2EZOA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
b'AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezoA00
4FK5C 2X7RB 2EZOA 1I5YA 5KA5A 3B8MA 1ENVA 1QCEA 1DF5A 1MG1A 3B8NA 4G2KA 3B77A 1F23A 1QBZA 4JPRA 1Y4MA 2EBOA 1I5XA 3M99B 3WFVA 3GWOA 4FJCC 1QR9A 4E2LA 4N21A 4N23A 1SZTA 5H9CA 2M7WA 3CP1A 2OT5A 3H01A 1JPXA 2P6JA 4JF3A 3MHHC 3K9AA 4JGSA 3CYOA 1EBOA 1JQ0A 2EZPA 1K34A 1MOFA 1DF4A 1QR8A 2MK3A 5CMUA 1Y66A 2LP7A 5CN0A 1DLBA 4FIPC 5HFMA 1K33A 3P30A 3MHSC 5HFLA 5KA6A
chains in the Genus database with same CATH superfamily
3L71H 4CS4A 4CH4A 4JI5O 3AG3B 2UXDB 3ML0A 4DR2O 2UXBO 4UVCA 2Q5ZA 3FB8C 1U97A 1BZKA 2ZR3A 1VF7A 1JPXA 4FLVA 4PDLA 1OCRC 1JQ0A 3AK1A 1AJNA 4EB6B 5B5EZ 3E2EA 2OWOA 1HNXB 2GUZB 2CTPA 4DV7O 1AJPA 1I5YA 3E83A 3B8MA 4FZ0A 3CS5A 4LF4O 4JYAO 3W7WA 3C90A 4JV5B 1IXMA 4ASUG 4FM1A 1BHBA 1KKDA 4K3AA 1HR0O 4LNUB 3X2QC 1VQNV 2MW2B 4JI6O 5LGUA 1XEQA 4FIPC 1A32A 3T1CA 3W7TA 4UCOA 1BGYH 1YF2A 2Q6AA 1S72V 1SQGA 2EILB 2ZE6A 1FFXB 3L73H 4KP4A 4YY3O 5JQGA 2YEVA 3K06A 2KG7B 2P22C 4JTCB 2A0LA 5LOVB 3K0GA 4AILC 1JJOA 4UUJC 3CX5F 2EX3A 2LP7A 1I94B 1KP3A 1KQSU 4K8XA 1DGSA 1HW7A 3ZHQA 1N34B 4DR3O 2Q4PA 2A3QA 4CC5A 2FYUH 4ZBMA 1S5HC 3RYCB 1W2BU 3CYOA 1M56C 1ZUQA 3FFQA 1PP9H 4PI2A 3BY6A 2WA4A 2BTQA 5KMGA 3SYPA 2VRZA 5JWPA 3FKSG 3K9SA 3UM7A 4CZZA 1EZJA 1WJZA 1I0HA 2Y0IA 2DE0X 3LSSA 5JQGB 1EN4A 2Q0OC 2UU9O 3OAAG 3U10A 1S3JA 5CN0A 5JCOA 1H2MA 1EZVH 4PA6A 2OCCB 4PA3A 3RYHA 3WB0A 3FB5C 4QJFB 5GW7A 5A2QN 3UT5A 3D36C 1XI1A 4NXMO 4W4LA 4WBNA 4WFGA 1J5EO 4FFBA 1G6UA 1SKVA 5KMGB 1QHTA 5IYDO 3AG2C 1BQZA 4I55A 4LBEC 4X9QA 1N33O 2E3CA 1VIBA 1TVKA 2RN9A 5FL7G 4B3SB 1H2NA 1OCCB 2VQFB 4G2KA 3E22A 3ZEDA 3JD3A 4JI1O 3NR7A 3QVNA 2ZNJA 1JA8A 1SESA 1EBOA 5IY5C 1LUVA 3CCLV 4ZOLB 4DR6O 3JARA 4DV3B 1URFA 3MHSC 3RYHB 2E5LO 3H1KH 2VWKA 1Q82W 5EBMC 5D5PA 4NKGB 4UCTA 1YTFD 2G38A 4JYCA 2YIBA 4KFMA 4DUZB 2UXCO 3UT5B 1XNQB 2JGDB 2WLLA 4FPPA 4LCUC 4QIWF 2UUCO 4FFBB 5BXZA 1K34A 1OJHA 2F4VO 4UCRA 3STZC 4ABMA 3M8AA 1HNZB 1JR9A 4LH6A 5IWAO 1NT2B 3E35A 2HP8A 1WP8A 2UUBO 3CMAV 3OGIB 1VMGA 4W4KA 5FLXN 3CCEV 2YI8A 4JZ2A 3HB3B 1K5QA 1RM1B 4X8AA 4ZI7A 3JALB 5JH7B 3LSUA 3U11A 1AILA 2BSKA 1XL6A 5KHGA 1YJWV 2VQEB 1GMGA 3DTUB 3K5MA 3CCMV 1RPOA 2ZINA 3J80N 4DK1A 1Y76A 3ZMVA 4IT5A 3SYCA 3B40A 3SPGA 2PF4E 4XDJA 1XMOB 3LUTB 1H2LA 2K9PA 2LFRA 4QPJA 1X4TA 2P4VA 3APOA 2IJIA 1SA0B 2YS8A 3A0RA 4GX0A 3L72H 5C8YA 2Q7HA 3PJSK 1FXKA 3KCXA 2Y69B 1Q7YW 4HNAA 1M1KW 2B5UA 4ZI7B 1W0JG 3SJCC 1IX9A 4X65B 5BR8B 5KHIA 4B3MO 1VQ5V 2OCHA 2GHYA 2WWWA 1FXKC 3R66A 4R8CA 3J81N 2X6BA 1R3LC 1Y76B 1XNRB 4LF8B 3F7VC 2F43G 3OW2U 4H37A 3G80A 1F51A 1QBZA 1Q3EA 4X1KA 1M93A 4O4IA 3A0HZ 4JYYA 4WFBV 5CBHA 2PUSA 5J2TB 4DV5B 4GT1A 3QO5A 5B1BC 3SDLA 1XMQO 3F5TA 4JTDB 4JI8B 4DV6B 3B2EE 5EYPA 1E1RG 2CGOA 4NVPA 4BIOA 2ATKC 1AB3A 3HR0A 4DV1O 2XTAA 3WFVA 2QKCA 2W0FC 4GKKB 1KUQA 2DYRC 3E89A 1CXZB 5LXTA 5J2UA 4ZHQB 2D2CB 2F95B 3RWRD 4JI2B 4MVZA 2QSAA 3K59A 4UCUA 4UVBA 5HFLA 3IAYA 2PTMA 3ABTA 1NTKH 1W59A 4LF7O 2GV9A 2DOSA 2QJ1A 4PDVA 1NH2D 4DR5O 4MVQA 1BS3A 4BW5A 4PA4A 4X1KB 2FL4A 2EIKB 4IGGA 4BIZA 5L3CA 1KBHA 1QU7A 1JMKC 4JYBA 4F6RA 4ICGA 4KHPB 5KAIZ 4PHZA 1V55C 3W7UA 3JSNA 2RDCA 5KX5B 1OCOB 3G6BA 3K5OA 3C3TA 3R65A 1EM1A 4LFAB 1V54B 3T1HB 4A5UB 3TETA 4MVOA 2D3OW 3QO8A 3CE2A 2DQ0A 4MVRA 2CK3G 1FJGB 3HKEA 4J42A 2WLHA 1PL4A 2Q69A 2JS3A 2QWPB 5LXTB 4F4LA 1WPBA 2EIMC 2F23A 4H0LB 5H5NA 3CCRV 1EFRG 3UO2A 3CC4V 1P7GA 4J7KA 2GDSA 2ZQMA 4OXSA 4IIJA 1WAZA 4BWAA 1IBKO 4PDRA 4J7JA 4X1YB 1VF5B 4WF9V 4NR1A 1KC8W 2EZPA 2Q67A 4JI3B 2HJDA 3CCVV 1IBLB 4DR7B 3M7MX 2FMLA 1KP2A 3BA8A 3VBBA 1KYOF 3ZRWA 5IJ0B 1MMMA 3IJ4A 3ABKB 5LHGA 3U0ZA 4O4LA 5LGTA 1R6TA 1UFIA 4JF3A 2NLJC 1PKXA 2BE3A 3AG4C 3FD9A 5HFMA 2W6IG 3WG7C 4LF6B 1K92A 1QVFU 1TA8A 1S76D 3CJHA 2RJZA 1NVPD 2ZCEA 1Z2GA 4LF5O 3HKDA 4TSFG 2ITDC 1BT8A 4LH7A 2IJJA 2P6JA 4YIPA 3CRRA 2Y48A 1Q6UA 3DGEA 1MZFA 4QGPA 3EHBB 4WFEA 5KHKA 2OTLV 4X20B 1QCEA 2AGAA 2KQXA 4LFCO 3IFXA 4NTXA 2ODMA 4K0KB 4O4LB 1S5JA 1XOUA 4HAMA 4UFZA 1US6A 1K8AW 1MA1A 3APQA 4DV0O 2Z5UA 3ABUA 1AR5A 3MHHC 3OGCC 2P7TC 1WLEA 2ILMA 3CRCA 2EINB 2Q7EA 4TUYB 2PYJA 2DN9A 1PL0A 1VF6A 1N36B 1VEWA 3CJHB 4U7OA 4JI7O 1F4NA 4J9ZB 3RYIA 3B4SA 1VQ7V 3G67A 3HKDB 3AK3A 1YTFB 2FB5A 4MTOA 4O2BB 3JATB 4B3TB 1YSCA 4MS2A 4DR4O 1VF6C 2UXNA 1Q8IA 1K5SA 4Q6GA 2F93B 3N27A 3N2KB 4FM0A 3ZS8C 4MT8A 4TT3G 2AW9A 1VQMV 3TXSA 2OTJV 1NU1H 4X89A 2ZD9A 1JOYA 2Q9LA 1VQ9V 3OEEG 1S77D 4FZ1A 3O65A 1PPJH 1IBMB 4I0XB 1HNXO 2QTSA 4LR3A 1JCHA 5B1AC 1FFTB 4MVSA 1UPGA 3TCUA 4XDLA 3OR7C 2RNBA 1Z5WA 4DUYB 5LBQA 4FLXA 1MNGA 1SETA 5FPOA 4DR2B 3CPWU 1FPOA 5EZYA 4D7SA 2UXBB 4DRXA 4OGQB 2CH7A 5BMVA 4F6EA 3FAVA 3LDEA 1M4UA 5L3GA 1K33A 4DK0A 2WLIA 1OCRB 2JDIG 1YJNV 3IC9A 2QWQB 5B66Z 4DV7B 3K04A 4LF4B 3AG1B 5DECA 3WB1A 3HKBA 1Z5VA 4ZKIA 3SPIA 5KHJA 3H01A 1Y74A 3D3IA 3E86A 4UVAA 1K3EA 1I94O 2QGNA 5L3FA 1HP8A 5B1OA 2ZE5A 4UV9A 4EEQA 3B09A 1XL4A 3FB6C 4YJ3A 3CMEV 3OT7A 2WLMA 3ASNC 1GKFA 3CB2A 3ICXA 2B1IA 1EN6A 4NB5A 2X0LA 3O9OA 2R70A 3K08A 4EFBA 1GN2A 4DRXB 3JD2A 2CH7B 3OUFA 1QR8A 1N0JA 4KUMA 1AI7A 2WLIB 5LHHA 4K35A 3T2MA 4J11A 1GO3F 4BR6A 5A9GA 5EC1C 1M90W 2XAHA 4DV4B 5EC2C 3K58A 3EFFK 2YXLA 2EIJC 1TUBA 5FPRA 4OX9O 1P7BA 3GVMA 3OTFA 2YEVB 2A06H 2HR3A 3CC7V 2RCVA 4O4JA 1DTOA 1K73W 3D36A 4QPKA 3T1YO 3ZRSA 2YIAA 4NXNB 4YJ3B 3EXAA 2R9AA 4NYKA 1WA8A 4RQEA 2ZXWC 3H1JH 2V4DA 1YI2V 2BCCH 4YXWG 1DK1A 2BTQB 4FVMA 3QO7A 4FK5C 3A8TA 3JCZA 4EKWA 3G71V 3ABMB 1K4CC 2JJ2G 4JTAB 4GX5A 1H2GA 4CBCA 3JAWA 4DV3O 4JAAA 4CH5A 2YSUB 3DXRA 4LF9O 1J5EB 2EJRA 4HYOA 4X64B 1ZSPA 5LYJA 1QLEC 1XNQO 2NR5A 4YIOA 3AG2B 1R73A 4X62B 3EVKA 2OIEA 4EFEA 1SZTA 4LFBB 5L3BA 1JVMA 3RYFA 4WBNB 1R6KA 2YICA 4CH6A 1HNZO 5L3DA 4AI8A 1R3JC 1ZWIC 1GM7A 4CH3A 5IY5B 1I7FA 4DR6B 4I55B 1TVKB 2E5LB 2OYQA 3HKCA 5LP6C 4GZRB 5CA3A 3E22B 1XHXA 2OT5A 3ZBHA 4X66B 3LSQA 4U7NA 2ZIMA 4CS2A 3MD0A 2UUCB 2IH3C 3C3SA 3OTOB 2ADPA 3OUSA 4GCZA 3OE7G 1BMFG 1NZ6A 3JARB 5LYJB 4IYHA 1AROP 3W7XA 4O4HA 3QF7A 4PV1B 1F23A 4OPHA 2EBOA 4DR1B 2XAFA 4JI4B 2UUBB 2WLLB 1OHHG 4IYIA 3RYFB 4JGSA 3S3WA 2ITCC 1KECA 1X59A 1AP6A 1VQPV 4HZ3A 4RO2A 4Z1VA 5CBFA 3K5LA 3Q4HA 1F4MA 5LMUO 3CCUV 4GKJB 1AI6A 1DF5A 4GUNA 2LW1A 1VQLV 4PD4F 5H2FZ 3QTCA 4QE7A 2P5OA 1BQ0A 3VQYA 2H8PC 3K79A 1NQTA 4X65O 5BR8O 1AJQA 5IYZA 4B08A 2RQ6A 1LNQA 1JJ2U 3DSQA 1VQ6V 2E74B 2A79B 2UXXA 2BSKB 1K9MW 5LA6A 1HNWO 4OPAA 1XNRO 2P90A 4DV2B 5LHIA 1YEWA 2FKXA 4FLUA 4J41A 2QTOA 4JAVA 1PNLA 1GAXA 2F66C 3AG7A 3I55V 4WFAV 4KL1A 2WA3A 3ZMUA 1CPYA 1Q90D 3JD0A 1M57B 3AK2A 4DV5O 2P4KA 3UQ8A 1O9HA 4DO2A 5JJNB 4JI8O 4DV6O 4O2AA 3P32A 5C8YB 5CB4A 1FXKB 3D8CA 4I9WA 3JD1A 3FYIB 2VWJA 3OM3B 3ZRXA 1VQ8V 4HNAB 5LMNB 5IYZB 1AR1B 1U96A 1KU9A 4FMTA 4YJ2A 5LA6B 2QWRB 2HKOA 4PELA 1BHAA 3VOUA 2M6YA 4WFFA 3RN4A 1XMQB 1ZAUA 3IGAC 2EIKC 1YCIA 4JI0O 5IJ9A 2ZM6B 1KB9F 1P84F 3KKYA 4DV1B 2BTOA 1GN6A 5EIBC 1FAFA 3IC7A 3JCUZ 4O4IB 3K5NA 1NJIW 4KHPO 1NR7A 4O2AB 1JFFA 5CB4B 3STLC 2L35A 3ZHTA 3RGBA 1ZTEA 5EK0A 4D7TA 1IZ3A 4B7KA 5EYPB 4AQYO 2DYRB 2UUAB 1FJGO 5KA5A 1YDXA 1IVSA 1Q5OA 4DR5B 1I5XA 1SRYA 3G6EV 5FNVA 4J9YB 1XUQA 3K0DA 5B3SC 1N32O 1P49A 2W0XA 5JJEB 5J2UB 3VQWA 2EULA 2WPDG 1ROPA 2YC0A 1DF4A 3BCCH 3SJAC 4MVMA 2Q73A 1IURA 1HWYA 2Z3YA 4MTFA 3OEHG 4YHHB 2XAQA 1ENVA 1FXHA 4TV8A 1N8RW 5J9PC 1Q43A 3SPCA 1AI4A 4BW9A 4JI3O 1IBLO 4DR7O 4F6RB 2JRIA 1JFFB 3E8HA 3SJBC 3ABKC 2A9HA 1BCCH 2DYSB 1M5IA 2EIMB 1GH6A 3JASA 2PI4A 4PI0A 3LDDA 1I08A 2DQ3A 2QWNB 1RSOA 4FLYA 4JPRA 3P3NA 3HKEB 2AXTZ 3TGUH 1B06A 3F5WC 1YIJV 1N4CA 2V7QG 1IBKB 3SPHA 2HHHB 3ASOC 4LF6O 4LWSA 3L9DA 2YDEA 2KB1A 3GB7C 5C93A 5CA1A 1G8MA 2CTQA 4Z2WA 4JZGA 4RQFA 2LGWA 4P9PA 1COWG 4IIJB 1OCZC 3E8FA 4X1IA 3H9VA 1T5EA 3JAKA 2QKSA 2XAJA 4PDMA 2R9IA 2IJHA 1SERA 2HG5C 2Y4UA 1K97A 3P30A 1R3KC 4H13B 3AG4B 3ZRWB 1D5NA 1THZA 1ZX3A 2O57A 3WG7B 4NTWA 2ZE8A 5GONA 4U3JA 4LF5B 3ZX6A 2ZR2A 1N36O 2LGQA 4I7ZB 3H1HH 1P4RA 2OIGA 4P9OA 3ZRVA 4I50A 2IU0A 3TXQA 5K1PA 5IYBO 3BA9A 5L3EA 3JYCA 2IU3A 3W7SA 1SZXA 2HVJC 4B3TO 4LFCB 3JAKB 3OMAB 4U3FH 4B3RB 1WB8A 1H8HG 4EB6A 3RFRA 5K1XA 2QKAA 2JIZG 3AG3C 4I5SA 2GUZA 4J10A 1KMIZ 3S3XA 2UXDO 2W6JG 5KLVH 3RT3C 1XHZA 5IYCO 1FKAO 5H6QA 3FYEB 2YXYA 1IBMO 2PGGA 3H1IH 4TOIA 1QLNA 2HEPA 1ZLZA 4LNUA 2HJFC 2JS5A 2JJ1G 1MABG 1WNSA 3ABLB 4DR4B 4DUYO 1R6NA 4JV5O 4PA9A 5EBWC 4JASA 4I50B 2CTRA 3RYIB 1FFXA 1Y4MA 2CUGA 3GWOA 4FFKA 4FLTA 4JI5B 5D5QA 2KG7A 2M7WA 3CP1A 5LOVA 2ZDIC 4RUFA 4BIUA 2ZKOA 2WAMA 1XQ8A 3ZN0A 2JEXA 1L0NH 2CTWA 2N74A 2NN4A 2EILC 4B7EA 3AG1C 3P3PA 4X88A 2KSDA 2LO1A 5EIBD 5B1AB 4R7CA 1BE3H 3RYCA 4JYAB 4GYCB 3BFRA 3GWKC 4MW8A 2DJVA 1QVGU 1HR0B 1N34O 2CAZC 5BY1A 3TJTA 4JI6B 5GTIZ 1MZEA 3X2QB 4G27B 1Y6XA 1MG1A 5EBLC 3CD6V 2IW5A 4RWUA 4HBNA 2EJ7A 2R9RB 5EZYB 2B1GA 3OD4A 4YY3B 2QWOB 4E4EA 5BMVB 2AZ0A 3FAVB 2V1DA 4UB6Z 4R50A 2AHZA 5E1AC 4DV4O 1L0LH 1H2KA 2AHYA 5JVDA 1SQBH 1NS1A 1MSWD 2ADQB 4TQDA 1H38A 4DR3B 5E79Z 3ETGA 3HKBB 1H8EG 2KKWA 3ASNB 1B6QA 1Y74B 4NXNO 2OCCC 4L87A 3A0BZ 1H2SB 4MTGA 1QNMA 3ZJZA 4G28B 1PM9A 2ZIOA 4TQFA 5KA6A 1TUEB 1M56B 2QM8A 1FD9A 1G1XB 3E8GA 1KKCA 4I4TA 5JJJB 3WU2Z 4IL6Z 2CDYA 1NTMH 2K1EA 2JK5C 4FJCC 3SGIA 3CC2V 3BRCA 2QA4V 1NTZH 4OX9B 1K7DA 1YVWA 2EIJB 2UU9B 1S0VA 4L8JA 4ZOLA 3WB2A 3KZIZ 1WP7A 1OCCC 3ABMC 3ZHRA 3T1YB 4B3SO 1JX9A 2VQFO 1VQ4V 2DMXA 5JVDB 4LP8A 2QR4A 3CEIA 1SC5B 3K57A 1XBLA 2JGDA 4E2LA 3NXSA 1SQVH 2N05A 1TUBB 2CE4A 5JCOC 4LC1A 3BABA 1NH2B 4JAUA 2X6AA 4O4JB 4X64O 4J80A 2ZXWB 5ITZA 4NXMB 2H3OA 1XILA 1KD1W 3CCSV 2GSMB 3ZN1A 1SQXH 1WB7A 3JD4A 1Y67A 4DUZO 2XHBA 4X62O 1WA8B 1PNKA 4I4TB 2NNUA 4LFBO 2PI5A 1N33B 2HFEC 1VARA 2HVKC 2BOCC 1D5AA 2XNDG 4P30A 1ZL8A 3SJQC 3JSLA 3RBZA 1EN5A 1BSMA 4UV8A 4BAYA 5LP6A 3ETDA 1GM9A 2ARHA 4QE9A 2WLJA 4JI1B 2PY5A 2Q68A 3OMIB 2XT9A 1AP5A 3J7AU 4MW3A 3G4SV 1SQFA 3FX7A 3N2GA 4LF9B 1UJWB 2QDOA 1GN3A 1R1BA 3BHPA 3E8BA 3JALA 5JH7A 4X66O 1QLEB 2GBOA 1GK9A 4FLWA 1J95A 2RMKB 3BAAA 4XBFA 3OTOO 2UXCB 4UCSA 3I5DA 3JAWB 5ITZB 1RM1C 1NKDA 2MK3A 3DXRB 1Y66A 2P67A 3OFNG 1LUWA 2F4VB 2R72A 1L8DA 4DR1O 5GTHZ 3CSXA 5IWAB 4JI4O 2DWEC 5LL6Y 3CRQA 4MVUA 1YITV 1XDCA 2VQEO 1ZL8B 5IE9A 3CRAA 2IM9A 1SA0A 5BZBA 2LW7A 1S5LZ 5LP6B 4FLZA 2IH1C 5CA0A 3BPZA 1XMOO 1MOFA 2Y0PA 1B3QA 1GTOA 5CMUA 2P06A 1DLBA 3SPJA 4GKJO 3N2GB 4DXWA 1G4YB 4DW1A 2Q8VA 4GX1A 4UXNA 3ZIAG 3B8NA 1NR1A 3L75H 3AEIA 3HKCB 1M9NA 1QQCA 2Y69C 2JVDA 3ZHSA 2GTSA 1SF9A 1PD3A 1NVPB 1F7YA 3ETQA 2ZE7A 1IDSA 1FXVA 4I9QA 4O4HB 1D2DA 5LMUB 3RVYA 1AI5A 4DV2O 1YJ9V 2HLDG 3CRMA 1NI8A 1VQKV 5J2TA 3CCQV 5KHHA 4LF8O 5CA0B 5H6RA 4Z1MG 2X6CA 5F2VO 1M57C 4RUEA 4TV9A 3TK1A 2WSSG 1NBMG 3Q4HB 1PNMA 1SS3A 4CS3A 2Z0AA 1OZ0A 4WCEV 2IBZH 1CP9A 2VS0A 3H1LH 3UCSC 3DC6A 4B3MB 1MSDA 4Q20A 2XASA 4KXRA 4ZHQA 2XAGA 5LMNO 1HNWB 1WN7A 1IXBA 1YXBA 3MDSA 4NTYA 2F1MA 3ETEA 1YHQV 3K03A 3THOA 3MAQA 5LGNA 1FS0G 4GKKO 4PJ0Z 5TISZ 2Y4TA 4JI2O 3CWBH 3VQVA 1L1FA 3VQXA 5KX5A 3QG5A 4IHJA 2ZM6O 2ZNIA 4TV9B 5B1BB 1GM8A 3UO3A 3B77A 2E75B 3ZHUA 3M99B 3ZCCA 4ZIBA 4GX2A 1OCOC 3D3QA 3KCYA 1FYJA 2QM4A 2E76B 1LR1A 5DN6G 2UUAO 1V54C 2IJKA 2QE7G 4LFAO 1SQQH 2C2AA 1O9GA 4H33A 3T1HO 2QEXV 5IDJA 2YIDA 3ZMSA 4D6TH 4JI0B 4GLXA 1XREA 4YJ2B 4LF7B 1B04A 4X1YA 2Q7GA 1GN4A 2DWDC 4UCVA 2JGUA 3K3WA 3FB7C 4AHCA 3ZMZA 4CC6A 1BL8A 2JEUA 4IHJB 4YHHO 3T4ZA 5IJ0A 3OMNB 4WFHA 1V55B 2X7RB 4AQYB 2PYLA 1PV0A 5IJ9B 5DEDA 2PZSA 2LFSA 1QR9A 4R6ZA 2DYSC 3BVOA 1V9PA 4MSWC 1N32B 4XDKA 4K8ZA 1Q6IA 1OV9A 3I56V 5B3SB 3F7YC 1R3IC 1W0KG 2N04A 1VP7A 5KUMA 3CCJV 1AVMA 2EZOA 1YZBA 3A2FA 2DW4A 4TWKA 5IT9N 2HHHO 2AZ2A 5FNVB 2L6LA 3RW0A 2YIBD 1E79G 1AR4A 3LNNA 1RPRA 5KUKA 1K4DC 4X20A 5AG2A 4DYLA 3CXHF 4DW0A 4TV8B 2LJ2A 3KG2A 5B1NA 1ORQC 2BOBC 2ETNA 4N21A 4QNHB 3LDCA 3K9AA 1N0NA 3ZHVA 3HPLC 3ASOB 3UKMA 4TUYA 1WPXA 4PA7A 3JASB 1VQOV 3RVZA 2LQTA 4K0KO 4UB8Z 3SYAA 1RSOB 3ZMTA 1GRJA 3PN1A 2XOKG 4MTXA 5H9CA 1Q86W 4J7ZA 3JAMN 1TAEA 3CHXA 2B9ZA 2EINC 1OCZB 3SR2C 4O2BA 3JATA 5DM6V 1Q6HA 3CXCU 4LWSB 1RFYA 4FM2A 4RAIA 2YI9A 3OR6C 2GTAA 2FTKA 3SYOA 5CA1B 3N2KA 1E1QG 2WLNA 2WLKA 2YXHA 1TGOA 1HDJA 5CBGA 5KAFZ 4B3RO 2H94A 4X1IB 1SQPH 2Q0AA 3L74H 4I0XA 3DC5A 3SYQA 4DV0B 4H44B 2QM7A 3LNMB 1RP3B 3L70H 3BEHA 1Q81W 4C7UA 2XUMA 4JI7B 5GONB 4N23A 2ZT9B 3T4DA 2CGNA 4U3JB 3ABLC 4P2ZA 2A7WA 2YUAA 3QNEA 2ZDIA 1CEZA
chains in the Genus database with same CATH topology
1JX9A 1VQ4V 2ZQMA 4LP8A 4OXSA 1LNQA 1JJ2U 3AG3B 3ML0A 1VQ6V 4PDRA 4UVCA 2A79B 2UXXA 4E2LA 3FB8C 1K9MW 3NXSA 2ZR3A 4WF9V 4LC1A 1NH2B 1JPXA 4JAUA 2P90A 2X6AA 1KC8W 4PDLA 1OCRC 5LHIA 1JQ0A 1AJNA 2ZXWB 2EZPA 3E2EA 2Q67A 3CCVV 1KP2A 1KD1W 3CCSV 2QTOA 2GSMB 3VBBA 3ZN1A 4JAVA 1PNLA 3ZRWA 3JD4A 1AJPA 1I5YA 3I55V 3E83A 3ABKB 3B8MA 4WFAV 1PNKA 2NNUA 5LHGA 3W7WA 3ZMUA 1CPYA 2PI5A 3JD0A 1M57B 2HFEC 2HVKC 1IXMA 4ASUG 2BOCC 2XNDG 4P30A 1KKDA 1BHBA 3SJQC 5LGTA 4DO2A 3RBZA 4JF3A 2NLJC 1PKXA 3P32A 4UV8A 4BAYA 3X2QC 3ETDA 1VQNV 1GM9A 4QE9A 3AG4C 2WLJA 1FXKB 2Q68A 3OMIB 3JD1A 4I9WA 3FYIB 5LGUA 3OM3B 5HFMA 2W6IG 3ZRXA 4FIPC 4MW3A 1VQ8V 3WG7C 3T1CA 3W7TA 3G4SV 1K92A 1QVFU 1S76D 1AR1B 2Q6AA 1UJWB 3E8BA 4FMTA 1S72V 2EILB 1NVPD 1QLEB 4TSFG 4KP4A 2ITDC 2YEVA 1GK9A 3K06A 4JTCB 2A0LA 1J95A 2IJJA 2HKOA 2P6JA 4XBFA 4PELA 3K0GA 3VOUA 1BHAA 4UUJC 1RM1C 4WFFA 1NKDA 2Y48A 3DGEA 2MK3A 1Y66A 2LP7A 2P67A 3EHBB 3OFNG 3IGAC 4WFEA 2EIKC 1KP3A 1KQSU 2OTLV 1QCEA 2DWEC 4ZBMA 4MVUA 3IFXA 1YITV 1S5HC 3IC7A 1NJIW 4HAMA 1K8AW 5BZBA 1NR7A 1W2BU 2Z5UA 3ABUA 3MHHC 3CYOA 2IH1C 1M56C 3STLC 3OGCC 2P7TC 3BY6A 1MOFA 1WLEA 5EK0A 1GTOA 5CMUA 1DLBA 2EINB 3SYPA 2DYRB 3SPJA 3FKSG 4DXWA 1G4YB 1PL0A 4GX1A 5KA5A 3UM7A 4CZZA 4UXNA 4U7OA 3ZIAG 3B8NA 1EZJA 1F4NA 4J9ZB 1NR1A 3AEIA 1VQ7V 1I5XA 1SRYA 1M9NA 3G6EV 4J9YB 3LSSA 3K0DA 5B3SC 2Y69C 1YTFB 4MTOA 3OAAG 1YSCA 4MS2A 1NVPB 1PD3A 1S3JA 2WPDG 2UXNA 1ROPA 1K5SA 1DF4A 5CN0A 4MVMA 1HWYA 2Z3YA 4PA6A 2OCCB 4PA3A 1FXVA 4MTFA 4MT8A 4TT3G 3OEHG 3FB5C 1VQMV 2XAQA 4QJFB 1ENVA 2OTJV 1FXHA 1N8RW 5GW7A 4X89A 5J9PC 3RVYA 1AI5A 2ZD9A 3SPCA 1AI4A 1YJ9V 2HLDG 1JOYA 1VQKV 1VQ9V 3OEEG 3CCQV 1S77D 4WFGA 3E8HA 5H6RA 3ABKC 2A9HA 2DYSB 1JCHA 5B1AC 4Z1MG 1FFTB 2X6CA 1M57C 4RUEA 5IYDO 2EIMB 3AG2C 4MVSA 3TK1A 2PI4A 4LBEC 2WSSG 1NBMG 3TCUA 4XDLA 1PNMA 3LDDA 5FL7G 3OR7C 2DQ3A 1OCCB 4G2KA 1OZ0A 4JPRA 4WCEV 5LBQA 1SETA 1CP9A 3F5WC 3CPWU 4Q20A 1YIJV 2XASA 3JD3A 2V7QG 3SPHA 3ASOC 1SESA 2XAGA 1EBOA 5IY5C 3CCLV 2KB1A 3LDEA 3GB7C 5C93A 1G8MA 5L3GA 1K33A 3MHSC 2WLIA 4RQFA 1OCRB 1Q82W 5EBMC 2JDIG 3ETEA 4P9PA 1YJNV 1YHQV 1YTFD 3K03A 4JYCA 1COWG 4KFMA 5LGNA 1OCZC 3K04A 3AG1B 1FS0G 3E8FA 4ZKIA 2WLLA 3SPIA 2QKSA 3H01A 4FPPA 4LCUC 2XAJA 4PDMA 4QIWF 3D3IA 3E86A 4UVAA 1K3EA 2R9IA 1L1FA 2IJHA 1SERA 5L3FA 2HG5C 1K34A 5B1OA 3STZC 1K97A 4UV9A 3P30A 1R3KC 1XL4A 3FB6C 5B1BB 1GM8A 3AG4B 3ZRWB 3CMEV 3E35A 1THZA 3WG7B 2WLMA 3ASNC 3B77A 1GKFA 1EFRG 2B1IA 3M99B 3ZCCA 3CMAV 4GX2A 2X0LA 3K08A 1OCOC 3CCEV 3JD2A 5DN6G 3OUFA 1V54C 1QR8A 3HB3B 2IJKA 2QE7G 2ZR2A 4H33A 2C2AA 4KUMA 1K5QA 1AI7A 2WLIB 5LHHA 1RM1B 4X8AA 3T2MA 2QEXV 5IDJA 1GO3F 1P4RA 4P9OA 3ZRVA 3ZMSA 5EC1C 2IU0A 1M90W 5IYBO 2XAHA 3JYCA 5L3EA 5EC2C 2IU3A 1XL6A 3W7SA 2HVJC 3EFFK 2EIJC 2DWDC 1YJWV 1P7BA 3OMAB 2YEVB 1GMGA 3DTUB 3CCMV 1RPOA 2HR3A 3K3WA 3CC7V 3FB7C 1DTOA 1H8HG 3ZMZA 1K73W 3D36A 4QPKA 1BL8A 3ZRSA 3ZMVA 2JEUA 3SYCA 3SPGA 2JIZG 3AG3C 4XDJA 3T4ZA 4I5SA 3LUTB 3OMNB 4WFHA 1V55B 2X7RB 2W6JG 4RQEA 5IYCO 5H6QA 2LFSA 2LFRA 1QR9A 3FYEB 4R6ZA 2ZXWC 4QPJA 1YI2V 2DYSC 2IJIA 3A0RA 4GX0A 1QLNA 4MSWC 4YXWG 3PJSK 4XDKA 1FXKA 2HJFC 3I56V 5B3SB 2Y69B 1Q7YW 3F7YC 2JJ1G 1R3IC 1MABG 1W0KG 3ABLB 3QO7A 1M1KW 5KUMA 4FK5C 1R6NA 3CCJV 2B5UA 2EZOA 4PA9A 1W0JG 5EBWC 4JASA 2DW4A 3JCZA 4EKWA 3G71V 3ABMB 4TWKA 1VQ5V 1K4CC 1Y4MA 2JJ2G 2GHYA 3GWOA 2WWWA 1FXKC 2M7WA 3CP1A 4JTAB 4GX5A 4R8CA 1H2GA 2ZDIC 4RUFA 4BIUA 2WAMA 4CBCA 2X6BA 3ZN0A 1R3LC 2JEXA 3RW0A 2YSUB 1E79G 1RPRA 2EJRA 4HYOA 2EILC 3AG1C 3F7VC 5KUKA 1K4DC 4X88A 2F43G 1QLEC 3OW2U 4H37A 5B1AB 1F51A 4R7CA 1QBZA 3AG2B 1R73A 3KG2A 5B1NA 1ORQC 2BOBC 4N21A 1SZTA 4QNHB 4WFBV 5CBHA 3LDCA 5L3BA 1JVMA 4GT1A 3K9AA 3QO5A 1R6KA 5B1BC 4MW8A 4JTDB 5L3DA 1QVGU 3HPLC 1R3JC 3ASOB 1E1RG 1ZWIC 3UKMA 1GM7A 1WPXA 4PA7A 5IY5B 3X2QB 2ATKC 4G27B 1VQOV 3RVZA 1MG1A 5EBLC 3SYAA 3ZMTA 3CD6V 2IW5A 3WFVA 5CA3A 2XOKG 2R9RB 4MTXA 5H9CA 1Q86W 2OT5A 2W0FC 2B1GA 2EINC 1OCZB 5DM6V 2DYRC 3LSQA 3E89A 4U7NA 3CXCU 3MD0A 4RAIA 2IH3C 3OR6C 4MVZA 2FTKA 3OUSA 4GCZA 4UVBA 2V1DA 3SYOA 3OE7G 5HFLA 1BMFG 1E1QG 2WLNA 3ABTA 1AROP 4R50A 2WLKA 2AHZA 5E1AC 3W7XA 4PDVA 1NH2D 2AHYA 4MVQA 5CBGA 4BW5A 1F23A 1MSWD 4PA4A 2EBOA 2EIKB 2H94A 1H38A 3ETGA 1H8EG 4BIZA 2XAFA 5L3CA 2WLLB 4JYBA 3ASNB 1B6QA 1OHHG 4JGSA 2OCCC 4L87A 1V55C 1KECA 2ITCC 3W7UA 4MTGA 3ZJZA 3SYQA 1VQPV 1OCOB 4G28B 2QM7A 5KA6A 4HZ3A 4RO2A 5CBFA 1TUEB 3R65A 3LNMB 1M56B 2QM8A 1F4MA 1V54B 3TETA 3CCUV 4MVOA 2D3OW 3E8GA 1AI6A 3QO8A 1DF5A 2DQ0A 4MVRA 2CK3G 3BEHA 1Q81W 2K1EA 2JK5C 4FJCC 1VQLV 2WLHA 4N23A 2Q69A 3CC2V 3T4DA 3ABLC 4P2ZA 2QA4V 4QE7A 4F4LA 1K7DA 2EIMC 2EIJB 3QNEA 2H8PC 3K79A 1S0VA 2ZDIA 1NQTA 1OCCC 3ABMC 3CCRV 1AJQA 1CEZA 3CC4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 C;  2X7R B;  2EZO A;  1I5Y A;  5KA5 A;  3B8M A;  1ENV A;  1QCE A;  1DF5 A;  1MG1 A;  3B8N A;  4G2K A;  3B77 A;  1F23 A;  1QBZ A;  4JPR A;  1Y4M A;  2EBO A;  1I5X A;  3M99 B;  3WFV A;  3GWO A;  4FJC C;  1QR9 A;  4E2L A;  4N21 A;  4N23 A;  1SZT A;  5H9C A;  2M7W A;  3CP1 A;  2OT5 A;  3H01 A;  1JPX A;  2P6J A;  4JF3 A;  3MHH C;  3K9A A;  4JGS A;  3CYO A;  1EBO A;  1JQ0 A;  2EZP A;  1K34 A;  1MOF A;  1DF4 A;  1QR8 A;  2MK3 A;  5CMU A;  1Y66 A;  2LP7 A;  5CN0 A;  1DLB A;  4FIP C;  5HFM A;  1K33 A;  3P30 A;  3MHS C;  5HFL A;  5KA6 A; 
#chains in the Genus database with same CATH topology
 3L71 H;  4CS4 A;  4CH4 A;  4JI5 O;  3AG3 B;  2UXD B;  3ML0 A;  4DR2 O;  2UXB O;  4UVC A;  2Q5Z A;  3FB8 C;  1U97 A;  1BZK A;  2ZR3 A;  1VF7 A;  1JPX A;  4FLV A;  4PDL A;  1OCR C;  1JQ0 A;  3AK1 A;  1AJN A;  4EB6 B;  5B5E Z;  3E2E A;  2OWO A;  1HNX B;  2GUZ B;  2CTP A;  4DV7 O;  1AJP A;  1I5Y A;  3E83 A;  3B8M A;  4FZ0 A;  3CS5 A;  4LF4 O;  4JYA O;  3W7W A;  3C90 A;  4JV5 B;  1IXM A;  4ASU G;  4FM1 A;  1BHB A;  1KKD A;  4K3A A;  1HR0 O;  4LNU B;  3X2Q C;  1VQN V;  2MW2 B;  4JI6 O;  5LGU A;  1XEQ A;  4FIP C;  1A32 A;  3T1C A;  3W7T A;  4UCO A;  1BGY H;  1YF2 A;  2Q6A A;  1S72 V;  1SQG A;  2EIL B;  2ZE6 A;  1FFX B;  3L73 H;  4KP4 A;  4YY3 O;  5JQG A;  2YEV A;  3K06 A;  2KG7 B;  2P22 C;  4JTC B;  2A0L A;  5LOV B;  3K0G A;  4AIL C;  1JJO A;  4UUJ C;  3CX5 F;  2EX3 A;  2LP7 A;  1I94 B;  1KP3 A;  1KQS U;  4K8X A;  1DGS A;  1HW7 A;  3ZHQ A;  1N34 B;  4DR3 O;  2Q4P A;  2A3Q A;  4CC5 A;  2FYU H;  4ZBM A;  1S5H C;  3RYC B;  1W2B U;  3CYO A;  1M56 C;  1ZUQ A;  3FFQ A;  1PP9 H;  4PI2 A;  3BY6 A;  2WA4 A;  2BTQ A;  5KMG A;  3SYP A;  2VRZ A;  5JWP A;  3FKS G;  3K9S A;  3UM7 A;  4CZZ A;  1EZJ A;  1WJZ A;  1I0H A;  2Y0I A;  2DE0 X;  3LSS A;  5JQG B;  1EN4 A;  2Q0O C;  2UU9 O;  3OAA G;  3U10 A;  1S3J A;  5CN0 A;  5JCO A;  1H2M A;  1EZV H;  4PA6 A;  2OCC B;  4PA3 A;  3RYH A;  3WB0 A;  3FB5 C;  4QJF B;  5GW7 A;  5A2Q N;  3UT5 A;  3D36 C;  1XI1 A;  4NXM O;  4W4L A;  4WBN A;  4WFG A;  1J5E O;  4FFB A;  1G6U A;  1SKV A;  5KMG B;  1QHT A;  5IYD O;  3AG2 C;  1BQZ A;  4I55 A;  4LBE C;  4X9Q A;  1N33 O;  2E3C A;  1VIB A;  1TVK A;  2RN9 A;  5FL7 G;  4B3S B;  1H2N A;  1OCC B;  2VQF B;  4G2K A;  3E22 A;  3ZED A;  3JD3 A;  4JI1 O;  3NR7 A;  3QVN A;  2ZNJ A;  1JA8 A;  1SES A;  1EBO A;  5IY5 C;  1LUV A;  3CCL V;  4ZOL B;  4DR6 O;  3JAR A;  4DV3 B;  1URF A;  3MHS C;  3RYH B;  2E5L O;  3H1K H;  2VWK A;  1Q82 W;  5EBM C;  5D5P A;  4NKG B;  4UCT A;  1YTF D;  2G38 A;  4JYC A;  2YIB A;  4KFM A;  4DUZ B;  2UXC O;  3UT5 B;  1XNQ B;  2JGD B;  2WLL A;  4FPP A;  4LCU C;  4QIW F;  2UUC O;  4FFB B;  5BXZ A;  1K34 A;  1OJH A;  2F4V O;  4UCR A;  3STZ C;  4ABM A;  3M8A A;  1HNZ B;  1JR9 A;  4LH6 A;  5IWA O;  1NT2 B;  3E35 A;  2HP8 A;  1WP8 A;  2UUB O;  3CMA V;  3OGI B;  1VMG A;  4W4K A;  5FLX N;  3CCE V;  2YI8 A;  4JZ2 A;  3HB3 B;  1K5Q A;  1RM1 B;  4X8A A;  4ZI7 A;  3JAL B;  5JH7 B;  3LSU A;  3U11 A;  1AIL A;  2BSK A;  1XL6 A;  5KHG A;  1YJW V;  2VQE B;  1GMG A;  3DTU B;  3K5M A;  3CCM V;  1RPO A;  2ZIN A;  3J80 N;  4DK1 A;  1Y76 A;  3ZMV A;  4IT5 A;  3SYC A;  3B40 A;  3SPG A;  2PF4 E;  4XDJ A;  1XMO B;  3LUT B;  1H2L A;  2K9P A;  2LFR A;  4QPJ A;  1X4T A;  2P4V A;  3APO A;  2IJI A;  1SA0 B;  2YS8 A;  3A0R A;  4GX0 A;  3L72 H;  5C8Y A;  2Q7H A;  3PJS K;  1FXK A;  3KCX A;  2Y69 B;  1Q7Y W;  4HNA A;  1M1K W;  2B5U A;  4ZI7 B;  1W0J G;  3SJC C;  1IX9 A;  4X65 B;  5BR8 B;  5KHI A;  4B3M O;  1VQ5 V;  2OCH A;  2GHY A;  2WWW A;  1FXK C;  3R66 A;  4R8C A;  3J81 N;  2X6B A;  1R3L C;  1Y76 B;  1XNR B;  4LF8 B;  3F7V C;  2F43 G;  3OW2 U;  4H37 A;  3G80 A;  1F51 A;  1QBZ A;  1Q3E A;  4X1K A;  1M93 A;  4O4I A;  3A0H Z;  4JYY A;  4WFB V;  5CBH A;  2PUS A;  5J2T B;  4DV5 B;  4GT1 A;  3QO5 A;  5B1B C;  3SDL A;  1XMQ O;  3F5T A;  4JTD B;  4JI8 B;  4DV6 B;  3B2E E;  5EYP A;  1E1R G;  2CGO A;  4NVP A;  4BIO A;  2ATK C;  1AB3 A;  3HR0 A;  4DV1 O;  2XTA A;  3WFV A;  2QKC A;  2W0F C;  4GKK B;  1KUQ A;  2DYR C;  3E89 A;  1CXZ B;  5LXT A;  5J2U A;  4ZHQ B;  2D2C B;  2F95 B;  3RWR D;  4JI2 B;  4MVZ A;  2QSA A;  3K59 A;  4UCU A;  4UVB A;  5HFL A;  3IAY A;  2PTM A;  3ABT A;  1NTK H;  1W59 A;  4LF7 O;  2GV9 A;  2DOS A;  2QJ1 A;  4PDV A;  1NH2 D;  4DR5 O;  4MVQ A;  1BS3 A;  4BW5 A;  4PA4 A;  4X1K B;  2FL4 A;  2EIK B;  4IGG A;  4BIZ A;  5L3C A;  1KBH A;  1QU7 A;  1JMK C;  4JYB A;  4F6R A;  4ICG A;  4KHP B;  5KAI Z;  4PHZ A;  1V55 C;  3W7U A;  3JSN A;  2RDC A;  5KX5 B;  1OCO B;  3G6B A;  3K5O A;  3C3T A;  3R65 A;  1EM1 A;  4LFA B;  1V54 B;  3T1H B;  4A5U B;  3TET A;  4MVO A;  2D3O W;  3QO8 A;  3CE2 A;  2DQ0 A;  4MVR A;  2CK3 G;  1FJG B;  3HKE A;  4J42 A;  2WLH A;  1PL4 A;  2Q69 A;  2JS3 A;  2QWP B;  5LXT B;  4F4L A;  1WPB A;  2EIM C;  2F23 A;  4H0L B;  5H5N A;  3CCR V;  1EFR G;  3UO2 A;  3CC4 V;  1P7G A;  4J7K A;  2GDS A;  2ZQM A;  4OXS A;  4IIJ A;  1WAZ A;  4BWA A;  1IBK O;  4PDR A;  4J7J A;  4X1Y B;  1VF5 B;  4WF9 V;  4NR1 A;  1KC8 W;  2EZP A;  2Q67 A;  4JI3 B;  2HJD A;  3CCV V;  1IBL B;  4DR7 B;  3M7M X;  2FML A;  1KP2 A;  3BA8 A;  3VBB A;  1KYO F;  3ZRW A;  5IJ0 B;  1MMM A;  3IJ4 A;  3ABK B;  5LHG A;  3U0Z A;  4O4L A;  5LGT A;  1R6T A;  1UFI A;  4JF3 A;  2NLJ C;  1PKX A;  2BE3 A;  3AG4 C;  3FD9 A;  5HFM A;  2W6I G;  3WG7 C;  4LF6 B;  1K92 A;  1QVF U;  1TA8 A;  1S76 D;  3CJH A;  2RJZ A;  1NVP D;  2ZCE A;  1Z2G A;  4LF5 O;  3HKD A;  4TSF G;  2ITD C;  1BT8 A;  4LH7 A;  2IJJ A;  2P6J A;  4YIP A;  3CRR A;  2Y48 A;  1Q6U A;  3DGE A;  1MZF A;  4QGP A;  3EHB B;  4WFE A;  5KHK A;  2OTL V;  4X20 B;  1QCE A;  2AGA A;  2KQX A;  4LFC O;  3IFX A;  4NTX A;  2ODM A;  4K0K B;  4O4L B;  1S5J A;  1XOU A;  4HAM A;  4UFZ A;  1US6 A;  1K8A W;  1MA1 A;  3APQ A;  4DV0 O;  2Z5U A;  3ABU A;  1AR5 A;  3MHH C;  3OGC C;  2P7T C;  1WLE A;  2ILM A;  3CRC A;  2EIN B;  2Q7E A;  4TUY B;  2PYJ A;  2DN9 A;  1PL0 A;  1VF6 A;  1N36 B;  1VEW A;  3CJH B;  4U7O A;  4JI7 O;  1F4N A;  4J9Z B;  3RYI A;  3B4S A;  1VQ7 V;  3G67 A;  3HKD B;  3AK3 A;  1YTF B;  2FB5 A;  4MTO A;  4O2B B;  3JAT B;  4B3T B;  1YSC A;  4MS2 A;  4DR4 O;  1VF6 C;  2UXN A;  1Q8I A;  1K5S A;  4Q6G A;  2F93 B;  3N27 A;  3N2K B;  4FM0 A;  3ZS8 C;  4MT8 A;  4TT3 G;  2AW9 A;  1VQM V;  3TXS A;  2OTJ V;  1NU1 H;  4X89 A;  2ZD9 A;  1JOY A;  2Q9L A;  1VQ9 V;  3OEE G;  1S77 D;  4FZ1 A;  3O65 A;  1PPJ H;  1IBM B;  4I0X B;  1HNX O;  2QTS A;  4LR3 A;  1JCH A;  5B1A C;  1FFT B;  4MVS A;  1UPG A;  3TCU A;  4XDL A;  3OR7 C;  2RNB A;  1Z5W A;  4DUY B;  5LBQ A;  4FLX A;  1MNG A;  1SET A;  5FPO A;  4DR2 B;  3CPW U;  1FPO A;  5EZY A;  4D7S A;  2UXB B;  4DRX A;  4OGQ B;  2CH7 A;  5BMV A;  4F6E A;  3FAV A;  3LDE A;  1M4U A;  5L3G A;  1K33 A;  4DK0 A;  2WLI A;  1OCR B;  2JDI G;  1YJN V;  3IC9 A;  2QWQ B;  5B66 Z;  4DV7 B;  3K04 A;  4LF4 B;  3AG1 B;  5DEC A;  3WB1 A;  3HKB A;  1Z5V A;  4ZKI A;  3SPI A;  5KHJ A;  3H01 A;  1Y74 A;  3D3I A;  3E86 A;  4UVA A;  1K3E A;  1I94 O;  2QGN A;  5L3F A;  1HP8 A;  5B1O A;  2ZE5 A;  4UV9 A;  4EEQ A;  3B09 A;  1XL4 A;  3FB6 C;  4YJ3 A;  3CME V;  3OT7 A;  2WLM A;  3ASN C;  1GKF A;  3CB2 A;  3ICX A;  2B1I A;  1EN6 A;  4NB5 A;  2X0L A;  3O9O A;  2R70 A;  3K08 A;  4EFB A;  1GN2 A;  4DRX B;  3JD2 A;  2CH7 B;  3OUF A;  1QR8 A;  1N0J A;  4KUM A;  1AI7 A;  2WLI B;  5LHH A;  4K35 A;  3T2M A;  4J11 A;  1GO3 F;  4BR6 A;  5A9G A;  5EC1 C;  1M90 W;  2XAH A;  4DV4 B;  5EC2 C;  3K58 A;  3EFF K;  2YXL A;  2EIJ C;  1TUB A;  5FPR A;  4OX9 O;  1P7B A;  3GVM A;  3OTF A;  2YEV B;  2A06 H;  2HR3 A;  3CC7 V;  2RCV A;  4O4J A;  1DTO A;  1K73 W;  3D36 A;  4QPK A;  3T1Y O;  3ZRS A;  2YIA A;  4NXN B;  4YJ3 B;  3EXA A;  2R9A A;  4NYK A;  1WA8 A;  4RQE A;  2ZXW C;  3H1J H;  2V4D A;  1YI2 V;  2BCC H;  4YXW G;  1DK1 A;  2BTQ B;  4FVM A;  3QO7 A;  4FK5 C;  3A8T A;  3JCZ A;  4EKW A;  3G71 V;  3ABM B;  1K4C C;  2JJ2 G;  4JTA B;  4GX5 A;  1H2G A;  4CBC A;  3JAW A;  4DV3 O;  4JAA A;  4CH5 A;  2YSU B;  3DXR A;  4LF9 O;  1J5E B;  2EJR A;  4HYO A;  4X64 B;  1ZSP A;  5LYJ A;  1QLE C;  1XNQ O;  2NR5 A;  4YIO A;  3AG2 B;  1R73 A;  4X62 B;  3EVK A;  2OIE A;  4EFE A;  1SZT A;  4LFB B;  5L3B A;  1JVM A;  3RYF A;  4WBN B;  1R6K A;  2YIC A;  4CH6 A;  1HNZ O;  5L3D A;  4AI8 A;  1R3J C;  1ZWI C;  1GM7 A;  4CH3 A;  5IY5 B;  1I7F A;  4DR6 B;  4I55 B;  1TVK B;  2E5L B;  2OYQ A;  3HKC A;  5LP6 C;  4GZR B;  5CA3 A;  3E22 B;  1XHX A;  2OT5 A;  3ZBH A;  4X66 B;  3LSQ A;  4U7N A;  2ZIM A;  4CS2 A;  3MD0 A;  2UUC B;  2IH3 C;  3C3S A;  3OTO B;  2ADP A;  3OUS A;  4GCZ A;  3OE7 G;  1BMF G;  1NZ6 A;  3JAR B;  5LYJ B;  4IYH A;  1ARO P;  3W7X A;  4O4H A;  3QF7 A;  4PV1 B;  1F23 A;  4OPH A;  2EBO A;  4DR1 B;  2XAF A;  4JI4 B;  2UUB B;  2WLL B;  1OHH G;  4IYI A;  3RYF B;  4JGS A;  3S3W A;  2ITC C;  1KEC A;  1X59 A;  1AP6 A;  1VQP V;  4HZ3 A;  4RO2 A;  4Z1V A;  5CBF A;  3K5L A;  3Q4H A;  1F4M A;  5LMU O;  3CCU V;  4GKJ B;  1AI6 A;  1DF5 A;  4GUN A;  2LW1 A;  1VQL V;  4PD4 F;  5H2F Z;  3QTC A;  4QE7 A;  2P5O A;  1BQ0 A;  3VQY A;  2H8P C;  3K79 A;  1NQT A;  4X65 O;  5BR8 O;  1AJQ A;  5IYZ A;  4B08 A;  2RQ6 A;  1LNQ A;  1JJ2 U;  3DSQ A;  1VQ6 V;  2E74 B;  2A79 B;  2UXX A;  2BSK B;  1K9M W;  5LA6 A;  1HNW O;  4OPA A;  1XNR O;  2P90 A;  4DV2 B;  5LHI A;  1YEW A;  2FKX A;  4FLU A;  4J41 A;  2QTO A;  4JAV A;  1PNL A;  1GAX A;  2F66 C;  3AG7 A;  3I55 V;  4WFA V;  4KL1 A;  2WA3 A;  3ZMU A;  1CPY A;  1Q90 D;  3JD0 A;  1M57 B;  3AK2 A;  4DV5 O;  2P4K A;  3UQ8 A;  1O9H A;  4DO2 A;  5JJN B;  4JI8 O;  4DV6 O;  4O2A A;  3P32 A;  5C8Y B;  5CB4 A;  1FXK B;  3D8C A;  4I9W A;  3JD1 A;  3FYI B;  2VWJ A;  3OM3 B;  3ZRX A;  1VQ8 V;  4HNA B;  5LMN B;  5IYZ B;  1AR1 B;  1U96 A;  1KU9 A;  4FMT A;  4YJ2 A;  5LA6 B;  2QWR B;  2HKO A;  4PEL A;  1BHA A;  3VOU A;  2M6Y A;  4WFF A;  3RN4 A;  1XMQ B;  1ZAU A;  3IGA C;  2EIK C;  1YCI A;  4JI0 O;  5IJ9 A;  2ZM6 B;  1KB9 F;  1P84 F;  3KKY A;  4DV1 B;  2BTO A;  1GN6 A;  5EIB C;  1FAF A;  3IC7 A;  3JCU Z;  4O4I B;  3K5N A;  1NJI W;  4KHP O;  1NR7 A;  4O2A B;  1JFF A;  5CB4 B;  3STL C;  2L35 A;  3ZHT A;  3RGB A;  1ZTE A;  5EK0 A;  4D7T A;  1IZ3 A;  4B7K A;  5EYP B;  4AQY O;  2DYR B;  2UUA B;  1FJG O;  5KA5 A;  1YDX A;  1IVS A;  1Q5O A;  4DR5 B;  1I5X A;  1SRY A;  3G6E V;  5FNV A;  4J9Y B;  1XUQ A;  3K0D A;  5B3S C;  1N32 O;  1P49 A;  2W0X A;  5JJE B;  5J2U B;  3VQW A;  2EUL A;  2WPD G;  1ROP A;  2YC0 A;  1DF4 A;  3BCC H;  3SJA C;  4MVM A;  2Q73 A;  1IUR A;  1HWY A;  2Z3Y A;  4MTF A;  3OEH G;  4YHH B;  2XAQ A;  1ENV A;  1FXH A;  4TV8 A;  1N8R W;  5J9P C;  1Q43 A;  3SPC A;  1AI4 A;  4BW9 A;  4JI3 O;  1IBL O;  4DR7 O;  4F6R B;  2JRI A;  1JFF B;  3E8H A;  3SJB C;  3ABK C;  2A9H A;  1BCC H;  2DYS B;  1M5I A;  2EIM B;  1GH6 A;  3JAS A;  2PI4 A;  4PI0 A;  3LDD A;  1I08 A;  2DQ3 A;  2QWN B;  1RSO A;  4FLY A;  4JPR A;  3P3N A;  3HKE B;  2AXT Z;  3TGU H;  1B06 A;  3F5W C;  1YIJ V;  1N4C A;  2V7Q G;  1IBK B;  3SPH A;  2HHH B;  3ASO C;  4LF6 O;  4LWS A;  3L9D A;  2YDE A;  2KB1 A;  3GB7 C;  5C93 A;  5CA1 A;  1G8M A;  2CTQ A;  4Z2W A;  4JZG A;  4RQF A;  2LGW A;  4P9P A;  1COW G;  4IIJ B;  1OCZ C;  3E8F A;  4X1I A;  3H9V A;  1T5E A;  3JAK A;  2QKS A;  2XAJ A;  4PDM A;  2R9I A;  2IJH A;  1SER A;  2HG5 C;  2Y4U A;  1K97 A;  3P30 A;  1R3K C;  4H13 B;  3AG4 B;  3ZRW B;  1D5N A;  1THZ A;  1ZX3 A;  2O57 A;  3WG7 B;  4NTW A;  2ZE8 A;  5GON A;  4U3J A;  4LF5 B;  3ZX6 A;  2ZR2 A;  1N36 O;  2LGQ A;  4I7Z B;  3H1H H;  1P4R A;  2OIG A;  4P9O A;  3ZRV A;  4I50 A;  2IU0 A;  3TXQ A;  5K1P A;  5IYB O;  3BA9 A;  5L3E A;  3JYC A;  2IU3 A;  3W7S A;  1SZX A;  2HVJ C;  4B3T O;  4LFC B;  3JAK B;  3OMA B;  4U3F H;  4B3R B;  1WB8 A;  1H8H G;  4EB6 A;  3RFR A;  5K1X A;  2QKA A;  2JIZ G;  3AG3 C;  4I5S A;  2GUZ A;  4J10 A;  1KMI Z;  3S3X A;  2UXD O;  2W6J G;  5KLV H;  3RT3 C;  1XHZ A;  5IYC O;  1FKA O;  5H6Q A;  3FYE B;  2YXY A;  1IBM O;  2PGG A;  3H1I H;  4TOI A;  1QLN A;  2HEP A;  1ZLZ A;  4LNU A;  2HJF C;  2JS5 A;  2JJ1 G;  1MAB G;  1WNS A;  3ABL B;  4DR4 B;  4DUY O;  1R6N A;  4JV5 O;  4PA9 A;  5EBW C;  4JAS A;  4I50 B;  2CTR A;  3RYI B;  1FFX A;  1Y4M A;  2CUG A;  3GWO A;  4FFK A;  4FLT A;  4JI5 B;  5D5Q A;  2KG7 A;  2M7W A;  3CP1 A;  5LOV A;  2ZDI C;  4RUF A;  4BIU A;  2ZKO A;  2WAM A;  1XQ8 A;  3ZN0 A;  2JEX A;  1L0N H;  2CTW A;  2N74 A;  2NN4 A;  2EIL C;  4B7E A;  3AG1 C;  3P3P A;  4X88 A;  2KSD A;  2LO1 A;  5EIB D;  5B1A B;  4R7C A;  1BE3 H;  3RYC A;  4JYA B;  4GYC B;  3BFR A;  3GWK C;  4MW8 A;  2DJV A;  1QVG U;  1HR0 B;  1N34 O;  2CAZ C;  5BY1 A;  3TJT A;  4JI6 B;  5GTI Z;  1MZE A;  3X2Q B;  4G27 B;  1Y6X A;  1MG1 A;  5EBL C;  3CD6 V;  2IW5 A;  4RWU A;  4HBN A;  2EJ7 A;  2R9R B;  5EZY B;  2B1G A;  3OD4 A;  4YY3 B;  2QWO B;  4E4E A;  5BMV B;  2AZ0 A;  3FAV B;  2V1D A;  4UB6 Z;  4R50 A;  2AHZ A;  5E1A C;  4DV4 O;  1L0L H;  1H2K A;  2AHY A;  5JVD A;  1SQB H;  1NS1 A;  1MSW D;  2ADQ B;  4TQD A;  1H38 A;  4DR3 B;  5E79 Z;  3ETG A;  3HKB B;  1H8E G;  2KKW A;  3ASN B;  1B6Q A;  1Y74 B;  4NXN O;  2OCC C;  4L87 A;  3A0B Z;  1H2S B;  4MTG A;  1QNM A;  3ZJZ A;  4G28 B;  1PM9 A;  2ZIO A;  4TQF A;  5KA6 A;  1TUE B;  1M56 B;  2QM8 A;  1FD9 A;  1G1X B;  3E8G A;  1KKC A;  4I4T A;  5JJJ B;  3WU2 Z;  4IL6 Z;  2CDY A;  1NTM H;  2K1E A;  2JK5 C;  4FJC C;  3SGI A;  3CC2 V;  3BRC A;  2QA4 V;  1NTZ H;  4OX9 B;  1K7D A;  1YVW A;  2EIJ B;  2UU9 B;  1S0V A;  4L8J A;  4ZOL A;  3WB2 A;  3KZI Z;  1WP7 A;  1OCC C;  3ABM C;  3ZHR A;  3T1Y B;  4B3S O;  1JX9 A;  2VQF O;  1VQ4 V;  2DMX A;  5JVD B;  4LP8 A;  2QR4 A;  3CEI A;  1SC5 B;  3K57 A;  1XBL A;  2JGD A;  4E2L A;  3NXS A;  1SQV H;  2N05 A;  1TUB B;  2CE4 A;  5JCO C;  4LC1 A;  3BAB A;  1NH2 B;  4JAU A;  2X6A A;  4O4J B;  4X64 O;  4J80 A;  2ZXW B;  5ITZ A;  4NXM B;  2H3O A;  1XIL A;  1KD1 W;  3CCS V;  2GSM B;  3ZN1 A;  1SQX H;  1WB7 A;  3JD4 A;  1Y67 A;  4DUZ O;  2XHB A;  4X62 O;  1WA8 B;  1PNK A;  4I4T B;  2NNU A;  4LFB O;  2PI5 A;  1N33 B;  2HFE C;  1VAR A;  2HVK C;  2BOC C;  1D5A A;  2XND G;  4P30 A;  1ZL8 A;  3SJQ C;  3JSL A;  3RBZ A;  1EN5 A;  1BSM A;  4UV8 A;  4BAY A;  5LP6 A;  3ETD A;  1GM9 A;  2ARH A;  4QE9 A;  2WLJ A;  4JI1 B;  2PY5 A;  2Q68 A;  3OMI B;  2XT9 A;  1AP5 A;  3J7A U;  4MW3 A;  3G4S V;  1SQF A;  3FX7 A;  3N2G A;  4LF9 B;  1UJW B;  2QDO A;  1GN3 A;  1R1B A;  3BHP A;  3E8B A;  3JAL A;  5JH7 A;  4X66 O;  1QLE B;  2GBO A;  1GK9 A;  4FLW A;  1J95 A;  2RMK B;  3BAA A;  4XBF A;  3OTO O;  2UXC B;  4UCS A;  3I5D A;  3JAW B;  5ITZ B;  1RM1 C;  1NKD A;  2MK3 A;  3DXR B;  1Y66 A;  2P67 A;  3OFN G;  1LUW A;  2F4V B;  2R72 A;  1L8D A;  4DR1 O;  5GTH Z;  3CSX A;  5IWA B;  4JI4 O;  2DWE C;  5LL6 Y;  3CRQ A;  4MVU A;  1YIT V;  1XDC A;  2VQE O;  1ZL8 B;  5IE9 A;  3CRA A;  2IM9 A;  1SA0 A;  5BZB A;  2LW7 A;  1S5L Z;  5LP6 B;  4FLZ A;  2IH1 C;  5CA0 A;  3BPZ A;  1XMO O;  1MOF A;  2Y0P A;  1B3Q A;  1GTO A;  5CMU A;  2P06 A;  1DLB A;  3SPJ A;  4GKJ O;  3N2G B;  4DXW A;  1G4Y B;  4DW1 A;  2Q8V A;  4GX1 A;  4UXN A;  3ZIA G;  3B8N A;  1NR1 A;  3L75 H;  3AEI A;  3HKC B;  1M9N A;  1QQC A;  2Y69 C;  2JVD A;  3ZHS A;  2GTS A;  1SF9 A;  1PD3 A;  1NVP B;  1F7Y A;  3ETQ A;  2ZE7 A;  1IDS A;  1FXV A;  4I9Q A;  4O4H B;  1D2D A;  5LMU B;  3RVY A;  1AI5 A;  4DV2 O;  1YJ9 V;  2HLD G;  3CRM A;  1NI8 A;  1VQK V;  5J2T A;  3CCQ V;  5KHH A;  4LF8 O;  5CA0 B;  5H6R A;  4Z1M G;  2X6C A;  5F2V O;  1M57 C;  4RUE A;  4TV9 A;  3TK1 A;  2WSS G;  1NBM G;  3Q4H B;  1PNM A;  1SS3 A;  4CS3 A;  2Z0A A;  1OZ0 A;  4WCE V;  2IBZ H;  1CP9 A;  2VS0 A;  3H1L H;  3UCS C;  3DC6 A;  4B3M B;  1MSD A;  4Q20 A;  2XAS A;  4KXR A;  4ZHQ A;  2XAG A;  5LMN O;  1HNW B;  1WN7 A;  1IXB A;  1YXB A;  3MDS A;  4NTY A;  2F1M A;  3ETE A;  1YHQ V;  3K03 A;  3THO A;  3MAQ A;  5LGN A;  1FS0 G;  4GKK O;  4PJ0 Z;  5TIS Z;  2Y4T A;  4JI2 O;  3CWB H;  3VQV A;  1L1F A;  3VQX A;  5KX5 A;  3QG5 A;  4IHJ A;  2ZM6 O;  2ZNI A;  4TV9 B;  5B1B B;  1GM8 A;  3UO3 A;  3B77 A;  2E75 B;  3ZHU A;  3M99 B;  3ZCC A;  4ZIB A;  4GX2 A;  1OCO C;  3D3Q A;  3KCY A;  1FYJ A;  2QM4 A;  2E76 B;  1LR1 A;  5DN6 G;  2UUA O;  1V54 C;  2IJK A;  2QE7 G;  4LFA O;  1SQQ H;  2C2A A;  1O9G A;  4H33 A;  3T1H O;  2QEX V;  5IDJ A;  2YID A;  3ZMS A;  4D6T H;  4JI0 B;  4GLX A;  1XRE A;  4YJ2 B;  4LF7 B;  1B04 A;  4X1Y A;  2Q7G A;  1GN4 A;  2DWD C;  4UCV A;  2JGU A;  3K3W A;  3FB7 C;  4AHC A;  3ZMZ A;  4CC6 A;  1BL8 A;  2JEU A;  4IHJ B;  4YHH O;  3T4Z A;  5IJ0 A;  3OMN B;  4WFH A;  1V55 B;  2X7R B;  4AQY B;  2PYL A;  1PV0 A;  5IJ9 B;  5DED A;  2PZS A;  2LFS A;  1QR9 A;  4R6Z A;  2DYS C;  3BVO A;  1V9P A;  4MSW C;  1N32 B;  4XDK A;  4K8Z A;  1Q6I A;  1OV9 A;  3I56 V;  5B3S B;  3F7Y C;  1R3I C;  1W0K G;  2N04 A;  1VP7 A;  5KUM A;  3CCJ V;  1AVM A;  2EZO A;  1YZB A;  3A2F A;  2DW4 A;  4TWK A;  5IT9 N;  2HHH O;  2AZ2 A;  5FNV B;  2L6L A;  3RW0 A;  2YIB D;  1E79 G;  1AR4 A;  3LNN A;  1RPR A;  5KUK A;  1K4D C;  4X20 A;  5AG2 A;  4DYL A;  3CXH F;  4DW0 A;  4TV8 B;  2LJ2 A;  3KG2 A;  5B1N A;  1ORQ C;  2BOB C;  2ETN A;  4N21 A;  4QNH B;  3LDC A;  3K9A A;  1N0N A;  3ZHV A;  3HPL C;  3ASO B;  3UKM A;  4TUY A;  1WPX A;  4PA7 A;  3JAS B;  1VQO V;  3RVZ A;  2LQT A;  4K0K O;  4UB8 Z;  3SYA A;  1RSO B;  3ZMT A;  1GRJ A;  3PN1 A;  2XOK G;  4MTX A;  5H9C A;  1Q86 W;  4J7Z A;  3JAM N;  1TAE A;  3CHX A;  2B9Z A;  2EIN C;  1OCZ B;  3SR2 C;  4O2B A;  3JAT A;  5DM6 V;  1Q6H A;  3CXC U;  4LWS B;  1RFY A;  4FM2 A;  4RAI A;  2YI9 A;  3OR6 C;  2GTA A;  2FTK A;  3SYO A;  5CA1 B;  3N2K A;  1E1Q G;  2WLN A;  2WLK A;  2YXH A;  1TGO A;  1HDJ A;  5CBG A;  5KAF Z;  4B3R O;  2H94 A;  4X1I B;  1SQP H;  2Q0A A;  3L74 H;  4I0X A;  3DC5 A;  3SYQ A;  4DV0 B;  4H44 B;  2QM7 A;  3LNM B;  1RP3 B;  3L70 H;  3BEH A;  1Q81 W;  4C7U A;  2XUM A;  4JI7 B;  5GON B;  4N23 A;  2ZT9 B;  3T4D A;  2CGN A;  4U3J B;  3ABL C;  4P2Z A;  2A7W A;  2YUA A;  3QNE A;  2ZDI A;  1CEZ A; 
#chains in the Genus database with same CATH homology
 1JX9 A;  1VQ4 V;  2ZQM A;  4LP8 A;  4OXS A;  1LNQ A;  1JJ2 U;  3AG3 B;  3ML0 A;  1VQ6 V;  4PDR A;  4UVC A;  2A79 B;  2UXX A;  4E2L A;  3FB8 C;  1K9M W;  3NXS A;  2ZR3 A;  4WF9 V;  4LC1 A;  1NH2 B;  1JPX A;  4JAU A;  2P90 A;  2X6A A;  1KC8 W;  4PDL A;  1OCR C;  5LHI A;  1JQ0 A;  1AJN A;  2ZXW B;  2EZP A;  3E2E A;  2Q67 A;  3CCV V;  1KP2 A;  1KD1 W;  3CCS V;  2QTO A;  2GSM B;  3VBB A;  3ZN1 A;  4JAV A;  1PNL A;  3ZRW A;  3JD4 A;  1AJP A;  1I5Y A;  3I55 V;  3E83 A;  3ABK B;  3B8M A;  4WFA V;  1PNK A;  2NNU A;  5LHG A;  3W7W A;  3ZMU A;  1CPY A;  2PI5 A;  3JD0 A;  1M57 B;  2HFE C;  2HVK C;  1IXM A;  4ASU G;  2BOC C;  2XND G;  4P30 A;  1KKD A;  1BHB A;  3SJQ C;  5LGT A;  4DO2 A;  3RBZ A;  4JF3 A;  2NLJ C;  1PKX A;  3P32 A;  4UV8 A;  4BAY A;  3X2Q C;  3ETD A;  1VQN V;  1GM9 A;  4QE9 A;  3AG4 C;  2WLJ A;  1FXK B;  2Q68 A;  3OMI B;  3JD1 A;  4I9W A;  3FYI B;  5LGU A;  3OM3 B;  5HFM A;  2W6I G;  3ZRX A;  4FIP C;  4MW3 A;  1VQ8 V;  3WG7 C;  3T1C A;  3W7T A;  3G4S V;  1K92 A;  1QVF U;  1S76 D;  1AR1 B;  2Q6A A;  1UJW B;  3E8B A;  4FMT A;  1S72 V;  2EIL B;  1NVP D;  1QLE B;  4TSF G;  4KP4 A;  2ITD C;  2YEV A;  1GK9 A;  3K06 A;  4JTC B;  2A0L A;  1J95 A;  2IJJ A;  2HKO A;  2P6J A;  4XBF A;  4PEL A;  3K0G A;  3VOU A;  1BHA A;  4UUJ C;  1RM1 C;  4WFF A;  1NKD A;  2Y48 A;  3DGE A;  2MK3 A;  1Y66 A;  2LP7 A;  2P67 A;  3EHB B;  3OFN G;  3IGA C;  4WFE A;  2EIK C;  1KP3 A;  1KQS U;  2OTL V;  1QCE A;  2DWE C;  4ZBM A;  4MVU A;  3IFX A;  1YIT V;  1S5H C;  3IC7 A;  1NJI W;  4HAM A;  1K8A W;  5BZB A;  1NR7 A;  1W2B U;  2Z5U A;  3ABU A;  3MHH C;  3CYO A;  2IH1 C;  1M56 C;  3STL C;  3OGC C;  2P7T C;  3BY6 A;  1MOF A;  1WLE A;  5EK0 A;  1GTO A;  5CMU A;  1DLB A;  2EIN B;  3SYP A;  2DYR B;  3SPJ A;  3FKS G;  4DXW A;  1G4Y B;  1PL0 A;  4GX1 A;  5KA5 A;  3UM7 A;  4CZZ A;  4UXN A;  4U7O A;  3ZIA G;  3B8N A;  1EZJ A;  1F4N A;  4J9Z B;  1NR1 A;  3AEI A;  1VQ7 V;  1I5X A;  1SRY A;  1M9N A;  3G6E V;  4J9Y B;  3LSS A;  3K0D A;  5B3S C;  2Y69 C;  1YTF B;  4MTO A;  3OAA G;  1YSC A;  4MS2 A;  1NVP B;  1PD3 A;  1S3J A;  2WPD G;  2UXN A;  1ROP A;  1K5S A;  1DF4 A;  5CN0 A;  4MVM A;  1HWY A;  2Z3Y A;  4PA6 A;  2OCC B;  4PA3 A;  1FXV A;  4MTF A;  4MT8 A;  4TT3 G;  3OEH G;  3FB5 C;  1VQM V;  2XAQ A;  4QJF B;  1ENV A;  2OTJ V;  1FXH A;  1N8R W;  5GW7 A;  4X89 A;  5J9P C;  3RVY A;  1AI5 A;  2ZD9 A;  3SPC A;  1AI4 A;  1YJ9 V;  2HLD G;  1JOY A;  1VQK V;  1VQ9 V;  3OEE G;  3CCQ V;  1S77 D;  4WFG A;  3E8H A;  5H6R A;  3ABK C;  2A9H A;  2DYS B;  1JCH A;  5B1A C;  4Z1M G;  1FFT B;  2X6C A;  1M57 C;  4RUE A;  5IYD O;  2EIM B;  3AG2 C;  4MVS A;  3TK1 A;  2PI4 A;  4LBE C;  2WSS G;  1NBM G;  3TCU A;  4XDL A;  1PNM A;  3LDD A;  5FL7 G;  3OR7 C;  2DQ3 A;  1OCC B;  4G2K A;  1OZ0 A;  4JPR A;  4WCE V;  5LBQ A;  1SET A;  1CP9 A;  3F5W C;  3CPW U;  4Q20 A;  1YIJ V;  2XAS A;  3JD3 A;  2V7Q G;  3SPH A;  3ASO C;  1SES A;  2XAG A;  1EBO A;  5IY5 C;  3CCL V;  2KB1 A;  3LDE A;  3GB7 C;  5C93 A;  1G8M A;  5L3G A;  1K33 A;  3MHS C;  2WLI A;  4RQF A;  1OCR B;  1Q82 W;  5EBM C;  2JDI G;  3ETE A;  4P9P A;  1YJN V;  1YHQ V;  1YTF D;  3K03 A;  4JYC A;  1COW G;  4KFM A;  5LGN A;  1OCZ C;  3K04 A;  3AG1 B;  1FS0 G;  3E8F A;  4ZKI A;  2WLL A;  3SPI A;  2QKS A;  3H01 A;  4FPP A;  4LCU C;  2XAJ A;  4PDM A;  4QIW F;  3D3I A;  3E86 A;  4UVA A;  1K3E A;  2R9I A;  1L1F A;  2IJH A;  1SER A;  5L3F A;  2HG5 C;  1K34 A;  5B1O A;  3STZ C;  1K97 A;  4UV9 A;  3P30 A;  1R3K C;  1XL4 A;  3FB6 C;  5B1B B;  1GM8 A;  3AG4 B;  3ZRW B;  3CME V;  3E35 A;  1THZ A;  3WG7 B;  2WLM A;  3ASN C;  3B77 A;  1GKF A;  1EFR G;  2B1I A;  3M99 B;  3ZCC A;  3CMA V;  4GX2 A;  2X0L A;  3K08 A;  1OCO C;  3CCE V;  3JD2 A;  5DN6 G;  3OUF A;  1V54 C;  1QR8 A;  3HB3 B;  2IJK A;  2QE7 G;  2ZR2 A;  4H33 A;  2C2A A;  4KUM A;  1K5Q A;  1AI7 A;  2WLI B;  5LHH A;  1RM1 B;  4X8A A;  3T2M A;  2QEX V;  5IDJ A;  1GO3 F;  1P4R A;  4P9O A;  3ZRV A;  3ZMS A;  5EC1 C;  2IU0 A;  1M90 W;  5IYB O;  2XAH A;  3JYC A;  5L3E A;  5EC2 C;  2IU3 A;  1XL6 A;  3W7S A;  2HVJ C;  3EFF K;  2EIJ C;  2DWD C;  1YJW V;  1P7B A;  3OMA B;  2YEV B;  1GMG A;  3DTU B;  3CCM V;  1RPO A;  2HR3 A;  3K3W A;  3CC7 V;  3FB7 C;  1DTO A;  1H8H G;  3ZMZ A;  1K73 W;  3D36 A;  4QPK A;  1BL8 A;  3ZRS A;  3ZMV A;  2JEU A;  3SYC A;  3SPG A;  2JIZ G;  3AG3 C;  4XDJ A;  3T4Z A;  4I5S A;  3LUT B;  3OMN B;  4WFH A;  1V55 B;  2X7R B;  2W6J G;  4RQE A;  5IYC O;  5H6Q A;  2LFS A;  2LFR A;  1QR9 A;  3FYE B;  4R6Z A;  2ZXW C;  4QPJ A;  1YI2 V;  2DYS C;  2IJI A;  3A0R A;  4GX0 A;  1QLN A;  4MSW C;  4YXW G;  3PJS K;  4XDK A;  1FXK A;  2HJF C;  3I56 V;  5B3S B;  2Y69 B;  1Q7Y W;  3F7Y C;  2JJ1 G;  1R3I C;  1MAB G;  1W0K G;  3ABL B;  3QO7 A;  1M1K W;  5KUM A;  4FK5 C;  1R6N A;  3CCJ V;  2B5U A;  2EZO A;  4PA9 A;  1W0J G;  5EBW C;  4JAS A;  2DW4 A;  3JCZ A;  4EKW A;  3G71 V;  3ABM B;  4TWK A;  1VQ5 V;  1K4C C;  1Y4M A;  2JJ2 G;  2GHY A;  3GWO A;  2WWW A;  1FXK C;  2M7W A;  3CP1 A;  4JTA B;  4GX5 A;  4R8C A;  1H2G A;  2ZDI C;  4RUF A;  4BIU A;  2WAM A;  4CBC A;  2X6B A;  3ZN0 A;  1R3L C;  2JEX A;  3RW0 A;  2YSU B;  1E79 G;  1RPR A;  2EJR A;  4HYO A;  2EIL C;  3AG1 C;  3F7V C;  5KUK A;  1K4D C;  4X88 A;  2F43 G;  1QLE C;  3OW2 U;  4H37 A;  5B1A B;  1F51 A;  4R7C A;  1QBZ A;  3AG2 B;  1R73 A;  3KG2 A;  5B1N A;  1ORQ C;  2BOB C;  4N21 A;  1SZT A;  4QNH B;  4WFB V;  5CBH A;  3LDC A;  5L3B A;  1JVM A;  4GT1 A;  3K9A A;  3QO5 A;  1R6K A;  5B1B C;  4MW8 A;  4JTD B;  5L3D A;  1QVG U;  3HPL C;  1R3J C;  3ASO B;  1E1R G;  1ZWI C;  3UKM A;  1GM7 A;  1WPX A;  4PA7 A;  5IY5 B;  3X2Q B;  2ATK C;  4G27 B;  1VQO V;  3RVZ A;  1MG1 A;  5EBL C;  3SYA A;  3ZMT A;  3CD6 V;  2IW5 A;  3WFV A;  5CA3 A;  2XOK G;  2R9R B;  4MTX A;  5H9C A;  1Q86 W;  2OT5 A;  2W0F C;  2B1G A;  2EIN C;  1OCZ B;  5DM6 V;  2DYR C;  3LSQ A;  3E89 A;  4U7N A;  3CXC U;  3MD0 A;  4RAI A;  2IH3 C;  3OR6 C;  4MVZ A;  2FTK A;  3OUS A;  4GCZ A;  4UVB A;  2V1D A;  3SYO A;  3OE7 G;  5HFL A;  1BMF G;  1E1Q G;  2WLN A;  3ABT A;  1ARO P;  4R50 A;  2WLK A;  2AHZ A;  5E1A C;  3W7X A;  4PDV A;  1NH2 D;  2AHY A;  4MVQ A;  5CBG A;  4BW5 A;  1F23 A;  1MSW D;  4PA4 A;  2EBO A;  2EIK B;  2H94 A;  1H38 A;  3ETG A;  1H8E G;  4BIZ A;  2XAF A;  5L3C A;  2WLL B;  4JYB A;  3ASN B;  1B6Q A;  1OHH G;  4JGS A;  2OCC C;  4L87 A;  1V55 C;  1KEC A;  2ITC C;  3W7U A;  4MTG A;  3ZJZ A;  3SYQ A;  1VQP V;  1OCO B;  4G28 B;  2QM7 A;  5KA6 A;  4HZ3 A;  4RO2 A;  5CBF A;  1TUE B;  3R65 A;  3LNM B;  1M56 B;  2QM8 A;  1F4M A;  1V54 B;  3TET A;  3CCU V;  4MVO A;  2D3O W;  3E8G A;  1AI6 A;  3QO8 A;  1DF5 A;  2DQ0 A;  4MVR A;  2CK3 G;  3BEH A;  1Q81 W;  2K1E A;  2JK5 C;  4FJC C;  1VQL V;  2WLH A;  4N23 A;  2Q69 A;  3CC2 V;  3T4D A;  3ABL C;  4P2Z A;  2QA4 V;  4QE7 A;  4F4L A;  1K7D A;  2EIM C;  2EIJ B;  3QNE A;  2H8P C;  3K79 A;  1S0V A;  2ZDI A;  1NQT A;  1OCC C;  3ABM C;  3CCR V;  1AJQ A;  1CEZ A;  3CC4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...