3FX7A

Crystal structure of hypothetical protein of hp0062 from helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
84
structure length
84
Chain Sequence
QMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal Structure of Hypothetical Protein HP0062 (O24902_HELPY) from Helicobacter pylori at 1.65 A Resolution.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 39
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 3fx7A00
4W4LA 4KXRA 3FX7A 4J11A 4J7JA 4W4KA 4J7KA 4J41A 2G38A 4J42A 4J10A 4IYIA 2GTSA 4IYHA
chains in the Genus database with same CATH superfamily
2LGQA 5BY1A 1VP7A 2B1GA 2CAZC 5LOVB 1QVFU 1NKDA 1GRJA 4JI8O 2Q6AA 1I0HA 1MNGA 2DQ0A 1Q43A 1Q5OA 3H01A 4LBEC 1YJ9V 4CS4A 4GCZA 1EZVH 1YI2V 4QJFB 4O2AB 5JCOC 5KMGB 3NR7A 4FPPA 3A2FA 4NR1A 4E4EA 2QJ1A 1XI1A 2GDSA 5D5QA 1WP7A 2WLHA 1NVPB 3J81N 3L71H 1KYOF 4CH3A 4UCTA 4X1YA 3HKCA 4JI5B 2H3OA 1QLEC 3M99B 2X0LA 2EILB 3LNNA 4DV0O 1H2MA 2E76B 1J5EB 2YEVB 4JI3O 2A7WA 1YCIA 2RNBA 3L75H 3K0GA 5FPRA 1Q90D 2Z0AA 2WWWA 4DR1B 1VQ4V 3LNMB 4FVMA 3ZHTA 1GN2A 1XILA 4BW9A 2HR3A 4JZ2A 2O57A 4O4IA 2CH7B 1ZL8B 4N21A 2AZ0A 3S3XA 3K08A 2W0XA 4GX0A 1S5JA 2VS0A 4Z1MG 2ZDIC 4CBCA 3N2KB 4GKKO 1FFXA 3ABMB 3ZHRA 4LFCB 1HDJA 1OCRB 2RMKB 3WB0A 2PGGA 1FJGO 3OW2U 3BY6A 1ZSPA 1ZLZA 3JD0A 1U96A 4DV7B 2ITDC 4JTAB 5EIBC 2Y48A 3S3WA 1SA0A 1KMIZ 3ZMTA 1L0NH 1W2BU 3K9AA 1YVWA 2JS3A 1KECA 5L3FA 4I7ZB 4FMTA 2LFSA 3THOA 4O2BB 2BTQA 3U11A 3CRAA 2Y69B 4KHPB 4PDLA 3ZMVA 3ABKC 1TVKA 3P3NA 4TQDA 3ASNC 5F2VO 1MG1A 1H8HG 3B8MA 1AI7A 4X66O 2BOCC 4I0XA 2GV9A 5FNVA 3H1JH 2AHZA 3K0DA 5LL6Y 3BAAA 4JI8B 4ZKIA 1NH2B 5E79Z 4I5SA 1PNMA 1CXZB 4L8JA 4LF6O 5IWAB 1BS3A 3D3QA 1ZWIC 3LUTB 4J9YB 2HHHO 3ABUA 4DR4O 1SZTA 4UB6Z 1SQXH 2OCHA 2F4VB 2F95B 2JGDB 3KG2A 4DR3O 2MW2B 2FKXA 1OCZC 1AP5A 2X6BA 2XNDG 3OMAB 3DC6A 3G6EV 4DV0B 3DXRB 3HKDA 3CC7V 2YS8A 3OUSA 2ZXWB 3A0RA 2UU9O 4JYBA 2YI8A 3SJCC 1YHQV 3K59A 5KHJA 4W4LA 4X88A 3SJQC 5GTHZ 3P3PA 3H1IH 3L70H 2CE4A 3AG2B 5LOVA 2WA4A 3FB8C 2EINC 4TWKA 4YIOA 3C3TA 1OHHG 1VQ9V 2OCCB 3F7VC 4GKKB 4TSFG 5KHGA 1B04A 2B1IA 4O2AA 4KUMA 5KMGA 3R66A 2YC0A 3E8FA 1V9PA 5CBHA 4H33A 1FJGB 4PDVA 1M57B 1K5SA 1HWYA 1VQ5V 1BHAA 1H2NA 3JCZA 1JX9A 1I08A 4GX2A 1F4MA 3BCCH 5IJ0B 1GTOA 5IY5B 2Q5ZA 1GK9A 5HFLA 3RW0A 5FL7G 2A3QA 3SYQA 4DV4O 2UXDO 1Q6IA 5LHIA 3OD4A 1FXKB 4DV5O 1JJ2U 1K97A 4X66B 5DEDA 3WU2Z 4LR3A 3H1KH 3FAVA 2D2CB 1HW7A 3SR2C 2QSAA 2CH7A 1YSCA 4X65O 1ENVA 2H8PC 5LP6B 4O4HB 3JSNA 1AJNA 3N2KA 3E2EA 4LF6B 3D36A 2ZM6O 3J7AU 3BA9A 5JVDB 2Q68A 1AP6A 4PJ0Z 4FM0A 1V55B 3AG4C 4EB6B 3U0ZA 1YJNV 1SESA 1I5XA 1TUBB 2Q0OC 2ZINA 3CCUV 1YDXA 4YY3O 4DR3B 3CSXA 1SQPH 3O9OA 4O2BA 2CTWA 3BABA 1BL8A 3BEHA 1EBOA 4NKGB 1SQBH 3E8GA 1M93A 2UU9B 1BZKA 4WF9V 3O65A 2Q69A 4U3FH 3ZRWB 1HR0B 3ASOC 2PF4E 5EBMC 2Q7GA 2CK3G 1URFA 4I4TB 4TV9B 4DUZO 2WAMA 3ZHSA 3BFRA 2XOKG 3OT7A 2IH3C 4YJ2A 1CEZA 1XMOO 2OIGA 3DC5A 1U97A 1O9HA 3OEHG 5CA0B 2WLIA 1Y74B 1FD9A 4AILC 3HB3B 1PL0A 1SQFA 1QQCA 2Y4UA 2DWDC 3L9DA 5LBQA 2JGDA 4DV1O 4WFFA 2E5LO 2K1EA 2WSSG 1D2DA 3E22A 4F4LA 1N8RW 1PV0A 3UKMA 3JD4A 3OR6C 2M7WA 3E35A 2C2AA 5AG2A 4JAUA 4DV4B 1I94O 1VIBA 5HFMA 2UXDB 1KQSU 1OCCC 1RSOB 2JS5A 1LUWA 4DV5B 2OYQA 4P9PA 1PKXA 3SDLA 2FTKA 5LMNO 2YIAA 1VF7A 4X65B 4JAVA 2Y0PA 4G27B 2Y0IA 2VWKA 3M8AA 3CCRV 1F4NA 1AJPA 4CZZA 1KP2A 3SYOA 4BW5A 1Q7YW 2ZM6B 3RN4A 3DSQA 1Q81W 5BR8O 1QCEA 3RYHB 3RVYA 4GX5A 4RUEA 2YSUB 3MHHC 4R50A 1KU9A 4YY3B 2ZKOA 1AB3A 4CH5A 3JSLA 2Q9LA 1MSDA 2ZE5A 1FXVA 3QVNA 2EBOA 4ABMA 5L3DA 5KA6A 3VQYA 2LP7A 3OEEG 1KUQA 1M9NA 2ZQMA 2XASA 3FD9A 2QM8A 4PA6A 3CRMA 4NYKA 2CTPA 4NB5A 3BHPA 1FFTB 1FXKA 1Y4MA 2A06H 5A9GA 2Q7EA 1UJWB 4UCSA 1IDSA 4ASUG 1R3JC 2R70A 2OTJV 3G6BA 5LGTA 1SQQH 1XNRO 2BSKA 3I5DA 4C7UA 3L73H 4QE7A 4DUZB 3UO3A 5IJ9B 5LP6A 2DYSB 4O4HA 4U7OA 1DK1A 4X20A 4JI2O 2FB5A 2WLKA 4JYCA 2WA3A 1XMOB 4AHCA 5JVDA 1NTMH 3A0BZ 4EB6A 4I9QA 2LJ2A 1N32O 1VQ7V 1AR1B 4PA7A 4X1IA 1TUBA 1BE3H 1WJZA 4GLXA 2BTQB 1W59A 1HP8A 3OTOO 4DV1B 2LGWA 2E5LB 4CH4A 4W4KA 4DR6O 1P49A 3ML0A 2MK3A 3AG3B 2ITCC 4RUFA 4G2KA 3APQA 5L3BA 3CMEV 2JJ1G 2KB1A 3SYCA 4I0XB 1BQ0A 3TK1A 1I94B 4Z1VA 1VF6A 1D5NA 4NTXA 4GYCB 1FS0G 2EIMB 3AG1C 3ZRWA 2AZ2A 4O4JA 1AR5A 1QNMA 2F43G 3ABLB 3CCJV 5LMNB 4LFCO 2YI9A 1ORQC 3LDCA 4DRXB 4I4TA 4TV9A 3K03A 1ZUQA 2EIJC 4DV2O 4JI1O 3G67A 1JCHA 5LA6B 3ZMUA 4DR5B 3I56V 3R65A 4B7EA 4MVMA 1K92A 2XAFA 1XMQO 5LMUO 3LDDA 1RPOA 1JPXA 4FLZA 1R73A 2ZIMA 5EK0A 1YTFB 4TV8B 4JGSA 1WPBA 3E8BA 4PI0A 1RSOA 4YHHB 1K8AW 1B06A 4J7KA 2A9HA 3WG7C 2XAGA 3CD6V 1XDCA 1SKVA 3K5MA 3RT3C 1Z5WA 1DTOA 1PPJH 2PZSA 1VQ8V 1SS3A 5IWAO 3HPLC 2OT5A 1XNRB 3FB5C 1WA8A 3IAYA 4JI2B 1L0LH 4UCVA 4GX1A 3T4ZA 2KG7B 1KD1W 5IYCO 2F4VO 5B3SB 1XHZA 2R9IA 1BT8A 3ZHVA 3CCEV 2HJFC 5EIBD 4LF8O 1N32B 3E86A 1P7BA 3RYHA 4CC5A 2OTLV 1RM1C 4I55A 4JTDB 1L1FA 2HVKC 3OTOB 5KHHA 3CRQA 3ETEA 2N04A 5EBLC 3FFQA 4DR6B 2X6AA 3RGBA 5B1OA 4MVUA 3KZIZ 1WNSA 1I7FA 3CHXA 3FAVB 2Z5UA 1XHXA 4ZBMA 3UQ8A 2QWRB 4DR7O 3A8TA 1BHBA 2GBOA 1VMGA 2EULA 4NTYA 3K5NA 2P4KA 5IJ9A 4DV2B 4ICGA 2YIDA 2XTAA 4JI1B 4JI7O 4B3MO 4TOIA 5C8YB 2EILC 3H1LH 1SQGA 1WB7A 3RYFA 1Q82W 4HAMA 4MVOA 1H38A 3I55V 4K3AA 2ZT9B 4D7TA 3IC7A 4WFEA 4FM2A 4BIOA 1AROP 2YUAA 3T4DA 3SPJA 1XMQB 5LMUB 4J7JA 4IL6Z 2FYUH 3VQXA 1OZ0A 5IT9N 1MSWD 4OXSA 2QWNB 4YIPA 1H2KA 1Q6UA 4JZGA 5CBGA 4F6RA 4FK5C 3LSUA 3H1HH 3A0HZ 4RO2A 3QO5A 1K33A 3D36C 3ZRXA 3ABMC 1S0VA 1QU7A 4MTGA 1OCRC 4YJ2B 3SYAA 2ATKC 1S76D 5LHHA 1N0NA 4DRXA 2WLIB 3UO2A 2F23A 5EYPB 2XAQA 3SPCA 1R1BA 1BCCH 3RWRD 1PP9H 1XL4A 1R6TA 3K58A 1Y76B 5LA6A 1WP8A 3QTCA 2QM7A 1VQ6V 3E22B 4LF8B 1HNZO 4MVRA 3K04A 2Y69C 3JAMN 3OGIB 1KKCA 1VF5B 4GKJO 3ABTA 4QPJA 3K57A 3KKYA 1G6UA 1X4TA 2QWPB 2FL4A 1K7DA 4MTXA 1SQVH 4GUNA 1NS1A 4TV8A 2IJKA 2PYLA 3JD2A 1GAXA 1IVSA 1VARA 1HR0O 3QO8A 2NLJC 1GM7A 4BIUA 5B1AB 1PNLA 4MVSA 1KBHA 5C93A 2DQ3A 4Z2WA 2R9AA 1IXBA 4U7NA 5GW7A 4K8XA 4UV8A 4DR7B 1SETA 1EN6A 3GWOA 3AK2A 4FLWA 4LCUC 3K5LA 1JOYA 2VQEO 2IBZH 4LNUB 1NJIW 1T5EA 4DV3O 4FM1A 3CXHF 4JI7B 2L35A 1DF4A 2IW5A 1QBZA 2KG7A 4R8CA 2M6YA 4B3MB 1S3JA 3W7XA 1P7GA 3UM7A 3ZHQA 3QNEA 3IGAC 1XNQO 2W0FC 5JJNB 3IJ4A 5J2TB 2ZXWC 4J7ZA 2DE0X 4LF7O 5IE9A 4I9WA 1IBLO 3F7YC 3BPZA 2QKCA 4IGGA 4EKWA 1B6QA 2K9PA 3LSSA 3AG2C 4QE9A 2DMXA 1WAZA 2GSMB 4MS2A 3CCLV 1XEQA 4D7SA 2OCCC 5B1BB 2BSKB 5KHKA 4QIWF 2RDCA 2VRZA 3CJHB 2AGAA 4X20B 1Y67A 3T1HO 4DK0A 4KP4A 3CEIA 4DV6O 1ROPA 4P30A 2QTOA 1XUQA 4GT1A 1M57C 2DW4A 4X1IB 2N74A 3X2QB 5BZBA 3E83A 2AW9A 4QNHB 4WFAV 4FFKA 5C8YA 1AI6A 5IY5C 3TETA 1LNQA 4CH6A 3W7SA 2DOSA 4B3TO 1N33O 5CB4B 1HNZB 4LFAO 4GKJB 4A5UB 1FXKC 5H6QA 1N34O 3HKBB 3ZEDA 2HP8A 1MZFA 4JF3A 2Z3YA 1JVMA 2P67A 4X62O 1CPYA 4O4JB 4TT3G 4UVAA 3FYEB 2V4DA 4WFBV 4WFHA 1IX9A 3LSQA 5LP6C 1K5QA 1WLEA 1O9GA 5BMVA 5DN6G 2JDIG 3ETDA 4HBNA 2ZE6A 5LHGA 1QHTA 2UUCO 2NR5A 2JJ2G 2YIBD 4DW1A 1M56B 4DXWA 2CDYA 1V54B 3OTFA 1M90W 3WFVA 1V55C 1K4CC 1AR4A 1B3QA 2VQEB 2EJ7A 3RBZA 5EBWC 1EM1A 4LF4O 3STLC 2QKAA 1GM8A 4DV3B 4JYAO 2YXHA 2ZR2A 4IYHA 5EYPA 2NNUA 4YXWG 2P4VA 2DWEC 4QPKA 1Y76A 2YXLA 4X64O 4UV9A 2QDOA 3ETGA 1LUVA 3K3WA 4LP8A 1XNQB 2KQXA 4PHZA 1XREA 4J10A 2UXBO 2UUAO 4LF7B 3AK3A 2YICA 1FKAO 5KAIZ 2QE7G 1IBLB 4J41A 3B2EE 4MSWC 5J9PC 3CC2V 3D8CA 5K1PA 4RQEA 1OCOB 2UXXA 4FIPC 1MOFA 1GM9A 3CS5A 1MA1A 4UCRA 1S5LZ 1YITV 4J11A 1WA8B 3BVOA 3MAQA 5KAFZ 1AI5A 3JAKB 4YJ3A 3T1HB 4JAAA 2PI4A 4R6ZA 4DV6B 2EZPA 2HG5C 1KB9F 4DR5O 4XDKA 1JQ0A 4LNUA 3JAWA 3VOUA 4FFBB 4EFEA 4B3RO 2N05A 3N27A 1BQZA 4I55B 1LR1A 1L8DA 2XAHA 3ZS8C 1AVMA 2P90A 3QG5A 4PV1B 4B3TB 1IURA 1N33B 4LFAB 5J2TA 2BTOA 2WLLB 1N34B 1DGSA 1AI4A 3NXSA 1F23A 3OM3B 5DECA 4YHHO 2DN9A 4X62B 2CTRA 1M1KW 4CC6A 5CMUA 2RJZA 3N2GA 4O4LA 4FLTA 3CJHA 4DR2O 2UUCB 2KKWA 4ZI7A 2WLNA 3AK1A 1NR1A 2QR4A 1EN4A 1YIJV 5GTIZ 4JTCB 1THZA 3QO7A 4LF4B 1SC5B 3RYFB 4IIJA 5LYJB 2P6JA 2EIKB 1N0JA 4JYAB 1K34A 2F66C 2IJJA 2B5UA 4X64B 4NTWA 2UXBB 5CB4A 3KCXA 5L3EA 2UUAB 2Q67A 4F6RB 1Z5VA 4IT5A 3CCVV 2AHYA 3HKBA 5CN0A 3Q4HB 1MMMA 2JEXA 5EC2C 2EZOA 2F1MA 4BAYA 4UXNA 1EN5A 3TXQA 3ZJZA 1KP3A 4FZ1A 1D5AA 2DYSC 1W0JG 5DM6V 2CTQA 1GKFA 3ZMSA 3E8HA 3HKEB 2F93B 5KA5A 3SPIA 1H2GA 1Z2GA 1MABG 2WLMA 3SPGA 5ITZA 1J95A 1JR9A 4B3RB 4PDRA 3W7WA 2QWOB 2BCCH 2YIBA 3T1YO 3AG3C 3B4SA 4N23A 3ZRVA 5KX5B 1VQNV 1NZ6A 1AJQA 4LWSA 5LXTA 2H94A 2EX3A 3M7MX 3OR7C 1EFRG 3OUFA 3EVKA 1FAFA 2X7RB 3DGEA 1QLEB 2EIMC 1IBKO 3JATA 3ABLC 2HLDG 4JI6O 4LH7A 5H6RA 1VQKV 2IJIA 3UT5B 3APOA 4DR2B 1COWG 5FLXN 5JH7B 5CA3A 1IBMO 4U3JB 3JAKA 1NVPD 4F6EA 3EXAA 3WB1A 5LGUA 4X1KA 3C90A 1WN7A 2R9RB 2QKSA 1SERA 4FFBA 4BIZA 2LQTA 2JEUA 2LW7A 3GB7C 4XDJA 5JQGB 2WLLA 3JALA 2V1DA 3ZN0A 2ETNA 3B40A 1NT2B 2IJHA 3OMNB 1FXHA 4WBNB 3VBBA 4I50B 4NXNO 1SRYA 1E79G 4UCOA 1PNKA 1OV9A 2ZCEA 5A2QN 1M5IA 2UXNA 2WPDG 3ABKB 3F5TA 1R3IC 3ASNB 4DO2A 2GUZB 2QM4A 3RYIA 3MD0A 5B3SC 2LFRA 1VQMV 2PTMA 1XBLA 2XT9A 2ZD9A 1YXBA 2Q8VA 2DYRB 2NN4A 5LYJA 2OWOA 4D6TH 1VEWA 2OIEA 1JFFA 3U10A 4NXMO 1NI8A 1R6NA 3T1YB 4B7KA 4R7CA 3SPHA 5CBFA 4LF9O 3AG7A 3WB2A 4BR6A 2VQFB 1G4YB 3RYCA 2P22C 2XAJA 5B1NA 1OCZB 3ETQA 3EHBB 3Q4HA 5BMVB 3SJAC 5D5PA 1WB8A 4UB8Z 1IBKB 1NH2D 3BRCA 4MT8A 2GHYA 5KHIA 4JI6B 1YEWA 2JIZG 1KKDA 2CUGA 3MHSC 3K9SA 2E3CA 1RP3B 1E1RG 5H5NA 1I5YA 2IU0A 1P84F 3HKEA 1NTKH 4AI8A 4FLXA 4PDMA 1IBMB 2DYRC 3RFRA 3VQWA 4DYLA 4DUYO 2EINB 5IDJA 1F7YA 3FKSG 3DTUB 1GH6A 3BA8A 4ZOLB 4LH6A 1NU1H 1YF2A 2W6IG 3C3SA 5JCOA 4NVPA 3OFNG 4TQFA 3JARB 5KX5A 1R3LC 2IM9A 4KXRA 4TUYB 2HKOA 1F51A 4KL1A 3L72H 4PA3A 4JI3B 1Y6XA 5JJEB 1Q8IA 4NXNB 1X59A 5J2UA 1PL4A 3ZMZA 2V7QG 3FYIB 2E75B 2QTSA 1VQOV 2FMLA 2G38A 4YJ3B 1DLBA 3W7TA 4OGQB 1JMKC 3STZC 1JA8A 3CB2A 3ZBHA 3UT5A 3RVZA 4JYYA 4HNAB 4FLUA 4X8AA 3JAWB 3K79A 5L3GA 1HNXO 1UPGA 1NR7A 5JH7A 2X6CA 4U3JA 2KSDA 3TXSA 4LFBO 2B9ZA 4IHJB 3SJBC 1MZEA 3HR0A 1ZAUA 4ZHQB 2ZDIA 4JI4O 5EZYB 3CP1A 2JGUA 2JRIA 5EC1C 4NXMB 4FJCC 3AG4B 3ZN1A 3JD3A 2EJRA 4LF9B 2PYJA 5JQGA 5B1AC 1R6KA 3K06A 1K4DC 4MTFA 1EZJA 2AXTZ 3KCYA 3N2GB 1S72V 1OJHA 2ZE7A 4WBNA 2YEVA 4O4LB 2R72A 4I50A 4MTOA 1XL6A 3TGUH 2ZNJA 3UCSC 4UFZA 2YXYA 4UVCA 3H9VA 4ZI7B 1CP9A 2W6JG 1XQ8A 1P4RA 1K3EA 4HYOA 5E1AC 1TAEA 5H9CA 2GUZA 2PY5A 4IIJB 1H2LA 2GTAA 1ZL8A 4Q6GA 3ASOB 3ZHUA 4PI2A 1R3KC 2D3OW 1A32A 4DUYB 2YDEA 5GONB 4JI0O 2PI5A 5JWPA 5KLVH 4UVBA 4KFMA 1K9MW 1Q3EA 2HHHB 3ZIAG 2Q7HA 4DR4B 2ADQB 1Q86W 4MVZA 3AEIA 5B66Z 1S5HC 3CX5F 3JD1A 1HNWO 3EFFK 4J42A 5B1BC 4DK1A 2HFEC 3ZCCA 1KC8W 1BGYH 4MW3A 2XUMA 4EEQA 5TISZ 3B77A 3GWKC 3G71V 4EFBA 1E1QG 2WLJA 2PUSA 3JASB 4JV5O 1NTZH 3OAAG 1G8MA 4X9QA 1OCCB 1YJWV 3X2QC 1IXMA 4GZRB 4K0KO 5CA1B 2HJDA 5ITZB 1HNXB 4XBFA 1QR9A 2ZIOA 2Y4TA 3CCMV 2Q4PA 5IYZB 2XHBA 4H37A 4BWAA 2A79B 3IC9A 4UCUA 1W0KG 4WFGA 4LFBB 4OX9O 3P32A 4MW8A 4ZOLA 1GN6A 5IYDO 4LWSB 4JI4B 3E89A 5LXTB 3OGCC 1ZTEA 1SZXA 1VF6C 3B09A 3JYCA 3LDEA 3JARA 1NBMG 2BE3A 3J80N 2JVDA 2ODMA 3JATB 1S77D 4X89A 5H2FZ 3CC4V 4TUYA 2QA4V 3DXRA 2QGNA 2ZR3A 1M56C 2HVJC 1ZX3A 1V54C 2P7TC 3F5WC 3SGIA 4K8ZA 1QLNA 4H13B 4P2ZA 2RQ6A 4X1KB 3PN1A 4HNAA 1N4CA 2ADPA 1N36O 2CGNA 3FB6C 2P06A 2Q0AA 1BSMA 3CMAV 4AQYO 4JI0B 4IHJA 1PM9A 2A0LA 2CGOA 3PJSK 4H44B 4DW0A 4ZHQA 2LW1A 4B3SO 1NQTA 4X1YB 5EZYA 3HKCB 3JALB 4L87A 2ZNIA 1FPOA 4XDLA 2UXCO 2UUBO 4LF5O 2IH1C 1Y66A 1K73W 1OCOC 3ZX6A 1HNWB 4CS3A 3CRCA 4UUJC 4J9ZB 1UFIA 5IJ0A 4G28B 1XOUA 5KUKA 1VQLV 4H0LB 1H2SB 1BMFG 2ZE8A 3G80A 3RYIB 1AILA 4O4IB 3D3IA 4RAIA 3TCUA 4JASA 4OPHA 4JV5B 2JK5C 3OE7G 3B8NA 2ARHA 3K5OA 1TGOA 5JJJB 3CCSV 4WCEV 3CCQV 1FFXB 2LO1A 1US6A 3AG1B 4K0KB 3QF7A 1SF9A 1TUEB 1JFFB 1GO3F 3MDSA 1YZBA 5IYBO 5GONA 4OX9B 5B5EZ 3GVMA 2EIJB 3CXCU 1SA0B 2L6LA 4P9OA 1FYJA 3RYCB 1RFYA 4JI5O 2HEPA 3CYOA 1VQPV 3JCUZ 3CWBH 2BOBC 3ZRSA 1J5EO 3OMIB 4MVQA 1DF5A 1QVGU 4FZ0A 3CRRA 4DR1O 1TVKB 5LGNA 4QGPA 2QWQB 1H8EG 5L3CA 3FX7A 1JJOA 4ZIBA 4OPAA 1QR8A 2E74B 2ILMA 1TA8A 2VWJA 4PD4F 5FNVB 4RWUA 3G4SV 5K1XA 4B08A 3JASA 4IYIA 2GTSA 5BXZA 1PD3A 4PA9A 4CS2A 1M4UA 2EIKC 3WG7B 4PA4A 4HZ3A 2QEXV 1GN4A 3VQVA 5CA1A 1IZ3A 5FPOA 1N36B 2RCVA 4FLVA 1G1XB 3FB7C 3T2MA 5IYZA 3CE2A 4RQFA 1GN3A 1WPXA 3P30A 4AQYB 3CPWU 4DV7O 2RN9A 1Q6HA 2DJVA 2VQFO 4PELA 4Q20A 4B3SB 1YTFD 3W7UA 3TJTA 5CA0A 4K35A 5BR8B 1Y74A 2P5OA 2Q73A 2UXCB 2UUBB 4LF5B 4LC1A 3HKDB 3SYPA 4FLYA 2IU3A 5KUMA 4KHPO 5J2UB 3IFXA 4J80A 1GMGA 1RM1B 4E2LA 4JPRA 3ICXA 1RPRA 3T1CA 3L74H
chains in the Genus database with same CATH topology
4W4LA 4KXRA 3FX7A 4J11A 4J7JA 4W4KA 4J7KA 4J41A 2G38A 4J42A 4J10A 4IYIA 2GTSA 4IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4L A;  4KXR A;  3FX7 A;  4J11 A;  4J7J A;  4W4K A;  4J7K A;  4J41 A;  2G38 A;  4J42 A;  4J10 A;  4IYI A;  2GTS A;  4IYH A; 
#chains in the Genus database with same CATH topology
 2LGQ A;  5BY1 A;  1VP7 A;  2B1G A;  2CAZ C;  5LOV B;  1QVF U;  1NKD A;  1GRJ A;  4JI8 O;  2Q6A A;  1I0H A;  1MNG A;  2DQ0 A;  1Q43 A;  1Q5O A;  3H01 A;  4LBE C;  1YJ9 V;  4CS4 A;  4GCZ A;  1EZV H;  1YI2 V;  4QJF B;  4O2A B;  5JCO C;  5KMG B;  3NR7 A;  4FPP A;  3A2F A;  4NR1 A;  4E4E A;  2QJ1 A;  1XI1 A;  2GDS A;  5D5Q A;  1WP7 A;  2WLH A;  1NVP B;  3J81 N;  3L71 H;  1KYO F;  4CH3 A;  4UCT A;  4X1Y A;  3HKC A;  4JI5 B;  2H3O A;  1QLE C;  3M99 B;  2X0L A;  2EIL B;  3LNN A;  4DV0 O;  1H2M A;  2E76 B;  1J5E B;  2YEV B;  4JI3 O;  2A7W A;  1YCI A;  2RNB A;  3L75 H;  3K0G A;  5FPR A;  1Q90 D;  2Z0A A;  2WWW A;  4DR1 B;  1VQ4 V;  3LNM B;  4FVM A;  3ZHT A;  1GN2 A;  1XIL A;  4BW9 A;  2HR3 A;  4JZ2 A;  2O57 A;  4O4I A;  2CH7 B;  1ZL8 B;  4N21 A;  2AZ0 A;  3S3X A;  3K08 A;  2W0X A;  4GX0 A;  1S5J A;  2VS0 A;  4Z1M G;  2ZDI C;  4CBC A;  3N2K B;  4GKK O;  1FFX A;  3ABM B;  3ZHR A;  4LFC B;  1HDJ A;  1OCR B;  2RMK B;  3WB0 A;  2PGG A;  1FJG O;  3OW2 U;  3BY6 A;  1ZSP A;  1ZLZ A;  3JD0 A;  1U96 A;  4DV7 B;  2ITD C;  4JTA B;  5EIB C;  2Y48 A;  3S3W A;  1SA0 A;  1KMI Z;  3ZMT A;  1L0N H;  1W2B U;  3K9A A;  1YVW A;  2JS3 A;  1KEC A;  5L3F A;  4I7Z B;  4FMT A;  2LFS A;  3THO A;  4O2B B;  2BTQ A;  3U11 A;  3CRA A;  2Y69 B;  4KHP B;  4PDL A;  3ZMV A;  3ABK C;  1TVK A;  3P3N A;  4TQD A;  3ASN C;  5F2V O;  1MG1 A;  1H8H G;  3B8M A;  1AI7 A;  4X66 O;  2BOC C;  4I0X A;  2GV9 A;  5FNV A;  3H1J H;  2AHZ A;  3K0D A;  5LL6 Y;  3BAA A;  4JI8 B;  4ZKI A;  1NH2 B;  5E79 Z;  4I5S A;  1PNM A;  1CXZ B;  4L8J A;  4LF6 O;  5IWA B;  1BS3 A;  3D3Q A;  1ZWI C;  3LUT B;  4J9Y B;  2HHH O;  3ABU A;  4DR4 O;  1SZT A;  4UB6 Z;  1SQX H;  2OCH A;  2F4V B;  2F95 B;  2JGD B;  3KG2 A;  4DR3 O;  2MW2 B;  2FKX A;  1OCZ C;  1AP5 A;  2X6B A;  2XND G;  3OMA B;  3DC6 A;  3G6E V;  4DV0 B;  3DXR B;  3HKD A;  3CC7 V;  2YS8 A;  3OUS A;  2ZXW B;  3A0R A;  2UU9 O;  4JYB A;  2YI8 A;  3SJC C;  1YHQ V;  3K59 A;  5KHJ A;  4W4L A;  4X88 A;  3SJQ C;  5GTH Z;  3P3P A;  3H1I H;  3L70 H;  2CE4 A;  3AG2 B;  5LOV A;  2WA4 A;  3FB8 C;  2EIN C;  4TWK A;  4YIO A;  3C3T A;  1OHH G;  1VQ9 V;  2OCC B;  3F7V C;  4GKK B;  4TSF G;  5KHG A;  1B04 A;  2B1I A;  4O2A A;  4KUM A;  5KMG A;  3R66 A;  2YC0 A;  3E8F A;  1V9P A;  5CBH A;  4H33 A;  1FJG B;  4PDV A;  1M57 B;  1K5S A;  1HWY A;  1VQ5 V;  1BHA A;  1H2N A;  3JCZ A;  1JX9 A;  1I08 A;  4GX2 A;  1F4M A;  3BCC H;  5IJ0 B;  1GTO A;  5IY5 B;  2Q5Z A;  1GK9 A;  5HFL A;  3RW0 A;  5FL7 G;  2A3Q A;  3SYQ A;  4DV4 O;  2UXD O;  1Q6I A;  5LHI A;  3OD4 A;  1FXK B;  4DV5 O;  1JJ2 U;  1K97 A;  4X66 B;  5DED A;  3WU2 Z;  4LR3 A;  3H1K H;  3FAV A;  2D2C B;  1HW7 A;  3SR2 C;  2QSA A;  2CH7 A;  1YSC A;  4X65 O;  1ENV A;  2H8P C;  5LP6 B;  4O4H B;  3JSN A;  1AJN A;  3N2K A;  3E2E A;  4LF6 B;  3D36 A;  2ZM6 O;  3J7A U;  3BA9 A;  5JVD B;  2Q68 A;  1AP6 A;  4PJ0 Z;  4FM0 A;  1V55 B;  3AG4 C;  4EB6 B;  3U0Z A;  1YJN V;  1SES A;  1I5X A;  1TUB B;  2Q0O C;  2ZIN A;  3CCU V;  1YDX A;  4YY3 O;  4DR3 B;  3CSX A;  1SQP H;  3O9O A;  4O2B A;  2CTW A;  3BAB A;  1BL8 A;  3BEH A;  1EBO A;  4NKG B;  1SQB H;  3E8G A;  1M93 A;  2UU9 B;  1BZK A;  4WF9 V;  3O65 A;  2Q69 A;  4U3F H;  3ZRW B;  1HR0 B;  3ASO C;  2PF4 E;  5EBM C;  2Q7G A;  2CK3 G;  1URF A;  4I4T B;  4TV9 B;  4DUZ O;  2WAM A;  3ZHS A;  3BFR A;  2XOK G;  3OT7 A;  2IH3 C;  4YJ2 A;  1CEZ A;  1XMO O;  2OIG A;  3DC5 A;  1U97 A;  1O9H A;  3OEH G;  5CA0 B;  2WLI A;  1Y74 B;  1FD9 A;  4AIL C;  3HB3 B;  1PL0 A;  1SQF A;  1QQC A;  2Y4U A;  2DWD C;  3L9D A;  5LBQ A;  2JGD A;  4DV1 O;  4WFF A;  2E5L O;  2K1E A;  2WSS G;  1D2D A;  3E22 A;  4F4L A;  1N8R W;  1PV0 A;  3UKM A;  3JD4 A;  3OR6 C;  2M7W A;  3E35 A;  2C2A A;  5AG2 A;  4JAU A;  4DV4 B;  1I94 O;  1VIB A;  5HFM A;  2UXD B;  1KQS U;  1OCC C;  1RSO B;  2JS5 A;  1LUW A;  4DV5 B;  2OYQ A;  4P9P A;  1PKX A;  3SDL A;  2FTK A;  5LMN O;  2YIA A;  1VF7 A;  4X65 B;  4JAV A;  2Y0P A;  4G27 B;  2Y0I A;  2VWK A;  3M8A A;  3CCR V;  1F4N A;  1AJP A;  4CZZ A;  1KP2 A;  3SYO A;  4BW5 A;  1Q7Y W;  2ZM6 B;  3RN4 A;  3DSQ A;  1Q81 W;  5BR8 O;  1QCE A;  3RYH B;  3RVY A;  4GX5 A;  4RUE A;  2YSU B;  3MHH C;  4R50 A;  1KU9 A;  4YY3 B;  2ZKO A;  1AB3 A;  4CH5 A;  3JSL A;  2Q9L A;  1MSD A;  2ZE5 A;  1FXV A;  3QVN A;  2EBO A;  4ABM A;  5L3D A;  5KA6 A;  3VQY A;  2LP7 A;  3OEE G;  1KUQ A;  1M9N A;  2ZQM A;  2XAS A;  3FD9 A;  2QM8 A;  4PA6 A;  3CRM A;  4NYK A;  2CTP A;  4NB5 A;  3BHP A;  1FFT B;  1FXK A;  1Y4M A;  2A06 H;  5A9G A;  2Q7E A;  1UJW B;  4UCS A;  1IDS A;  4ASU G;  1R3J C;  2R70 A;  2OTJ V;  3G6B A;  5LGT A;  1SQQ H;  1XNR O;  2BSK A;  3I5D A;  4C7U A;  3L73 H;  4QE7 A;  4DUZ B;  3UO3 A;  5IJ9 B;  5LP6 A;  2DYS B;  4O4H A;  4U7O A;  1DK1 A;  4X20 A;  4JI2 O;  2FB5 A;  2WLK A;  4JYC A;  2WA3 A;  1XMO B;  4AHC A;  5JVD A;  1NTM H;  3A0B Z;  4EB6 A;  4I9Q A;  2LJ2 A;  1N32 O;  1VQ7 V;  1AR1 B;  4PA7 A;  4X1I A;  1TUB A;  1BE3 H;  1WJZ A;  4GLX A;  2BTQ B;  1W59 A;  1HP8 A;  3OTO O;  4DV1 B;  2LGW A;  2E5L B;  4CH4 A;  4W4K A;  4DR6 O;  1P49 A;  3ML0 A;  2MK3 A;  3AG3 B;  2ITC C;  4RUF A;  4G2K A;  3APQ A;  5L3B A;  3CME V;  2JJ1 G;  2KB1 A;  3SYC A;  4I0X B;  1BQ0 A;  3TK1 A;  1I94 B;  4Z1V A;  1VF6 A;  1D5N A;  4NTX A;  4GYC B;  1FS0 G;  2EIM B;  3AG1 C;  3ZRW A;  2AZ2 A;  4O4J A;  1AR5 A;  1QNM A;  2F43 G;  3ABL B;  3CCJ V;  5LMN B;  4LFC O;  2YI9 A;  1ORQ C;  3LDC A;  4DRX B;  4I4T A;  4TV9 A;  3K03 A;  1ZUQ A;  2EIJ C;  4DV2 O;  4JI1 O;  3G67 A;  1JCH A;  5LA6 B;  3ZMU A;  4DR5 B;  3I56 V;  3R65 A;  4B7E A;  4MVM A;  1K92 A;  2XAF A;  1XMQ O;  5LMU O;  3LDD A;  1RPO A;  1JPX A;  4FLZ A;  1R73 A;  2ZIM A;  5EK0 A;  1YTF B;  4TV8 B;  4JGS A;  1WPB A;  3E8B A;  4PI0 A;  1RSO A;  4YHH B;  1K8A W;  1B06 A;  4J7K A;  2A9H A;  3WG7 C;  2XAG A;  3CD6 V;  1XDC A;  1SKV A;  3K5M A;  3RT3 C;  1Z5W A;  1DTO A;  1PPJ H;  2PZS A;  1VQ8 V;  1SS3 A;  5IWA O;  3HPL C;  2OT5 A;  1XNR B;  3FB5 C;  1WA8 A;  3IAY A;  4JI2 B;  1L0L H;  4UCV A;  4GX1 A;  3T4Z A;  2KG7 B;  1KD1 W;  5IYC O;  2F4V O;  5B3S B;  1XHZ A;  2R9I A;  1BT8 A;  3ZHV A;  3CCE V;  2HJF C;  5EIB D;  4LF8 O;  1N32 B;  3E86 A;  1P7B A;  3RYH A;  4CC5 A;  2OTL V;  1RM1 C;  4I55 A;  4JTD B;  1L1F A;  2HVK C;  3OTO B;  5KHH A;  3CRQ A;  3ETE A;  2N04 A;  5EBL C;  3FFQ A;  4DR6 B;  2X6A A;  3RGB A;  5B1O A;  4MVU A;  3KZI Z;  1WNS A;  1I7F A;  3CHX A;  3FAV B;  2Z5U A;  1XHX A;  4ZBM A;  3UQ8 A;  2QWR B;  4DR7 O;  3A8T A;  1BHB A;  2GBO A;  1VMG A;  2EUL A;  4NTY A;  3K5N A;  2P4K A;  5IJ9 A;  4DV2 B;  4ICG A;  2YID A;  2XTA A;  4JI1 B;  4JI7 O;  4B3M O;  4TOI A;  5C8Y B;  2EIL C;  3H1L H;  1SQG A;  1WB7 A;  3RYF A;  1Q82 W;  4HAM A;  4MVO A;  1H38 A;  3I55 V;  4K3A A;  2ZT9 B;  4D7T A;  3IC7 A;  4WFE A;  4FM2 A;  4BIO A;  1ARO P;  2YUA A;  3T4D A;  3SPJ A;  1XMQ B;  5LMU B;  4J7J A;  4IL6 Z;  2FYU H;  3VQX A;  1OZ0 A;  5IT9 N;  1MSW D;  4OXS A;  2QWN B;  4YIP A;  1H2K A;  1Q6U A;  4JZG A;  5CBG A;  4F6R A;  4FK5 C;  3LSU A;  3H1H H;  3A0H Z;  4RO2 A;  3QO5 A;  1K33 A;  3D36 C;  3ZRX A;  3ABM C;  1S0V A;  1QU7 A;  4MTG A;  1OCR C;  4YJ2 B;  3SYA A;  2ATK C;  1S76 D;  5LHH A;  1N0N A;  4DRX A;  2WLI B;  3UO2 A;  2F23 A;  5EYP B;  2XAQ A;  3SPC A;  1R1B A;  1BCC H;  3RWR D;  1PP9 H;  1XL4 A;  1R6T A;  3K58 A;  1Y76 B;  5LA6 A;  1WP8 A;  3QTC A;  2QM7 A;  1VQ6 V;  3E22 B;  4LF8 B;  1HNZ O;  4MVR A;  3K04 A;  2Y69 C;  3JAM N;  3OGI B;  1KKC A;  1VF5 B;  4GKJ O;  3ABT A;  4QPJ A;  3K57 A;  3KKY A;  1G6U A;  1X4T A;  2QWP B;  2FL4 A;  1K7D A;  4MTX A;  1SQV H;  4GUN A;  1NS1 A;  4TV8 A;  2IJK A;  2PYL A;  3JD2 A;  1GAX A;  1IVS A;  1VAR A;  1HR0 O;  3QO8 A;  2NLJ C;  1GM7 A;  4BIU A;  5B1A B;  1PNL A;  4MVS A;  1KBH A;  5C93 A;  2DQ3 A;  4Z2W A;  2R9A A;  1IXB A;  4U7N A;  5GW7 A;  4K8X A;  4UV8 A;  4DR7 B;  1SET A;  1EN6 A;  3GWO A;  3AK2 A;  4FLW A;  4LCU C;  3K5L A;  1JOY A;  2VQE O;  2IBZ H;  4LNU B;  1NJI W;  1T5E A;  4DV3 O;  4FM1 A;  3CXH F;  4JI7 B;  2L35 A;  1DF4 A;  2IW5 A;  1QBZ A;  2KG7 A;  4R8C A;  2M6Y A;  4B3M B;  1S3J A;  3W7X A;  1P7G A;  3UM7 A;  3ZHQ A;  3QNE A;  3IGA C;  1XNQ O;  2W0F C;  5JJN B;  3IJ4 A;  5J2T B;  2ZXW C;  4J7Z A;  2DE0 X;  4LF7 O;  5IE9 A;  4I9W A;  1IBL O;  3F7Y C;  3BPZ A;  2QKC A;  4IGG A;  4EKW A;  1B6Q A;  2K9P A;  3LSS A;  3AG2 C;  4QE9 A;  2DMX A;  1WAZ A;  2GSM B;  4MS2 A;  3CCL V;  1XEQ A;  4D7S A;  2OCC C;  5B1B B;  2BSK B;  5KHK A;  4QIW F;  2RDC A;  2VRZ A;  3CJH B;  2AGA A;  4X20 B;  1Y67 A;  3T1H O;  4DK0 A;  4KP4 A;  3CEI A;  4DV6 O;  1ROP A;  4P30 A;  2QTO A;  1XUQ A;  4GT1 A;  1M57 C;  2DW4 A;  4X1I B;  2N74 A;  3X2Q B;  5BZB A;  3E83 A;  2AW9 A;  4QNH B;  4WFA V;  4FFK A;  5C8Y A;  1AI6 A;  5IY5 C;  3TET A;  1LNQ A;  4CH6 A;  3W7S A;  2DOS A;  4B3T O;  1N33 O;  5CB4 B;  1HNZ B;  4LFA O;  4GKJ B;  4A5U B;  1FXK C;  5H6Q A;  1N34 O;  3HKB B;  3ZED A;  2HP8 A;  1MZF A;  4JF3 A;  2Z3Y A;  1JVM A;  2P67 A;  4X62 O;  1CPY A;  4O4J B;  4TT3 G;  4UVA A;  3FYE B;  2V4D A;  4WFB V;  4WFH A;  1IX9 A;  3LSQ A;  5LP6 C;  1K5Q A;  1WLE A;  1O9G A;  5BMV A;  5DN6 G;  2JDI G;  3ETD A;  4HBN A;  2ZE6 A;  5LHG A;  1QHT A;  2UUC O;  2NR5 A;  2JJ2 G;  2YIB D;  4DW1 A;  1M56 B;  4DXW A;  2CDY A;  1V54 B;  3OTF A;  1M90 W;  3WFV A;  1V55 C;  1K4C C;  1AR4 A;  1B3Q A;  2VQE B;  2EJ7 A;  3RBZ A;  5EBW C;  1EM1 A;  4LF4 O;  3STL C;  2QKA A;  1GM8 A;  4DV3 B;  4JYA O;  2YXH A;  2ZR2 A;  4IYH A;  5EYP A;  2NNU A;  4YXW G;  2P4V A;  2DWE C;  4QPK A;  1Y76 A;  2YXL A;  4X64 O;  4UV9 A;  2QDO A;  3ETG A;  1LUV A;  3K3W A;  4LP8 A;  1XNQ B;  2KQX A;  4PHZ A;  1XRE A;  4J10 A;  2UXB O;  2UUA O;  4LF7 B;  3AK3 A;  2YIC A;  1FKA O;  5KAI Z;  2QE7 G;  1IBL B;  4J41 A;  3B2E E;  4MSW C;  5J9P C;  3CC2 V;  3D8C A;  5K1P A;  4RQE A;  1OCO B;  2UXX A;  4FIP C;  1MOF A;  1GM9 A;  3CS5 A;  1MA1 A;  4UCR A;  1S5L Z;  1YIT V;  4J11 A;  1WA8 B;  3BVO A;  3MAQ A;  5KAF Z;  1AI5 A;  3JAK B;  4YJ3 A;  3T1H B;  4JAA A;  2PI4 A;  4R6Z A;  4DV6 B;  2EZP A;  2HG5 C;  1KB9 F;  4DR5 O;  4XDK A;  1JQ0 A;  4LNU A;  3JAW A;  3VOU A;  4FFB B;  4EFE A;  4B3R O;  2N05 A;  3N27 A;  1BQZ A;  4I55 B;  1LR1 A;  1L8D A;  2XAH A;  3ZS8 C;  1AVM A;  2P90 A;  3QG5 A;  4PV1 B;  4B3T B;  1IUR A;  1N33 B;  4LFA B;  5J2T A;  2BTO A;  2WLL B;  1N34 B;  1DGS A;  1AI4 A;  3NXS A;  1F23 A;  3OM3 B;  5DEC A;  4YHH O;  2DN9 A;  4X62 B;  2CTR A;  1M1K W;  4CC6 A;  5CMU A;  2RJZ A;  3N2G A;  4O4L A;  4FLT A;  3CJH A;  4DR2 O;  2UUC B;  2KKW A;  4ZI7 A;  2WLN A;  3AK1 A;  1NR1 A;  2QR4 A;  1EN4 A;  1YIJ V;  5GTI Z;  4JTC B;  1THZ A;  3QO7 A;  4LF4 B;  1SC5 B;  3RYF B;  4IIJ A;  5LYJ B;  2P6J A;  2EIK B;  1N0J A;  4JYA B;  1K34 A;  2F66 C;  2IJJ A;  2B5U A;  4X64 B;  4NTW A;  2UXB B;  5CB4 A;  3KCX A;  5L3E A;  2UUA B;  2Q67 A;  4F6R B;  1Z5V A;  4IT5 A;  3CCV V;  2AHY A;  3HKB A;  5CN0 A;  3Q4H B;  1MMM A;  2JEX A;  5EC2 C;  2EZO A;  2F1M A;  4BAY A;  4UXN A;  1EN5 A;  3TXQ A;  3ZJZ A;  1KP3 A;  4FZ1 A;  1D5A A;  2DYS C;  1W0J G;  5DM6 V;  2CTQ A;  1GKF A;  3ZMS A;  3E8H A;  3HKE B;  2F93 B;  5KA5 A;  3SPI A;  1H2G A;  1Z2G A;  1MAB G;  2WLM A;  3SPG A;  5ITZ A;  1J95 A;  1JR9 A;  4B3R B;  4PDR A;  3W7W A;  2QWO B;  2BCC H;  2YIB A;  3T1Y O;  3AG3 C;  3B4S A;  4N23 A;  3ZRV A;  5KX5 B;  1VQN V;  1NZ6 A;  1AJQ A;  4LWS A;  5LXT A;  2H94 A;  2EX3 A;  3M7M X;  3OR7 C;  1EFR G;  3OUF A;  3EVK A;  1FAF A;  2X7R B;  3DGE A;  1QLE B;  2EIM C;  1IBK O;  3JAT A;  3ABL C;  2HLD G;  4JI6 O;  4LH7 A;  5H6R A;  1VQK V;  2IJI A;  3UT5 B;  3APO A;  4DR2 B;  1COW G;  5FLX N;  5JH7 B;  5CA3 A;  1IBM O;  4U3J B;  3JAK A;  1NVP D;  4F6E A;  3EXA A;  3WB1 A;  5LGU A;  4X1K A;  3C90 A;  1WN7 A;  2R9R B;  2QKS A;  1SER A;  4FFB A;  4BIZ A;  2LQT A;  2JEU A;  2LW7 A;  3GB7 C;  4XDJ A;  5JQG B;  2WLL A;  3JAL A;  2V1D A;  3ZN0 A;  2ETN A;  3B40 A;  1NT2 B;  2IJH A;  3OMN B;  1FXH A;  4WBN B;  3VBB A;  4I50 B;  4NXN O;  1SRY A;  1E79 G;  4UCO A;  1PNK A;  1OV9 A;  2ZCE A;  5A2Q N;  1M5I A;  2UXN A;  2WPD G;  3ABK B;  3F5T A;  1R3I C;  3ASN B;  4DO2 A;  2GUZ B;  2QM4 A;  3RYI A;  3MD0 A;  5B3S C;  2LFR A;  1VQM V;  2PTM A;  1XBL A;  2XT9 A;  2ZD9 A;  1YXB A;  2Q8V A;  2DYR B;  2NN4 A;  5LYJ A;  2OWO A;  4D6T H;  1VEW A;  2OIE A;  1JFF A;  3U10 A;  4NXM O;  1NI8 A;  1R6N A;  3T1Y B;  4B7K A;  4R7C A;  3SPH A;  5CBF A;  4LF9 O;  3AG7 A;  3WB2 A;  4BR6 A;  2VQF B;  1G4Y B;  3RYC A;  2P22 C;  2XAJ A;  5B1N A;  1OCZ B;  3ETQ A;  3EHB B;  3Q4H A;  5BMV B;  3SJA C;  5D5P A;  1WB8 A;  4UB8 Z;  1IBK B;  1NH2 D;  3BRC A;  4MT8 A;  2GHY A;  5KHI A;  4JI6 B;  1YEW A;  2JIZ G;  1KKD A;  2CUG A;  3MHS C;  3K9S A;  2E3C A;  1RP3 B;  1E1R G;  5H5N A;  1I5Y A;  2IU0 A;  1P84 F;  3HKE A;  1NTK H;  4AI8 A;  4FLX A;  4PDM A;  1IBM B;  2DYR C;  3RFR A;  3VQW A;  4DYL A;  4DUY O;  2EIN B;  5IDJ A;  1F7Y A;  3FKS G;  3DTU B;  1GH6 A;  3BA8 A;  4ZOL B;  4LH6 A;  1NU1 H;  1YF2 A;  2W6I G;  3C3S A;  5JCO A;  4NVP A;  3OFN G;  4TQF A;  3JAR B;  5KX5 A;  1R3L C;  2IM9 A;  4KXR A;  4TUY B;  2HKO A;  1F51 A;  4KL1 A;  3L72 H;  4PA3 A;  4JI3 B;  1Y6X A;  5JJE B;  1Q8I A;  4NXN B;  1X59 A;  5J2U A;  1PL4 A;  3ZMZ A;  2V7Q G;  3FYI B;  2E75 B;  2QTS A;  1VQO V;  2FML A;  2G38 A;  4YJ3 B;  1DLB A;  3W7T A;  4OGQ B;  1JMK C;  3STZ C;  1JA8 A;  3CB2 A;  3ZBH A;  3UT5 A;  3RVZ A;  4JYY A;  4HNA B;  4FLU A;  4X8A A;  3JAW B;  3K79 A;  5L3G A;  1HNX O;  1UPG A;  1NR7 A;  5JH7 A;  2X6C A;  4U3J A;  2KSD A;  3TXS A;  4LFB O;  2B9Z A;  4IHJ B;  3SJB C;  1MZE A;  3HR0 A;  1ZAU A;  4ZHQ B;  2ZDI A;  4JI4 O;  5EZY B;  3CP1 A;  2JGU A;  2JRI A;  5EC1 C;  4NXM B;  4FJC C;  3AG4 B;  3ZN1 A;  3JD3 A;  2EJR A;  4LF9 B;  2PYJ A;  5JQG A;  5B1A C;  1R6K A;  3K06 A;  1K4D C;  4MTF A;  1EZJ A;  2AXT Z;  3KCY A;  3N2G B;  1S72 V;  1OJH A;  2ZE7 A;  4WBN A;  2YEV A;  4O4L B;  2R72 A;  4I50 A;  4MTO A;  1XL6 A;  3TGU H;  2ZNJ A;  3UCS C;  4UFZ A;  2YXY A;  4UVC A;  3H9V A;  4ZI7 B;  1CP9 A;  2W6J G;  1XQ8 A;  1P4R A;  1K3E A;  4HYO A;  5E1A C;  1TAE A;  5H9C A;  2GUZ A;  2PY5 A;  4IIJ B;  1H2L A;  2GTA A;  1ZL8 A;  4Q6G A;  3ASO B;  3ZHU A;  4PI2 A;  1R3K C;  2D3O W;  1A32 A;  4DUY B;  2YDE A;  5GON B;  4JI0 O;  2PI5 A;  5JWP A;  5KLV H;  4UVB A;  4KFM A;  1K9M W;  1Q3E A;  2HHH B;  3ZIA G;  2Q7H A;  4DR4 B;  2ADQ B;  1Q86 W;  4MVZ A;  3AEI A;  5B66 Z;  1S5H C;  3CX5 F;  3JD1 A;  1HNW O;  3EFF K;  4J42 A;  5B1B C;  4DK1 A;  2HFE C;  3ZCC A;  1KC8 W;  1BGY H;  4MW3 A;  2XUM A;  4EEQ A;  5TIS Z;  3B77 A;  3GWK C;  3G71 V;  4EFB A;  1E1Q G;  2WLJ A;  2PUS A;  3JAS B;  4JV5 O;  1NTZ H;  3OAA G;  1G8M A;  4X9Q A;  1OCC B;  1YJW V;  3X2Q C;  1IXM A;  4GZR B;  4K0K O;  5CA1 B;  2HJD A;  5ITZ B;  1HNX B;  4XBF A;  1QR9 A;  2ZIO A;  2Y4T A;  3CCM V;  2Q4P A;  5IYZ B;  2XHB A;  4H37 A;  4BWA A;  2A79 B;  3IC9 A;  4UCU A;  1W0K G;  4WFG A;  4LFB B;  4OX9 O;  3P32 A;  4MW8 A;  4ZOL A;  1GN6 A;  5IYD O;  4LWS B;  4JI4 B;  3E89 A;  5LXT B;  3OGC C;  1ZTE A;  1SZX A;  1VF6 C;  3B09 A;  3JYC A;  3LDE A;  3JAR A;  1NBM G;  2BE3 A;  3J80 N;  2JVD A;  2ODM A;  3JAT B;  1S77 D;  4X89 A;  5H2F Z;  3CC4 V;  4TUY A;  2QA4 V;  3DXR A;  2QGN A;  2ZR3 A;  1M56 C;  2HVJ C;  1ZX3 A;  1V54 C;  2P7T C;  3F5W C;  3SGI A;  4K8Z A;  1QLN A;  4H13 B;  4P2Z A;  2RQ6 A;  4X1K B;  3PN1 A;  4HNA A;  1N4C A;  2ADP A;  1N36 O;  2CGN A;  3FB6 C;  2P06 A;  2Q0A A;  1BSM A;  3CMA V;  4AQY O;  4JI0 B;  4IHJ A;  1PM9 A;  2A0L A;  2CGO A;  3PJS K;  4H44 B;  4DW0 A;  4ZHQ A;  2LW1 A;  4B3S O;  1NQT A;  4X1Y B;  5EZY A;  3HKC B;  3JAL B;  4L87 A;  2ZNI A;  1FPO A;  4XDL A;  2UXC O;  2UUB O;  4LF5 O;  2IH1 C;  1Y66 A;  1K73 W;  1OCO C;  3ZX6 A;  1HNW B;  4CS3 A;  3CRC A;  4UUJ C;  4J9Z B;  1UFI A;  5IJ0 A;  4G28 B;  1XOU A;  5KUK A;  1VQL V;  4H0L B;  1H2S B;  1BMF G;  2ZE8 A;  3G80 A;  3RYI B;  1AIL A;  4O4I B;  3D3I A;  4RAI A;  3TCU A;  4JAS A;  4OPH A;  4JV5 B;  2JK5 C;  3OE7 G;  3B8N A;  2ARH A;  3K5O A;  1TGO A;  5JJJ B;  3CCS V;  4WCE V;  3CCQ V;  1FFX B;  2LO1 A;  1US6 A;  3AG1 B;  4K0K B;  3QF7 A;  1SF9 A;  1TUE B;  1JFF B;  1GO3 F;  3MDS A;  1YZB A;  5IYB O;  5GON A;  4OX9 B;  5B5E Z;  3GVM A;  2EIJ B;  3CXC U;  1SA0 B;  2L6L A;  4P9O A;  1FYJ A;  3RYC B;  1RFY A;  4JI5 O;  2HEP A;  3CYO A;  1VQP V;  3JCU Z;  3CWB H;  2BOB C;  3ZRS A;  1J5E O;  3OMI B;  4MVQ A;  1DF5 A;  1QVG U;  4FZ0 A;  3CRR A;  4DR1 O;  1TVK B;  5LGN A;  4QGP A;  2QWQ B;  1H8E G;  5L3C A;  3FX7 A;  1JJO A;  4ZIB A;  4OPA A;  1QR8 A;  2E74 B;  2ILM A;  1TA8 A;  2VWJ A;  4PD4 F;  5FNV B;  4RWU A;  3G4S V;  5K1X A;  4B08 A;  3JAS A;  4IYI A;  2GTS A;  5BXZ A;  1PD3 A;  4PA9 A;  4CS2 A;  1M4U A;  2EIK C;  3WG7 B;  4PA4 A;  4HZ3 A;  2QEX V;  1GN4 A;  3VQV A;  5CA1 A;  1IZ3 A;  5FPO A;  1N36 B;  2RCV A;  4FLV A;  1G1X B;  3FB7 C;  3T2M A;  5IYZ A;  3CE2 A;  4RQF A;  1GN3 A;  1WPX A;  3P30 A;  4AQY B;  3CPW U;  4DV7 O;  2RN9 A;  1Q6H A;  2DJV A;  2VQF O;  4PEL A;  4Q20 A;  4B3S B;  1YTF D;  3W7U A;  3TJT A;  5CA0 A;  4K35 A;  5BR8 B;  1Y74 A;  2P5O A;  2Q73 A;  2UXC B;  2UUB B;  4LF5 B;  4LC1 A;  3HKD B;  3SYP A;  4FLY A;  2IU3 A;  5KUM A;  4KHP O;  5J2U B;  3IFX A;  4J80 A;  1GMG A;  1RM1 B;  4E2L A;  4JPR A;  3ICX A;  1RPR A;  3T1C A;  3L74 H; 
#chains in the Genus database with same CATH homology
 4W4L A;  4KXR A;  3FX7 A;  4J11 A;  4J7J A;  4W4K A;  4J7K A;  4J41 A;  2G38 A;  4J42 A;  4J10 A;  4IYI A;  2GTS A;  4IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...