2EZOA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords GP41
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezoA00
3MHHC 1QCEA 2P6JA 1K33A 1QBZA 3B8NA 4G2KA 3K9AA 5HFLA 1ENVA 1I5YA 1K34A 3WFVA 2M7WA 1F23A 4E2LA 3CYOA 4FK5C 3GWOA 3P30A 2LP7A 4JF3A 4JGSA 5CN0A 5CMUA 5KA6A 5H9CA 2X7RB 3B8MA 1Y4MA 2EZOA 2EBOA 1MOFA 4N21A 3MHSC 3CP1A 1QR8A 3M99B 4N23A 1DLBA 1DF5A 4JPRA 1DF4A 1I5XA 3H01A 1EBOA 1QR9A 2MK3A 4FJCC 1Y66A 1SZTA 4FIPC 5HFMA 1JQ0A 1MG1A 2OT5A 2EZPA 3B77A 5KA5A 1JPXA
chains in the Genus database with same CATH superfamily
3TXSA 2EILC 3IFXA 4OX9B 3OGIB 2PI4A 2Q6AA 4DXWA 4LF6B 4NXMB 2N74A 3TJTA 1JOYA 4GX1A 2CGOA 1XI1A 2VS0A 4JPRA 3K5NA 1OV9A 1RPOA 3BPZA 2XTAA 3AG4C 4K35A 5BXZA 4MVOA 2EIJC 1K3EA 4X66O 1L1FA 3K0DA 1PNMA 5GW7A 4WCEV 4MS2A 1FYJA 3FD9A 5H6RA 4JV5B 2UUBO 3JAKA 4UB6Z 2V7QG 4EB6B 2YSUB 4DV4B 4FZ1A 2WA4A 5LL6Y 3N2KA 4O4JA 4R6ZA 4EFBA 1MZFA 4NXNB 3QNEA 5B1NA 1NTKH 4EB6A 3H9VA 4FLUA 1KUQA 3N2KB 2EJRA 4PHZA 2VQEO 1IBKB 1BQZA 3SR2C 1BSMA 1PP9H 4DR7O 1YJ9V 4UVCA 2ILMA 3JARA 2ZM6B 1M9NA 4FIPC 5EIBC 2Y69C 4FLYA 4YY3O 1AI4A 3H1KH 1FXVA 5LA6A 1I7FA 1GTOA 2QTSA 4DR3B 2JRIA 4O4LA 4YJ2A 2ARHA 5KX5B 2BOBC 3L75H 5BR8B 1ZX3A 5EBMC 4NKGB 3CHXA 1QNMA 4PDVA 3CJHB 3ZIAG 1N34O 4YJ2B 4QPJA 3SYQA 1WAZA 2VWJA 2JEXA 2Y4UA 1WNSA 3CJHA 1P7GA 2H8PC 4DR2O 2KSDA 4TUYB 4B3MB 4DV3B 1R73A 2QA4V 1AR4A 1SZTA 1XBLA 3RYIA 5JVDA 3ZHTA 4U7NA 2VRZA 1OCZB 1TUEB 3L74H 2WLIB 2P6JA 1QBZA 2XNDG 1BHBA 4W4KA 3FAVA 3AG2B 4HZ3A 2WAMA 4P9PA 4LF7B 4JI2B 3J81N 2WLIA 3HR0A 3K5LA 1NVPD 1P4RA 4I4TA 2K1EA 4H0LB 3UKMA 5GONA 3E83A 4XBFA 2CH7A 3QO5A 1E79G 2EIMC 2K9PA 5LP6A 4RUFA 4TSFG 2UUAO 3AG2C 4CS4A 4MSWC 1XOUA 5GONB 2GTSA 1LNQA 5KA6A 2F93B 3B2EE 4OPAA 1G4YB 1KP2A 1NQTA 4MTXA 3M99B 3KCYA 3L9DA 4FLVA 2UU9B 2Q7GA 4LR3A 2P5OA 5IY5B 3AK2A 3JAKB 4JASA 3B09A 1HDJA 4MTFA 5FNVA 4UUJC 4DV6B 1R3IC 2UXCB 3ABLB 2QKAA 4LWSA 5FNVB 4YHHB 1SESA 3ZMZA 2W6IG 3G80A 5D5PA 5LP6C 1H2GA 3JAWB 4UXNA 4KP4A 3W7UA 3X2QC 1Z5WA 1XMQO 1QCEA 2Q0AA 1H2KA 1I94O 2PY5A 1Q7YW 3JARB 4PDLA 3OT7A 4QPKA 4U7OA 1K4CC 2WLLB 4CBCA 2JGDA 3C3TA 4ZI7B 1B6QA 4ASUG 1RFYA 1RSOA 5LA6B 1DGSA 1HWYA 4GX5A 5KHKA 1VIBA 1G8MA 1U97A 1SQXH 5JJJB 4P9OA 3MHHC 2DE0X 4JI0O 3HKDA 3E8FA 4X1YB 4LF9O 4X62B 4R8CA 1JCHA 3P32A 5LGNA 4DV5B 1XDCA 5CA0A 4JAUA 4LFBB 4FFKA 1AILA 3L73H 3ZJZA 1KYOF 1M1KW 2OT5A 2W6JG 4JI7B 2E3CA 5BZBA 4DR6O 3ABKC 3RBZA 3ZRWA 2ZDIA 3GWOA 4JGSA 5IJ0A 4F6EA 1A32A 5JQGB 3DC5A 2WWWA 4PDRA 3FAVB 2UUAB 4DR5B 5FLXN 4UCOA 4UCTA 2LW7A 3ZRXA 1YVWA 5L3BA 3U10A 3ZHUA 4CH5A 2UXXA 3JALA 2Q67A 4J42A 5LMUB 4Q20A 1WB8A 3K9SA 2Q4PA 2P90A 4PI0A 1WN7A 3RYFB 1XNQB 1OCCB 4ZOLA 3A0BZ 3JALB 1XEQA 5IY5C 4BWAA 1YEWA 1NH2D 1N36B 4GKJB 3HKEA 3P30A 1GO3F 2HHHO 4LFBO 4CH3A 2DJVA 4MVRA 3A0HZ 3DXRB 5EC1C 3H1LH 4J9ZB 1VEWA 5LXTB 1S3JA 2EULA 2BTQA 2Q0OC 2EIMB 3UQ8A 4PELA 4OX9O 2KKWA 4EFEA 4A5UB 1BGYH 4JI0B 1Z2GA 1EFRG 4LWSB 1Q90D 1VQ6V 2E75B 4CC6A 4DR1O 1I08A 2WSSG 1CP9A 2OCCB 4WBNB 4MW8A 3W7SA 1UPGA 3K0GA 1SZXA 4I9WA 1V54C 1V54B 3ZBHA 3TETA 1E1RG 4XDLA 1JQ0A 2JGDB 5KAFZ 2KB1A 1S76D 3E86A 2ZCEA 2FTKA 2UUCO 1Q86W 4WFBV 3E2EA 1VF6A 1H8HG 2CE4A 2ZXWB 2ZINA 1NKDA 3RWRD 3G4SV 1QR8A 3CCRV 4DV7B 1AJNA 1M57C 5A2QN 1N8RW 2DOSA 4JTCB 1TGOA 1T5EA 1QU7A 4DR1B 5F2VO 3JD3A 5E1AC 1YTFD 1PNLA 2UXDB 4E4EA 1PV0A 4Z1VA 3OTFA 1THZA 1YITV 1F23A 3JCZA 1EN5A 1N33B 4JYYA 4BR6A 1QLNA 5B3SC 3H01A 3L71H 5ITZB 1SERA 4WF9V 3AG1C 5LMNB 5DM6V 3W7WA 4JYAO 4X1KA 1HR0B 4DR2B 3F5WC 4YXWG 1BMFG 2RQ6A 4O2AA 1QLEB 2L6LA 2DYRB 2LO1A 2VQFB 1KMIZ 5L3GA 2YEVA 1K97A 1IX9A 1OCOC 4B08A 5KHGA 2GTAA 4O2AB 1QLEC 2LJ2A 3JATA 3CRQA 3W7TA 3K9AA 1XQ8A 3SPCA 2WLMA 3CD6V 3RYFA 4ZOLB 2ZNJA 1PL4A 5JWPA 3JATB 3H1HH 2IM9A 4NVPA 2ATKC 1SS3A 3OFNG 3SJAC 3IGAC 2BE3A 5EIBD 3K08A 3HKCB 1FFXB 4MVSA 3OMNB 3CE2A 1K8AW 3H1IH 3I56V 4HAMA 2V1DA 3WG7B 3ZN1A 2Z3YA 2HR3A 3SGIA 4TOIA 4YHHO 1EN6A 4PA7A 1EZJA 1IXMA 4OPHA 3AEIA 2QWPB 4I9QA 3A2FA 3FB8C 4O2BB 4X88A 3OM3B 1PM9A 4IYHA 4K0KO 1WLEA 2DYSC 5LOVA 1IVSA 4UCRA 2B1IA 4UV9A 4NTXA 4HYOA 1ZUQA 2Q73A 4H37A 1TUBA 1IXBA 2F95B 3J80N 2IJIA 2HEPA 3A8TA 2RMKB 1Y76B 1N0NA 4U3JA 1VQ4V 1HNWB 5LHIA 1W2BU 1K5SA 2IU3A 3BCCH 5JCOA 3SDLA 4X1IA 4GX0A 4L8JA 5GTHZ 3K5OA 1Y76A 1MABG 1FD9A 1O9GA 5IYZB 3BY6A 3GWKC 1XNRB 4I50B 1MG1A 1SC5B 1EN4A 1NR7A 1HNXO 2JEUA 2W0XA 2PUSA 3AK3A 4MVZA 4BIOA 1G1XB 2Q69A 1YXBA 2YIDA 4DW0A 1ZAUA 1DLBA 4JI7O 4WFHA 2ZNIA 2GHYA 1HR0O 3MDSA 1VF7A 1BCCH 4LNUA 1XILA 1FJGB 1S77D 4FZ0A 1KECA 1IZ3A 2YEVB 5L3DA 1KB9F 5EK0A 2DMXA 3QF7A 1VF5B 4D6TH 2DQ0A 1YIJV 2QEXV 2CTWA 4AI8A 4DRXB 1M57B 5E79Z 1Z5VA 3KCXA 1XHXA 2FL4A 2AGAA 3LUTB 3OR7C 2M6YA 1GM9A 4W4LA 4TQFA 2MW2B 3HKBA 1BL8A 4OGQB 4LCUC 1OCRC 1WJZA 3CWBH 2YXLA 4JTDB 1SQPH 1ZLZA 2HLDG 1PL0A 3IC9A 3HKBB 3MD0A 1DF4A 1XMOO 5J2TB 3JAMN 5LGTA 3E8GA 1XMQB 5B5EZ 1H2MA 4O2BA 1R3LC 5KA5A 3ZMUA 3APOA 3S3XA 1L8DA 3B8NA 4XDKA 3ETGA 3ASOB 4PA6A 1UJWB 1K34A 3CRAA 1FXKA 1Q6HA 1FPOA 3K58A 2YUAA 3FB6C 1WPBA 2UXCO 2P4VA 1S0VA 3OTOO 1FXKB 4FJCC 5LOVB 1Q5OA 4WFGA 5KUMA 1TUBB 4F4LA 2BSKA 3RFRA 5C93A 4UB8Z 3TK1A 3WB1A 5IYCO 2WLJA 3L72H 4LF5B 2X6CA 4MVUA 3BRCA 4B3TO 3K59A 2CTPA 3E22B 1L0LH 1NTZH 4WFAV 2ETNA 2FMLA 1OCZC 1Q6UA 1XMOB 2HKOA 3QG5A 1HNXB 3ABMC 4DR5O 3B40A 4UVAA 1XL6A 1MSDA 4X89A 4HBNA 2QM4A 2ZT9B 4NTWA 2LGQA 1Q6IA 4MTOA 4N23A 2P06A 2EINB 4TV9B 3BA8A 1S72V 2P7TC 4XDJA 2L35A 1HNWO 4EEQA 3FB5C 3CCSV 4JI6O 4I0XA 4TUYA 1AI7A 3T1HB 1JJ2U 3JYCA 4IL6Z 4JI1O 3RYIB 4DV1O 5JH7B 4AILC 5IYDO 3K06A 1R6NA 4NXMO 4LFAB 1K5QA 4K0KB 5JH7A 3LDDA 4JI3B 2Z5UA 4U3FH 2H94A 3G71V 2DYSB 4G28B 2ZM6O 2F4VB 1NI8A 1Y74A 1JX9A 1U96A 4LC1A 4IT5A 1YF2A 4O4IB 2PI5A 2AHZA 1I5YA 4DK0A 3IC7A 2RCVA 1EM1A 3J7AU 5DECA 1Y74B 1W0JG 2V4DA 5CBFA 4F6RA 3ZCCA 4P30A 4TQDA 1NR1A 3ABLC 3ZX6A 3WB2A 4P2ZA 3CS5A 1XL4A 3QTCA 2OYQA 2XAGA 1H8EG 2B1GA 4F6RB 4X8AA 1PKXA 3GB7C 5CB4B 4B7KA 4LF5O 1PPJH 3ZHVA 2ODMA 2N04A 2C2AA 4N21A 4B3RO 3W7XA 3G6EV 1VQOV 4RWUA 1V55C 5CB4A 1VQ5V 2CGNA 1CXZB 4GUNA 1WP8A 1V9PA 2YDEA 4MVQA 3OD4A 1VQ7V 5CBHA 4FPPA 2VQFO 2RNBA 2RN9A 3K03A 5B1OA 1WP7A 3K04A 5B1AB 1D5AA 4FVMA 1Y66A 1FJGO 2ZIMA 4CH4A 5LMNO 4DO2A 2P4KA 3SYCA 2B9ZA 3ETEA 3CRRA 1YJWV 1YHQV 1M90W 3NR7A 4KHPO 2M7WA 1Y67A 4ZIBA 4ZHQA 4X64B 2OCCC 3VBBA 2HP8A 4LF4B 1J5EB 3ZHRA 2JS3A 3M8AA 3O65A 4FFBB 4IHJB 2ADQB 4LBEC 5HFLA 5JJNB 4DR7B 1ORQC 5K1XA 1NBMG 3NXSA 1X59A 2NLJC 4GKKB 1AJQA 2XAHA 2QSAA 1I5XA 5TISZ 2XAQA 2AZ0A 1OJHA 4CH6A 3H1JH 1GMGA 1WA8B 4Z2WA 3JASA 1TAEA 2QWNB 1CEZA 2UXBO 4CS3A 1YJNV 3OMAB 4BIUA 4O4IA 2F66C 1VQ9V 3UM7A 1ZSPA 2EIJB 2XUMA 1SKVA 1SF9A 4KL1A 3CXHF 4PI2A 2BCCH 4NYKA 4K8ZA 1N0JA 2BOCC 4QNHB 3CCJV 1NU1H 3CRCA 4B3MO 2LW1A 2E74B 2XAJA 2AXTZ 1GM7A 2DWEC 2B5UA 1S5JA 4CZZA 4J11A 3DC6A 2DYRC 3ZRSA 3RYHB 2EX3A 1R3KC 2E5LB 2XHBA 4O4HA 2OIGA 3UO2A 4O4JB 2FB5A 1FS0G 1ZWIC 5LHHA 4CS2A 4GYCB 3F7YC 3JD2A 2Z0AA 3ETQA 2EZOA 2YI9A 3ZMTA 1AI5A 1MOFA 1TVKB 2P22C 1B3QA 1W59A 3UT5A 1P49A 2JK5C 1X4TA 5LGUA 2F4VO 1AROP 4DV7O 4FLZA 1VQNV 2XOKG 2GUZA 1SQVH 3IAYA 3LDEA 1BE3H 2IBZH 3U11A 2DQ3A 3ZHQA 2ZXWC 4GKKO 1XUQA 3ZHSA 2ZE7A 1GN2A 2OTJV 2GUZB 1HW7A 3CMAV 3OE7G 1FXHA 1VQLV 2HJFC 1URFA 4O4LB 2WLLA 5KX5A 1YTFB 1VQPV 1QVGU 4BW5A 4IIJB 3C90A 3SPIA 1RSOB 5BR8O 2CUGA 3AG1B 3G67A 2JJ2G 1SA0A 5FPOA 1NVPB 5FPRA 2F43G 3KG2A 1VF6C 4IHJA 1GRJA 3OUFA 3EFFK 1M5IA 3BABA 3HKDB 1K4DC 2JIZG 1MA1A 3OGCC 1MMMA 1K73W 4IGGA 1AP6A 4YIOA 4GZRB 1PD3A 3D3IA 1BQ0A 4GT1A 3ASNB 3OEHG 3CCVV 2OWOA 1KKDA 4DV3O 1COWG 3PJSK 5H9CA 1IBLB 1WA8A 5H5NA 3GVMA 5KMGA 5BMVB 3ZRWB 5IDJA 5IJ0B 3SJCC 2R70A 4QGPA 2CTRA 4C7UA 2KG7A 4G2KA 3AG7A 2Y0PA 2QKCA 3WG7C 2QR4A 4JV5O 5KMGB 3M7MX 2DN9A 3U0ZA 5L3EA 4X20B 3I5DA 1VQMV 4BAYA 5LP6B 2Q8VA 1BT8A 2NN4A 1F4MA 4DV6O 1BZKA 3B77A 4B3SO 1GN4A 2X6AA 1W0KG 2Q9LA 1IBLO 3VQYA 4JI2O 5LBQA 3RYHA 2F23A 3LSSA 3ABUA 3OEEG 4JI8O 1HNZB 3K79A 1XHZA 1N36O 4BIZA 4O4HB 4GKJO 1K9MW 4NB5A 3BFRA 2PGGA 3CCQV 4LF8O 2ZIOA 3X2QB 2WLKA 2R9AA 3FX7A 4QIWF 2JJ1G 3CSXA 2QGNA 3AK1A 3CXCU 1LUWA 1TVKA 1OHHG 5J2UA 3T4ZA 4BW9A 3UT5B 2A0LA 3R65A 2KQXA 3E35A 1CPYA 3JAWA 4LF4O 5L3CA 4RQEA 1Y4MA 2EINC 1NZ6A 3ZN0A 1SQQH 4YIPA 1K92A 3CRMA 3UCSC 4WBNA 1RP3B 1N32O 2LFSA 4DUYO 1GAXA 2XT9A 1Y6XA 5CBGA 2ITCC 1V55B 2AW9A 3WU2Z 2QJ1A 4JI4O 4KUMA 1OCRB 2LGWA 3B4SA 4X1YA 4DR6B 1HP8A 3CCLV 1VQKV 1SA0B 1KC8W 2IW5A 3HPLC 2BTOA 4RAIA 4FMTA 3CEIA 2EZPA 1AR1B 3OTOB 3CC4V 3E8HA 2CTQA 2GDSA 5CA0B 2QWRB 4FLXA 5IT9N 4DV5O 4B3RB 3ABKB 2PYJA 3OUSA 2YS8A 5CMUA 3K57A 2X7RB 4DV0O 5JCOC 5KHJA 4K3AA 5L3FA 2EIKC 1G6UA 1R1BA 1KD1W 1JMKC 3TXQA 1FKAO 1M56C 1UFIA 4KHPB 3AG4B 2FYUH 4LP8A 3O9OA 4RO2A 5B66Z 5IE9A 4AHCA 5KLVH 4LF6O 1FAFA 1Q82W 5JQGA 3CYOA 2RJZA 4MT8A 5JVDB 4B7EA 2Y69B 2GSMB 2FKXA 3B8MA 4LNUB 1KKCA 2KG7B 3TGUH 4GCZA 3BHPA 2AHYA 4UCSA 2F1MA 4B3SB 2D3OW 3SYAA 5LHGA 5BY1A 5GTIZ 2PTMA 2OCHA 3G6BA 1Q81W 2A3QA 2CAZC 3ZS8C 4DR4O 3EHBB 4I4TB 1ENVA 3SYPA 1N4CA 3OR6C 1IURA 5CN0A 3QO7A 2CH7B 1BS3A 1OCCC 2QM8A 1SQFA 2YXYA 2EBOA 3TCUA 2ZDIC 2D2CB 2LFRA 2X0LA 1LR1A 4TT3G 2AZ2A 2EIKB 2QM7A 3CCEV 3D3QA 4LF9B 2ZR3A 4I5SA 2X6BA 3K5MA 3DXRA 2NNUA 4FM0A 1ZTEA 1ROPA 1H2LA 4FLTA 3OW2U 5LXTA 3HKCA 4JI4B 3ABMB 3N27A 4I7ZB 2N05A 4JZGA 5KHHA 2OTLV 3MHSC 5DN6G 5J2UB 4D7SA 3D8CA 1QR9A 3ZRVA 2E5LO 3LSQA 1KU9A 3SPJA 3P3NA 1JPXA 3THOA 3DTUB 2PF4E 4IYIA 4JI3O 4MVMA 1TA8A 1KQSU 2QWQB 3VOUA 1GH6A 2WA3A 4X64O 4DV4O 2IJKA 3RT3C 4J10A 1VARA 5AG2A 5DEDA 2ZE8A 2JVDA 4NR1A 3UO3A 4YJ3A 5EZYA 4OXSA 4DV2O 3T4DA 4ZI7A 1GN3A 4Z1MG 2PZSA 2A7WA 3SPHA 2LQTA 1IBKO 4JI8B 1VP7A 4E2LA 2P67A 1DK1A 4YJ3B 5EZYB 2G38A 5EBLC 1IBMB 3L70H 4DW1A 4U3JB 2NR5A 3CX5F 2Q7EA 2MK3A 4X1IB 4JYAB 2R9IA 3ZMSA 1QHTA 2IJJA 3CC7V 4UFZA 4DYLA 4J80A 4GX2A 5IYZA 3BA9A 5IYBO 5ITZA 3QVNA 4PA9A 1WB7A 2QKSA 3RN4A 1B04A 2QWOB 2Y0IA 3HB3B 4DV2B 3VQVA 4JTAB 3CMEV 1I94B 1WPXA 4J7KA 5H2FZ 2IU0A 1J5EO 4PA4A 3AG3C 4LF7O 2WLHA 2HHHB 2YIAA 1P7BA 1AVMA 5LMUO 3K3WA 5KUKA 2HVJC 3CB2A 1J95A 3STZC 1YCIA 4AQYB 1MZEA 2PYLA 2HFEC 3BVOA 4I0XB 3S3WA 2ZE5A 3CCUV 5K1PA 4X9QA 3D36C 2ZD9A 5CA1A 2CDYA 4JAAA 3SYOA 3LSUA 1HNZO 4PA3A 5KHIA 1DTOA 1RPRA 1P84F 4DV0B 1FFXA 2E76B 3KZIZ 3FFQA 4GLXA 5EBWC 5CA1B 5FL7G 4FM2A 5IWAB 4JI1B 3EXAA 1ZL8B 1DF5A 2UXNA 1N32B 3HKEB 4J41A 1YDXA 3RVYA 3WB0A 3E8BA 2HJDA 4PJ0Z 2WLNA 1NH2B 1IBMO 2BTQB 1NT2B 4J7JA 5EC2C 2YXHA 3JSNA 1SRYA 3CP1A 4JZ2A 4FLWA 2UXDO 5HFMA 1AI6A 3T1YO 2H3OA 4KXRA 1XNRO 1SQBH 3FB7C 1US6A 2EILB 4ABMA 3ABTA 4I55A 1Q43A 3JD0A 1F7YA 2XAFA 5D5QA 1AP5A 5J9PC 3OAAG 2UUBB 2IJHA 2IH3C 1H2SB 3RVZA 2BSKB 1AJPA 4TV8B 3Q4HB 4MTGA 2XASA 4H44B 4I55B 1M56B 4LFAO 4CC5A 1I0HA 4B3TB 3LNNA 2YI8A 1KP3A 4TV8A 1N33O 1F4NA 3OMIB 2WPDG 4LFCB 3E89A 3ZMVA 4TWKA 2Y4TA 4QJFB 4ZBMA 3SJBC 2UU9O 4LH7A 1K7DA 4K8XA 4ZKIA 1JVMA 4J9YB 1Q8IA 1BHAA 1LUVA 4PV1B 2YICA 4MW3A 4QE7A 2LP7A 3EVKA 1MSWD 4DV1B 1JJOA 5H6QA 4J7ZA 4X1KB 2CK3G 3RGBA 4UCUA 2ADPA 1D5NA 1H2NA 2YC0A 3SPGA 5EYPA 5IJ9B 5JJEB 1M4UA 3VQWA 5B3SB 4JI5B 3SJQC 3VQXA 3ETDA 3FYIB 1YZBA 3CC2V 4DRXA 2YIBA 4TV9A 2JGUA 4X65B 2JS5A 1RM1B 1R3JC 5KAIZ 3A0RA 4JYBA 4D7TA 5LYJA 5EYPB 2W0FC 1GK9A 5IJ9A 3T1CA 2VWKA 1AR5A 1YI2V 2YIBD 1F51A 1VQ8V 4UVBA 1QQCA 3JASB 4JYCA 5LYJB 3T1YB 4PD4F 4LF8B 2ZKOA 3ASNC 3BEHA 1ZL8A 2A06H 4KFMA 4R7CA 5J2TA 2RDCA 1M93A 3F5TA 4PDMA 1OCOB 3ML0A 2QE7G 1JFFA 3I55V 3AG3B 3RYCB 3BAAA 4UCVA 2ZE6A 4H33A 3R66A 2A79B 5CA3A 1RM1C 1K33A 1GKFA 2GBOA 1JFFB 5IWAO 3RYCA 2R72A 4AQYO 1JA8A 4DR3O 1B06A 4NTYA 3N2GA 2O57A 2Y48A 4X62O 3APQA 2HG5C 1R6TA 3CPWU 1PNKA 2OIEA 1EBOA 4JI5O 1KBHA 2QDOA 1XREA 2ITDC 1YSCA 3N2GB 2QTOA 1QVFU 5A9GA 5B1BC 4Q6GA 4RQFA 3ICXA 1NTMH 3E22A 3Q4HA 4DK1A 1L0NH 2Q68A 1NJIW 2HVKC 4WFFA 4JAVA 3STLC 3T2MA 3MAQA 1R6KA 2IH1C 2R9RB 2UUCB 4RUEA 1AB3A 1SQGA 3RW0A 1N34B 5C8YA 3ASOC 4DUZO 1NS1A 1GM8A 4I50A 4EKWA 2JDIG 3F7VC 4G27B 1EZVH 3JD4A 4IIJA 3PN1A 3LNMB 1MNGA 3DSQA 1OZ0A 4QE9A 5C8YB 4L87A 1GN6A 1D2DA 4DR4B 4ZHQB 1E1QG 1JR9A 3QO8A 5B1BB 4ICGA 2ZR2A 4YY3B 3FYEB 2Q5ZA 4WFEA 4LFCO 4HNAA 4FK5C 4FM1A 4LH6A 3CCMV 4DUYB 3D36A 4FFBA 4DUZB 3ZEDA 1S5LZ 4JI6B 4HNAB 4H13B 3FKSG 4X65O 3KKYA 3JD1A 1XNQO 2DWDC 3JSLA 2DW4A 2ZQMA 1Q3EA 4NXNO 4UV8A 3C3SA 2GV9A 3WFVA 5BMVA 2Q7HA 4JF3A 1IDSA 1SETA 2EJ7A 2VQEB 1FFTB 3P3PA 3JCUZ 5B1AC 2UXBB 4X66B 1H38A 2A9HA 4X20A 3DGEA 1S5HC 3LDCA 3IJ4A 3T1HO 1FXKC 1O9HA 4R50A 1VMGA
chains in the Genus database with same CATH topology
5DM6V 2EILC 3W7WA 3IFXA 4MVMA 2PI4A 1KQSU 3VOUA 2Q6AA 2M7WA 3F5WC 4YXWG 4DXWA 1BMFG 2IJKA 1JOYA 4GX1A 1QLEB 2DYRB 2OCCC 3VBBA 4JPRA 5L3GA 1RPOA 2YEVA 1K97A 1OCOC 1QLEC 3AG4C 4OXSA 3T4DA 1YHQV 4MVOA 2EIJC 1K3EA 4Z1MG 1L1FA 3K0DA 1PNMA 5GW7A 3K9AA 3W7TA 3SPCA 4LBEC 3SPHA 4MS2A 5HFLA 4WCEV 2WLMA 3CD6V 1ORQC 1NBMG 3NXSA 2P67A 5H6RA 4E2LA 2V7QG 2YSUB 5EBLC 2NLJC 2ATKC 1AJQA 3OFNG 2XAHA 3IGAC 4R6ZA 1I5XA 3K08A 2MK3A 2R9IA 3ZMSA 2IJJA 2XAQA 3QNEA 4MVSA 5B1NA 3CC7V 3OMNB 1K8AW 3I56V 4HAMA 2V1DA 1GMGA 3WG7B 3ZN1A 2Z3YA 4GX2A 2HR3A 2EJRA 5IYBO 4PA7A 1EZJA 4PA9A 1CEZA 1IXMA 2QKSA 3AEIA 1YJNV 3FB8C 3OMAB 4X88A 1YJ9V 4BIUA 3HB3B 4UVCA 1VQ9V 3OM3B 4JTAB 3UM7A 3CMEV 1M9NA 1WPXA 2EIJB 4FIPC 2Y69C 2IU0A 1AI4A 1FXVA 4PA4A 3AG3C 1WLEA 1GTOA 2WLHA 1P7BA 2BOCC 2DYSC 4QNHB 3CCJV 3K3WA 5KUKA 2HVJC 2BOBC 1J95A 2B1IA 3STZC 2XAJA 5EBMC 1GM7A 2HFEC 4UV9A 2DWEC 2B5UA 4CZZA 4HYOA 2DYRC 4H37A 4PDVA 3ZIAG 3ZRSA 3CCUV 2ZD9A 2IJIA 4QPJA 1R3KC 3SYOA 3SYQA 1VQ4V 5LHIA 4PA3A 1K5SA 1W2BU 2JEXA 1FS0G 1ZWIC 5LHHA 2IU3A 1DTOA 1RPRA 2H8PC 3F7YC 4GX0A 3JD2A 5EBWC 5FL7G 1MABG 2EZOA 3ZMTA 1AI5A 1MOFA 1DF5A 2UXNA 1R73A 2QA4V 2JK5C 3BY6A 5LGUA 1SZTA 1AROP 1MG1A 3RVYA 4U7NA 1VQNV 1OCZB 1TUEB 1NR7A 2WLIB 2XOKG 2P6JA 1QBZA 3E8BA 2JEUA 3LDEA 2WLNA 2XNDG 1BHBA 1NH2B 3AG2B 4MVZA 2DQ3A 2ZXWC 4HZ3A 2Q69A 2WAMA 4P9PA 5EC2C 2WLIA 1NVPD 2OTJV 1P4RA 1SRYA 3CP1A 3CMAV 1DLBA 2K1EA 3OE7G 1FXHA 3UKMA 1VQLV 2HJFC 3E83A 4WFHA 4XBFA 2WLLA 5HFMA 2GHYA 1AI6A 3QO5A 1YTFB 1VQPV 1E79G 4BW5A 1QVGU 2EIMC 4RUFA 4TSFG 3SPIA 3AG2C 1S77D 1KECA 3FB7C 4MSWC 2EILB 3AG1B 2JJ2G 2YEVB 1NVPB 5L3DA 3ABTA 1LNQA 2F43G 5EK0A 3KG2A 5KA6A 3JD0A 1G4YB 1KP2A 2XAFA 3EFFK 1NQTA 2DQ0A 3OUFA 1YIJV 4MTXA 3M99B 2QEXV 5J9PC 1K4DC 1M57B 2JIZG 3OAAG 2IJHA 2IH3C 3OGCC 3RVZA 1K73W 1AJPA 3LUTB 5IY5B 4MTGA 2XASA 4JASA 3OR7C 1GM9A 4MTFA 4UUJC 1M56B 1BL8A 1R3IC 4LCUC 1OCRC 1PD3A 3D3IA 4GT1A 4JTDB 1KP3A 3ASNB 3OEHG 3CCVV 1KKDA 3ABLB 1F4NA 3OMIB 1COWG 2HLDG 3PJSK 5H9CA 1PL0A 2WPDG 3E89A 1SESA 3ZMVA 4TWKA 3MD0A 4QJFB 3ZMZA 4ZBMA 1DF4A 2W6IG 3ZRWB 1H2GA 5LGTA 3E8GA 4UXNA 5IDJA 1K7DA 4KP4A 1R3LC 5KA5A 3X2QC 4ZKIA 3W7UA 1JVMA 3ZMUA 1QCEA 4J9YB 4XDKA 3B8NA 4G2KA 1BHAA 3ETGA 3ASOB 1Q7YW 4PA6A 1UJWB 3WG7C 4PDLA 1K34A 1FXKA 4QPKA 4U7OA 4MW3A 4QE7A 1K4CC 2LP7A 2WLLB 4CBCA 5L3EA 3FB6C 1MSWD 1VQMV 4BAYA 1B6QA 5H6QA 1S0VA 4ASUG 2CK3G 1HWYA 4GX5A 1FXKB 4FJCC 1F4MA 1G8MA 3SPGA 3B77A 4P9OA 2X6AA 3MHHC 4WFGA 1W0KG 5B3SB 3SJQC 3ETDA 3FYIB 5KUMA 3CC2V 3E8FA 1RM1B 4R8CA 4F4LA 1R3JC 3A0RA 4JYBA 5LBQA 1JCHA 2W0FC 1GK9A 3ABUA 3LSSA 3OEEG 3P32A 5C93A 3K79A 3TK1A 3T1CA 5LGNA 2WLJA 5IYCO 4BIZA 1YI2V 1K9MW 4JAUA 2X6CA 4MVUA 1F51A 3CCQV 1VQ8V 4UVBA 4JYCA 3X2QB 2WLKA 3ZJZA 4QIWF 2JJ1G 2OT5A 1M1KW 2W6JG 3CXCU 5BZBA 3ABKC 4WFAV 3ASNC 3RBZA 1OHHG 3BEHA 3T4ZA 4KFMA 4R7CA 2A0LA 3R65A 3E35A 1CPYA 3ZRWA 2ZDIA 3GWOA 4JGSA 1OCZC 5L3CA 4RQEA 1Y4MA 4PDMA 1OCOB 2HKOA 3ML0A 2EINC 2QE7G 3I55V 3AG3B 3ZN0A 2WWWA 4PDRA 1K92A 4H33A 2A79B 3ABMC 3ZRXA 5CA3A 5L3BA 1RM1C 1K33A 2LFSA 1GKFA 4UVAA 1XL6A 4X89A 5CBGA 2ITCC 1V55B 2UXXA 2Q67A 4Q20A 2Y48A 4KUMA 1OCRB 2HG5C 4MTOA 4N23A 1PNKA 3CPWU 2EINB 2P90A 1S72V 1EBOA 3CCLV 1VQKV 2P7TC 4XDJA 1KC8W 1OCCB 2IW5A 3HPLC 4RAIA 4FMTA 5IY5C 1AR1B 2EZPA 2ITDC 3CC4V 1YSCA 3FB5C 3E8HA 2QTOA 3CCSV 1QVFU 1JJ2U 1AI7A 1NH2D 3JYCA 5B1BC 3ABKB 4RQFA 3OUSA 3P30A 1GO3F 5IYDO 5CMUA 3K06A 2Q68A 1NJIW 2HVKC 2X7RB 4WFFA 4MVRA 4JAVA 1R6NA 3STLC 3T2MA 5EC1C 2EIKC 5L3FA 1KD1W 4J9ZB 1R6KA 1S3JA 1K5QA 1M56C 2IH1C 2EIMB 3LDDA 4PELA 2R9RB 3AG4B 2Z5UA 4LP8A 2H94A 1EFRG 4RUEA 3G71V 2DYSB 4G28B 1VQ6V 4RO2A 3RW0A 2PI5A 1JX9A 4LC1A 3ASOC 1Q82W 2AHZA 1I5YA 2WSSG 1CP9A 2OCCB 3CYOA 3IC7A 4MT8A 1GM8A 4EKWA 2JDIG 3F7VC 4G27B 2Y69B 3JD4A 2GSMB 3B8MA 3LNMB 4MW8A 3W7SA 3K0GA 1W0JG 1OZ0A 4QE9A 4I9WA 1V54C 5CBFA 4GCZA 1V54B 2AHYA 4L87A 3ZCCA 3TETA 1E1RG 3SYAA 2D3OW 4XDLA 4P30A 1JQ0A 5LHGA 1S76D 2KB1A 1E1QG 3E86A 1NR1A 3ABLC 3QO8A 1Q81W 5B1BB 4P2ZA 2FTKA 1XL4A 2ZR2A 3FYEB 1Q86W 3EHBB 2XAGA 1H8EG 4WFBV 1ENVA 2B1GA 4WFEA 3E2EA 3SYPA 1H8HG 4X8AA 3OR6C 4FK5C 5CN0A 3QO7A 3CCMV 1PKXA 1OCCC 2QM8A 2ZXWB 3GB7C 3D36A 1NKDA 2C2AA 2EBOA 3TCUA 4N21A 2ZDIC 3G4SV 3W7XA 1QR8A 3G6EV 3CCRV 1AJNA 1M57C 2LFRA 2X0LA 1VQOV 4TT3G 1N8RW 2EIKB 4JTCB 2QM7A 3FKSG 3CCEV 1V55C 3JD3A 1VQ5V 5E1AC 2ZR3A 3JD1A 4I5SA 2X6BA 1YTFD 1PNLA 2DWDC 2NNUA 2DW4A 2ZQMA 1ROPA 1THZA 4UV8A 4MVQA 3OW2U 1VQ7V 3WFVA 1YITV 1F23A 5CBHA 3ABMB 4JF3A 4FPPA 3JCZA 3K03A 5B1OA 1SETA 2OTLV 3MHSC 5DN6G 1FFTB 1QLNA 3K04A 5B1AB 5B3SC 5B1AC 3H01A 1QR9A 3ZRVA 1SERA 3LSQA 1Y66A 3SPJA 1H38A 2A9HA 4DO2A 4WF9V 3DGEA 1S5HC 3LDCA 3SYCA 3ETEA 1YJWV 1FXKC 4R50A 1JPXA 3AG1C 3DTUB 1M90W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  1QCE A;  2P6J A;  1K33 A;  1QBZ A;  3B8N A;  4G2K A;  3K9A A;  5HFL A;  1ENV A;  1I5Y A;  1K34 A;  3WFV A;  2M7W A;  1F23 A;  4E2L A;  3CYO A;  4FK5 C;  3GWO A;  3P30 A;  2LP7 A;  4JF3 A;  4JGS A;  5CN0 A;  5CMU A;  5KA6 A;  5H9C A;  2X7R B;  3B8M A;  1Y4M A;  2EZO A;  2EBO A;  1MOF A;  4N21 A;  3MHS C;  3CP1 A;  1QR8 A;  3M99 B;  4N23 A;  1DLB A;  1DF5 A;  4JPR A;  1DF4 A;  1I5X A;  3H01 A;  1EBO A;  1QR9 A;  2MK3 A;  4FJC C;  1Y66 A;  1SZT A;  4FIP C;  5HFM A;  1JQ0 A;  1MG1 A;  2OT5 A;  2EZP A;  3B77 A;  5KA5 A;  1JPX A; 
#chains in the Genus database with same CATH topology
 3TXS A;  2EIL C;  3IFX A;  4OX9 B;  3OGI B;  2PI4 A;  2Q6A A;  4DXW A;  4LF6 B;  4NXM B;  2N74 A;  3TJT A;  1JOY A;  4GX1 A;  2CGO A;  1XI1 A;  2VS0 A;  4JPR A;  3K5N A;  1OV9 A;  1RPO A;  3BPZ A;  2XTA A;  3AG4 C;  4K35 A;  5BXZ A;  4MVO A;  2EIJ C;  1K3E A;  4X66 O;  1L1F A;  3K0D A;  1PNM A;  5GW7 A;  4WCE V;  4MS2 A;  1FYJ A;  3FD9 A;  5H6R A;  4JV5 B;  2UUB O;  3JAK A;  4UB6 Z;  2V7Q G;  4EB6 B;  2YSU B;  4DV4 B;  4FZ1 A;  2WA4 A;  5LL6 Y;  3N2K A;  4O4J A;  4R6Z A;  4EFB A;  1MZF A;  4NXN B;  3QNE A;  5B1N A;  1NTK H;  4EB6 A;  3H9V A;  4FLU A;  1KUQ A;  3N2K B;  2EJR A;  4PHZ A;  2VQE O;  1IBK B;  1BQZ A;  3SR2 C;  1BSM A;  1PP9 H;  4DR7 O;  1YJ9 V;  4UVC A;  2ILM A;  3JAR A;  2ZM6 B;  1M9N A;  4FIP C;  5EIB C;  2Y69 C;  4FLY A;  4YY3 O;  1AI4 A;  3H1K H;  1FXV A;  5LA6 A;  1I7F A;  1GTO A;  2QTS A;  4DR3 B;  2JRI A;  4O4L A;  4YJ2 A;  2ARH A;  5KX5 B;  2BOB C;  3L75 H;  5BR8 B;  1ZX3 A;  5EBM C;  4NKG B;  3CHX A;  1QNM A;  4PDV A;  3CJH B;  3ZIA G;  1N34 O;  4YJ2 B;  4QPJ A;  3SYQ A;  1WAZ A;  2VWJ A;  2JEX A;  2Y4U A;  1WNS A;  3CJH A;  1P7G A;  2H8P C;  4DR2 O;  2KSD A;  4TUY B;  4B3M B;  4DV3 B;  1R73 A;  2QA4 V;  1AR4 A;  1SZT A;  1XBL A;  3RYI A;  5JVD A;  3ZHT A;  4U7N A;  2VRZ A;  1OCZ B;  1TUE B;  3L74 H;  2WLI B;  2P6J A;  1QBZ A;  2XND G;  1BHB A;  4W4K A;  3FAV A;  3AG2 B;  4HZ3 A;  2WAM A;  4P9P A;  4LF7 B;  4JI2 B;  3J81 N;  2WLI A;  3HR0 A;  3K5L A;  1NVP D;  1P4R A;  4I4T A;  2K1E A;  4H0L B;  3UKM A;  5GON A;  3E83 A;  4XBF A;  2CH7 A;  3QO5 A;  1E79 G;  2EIM C;  2K9P A;  5LP6 A;  4RUF A;  4TSF G;  2UUA O;  3AG2 C;  4CS4 A;  4MSW C;  1XOU A;  5GON B;  2GTS A;  1LNQ A;  5KA6 A;  2F93 B;  3B2E E;  4OPA A;  1G4Y B;  1KP2 A;  1NQT A;  4MTX A;  3M99 B;  3KCY A;  3L9D A;  4FLV A;  2UU9 B;  2Q7G A;  4LR3 A;  2P5O A;  5IY5 B;  3AK2 A;  3JAK B;  4JAS A;  3B09 A;  1HDJ A;  4MTF A;  5FNV A;  4UUJ C;  4DV6 B;  1R3I C;  2UXC B;  3ABL B;  2QKA A;  4LWS A;  5FNV B;  4YHH B;  1SES A;  3ZMZ A;  2W6I G;  3G80 A;  5D5P A;  5LP6 C;  1H2G A;  3JAW B;  4UXN A;  4KP4 A;  3W7U A;  3X2Q C;  1Z5W A;  1XMQ O;  1QCE A;  2Q0A A;  1H2K A;  1I94 O;  2PY5 A;  1Q7Y W;  3JAR B;  4PDL A;  3OT7 A;  4QPK A;  4U7O A;  1K4C C;  2WLL B;  4CBC A;  2JGD A;  3C3T A;  4ZI7 B;  1B6Q A;  4ASU G;  1RFY A;  1RSO A;  5LA6 B;  1DGS A;  1HWY A;  4GX5 A;  5KHK A;  1VIB A;  1G8M A;  1U97 A;  1SQX H;  5JJJ B;  4P9O A;  3MHH C;  2DE0 X;  4JI0 O;  3HKD A;  3E8F A;  4X1Y B;  4LF9 O;  4X62 B;  4R8C A;  1JCH A;  3P32 A;  5LGN A;  4DV5 B;  1XDC A;  5CA0 A;  4JAU A;  4LFB B;  4FFK A;  1AIL A;  3L73 H;  3ZJZ A;  1KYO F;  1M1K W;  2OT5 A;  2W6J G;  4JI7 B;  2E3C A;  5BZB A;  4DR6 O;  3ABK C;  3RBZ A;  3ZRW A;  2ZDI A;  3GWO A;  4JGS A;  5IJ0 A;  4F6E A;  1A32 A;  5JQG B;  3DC5 A;  2WWW A;  4PDR A;  3FAV B;  2UUA B;  4DR5 B;  5FLX N;  4UCO A;  4UCT A;  2LW7 A;  3ZRX A;  1YVW A;  5L3B A;  3U10 A;  3ZHU A;  4CH5 A;  2UXX A;  3JAL A;  2Q67 A;  4J42 A;  5LMU B;  4Q20 A;  1WB8 A;  3K9S A;  2Q4P A;  2P90 A;  4PI0 A;  1WN7 A;  3RYF B;  1XNQ B;  1OCC B;  4ZOL A;  3A0B Z;  3JAL B;  1XEQ A;  5IY5 C;  4BWA A;  1YEW A;  1NH2 D;  1N36 B;  4GKJ B;  3HKE A;  3P30 A;  1GO3 F;  2HHH O;  4LFB O;  4CH3 A;  2DJV A;  4MVR A;  3A0H Z;  3DXR B;  5EC1 C;  3H1L H;  4J9Z B;  1VEW A;  5LXT B;  1S3J A;  2EUL A;  2BTQ A;  2Q0O C;  2EIM B;  3UQ8 A;  4PEL A;  4OX9 O;  2KKW A;  4EFE A;  4A5U B;  1BGY H;  4JI0 B;  1Z2G A;  1EFR G;  4LWS B;  1Q90 D;  1VQ6 V;  2E75 B;  4CC6 A;  4DR1 O;  1I08 A;  2WSS G;  1CP9 A;  2OCC B;  4WBN B;  4MW8 A;  3W7S A;  1UPG A;  3K0G A;  1SZX A;  4I9W A;  1V54 C;  1V54 B;  3ZBH A;  3TET A;  1E1R G;  4XDL A;  1JQ0 A;  2JGD B;  5KAF Z;  2KB1 A;  1S76 D;  3E86 A;  2ZCE A;  2FTK A;  2UUC O;  1Q86 W;  4WFB V;  3E2E A;  1VF6 A;  1H8H G;  2CE4 A;  2ZXW B;  2ZIN A;  1NKD A;  3RWR D;  3G4S V;  1QR8 A;  3CCR V;  4DV7 B;  1AJN A;  1M57 C;  5A2Q N;  1N8R W;  2DOS A;  4JTC B;  1TGO A;  1T5E A;  1QU7 A;  4DR1 B;  5F2V O;  3JD3 A;  5E1A C;  1YTF D;  1PNL A;  2UXD B;  4E4E A;  1PV0 A;  4Z1V A;  3OTF A;  1THZ A;  1YIT V;  1F23 A;  3JCZ A;  1EN5 A;  1N33 B;  4JYY A;  4BR6 A;  1QLN A;  5B3S C;  3H01 A;  3L71 H;  5ITZ B;  1SER A;  4WF9 V;  3AG1 C;  5LMN B;  5DM6 V;  3W7W A;  4JYA O;  4X1K A;  1HR0 B;  4DR2 B;  3F5W C;  4YXW G;  1BMF G;  2RQ6 A;  4O2A A;  1QLE B;  2L6L A;  2DYR B;  2LO1 A;  2VQF B;  1KMI Z;  5L3G A;  2YEV A;  1K97 A;  1IX9 A;  1OCO C;  4B08 A;  5KHG A;  2GTA A;  4O2A B;  1QLE C;  2LJ2 A;  3JAT A;  3CRQ A;  3W7T A;  3K9A A;  1XQ8 A;  3SPC A;  2WLM A;  3CD6 V;  3RYF A;  4ZOL B;  2ZNJ A;  1PL4 A;  5JWP A;  3JAT B;  3H1H H;  2IM9 A;  4NVP A;  2ATK C;  1SS3 A;  3OFN G;  3SJA C;  3IGA C;  2BE3 A;  5EIB D;  3K08 A;  3HKC B;  1FFX B;  4MVS A;  3OMN B;  3CE2 A;  1K8A W;  3H1I H;  3I56 V;  4HAM A;  2V1D A;  3WG7 B;  3ZN1 A;  2Z3Y A;  2HR3 A;  3SGI A;  4TOI A;  4YHH O;  1EN6 A;  4PA7 A;  1EZJ A;  1IXM A;  4OPH A;  3AEI A;  2QWP B;  4I9Q A;  3A2F A;  3FB8 C;  4O2B B;  4X88 A;  3OM3 B;  1PM9 A;  4IYH A;  4K0K O;  1WLE A;  2DYS C;  5LOV A;  1IVS A;  4UCR A;  2B1I A;  4UV9 A;  4NTX A;  4HYO A;  1ZUQ A;  2Q73 A;  4H37 A;  1TUB A;  1IXB A;  2F95 B;  3J80 N;  2IJI A;  2HEP A;  3A8T A;  2RMK B;  1Y76 B;  1N0N A;  4U3J A;  1VQ4 V;  1HNW B;  5LHI A;  1W2B U;  1K5S A;  2IU3 A;  3BCC H;  5JCO A;  3SDL A;  4X1I A;  4GX0 A;  4L8J A;  5GTH Z;  3K5O A;  1Y76 A;  1MAB G;  1FD9 A;  1O9G A;  5IYZ B;  3BY6 A;  3GWK C;  1XNR B;  4I50 B;  1MG1 A;  1SC5 B;  1EN4 A;  1NR7 A;  1HNX O;  2JEU A;  2W0X A;  2PUS A;  3AK3 A;  4MVZ A;  4BIO A;  1G1X B;  2Q69 A;  1YXB A;  2YID A;  4DW0 A;  1ZAU A;  1DLB A;  4JI7 O;  4WFH A;  2ZNI A;  2GHY A;  1HR0 O;  3MDS A;  1VF7 A;  1BCC H;  4LNU A;  1XIL A;  1FJG B;  1S77 D;  4FZ0 A;  1KEC A;  1IZ3 A;  2YEV B;  5L3D A;  1KB9 F;  5EK0 A;  2DMX A;  3QF7 A;  1VF5 B;  4D6T H;  2DQ0 A;  1YIJ V;  2QEX V;  2CTW A;  4AI8 A;  4DRX B;  1M57 B;  5E79 Z;  1Z5V A;  3KCX A;  1XHX A;  2FL4 A;  2AGA A;  3LUT B;  3OR7 C;  2M6Y A;  1GM9 A;  4W4L A;  4TQF A;  2MW2 B;  3HKB A;  1BL8 A;  4OGQ B;  4LCU C;  1OCR C;  1WJZ A;  3CWB H;  2YXL A;  4JTD B;  1SQP H;  1ZLZ A;  2HLD G;  1PL0 A;  3IC9 A;  3HKB B;  3MD0 A;  1DF4 A;  1XMO O;  5J2T B;  3JAM N;  5LGT A;  3E8G A;  1XMQ B;  5B5E Z;  1H2M A;  4O2B A;  1R3L C;  5KA5 A;  3ZMU A;  3APO A;  3S3X A;  1L8D A;  3B8N A;  4XDK A;  3ETG A;  3ASO B;  4PA6 A;  1UJW B;  1K34 A;  3CRA A;  1FXK A;  1Q6H A;  1FPO A;  3K58 A;  2YUA A;  3FB6 C;  1WPB A;  2UXC O;  2P4V A;  1S0V A;  3OTO O;  1FXK B;  4FJC C;  5LOV B;  1Q5O A;  4WFG A;  5KUM A;  1TUB B;  4F4L A;  2BSK A;  3RFR A;  5C93 A;  4UB8 Z;  3TK1 A;  3WB1 A;  5IYC O;  2WLJ A;  3L72 H;  4LF5 B;  2X6C A;  4MVU A;  3BRC A;  4B3T O;  3K59 A;  2CTP A;  3E22 B;  1L0L H;  1NTZ H;  4WFA V;  2ETN A;  2FML A;  1OCZ C;  1Q6U A;  1XMO B;  2HKO A;  3QG5 A;  1HNX B;  3ABM C;  4DR5 O;  3B40 A;  4UVA A;  1XL6 A;  1MSD A;  4X89 A;  4HBN A;  2QM4 A;  2ZT9 B;  4NTW A;  2LGQ A;  1Q6I A;  4MTO A;  4N23 A;  2P06 A;  2EIN B;  4TV9 B;  3BA8 A;  1S72 V;  2P7T C;  4XDJ A;  2L35 A;  1HNW O;  4EEQ A;  3FB5 C;  3CCS V;  4JI6 O;  4I0X A;  4TUY A;  1AI7 A;  3T1H B;  1JJ2 U;  3JYC A;  4IL6 Z;  4JI1 O;  3RYI B;  4DV1 O;  5JH7 B;  4AIL C;  5IYD O;  3K06 A;  1R6N A;  4NXM O;  4LFA B;  1K5Q A;  4K0K B;  5JH7 A;  3LDD A;  4JI3 B;  2Z5U A;  4U3F H;  2H94 A;  3G71 V;  2DYS B;  4G28 B;  2ZM6 O;  2F4V B;  1NI8 A;  1Y74 A;  1JX9 A;  1U96 A;  4LC1 A;  4IT5 A;  1YF2 A;  4O4I B;  2PI5 A;  2AHZ A;  1I5Y A;  4DK0 A;  3IC7 A;  2RCV A;  1EM1 A;  3J7A U;  5DEC A;  1Y74 B;  1W0J G;  2V4D A;  5CBF A;  4F6R A;  3ZCC A;  4P30 A;  4TQD A;  1NR1 A;  3ABL C;  3ZX6 A;  3WB2 A;  4P2Z A;  3CS5 A;  1XL4 A;  3QTC A;  2OYQ A;  2XAG A;  1H8E G;  2B1G A;  4F6R B;  4X8A A;  1PKX A;  3GB7 C;  5CB4 B;  4B7K A;  4LF5 O;  1PPJ H;  3ZHV A;  2ODM A;  2N04 A;  2C2A A;  4N21 A;  4B3R O;  3W7X A;  3G6E V;  1VQO V;  4RWU A;  1V55 C;  5CB4 A;  1VQ5 V;  2CGN A;  1CXZ B;  4GUN A;  1WP8 A;  1V9P A;  2YDE A;  4MVQ A;  3OD4 A;  1VQ7 V;  5CBH A;  4FPP A;  2VQF O;  2RNB A;  2RN9 A;  3K03 A;  5B1O A;  1WP7 A;  3K04 A;  5B1A B;  1D5A A;  4FVM A;  1Y66 A;  1FJG O;  2ZIM A;  4CH4 A;  5LMN O;  4DO2 A;  2P4K A;  3SYC A;  2B9Z A;  3ETE A;  3CRR A;  1YJW V;  1YHQ V;  1M90 W;  3NR7 A;  4KHP O;  2M7W A;  1Y67 A;  4ZIB A;  4ZHQ A;  4X64 B;  2OCC C;  3VBB A;  2HP8 A;  4LF4 B;  1J5E B;  3ZHR A;  2JS3 A;  3M8A A;  3O65 A;  4FFB B;  4IHJ B;  2ADQ B;  4LBE C;  5HFL A;  5JJN B;  4DR7 B;  1ORQ C;  5K1X A;  1NBM G;  3NXS A;  1X59 A;  2NLJ C;  4GKK B;  1AJQ A;  2XAH A;  2QSA A;  1I5X A;  5TIS Z;  2XAQ A;  2AZ0 A;  1OJH A;  4CH6 A;  3H1J H;  1GMG A;  1WA8 B;  4Z2W A;  3JAS A;  1TAE A;  2QWN B;  1CEZ A;  2UXB O;  4CS3 A;  1YJN V;  3OMA B;  4BIU A;  4O4I A;  2F66 C;  1VQ9 V;  3UM7 A;  1ZSP A;  2EIJ B;  2XUM A;  1SKV A;  1SF9 A;  4KL1 A;  3CXH F;  4PI2 A;  2BCC H;  4NYK A;  4K8Z A;  1N0J A;  2BOC C;  4QNH B;  3CCJ V;  1NU1 H;  3CRC A;  4B3M O;  2LW1 A;  2E74 B;  2XAJ A;  2AXT Z;  1GM7 A;  2DWE C;  2B5U A;  1S5J A;  4CZZ A;  4J11 A;  3DC6 A;  2DYR C;  3ZRS A;  3RYH B;  2EX3 A;  1R3K C;  2E5L B;  2XHB A;  4O4H A;  2OIG A;  3UO2 A;  4O4J B;  2FB5 A;  1FS0 G;  1ZWI C;  5LHH A;  4CS2 A;  4GYC B;  3F7Y C;  3JD2 A;  2Z0A A;  3ETQ A;  2EZO A;  2YI9 A;  3ZMT A;  1AI5 A;  1MOF A;  1TVK B;  2P22 C;  1B3Q A;  1W59 A;  3UT5 A;  1P49 A;  2JK5 C;  1X4T A;  5LGU A;  2F4V O;  1ARO P;  4DV7 O;  4FLZ A;  1VQN V;  2XOK G;  2GUZ A;  1SQV H;  3IAY A;  3LDE A;  1BE3 H;  2IBZ H;  3U11 A;  2DQ3 A;  3ZHQ A;  2ZXW C;  4GKK O;  1XUQ A;  3ZHS A;  2ZE7 A;  1GN2 A;  2OTJ V;  2GUZ B;  1HW7 A;  3CMA V;  3OE7 G;  1FXH A;  1VQL V;  2HJF C;  1URF A;  4O4L B;  2WLL A;  5KX5 A;  1YTF B;  1VQP V;  1QVG U;  4BW5 A;  4IIJ B;  3C90 A;  3SPI A;  1RSO B;  5BR8 O;  2CUG A;  3AG1 B;  3G67 A;  2JJ2 G;  1SA0 A;  5FPO A;  1NVP B;  5FPR A;  2F43 G;  3KG2 A;  1VF6 C;  4IHJ A;  1GRJ A;  3OUF A;  3EFF K;  1M5I A;  3BAB A;  3HKD B;  1K4D C;  2JIZ G;  1MA1 A;  3OGC C;  1MMM A;  1K73 W;  4IGG A;  1AP6 A;  4YIO A;  4GZR B;  1PD3 A;  3D3I A;  1BQ0 A;  4GT1 A;  3ASN B;  3OEH G;  3CCV V;  2OWO A;  1KKD A;  4DV3 O;  1COW G;  3PJS K;  5H9C A;  1IBL B;  1WA8 A;  5H5N A;  3GVM A;  5KMG A;  5BMV B;  3ZRW B;  5IDJ A;  5IJ0 B;  3SJC C;  2R70 A;  4QGP A;  2CTR A;  4C7U A;  2KG7 A;  4G2K A;  3AG7 A;  2Y0P A;  2QKC A;  3WG7 C;  2QR4 A;  4JV5 O;  5KMG B;  3M7M X;  2DN9 A;  3U0Z A;  5L3E A;  4X20 B;  3I5D A;  1VQM V;  4BAY A;  5LP6 B;  2Q8V A;  1BT8 A;  2NN4 A;  1F4M A;  4DV6 O;  1BZK A;  3B77 A;  4B3S O;  1GN4 A;  2X6A A;  1W0K G;  2Q9L A;  1IBL O;  3VQY A;  4JI2 O;  5LBQ A;  3RYH A;  2F23 A;  3LSS A;  3ABU A;  3OEE G;  4JI8 O;  1HNZ B;  3K79 A;  1XHZ A;  1N36 O;  4BIZ A;  4O4H B;  4GKJ O;  1K9M W;  4NB5 A;  3BFR A;  2PGG A;  3CCQ V;  4LF8 O;  2ZIO A;  3X2Q B;  2WLK A;  2R9A A;  3FX7 A;  4QIW F;  2JJ1 G;  3CSX A;  2QGN A;  3AK1 A;  3CXC U;  1LUW A;  1TVK A;  1OHH G;  5J2U A;  3T4Z A;  4BW9 A;  3UT5 B;  2A0L A;  3R65 A;  2KQX A;  3E35 A;  1CPY A;  3JAW A;  4LF4 O;  5L3C A;  4RQE A;  1Y4M A;  2EIN C;  1NZ6 A;  3ZN0 A;  1SQQ H;  4YIP A;  1K92 A;  3CRM A;  3UCS C;  4WBN A;  1RP3 B;  1N32 O;  2LFS A;  4DUY O;  1GAX A;  2XT9 A;  1Y6X A;  5CBG A;  2ITC C;  1V55 B;  2AW9 A;  3WU2 Z;  2QJ1 A;  4JI4 O;  4KUM A;  1OCR B;  2LGW A;  3B4S A;  4X1Y A;  4DR6 B;  1HP8 A;  3CCL V;  1VQK V;  1SA0 B;  1KC8 W;  2IW5 A;  3HPL C;  2BTO A;  4RAI A;  4FMT A;  3CEI A;  2EZP A;  1AR1 B;  3OTO B;  3CC4 V;  3E8H A;  2CTQ A;  2GDS A;  5CA0 B;  2QWR B;  4FLX A;  5IT9 N;  4DV5 O;  4B3R B;  3ABK B;  2PYJ A;  3OUS A;  2YS8 A;  5CMU A;  3K57 A;  2X7R B;  4DV0 O;  5JCO C;  5KHJ A;  4K3A A;  5L3F A;  2EIK C;  1G6U A;  1R1B A;  1KD1 W;  1JMK C;  3TXQ A;  1FKA O;  1M56 C;  1UFI A;  4KHP B;  3AG4 B;  2FYU H;  4LP8 A;  3O9O A;  4RO2 A;  5B66 Z;  5IE9 A;  4AHC A;  5KLV H;  4LF6 O;  1FAF A;  1Q82 W;  5JQG A;  3CYO A;  2RJZ A;  4MT8 A;  5JVD B;  4B7E A;  2Y69 B;  2GSM B;  2FKX A;  3B8M A;  4LNU B;  1KKC A;  2KG7 B;  3TGU H;  4GCZ A;  3BHP A;  2AHY A;  4UCS A;  2F1M A;  4B3S B;  2D3O W;  3SYA A;  5LHG A;  5BY1 A;  5GTI Z;  2PTM A;  2OCH A;  3G6B A;  1Q81 W;  2A3Q A;  2CAZ C;  3ZS8 C;  4DR4 O;  3EHB B;  4I4T B;  1ENV A;  3SYP A;  1N4C A;  3OR6 C;  1IUR A;  5CN0 A;  3QO7 A;  2CH7 B;  1BS3 A;  1OCC C;  2QM8 A;  1SQF A;  2YXY A;  2EBO A;  3TCU A;  2ZDI C;  2D2C B;  2LFR A;  2X0L A;  1LR1 A;  4TT3 G;  2AZ2 A;  2EIK B;  2QM7 A;  3CCE V;  3D3Q A;  4LF9 B;  2ZR3 A;  4I5S A;  2X6B A;  3K5M A;  3DXR A;  2NNU A;  4FM0 A;  1ZTE A;  1ROP A;  1H2L A;  4FLT A;  3OW2 U;  5LXT A;  3HKC A;  4JI4 B;  3ABM B;  3N27 A;  4I7Z B;  2N05 A;  4JZG A;  5KHH A;  2OTL V;  3MHS C;  5DN6 G;  5J2U B;  4D7S A;  3D8C A;  1QR9 A;  3ZRV A;  2E5L O;  3LSQ A;  1KU9 A;  3SPJ A;  3P3N A;  1JPX A;  3THO A;  3DTU B;  2PF4 E;  4IYI A;  4JI3 O;  4MVM A;  1TA8 A;  1KQS U;  2QWQ B;  3VOU A;  1GH6 A;  2WA3 A;  4X64 O;  4DV4 O;  2IJK A;  3RT3 C;  4J10 A;  1VAR A;  5AG2 A;  5DED A;  2ZE8 A;  2JVD A;  4NR1 A;  3UO3 A;  4YJ3 A;  5EZY A;  4OXS A;  4DV2 O;  3T4D A;  4ZI7 A;  1GN3 A;  4Z1M G;  2PZS A;  2A7W A;  3SPH A;  2LQT A;  1IBK O;  4JI8 B;  1VP7 A;  4E2L A;  2P67 A;  1DK1 A;  4YJ3 B;  5EZY B;  2G38 A;  5EBL C;  1IBM B;  3L70 H;  4DW1 A;  4U3J B;  2NR5 A;  3CX5 F;  2Q7E A;  2MK3 A;  4X1I B;  4JYA B;  2R9I A;  3ZMS A;  1QHT A;  2IJJ A;  3CC7 V;  4UFZ A;  4DYL A;  4J80 A;  4GX2 A;  5IYZ A;  3BA9 A;  5IYB O;  5ITZ A;  3QVN A;  4PA9 A;  1WB7 A;  2QKS A;  3RN4 A;  1B04 A;  2QWO B;  2Y0I A;  3HB3 B;  4DV2 B;  3VQV A;  4JTA B;  3CME V;  1I94 B;  1WPX A;  4J7K A;  5H2F Z;  2IU0 A;  1J5E O;  4PA4 A;  3AG3 C;  4LF7 O;  2WLH A;  2HHH B;  2YIA A;  1P7B A;  1AVM A;  5LMU O;  3K3W A;  5KUK A;  2HVJ C;  3CB2 A;  1J95 A;  3STZ C;  1YCI A;  4AQY B;  1MZE A;  2PYL A;  2HFE C;  3BVO A;  4I0X B;  3S3W A;  2ZE5 A;  3CCU V;  5K1P A;  4X9Q A;  3D36 C;  2ZD9 A;  5CA1 A;  2CDY A;  4JAA A;  3SYO A;  3LSU A;  1HNZ O;  4PA3 A;  5KHI A;  1DTO A;  1RPR A;  1P84 F;  4DV0 B;  1FFX A;  2E76 B;  3KZI Z;  3FFQ A;  4GLX A;  5EBW C;  5CA1 B;  5FL7 G;  4FM2 A;  5IWA B;  4JI1 B;  3EXA A;  1ZL8 B;  1DF5 A;  2UXN A;  1N32 B;  3HKE B;  4J41 A;  1YDX A;  3RVY A;  3WB0 A;  3E8B A;  2HJD A;  4PJ0 Z;  2WLN A;  1NH2 B;  1IBM O;  2BTQ B;  1NT2 B;  4J7J A;  5EC2 C;  2YXH A;  3JSN A;  1SRY A;  3CP1 A;  4JZ2 A;  4FLW A;  2UXD O;  5HFM A;  1AI6 A;  3T1Y O;  2H3O A;  4KXR A;  1XNR O;  1SQB H;  3FB7 C;  1US6 A;  2EIL B;  4ABM A;  3ABT A;  4I55 A;  1Q43 A;  3JD0 A;  1F7Y A;  2XAF A;  5D5Q A;  1AP5 A;  5J9P C;  3OAA G;  2UUB B;  2IJH A;  2IH3 C;  1H2S B;  3RVZ A;  2BSK B;  1AJP A;  4TV8 B;  3Q4H B;  4MTG A;  2XAS A;  4H44 B;  4I55 B;  1M56 B;  4LFA O;  4CC5 A;  1I0H A;  4B3T B;  3LNN A;  2YI8 A;  1KP3 A;  4TV8 A;  1N33 O;  1F4N A;  3OMI B;  2WPD G;  4LFC B;  3E89 A;  3ZMV A;  4TWK A;  2Y4T A;  4QJF B;  4ZBM A;  3SJB C;  2UU9 O;  4LH7 A;  1K7D A;  4K8X A;  4ZKI A;  1JVM A;  4J9Y B;  1Q8I A;  1BHA A;  1LUV A;  4PV1 B;  2YIC A;  4MW3 A;  4QE7 A;  2LP7 A;  3EVK A;  1MSW D;  4DV1 B;  1JJO A;  5H6Q A;  4J7Z A;  4X1K B;  2CK3 G;  3RGB A;  4UCU A;  2ADP A;  1D5N A;  1H2N A;  2YC0 A;  3SPG A;  5EYP A;  5IJ9 B;  5JJE B;  1M4U A;  3VQW A;  5B3S B;  4JI5 B;  3SJQ C;  3VQX A;  3ETD A;  3FYI B;  1YZB A;  3CC2 V;  4DRX A;  2YIB A;  4TV9 A;  2JGU A;  4X65 B;  2JS5 A;  1RM1 B;  1R3J C;  5KAI Z;  3A0R A;  4JYB A;  4D7T A;  5LYJ A;  5EYP B;  2W0F C;  1GK9 A;  5IJ9 A;  3T1C A;  2VWK A;  1AR5 A;  1YI2 V;  2YIB D;  1F51 A;  1VQ8 V;  4UVB A;  1QQC A;  3JAS B;  4JYC A;  5LYJ B;  3T1Y B;  4PD4 F;  4LF8 B;  2ZKO A;  3ASN C;  3BEH A;  1ZL8 A;  2A06 H;  4KFM A;  4R7C A;  5J2T A;  2RDC A;  1M93 A;  3F5T A;  4PDM A;  1OCO B;  3ML0 A;  2QE7 G;  1JFF A;  3I55 V;  3AG3 B;  3RYC B;  3BAA A;  4UCV A;  2ZE6 A;  4H33 A;  3R66 A;  2A79 B;  5CA3 A;  1RM1 C;  1K33 A;  1GKF A;  2GBO A;  1JFF B;  5IWA O;  3RYC A;  2R72 A;  4AQY O;  1JA8 A;  4DR3 O;  1B06 A;  4NTY A;  3N2G A;  2O57 A;  2Y48 A;  4X62 O;  3APQ A;  2HG5 C;  1R6T A;  3CPW U;  1PNK A;  2OIE A;  1EBO A;  4JI5 O;  1KBH A;  2QDO A;  1XRE A;  2ITD C;  1YSC A;  3N2G B;  2QTO A;  1QVF U;  5A9G A;  5B1B C;  4Q6G A;  4RQF A;  3ICX A;  1NTM H;  3E22 A;  3Q4H A;  4DK1 A;  1L0N H;  2Q68 A;  1NJI W;  2HVK C;  4WFF A;  4JAV A;  3STL C;  3T2M A;  3MAQ A;  1R6K A;  2IH1 C;  2R9R B;  2UUC B;  4RUE A;  1AB3 A;  1SQG A;  3RW0 A;  1N34 B;  5C8Y A;  3ASO C;  4DUZ O;  1NS1 A;  1GM8 A;  4I50 A;  4EKW A;  2JDI G;  3F7V C;  4G27 B;  1EZV H;  3JD4 A;  4IIJ A;  3PN1 A;  3LNM B;  1MNG A;  3DSQ A;  1OZ0 A;  4QE9 A;  5C8Y B;  4L87 A;  1GN6 A;  1D2D A;  4DR4 B;  4ZHQ B;  1E1Q G;  1JR9 A;  3QO8 A;  5B1B B;  4ICG A;  2ZR2 A;  4YY3 B;  3FYE B;  2Q5Z A;  4WFE A;  4LFC O;  4HNA A;  4FK5 C;  4FM1 A;  4LH6 A;  3CCM V;  4DUY B;  3D36 A;  4FFB A;  4DUZ B;  3ZED A;  1S5L Z;  4JI6 B;  4HNA B;  4H13 B;  3FKS G;  4X65 O;  3KKY A;  3JD1 A;  1XNQ O;  2DWD C;  3JSL A;  2DW4 A;  2ZQM A;  1Q3E A;  4NXN O;  4UV8 A;  3C3S A;  2GV9 A;  3WFV A;  5BMV A;  2Q7H A;  4JF3 A;  1IDS A;  1SET A;  2EJ7 A;  2VQE B;  1FFT B;  3P3P A;  3JCU Z;  5B1A C;  2UXB B;  4X66 B;  1H38 A;  2A9H A;  4X20 A;  3DGE A;  1S5H C;  3LDC A;  3IJ4 A;  3T1H O;  1FXK C;  1O9H A;  4R50 A;  1VMG A; 
#chains in the Genus database with same CATH homology
 5DM6 V;  2EIL C;  3W7W A;  3IFX A;  4MVM A;  2PI4 A;  1KQS U;  3VOU A;  2Q6A A;  2M7W A;  3F5W C;  4YXW G;  4DXW A;  1BMF G;  2IJK A;  1JOY A;  4GX1 A;  1QLE B;  2DYR B;  2OCC C;  3VBB A;  4JPR A;  5L3G A;  1RPO A;  2YEV A;  1K97 A;  1OCO C;  1QLE C;  3AG4 C;  4OXS A;  3T4D A;  1YHQ V;  4MVO A;  2EIJ C;  1K3E A;  4Z1M G;  1L1F A;  3K0D A;  1PNM A;  5GW7 A;  3K9A A;  3W7T A;  3SPC A;  4LBE C;  3SPH A;  4MS2 A;  5HFL A;  4WCE V;  2WLM A;  3CD6 V;  1ORQ C;  1NBM G;  3NXS A;  2P67 A;  5H6R A;  4E2L A;  2V7Q G;  2YSU B;  5EBL C;  2NLJ C;  2ATK C;  1AJQ A;  3OFN G;  2XAH A;  3IGA C;  4R6Z A;  1I5X A;  3K08 A;  2MK3 A;  2R9I A;  3ZMS A;  2IJJ A;  2XAQ A;  3QNE A;  4MVS A;  5B1N A;  3CC7 V;  3OMN B;  1K8A W;  3I56 V;  4HAM A;  2V1D A;  1GMG A;  3WG7 B;  3ZN1 A;  2Z3Y A;  4GX2 A;  2HR3 A;  2EJR A;  5IYB O;  4PA7 A;  1EZJ A;  4PA9 A;  1CEZ A;  1IXM A;  2QKS A;  3AEI A;  1YJN V;  3FB8 C;  3OMA B;  4X88 A;  1YJ9 V;  4BIU A;  3HB3 B;  4UVC A;  1VQ9 V;  3OM3 B;  4JTA B;  3UM7 A;  3CME V;  1M9N A;  1WPX A;  2EIJ B;  4FIP C;  2Y69 C;  2IU0 A;  1AI4 A;  1FXV A;  4PA4 A;  3AG3 C;  1WLE A;  1GTO A;  2WLH A;  1P7B A;  2BOC C;  2DYS C;  4QNH B;  3CCJ V;  3K3W A;  5KUK A;  2HVJ C;  2BOB C;  1J95 A;  2B1I A;  3STZ C;  2XAJ A;  5EBM C;  1GM7 A;  2HFE C;  4UV9 A;  2DWE C;  2B5U A;  4CZZ A;  4HYO A;  2DYR C;  4H37 A;  4PDV A;  3ZIA G;  3ZRS A;  3CCU V;  2ZD9 A;  2IJI A;  4QPJ A;  1R3K C;  3SYO A;  3SYQ A;  1VQ4 V;  5LHI A;  4PA3 A;  1K5S A;  1W2B U;  2JEX A;  1FS0 G;  1ZWI C;  5LHH A;  2IU3 A;  1DTO A;  1RPR A;  2H8P C;  3F7Y C;  4GX0 A;  3JD2 A;  5EBW C;  5FL7 G;  1MAB G;  2EZO A;  3ZMT A;  1AI5 A;  1MOF A;  1DF5 A;  2UXN A;  1R73 A;  2QA4 V;  2JK5 C;  3BY6 A;  5LGU A;  1SZT A;  1ARO P;  1MG1 A;  3RVY A;  4U7N A;  1VQN V;  1OCZ B;  1TUE B;  1NR7 A;  2WLI B;  2XOK G;  2P6J A;  1QBZ A;  3E8B A;  2JEU A;  3LDE A;  2WLN A;  2XND G;  1BHB A;  1NH2 B;  3AG2 B;  4MVZ A;  2DQ3 A;  2ZXW C;  4HZ3 A;  2Q69 A;  2WAM A;  4P9P A;  5EC2 C;  2WLI A;  1NVP D;  2OTJ V;  1P4R A;  1SRY A;  3CP1 A;  3CMA V;  1DLB A;  2K1E A;  3OE7 G;  1FXH A;  3UKM A;  1VQL V;  2HJF C;  3E83 A;  4WFH A;  4XBF A;  2WLL A;  5HFM A;  2GHY A;  1AI6 A;  3QO5 A;  1YTF B;  1VQP V;  1E79 G;  4BW5 A;  1QVG U;  2EIM C;  4RUF A;  4TSF G;  3SPI A;  3AG2 C;  1S77 D;  1KEC A;  3FB7 C;  4MSW C;  2EIL B;  3AG1 B;  2JJ2 G;  2YEV B;  1NVP B;  5L3D A;  3ABT A;  1LNQ A;  2F43 G;  5EK0 A;  3KG2 A;  5KA6 A;  3JD0 A;  1G4Y B;  1KP2 A;  2XAF A;  3EFF K;  1NQT A;  2DQ0 A;  3OUF A;  1YIJ V;  4MTX A;  3M99 B;  2QEX V;  5J9P C;  1K4D C;  1M57 B;  2JIZ G;  3OAA G;  2IJH A;  2IH3 C;  3OGC C;  3RVZ A;  1K73 W;  1AJP A;  3LUT B;  5IY5 B;  4MTG A;  2XAS A;  4JAS A;  3OR7 C;  1GM9 A;  4MTF A;  4UUJ C;  1M56 B;  1BL8 A;  1R3I C;  4LCU C;  1OCR C;  1PD3 A;  3D3I A;  4GT1 A;  4JTD B;  1KP3 A;  3ASN B;  3OEH G;  3CCV V;  1KKD A;  3ABL B;  1F4N A;  3OMI B;  1COW G;  2HLD G;  3PJS K;  5H9C A;  1PL0 A;  2WPD G;  3E89 A;  1SES A;  3ZMV A;  4TWK A;  3MD0 A;  4QJF B;  3ZMZ A;  4ZBM A;  1DF4 A;  2W6I G;  3ZRW B;  1H2G A;  5LGT A;  3E8G A;  4UXN A;  5IDJ A;  1K7D A;  4KP4 A;  1R3L C;  5KA5 A;  3X2Q C;  4ZKI A;  3W7U A;  1JVM A;  3ZMU A;  1QCE A;  4J9Y B;  4XDK A;  3B8N A;  4G2K A;  1BHA A;  3ETG A;  3ASO B;  1Q7Y W;  4PA6 A;  1UJW B;  3WG7 C;  4PDL A;  1K34 A;  1FXK A;  4QPK A;  4U7O A;  4MW3 A;  4QE7 A;  1K4C C;  2LP7 A;  2WLL B;  4CBC A;  5L3E A;  3FB6 C;  1MSW D;  1VQM V;  4BAY A;  1B6Q A;  5H6Q A;  1S0V A;  4ASU G;  2CK3 G;  1HWY A;  4GX5 A;  1FXK B;  4FJC C;  1F4M A;  1G8M A;  3SPG A;  3B77 A;  4P9O A;  2X6A A;  3MHH C;  4WFG A;  1W0K G;  5B3S B;  3SJQ C;  3ETD A;  3FYI B;  5KUM A;  3CC2 V;  3E8F A;  1RM1 B;  4R8C A;  4F4L A;  1R3J C;  3A0R A;  4JYB A;  5LBQ A;  1JCH A;  2W0F C;  1GK9 A;  3ABU A;  3LSS A;  3OEE G;  3P32 A;  5C93 A;  3K79 A;  3TK1 A;  3T1C A;  5LGN A;  2WLJ A;  5IYC O;  4BIZ A;  1YI2 V;  1K9M W;  4JAU A;  2X6C A;  4MVU A;  1F51 A;  3CCQ V;  1VQ8 V;  4UVB A;  4JYC A;  3X2Q B;  2WLK A;  3ZJZ A;  4QIW F;  2JJ1 G;  2OT5 A;  1M1K W;  2W6J G;  3CXC U;  5BZB A;  3ABK C;  4WFA V;  3ASN C;  3RBZ A;  1OHH G;  3BEH A;  3T4Z A;  4KFM A;  4R7C A;  2A0L A;  3R65 A;  3E35 A;  1CPY A;  3ZRW A;  2ZDI A;  3GWO A;  4JGS A;  1OCZ C;  5L3C A;  4RQE A;  1Y4M A;  4PDM A;  1OCO B;  2HKO A;  3ML0 A;  2EIN C;  2QE7 G;  3I55 V;  3AG3 B;  3ZN0 A;  2WWW A;  4PDR A;  1K92 A;  4H33 A;  2A79 B;  3ABM C;  3ZRX A;  5CA3 A;  5L3B A;  1RM1 C;  1K33 A;  2LFS A;  1GKF A;  4UVA A;  1XL6 A;  4X89 A;  5CBG A;  2ITC C;  1V55 B;  2UXX A;  2Q67 A;  4Q20 A;  2Y48 A;  4KUM A;  1OCR B;  2HG5 C;  4MTO A;  4N23 A;  1PNK A;  3CPW U;  2EIN B;  2P90 A;  1S72 V;  1EBO A;  3CCL V;  1VQK V;  2P7T C;  4XDJ A;  1KC8 W;  1OCC B;  2IW5 A;  3HPL C;  4RAI A;  4FMT A;  5IY5 C;  1AR1 B;  2EZP A;  2ITD C;  3CC4 V;  1YSC A;  3FB5 C;  3E8H A;  2QTO A;  3CCS V;  1QVF U;  1JJ2 U;  1AI7 A;  1NH2 D;  3JYC A;  5B1B C;  3ABK B;  4RQF A;  3OUS A;  3P30 A;  1GO3 F;  5IYD O;  5CMU A;  3K06 A;  2Q68 A;  1NJI W;  2HVK C;  2X7R B;  4WFF A;  4MVR A;  4JAV A;  1R6N A;  3STL C;  3T2M A;  5EC1 C;  2EIK C;  5L3F A;  1KD1 W;  4J9Z B;  1R6K A;  1S3J A;  1K5Q A;  1M56 C;  2IH1 C;  2EIM B;  3LDD A;  4PEL A;  2R9R B;  3AG4 B;  2Z5U A;  4LP8 A;  2H94 A;  1EFR G;  4RUE A;  3G71 V;  2DYS B;  4G28 B;  1VQ6 V;  4RO2 A;  3RW0 A;  2PI5 A;  1JX9 A;  4LC1 A;  3ASO C;  1Q82 W;  2AHZ A;  1I5Y A;  2WSS G;  1CP9 A;  2OCC B;  3CYO A;  3IC7 A;  4MT8 A;  1GM8 A;  4EKW A;  2JDI G;  3F7V C;  4G27 B;  2Y69 B;  3JD4 A;  2GSM B;  3B8M A;  3LNM B;  4MW8 A;  3W7S A;  3K0G A;  1W0J G;  1OZ0 A;  4QE9 A;  4I9W A;  1V54 C;  5CBF A;  4GCZ A;  1V54 B;  2AHY A;  4L87 A;  3ZCC A;  3TET A;  1E1R G;  3SYA A;  2D3O W;  4XDL A;  4P30 A;  1JQ0 A;  5LHG A;  1S76 D;  2KB1 A;  1E1Q G;  3E86 A;  1NR1 A;  3ABL C;  3QO8 A;  1Q81 W;  5B1B B;  4P2Z A;  2FTK A;  1XL4 A;  2ZR2 A;  3FYE B;  1Q86 W;  3EHB B;  2XAG A;  1H8E G;  4WFB V;  1ENV A;  2B1G A;  4WFE A;  3E2E A;  3SYP A;  1H8H G;  4X8A A;  3OR6 C;  4FK5 C;  5CN0 A;  3QO7 A;  3CCM V;  1PKX A;  1OCC C;  2QM8 A;  2ZXW B;  3GB7 C;  3D36 A;  1NKD A;  2C2A A;  2EBO A;  3TCU A;  4N21 A;  2ZDI C;  3G4S V;  3W7X A;  1QR8 A;  3G6E V;  3CCR V;  1AJN A;  1M57 C;  2LFR A;  2X0L A;  1VQO V;  4TT3 G;  1N8R W;  2EIK B;  4JTC B;  2QM7 A;  3FKS G;  3CCE V;  1V55 C;  3JD3 A;  1VQ5 V;  5E1A C;  2ZR3 A;  3JD1 A;  4I5S A;  2X6B A;  1YTF D;  1PNL A;  2DWD C;  2NNU A;  2DW4 A;  2ZQM A;  1ROP A;  1THZ A;  4UV8 A;  4MVQ A;  3OW2 U;  1VQ7 V;  3WFV A;  1YIT V;  1F23 A;  5CBH A;  3ABM B;  4JF3 A;  4FPP A;  3JCZ A;  3K03 A;  5B1O A;  1SET A;  2OTL V;  3MHS C;  5DN6 G;  1FFT B;  1QLN A;  3K04 A;  5B1A B;  5B3S C;  5B1A C;  3H01 A;  1QR9 A;  3ZRV A;  1SER A;  3LSQ A;  1Y66 A;  3SPJ A;  1H38 A;  2A9H A;  4DO2 A;  4WF9 V;  3DGE A;  1S5H C;  3LDC A;  3SYC A;  3ETE A;  1YJW V;  1FXK C;  4R50 A;  1JPX A;  3AG1 C;  3DTU B;  1M90 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...