2EZOA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezoA00
4JF3A 4JGSA 1F23A 1EBOA 1Y4MA 1ENVA 3MHHC 4FIPC 1Y66A 1DF5A 1QBZA 3B8NA 2EBOA 5CN0A 3P30A 4E2LA 1SZTA 3CP1A 5KA5A 5CMUA 1QR8A 1MG1A 2EZPA 2M7WA 4JPRA 1MOFA 2EZOA 3K9AA 3WFVA 1DF4A 2OT5A 1JQ0A 1I5YA 5KA6A 3GWOA 1I5XA 3H01A 4FJCC 1JPXA 2LP7A 4FK5C 4N23A 5H9CA 1K34A 2X7RB 4G2KA 3M99B 5HFMA 3MHSC 3B8MA 2MK3A 2P6JA 1QR9A 3CYOA 5HFLA 1QCEA 1K33A 3B77A 4N21A 1DLBA
chains in the Genus database with same CATH superfamily
3JAWB 4JTAB 3K5OA 2R9AA 1N34B 1AI4A 5LMNB 4B3MO 3RYFA 5LOVB 4R6ZA 1RSOB 4AILC 4CS3A 4TUYB 3ABKC 4K8XA 5BR8B 2DW4A 2EINB 1XHXA 1AR5A 1HNZB 3GVMA 4IGGA 4K3AA 3STLC 4JAVA 4DV6O 4WFFA 1Q6UA 4B3TB 5B1OA 1VQNV 4CS4A 5CA1B 1Q7YW 1IBLO 2F95B 4NXNO 1V54B 5CMUA 1GMGA 2AHYA 1IBMO 3JARB 3SPCA 1SERA 2HR3A 2ETNA 3GWKC 3A0HZ 3DTUB 4D7SA 2A79B 2HP8A 2OTJV 4Z2WA 5CB4A 1K5SA 1OCRB 3E8HA 1Q3EA 1AR1B 4HNAB 1RP3B 2A3QA 4HAMA 4I0XB 5IYBO 3BEHA 1GN4A 3AG7A 4OPHA 3IFXA 3M99B 1QR9A 3BAAA 5H6QA 4I4TB 1M57C 2WLLA 4H44B 4NKGB 1X4TA 4Q6GA 3D3IA 3HPLC 1WJZA 2P06A 1NR7A 2ZE5A 1WA8A 4O4LB 3ZHQA 3CE2A 1GM8A 5KA5A 2XOKG 2V7QG 4EB6A 4GUNA 3LDDA 2LW1A 3LSUA 4EFEA 2R9IA 4CBCA 2IH3C 5GONB 1XOUA 2BTQB 2QM4A 2IBZH 2KB1A 3K5MA 1DLBA 3AG1C 2P7TC 4DV4O 4OXSA 1YVWA 2PY5A 3OTFA 4F6RB 2UXDB 1COWG 5L3EA 1FFTB 4DV2O 4OX9O 2QR4A 2F43G 3UT5A 2JK5C 5FNVA 1FJGO 4WF9V 4LF5O 2JGDA 2WLNA 5LHHA 3OAAG 4KFMA 2VS0A 3THOA 3KCXA 4U3JA 4JI8B 5JQGA 2YICA 2GHYA 2EBOA 2AXTZ 2OCHA 1SA0A 3RYHB 1TGOA 4GYCB 4QPKA 3RBZA 2ZD9A 5IJ9B 3RFRA 5KAFZ 5J2TA 2RCVA 3BCCH 3FB7C 1S77D 1S3JA 2Y0PA 1YF2A 4JZ2A 2K1EA 3H1IH 5JWPA 4NB5A 3OE7G 5B1NA 2ZR2A 3CJHB 4ZI7A 5IT9N 1YZBA 4YY3O 3JAMN 2VQFO 2KG7A 1Z5WA 3VBBA 4DV0B 2AW9A 3RYCA 4RQFA 3CC7V 2G38A 1P84F 3EXAA 4LFAO 4X64B 5BXZA 4DR1O 2JS3A 3AK2A 2GUZA 5JCOC 5LP6C 5L3DA 3AG2B 3ASNB 3RT3C 1A32A 2EILB 1NU1H 3LNNA 1AJQA 5LOVA 2B1GA 3JATA 4LR3A 1N32O 1VQ7V 2Y4TA 2CGOA 2P67A 4J10A 3AK1A 4FFKA 3UM7A 4H13B 3VQVA 2LFSA 3WB1A 3OFNG 3MD0A 2KQXA 3DXRA 3PN1A 5H6RA 2R72A 1YDXA 3IC7A 4WCEV 1DF4A 3EFFK 4Z1VA 3D36C 2DJVA 2A7WA 3OR6C 4G28B 3J81N 5D5QA 2QWRB 2YIBA 3D3QA 2ITCC 1TUBA 5LA6A 3ETQA 3WB0A 1E1RG 4JF3A 4FLTA 3CD6V 3SJBC 2GV9A 1SQXH 4IIJB 3CB2A 2BSKA 4HNAA 5H5NA 2X6BA 2A9HA 5JVDA 4I50A 3JD0A 1E1QG 4DK1A 1R6KA 4LF6B 1IXMA 3I5DA 3K08A 1YJNV 3TXSA 4FZ1A 3S3WA 4J7ZA 2HJFC 3AG3C 2Q0AA 2JIZG 3FB5C 2BE3A 1GAXA 4DV7O 1QNMA 3DC5A 4IHJB 1V55C 4IT5A 1XREA 3ZMZA 1SF9A 1BCCH 5A9GA 1NKDA 1QVGU 2L35A 4FLUA 1IXBA 4DO2A 3F5WC 2V1DA 1F4MA 2Q7EA 3C90A 4JI4B 3N2KA 1ZL8B 4GX1A 5AG2A 4X88A 4DW1A 2HKOA 1G1XB 3K0GA 1M5IA 3D8CA 1HNXO 4DR5B 2F4VO 2W0FC 4WFBV 1LR1A 1U97A 4U7OA 4DR5O 1CPYA 3CEIA 4K0KO 2E5LB 2WA4A 3RYIA 1AJPA 4O4JA 1WPBA 1SZXA 3LUTB 4DR3O 1XHZA 5IYZB 4BAYA 1K34A 2QTSA 1H2SB 1B6QA 5BMVB 5LMUB 3CCVV 3IGAC 4LWSB 4O4HA 3CS5A 1QBZA 3ML0A 3TK1A 2CH7B 3U0ZA 3E8FA 1PKXA 4TV9B 4TQDA 1K9MW 3ASOB 3Q4HB 4DW0A 1KECA 2UXBO 2V4DA 2LP7A 2QJ1A 2DYRB 3ZMSA 1EN4A 3I55V 1XI1A 4KHPB 4K35A 1RM1C 2LGWA 1UPGA 1O9HA 3F7VC 4PI0A 4FM0A 4RO2A 1PM9A 4TWKA 3ZHUA 3KZIZ 5A2QN 5KHKA 4GKJO 4MW3A 2OIEA 2YIDA 1W0JG 4PJ0Z 3T4DA 5GTIZ 2ADPA 2N04A 5E79Z 1L0NH 2YEVB 2D2CB 4U3FH 1VQMV 1AILA 3B09A 1GRJA 3DC6A 2ZDIC 1BE3H 4LCUC 3ZEDA 1PPJH 1F51A 2YI9A 3FB8C 4MVRA 2E3CA 1EN6A 4E2LA 3FFQA 5IY5B 2F66C 3SYPA 2OYQA 5K1PA 1JQ0A 2LFRA 1NH2D 3ZN0A 3FYIB 4I5SA 3OEHG 3BPZA 1N33O 4DUYB 2Q9LA 1JA8A 2VRZA 2JJ1G 2Q73A 3OUFA 2YXLA 1ORQC 1JCHA 5TISZ 4JI2B 2IJIA 1T5EA 2EIMB 2QKAA 3P3PA 1Q8IA 4O4IB 2B9ZA 1G6UA 1Y67A 4XBFA 2IU0A 1XILA 1SQPH 1XUQA 3CCLV 4B3RO 2PYLA 1IURA 1VQ5V 4FLVA 2DWDC 3E22A 3VQXA 5F2VO 1IX9A 1NT2B 3UO3A 3ZIAG 3WFVA 2EIKB 2EJRA 3ZHSA 1FXKC 2WLHA 3AG4C 3AK3A 5HFMA 3ZJZA 3ZRWA 1P49A 3JD1A 5J2UA 1BS3A 4QPJA 1SKVA 1M57B 5IE9A 3K9AA 4LFBB 3LDCA 1WP7A 3QF7A 2AZ2A 5JH7A 3T1YO 5E1AC 4NYKA 2XTAA 3ZHVA 1I08A 4IYHA 4RAIA 1FAFA 4UCSA 3FAVA 4LF8B 4X66O 4JI1O 3P30A 2H3OA 4X1YB 1K92A 3AG1B 4UV8A 2QKSA 4X62O 2OT5A 3JALB 4N23A 3HKDB 2CTWA 2MK3A 3CYOA 1IBKB 4PDVA 4ICGA 4LC1A 3E8GA 3HB3B 4JYYA 1DF5A 3BY6A 4O2BA 2D3OW 1KKCA 4DRXA 5KMGB 3G71V 1R6NA 2ZIMA 3JASB 3A0BZ 4HZ3A 4JI7B 5KHJA 2FYUH 3N2GA 1G8MA 4LF9B 3HKEB 2AGAA 2UUAO 2DYSC 2GTSA 1Z5VA 1XNQB 4JI5O 1XMQB 1XNRB 5EZYA 3H1KH 2WAMA 5IYDO 1VF7A 2NN4A 1QVFU 1N34O 5H2FZ 2PGGA 1P7GA 3MAQA 3WU2Z 1MNGA 5LMNO 3K04A 1JMKC 2IH1C 3C3TA 3ZRSA 5H9CA 1TVKA 4JZGA 3CC2V 1KP3A 4EKWA 3BABA 3ABUA 1K33A 5BR8O 3T4ZA 5LHGA 2IW5A 1GH6A 3IC9A 1HNZO 4TQFA 4PHZA 3JD2A 4Z1MG 4B3TO 2UXXA 4I9WA 3T1HB 1PP9H 3ABTA 5LP6B 4X20A 3OGCC 4FLYA 3B8MA 4R50A 5L3FA 1QCEA 4GT1A 1Q82W 4JASA 2QWPB 3B2EE 5L3BA 1Y74B 4YJ3A 5LL6Y 2HVKC 4DUZB 1Q86W 2BOBC 3K5LA 4LBEC 2EZPA 1GN3A 3M7MX 1M1KW 1HNWB 1Q6IA 4UCTA 3J7AU 3K06A 4FFBA 4UCVA 1KC8W 2RNBA 3JD4A 1S76D 1SETA 1DTOA 2RN9A 3JYCA 3L70H 5EIBD 1B04A 4JTCB 1Y66A 5IDJA 5LGNA 1N36B 2CGNA 2OTLV 1BMFG 3U11A 4FLWA 2CTQA 1BT8A 1G4YB 2Y69B 5K1XA 4GX2A 2A0LA 2W6JG 5C8YA 4YJ2B 4QE7A 3H01A 5FL7G 4PDMA 2ZE7A 3EVKA 3RN4A 3OEEG 4DR4B 4QGPA 4ZKIA 5LHIA 2L6LA 1IZ3A 4ZHQB 2IJKA 4J42A 4DV1B 1WN7A 2XASA 1NTMH 1N0JA 2KSDA 1KQSU 3KCYA 2UXDO 3NXSA 2YDEA 4MTOA 3AG3B 2NR5A 4L87A 5EYPB 2RDCA 2DOSA 4GX0A 2GBOA 1KBHA 2UUCB 1H38A 2Y0IA 2ZCEA 2N05A 4JI8O 1K73W 1Q43A 3BVOA 3OGIB 2PZSA 2DE0X 3L75H 5KX5B 3E89A 2C2AA 2EULA 2UU9B 2E74B 4JAUA 3SR2C 1WLEA 1XBLA 1EM1A 1M56C 1JOYA 1IDSA 2ZE6A 3J80N 2B1IA 3L9DA 3ABLC 3P32A 4OPAA 3IAYA 5C93A 3HKBA 4PA9A 2Q7GA 4DR7B 1KKDA 2X6CA 4UVBA 1GTOA 4JI0B 3BHPA 5JJEB 4AQYB 3RGBA 2DMXA 4DV0O 3ETGA 3LDEA 3TETA 4UB8Z 1YHQV 1ENVA 1ZSPA 1R3IC 4X64O 2WLKA 5CN0A 1BQZA 4P2ZA 3SPGA 3JAWA 5GW7A 1XDCA 2FMLA 2Q67A 1H8HG 5DM6V 2PI4A 2WLMA 4JYBA 4Q20A 4UV9A 4UUJC 1YIJV 1OCZC 1FYJA 1EN5A 1RSOA 4X1IB 4PELA 1VQ6V 4RQEA 3AEIA 1FD9A 4TUYA 1V54C 2UXCB 1RPOA 1MZFA 5LXTB 5EIBC 3OMNB 1RM1B 3MDSA 1X59A 3CSXA 5IJ0B 2ADQB 1KYOF 4G27B 4LNUB 3G80A 1KP2A 3K79A 3TXQA 2DN9A 5CA1A 3T2MA 5LYJB 5LGUA 4CS2A 3JARA 4IL6Z 1SQFA 1AP5A 1W59A 1EFRG 4MVZA 1GKFA 3H1JH 2IM9A 2CK3G 4CC6A 2X6AA 4I0XA 3BA8A 1YI2V 3TGUH 1R3KC 1SQGA 2ZM6B 2ITDC 2ATKC 3QO8A 1BQ0A 2XT9A 4LFCB 5HFLA 1R3LC 3ZS8C 4LF6O 4UVCA 4I4TA 2WLJA 3JD3A 3CHXA 2E75B 3FD9A 4J9ZB 2WLIB 3QO5A 3TCUA 4O4LA 4DV3B 4P9OA 1K97A 2P6JA 5DECA 1KMIZ 2M6YA 2ZR3A 1BSMA 5ITZB 1FXVA 1WAZA 5GONA 1R3JC 2BTQA 3K58A 4O2AB 3SYCA 1YEWA 3APQA 4DR6B 5BZBA 4PDRA 4JI3B 4X1KB 4NVPA 1VIBA 4F6RA 4YHHB 4JI4O 2XUMA 1FXKB 3AG4B 3JAKB 4CH4A 3LSSA 4J7JA 3OMIB 5CBHA 2R70A 2E5LO 3UO2A 3K57A 1K3EA 1NS1A 2Q69A 3CCQV 4FK5C 2YUAA 4B3SB 2YIAA 1WB8A 2YSUB 1NTZH 4UCUA 3RYHA 3QVNA 3OW2U 1VQLV 1GN6A 2ZIOA 5B3SC 5LMUO 1K8AW 4LF7B 1OCOC 5IJ9A 3R66A 5CBGA 1Y76B 4LH6A 1AI6A 2OIGA 5KAIZ 4WBNB 1JX9A 3A8TA 1NJIW 1YTFB 2PTMA 1Q81W 2YC0A 1FKAO 4JYAB 3CJHA 4X65B 1FFXB 1S5JA 1V9PA 4MTFA 1D5NA 1OJHA 2EILC 1YTFD 1US6A 3E86A 3SPJA 4TV8B 4KHPO 1SS3A 4GKKB 3UQ8A 2P22C 3K9SA 3ZHRA 5CA0B 3SGIA 2EIJB 4XDLA 4G2KA 2HHHB 3OMAB 2JRIA 2YXYA 2NLJC 2CE4A 3RYFB 2HFEC 1NH2B 1AJNA 3VQWA 3G6EV 1H2NA 2DYSB 1M9NA 2WSSG 1ZTEA 4JPRA 1CXZB 3CRCA 1W2BU 1MABG 3SPIA 4MSWC 2YS8A 4J80A 2QWQB 3ZRVA 2XHBA 2P4KA 3CRMA 3ABKB 4J7KA 4PA7A 1PNMA 4J9YB 5B1AC 4DUYO 3B8NA 2W0XA 4UCRA 4PV1B 4I55B 4JV5B 4MVQA 2JGUA 3M8AA 4IIJA 3VOUA 1JPXA 4JI2O 3A0RA 5CB4B 4ZOLB 3CPWU 1HR0B 1P4RA 1JVMA 2P5OA 3ZMVA 1TAEA 4KXRA 5JJNB 1ZAUA 1OCCC 4WFAV 3BA9A 1Y6XA 2FTKA 2CAZC 3KKYA 4CH6A 2LO1A 4CC5A 2Z5UA 1I5YA 1CEZA 2JS5A 2WLLB 3CCMV 4PDLA 3E2EA 1N4CA 2F23A 2EJ7A 2GTAA 4AHCA 4LF4B 2UUBB 3ZBHA 1WA8B 4ZBMA 1YJ9V 4WFEA 2KKWA 1KU9A 4X9QA 5CA3A 4EFBA 3UCSC 1J5EB 4UVAA 2ZT9B 1XEQA 4DR2B 5IWAB 4E4EA 4IHJA 2DQ3A 3CP1A 2YXHA 1MG1A 5CBFA 3LNMB 1GM9A 1BHBA 3K03A 2ARHA 1AROP 5EBLC 4BIOA 2DQ0A 4LFBO 2Z0AA 1SQQH 2F1MA 3QG5A 2N74A 1ZL8A 3BFRA 2LGQA 4JI6B 1VP7A 1ZX3A 1BHAA 2HEPA 3JCZA 3SJAC 3BRCA 3ZHTA 1MSWD 4QJFB 1PNLA 1EZJA 3UT5B 3X2QC 5FNVB 4LF8O 1K7DA 2FB5A 3ZCCA 3K5NA 1PD3A 2JGDB 2Q4PA 4FLXA 3K3WA 4FZ0A 4DV5B 4U3JB 1M90W 4MVOA 5JQGB 5IYZA 5BMVA 3DGEA 3QO7A 3OTOB 1IBKO 1THZA 1SA0B 2JJ2G 4X89A 4EEQA 4FVMA 2DYRC 4LWSA 4U7NA 2FL4A 1S5HC 1AP6A 1HW7A 3S3XA 2CH7A 5J2TB 4GCZA 4TV9A 2VQEB 4JI7O 3H9VA 3Q4HA 4F4LA 2QWNB 3ICXA 2JEUA 4LF9O 1I94B 1HP8A 1OZ0A 3W7XA 1I7FA 1GK9A 1YSCA 4ZI7B 4H0LB 1XNQO 2OCCC 1FXHA 4UB6Z 2XAQA 4X8AA 4NXMB 1XMQO 2M7WA 1XNRO 3RYCB 3ABLB 1NBMG 4JYCA 1XMOB 1O9GA 2VWKA 2O57A 2GUZB 1L1FA 5D5PA 2R9RB 4HBNA 2QGNA 2YEVA 4B08A 5IYCO 4DK0A 1K5QA 2UXNA 5IY5C 1PV0A 1Y4MA 4B3MB 4RUEA 2LW7A 2P90A 4TSFG 1PL4A 2Q6AA 3N27A 3JATB 1MZEA 4GX5A 2JDIG 3CWBH 3PJSK 3T1HO 2QE7G 3RVZA 5KHGA 4HYOA 3OM3B 1YJWV 2Y48A 5KUMA 4DV6B 3DXRB 4JGSA 1OCZB 2EIMC 2XNDG 5FPRA 1N8RW 4W4KA 1IBLB 4NXNB 1DK1A 1SC5B 3G4SV 1KUQA 1S0VA 1SRYA 1SZTA 1XL6A 1IBMB 3CXHF 2EX3A 1ZUQA 1TUBB 4DUZO 1WNSA 5LA6B 2P4VA 1HNWO 4I55A 2FKXA 5DN6G 1SQVH 4H37A 1AI7A 3H1LH 4MTGA 3WG7C 4O4IA 4ZOLA 2BSKB 1D2DA 2YIBD 3C3SA 2EIKC 2CTPA 1XL4A 4BWAA 1QLEC 3F5TA 5JVDB 4I50B 1VQ8V 1FPOA 1N36O 1GN2A 1Q6HA 2IJJA 3ABMC 2PF4E 1VQKV 1VEWA 4BW9A 1WPXA 5B1BC 1VQ9V 2MW2B 4DR4O 4FIPC 4QNHB 2WWWA 4DV1O 2PI5A 2CDYA 3T1CA 1SQBH 4FM1A 4P30A 3STZC 2QDOA 4PA4A 4D6TH 2QSAA 1GO3F 2ILMA 2QKCA 4I7ZB 4BIUA 2AZ0A 4D7TA 2QM8A 3W7TA 4DV4B 1S72V 1HWYA 2E76B 1ZLZA 2QTOA 2Z3YA 2QWOB 1MMMA 3N2KB 1W0KG 4DV2B 2UUCO 4OX9B 1JR9A 1V55B 1FJGB 4FPPA 4LF5B 5KHIA 2ZXWC 4X1YA 3B4SA 3CCEV 1YITV 4DYLA 1WB7A 3O9OA 4CH5A 3OT7A 3JALA 1WP8A 3RYIB 3HKCB 2UU9O 4O4JB 3HKDA 3OUSA 5B66Z 1I0HA 2ZNIA 4ZIBA 1AR4A 1D5AA 2HLDG 1BZKA 4B7EA 3FKSG 5KMGA 4O4HB 4DR7O 3CRQA 4JI0O 3JASA 4UCOA 3GB7C 5J9PC 4AQYO 1AVMA 2A06H 4J41A 3JSLA 1VF6C 2XAHA 3SJQC 3HKEA 3DSQA 5B3SB 2EINC 3L73H 1M93A 4YY3B 1OCOB 2VQFB 1MOFA 1K4CC 5EK0A 1F7YA 1M4UA 4YXWG 1H8EG 3GWOA 3RVYA 3SYAA 4CZZA 5BY1A 4LFAB 1VF6A 4LP8A 4DR1B 5LGTA 4MW8A 2H8PC 2LJ2A 1N0NA 4NTWA 2UXCO 4QE9A 5L3CA 3SDLA 3L74H 2DWEC 2LQTA 3I56V 5DEDA 1H2MA 1NI8A 2B5UA 3F7YC 1N32B 1NTKH 4PA6A 1OCRC 3EHBB 3P3NA 5JCOA 5LP6A 3B77A 1PL0A 1UJWB 3OR7C 1JJ2U 1EZVH 1Y74A 1OV9A 1QHTA 1IVSA 2H94A 3UKMA 4RWUA 4GZRB 1LNQA 1ROPA 1TA8A 3W7WA 3HR0A 4N21A 1SESA 4L8JA 2ZM6O 2Y69C 3CMAV 2PUSA 4RUFA 3CCUV 3CXCU 3R65A 1JJOA 4LFCO 3D36A 1NZ6A 3G67A 3LSQA 2AHZA 2HVJC 3KG2A 5B1AB 1E79G 4R7CA 2X7RB 2Q68A 3MHSC 5KHHA 4OGQB 4DV3O 3E22B 4YJ2A 1MSDA 3JSNA 1YXBA 4NTXA 4K8ZA 3U10A 4XDJA 3K59A 1VQPV 1H2KA 3ZX6A 3FYEB 4TT3G 1OCCB 3CRAA 1B06A 4NTYA 4ZHQA 1HDJA 1VMGA 3ZRWB 5KA6A 4DR6O 2Q8VA 3ZMUA 4DV7B 1J95A 4YIPA 5J2UB 1H2LA 4PA3A 4JI3O 5FPOA 5B5EZ 1QQCA 4YHHO 2QA4V 1NR1A 5LBQA 3CMEV 1FS0G 5EYPA 1YCIA 2ZINA 1TUEB 4R8CA 5JH7B 2GDSA 3FX7A 1NQTA 4FMTA 1HNXB 2F4VB 1NVPB 4B3SO 3FAVB 5KX5A 4QIWF 4W4LA 3G6BA 4K0KB 1JFFB 2RQ6A 2Y4UA 4IYIA 1R6TA 3HKCA 4LF7O 1NVPD 1K4DC 4DR3B 2RMKB 3E8BA 4C7UA 2JVDA 2WPDG 4FJCC 1LUWA 4MS2A 3X2QB 4DXWA 3APOA 3SYOA 4O2BB 4MVSA 2ODMA 4DRXB 2QM7A 4JYAO 3AG2C 3ASNC 4X65O 2XAFA 3MHHC 3CRRA 2RJZA 2IU3A 4BW5A 3ZRXA 2UXBB 4MVMA 3N2GB 4GKKO 5FLXN 4I9QA 1VQ4V 4PI2A 2HG5C 5EC1C 4NR1A 4J11A 2W6IG 2Q0OC 2HHHO 5EZYB 1URFA 4A5UB 1U96A 1H2GA 1EBOA 4X1IA 4GKJB 2ZKOA 3QTCA 2PYJA 1MA1A 5EC2C 2X0LA 1BL8A 1B3QA 1TVKB 2K9PA 1LUVA 2WA3A 3QNEA 3RW0A 5LXTA 1I5XA 4YIOA 5GTHZ 2OCCB 3ZMTA 5IJ0A 3H1HH 4LNUA 4MVUA 2Q7HA 1L0LH 5LYJA 2NNUA 2ZNJA 1Q5OA 4GLXA 4X20B 2QEXV 4B7KA 2ZDIA 4JV5O 1N33B 1Z2GA 5L3GA 4WFGA 4YJ3B 3ETDA 5KLVH 4ASUG 1HR0O 4UXNA 1UFIA 1VQOV 3A2FA 3SJCC 4FFBB 3JCUZ 4FM2A 2EZOA 4WFHA 3O65A 5EBMC 4TOIA 3CCRV 2XAJA 4B3RB 4P9PA 3VQYA 2WLIA 2BOCC 1L8DA 3ETEA 2CTRA 1Q90D 1R1BA 2IJHA 4LF4O 3L72H 2UUBO 5C8YB 4EB6B 3TJTA 1PNKA 3WG7B 5ITZA 2F93B 4F6EA 1OHHG 1KD1W 1J5EO 1AB3A 2YI8A 5IWAO 4MT8A 2Q5ZA 4DR2O 4O2AA 1QLEB 2XAGA 3IJ4A 3RWRD 2BTOA 4KL1A 3WB2A 4X1KA 3ABMB 1S5LZ 1ZWIC 4BR6A 3CCSV 2ZQMA 4KUMA 4XDKA 4JI6O 5KUKA 2ZE8A 1RPRA 5B1BB 1FXKA 3E83A 3JAKA 1QR8A 2OWOA 4CH3A 3K0DA 3SYQA 3T1YB 1BGYH 1XQ8A 3CC4V 4DV5O 2GSMB 4X66B 4ABMA 4AI8A 1GM7A 1F23A 4JI1B 4FLZA 3W7UA 3ASOC 1JFFA 4X62B 3OTOO 2BCCH 3FB6C 4H33A 1QLNA 5EBWC 1Y76A 4KP4A 3NR7A 4WBNA 2HJDA 1R73A 1P7BA 3B40A 3L71H 2VQEO 2ZXWB 1DGSA 1KB9F 3HKBB 1CP9A 3SPHA 3W7SA 1FFXA 1RFYA 4JAAA 1I94O 4BIZA 2EIJC 1VF5B 4PD4F 4JTDB 3OD4A 1VARA 2KG7B 1M56B 4TV8A 1AI5A 3CX5F 3E35A 4NXMO 5JJJB 2UUAB 2VWJA 1F4NA 3CCJV 1XMOO 2JEXA 2CUGA 4LH7A 4UFZA 1QU7A 4JI5B 5CA0A 4MTXA 3ZN1A
chains in the Genus database with same CATH topology
3OUSA 4JTAB 1R3JC 2JJ1G 3SYCA 3OUFA 1ORQC 1AI4A 1JCHA 2HLDG 5BZBA 4R6ZA 2IJIA 3FKSG 2EIMB 4PDRA 3ABKC 2DW4A 2EINB 4XBFA 2IU0A 3CCLV 3GB7C 5J9PC 1VQ5V 1FXKB 3AG4B 3STLC 2XAHA 4JAVA 4WFFA 3SJQC 2DWDC 5B1OA 1VQNV 3LSSA 3OMIB 5CBHA 1Q7YW 5B3SB 1V54B 3ZIAG 2EINC 5CMUA 3WFVA 1OCOB 1MOFA 1K4CC 2EIKB 5EK0A 2EJRA 4YXWG 1K3EA 1H8EG 1GMGA 3GWOA 2AHYA 2Q69A 4FK5C 3CCQV 1FXKC 2WLHA 3AG4C 3RVYA 2HR3A 3SPCA 3SYAA 4CZZA 1SERA 5HFMA 3DTUB 2YSUB 4LP8A 2A79B 5LGTA 3ZJZA 3ZRWA 2OTJV 3OW2U 1VQLV 4MW8A 3JD1A 1K5SA 5B3SC 1OCRB 1K8AW 4QPJA 3E8HA 1OCOC 2H8PC 1AR1B 5CBGA 4HAMA 1AI6A 1M57B 4QE9A 5IYBO 5L3CA 1JX9A 3K9AA 2DWEC 3BEHA 1NJIW 1YTFB 3I56V 3LDCA 2B5UA 3F7YC 3IFXA 4PA6A 1Q81W 1OCRC 3M99B 3EHBB 1QR9A 5H6QA 4MTFA 1M57C 2WLLA 3B77A 5E1AC 1PL0A 1UJWB 2EILC 4RAIA 1YTFD 3D3IA 3HPLC 3E86A 3SPJA 1NR7A 3OR7C 1JJ2U 3P30A 1GM8A 1K92A 5KA5A 2XOKG 3AG1B 4UV8A 2V7QG 2QKSA 2OT5A 3LDDA 4N23A 2H94A 2EIJB 4XDLA 4G2KA 3UKMA 2R9IA 3OMAB 1LNQA 2MK3A 4CBCA 1ROPA 2IH3C 3CYOA 3W7WA 4N21A 1SESA 2KB1A 2NLJC 2Y69C 1DLBA 3CMAV 4RUFA 4PDVA 3CCUV 2HFEC 3CXCU 1NH2B 3AG1C 4LC1A 3E8GA 2P7TC 1AJNA 3HB3B 3R65A 1DF5A 3BY6A 3D36A 3G6EV 2D3OW 4OXSA 3G71V 2DYSB 1M9NA 1R6NA 2WSSG 3LSQA 2AHZA 4JPRA 2HVJC 1COWG 3KG2A 5L3EA 1FFTB 5B1AB 1W2BU 1E79G 1MABG 3SPIA 4HZ3A 4MSWC 4R7CA 2F43G 2X7RB 2Q68A 2JK5C 4WF9V 3MHSC 1G8MA 3ZRVA 2WLNA 5LHHA 3OAAG 2DYSC 4KFMA 3ABKB 4PA7A 1PNMA 4J9YB 4XDJA 1VQPV 5B1AC 2GHYA 3B8NA 3FYEB 2EBOA 4TT3G 1OCCB 2WAMA 5IYDO 1QVFU 4MVQA 3ZRWB 3K04A 3VOUA 5KA6A 3ZRSA 2IH1C 1JPXA 5H9CA 3ZMUA 3A0RA 1J95A 4QPKA 3RBZA 3CPWU 2ZD9A 3CC2V 1KP3A 4PA3A 4EKWA 1P4RA 1JVMA 3ABUA 3ZMVA 1K33A 3ZN1A 1OCCC 3T4ZA 4WFAV 5LHGA 2IW5A 2QA4V 2FTKA 3FB7C 1NR1A 5LBQA 1S77D 1S3JA 3CMEV 1FS0G 3JD2A 4Z1MG 2K1EA 2UXXA 2Z5UA 1TUEB 3OE7G 4I9WA 4R8CA 5B1NA 2ZR2A 3ABTA 1I5YA 1CEZA 2WLLB 3CCMV 4PDLA 3E2EA 1NQTA 3OGCC 4FMTA 3VBBA 3B8MA 1NVPB 4R50A 4RQFA 3CC7V 5L3FA 1QCEA 4QIWF 4GT1A 4ZBMA 1YJ9V 1Q82W 4JASA 4WFEA 5L3BA 5CA3A 4UVAA 2HVKC 5L3DA 1K4DC 1NVPD 3AG2B 3ASNB 1Q86W 3E8BA 2DQ3A 2BOBC 3CP1A 2EILB 1MG1A 2EZPA 2WPDG 4LBEC 1M1KW 5CBFA 3LNMB 1GM9A 1AJQA 4FJCC 1BHBA 3K03A 5EBLC 1AROP 3K06A 2DQ0A 3X2QB 4DXWA 2B1GA 1KC8W 3SYOA 3JD4A 1VQ7V 4MVSA 1S76D 2P67A 2QM7A 1SETA 1DTOA 3JYCA 3AG2C 3ASNC 1BHAA 3JCZA 3UM7A 2XAFA 2LFSA 4JTCB 3MHHC 3OFNG 1Y66A 1MSWD 3MD0A 5IDJA 4QJFB 5LGNA 1PNLA 2IU3A 1EZJA 4BW5A 2OTLV 5H6RA 1BMFG 3X2QC 3ZRXA 1G4YB 2Y69B 4MVMA 1K7DA 4GX2A 3IC7A 3ZCCA 4WCEV 2A0LA 2W6JG 1DF4A 3EFFK 1PD3A 1VQ4V 4QE7A 3H01A 3OR6C 4G28B 2HG5C 5FL7G 4PDMA 5EC1C 3K3WA 2ITCC 1M90W 4MVOA 2W6IG 3OEEG 5LHIA 4ZKIA 1E1RG 4JF3A 1H2GA 1EBOA 2IJKA 3CD6V 3DGEA 3QO7A 1THZA 2JJ2G 4X89A 5EC2C 2X0LA 2DYRC 2XASA 1BL8A 1KQSU 4U7NA 2X6BA 1S5HC 3QNEA 3RW0A 2A9HA 1I5XA 2OCCB 4GCZA 3ZMTA 3JD0A 3NXSA 1E1QG 4MTOA 1R6KA 3AG3B 4F4LA 4L87A 4MVUA 2JEUA 4GX0A 1IXMA 1OZ0A 3W7XA 1GK9A 1YSCA 2NNUA 3K08A 1H38A 1YJNV 2OCCC 1FXHA 1K73W 2XAQA 4X8AA 2QEXV 2M7WA 2HJFC 3ABLB 3AG3C 2ZDIA 1NBMG 4JYCA 3E89A 2C2AA 2JIZG 3FB5C 5L3GA 1L1FA 4WFGA 2R9RB 4JAUA 3ETDA 2YEVA 4ASUG 5IYCO 1WLEA 1K5QA 1V55C 1M56C 2UXNA 5IY5C 1JOYA 4UXNA 1Y4MA 2B1IA 4RUEA 3ABLC 3ZMZA 1VQOV 3P32A 2P90A 4TSFG 2Q6AA 1NKDA 5C93A 1QVGU 4GX5A 2EZOA 4DO2A 3F5WC 4PA9A 4WFHA 2V1DA 1F4MA 2JDIG 1KKDA 5EBMC 2X6CA 3PJSK 1GTOA 4UVBA 4GX1A 4X88A 3CCRV 2QE7G 2XAJA 2HKOA 4P9PA 3RVZA 4HYOA 3OM3B 1YJWV 2WLIA 3K0GA 2Y48A 2BOCC 5KUMA 3ETEA 2W0FC 3ETGA 4WFBV 3LDEA 2IJHA 3TETA 4JGSA 4U7OA 1OCZB 2EIMC 2XNDG 1YHQV 1CPYA 1ENVA 1N8RW 1R3IC 3WG7B 1PNKA 2WLKA 3G4SV 1S0VA 1KD1W 1AJPA 1OHHG 5CN0A 1SRYA 4P2ZA 3SPGA 1SZTA 5GW7A 1XL6A 3LUTB 4MT8A 1QLEB 2XAGA 2Q67A 1H8HG 5DM6V 2PI4A 2WLMA 4JYBA 4Q20A 1K34A 4BAYA 4UV9A 5DN6G 1B6QA 4UUJC 1OCZC 1YIJV 4H37A 4PELA 1AI7A 1VQ6V 4RQEA 3AEIA 4MTGA 3WG7C 3CCVV 3IGAC 1V54C 3ABMB 1ZWIC 3CCSV 2EIKC 2ZQMA 4KUMA 4XDKA 1RPOA 1QBZA 1XL4A 5KUKA 1QLEC 3ML0A 1RPRA 3TK1A 5B1BB 1FXKA 3OMNB 1RM1B 3E83A 3E8FA 1PKXA 1K9MW 1VQ8V 1QR8A 3ASOB 3K0DA 4G27B 1KP2A 3K79A 1KECA 2LP7A 3SYQA 2IJJA 3ABMC 2DYRB 3T2MA 3ZMSA 1VQKV 5LGUA 3I55V 1WPXA 3CC4V 2GSMB 5B1BC 1RM1C 1GM7A 1F23A 3F7VC 1VQ9V 4FIPC 3W7UA 3ASOC 4QNHB 1EFRG 2WWWA 4MVZA 1GKFA 4RO2A 4TWKA 2PI5A 4MW3A 3FB6C 4H33A 3T1CA 1QLNA 1W0JG 2CK3G 4P30A 3T4DA 2X6AA 5EBWC 3STZC 4KP4A 1YI2V 1R3KC 2YEVB 4PA4A 1VQMV 1R73A 1GO3F 1P7BA 2ITDC 2ATKC 2ZDIC 3QO8A 4LCUC 2ZXWB 5HFLA 4BIUA 1R3LC 2QM8A 3W7TA 1S72V 1F51A 1HWYA 1CP9A 3FB8C 4MVRA 3SPHA 2QTOA 3W7SA 2Z3YA 4UVCA 4BIZA 2EIJC 2WLJA 1W0KG 3JD3A 4J9ZB 4E2LA 4JTDB 1V55B 1M56B 5IY5B 2WLIB 3SYPA 3QO5A 3TCUA 1AI5A 1JQ0A 2LFRA 4FPPA 3E35A 1NH2D 3ZN0A 3FYIB 4I5SA 4P9OA 2ZXWC 3CCEV 1K97A 1YITV 1F4NA 2P6JA 3CCJV 3OEHG 2JEXA 2ZR3A 4MS2A 4MTXA 1FXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF3 A;  4JGS A;  1F23 A;  1EBO A;  1Y4M A;  1ENV A;  3MHH C;  4FIP C;  1Y66 A;  1DF5 A;  1QBZ A;  3B8N A;  2EBO A;  5CN0 A;  3P30 A;  4E2L A;  1SZT A;  3CP1 A;  5KA5 A;  5CMU A;  1QR8 A;  1MG1 A;  2EZP A;  2M7W A;  4JPR A;  1MOF A;  2EZO A;  3K9A A;  3WFV A;  1DF4 A;  2OT5 A;  1JQ0 A;  1I5Y A;  5KA6 A;  3GWO A;  1I5X A;  3H01 A;  4FJC C;  1JPX A;  2LP7 A;  4FK5 C;  4N23 A;  5H9C A;  1K34 A;  2X7R B;  4G2K A;  3M99 B;  5HFM A;  3MHS C;  3B8M A;  2MK3 A;  2P6J A;  1QR9 A;  3CYO A;  5HFL A;  1QCE A;  1K33 A;  3B77 A;  4N21 A;  1DLB A; 
#chains in the Genus database with same CATH topology
 3JAW B;  4JTA B;  3K5O A;  2R9A A;  1N34 B;  1AI4 A;  5LMN B;  4B3M O;  3RYF A;  5LOV B;  4R6Z A;  1RSO B;  4AIL C;  4CS3 A;  4TUY B;  3ABK C;  4K8X A;  5BR8 B;  2DW4 A;  2EIN B;  1XHX A;  1AR5 A;  1HNZ B;  3GVM A;  4IGG A;  4K3A A;  3STL C;  4JAV A;  4DV6 O;  4WFF A;  1Q6U A;  4B3T B;  5B1O A;  1VQN V;  4CS4 A;  5CA1 B;  1Q7Y W;  1IBL O;  2F95 B;  4NXN O;  1V54 B;  5CMU A;  1GMG A;  2AHY A;  1IBM O;  3JAR B;  3SPC A;  1SER A;  2HR3 A;  2ETN A;  3GWK C;  3A0H Z;  3DTU B;  4D7S A;  2A79 B;  2HP8 A;  2OTJ V;  4Z2W A;  5CB4 A;  1K5S A;  1OCR B;  3E8H A;  1Q3E A;  1AR1 B;  4HNA B;  1RP3 B;  2A3Q A;  4HAM A;  4I0X B;  5IYB O;  3BEH A;  1GN4 A;  3AG7 A;  4OPH A;  3IFX A;  3M99 B;  1QR9 A;  3BAA A;  5H6Q A;  4I4T B;  1M57 C;  2WLL A;  4H44 B;  4NKG B;  1X4T A;  4Q6G A;  3D3I A;  3HPL C;  1WJZ A;  2P06 A;  1NR7 A;  2ZE5 A;  1WA8 A;  4O4L B;  3ZHQ A;  3CE2 A;  1GM8 A;  5KA5 A;  2XOK G;  2V7Q G;  4EB6 A;  4GUN A;  3LDD A;  2LW1 A;  3LSU A;  4EFE A;  2R9I A;  4CBC A;  2IH3 C;  5GON B;  1XOU A;  2BTQ B;  2QM4 A;  2IBZ H;  2KB1 A;  3K5M A;  1DLB A;  3AG1 C;  2P7T C;  4DV4 O;  4OXS A;  1YVW A;  2PY5 A;  3OTF A;  4F6R B;  2UXD B;  1COW G;  5L3E A;  1FFT B;  4DV2 O;  4OX9 O;  2QR4 A;  2F43 G;  3UT5 A;  2JK5 C;  5FNV A;  1FJG O;  4WF9 V;  4LF5 O;  2JGD A;  2WLN A;  5LHH A;  3OAA G;  4KFM A;  2VS0 A;  3THO A;  3KCX A;  4U3J A;  4JI8 B;  5JQG A;  2YIC A;  2GHY A;  2EBO A;  2AXT Z;  2OCH A;  1SA0 A;  3RYH B;  1TGO A;  4GYC B;  4QPK A;  3RBZ A;  2ZD9 A;  5IJ9 B;  3RFR A;  5KAF Z;  5J2T A;  2RCV A;  3BCC H;  3FB7 C;  1S77 D;  1S3J A;  2Y0P A;  1YF2 A;  4JZ2 A;  2K1E A;  3H1I H;  5JWP A;  4NB5 A;  3OE7 G;  5B1N A;  2ZR2 A;  3CJH B;  4ZI7 A;  5IT9 N;  1YZB A;  4YY3 O;  3JAM N;  2VQF O;  2KG7 A;  1Z5W A;  3VBB A;  4DV0 B;  2AW9 A;  3RYC A;  4RQF A;  3CC7 V;  2G38 A;  1P84 F;  3EXA A;  4LFA O;  4X64 B;  5BXZ A;  4DR1 O;  2JS3 A;  3AK2 A;  2GUZ A;  5JCO C;  5LP6 C;  5L3D A;  3AG2 B;  3ASN B;  3RT3 C;  1A32 A;  2EIL B;  1NU1 H;  3LNN A;  1AJQ A;  5LOV A;  2B1G A;  3JAT A;  4LR3 A;  1N32 O;  1VQ7 V;  2Y4T A;  2CGO A;  2P67 A;  4J10 A;  3AK1 A;  4FFK A;  3UM7 A;  4H13 B;  3VQV A;  2LFS A;  3WB1 A;  3OFN G;  3MD0 A;  2KQX A;  3DXR A;  3PN1 A;  5H6R A;  2R72 A;  1YDX A;  3IC7 A;  4WCE V;  1DF4 A;  3EFF K;  4Z1V A;  3D36 C;  2DJV A;  2A7W A;  3OR6 C;  4G28 B;  3J81 N;  5D5Q A;  2QWR B;  2YIB A;  3D3Q A;  2ITC C;  1TUB A;  5LA6 A;  3ETQ A;  3WB0 A;  1E1R G;  4JF3 A;  4FLT A;  3CD6 V;  3SJB C;  2GV9 A;  1SQX H;  4IIJ B;  3CB2 A;  2BSK A;  4HNA A;  5H5N A;  2X6B A;  2A9H A;  5JVD A;  4I50 A;  3JD0 A;  1E1Q G;  4DK1 A;  1R6K A;  4LF6 B;  1IXM A;  3I5D A;  3K08 A;  1YJN V;  3TXS A;  4FZ1 A;  3S3W A;  4J7Z A;  2HJF C;  3AG3 C;  2Q0A A;  2JIZ G;  3FB5 C;  2BE3 A;  1GAX A;  4DV7 O;  1QNM A;  3DC5 A;  4IHJ B;  1V55 C;  4IT5 A;  1XRE A;  3ZMZ A;  1SF9 A;  1BCC H;  5A9G A;  1NKD A;  1QVG U;  2L35 A;  4FLU A;  1IXB A;  4DO2 A;  3F5W C;  2V1D A;  1F4M A;  2Q7E A;  3C90 A;  4JI4 B;  3N2K A;  1ZL8 B;  4GX1 A;  5AG2 A;  4X88 A;  4DW1 A;  2HKO A;  1G1X B;  3K0G A;  1M5I A;  3D8C A;  1HNX O;  4DR5 B;  2F4V O;  2W0F C;  4WFB V;  1LR1 A;  1U97 A;  4U7O A;  4DR5 O;  1CPY A;  3CEI A;  4K0K O;  2E5L B;  2WA4 A;  3RYI A;  1AJP A;  4O4J A;  1WPB A;  1SZX A;  3LUT B;  4DR3 O;  1XHZ A;  5IYZ B;  4BAY A;  1K34 A;  2QTS A;  1H2S B;  1B6Q A;  5BMV B;  5LMU B;  3CCV V;  3IGA C;  4LWS B;  4O4H A;  3CS5 A;  1QBZ A;  3ML0 A;  3TK1 A;  2CH7 B;  3U0Z A;  3E8F A;  1PKX A;  4TV9 B;  4TQD A;  1K9M W;  3ASO B;  3Q4H B;  4DW0 A;  1KEC A;  2UXB O;  2V4D A;  2LP7 A;  2QJ1 A;  2DYR B;  3ZMS A;  1EN4 A;  3I55 V;  1XI1 A;  4KHP B;  4K35 A;  1RM1 C;  2LGW A;  1UPG A;  1O9H A;  3F7V C;  4PI0 A;  4FM0 A;  4RO2 A;  1PM9 A;  4TWK A;  3ZHU A;  3KZI Z;  5A2Q N;  5KHK A;  4GKJ O;  4MW3 A;  2OIE A;  2YID A;  1W0J G;  4PJ0 Z;  3T4D A;  5GTI Z;  2ADP A;  2N04 A;  5E79 Z;  1L0N H;  2YEV B;  2D2C B;  4U3F H;  1VQM V;  1AIL A;  3B09 A;  1GRJ A;  3DC6 A;  2ZDI C;  1BE3 H;  4LCU C;  3ZED A;  1PPJ H;  1F51 A;  2YI9 A;  3FB8 C;  4MVR A;  2E3C A;  1EN6 A;  4E2L A;  3FFQ A;  5IY5 B;  2F66 C;  3SYP A;  2OYQ A;  5K1P A;  1JQ0 A;  2LFR A;  1NH2 D;  3ZN0 A;  3FYI B;  4I5S A;  3OEH G;  3BPZ A;  1N33 O;  4DUY B;  2Q9L A;  1JA8 A;  2VRZ A;  2JJ1 G;  2Q73 A;  3OUF A;  2YXL A;  1ORQ C;  1JCH A;  5TIS Z;  4JI2 B;  2IJI A;  1T5E A;  2EIM B;  2QKA A;  3P3P A;  1Q8I A;  4O4I B;  2B9Z A;  1G6U A;  1Y67 A;  4XBF A;  2IU0 A;  1XIL A;  1SQP H;  1XUQ A;  3CCL V;  4B3R O;  2PYL A;  1IUR A;  1VQ5 V;  4FLV A;  2DWD C;  3E22 A;  3VQX A;  5F2V O;  1IX9 A;  1NT2 B;  3UO3 A;  3ZIA G;  3WFV A;  2EIK B;  2EJR A;  3ZHS A;  1FXK C;  2WLH A;  3AG4 C;  3AK3 A;  5HFM A;  3ZJZ A;  3ZRW A;  1P49 A;  3JD1 A;  5J2U A;  1BS3 A;  4QPJ A;  1SKV A;  1M57 B;  5IE9 A;  3K9A A;  4LFB B;  3LDC A;  1WP7 A;  3QF7 A;  2AZ2 A;  5JH7 A;  3T1Y O;  5E1A C;  4NYK A;  2XTA A;  3ZHV A;  1I08 A;  4IYH A;  4RAI A;  1FAF A;  4UCS A;  3FAV A;  4LF8 B;  4X66 O;  4JI1 O;  3P30 A;  2H3O A;  4X1Y B;  1K92 A;  3AG1 B;  4UV8 A;  2QKS A;  4X62 O;  2OT5 A;  3JAL B;  4N23 A;  3HKD B;  2CTW A;  2MK3 A;  3CYO A;  1IBK B;  4PDV A;  4ICG A;  4LC1 A;  3E8G A;  3HB3 B;  4JYY A;  1DF5 A;  3BY6 A;  4O2B A;  2D3O W;  1KKC A;  4DRX A;  5KMG B;  3G71 V;  1R6N A;  2ZIM A;  3JAS B;  3A0B Z;  4HZ3 A;  4JI7 B;  5KHJ A;  2FYU H;  3N2G A;  1G8M A;  4LF9 B;  3HKE B;  2AGA A;  2UUA O;  2DYS C;  2GTS A;  1Z5V A;  1XNQ B;  4JI5 O;  1XMQ B;  1XNR B;  5EZY A;  3H1K H;  2WAM A;  5IYD O;  1VF7 A;  2NN4 A;  1QVF U;  1N34 O;  5H2F Z;  2PGG A;  1P7G A;  3MAQ A;  3WU2 Z;  1MNG A;  5LMN O;  3K04 A;  1JMK C;  2IH1 C;  3C3T A;  3ZRS A;  5H9C A;  1TVK A;  4JZG A;  3CC2 V;  1KP3 A;  4EKW A;  3BAB A;  3ABU A;  1K33 A;  5BR8 O;  3T4Z A;  5LHG A;  2IW5 A;  1GH6 A;  3IC9 A;  1HNZ O;  4TQF A;  4PHZ A;  3JD2 A;  4Z1M G;  4B3T O;  2UXX A;  4I9W A;  3T1H B;  1PP9 H;  3ABT A;  5LP6 B;  4X20 A;  3OGC C;  4FLY A;  3B8M A;  4R50 A;  5L3F A;  1QCE A;  4GT1 A;  1Q82 W;  4JAS A;  2QWP B;  3B2E E;  5L3B A;  1Y74 B;  4YJ3 A;  5LL6 Y;  2HVK C;  4DUZ B;  1Q86 W;  2BOB C;  3K5L A;  4LBE C;  2EZP A;  1GN3 A;  3M7M X;  1M1K W;  1HNW B;  1Q6I A;  4UCT A;  3J7A U;  3K06 A;  4FFB A;  4UCV A;  1KC8 W;  2RNB A;  3JD4 A;  1S76 D;  1SET A;  1DTO A;  2RN9 A;  3JYC A;  3L70 H;  5EIB D;  1B04 A;  4JTC B;  1Y66 A;  5IDJ A;  5LGN A;  1N36 B;  2CGN A;  2OTL V;  1BMF G;  3U11 A;  4FLW A;  2CTQ A;  1BT8 A;  1G4Y B;  2Y69 B;  5K1X A;  4GX2 A;  2A0L A;  2W6J G;  5C8Y A;  4YJ2 B;  4QE7 A;  3H01 A;  5FL7 G;  4PDM A;  2ZE7 A;  3EVK A;  3RN4 A;  3OEE G;  4DR4 B;  4QGP A;  4ZKI A;  5LHI A;  2L6L A;  1IZ3 A;  4ZHQ B;  2IJK A;  4J42 A;  4DV1 B;  1WN7 A;  2XAS A;  1NTM H;  1N0J A;  2KSD A;  1KQS U;  3KCY A;  2UXD O;  3NXS A;  2YDE A;  4MTO A;  3AG3 B;  2NR5 A;  4L87 A;  5EYP B;  2RDC A;  2DOS A;  4GX0 A;  2GBO A;  1KBH A;  2UUC B;  1H38 A;  2Y0I A;  2ZCE A;  2N05 A;  4JI8 O;  1K73 W;  1Q43 A;  3BVO A;  3OGI B;  2PZS A;  2DE0 X;  3L75 H;  5KX5 B;  3E89 A;  2C2A A;  2EUL A;  2UU9 B;  2E74 B;  4JAU A;  3SR2 C;  1WLE A;  1XBL A;  1EM1 A;  1M56 C;  1JOY A;  1IDS A;  2ZE6 A;  3J80 N;  2B1I A;  3L9D A;  3ABL C;  3P32 A;  4OPA A;  3IAY A;  5C93 A;  3HKB A;  4PA9 A;  2Q7G A;  4DR7 B;  1KKD A;  2X6C A;  4UVB A;  1GTO A;  4JI0 B;  3BHP A;  5JJE B;  4AQY B;  3RGB A;  2DMX A;  4DV0 O;  3ETG A;  3LDE A;  3TET A;  4UB8 Z;  1YHQ V;  1ENV A;  1ZSP A;  1R3I C;  4X64 O;  2WLK A;  5CN0 A;  1BQZ A;  4P2Z A;  3SPG A;  3JAW A;  5GW7 A;  1XDC A;  2FML A;  2Q67 A;  1H8H G;  5DM6 V;  2PI4 A;  2WLM A;  4JYB A;  4Q20 A;  4UV9 A;  4UUJ C;  1YIJ V;  1OCZ C;  1FYJ A;  1EN5 A;  1RSO A;  4X1I B;  4PEL A;  1VQ6 V;  4RQE A;  3AEI A;  1FD9 A;  4TUY A;  1V54 C;  2UXC B;  1RPO A;  1MZF A;  5LXT B;  5EIB C;  3OMN B;  1RM1 B;  3MDS A;  1X59 A;  3CSX A;  5IJ0 B;  2ADQ B;  1KYO F;  4G27 B;  4LNU B;  3G80 A;  1KP2 A;  3K79 A;  3TXQ A;  2DN9 A;  5CA1 A;  3T2M A;  5LYJ B;  5LGU A;  4CS2 A;  3JAR A;  4IL6 Z;  1SQF A;  1AP5 A;  1W59 A;  1EFR G;  4MVZ A;  1GKF A;  3H1J H;  2IM9 A;  2CK3 G;  4CC6 A;  2X6A A;  4I0X A;  3BA8 A;  1YI2 V;  3TGU H;  1R3K C;  1SQG A;  2ZM6 B;  2ITD C;  2ATK C;  3QO8 A;  1BQ0 A;  2XT9 A;  4LFC B;  5HFL A;  1R3L C;  3ZS8 C;  4LF6 O;  4UVC A;  4I4T A;  2WLJ A;  3JD3 A;  3CHX A;  2E75 B;  3FD9 A;  4J9Z B;  2WLI B;  3QO5 A;  3TCU A;  4O4L A;  4DV3 B;  4P9O A;  1K97 A;  2P6J A;  5DEC A;  1KMI Z;  2M6Y A;  2ZR3 A;  1BSM A;  5ITZ B;  1FXV A;  1WAZ A;  5GON A;  1R3J C;  2BTQ A;  3K58 A;  4O2A B;  3SYC A;  1YEW A;  3APQ A;  4DR6 B;  5BZB A;  4PDR A;  4JI3 B;  4X1K B;  4NVP A;  1VIB A;  4F6R A;  4YHH B;  4JI4 O;  2XUM A;  1FXK B;  3AG4 B;  3JAK B;  4CH4 A;  3LSS A;  4J7J A;  3OMI B;  5CBH A;  2R70 A;  2E5L O;  3UO2 A;  3K57 A;  1K3E A;  1NS1 A;  2Q69 A;  3CCQ V;  4FK5 C;  2YUA A;  4B3S B;  2YIA A;  1WB8 A;  2YSU B;  1NTZ H;  4UCU A;  3RYH A;  3QVN A;  3OW2 U;  1VQL V;  1GN6 A;  2ZIO A;  5B3S C;  5LMU O;  1K8A W;  4LF7 B;  1OCO C;  5IJ9 A;  3R66 A;  5CBG A;  1Y76 B;  4LH6 A;  1AI6 A;  2OIG A;  5KAI Z;  4WBN B;  1JX9 A;  3A8T A;  1NJI W;  1YTF B;  2PTM A;  1Q81 W;  2YC0 A;  1FKA O;  4JYA B;  3CJH A;  4X65 B;  1FFX B;  1S5J A;  1V9P A;  4MTF A;  1D5N A;  1OJH A;  2EIL C;  1YTF D;  1US6 A;  3E86 A;  3SPJ A;  4TV8 B;  4KHP O;  1SS3 A;  4GKK B;  3UQ8 A;  2P22 C;  3K9S A;  3ZHR A;  5CA0 B;  3SGI A;  2EIJ B;  4XDL A;  4G2K A;  2HHH B;  3OMA B;  2JRI A;  2YXY A;  2NLJ C;  2CE4 A;  3RYF B;  2HFE C;  1NH2 B;  1AJN A;  3VQW A;  3G6E V;  1H2N A;  2DYS B;  1M9N A;  2WSS G;  1ZTE A;  4JPR A;  1CXZ B;  3CRC A;  1W2B U;  1MAB G;  3SPI A;  4MSW C;  2YS8 A;  4J80 A;  2QWQ B;  3ZRV A;  2XHB A;  2P4K A;  3CRM A;  3ABK B;  4J7K A;  4PA7 A;  1PNM A;  4J9Y B;  5B1A C;  4DUY O;  3B8N A;  2W0X A;  4UCR A;  4PV1 B;  4I55 B;  4JV5 B;  4MVQ A;  2JGU A;  3M8A A;  4IIJ A;  3VOU A;  1JPX A;  4JI2 O;  3A0R A;  5CB4 B;  4ZOL B;  3CPW U;  1HR0 B;  1P4R A;  1JVM A;  2P5O A;  3ZMV A;  1TAE A;  4KXR A;  5JJN B;  1ZAU A;  1OCC C;  4WFA V;  3BA9 A;  1Y6X A;  2FTK A;  2CAZ C;  3KKY A;  4CH6 A;  2LO1 A;  4CC5 A;  2Z5U A;  1I5Y A;  1CEZ A;  2JS5 A;  2WLL B;  3CCM V;  4PDL A;  3E2E A;  1N4C A;  2F23 A;  2EJ7 A;  2GTA A;  4AHC A;  4LF4 B;  2UUB B;  3ZBH A;  1WA8 B;  4ZBM A;  1YJ9 V;  4WFE A;  2KKW A;  1KU9 A;  4X9Q A;  5CA3 A;  4EFB A;  3UCS C;  1J5E B;  4UVA A;  2ZT9 B;  1XEQ A;  4DR2 B;  5IWA B;  4E4E A;  4IHJ A;  2DQ3 A;  3CP1 A;  2YXH A;  1MG1 A;  5CBF A;  3LNM B;  1GM9 A;  1BHB A;  3K03 A;  2ARH A;  1ARO P;  5EBL C;  4BIO A;  2DQ0 A;  4LFB O;  2Z0A A;  1SQQ H;  2F1M A;  3QG5 A;  2N74 A;  1ZL8 A;  3BFR A;  2LGQ A;  4JI6 B;  1VP7 A;  1ZX3 A;  1BHA A;  2HEP A;  3JCZ A;  3SJA C;  3BRC A;  3ZHT A;  1MSW D;  4QJF B;  1PNL A;  1EZJ A;  3UT5 B;  3X2Q C;  5FNV B;  4LF8 O;  1K7D A;  2FB5 A;  3ZCC A;  3K5N A;  1PD3 A;  2JGD B;  2Q4P A;  4FLX A;  3K3W A;  4FZ0 A;  4DV5 B;  4U3J B;  1M90 W;  4MVO A;  5JQG B;  5IYZ A;  5BMV A;  3DGE A;  3QO7 A;  3OTO B;  1IBK O;  1THZ A;  1SA0 B;  2JJ2 G;  4X89 A;  4EEQ A;  4FVM A;  2DYR C;  4LWS A;  4U7N A;  2FL4 A;  1S5H C;  1AP6 A;  1HW7 A;  3S3X A;  2CH7 A;  5J2T B;  4GCZ A;  4TV9 A;  2VQE B;  4JI7 O;  3H9V A;  3Q4H A;  4F4L A;  2QWN B;  3ICX A;  2JEU A;  4LF9 O;  1I94 B;  1HP8 A;  1OZ0 A;  3W7X A;  1I7F A;  1GK9 A;  1YSC A;  4ZI7 B;  4H0L B;  1XNQ O;  2OCC C;  1FXH A;  4UB6 Z;  2XAQ A;  4X8A A;  4NXM B;  1XMQ O;  2M7W A;  1XNR O;  3RYC B;  3ABL B;  1NBM G;  4JYC A;  1XMO B;  1O9G A;  2VWK A;  2O57 A;  2GUZ B;  1L1F A;  5D5P A;  2R9R B;  4HBN A;  2QGN A;  2YEV A;  4B08 A;  5IYC O;  4DK0 A;  1K5Q A;  2UXN A;  5IY5 C;  1PV0 A;  1Y4M A;  4B3M B;  4RUE A;  2LW7 A;  2P90 A;  4TSF G;  1PL4 A;  2Q6A A;  3N27 A;  3JAT B;  1MZE A;  4GX5 A;  2JDI G;  3CWB H;  3PJS K;  3T1H O;  2QE7 G;  3RVZ A;  5KHG A;  4HYO A;  3OM3 B;  1YJW V;  2Y48 A;  5KUM A;  4DV6 B;  3DXR B;  4JGS A;  1OCZ B;  2EIM C;  2XND G;  5FPR A;  1N8R W;  4W4K A;  1IBL B;  4NXN B;  1DK1 A;  1SC5 B;  3G4S V;  1KUQ A;  1S0V A;  1SRY A;  1SZT A;  1XL6 A;  1IBM B;  3CXH F;  2EX3 A;  1ZUQ A;  1TUB B;  4DUZ O;  1WNS A;  5LA6 B;  2P4V A;  1HNW O;  4I55 A;  2FKX A;  5DN6 G;  1SQV H;  4H37 A;  1AI7 A;  3H1L H;  4MTG A;  3WG7 C;  4O4I A;  4ZOL A;  2BSK B;  1D2D A;  2YIB D;  3C3S A;  2EIK C;  2CTP A;  1XL4 A;  4BWA A;  1QLE C;  3F5T A;  5JVD B;  4I50 B;  1VQ8 V;  1FPO A;  1N36 O;  1GN2 A;  1Q6H A;  2IJJ A;  3ABM C;  2PF4 E;  1VQK V;  1VEW A;  4BW9 A;  1WPX A;  5B1B C;  1VQ9 V;  2MW2 B;  4DR4 O;  4FIP C;  4QNH B;  2WWW A;  4DV1 O;  2PI5 A;  2CDY A;  3T1C A;  1SQB H;  4FM1 A;  4P30 A;  3STZ C;  2QDO A;  4PA4 A;  4D6T H;  2QSA A;  1GO3 F;  2ILM A;  2QKC A;  4I7Z B;  4BIU A;  2AZ0 A;  4D7T A;  2QM8 A;  3W7T A;  4DV4 B;  1S72 V;  1HWY A;  2E76 B;  1ZLZ A;  2QTO A;  2Z3Y A;  2QWO B;  1MMM A;  3N2K B;  1W0K G;  4DV2 B;  2UUC O;  4OX9 B;  1JR9 A;  1V55 B;  1FJG B;  4FPP A;  4LF5 B;  5KHI A;  2ZXW C;  4X1Y A;  3B4S A;  3CCE V;  1YIT V;  4DYL A;  1WB7 A;  3O9O A;  4CH5 A;  3OT7 A;  3JAL A;  1WP8 A;  3RYI B;  3HKC B;  2UU9 O;  4O4J B;  3HKD A;  3OUS A;  5B66 Z;  1I0H A;  2ZNI A;  4ZIB A;  1AR4 A;  1D5A A;  2HLD G;  1BZK A;  4B7E A;  3FKS G;  5KMG A;  4O4H B;  4DR7 O;  3CRQ A;  4JI0 O;  3JAS A;  4UCO A;  3GB7 C;  5J9P C;  4AQY O;  1AVM A;  2A06 H;  4J41 A;  3JSL A;  1VF6 C;  2XAH A;  3SJQ C;  3HKE A;  3DSQ A;  5B3S B;  2EIN C;  3L73 H;  1M93 A;  4YY3 B;  1OCO B;  2VQF B;  1MOF A;  1K4C C;  5EK0 A;  1F7Y A;  1M4U A;  4YXW G;  1H8E G;  3GWO A;  3RVY A;  3SYA A;  4CZZ A;  5BY1 A;  4LFA B;  1VF6 A;  4LP8 A;  4DR1 B;  5LGT A;  4MW8 A;  2H8P C;  2LJ2 A;  1N0N A;  4NTW A;  2UXC O;  4QE9 A;  5L3C A;  3SDL A;  3L74 H;  2DWE C;  2LQT A;  3I56 V;  5DED A;  1H2M A;  1NI8 A;  2B5U A;  3F7Y C;  1N32 B;  1NTK H;  4PA6 A;  1OCR C;  3EHB B;  3P3N A;  5JCO A;  5LP6 A;  3B77 A;  1PL0 A;  1UJW B;  3OR7 C;  1JJ2 U;  1EZV H;  1Y74 A;  1OV9 A;  1QHT A;  1IVS A;  2H94 A;  3UKM A;  4RWU A;  4GZR B;  1LNQ A;  1ROP A;  1TA8 A;  3W7W A;  3HR0 A;  4N21 A;  1SES A;  4L8J A;  2ZM6 O;  2Y69 C;  3CMA V;  2PUS A;  4RUF A;  3CCU V;  3CXC U;  3R65 A;  1JJO A;  4LFC O;  3D36 A;  1NZ6 A;  3G67 A;  3LSQ A;  2AHZ A;  2HVJ C;  3KG2 A;  5B1A B;  1E79 G;  4R7C A;  2X7R B;  2Q68 A;  3MHS C;  5KHH A;  4OGQ B;  4DV3 O;  3E22 B;  4YJ2 A;  1MSD A;  3JSN A;  1YXB A;  4NTX A;  4K8Z A;  3U10 A;  4XDJ A;  3K59 A;  1VQP V;  1H2K A;  3ZX6 A;  3FYE B;  4TT3 G;  1OCC B;  3CRA A;  1B06 A;  4NTY A;  4ZHQ A;  1HDJ A;  1VMG A;  3ZRW B;  5KA6 A;  4DR6 O;  2Q8V A;  3ZMU A;  4DV7 B;  1J95 A;  4YIP A;  5J2U B;  1H2L A;  4PA3 A;  4JI3 O;  5FPO A;  5B5E Z;  1QQC A;  4YHH O;  2QA4 V;  1NR1 A;  5LBQ A;  3CME V;  1FS0 G;  5EYP A;  1YCI A;  2ZIN A;  1TUE B;  4R8C A;  5JH7 B;  2GDS A;  3FX7 A;  1NQT A;  4FMT A;  1HNX B;  2F4V B;  1NVP B;  4B3S O;  3FAV B;  5KX5 A;  4QIW F;  4W4L A;  3G6B A;  4K0K B;  1JFF B;  2RQ6 A;  2Y4U A;  4IYI A;  1R6T A;  3HKC A;  4LF7 O;  1NVP D;  1K4D C;  4DR3 B;  2RMK B;  3E8B A;  4C7U A;  2JVD A;  2WPD G;  4FJC C;  1LUW A;  4MS2 A;  3X2Q B;  4DXW A;  3APO A;  3SYO A;  4O2B B;  4MVS A;  2ODM A;  4DRX B;  2QM7 A;  4JYA O;  3AG2 C;  3ASN C;  4X65 O;  2XAF A;  3MHH C;  3CRR A;  2RJZ A;  2IU3 A;  4BW5 A;  3ZRX A;  2UXB B;  4MVM A;  3N2G B;  4GKK O;  5FLX N;  4I9Q A;  1VQ4 V;  4PI2 A;  2HG5 C;  5EC1 C;  4NR1 A;  4J11 A;  2W6I G;  2Q0O C;  2HHH O;  5EZY B;  1URF A;  4A5U B;  1U96 A;  1H2G A;  1EBO A;  4X1I A;  4GKJ B;  2ZKO A;  3QTC A;  2PYJ A;  1MA1 A;  5EC2 C;  2X0L A;  1BL8 A;  1B3Q A;  1TVK B;  2K9P A;  1LUV A;  2WA3 A;  3QNE A;  3RW0 A;  5LXT A;  1I5X A;  4YIO A;  5GTH Z;  2OCC B;  3ZMT A;  5IJ0 A;  3H1H H;  4LNU A;  4MVU A;  2Q7H A;  1L0L H;  5LYJ A;  2NNU A;  2ZNJ A;  1Q5O A;  4GLX A;  4X20 B;  2QEX V;  4B7K A;  2ZDI A;  4JV5 O;  1N33 B;  1Z2G A;  5L3G A;  4WFG A;  4YJ3 B;  3ETD A;  5KLV H;  4ASU G;  1HR0 O;  4UXN A;  1UFI A;  1VQO V;  3A2F A;  3SJC C;  4FFB B;  3JCU Z;  4FM2 A;  2EZO A;  4WFH A;  3O65 A;  5EBM C;  4TOI A;  3CCR V;  2XAJ A;  4B3R B;  4P9P A;  3VQY A;  2WLI A;  2BOC C;  1L8D A;  3ETE A;  2CTR A;  1Q90 D;  1R1B A;  2IJH A;  4LF4 O;  3L72 H;  2UUB O;  5C8Y B;  4EB6 B;  3TJT A;  1PNK A;  3WG7 B;  5ITZ A;  2F93 B;  4F6E A;  1OHH G;  1KD1 W;  1J5E O;  1AB3 A;  2YI8 A;  5IWA O;  4MT8 A;  2Q5Z A;  4DR2 O;  4O2A A;  1QLE B;  2XAG A;  3IJ4 A;  3RWR D;  2BTO A;  4KL1 A;  3WB2 A;  4X1K A;  3ABM B;  1S5L Z;  1ZWI C;  4BR6 A;  3CCS V;  2ZQM A;  4KUM A;  4XDK A;  4JI6 O;  5KUK A;  2ZE8 A;  1RPR A;  5B1B B;  1FXK A;  3E83 A;  3JAK A;  1QR8 A;  2OWO A;  4CH3 A;  3K0D A;  3SYQ A;  3T1Y B;  1BGY H;  1XQ8 A;  3CC4 V;  4DV5 O;  2GSM B;  4X66 B;  4ABM A;  4AI8 A;  1GM7 A;  1F23 A;  4JI1 B;  4FLZ A;  3W7U A;  3ASO C;  1JFF A;  4X62 B;  3OTO O;  2BCC H;  3FB6 C;  4H33 A;  1QLN A;  5EBW C;  1Y76 A;  4KP4 A;  3NR7 A;  4WBN A;  2HJD A;  1R73 A;  1P7B A;  3B40 A;  3L71 H;  2VQE O;  2ZXW B;  1DGS A;  1KB9 F;  3HKB B;  1CP9 A;  3SPH A;  3W7S A;  1FFX A;  1RFY A;  4JAA A;  1I94 O;  4BIZ A;  2EIJ C;  1VF5 B;  4PD4 F;  4JTD B;  3OD4 A;  1VAR A;  2KG7 B;  1M56 B;  4TV8 A;  1AI5 A;  3CX5 F;  3E35 A;  4NXM O;  5JJJ B;  2UUA B;  2VWJ A;  1F4N A;  3CCJ V;  1XMO O;  2JEX A;  2CUG A;  4LH7 A;  4UFZ A;  1QU7 A;  4JI5 B;  5CA0 A;  4MTX A;  3ZN1 A; 
#chains in the Genus database with same CATH homology
 3OUS A;  4JTA B;  1R3J C;  2JJ1 G;  3SYC A;  3OUF A;  1ORQ C;  1AI4 A;  1JCH A;  2HLD G;  5BZB A;  4R6Z A;  2IJI A;  3FKS G;  2EIM B;  4PDR A;  3ABK C;  2DW4 A;  2EIN B;  4XBF A;  2IU0 A;  3CCL V;  3GB7 C;  5J9P C;  1VQ5 V;  1FXK B;  3AG4 B;  3STL C;  2XAH A;  4JAV A;  4WFF A;  3SJQ C;  2DWD C;  5B1O A;  1VQN V;  3LSS A;  3OMI B;  5CBH A;  1Q7Y W;  5B3S B;  1V54 B;  3ZIA G;  2EIN C;  5CMU A;  3WFV A;  1OCO B;  1MOF A;  1K4C C;  2EIK B;  5EK0 A;  2EJR A;  4YXW G;  1K3E A;  1H8E G;  1GMG A;  3GWO A;  2AHY A;  2Q69 A;  4FK5 C;  3CCQ V;  1FXK C;  2WLH A;  3AG4 C;  3RVY A;  2HR3 A;  3SPC A;  3SYA A;  4CZZ A;  1SER A;  5HFM A;  3DTU B;  2YSU B;  4LP8 A;  2A79 B;  5LGT A;  3ZJZ A;  3ZRW A;  2OTJ V;  3OW2 U;  1VQL V;  4MW8 A;  3JD1 A;  1K5S A;  5B3S C;  1OCR B;  1K8A W;  4QPJ A;  3E8H A;  1OCO C;  2H8P C;  1AR1 B;  5CBG A;  4HAM A;  1AI6 A;  1M57 B;  4QE9 A;  5IYB O;  5L3C A;  1JX9 A;  3K9A A;  2DWE C;  3BEH A;  1NJI W;  1YTF B;  3I56 V;  3LDC A;  2B5U A;  3F7Y C;  3IFX A;  4PA6 A;  1Q81 W;  1OCR C;  3M99 B;  3EHB B;  1QR9 A;  5H6Q A;  4MTF A;  1M57 C;  2WLL A;  3B77 A;  5E1A C;  1PL0 A;  1UJW B;  2EIL C;  4RAI A;  1YTF D;  3D3I A;  3HPL C;  3E86 A;  3SPJ A;  1NR7 A;  3OR7 C;  1JJ2 U;  3P30 A;  1GM8 A;  1K92 A;  5KA5 A;  2XOK G;  3AG1 B;  4UV8 A;  2V7Q G;  2QKS A;  2OT5 A;  3LDD A;  4N23 A;  2H94 A;  2EIJ B;  4XDL A;  4G2K A;  3UKM A;  2R9I A;  3OMA B;  1LNQ A;  2MK3 A;  4CBC A;  1ROP A;  2IH3 C;  3CYO A;  3W7W A;  4N21 A;  1SES A;  2KB1 A;  2NLJ C;  2Y69 C;  1DLB A;  3CMA V;  4RUF A;  4PDV A;  3CCU V;  2HFE C;  3CXC U;  1NH2 B;  3AG1 C;  4LC1 A;  3E8G A;  2P7T C;  1AJN A;  3HB3 B;  3R65 A;  1DF5 A;  3BY6 A;  3D36 A;  3G6E V;  2D3O W;  4OXS A;  3G71 V;  2DYS B;  1M9N A;  1R6N A;  2WSS G;  3LSQ A;  2AHZ A;  4JPR A;  2HVJ C;  1COW G;  3KG2 A;  5L3E A;  1FFT B;  5B1A B;  1W2B U;  1E79 G;  1MAB G;  3SPI A;  4HZ3 A;  4MSW C;  4R7C A;  2F43 G;  2X7R B;  2Q68 A;  2JK5 C;  4WF9 V;  3MHS C;  1G8M A;  3ZRV A;  2WLN A;  5LHH A;  3OAA G;  2DYS C;  4KFM A;  3ABK B;  4PA7 A;  1PNM A;  4J9Y B;  4XDJ A;  1VQP V;  5B1A C;  2GHY A;  3B8N A;  3FYE B;  2EBO A;  4TT3 G;  1OCC B;  2WAM A;  5IYD O;  1QVF U;  4MVQ A;  3ZRW B;  3K04 A;  3VOU A;  5KA6 A;  3ZRS A;  2IH1 C;  1JPX A;  5H9C A;  3ZMU A;  3A0R A;  1J95 A;  4QPK A;  3RBZ A;  3CPW U;  2ZD9 A;  3CC2 V;  1KP3 A;  4PA3 A;  4EKW A;  1P4R A;  1JVM A;  3ABU A;  3ZMV A;  1K33 A;  3ZN1 A;  1OCC C;  3T4Z A;  4WFA V;  5LHG A;  2IW5 A;  2QA4 V;  2FTK A;  3FB7 C;  1NR1 A;  5LBQ A;  1S77 D;  1S3J A;  3CME V;  1FS0 G;  3JD2 A;  4Z1M G;  2K1E A;  2UXX A;  2Z5U A;  1TUE B;  3OE7 G;  4I9W A;  4R8C A;  5B1N A;  2ZR2 A;  3ABT A;  1I5Y A;  1CEZ A;  2WLL B;  3CCM V;  4PDL A;  3E2E A;  1NQT A;  3OGC C;  4FMT A;  3VBB A;  3B8M A;  1NVP B;  4R50 A;  4RQF A;  3CC7 V;  5L3F A;  1QCE A;  4QIW F;  4GT1 A;  4ZBM A;  1YJ9 V;  1Q82 W;  4JAS A;  4WFE A;  5L3B A;  5CA3 A;  4UVA A;  2HVK C;  5L3D A;  1K4D C;  1NVP D;  3AG2 B;  3ASN B;  1Q86 W;  3E8B A;  2DQ3 A;  2BOB C;  3CP1 A;  2EIL B;  1MG1 A;  2EZP A;  2WPD G;  4LBE C;  1M1K W;  5CBF A;  3LNM B;  1GM9 A;  1AJQ A;  4FJC C;  1BHB A;  3K03 A;  5EBL C;  1ARO P;  3K06 A;  2DQ0 A;  3X2Q B;  4DXW A;  2B1G A;  1KC8 W;  3SYO A;  3JD4 A;  1VQ7 V;  4MVS A;  1S76 D;  2P67 A;  2QM7 A;  1SET A;  1DTO A;  3JYC A;  3AG2 C;  3ASN C;  1BHA A;  3JCZ A;  3UM7 A;  2XAF A;  2LFS A;  4JTC B;  3MHH C;  3OFN G;  1Y66 A;  1MSW D;  3MD0 A;  5IDJ A;  4QJF B;  5LGN A;  1PNL A;  2IU3 A;  1EZJ A;  4BW5 A;  2OTL V;  5H6R A;  1BMF G;  3X2Q C;  3ZRX A;  1G4Y B;  2Y69 B;  4MVM A;  1K7D A;  4GX2 A;  3IC7 A;  3ZCC A;  4WCE V;  2A0L A;  2W6J G;  1DF4 A;  3EFF K;  1PD3 A;  1VQ4 V;  4QE7 A;  3H01 A;  3OR6 C;  4G28 B;  2HG5 C;  5FL7 G;  4PDM A;  5EC1 C;  3K3W A;  2ITC C;  1M90 W;  4MVO A;  2W6I G;  3OEE G;  5LHI A;  4ZKI A;  1E1R G;  4JF3 A;  1H2G A;  1EBO A;  2IJK A;  3CD6 V;  3DGE A;  3QO7 A;  1THZ A;  2JJ2 G;  4X89 A;  5EC2 C;  2X0L A;  2DYR C;  2XAS A;  1BL8 A;  1KQS U;  4U7N A;  2X6B A;  1S5H C;  3QNE A;  3RW0 A;  2A9H A;  1I5X A;  2OCC B;  4GCZ A;  3ZMT A;  3JD0 A;  3NXS A;  1E1Q G;  4MTO A;  1R6K A;  3AG3 B;  4F4L A;  4L87 A;  4MVU A;  2JEU A;  4GX0 A;  1IXM A;  1OZ0 A;  3W7X A;  1GK9 A;  1YSC A;  2NNU A;  3K08 A;  1H38 A;  1YJN V;  2OCC C;  1FXH A;  1K73 W;  2XAQ A;  4X8A A;  2QEX V;  2M7W A;  2HJF C;  3ABL B;  3AG3 C;  2ZDI A;  1NBM G;  4JYC A;  3E89 A;  2C2A A;  2JIZ G;  3FB5 C;  5L3G A;  1L1F A;  4WFG A;  2R9R B;  4JAU A;  3ETD A;  2YEV A;  4ASU G;  5IYC O;  1WLE A;  1K5Q A;  1V55 C;  1M56 C;  2UXN A;  5IY5 C;  1JOY A;  4UXN A;  1Y4M A;  2B1I A;  4RUE A;  3ABL C;  3ZMZ A;  1VQO V;  3P32 A;  2P90 A;  4TSF G;  2Q6A A;  1NKD A;  5C93 A;  1QVG U;  4GX5 A;  2EZO A;  4DO2 A;  3F5W C;  4PA9 A;  4WFH A;  2V1D A;  1F4M A;  2JDI G;  1KKD A;  5EBM C;  2X6C A;  3PJS K;  1GTO A;  4UVB A;  4GX1 A;  4X88 A;  3CCR V;  2QE7 G;  2XAJ A;  2HKO A;  4P9P A;  3RVZ A;  4HYO A;  3OM3 B;  1YJW V;  2WLI A;  3K0G A;  2Y48 A;  2BOC C;  5KUM A;  3ETE A;  2W0F C;  3ETG A;  4WFB V;  3LDE A;  2IJH A;  3TET A;  4JGS A;  4U7O A;  1OCZ B;  2EIM C;  2XND G;  1YHQ V;  1CPY A;  1ENV A;  1N8R W;  1R3I C;  3WG7 B;  1PNK A;  2WLK A;  3G4S V;  1S0V A;  1KD1 W;  1AJP A;  1OHH G;  5CN0 A;  1SRY A;  4P2Z A;  3SPG A;  1SZT A;  5GW7 A;  1XL6 A;  3LUT B;  4MT8 A;  1QLE B;  2XAG A;  2Q67 A;  1H8H G;  5DM6 V;  2PI4 A;  2WLM A;  4JYB A;  4Q20 A;  1K34 A;  4BAY A;  4UV9 A;  5DN6 G;  1B6Q A;  4UUJ C;  1OCZ C;  1YIJ V;  4H37 A;  4PEL A;  1AI7 A;  1VQ6 V;  4RQE A;  3AEI A;  4MTG A;  3WG7 C;  3CCV V;  3IGA C;  1V54 C;  3ABM B;  1ZWI C;  3CCS V;  2EIK C;  2ZQM A;  4KUM A;  4XDK A;  1RPO A;  1QBZ A;  1XL4 A;  5KUK A;  1QLE C;  3ML0 A;  1RPR A;  3TK1 A;  5B1B B;  1FXK A;  3OMN B;  1RM1 B;  3E83 A;  3E8F A;  1PKX A;  1K9M W;  1VQ8 V;  1QR8 A;  3ASO B;  3K0D A;  4G27 B;  1KP2 A;  3K79 A;  1KEC A;  2LP7 A;  3SYQ A;  2IJJ A;  3ABM C;  2DYR B;  3T2M A;  3ZMS A;  1VQK V;  5LGU A;  3I55 V;  1WPX A;  3CC4 V;  2GSM B;  5B1B C;  1RM1 C;  1GM7 A;  1F23 A;  3F7V C;  1VQ9 V;  4FIP C;  3W7U A;  3ASO C;  4QNH B;  1EFR G;  2WWW A;  4MVZ A;  1GKF A;  4RO2 A;  4TWK A;  2PI5 A;  4MW3 A;  3FB6 C;  4H33 A;  3T1C A;  1QLN A;  1W0J G;  2CK3 G;  4P30 A;  3T4D A;  2X6A A;  5EBW C;  3STZ C;  4KP4 A;  1YI2 V;  1R3K C;  2YEV B;  4PA4 A;  1VQM V;  1R73 A;  1GO3 F;  1P7B A;  2ITD C;  2ATK C;  2ZDI C;  3QO8 A;  4LCU C;  2ZXW B;  5HFL A;  4BIU A;  1R3L C;  2QM8 A;  3W7T A;  1S72 V;  1F51 A;  1HWY A;  1CP9 A;  3FB8 C;  4MVR A;  3SPH A;  2QTO A;  3W7S A;  2Z3Y A;  4UVC A;  4BIZ A;  2EIJ C;  2WLJ A;  1W0K G;  3JD3 A;  4J9Z B;  4E2L A;  4JTD B;  1V55 B;  1M56 B;  5IY5 B;  2WLI B;  3SYP A;  3QO5 A;  3TCU A;  1AI5 A;  1JQ0 A;  2LFR A;  4FPP A;  3E35 A;  1NH2 D;  3ZN0 A;  3FYI B;  4I5S A;  4P9O A;  2ZXW C;  3CCE V;  1K97 A;  1YIT V;  1F4N A;  2P6J A;  3CCJ V;  3OEH G;  2JEX A;  2ZR3 A;  4MS2 A;  4MTX A;  1FXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...