8 V;  3ZMS A;  5L3F A;  3AG2 C;  5B1O A;  1B6Q A;  1VQO V;  2W0F C;  2GHY A;  1VQ5 V;  1AR1 B;  3K04 A;  3E83 A;  3WG7 C;  3SJQ C;  3WFV A;  2UXN A;  1JCH A;  3AG3 C;  1DLB A;  3EFF K;  4R50 A;  3SPJ A;  3X2Q B;  5FL7 G;  1AI5 A;  4ZKI A;  4PA9 A;  3EHB B;  1MG1 A;  1JQ0 A;  4MW8 A;  3QO8 A;  3QNE A;  1S3J A;  1SES A;  2LFS A;  4RQE A;  4DXW A;  4PA6 A;  5E1A C;  3RVY A;  1WLE A;  3ABU A;  1NR7 A;  1WPX A;  3CCR V;  1NR1 A;  3ABT A;  1I5X A;  2QM8 A;  3F5W C;  3I56 V;  1PL0 A;  2Y69 B;  2D3O W;  1S77 D;  4Q20 A;  3VOU A;  5B1A B;  1PKX A;  3CCV V;  3AG4 B;  1FXK B;  2XAG A;  4GX0 A;  4I9W A;  4PDV A;  4UVC A;  5EBL C;  3SPC A;  1K92 A;  4EKW A;  1V54 B;  3P30 A;  1M1K W;  3CCQ V;  4QNH B;  1R3I C;  1YSC A;  4PDM A;  4JPR A;  2LFR A;  3SPG A;  2IU0 A;  3STZ C;  3HPL C;  1XL4 A;  1R3K C;  1Q82 W;  5L3G A;  3F7Y C;  5BZB A;  1QBZ A;  5CN0 A;  2K1E A;  4HAM A;  3ZMZ A;  3ETG A;  4LC1 A;  3F7V C;  5B1A C;  1YTF D;  2Q68 A;  5L3D A;  3W7W A;  1IXM A;  2P67 A;  1JPX A;  2OCC B;  1XL6 A;  4XDL A;  4QE9 A;  3ABL C;  4BIU A;  1K34 A;  5LGU A;  1OCO B;  2Z5U A;  2ZXW C;  2WPD G;  2Z3Y A;  1NQT A;  3OEH G;  3T4Z A;  4L87 A;  2DQ0 A;  4XDK A;  1S0V A;  5LHI A;  3LDE A;  4J9Z B;  3OMN B;  3OUS A;  2WLI A;  2EIK C;  1SER A;  2EIL C;  1R6N A;  1OCR B;  2X0L A;  5IYB O;  4OXS A;  5LBQ A;  3FKS G;  1VQ7 V;  3R65 A;  4H33 A;  1GK9 A;  4QPJ A;  4CZZ A;  2Q69 A;  2IJJ A;  1NVP D;  1K8A W;  3AG1 B;  5LHG A;  5KUK A;  4Z1M G;  3ZCC A;  2ZR2 A;  3ML0 A;  4N21 A;  5LGT A;  4BW5 A;  5H9C A;  3G4S V;  3OR7 C;  4UVA A;  3FB6 C;  1RM1 B;  2Q67 A;  2WWW A;  4FJC C;  4JYC A;  4CBC A;  2HVJ C;  3JD0 A;  1FXK A;  1OCC B;  1G4Y B;  3E8G A;  2AHZ A;  2P7T C;  1DF5 A;  3GB7 C;  4U7N A;  4QJF B;  1OCZ B;  1OCR C;  2PI5 A;  2B5U A;  1K5S A;  1YIJ V;  3K06 A;  1KEC A;  4ZBM A;  5LHH A;  1RPO A;  2M7W A;  3FB7 C;  4JTA B;  4RUF A;  1NVP B;  4HYO A;  3OW2 U;  1OZ0 A;  3ZIA G;  3IFX A;  2DW4 A;  1F51 A;  2EZP A;  4R7C A;  5J9P C;  2IU3 A;  3SYP A;  3SYO A;  3K9A A;  3OEE G;  2EIM C;  1SRY A;  4FPP A;  3BY6 A;  4MTO A;  3QO5 A;  3CCE V;  1RM1 C;  1AJQ A;  1KC8 W;  1BL8 A;  1QCE A;  1M9N A;  3TET A;  3ZN0 A;  4WCE V;  2MK3 A;  2V1D A;  4MVU A;  4WFF A;  3JYC A;  4P9O A;  5IYD O;  2XAH A;  4LP8 A;  1K9M W;  1ORQ C;  1EFR G;  2HJF C;  2EBO A;  4E2L A;  4JTC B;  4UV9 A;  1S76 D;  1FXV A;  1EZJ A;  1KP2 A;  1PNK A;  2WLI B;  2ZQM A;  1K73 W;  4G27 B;  1JJ2 U;  5CMU A;  2QEX V;  5HFL A;  1RPR A;  1E79 G;  1W0K G;  2ZDI A;  3SYA A;  3LDD A;  4MT8 A;  1H2G A;  2EJR A;  4KUM A;  5B3S C;  1JVM A;  2IW5 A;  2C2A A;  2DYR C;  1BHB A;  3GWO A;  4R6Z A;  4WFE A;  3JCZ A;  1CP9 A;  2X6B A;  2DWE C;  2YEV B;  2XAJ A;  2H94 A;  3CMA V;  1K4D C;  3B8M A;  3ETD A;  3E35 A;  1NH2 B;  3CC2 V;  3ABK B;  4P2Z A;  5EC1 C;  5DM6 V;  3X2Q C;  1R6K A;  3NXS A;  4GT1 A;  2NLJ C;  2ITC C;  4JTD B;  3CC7 V;  5L3E A;  3MHH C;  4JAS A;  2QTO A;  2UXX A;  3JD2 A;  5B1B B;  1M56 B;  2XND G;  1GKF A;  4UXN A;  4GX2 A;  3SYC A;  4PA3 A;  1QVF U;  2EIJ B;  3K79 A;  4UUJ C;  2Y69 C;  3ZRW B;  2JIZ G;  3W7T A;  3M99 B;  3K0D A;  3FB5 C;  4LCU C;  3RVZ A;  2X6C A;  3AG4 C;  1GTO A;  1CPY A;  1FXK C;  3K08 A;  1VQL V;  5CBF A;  3SPI A;  1MAB G;  2ITD C;  2H8P C;  1V54 C;  2Q6A A;  3JD1 A;  1R3J C;  4PDR A;  3CCJ V;  2BOB C;  3E86 A;  5C93 A;  1PNM A;  3SPH A;  4MVQ A;  3CP1 A;  1DF4 A;  3BEH A;  4F4L A;  1QLN A;  2EIN B;  3DGE A;  3OMA B;  3KG2 A;  4LBE C;  4TT3 G;  2XAS A;  3OAA G;  1KQS U;  3ASN B;  4UV8 A;  4X88 A;  5EK0 A;  3ETE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...