2EZOA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezoA00
3CYOA 2P6JA 1Y4MA 4G2KA 1ENVA 4FK5C 4JGSA 5CMUA 2EZOA 1QBZA 1QCEA 2LP7A 4JF3A 1JPXA 2MK3A 1Y66A 5CN0A 1JQ0A 1F23A 4N21A 1K33A 3CP1A 1EBOA 3MHSC 3P30A 4N23A 3M99B 3B8NA 2OT5A 5HFLA 4FJCC 4FIPC 5KA6A 2M7WA 3MHHC 1DF4A 3B77A 3GWOA 5H9CA 5HFMA 5KA5A 1I5YA 1DLBA 2X7RB 3B8MA 2EBOA 3WFVA 1I5XA 1MG1A 1QR9A 1DF5A 1SZTA 1MOFA 4JPRA 3K9AA 3H01A 2EZPA 1K34A 4E2LA 1QR8A
chains in the Genus database with same CATH superfamily
1GN2A 3J7AU 1SQQH 3D36A 3WB2A 4X64O 4FLWA 4KP4A 2CAZC 2IJKA 3CPWU 1OV9A 3CHXA 4ICGA 3N27A 1HWYA 2VS0A 2JIZG 1HNWB 4KHPO 2QDOA 1Y74A 3QTCA 4DR1B 1RSOB 1SESA 3FKSG 3FB6C 4WFHA 3BEHA 2KG7B 1HNXB 1AI6A 5IWAO 2EJ7A 3K59A 4AQYO 1Q7YW 2QWOB 1AROP 2XOKG 2VRZA 2GV9A 2EJRA 5IDJA 1I5YA 1KUQA 2YIBD 3E8FA 2VWKA 1JFFA 4DR7B 1P84F 4JPRA 2Q5ZA 3AG1C 4UXNA 1AI4A 3DTUB 3H01A 4YJ2A 4O4IA 5GTIZ 1P7GA 2ETNA 3H9VA 3JD3A 4CH4A 1Z5WA 4X8AA 4X65O 1TUEB 1JOYA 1FXVA 1VF6C 4GUNA 4YIPA 1NR1A 1ZUQA 3K5NA 4TT3G 3RYIB 5BR8O 1S76D 1V54C 3WB1A 1F7YA 2QTOA 2H94A 5JCOC 2YICA 3T1YO 4TQFA 1SKVA 4FPPA 2WLJA 1JQ0A 3TXQA 4TV9A 1CPYA 4MVSA 2W6JG 2DYSC 1N36B 1OCRC 5ITZB 3RN4A 1D2DA 2KQXA 2MW2B 3AG1B 1YSCA 4MT8A 4PI2A 1FXKA 4L8JA 4DR1O 1E79G 1PL0A 4DV4B 4K35A 4MVMA 3K5OA 3U10A 5IY5C 5LGNA 2YIAA 1N4CA 4N21A 4O4JA 2ZT9B 3O65A 1XMQB 4R6ZA 4LF6B 1V54B 1IBLB 2WWWA 3HKEA 4I55B 4DR7O 3RYCA 1H2NA 4TV8B 1IBMB 3ZMTA 4ZKIA 5CA1A 2AZ0A 4JTAB 1IURA 2MK3A 3SPCA 4U7NA 4U3JA 3JATB 1WP8A 5AG2A 5IJ0A 2ZDIC 3OTFA 2P67A 1H2LA 5CBHA 1IXMA 1VQKV 4WF9V 1NQTA 2X6CA 4PA6A 2GUZA 2Y0IA 5LOVA 2B9ZA 5IJ9B 4X62O 3WG7C 1N0NA 3BCCH 2YS8A 2LJ2A 4WBNA 1HNZB 1NI8A 2R9IA 3F5WC 4ZI7B 5FLXN 4O4LB 4DV3O 4I5SA 1O9HA 3EXAA 4PD4F 3K0DA 4BW5A 1JX9A 1YF2A 1ZTEA 5LHHA 1CP9A 3HKDB 4DW1A 3TJTA 4Q6GA 3RYHA 2OCHA 1LNQA 2CDYA 1EN6A 3OMAB 4UCVA 1YJ9V 4EFBA 4LF6O 1P49A 3ZCCA 2R70A 2KSDA 3S3XA 2D2CB 1WAZA 4G28B 4YXWG 1U96A 2V1DA 3CCSV 3BY6A 4IGGA 4XBFA 1JCHA 4B3MB 1CEZA 1N0JA 2AZ2A 3U0ZA 3SYAA 4Z2WA 4DR4O 5EC1C 3KKYA 1Z2GA 1N33B 3A0HZ 2Y4TA 2WSSG 1KQSU 2W0FC 4DV2B 4PDMA 3EFFK 5EIBC 2JS5A 5KAIZ 2Q7HA 2Q68A 4CC5A 1E1QG 1FD9A 1S3JA 1VQ5V 2DN9A 3MD0A 4J11A 1JR9A 3JSNA 4DV5O 1VQ6V 5F2VO 5HFMA 2YC0A 2JJ1G 2F23A 2VQFB 1SA0B 1AB3A 3JD1A 2CH7A 3G80A 2ZQMA 3ZMUA 3EHBB 5H6QA 4MS2A 1OCCB 2A0LA 4X66O 3FYIB 4RUFA 1R3JC 1M57C 4FFKA 4MVQA 2UXBB 3DGEA 4JI8B 2Y69C 3AG3C 4QPJA 3S3WA 3P3PA 2P6JA 3ZMZA 4JI0B 4B3MO 2DWEC 3HPLC 1BHBA 3C90A 3Q4HB 4YJ3B 1NKDA 5BXZA 2UXNA 3MHHC 1X4TA 4WFGA 4MW8A 4U7OA 3LUTB 1N33O 5J2UA 3E8GA 3G4SV 1Y76B 5BMVB 3LSUA 4X20A 3FYEB 1FJGB 1SS3A 3UT5A 2Y0PA 4QPKA 4PHZA 1W2BU 1UPGA 3E8BA 1VARA 2DQ0A 3AG2B 2JDIG 2R9AA 3RFRA 2EIMC 1M57B 4LH7A 4FIPC 4CH3A 2XAFA 2Y69B 3AG3B 4DV1B 4PV1B 4JYBA 3CE2A 2WLIA 1S5JA 2QKSA 2HEPA 5LA6A 4KXRA 1XHZA 3CCQV 1HW7A 4DV0O 5E1AC 2UUCO 5J9PC 3JAWA 4LF7B 3QF7A 4W4LA 3I55V 3LDDA 3UO3A 1BSMA 1IZ3A 1QLNA 4JTDB 3G6BA 3KG2A 3ZS8C 3HKBA 4FVMA 4JI8O 3SR2C 4LFCB 3X2QC 5IT9N 2YEVA 3BHPA 3FFQA 4B3SB 3QVNA 5CA0A 3ZHRA 4RO2A 2CTWA 4DV7B 5L3CA 2EIMB 5GW7A 2QR4A 4DK1A 2ATKC 5DM6V 2LGQA 2X6BA 1P4RA 4MSWC 4MVRA 3HB3B 1K73W 5FNVA 2ZXWC 4OX9O 2OTJV 4I9QA 1FJGO 4JYYA 3ETQA 1S72V 2W6IG 4NB5A 3K5MA 1K8AW 4LF4O 1XL4A 2BOBC 4LF8O 4JYCA 3FAVA 4JAUA 3E83A 1QCEA 4JI4B 2E3CA 4JAVA 4NTXA 2CTPA 3LNMB 2HJDA 2X6AA 2M7WA 3X2QB 1AP6A 1WA8A 1VQLV 5KA5A 2W0XA 4FM2A 4GX5A 4DR6B 1MOFA 2EZPA 4E2LA 1PL4A 4JV5O 5LMNO 4HZ3A 2PTMA 3BA8A 4I7ZB 4LP8A 1H2MA 5C8YB 1SZXA 1BQZA 4B3TB 3CRAA 1F23A 3SPGA 1TUBA 4LF7O 1I94B 1XREA 5KA6A 5EK0A 3GWOA 3ZEDA 4GKKB 1NZ6A 3CCRV 3GWKC 4BAYA 2EINB 4BIZA 1QR9A 4CBCA 5CN0A 5JJEB 3KCYA 4UVCA 1H38A 4FZ0A 2F1MA 4J9YB 1R6KA 5DN6G 4NTWA 3ETEA 3VOUA 5KHHA 3MAQA 4JI1B 1BL8A 3T2MA 1J95A 1M56B 2IBZH 3R65A 2HHHO 4JI4O 4GCZA 1JFFB 1FYJA 3D3IA 1N34B 3JCZA 4WFBV 4YJ2B 4KFMA 4BW9A 4FJCC 4O4IB 3BABA 4GYCB 4DR6O 4JAAA 2FL4A 4ABMA 4WFAV 5L3EA 4KHPB 4FMTA 3K5LA 1G8MA 4A5UB 1SQVH 2LFSA 1SQPH 4R8CA 1BGYH 3VQYA 3ICXA 2HG5C 1R3IC 5IWAB 1VP7A 2NLJC 3TGUH 4GKKO 1Q43A 1XOUA 2UXDO 2R9RB 4I9WA 2EULA 4TV9B 3OE7G 3CCJV 1PNMA 2ZNJA 5GTHZ 1FFTB 2P4VA 3N2GA 1FXKB 3CC4V 3ABMB 5JQGA 3CMEV 1KP3A 3G67A 4NTYA 4X65B 3OUSA 4JI1O 2A3QA 4YY3O 4JI7O 4GX1A 1K5QA 4O4JB 2B5UA 3F7VC 5BR8B 1M90W 1W0JG 2WA4A 5IYBO 4IL6Z 4EEQA 5C93A 2PF4E 3APQA 3B2EE 1YVWA 3HKEB 3DC6A 4ZHQA 3LDCA 5LP6A 4P9OA 3ZIAG 3CCLV 3RYCB 3T1YB 1Q81W 1N34O 2JK5C 5H5NA 4RAIA 5CA1B 3K9SA 1VQOV 4J7JA 3SYCA 4U3JB 1YTFB 4IYIA 1G6UA 3APOA 5IJ0B 2YXYA 2E76B 3G6EV 4JGSA 4MTGA 4DUZB 1HDJA 2RN9A 2GUZB 1Y6XA 5LOVB 4PA4A 1PD3A 3RGBA 1SQFA 2LW1A 2Y48A 3CC7V 4WBNB 4J41A 3L9DA 1H8EG 4QNHB 2JJ2G 4O4HA 1PV0A 2UXCB 4R50A 5GONA 1NTZH 1XBLA 1Y66A 2YIDA 3AG4C 5CA3A 2NR5A 5B66Z 2YSUB 3RYHB 2ZE8A 5KHJA 4FLXA 3VBBA 3OR7C 3E2EA 1Q86W 3ZX6A 3JALA 4F4LA 1N32O 2N74A 2Q0OC 4X62B 2BE3A 3H1LH 3P32A 4N23A 3K08A 3CRQA 5JH7A 1G1XB 1KYOF 1DTOA 2N05A 3OT7A 3IGAC 4DV3B 2OCCC 1VQ9V 3L74H 4MTXA 3LSSA 3CC2V 4LC1A 3AG4B 2ZD9A 3CYOA 4DUZO 3IAYA 4D7SA 5J2TA 5KX5A 5EIBD 3UCSC 1FS0G 2GBOA 4J7KA 2XAQA 2CUGA 2Z0AA 5H2FZ 2DOSA 3SYOA 4DYLA 2IJIA 3RWRD 5H6RA 4IIJA 1R6TA 3DXRA 3E22A 3PN1A 1GK9A 3SJCC 2QA4V 3VQXA 5B5EZ 1WNSA 2PI5A 4CZZA 1SQGA 1MZEA 1DGSA 2GDSA 4I50A 2UXCO 2YXLA 5CB4A 2Q7EA 3RT3C 2IM9A 3ZHSA 4C7UA 3CMAV 2UUBB 4QIWF 2CH7B 1S77D 1YZBA 2OCCB 2XAHA 4LF5B 1DF4A 5H9CA 4HAMA 4DR4B 1OCOC 1V9PA 4WFEA 4X89A 1B06A 2FYUH 1XNQB 4X1YA 3VQWA 1ZLZA 2DW4A 2VWJA 2UU9B 1MMMA 3T4DA 2Q9LA 4QGPA 1GMGA 2K1EA 4LH6A 3SJAC 4FZ1A 4DV5B 3ZRSA 1JMKC 2HR3A 4X9QA 5JJJB 5KHGA 4G2KA 2WLMA 2FTKA 3I56V 2P90A 1X59A 3E35A 2AGAA 5J2UB 4KUMA 4X20B 1WB8A 3MHSC 4I0XB 3UT5B 1NR7A 4UCRA 1JJOA 4X66B 1OCOB 5LMUO 2LW7A 4H0LB 3LSQA 2HVJC 4D6TH 2BTQA 3KZIZ 2CGOA 2A9HA 3OTOO 2VQEO 1L8DA 1XQ8A 4DV6B 1K4DC 2HKOA 5IYDO 4UB8Z 2UUBO 3TCUA 3OAAG 5LL6Y 4ZOLA 3CSXA 5B3SC 4LF5O 1OCCC 2WLIB 4CS4A 3BVOA 5LA6B 4NXNO 3C3TA 1YEWA 5FL7G 2F4VO 1PNKA 1XNQO 4UCOA 2G38A 3ZRVA 3JAWB 1YHQV 4MVZA 4TUYA 1N8RW 2UU9O 3HKBB 1AP5A 2GTSA 1Q6HA 2YEVB 3L71H 2E74B 5B1NA 5CA0B 2RCVA 2PYJA 4JZGA 3CJHB 3QG5A 4JTCB 2A79B 1VF6A 4YIOA 4UV8A 2ZIOA 4K8ZA 1B04A 3CRCA 5FNVB 1KU9A 3RYFA 2X0LA 5B3SB 5LYJA 4EKWA 4LFBO 4G27B 5JCOA 3M8AA 1WN7A 4DV0B 1SF9A 2UUCB 5L3FA 3AG2C 3STLC 3OEHG 5TISZ 3FAVB 2XNDG 2L35A 4FLUA 1US6A 3FB7C 1M93A 1S5LZ 2BSKA 4F6RA 4DV6O 1I0HA 3JARA 4DW0A 3W7SA 3N2KA 2FMLA 1WA8B 2JEUA 4H13B 4D7TA 3L75H 1NH2B 2ZINA 3ABKB 5A9GA 1MA1A 3L70H 2QKCA 2RQ6A 1UFIA 3BRCA 1NS1A 5IYZA 5FPOA 1IVSA 1L0LH 4Z1VA 2WAMA 2XTAA 4OX9B 3K57A 1TUBB 4OPAA 3HR0A 1VF7A 4XDJA 2IU0A 4IYHA 4LBEC 3F5TA 4FLZA 4F6EA 4LF4B 1Z5VA 2P06A 3OMIB 4LF8B 3P3NA 3RW0A 4QE9A 3EVKA 3ZN1A 4MVOA 3ZBHA 3IJ4A 1OZ0A 4HNAA 2ZDIA 1Q6UA 5E79Z 2X7RB 2LGWA 1PKXA 4K3AA 4FLTA 1Q3EA 3CRRA 1TAEA 3CB2A 3U11A 4J80A 3ABTA 1UJWB 2O57A 5EBMC 4JV5B 5LMNB 1COWG 4IHJA 1DK1A 4X1IA 1XUQA 2LQTA 3A2FA 1JJ2U 5LXTA 2ZR2A 2WLLA 3QO7A 2R72A 1TGOA 2IW5A 2YIBA 2D3OW 2ZCEA 2XASA 3FX7A 4AI8A 2Q73A 1THZA 4FM1A 5DECA 3H1JH 4LNUA 3D36C 5LP6C 5JVDA 1EZJA 5K1XA 1YTFD 2EINC 4GX0A 2HHHB 4MTOA 5IE9A 2DMXA 1GKFA 1TVKA 5BY1A 2RMKB 4BWAA 3K58A 2WLKA 3B77A 3N2GB 4DK0A 2ITCC 2Q4PA 2ZKOA 3ZHVA 1LUWA 1YITV 5JQGB 1IXBA 2K9PA 5K1PA 1XMOB 1XHXA 3J80N 1M56C 2BOCC 4DR3B 1WLEA 2Z5UA 1URFA 2HLDG 1H8HG 3ZMVA 1SQXH 1QNMA 1H2GA 1FAFA 3TK1A 4ZHQB 5LP6B 2Q69A 5KMGA 2UXDB 4MW3A 3ZHQA 3SYPA 1ZX3A 1Q6IA 3IC7A 3CWBH 2DYRB 1ORQC 1P7BA 4J7ZA 2ARHA 1EN5A 2A7WA 1W0KG 1F4MA 1Y74B 1VQNV 2V7QG 3R66A 2FB5A 4QE7A 4DXWA 3RVYA 3WFVA 1MG1A 1SZTA 4K0KO 4YY3B 2JVDA 4JI7B 3UM7A 4UCTA 3SPHA 1VQMV 1M9NA 3HKCA 3ABLC 4AILC 4NYKA 1D5AA 4MTFA 5CBGA 2LO1A 4ZIBA 3CCUV 4Z1MG 1XEQA 4O4HB 5GONB 1QLEC 1FXKC 2ZM6O 3ABMC 4DO2A 2N04A 3AK2A 4DUYB 1FFXA 1XMOO 1I08A 1IBKB 4LWSA 2HP8A 4DRXA 1LUVA 5CMUA 4DR3O 3OMNB 3ABUA 4TSFG 3JALB 3AK1A 1PPJH 1ZL8A 4UCUA 3SGIA 4E4EA 1XI1A 4R7CA 4JI3O 4H44B 4X1KA 1FKAO 3ABLB 1NVPB 1GN3A 3THOA 3JCUZ 5JH7B 1QR8A 3CD6V 3B09A 1ENVA 4GZRB 2QWPB 5KHIA 4EB6A 1QLEB 1CXZB 3A0BZ 3SJBC 3ASNB 1VEWA 3OGIB 2F93B 3NXSA 2HJFC 3UO2A 3JASA 3ZMSA 5J2TB 2NNUA 5KX5B 1JA8A 4B3RO 5KHKA 4K8XA 2ADPA 4YHHB 4TOIA 1NT2B 4JI5O 4JI6O 4IIJB 3DXRB 3E22B 2ZE7A 2LP7A 1N32B 2WLHA 3K3WA 5DEDA 4Q20A 5L3DA 1K7DA 3GB7C 4I50B 5A2QN 5CB4B 3OUFA 5HFLA 2F43G 4L87A 4B7EA 4DUYO 2EIKB 4O2AA 1IBKO 5L3BA 1ZWIC 4O2BA 4FFBA 1WB7A 5BZBA 4GKJB 2L6LA 4AHCA 1GM9A 3WU2Z 1HP8A 3W7TA 4X1YB 2DQ3A 3SYQA 5EZYA 3A0RA 3D8CA 3QO8A 2IH3C 2IJHA 1HR0O 2HVKC 3ZRWA 3JAMN 2KKWA 1YCIA 2UUAO 1Y4MA 3IC9A 3G71V 3UQ8A 4NXMB 5LGTA 2RJZA 1K33A 1MZFA 2JGDA 3K04A 3T1CA 2DE0X 3ML0A 1NJIW 4YHHO 1H2KA 2E5LO 4MVUA 2OIEA 1E1RG 2BCCH 1QHTA 1GTOA 3LDEA 5JJNB 3FB5C 1NTMH 3T1HB 2BTQB 2OWOA 1YIJV 1AJPA 1RPRA 1KC8W 3C3SA 4U3FH 2XUMA 4DR2B 2Q8VA 4XDKA 1QVFU 1MNGA 2PYLA 1K92A 1J5EB 1K9MW 4ZOLB 1R3KC 3JAKA 4PJ0Z 4JYAB 4GKJO 2QSAA 4I4TA 3CS5A 4P2ZA 1Y67A 4IT5A 1NH2D 5KAFZ 1HNWO 4TUYB 1SQBH 1R1BA 2V4DA 1M5IA 1OCZC 1R6NA 2KB1A 2QWQB 2EX3A 1KB9F 3BA9A 5LMUB 4P9PA 3JSLA 4NR1A 2EBOA 1M4UA 4FLVA 1DF5A 1A32A 1HNXO 3OTOB 2PGGA 1D5NA 2VQEB 1VQPV 4NXMO 4GT1A 2WPDG 2RNBA 4KL1A 5EYPA 4GLXA 4HBNA 1RFYA 3RVZA 2A06H 2PI4A 2IU3A 1GM7A 1W59A 1MABG 4CH5A 1NTKH 3RYFB 5B1AC 1S0VA 5LYJB 3ZJZA 1G4YB 4J10A 4NXNB 3ZHUA 2JRIA 1I5XA 1MSDA 2F4VB 2IJJA 1L0NH 2DYSB 1OCRB 2JGUA 1FXHA 3T1HO 4WCEV 2XT9A 4UCSA 2Q67A 2BSKB 5LBQA 1OCZB 4F6RB 4EFEA 1RSOA 3JARB 4DR2O 3N2KB 5FPRA 3K79A 1FPOA 2KG7A 3SJQC 3O9OA 1J5EO 5IY5B 4JYAO 1BS3A 3DSQA 2Q7GA 5IYZB 4HYOA 3PJSK 4RWUA 5LHIA 3W7XA 1N36O 3SDLA 1EBOA 5B1AB 4LFBB 3CXCU 3D3QA 1BZKA 4ZBMA 1KMIZ 1KD1W 5L3GA 4DV4O 1QU7A 2B1GA 3GVMA 1K34A 2LFRA 2PUSA 2QTSA 3I5DA 1QBZA 4HNAB 2OIGA 1O9GA 1K97A 1RPOA 3RYIA 3A8TA 3CP1A 1XMQO 1GRJA 5JWPA 1IBLO 1PNLA 4PA7A 2YDEA 3E89A 3FB8C 1XILA 1GM8A 3IFXA 3WG7B 1QQCA 4NKGB 4IHJB 4JI2B 3CCVV 1IBMO 4X1IB 3CCEV 2HFEC 5ITZA 1F4NA 5LXTB 1AI5A 3ASOC 1YDXA 2EIJC 4PI0A 2WLLB 3CXHF 2ITDC 4CC6A 1WPBA 3ABKC 3OR6C 3DC5A 2ADQB 3H1KH 4UB6Z 3KCXA 1PP9H 1AJNA 1SRYA 3H1HH 2H8PC 1ZSPA 4LCUC 5KLVH 1U97A 2IH1C 1HNZO 2OYQA 1IX9A 2QM7A 4LR3A 4I55A 1S5HC 2E75B 5KUMA 4TV8A 4LNUB 2QEXV 4PA9A 5JVDB 5LGUA 1Q8IA 1AR5A 2YUAA 3ASOB 2AHZA 3JATA 3CEIA 1TVKB 2EIJB 1H2SB 2YI8A 1IDSA 2FKXA 1GO3F 2CK3G 3ZHTA 2XHBA 2QKAA 4FK5C 3ETDA 4H37A 1KKCA 2EILC 4BR6A 4PDVA 1VQ7V 5IJ9A 1BMFG 5CBFA 2CGNA 3MDSA 3BPZA 4UVBA 4RQEA 4JI2O 4JZ2A 1AJQA 3K0GA 4ZI7A 4O4LA 1V55C 4B08A 2ZR3A 2XAGA 5KMGB 4FLYA 3UKMA 1GN6A 3P30A 1VQ4V 3M99B 2NN4A 4RQFA 1M1KW 1VIBA 3HKDA 2WA3A 1T5EA 1R73A 3RBZA 1QVGU 3NR7A 2QE7G 1AVMA 3ZRXA 1YI2V 4I0XA 3B4SA 5KUKA 3K03A 4DV2O 2BTOA 2EILB 3CCMV 3F7YC 1NVPD 4H33A 1YJWV 1BT8A 2F66C 2OTLV 2QM8A 2VQFO 2AXTZ 3HKCB 1WP7A 3JYCA 5IYCO 1V55B 4B7KA 1XDCA 3B40A 2ZNIA 5B1OA 2ZE5A 1SC5B 3CRMA 3W7WA 4LF9B 1WPXA 2P5OA 3W7UA 2C2AA 1GAXA 1FFXB 4P30A 4GX2A 2AHYA 3B8NA 2YXHA 4LWSB 4DRXB 1OHHG 1Q90D 5EBLC 2UXBO 3TXSA 2ILMA 3B8MA 2P22C 2UXXA 4J42A 3J81N 2RDCA 4JI0O 4K0KB 2P7TC 1K5SA 1ZL8B 3CJHA 4J9ZB 1B6QA 4DR5B 4PDLA 4TQDA 2Y4UA 1SA0A 4X1KB 2DYRC 3JD4A 1F51A 3E86A 2H3OA 2F95B 4FM0A 2ZIMA 1DLBA 4BIUA 2ZM6B 3BAAA 4EB6B 2QGNA 3AK3A 1KKDA 1I7FA 4XDLA 1ZAUA 4CS2A 3JASB 1GN4A 5D5PA 2DJVA 4JF3A 2Q6AA 3SPIA 2B1IA 3OFNG 3JD2A 1WJZA 1B3QA 3H1IH 3T4ZA 4TWKA 4DV1O 3OEEG 2CE4A 4OGQB 1RM1C 1SETA 1MSWD 1KBHA 5B1BC 3Q4HA 2P4KA 4YJ3A 3OM3B 2PY5A 4JI3B 2QJ1A 4LF9O 2ZE6A 1BHAA 1TA8A 1EZVH 4JASA 2AW9A 1Q82W 1NU1H 1PM9A 2JEXA 4NVPA 1AI7A 1EN4A 2ZXWB 2QWNB 4O2AB 1Y76A 5BMVA 1SERA 1LR1A 3BFRA 4UFZA 3E8HA 3L72H 2QM4A 1KECA 4O2BB 4FFBB 1VF5B 4LFCO 2CTRA 4B3SO 4DV7O 4B3RB 2JS3A 3STZC 1XNRB 1OJHA 3AG7A 2GHYA 5EZYB 4JI5B 2GTAA 3L73H 4DR5O 4JI6B 3ZN0A 3FD9A 2XAJA 1JPXA 1AR4A 3WB0A 4ASUG 4W4KA 1RM1B 3ZRWB 1EM1A 1VQ8V 5B1BB 1BE3H 4X88A 4QJFB 1RP3B 1YXBA 4WFFA 3CX5F 1K3EA 3ASNC 3QO5A 3OGCC 4UVAA 2JGDB 4PA3A 2QWRB 4LFAB 3ETGA 1XL6A 3OW2U 4X64B 1KP2A 2Z3YA 4PDRA 3VQVA 2CTQA 4UUJC 1Q5OA 3K9AA 4OXSA 1HR0B 5EBWC 1K4CC 1GH6A 4UV9A 3AEIA 5EC2C 2YI9A 4CS3A 2EIKC 4B3TO 3SPJA 1JVMA 2UUAB 1AILA 3K06A 3QNEA 1I94O 1YJNV 3JD0A 3TETA 1NBMG 4AQYB 3JAKB 4BIOA 2M6YA 4PELA 1ROPA 4I4TB 1XNRO 2E5LB 3OD4A 1EFRG 5LHGA 2ODMA 1L1FA 2EZOA 1BQ0A 1R3LC 2WLNA 2DWDC 4RUEA 1BCCH 5D5QA 3LNNA 2OT5A 1VMGA 4CH6A 5C8YA 3M7MX 5EYPB 2Q0AA 2PZSA 1AR1B 2GSMB 4LFAO 4OPHA
chains in the Genus database with same CATH topology
2JEUA 2DYSB 4HZ3A 1OCRB 3D36A 1FXHA 3ABKB 1NH2B 4LP8A 4KP4A 4WCEV 2IJKA 3CPWU 2Q67A 5LBQA 1F23A 3SPGA 1OCZB 1HWYA 5KA6A 3K79A 5EK0A 3GWOA 2JIZG 3SJQC 2WAMA 5IY5B 3CCRV 4BAYA 2EINB 4BIZA 1QR9A 4XDJA 4CBCA 2IU0A 5CN0A 1SESA 3FKSG 3FB6C 4HYOA 4WFHA 4LBEC 4UVCA 3BEHA 1H38A 1AI6A 3PJSK 5LHIA 1Q7YW 3W7XA 3OMIB 4J9YB 3RW0A 1EBOA 1R6KA 5B1AB 5DN6G 1AROP 2XOKG 3CXCU 4QE9A 3ZN1A 2EJRA 5IDJA 4ZBMA 1KD1W 4MVOA 3ETEA 3VOUA 1I5YA 1OZ0A 2ZDIA 3E8FA 5L3GA 2X7RB 1BL8A 4JPRA 1PKXA 1J95A 1M56B 3T2MA 2B1GA 3R65A 3AG1C 3H01A 1AI4A 3DTUB 1K34A 4UXNA 2LFRA 3ABTA 1UJWB 1QBZA 3JD3A 5EBMC 1K97A 4GCZA 1RPOA 1COWG 4X8AA 3CP1A 3D3IA 3JCZA 4WFBV 1JJ2U 4KFMA 4FJCC 1TUEB 1PNLA 1JOYA 1FXVA 2ZR2A 3E89A 4PA7A 3FB8C 1GM8A 1NR1A 3IFXA 3WG7B 4WFAV 2WLLA 4TT3G 5L3EA 3QO7A 4FMTA 3CCVV 3CCEV 1S76D 1V54C 2HFEC 2IW5A 1F4NA 2QTOA 3ASOC 1AI5A 1G8MA 2H94A 2LFSA 2EIJC 2D3OW 4R8CA 4FPPA 2WLLB 2WLJA 2ITDC 1JQ0A 2HG5C 1R3IC 1CPYA 4MVSA 2W6JG 2DYSC 2XASA 1OCRC 3ABKC 3OR6C 2NLJC 1THZA 2R9RB 1YSCA 3AG1B 1SRYA 1AJNA 4MT8A 4I9WA 1FXKA 2H8PC 1E79G 1PL0A 4LCUC 3OE7G 3CCJV 1PNMA 1EZJA 2IH1C 1FFTB 4MVMA 1YTFD 5IY5C 2QM7A 5LGNA 2EINC 1FXKB 1S5HC 4GX0A 4MTOA 3CC4V 4N21A 3ABMB 1GKFA 5KUMA 3CMEV 2QEXV 4PA9A 1KP3A 2WLKA 5LGUA 3B77A 4R6ZA 1V54B 2ITCC 3OUSA 2WWWA 3ASOB 2AHZA 4GX1A 1K5QA 2EIJB 1YITV 2B5UA 3F7VC 1M90W 1W0JG 1GO3F 5IYBO 2CK3G 5C93A 3ZMTA 4ZKIA 4FK5C 3ETDA 4H37A 3LDCA 4JTAB 2MK3A 1M56C 4P9OA 3SPCA 3ZIAG 4U7NA 3CCLV 2BOCC 1Q81W 1WLEA 2EILC 2Z5UA 2JK5C 2HLDG 4PDVA 1VQ7V 1H8HG 1BMFG 2ZDIC 4RAIA 3ZMVA 5CBFA 2P67A 1H2GA 4UVBA 4RQEA 3TK1A 5CBHA 1IXMA 1VQKV 1VQOV 4WF9V 1NQTA 1AJQA 3SYCA 2Q69A 1YTFB 2X6CA 3K0GA 4MW3A 4PA6A 3SYPA 3IC7A 1V55C 3WG7C 2ZR3A 3G6EV 2DYRB 4JGSA 1ORQC 1P7BA 4MTGA 2XAGA 1W0KG 3UKMA 2R9IA 1F4MA 3F5WC 3P30A 1VQ4V 3M99B 4RQFA 1M1KW 1VQNV 4PA4A 1PD3A 2V7QG 1R73A 4I5SA 3RBZA 1QVGU 2Y48A 3CC7V 4QE7A 2QE7G 4DXWA 3ZRXA 1YI2V 3K0DA 3RVYA 4BW5A 1JX9A 3WFVA 1MG1A 1SZTA 1CP9A 5LHHA 5KUKA 3K03A 1H8EG 4QNHB 2JJ2G 4R50A 3UM7A 2EILB 3SPHA 1M9NA 1VQMV 3CCMV 1LNQA 3ABLC 3F7YC 1NVPD 4H33A 3OMAB 1Y66A 4MTFA 5CBGA 3AG4C 5CA3A 1YJWV 3CCUV 4Z1MG 1YJ9V 2OTLV 2QM8A 2YSUB 1QLEC 1FXKC 3ABMC 3VBBA 3ZCCA 3OR7C 3JYCA 5IYCO 1V55B 4DO2A 3E2EA 1Q86W 5B1OA 4F4LA 4G28B 4YXWG 3W7WA 2V1DA 3CCSV 3BY6A 1WPXA 5CMUA 4XBFA 3W7UA 1JCHA 3OMNB 2C2AA 1CEZA 3ABUA 3P32A 4N23A 4P30A 4TSFG 3K08A 2AHYA 4GX2A 3B8NA 1OHHG 3SYAA 1DTOA 5EBLC 5EC1C 3IGAC 2OCCC 4R7CA 3B8MA 2UXXA 1VQ9V 4MTXA 3LSSA 3ABLB 1NVPB 3CC2V 2WSSG 4LC1A 1KQSU 2W0FC 3AG4B 1QR8A 2P7TC 1K5SA 2ZD9A 3CYOA 3CD6V 1ENVA 4J9ZB 1B6QA 4PDMA 3EFFK 1FS0G 4PDLA 1QLEB 2Q68A 2XAQA 1E1QG 3ASNB 3SYOA 1S3JA 1VQ5V 3NXSA 2DYRC 2IJIA 3JD4A 1F51A 3E86A 5H6RA 2HJFC 3MD0A 1VQ6V 3ZMSA 5HFMA 2NNUA 1GK9A 2JJ1G 1DLBA 4BIUA 2QA4V 1KKDA 2PI5A 4XDLA 3JD1A 4CZZA 2ZQMA 3ZMUA 3EHBB 5H6QA 4MS2A 2LP7A 4JF3A 2Q6AA 1OCCB 2B1IA 3SPIA 2WLHA 3JD2A 3K3WA 3OFNG 2A0LA 3CMAV 4Q20A 5L3DA 3T4ZA 4QIWF 3FYIB 1K7DA 3GB7C 1S77D 4RUFA 3OUFA 2OCCB 1R3JC 5HFLA 4TWKA 2XAHA 1DF4A 3OEEG 5H9CA 1M57C 4HAMA 2F43G 1RM1C 1SETA 4L87A 1MSWD 4MVQA 5B1BC 2EIKB 1OCOC 4WFEA 3DGEA 4X89A 3OM3B 2Y69C 3AG3C 1BHAA 5L3BA 4QPJA 1ZWIC 2P6JA 3ZMZA 4JASA 1Q82W 2DW4A 2DWEC 3HPLC 2JEXA 1BHBA 1AI7A 5BZBA 2ZXWB 3T4DA 1SERA 1GM9A 1NKDA 3W7TA 2DQ3A 3SYQA 3E8HA 2UXNA 1GMGA 1KECA 2K1EA 3MHHC 3A0RA 4WFGA 4MW8A 4U7OA 3LUTB 3ZRSA 3QO8A 2IH3C 2IJHA 3E8GA 3G4SV 2HVKC 3FYEB 3STZC 2HR3A 3ZRWA 4QPKA 2GHYA 1Y4MA 4G2KA 1W2BU 2WLMA 3E8BA 3ZN0A 2FTKA 3I56V 2P90A 2XAJA 3E35A 1JPXA 2DQ0A 3G71V 3AG2B 2JDIG 4KUMA 4ASUG 5LGTA 1K33A 2EIMC 1M57B 3MHSC 1RM1B 3ZRWB 3K04A 3T1CA 1VQ8V 5B1BB 1NR7A 4X88A 1OCOB 4FIPC 4QJFB 2XAFA 2Y69B 4WFFA 3AG3B 1K3EA 3ASNC 3ML0A 3OGCC 3QO5A 1NJIW 4UVAA 3LSQA 2HVJC 4MVUA 2A9HA 4JYBA 1E1RG 4PA3A 2WLIA 3ETGA 1K4DC 2QKSA 2HKOA 1XL6A 3OW2U 5IYDO 1GTOA 3LDEA 3CCQV 3FB5C 3TCUA 3OAAG 1KP2A 5E1AC 5J9PC 1YIJV 2Z3YA 1AJPA 1RPRA 5B3SC 1KC8W 1OCCC 2WLIB 4PDRA 3I55V 3LDDA 1QLNA 4JTDB 4XDKA 3KG2A 4UUJC 1QVFU 5FL7G 1K92A 1PNKA 3X2QC 2YEVA 1K9MW 1R3KC 3ZRVA 3K9AA 4OXSA 1YHQV 5EBWC 1K4CC 4RO2A 4UV9A 4MVZA 3AEIA 5EC2C 5L3CA 2EIMB 2EIKC 5GW7A 1N8RW 3SPJA 1JVMA 3K06A 3QNEA 1YJNV 4P2ZA 3JD0A 3TETA 1NBMG 2YEVB 2ATKC 1NH2D 5DM6V 2X6BA 4MSWC 1P4RA 4MVRA 5B1NA 3HB3B 1K73W 2ZXWC 1OCZC 1R6NA 2KB1A 4JTCB 2A79B 4PELA 1ROPA 2OTJV 4P9PA 2EBOA 1S72V 1DF5A 4UV8A 2W6IG 1K8AW 1EFRG 1XL4A 5LHGA 2BOBC 1VQPV 4JYCA 4JAUA 1L1FA 2EZOA 2X0LA 1QCEA 1R3LC 2WLNA 3E83A 4GT1A 5B3SB 2WPDG 4EKWA 4G27B 2DWDC 4JAVA 4RUEA 3RVZA 3LNMB 2PI4A 2IU3A 1GM7A 2OT5A 1MABG 5L3FA 2X6AA 2M7WA 3X2QB 3AG2C 3STLC 3OEHG 1VQLV 5KA5A 5B1AC 2XNDG 1S0VA 3ZJZA 1G4YB 3FB7C 4GX5A 1AR1B 2GSMB 1I5XA 1MOFA 2EZPA 2IJJA 4E2LA 3W7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYO A;  2P6J A;  1Y4M A;  4G2K A;  1ENV A;  4FK5 C;  4JGS A;  5CMU A;  2EZO A;  1QBZ A;  1QCE A;  2LP7 A;  4JF3 A;  1JPX A;  2MK3 A;  1Y66 A;  5CN0 A;  1JQ0 A;  1F23 A;  4N21 A;  1K33 A;  3CP1 A;  1EBO A;  3MHS C;  3P30 A;  4N23 A;  3M99 B;  3B8N A;  2OT5 A;  5HFL A;  4FJC C;  4FIP C;  5KA6 A;  2M7W A;  3MHH C;  1DF4 A;  3B77 A;  3GWO A;  5H9C A;  5HFM A;  5KA5 A;  1I5Y A;  1DLB A;  2X7R B;  3B8M A;  2EBO A;  3WFV A;  1I5X A;  1MG1 A;  1QR9 A;  1DF5 A;  1SZT A;  1MOF A;  4JPR A;  3K9A A;  3H01 A;  2EZP A;  1K34 A;  4E2L A;  1QR8 A; 
#chains in the Genus database with same CATH topology
 1GN2 A;  3J7A U;  1SQQ H;  3D36 A;  3WB2 A;  4X64 O;  4FLW A;  4KP4 A;  2CAZ C;  2IJK A;  3CPW U;  1OV9 A;  3CHX A;  4ICG A;  3N27 A;  1HWY A;  2VS0 A;  2JIZ G;  1HNW B;  4KHP O;  2QDO A;  1Y74 A;  3QTC A;  4DR1 B;  1RSO B;  1SES A;  3FKS G;  3FB6 C;  4WFH A;  3BEH A;  2KG7 B;  1HNX B;  1AI6 A;  5IWA O;  2EJ7 A;  3K59 A;  4AQY O;  1Q7Y W;  2QWO B;  1ARO P;  2XOK G;  2VRZ A;  2GV9 A;  2EJR A;  5IDJ A;  1I5Y A;  1KUQ A;  2YIB D;  3E8F A;  2VWK A;  1JFF A;  4DR7 B;  1P84 F;  4JPR A;  2Q5Z A;  3AG1 C;  4UXN A;  1AI4 A;  3DTU B;  3H01 A;  4YJ2 A;  4O4I A;  5GTI Z;  1P7G A;  2ETN A;  3H9V A;  3JD3 A;  4CH4 A;  1Z5W A;  4X8A A;  4X65 O;  1TUE B;  1JOY A;  1FXV A;  1VF6 C;  4GUN A;  4YIP A;  1NR1 A;  1ZUQ A;  3K5N A;  4TT3 G;  3RYI B;  5BR8 O;  1S76 D;  1V54 C;  3WB1 A;  1F7Y A;  2QTO A;  2H94 A;  5JCO C;  2YIC A;  3T1Y O;  4TQF A;  1SKV A;  4FPP A;  2WLJ A;  1JQ0 A;  3TXQ A;  4TV9 A;  1CPY A;  4MVS A;  2W6J G;  2DYS C;  1N36 B;  1OCR C;  5ITZ B;  3RN4 A;  1D2D A;  2KQX A;  2MW2 B;  3AG1 B;  1YSC A;  4MT8 A;  4PI2 A;  1FXK A;  4L8J A;  4DR1 O;  1E79 G;  1PL0 A;  4DV4 B;  4K35 A;  4MVM A;  3K5O A;  3U10 A;  5IY5 C;  5LGN A;  2YIA A;  1N4C A;  4N21 A;  4O4J A;  2ZT9 B;  3O65 A;  1XMQ B;  4R6Z A;  4LF6 B;  1V54 B;  1IBL B;  2WWW A;  3HKE A;  4I55 B;  4DR7 O;  3RYC A;  1H2N A;  4TV8 B;  1IBM B;  3ZMT A;  4ZKI A;  5CA1 A;  2AZ0 A;  4JTA B;  1IUR A;  2MK3 A;  3SPC A;  4U7N A;  4U3J A;  3JAT B;  1WP8 A;  5AG2 A;  5IJ0 A;  2ZDI C;  3OTF A;  2P67 A;  1H2L A;  5CBH A;  1IXM A;  1VQK V;  4WF9 V;  1NQT A;  2X6C A;  4PA6 A;  2GUZ A;  2Y0I A;  5LOV A;  2B9Z A;  5IJ9 B;  4X62 O;  3WG7 C;  1N0N A;  3BCC H;  2YS8 A;  2LJ2 A;  4WBN A;  1HNZ B;  1NI8 A;  2R9I A;  3F5W C;  4ZI7 B;  5FLX N;  4O4L B;  4DV3 O;  4I5S A;  1O9H A;  3EXA A;  4PD4 F;  3K0D A;  4BW5 A;  1JX9 A;  1YF2 A;  1ZTE A;  5LHH A;  1CP9 A;  3HKD B;  4DW1 A;  3TJT A;  4Q6G A;  3RYH A;  2OCH A;  1LNQ A;  2CDY A;  1EN6 A;  3OMA B;  4UCV A;  1YJ9 V;  4EFB A;  4LF6 O;  1P49 A;  3ZCC A;  2R70 A;  2KSD A;  3S3X A;  2D2C B;  1WAZ A;  4G28 B;  4YXW G;  1U96 A;  2V1D A;  3CCS V;  3BY6 A;  4IGG A;  4XBF A;  1JCH A;  4B3M B;  1CEZ A;  1N0J A;  2AZ2 A;  3U0Z A;  3SYA A;  4Z2W A;  4DR4 O;  5EC1 C;  3KKY A;  1Z2G A;  1N33 B;  3A0H Z;  2Y4T A;  2WSS G;  1KQS U;  2W0F C;  4DV2 B;  4PDM A;  3EFF K;  5EIB C;  2JS5 A;  5KAI Z;  2Q7H A;  2Q68 A;  4CC5 A;  1E1Q G;  1FD9 A;  1S3J A;  1VQ5 V;  2DN9 A;  3MD0 A;  4J11 A;  1JR9 A;  3JSN A;  4DV5 O;  1VQ6 V;  5F2V O;  5HFM A;  2YC0 A;  2JJ1 G;  2F23 A;  2VQF B;  1SA0 B;  1AB3 A;  3JD1 A;  2CH7 A;  3G80 A;  2ZQM A;  3ZMU A;  3EHB B;  5H6Q A;  4MS2 A;  1OCC B;  2A0L A;  4X66 O;  3FYI B;  4RUF A;  1R3J C;  1M57 C;  4FFK A;  4MVQ A;  2UXB B;  3DGE A;  4JI8 B;  2Y69 C;  3AG3 C;  4QPJ A;  3S3W A;  3P3P A;  2P6J A;  3ZMZ A;  4JI0 B;  4B3M O;  2DWE C;  3HPL C;  1BHB A;  3C90 A;  3Q4H B;  4YJ3 B;  1NKD A;  5BXZ A;  2UXN A;  3MHH C;  1X4T A;  4WFG A;  4MW8 A;  4U7O A;  3LUT B;  1N33 O;  5J2U A;  3E8G A;  3G4S V;  1Y76 B;  5BMV B;  3LSU A;  4X20 A;  3FYE B;  1FJG B;  1SS3 A;  3UT5 A;  2Y0P A;  4QPK A;  4PHZ A;  1W2B U;  1UPG A;  3E8B A;  1VAR A;  2DQ0 A;  3AG2 B;  2JDI G;  2R9A A;  3RFR A;  2EIM C;  1M57 B;  4LH7 A;  4FIP C;  4CH3 A;  2XAF A;  2Y69 B;  3AG3 B;  4DV1 B;  4PV1 B;  4JYB A;  3CE2 A;  2WLI A;  1S5J A;  2QKS A;  2HEP A;  5LA6 A;  4KXR A;  1XHZ A;  3CCQ V;  1HW7 A;  4DV0 O;  5E1A C;  2UUC O;  5J9P C;  3JAW A;  4LF7 B;  3QF7 A;  4W4L A;  3I55 V;  3LDD A;  3UO3 A;  1BSM A;  1IZ3 A;  1QLN A;  4JTD B;  3G6B A;  3KG2 A;  3ZS8 C;  3HKB A;  4FVM A;  4JI8 O;  3SR2 C;  4LFC B;  3X2Q C;  5IT9 N;  2YEV A;  3BHP A;  3FFQ A;  4B3S B;  3QVN A;  5CA0 A;  3ZHR A;  4RO2 A;  2CTW A;  4DV7 B;  5L3C A;  2EIM B;  5GW7 A;  2QR4 A;  4DK1 A;  2ATK C;  5DM6 V;  2LGQ A;  2X6B A;  1P4R A;  4MSW C;  4MVR A;  3HB3 B;  1K73 W;  5FNV A;  2ZXW C;  4OX9 O;  2OTJ V;  4I9Q A;  1FJG O;  4JYY A;  3ETQ A;  1S72 V;  2W6I G;  4NB5 A;  3K5M A;  1K8A W;  4LF4 O;  1XL4 A;  2BOB C;  4LF8 O;  4JYC A;  3FAV A;  4JAU A;  3E83 A;  1QCE A;  4JI4 B;  2E3C A;  4JAV A;  4NTX A;  2CTP A;  3LNM B;  2HJD A;  2X6A A;  2M7W A;  3X2Q B;  1AP6 A;  1WA8 A;  1VQL V;  5KA5 A;  2W0X A;  4FM2 A;  4GX5 A;  4DR6 B;  1MOF A;  2EZP A;  4E2L A;  1PL4 A;  4JV5 O;  5LMN O;  4HZ3 A;  2PTM A;  3BA8 A;  4I7Z B;  4LP8 A;  1H2M A;  5C8Y B;  1SZX A;  1BQZ A;  4B3T B;  3CRA A;  1F23 A;  3SPG A;  1TUB A;  4LF7 O;  1I94 B;  1XRE A;  5KA6 A;  5EK0 A;  3GWO A;  3ZED A;  4GKK B;  1NZ6 A;  3CCR V;  3GWK C;  4BAY A;  2EIN B;  4BIZ A;  1QR9 A;  4CBC A;  5CN0 A;  5JJE B;  3KCY A;  4UVC A;  1H38 A;  4FZ0 A;  2F1M A;  4J9Y B;  1R6K A;  5DN6 G;  4NTW A;  3ETE A;  3VOU A;  5KHH A;  3MAQ A;  4JI1 B;  1BL8 A;  3T2M A;  1J95 A;  1M56 B;  2IBZ H;  3R65 A;  2HHH O;  4JI4 O;  4GCZ A;  1JFF B;  1FYJ A;  3D3I A;  1N34 B;  3JCZ A;  4WFB V;  4YJ2 B;  4KFM A;  4BW9 A;  4FJC C;  4O4I B;  3BAB A;  4GYC B;  4DR6 O;  4JAA A;  2FL4 A;  4ABM A;  4WFA V;  5L3E A;  4KHP B;  4FMT A;  3K5L A;  1G8M A;  4A5U B;  1SQV H;  2LFS A;  1SQP H;  4R8C A;  1BGY H;  3VQY A;  3ICX A;  2HG5 C;  1R3I C;  5IWA B;  1VP7 A;  2NLJ C;  3TGU H;  4GKK O;  1Q43 A;  1XOU A;  2UXD O;  2R9R B;  4I9W A;  2EUL A;  4TV9 B;  3OE7 G;  3CCJ V;  1PNM A;  2ZNJ A;  5GTH Z;  1FFT B;  2P4V A;  3N2G A;  1FXK B;  3CC4 V;  3ABM B;  5JQG A;  3CME V;  1KP3 A;  3G67 A;  4NTY A;  4X65 B;  3OUS A;  4JI1 O;  2A3Q A;  4YY3 O;  4JI7 O;  4GX1 A;  1K5Q A;  4O4J B;  2B5U A;  3F7V C;  5BR8 B;  1M90 W;  1W0J G;  2WA4 A;  5IYB O;  4IL6 Z;  4EEQ A;  5C93 A;  2PF4 E;  3APQ A;  3B2E E;  1YVW A;  3HKE B;  3DC6 A;  4ZHQ A;  3LDC A;  5LP6 A;  4P9O A;  3ZIA G;  3CCL V;  3RYC B;  3T1Y B;  1Q81 W;  1N34 O;  2JK5 C;  5H5N A;  4RAI A;  5CA1 B;  3K9S A;  1VQO V;  4J7J A;  3SYC A;  4U3J B;  1YTF B;  4IYI A;  1G6U A;  3APO A;  5IJ0 B;  2YXY A;  2E76 B;  3G6E V;  4JGS A;  4MTG A;  4DUZ B;  1HDJ A;  2RN9 A;  2GUZ B;  1Y6X A;  5LOV B;  4PA4 A;  1PD3 A;  3RGB A;  1SQF A;  2LW1 A;  2Y48 A;  3CC7 V;  4WBN B;  4J41 A;  3L9D A;  1H8E G;  4QNH B;  2JJ2 G;  4O4H A;  1PV0 A;  2UXC B;  4R50 A;  5GON A;  1NTZ H;  1XBL A;  1Y66 A;  2YID A;  3AG4 C;  5CA3 A;  2NR5 A;  5B66 Z;  2YSU B;  3RYH B;  2ZE8 A;  5KHJ A;  4FLX A;  3VBB A;  3OR7 C;  3E2E A;  1Q86 W;  3ZX6 A;  3JAL A;  4F4L A;  1N32 O;  2N74 A;  2Q0O C;  4X62 B;  2BE3 A;  3H1L H;  3P32 A;  4N23 A;  3K08 A;  3CRQ A;  5JH7 A;  1G1X B;  1KYO F;  1DTO A;  2N05 A;  3OT7 A;  3IGA C;  4DV3 B;  2OCC C;  1VQ9 V;  3L74 H;  4MTX A;  3LSS A;  3CC2 V;  4LC1 A;  3AG4 B;  2ZD9 A;  3CYO A;  4DUZ O;  3IAY A;  4D7S A;  5J2T A;  5KX5 A;  5EIB D;  3UCS C;  1FS0 G;  2GBO A;  4J7K A;  2XAQ A;  2CUG A;  2Z0A A;  5H2F Z;  2DOS A;  3SYO A;  4DYL A;  2IJI A;  3RWR D;  5H6R A;  4IIJ A;  1R6T A;  3DXR A;  3E22 A;  3PN1 A;  1GK9 A;  3SJC C;  2QA4 V;  3VQX A;  5B5E Z;  1WNS A;  2PI5 A;  4CZZ A;  1SQG A;  1MZE A;  1DGS A;  2GDS A;  4I50 A;  2UXC O;  2YXL A;  5CB4 A;  2Q7E A;  3RT3 C;  2IM9 A;  3ZHS A;  4C7U A;  3CMA V;  2UUB B;  4QIW F;  2CH7 B;  1S77 D;  1YZB A;  2OCC B;  2XAH A;  4LF5 B;  1DF4 A;  5H9C A;  4HAM A;  4DR4 B;  1OCO C;  1V9P A;  4WFE A;  4X89 A;  1B06 A;  2FYU H;  1XNQ B;  4X1Y A;  3VQW A;  1ZLZ A;  2DW4 A;  2VWJ A;  2UU9 B;  1MMM A;  3T4D A;  2Q9L A;  4QGP A;  1GMG A;  2K1E A;  4LH6 A;  3SJA C;  4FZ1 A;  4DV5 B;  3ZRS A;  1JMK C;  2HR3 A;  4X9Q A;  5JJJ B;  5KHG A;  4G2K A;  2WLM A;  2FTK A;  3I56 V;  2P90 A;  1X59 A;  3E35 A;  2AGA A;  5J2U B;  4KUM A;  4X20 B;  1WB8 A;  3MHS C;  4I0X B;  3UT5 B;  1NR7 A;  4UCR A;  1JJO A;  4X66 B;  1OCO B;  5LMU O;  2LW7 A;  4H0L B;  3LSQ A;  2HVJ C;  4D6T H;  2BTQ A;  3KZI Z;  2CGO A;  2A9H A;  3OTO O;  2VQE O;  1L8D A;  1XQ8 A;  4DV6 B;  1K4D C;  2HKO A;  5IYD O;  4UB8 Z;  2UUB O;  3TCU A;  3OAA G;  5LL6 Y;  4ZOL A;  3CSX A;  5B3S C;  4LF5 O;  1OCC C;  2WLI B;  4CS4 A;  3BVO A;  5LA6 B;  4NXN O;  3C3T A;  1YEW A;  5FL7 G;  2F4V O;  1PNK A;  1XNQ O;  4UCO A;  2G38 A;  3ZRV A;  3JAW B;  1YHQ V;  4MVZ A;  4TUY A;  1N8R W;  2UU9 O;  3HKB B;  1AP5 A;  2GTS A;  1Q6H A;  2YEV B;  3L71 H;  2E74 B;  5B1N A;  5CA0 B;  2RCV A;  2PYJ A;  4JZG A;  3CJH B;  3QG5 A;  4JTC B;  2A79 B;  1VF6 A;  4YIO A;  4UV8 A;  2ZIO A;  4K8Z A;  1B04 A;  3CRC A;  5FNV B;  1KU9 A;  3RYF A;  2X0L A;  5B3S B;  5LYJ A;  4EKW A;  4LFB O;  4G27 B;  5JCO A;  3M8A A;  1WN7 A;  4DV0 B;  1SF9 A;  2UUC B;  5L3F A;  3AG2 C;  3STL C;  3OEH G;  5TIS Z;  3FAV B;  2XND G;  2L35 A;  4FLU A;  1US6 A;  3FB7 C;  1M93 A;  1S5L Z;  2BSK A;  4F6R A;  4DV6 O;  1I0H A;  3JAR A;  4DW0 A;  3W7S A;  3N2K A;  2FML A;  1WA8 B;  2JEU A;  4H13 B;  4D7T A;  3L75 H;  1NH2 B;  2ZIN A;  3ABK B;  5A9G A;  1MA1 A;  3L70 H;  2QKC A;  2RQ6 A;  1UFI A;  3BRC A;  1NS1 A;  5IYZ A;  5FPO A;  1IVS A;  1L0L H;  4Z1V A;  2WAM A;  2XTA A;  4OX9 B;  3K57 A;  1TUB B;  4OPA A;  3HR0 A;  1VF7 A;  4XDJ A;  2IU0 A;  4IYH A;  4LBE C;  3F5T A;  4FLZ A;  4F6E A;  4LF4 B;  1Z5V A;  2P06 A;  3OMI B;  4LF8 B;  3P3N A;  3RW0 A;  4QE9 A;  3EVK A;  3ZN1 A;  4MVO A;  3ZBH A;  3IJ4 A;  1OZ0 A;  4HNA A;  2ZDI A;  1Q6U A;  5E79 Z;  2X7R B;  2LGW A;  1PKX A;  4K3A A;  4FLT A;  1Q3E A;  3CRR A;  1TAE A;  3CB2 A;  3U11 A;  4J80 A;  3ABT A;  1UJW B;  2O57 A;  5EBM C;  4JV5 B;  5LMN B;  1COW G;  4IHJ A;  1DK1 A;  4X1I A;  1XUQ A;  2LQT A;  3A2F A;  1JJ2 U;  5LXT A;  2ZR2 A;  2WLL A;  3QO7 A;  2R72 A;  1TGO A;  2IW5 A;  2YIB A;  2D3O W;  2ZCE A;  2XAS A;  3FX7 A;  4AI8 A;  2Q73 A;  1THZ A;  4FM1 A;  5DEC A;  3H1J H;  4LNU A;  3D36 C;  5LP6 C;  5JVD A;  1EZJ A;  5K1X A;  1YTF D;  2EIN C;  4GX0 A;  2HHH B;  4MTO A;  5IE9 A;  2DMX A;  1GKF A;  1TVK A;  5BY1 A;  2RMK B;  4BWA A;  3K58 A;  2WLK A;  3B77 A;  3N2G B;  4DK0 A;  2ITC C;  2Q4P A;  2ZKO A;  3ZHV A;  1LUW A;  1YIT V;  5JQG B;  1IXB A;  2K9P A;  5K1P A;  1XMO B;  1XHX A;  3J80 N;  1M56 C;  2BOC C;  4DR3 B;  1WLE A;  2Z5U A;  1URF A;  2HLD G;  1H8H G;  3ZMV A;  1SQX H;  1QNM A;  1H2G A;  1FAF A;  3TK1 A;  4ZHQ B;  5LP6 B;  2Q69 A;  5KMG A;  2UXD B;  4MW3 A;  3ZHQ A;  3SYP A;  1ZX3 A;  1Q6I A;  3IC7 A;  3CWB H;  2DYR B;  1ORQ C;  1P7B A;  4J7Z A;  2ARH A;  1EN5 A;  2A7W A;  1W0K G;  1F4M A;  1Y74 B;  1VQN V;  2V7Q G;  3R66 A;  2FB5 A;  4QE7 A;  4DXW A;  3RVY A;  3WFV A;  1MG1 A;  1SZT A;  4K0K O;  4YY3 B;  2JVD A;  4JI7 B;  3UM7 A;  4UCT A;  3SPH A;  1VQM V;  1M9N A;  3HKC A;  3ABL C;  4AIL C;  4NYK A;  1D5A A;  4MTF A;  5CBG A;  2LO1 A;  4ZIB A;  3CCU V;  4Z1M G;  1XEQ A;  4O4H B;  5GON B;  1QLE C;  1FXK C;  2ZM6 O;  3ABM C;  4DO2 A;  2N04 A;  3AK2 A;  4DUY B;  1FFX A;  1XMO O;  1I08 A;  1IBK B;  4LWS A;  2HP8 A;  4DRX A;  1LUV A;  5CMU A;  4DR3 O;  3OMN B;  3ABU A;  4TSF G;  3JAL B;  3AK1 A;  1PPJ H;  1ZL8 A;  4UCU A;  3SGI A;  4E4E A;  1XI1 A;  4R7C A;  4JI3 O;  4H44 B;  4X1K A;  1FKA O;  3ABL B;  1NVP B;  1GN3 A;  3THO A;  3JCU Z;  5JH7 B;  1QR8 A;  3CD6 V;  3B09 A;  1ENV A;  4GZR B;  2QWP B;  5KHI A;  4EB6 A;  1QLE B;  1CXZ B;  3A0B Z;  3SJB C;  3ASN B;  1VEW A;  3OGI B;  2F93 B;  3NXS A;  2HJF C;  3UO2 A;  3JAS A;  3ZMS A;  5J2T B;  2NNU A;  5KX5 B;  1JA8 A;  4B3R O;  5KHK A;  4K8X A;  2ADP A;  4YHH B;  4TOI A;  1NT2 B;  4JI5 O;  4JI6 O;  4IIJ B;  3DXR B;  3E22 B;  2ZE7 A;  2LP7 A;  1N32 B;  2WLH A;  3K3W A;  5DED A;  4Q20 A;  5L3D A;  1K7D A;  3GB7 C;  4I50 B;  5A2Q N;  5CB4 B;  3OUF A;  5HFL A;  2F43 G;  4L87 A;  4B7E A;  4DUY O;  2EIK B;  4O2A A;  1IBK O;  5L3B A;  1ZWI C;  4O2B A;  4FFB A;  1WB7 A;  5BZB A;  4GKJ B;  2L6L A;  4AHC A;  1GM9 A;  3WU2 Z;  1HP8 A;  3W7T A;  4X1Y B;  2DQ3 A;  3SYQ A;  5EZY A;  3A0R A;  3D8C A;  3QO8 A;  2IH3 C;  2IJH A;  1HR0 O;  2HVK C;  3ZRW A;  3JAM N;  2KKW A;  1YCI A;  2UUA O;  1Y4M A;  3IC9 A;  3G71 V;  3UQ8 A;  4NXM B;  5LGT A;  2RJZ A;  1K33 A;  1MZF A;  2JGD A;  3K04 A;  3T1C A;  2DE0 X;  3ML0 A;  1NJI W;  4YHH O;  1H2K A;  2E5L O;  4MVU A;  2OIE A;  1E1R G;  2BCC H;  1QHT A;  1GTO A;  3LDE A;  5JJN B;  3FB5 C;  1NTM H;  3T1H B;  2BTQ B;  2OWO A;  1YIJ V;  1AJP A;  1RPR A;  1KC8 W;  3C3S A;  4U3F H;  2XUM A;  4DR2 B;  2Q8V A;  4XDK A;  1QVF U;  1MNG A;  2PYL A;  1K92 A;  1J5E B;  1K9M W;  4ZOL B;  1R3K C;  3JAK A;  4PJ0 Z;  4JYA B;  4GKJ O;  2QSA A;  4I4T A;  3CS5 A;  4P2Z A;  1Y67 A;  4IT5 A;  1NH2 D;  5KAF Z;  1HNW O;  4TUY B;  1SQB H;  1R1B A;  2V4D A;  1M5I A;  1OCZ C;  1R6N A;  2KB1 A;  2QWQ B;  2EX3 A;  1KB9 F;  3BA9 A;  5LMU B;  4P9P A;  3JSL A;  4NR1 A;  2EBO A;  1M4U A;  4FLV A;  1DF5 A;  1A32 A;  1HNX O;  3OTO B;  2PGG A;  1D5N A;  2VQE B;  1VQP V;  4NXM O;  4GT1 A;  2WPD G;  2RNB A;  4KL1 A;  5EYP A;  4GLX A;  4HBN A;  1RFY A;  3RVZ A;  2A06 H;  2PI4 A;  2IU3 A;  1GM7 A;  1W59 A;  1MAB G;  4CH5 A;  1NTK H;  3RYF B;  5B1A C;  1S0V A;  5LYJ B;  3ZJZ A;  1G4Y B;  4J10 A;  4NXN B;  3ZHU A;  2JRI A;  1I5X A;  1MSD A;  2F4V B;  2IJJ A;  1L0N H;  2DYS B;  1OCR B;  2JGU A;  1FXH A;  3T1H O;  4WCE V;  2XT9 A;  4UCS A;  2Q67 A;  2BSK B;  5LBQ A;  1OCZ B;  4F6R B;  4EFE A;  1RSO A;  3JAR B;  4DR2 O;  3N2K B;  5FPR A;  3K79 A;  1FPO A;  2KG7 A;  3SJQ C;  3O9O A;  1J5E O;  5IY5 B;  4JYA O;  1BS3 A;  3DSQ A;  2Q7G A;  5IYZ B;  4HYO A;  3PJS K;  4RWU A;  5LHI A;  3W7X A;  1N36 O;  3SDL A;  1EBO A;  5B1A B;  4LFB B;  3CXC U;  3D3Q A;  1BZK A;  4ZBM A;  1KMI Z;  1KD1 W;  5L3G A;  4DV4 O;  1QU7 A;  2B1G A;  3GVM A;  1K34 A;  2LFR A;  2PUS A;  2QTS A;  3I5D A;  1QBZ A;  4HNA B;  2OIG A;  1O9G A;  1K97 A;  1RPO A;  3RYI A;  3A8T A;  3CP1 A;  1XMQ O;  1GRJ A;  5JWP A;  1IBL O;  1PNL A;  4PA7 A;  2YDE A;  3E89 A;  3FB8 C;  1XIL A;  1GM8 A;  3IFX A;  3WG7 B;  1QQC A;  4NKG B;  4IHJ B;  4JI2 B;  3CCV V;  1IBM O;  4X1I B;  3CCE V;  2HFE C;  5ITZ A;  1F4N A;  5LXT B;  1AI5 A;  3ASO C;  1YDX A;  2EIJ C;  4PI0 A;  2WLL B;  3CXH F;  2ITD C;  4CC6 A;  1WPB A;  3ABK C;  3OR6 C;  3DC5 A;  2ADQ B;  3H1K H;  4UB6 Z;  3KCX A;  1PP9 H;  1AJN A;  1SRY A;  3H1H H;  2H8P C;  1ZSP A;  4LCU C;  5KLV H;  1U97 A;  2IH1 C;  1HNZ O;  2OYQ A;  1IX9 A;  2QM7 A;  4LR3 A;  4I55 A;  1S5H C;  2E75 B;  5KUM A;  4TV8 A;  4LNU B;  2QEX V;  4PA9 A;  5JVD B;  5LGU A;  1Q8I A;  1AR5 A;  2YUA A;  3ASO B;  2AHZ A;  3JAT A;  3CEI A;  1TVK B;  2EIJ B;  1H2S B;  2YI8 A;  1IDS A;  2FKX A;  1GO3 F;  2CK3 G;  3ZHT A;  2XHB A;  2QKA A;  4FK5 C;  3ETD A;  4H37 A;  1KKC A;  2EIL C;  4BR6 A;  4PDV A;  1VQ7 V;  5IJ9 A;  1BMF G;  5CBF A;  2CGN A;  3MDS A;  3BPZ A;  4UVB A;  4RQE A;  4JI2 O;  4JZ2 A;  1AJQ A;  3K0G A;  4ZI7 A;  4O4L A;  1V55 C;  4B08 A;  2ZR3 A;  2XAG A;  5KMG B;  4FLY A;  3UKM A;  1GN6 A;  3P30 A;  1VQ4 V;  3M99 B;  2NN4 A;  4RQF A;  1M1K W;  1VIB A;  3HKD A;  2WA3 A;  1T5E A;  1R73 A;  3RBZ A;  1QVG U;  3NR7 A;  2QE7 G;  1AVM A;  3ZRX A;  1YI2 V;  4I0X A;  3B4S A;  5KUK A;  3K03 A;  4DV2 O;  2BTO A;  2EIL B;  3CCM V;  3F7Y C;  1NVP D;  4H33 A;  1YJW V;  1BT8 A;  2F66 C;  2OTL V;  2QM8 A;  2VQF O;  2AXT Z;  3HKC B;  1WP7 A;  3JYC A;  5IYC O;  1V55 B;  4B7K A;  1XDC A;  3B40 A;  2ZNI A;  5B1O A;  2ZE5 A;  1SC5 B;  3CRM A;  3W7W A;  4LF9 B;  1WPX A;  2P5O A;  3W7U A;  2C2A A;  1GAX A;  1FFX B;  4P30 A;  4GX2 A;  2AHY A;  3B8N A;  2YXH A;  4LWS B;  4DRX B;  1OHH G;  1Q90 D;  5EBL C;  2UXB O;  3TXS A;  2ILM A;  3B8M A;  2P22 C;  2UXX A;  4J42 A;  3J81 N;  2RDC A;  4JI0 O;  4K0K B;  2P7T C;  1K5S A;  1ZL8 B;  3CJH A;  4J9Z B;  1B6Q A;  4DR5 B;  4PDL A;  4TQD A;  2Y4U A;  1SA0 A;  4X1K B;  2DYR C;  3JD4 A;  1F51 A;  3E86 A;  2H3O A;  2F95 B;  4FM0 A;  2ZIM A;  1DLB A;  4BIU A;  2ZM6 B;  3BAA A;  4EB6 B;  2QGN A;  3AK3 A;  1KKD A;  1I7F A;  4XDL A;  1ZAU A;  4CS2 A;  3JAS B;  1GN4 A;  5D5P A;  2DJV A;  4JF3 A;  2Q6A A;  3SPI A;  2B1I A;  3OFN G;  3JD2 A;  1WJZ A;  1B3Q A;  3H1I H;  3T4Z A;  4TWK A;  4DV1 O;  3OEE G;  2CE4 A;  4OGQ B;  1RM1 C;  1SET A;  1MSW D;  1KBH A;  5B1B C;  3Q4H A;  2P4K A;  4YJ3 A;  3OM3 B;  2PY5 A;  4JI3 B;  2QJ1 A;  4LF9 O;  2ZE6 A;  1BHA A;  1TA8 A;  1EZV H;  4JAS A;  2AW9 A;  1Q82 W;  1NU1 H;  1PM9 A;  2JEX A;  4NVP A;  1AI7 A;  1EN4 A;  2ZXW B;  2QWN B;  4O2A B;  1Y76 A;  5BMV A;  1SER A;  1LR1 A;  3BFR A;  4UFZ A;  3E8H A;  3L72 H;  2QM4 A;  1KEC A;  4O2B B;  4FFB B;  1VF5 B;  4LFC O;  2CTR A;  4B3S O;  4DV7 O;  4B3R B;  2JS3 A;  3STZ C;  1XNR B;  1OJH A;  3AG7 A;  2GHY A;  5EZY B;  4JI5 B;  2GTA A;  3L73 H;  4DR5 O;  4JI6 B;  3ZN0 A;  3FD9 A;  2XAJ A;  1JPX A;  1AR4 A;  3WB0 A;  4ASU G;  4W4K A;  1RM1 B;  3ZRW B;  1EM1 A;  1VQ8 V;  5B1B B;  1BE3 H;  4X88 A;  4QJF B;  1RP3 B;  1YXB A;  4WFF A;  3CX5 F;  1K3E A;  3ASN C;  3QO5 A;  3OGC C;  4UVA A;  2JGD B;  4PA3 A;  2QWR B;  4LFA B;  3ETG A;  1XL6 A;  3OW2 U;  4X64 B;  1KP2 A;  2Z3Y A;  4PDR A;  3VQV A;  2CTQ A;  4UUJ C;  1Q5O A;  3K9A A;  4OXS A;  1HR0 B;  5EBW C;  1K4C C;  1GH6 A;  4UV9 A;  3AEI A;  5EC2 C;  2YI9 A;  4CS3 A;  2EIK C;  4B3T O;  3SPJ A;  1JVM A;  2UUA B;  1AIL A;  3K06 A;  3QNE A;  1I94 O;  1YJN V;  3JD0 A;  3TET A;  1NBM G;  4AQY B;  3JAK B;  4BIO A;  2M6Y A;  4PEL A;  1ROP A;  4I4T B;  1XNR O;  2E5L B;  3OD4 A;  1EFR G;  5LHG A;  2ODM A;  1L1F A;  2EZO A;  1BQ0 A;  1R3L C;  2WLN A;  2DWD C;  4RUE A;  1BCC H;  5D5Q A;  3LNN A;  2OT5 A;  1VMG A;  4CH6 A;  5C8Y A;  3M7M X;  5EYP B;  2Q0A A;  2PZS A;  1AR1 B;  2GSM B;  4LFA O;  4OPH A; 
#chains in the Genus database with same CATH homology
 2JEU A;  2DYS B;  4HZ3 A;  1OCR B;  3D36 A;  1FXH A;  3ABK B;  1NH2 B;  4LP8 A;  4KP4 A;  4WCE V;  2IJK A;  3CPW U;  2Q67 A;  5LBQ A;  1F23 A;  3SPG A;  1OCZ B;  1HWY A;  5KA6 A;  3K79 A;  5EK0 A;  3GWO A;  2JIZ G;  3SJQ C;  2WAM A;  5IY5 B;  3CCR V;  4BAY A;  2EIN B;  4BIZ A;  1QR9 A;  4XDJ A;  4CBC A;  2IU0 A;  5CN0 A;  1SES A;  3FKS G;  3FB6 C;  4HYO A;  4WFH A;  4LBE C;  4UVC A;  3BEH A;  1H38 A;  1AI6 A;  3PJS K;  5LHI A;  1Q7Y W;  3W7X A;  3OMI B;  4J9Y B;  3RW0 A;  1EBO A;  1R6K A;  5B1A B;  5DN6 G;  1ARO P;  2XOK G;  3CXC U;  4QE9 A;  3ZN1 A;  2EJR A;  5IDJ A;  4ZBM A;  1KD1 W;  4MVO A;  3ETE A;  3VOU A;  1I5Y A;  1OZ0 A;  2ZDI A;  3E8F A;  5L3G A;  2X7R B;  1BL8 A;  4JPR A;  1PKX A;  1J95 A;  1M56 B;  3T2M A;  2B1G A;  3R65 A;  3AG1 C;  3H01 A;  1AI4 A;  3DTU B;  1K34 A;  4UXN A;  2LFR A;  3ABT A;  1UJW B;  1QBZ A;  3JD3 A;  5EBM C;  1K97 A;  4GCZ A;  1RPO A;  1COW G;  4X8A A;  3CP1 A;  3D3I A;  3JCZ A;  4WFB V;  1JJ2 U;  4KFM A;  4FJC C;  1TUE B;  1PNL A;  1JOY A;  1FXV A;  2ZR2 A;  3E89 A;  4PA7 A;  3FB8 C;  1GM8 A;  1NR1 A;  3IFX A;  3WG7 B;  4WFA V;  2WLL A;  4TT3 G;  5L3E A;  3QO7 A;  4FMT A;  3CCV V;  3CCE V;  1S76 D;  1V54 C;  2HFE C;  2IW5 A;  1F4N A;  2QTO A;  3ASO C;  1AI5 A;  1G8M A;  2H94 A;  2LFS A;  2EIJ C;  2D3O W;  4R8C A;  4FPP A;  2WLL B;  2WLJ A;  2ITD C;  1JQ0 A;  2HG5 C;  1R3I C;  1CPY A;  4MVS A;  2W6J G;  2DYS C;  2XAS A;  1OCR C;  3ABK C;  3OR6 C;  2NLJ C;  1THZ A;  2R9R B;  1YSC A;  3AG1 B;  1SRY A;  1AJN A;  4MT8 A;  4I9W A;  1FXK A;  2H8P C;  1E79 G;  1PL0 A;  4LCU C;  3OE7 G;  3CCJ V;  1PNM A;  1EZJ A;  2IH1 C;  1FFT B;  4MVM A;  1YTF D;  5IY5 C;  2QM7 A;  5LGN A;  2EIN C;  1FXK B;  1S5H C;  4GX0 A;  4MTO A;  3CC4 V;  4N21 A;  3ABM B;  1GKF A;  5KUM A;  3CME V;  2QEX V;  4PA9 A;  1KP3 A;  2WLK A;  5LGU A;  3B77 A;  4R6Z A;  1V54 B;  2ITC C;  3OUS A;  2WWW A;  3ASO B;  2AHZ A;  4GX1 A;  1K5Q A;  2EIJ B;  1YIT V;  2B5U A;  3F7V C;  1M90 W;  1W0J G;  1GO3 F;  5IYB O;  2CK3 G;  5C93 A;  3ZMT A;  4ZKI A;  4FK5 C;  3ETD A;  4H37 A;  3LDC A;  4JTA B;  2MK3 A;  1M56 C;  4P9O A;  3SPC A;  3ZIA G;  4U7N A;  3CCL V;  2BOC C;  1Q81 W;  1WLE A;  2EIL C;  2Z5U A;  2JK5 C;  2HLD G;  4PDV A;  1VQ7 V;  1H8H G;  1BMF G;  2ZDI C;  4RAI A;  3ZMV A;  5CBF A;  2P67 A;  1H2G A;  4UVB A;  4RQE A;  3TK1 A;  5CBH A;  1IXM A;  1VQK V;  1VQO V;  4WF9 V;  1NQT A;  1AJQ A;  3SYC A;  2Q69 A;  1YTF B;  2X6C A;  3K0G A;  4MW3 A;  4PA6 A;  3SYP A;  3IC7 A;  1V55 C;  3WG7 C;  2ZR3 A;  3G6E V;  2DYR B;  4JGS A;  1ORQ C;  1P7B A;  4MTG A;  2XAG A;  1W0K G;  3UKM A;  2R9I A;  1F4M A;  3F5W C;  3P30 A;  1VQ4 V;  3M99 B;  4RQF A;  1M1K W;  1VQN V;  4PA4 A;  1PD3 A;  2V7Q G;  1R73 A;  4I5S A;  3RBZ A;  1QVG U;  2Y48 A;  3CC7 V;  4QE7 A;  2QE7 G;  4DXW A;  3ZRX A;  1YI2 V;  3K0D A;  3RVY A;  4BW5 A;  1JX9 A;  3WFV A;  1MG1 A;  1SZT A;  1CP9 A;  5LHH A;  5KUK A;  3K03 A;  1H8E G;  4QNH B;  2JJ2 G;  4R50 A;  3UM7 A;  2EIL B;  3SPH A;  1M9N A;  1VQM V;  3CCM V;  1LNQ A;  3ABL C;  3F7Y C;  1NVP D;  4H33 A;  3OMA B;  1Y66 A;  4MTF A;  5CBG A;  3AG4 C;  5CA3 A;  1YJW V;  3CCU V;  4Z1M G;  1YJ9 V;  2OTL V;  2QM8 A;  2YSU B;  1QLE C;  1FXK C;  3ABM C;  3VBB A;  3ZCC A;  3OR7 C;  3JYC A;  5IYC O;  1V55 B;  4DO2 A;  3E2E A;  1Q86 W;  5B1O A;  4F4L A;  4G28 B;  4YXW G;  3W7W A;  2V1D A;  3CCS V;  3BY6 A;  1WPX A;  5CMU A;  4XBF A;  3W7U A;  1JCH A;  3OMN B;  2C2A A;  1CEZ A;  3ABU A;  3P32 A;  4N23 A;  4P30 A;  4TSF G;  3K08 A;  2AHY A;  4GX2 A;  3B8N A;  1OHH G;  3SYA A;  1DTO A;  5EBL C;  5EC1 C;  3IGA C;  2OCC C;  4R7C A;  3B8M A;  2UXX A;  1VQ9 V;  4MTX A;  3LSS A;  3ABL B;  1NVP B;  3CC2 V;  2WSS G;  4LC1 A;  1KQS U;  2W0F C;  3AG4 B;  1QR8 A;  2P7T C;  1K5S A;  2ZD9 A;  3CYO A;  3CD6 V;  1ENV A;  4J9Z B;  1B6Q A;  4PDM A;  3EFF K;  1FS0 G;  4PDL A;  1QLE B;  2Q68 A;  2XAQ A;  1E1Q G;  3ASN B;  3SYO A;  1S3J A;  1VQ5 V;  3NXS A;  2DYR C;  2IJI A;  3JD4 A;  1F51 A;  3E86 A;  5H6R A;  2HJF C;  3MD0 A;  1VQ6 V;  3ZMS A;  5HFM A;  2NNU A;  1GK9 A;  2JJ1 G;  1DLB A;  4BIU A;  2QA4 V;  1KKD A;  2PI5 A;  4XDL A;  3JD1 A;  4CZZ A;  2ZQM A;  3ZMU A;  3EHB B;  5H6Q A;  4MS2 A;  2LP7 A;  4JF3 A;  2Q6A A;  1OCC B;  2B1I A;  3SPI A;  2WLH A;  3JD2 A;  3K3W A;  3OFN G;  2A0L A;  3CMA V;  4Q20 A;  5L3D A;  3T4Z A;  4QIW F;  3FYI B;  1K7D A;  3GB7 C;  1S77 D;  4RUF A;  3OUF A;  2OCC B;  1R3J C;  5HFL A;  4TWK A;  2XAH A;  1DF4 A;  3OEE G;  5H9C A;  1M57 C;  4HAM A;  2F43 G;  1RM1 C;  1SET A;  4L87 A;  1MSW D;  4MVQ A;  5B1B C;  2EIK B;  1OCO C;  4WFE A;  3DGE A;  4X89 A;  3OM3 B;  2Y69 C;  3AG3 C;  1BHA A;  5L3B A;  4QPJ A;  1ZWI C;  2P6J A;  3ZMZ A;  4JAS A;  1Q82 W;  2DW4 A;  2DWE C;  3HPL C;  2JEX A;  1BHB A;  1AI7 A;  5BZB A;  2ZXW B;  3T4D A;  1SER A;  1GM9 A;  1NKD A;  3W7T A;  2DQ3 A;  3SYQ A;  3E8H A;  2UXN A;  1GMG A;  1KEC A;  2K1E A;  3MHH C;  3A0R A;  4WFG A;  4MW8 A;  4U7O A;  3LUT B;  3ZRS A;  3QO8 A;  2IH3 C;  2IJH A;  3E8G A;  3G4S V;  2HVK C;  3FYE B;  3STZ C;  2HR3 A;  3ZRW A;  4QPK A;  2GHY A;  1Y4M A;  4G2K A;  1W2B U;  2WLM A;  3E8B A;  3ZN0 A;  2FTK A;  3I56 V;  2P90 A;  2XAJ A;  3E35 A;  1JPX A;  2DQ0 A;  3G71 V;  3AG2 B;  2JDI G;  4KUM A;  4ASU G;  5LGT A;  1K33 A;  2EIM C;  1M57 B;  3MHS C;  1RM1 B;  3ZRW B;  3K04 A;  3T1C A;  1VQ8 V;  5B1B B;  1NR7 A;  4X88 A;  1OCO B;  4FIP C;  4QJF B;  2XAF A;  2Y69 B;  4WFF A;  3AG3 B;  1K3E A;  3ASN C;  3ML0 A;  3OGC C;  3QO5 A;  1NJI W;  4UVA A;  3LSQ A;  2HVJ C;  4MVU A;  2A9H A;  4JYB A;  1E1R G;  4PA3 A;  2WLI A;  3ETG A;  1K4D C;  2QKS A;  2HKO A;  1XL6 A;  3OW2 U;  5IYD O;  1GTO A;  3LDE A;  3CCQ V;  3FB5 C;  3TCU A;  3OAA G;  1KP2 A;  5E1A C;  5J9P C;  1YIJ V;  2Z3Y A;  1AJP A;  1RPR A;  5B3S C;  1KC8 W;  1OCC C;  2WLI B;  4PDR A;  3I55 V;  3LDD A;  1QLN A;  4JTD B;  4XDK A;  3KG2 A;  4UUJ C;  1QVF U;  5FL7 G;  1K92 A;  1PNK A;  3X2Q C;  2YEV A;  1K9M W;  1R3K C;  3ZRV A;  3K9A A;  4OXS A;  1YHQ V;  5EBW C;  1K4C C;  4RO2 A;  4UV9 A;  4MVZ A;  3AEI A;  5EC2 C;  5L3C A;  2EIM B;  2EIK C;  5GW7 A;  1N8R W;  3SPJ A;  1JVM A;  3K06 A;  3QNE A;  1YJN V;  4P2Z A;  3JD0 A;  3TET A;  1NBM G;  2YEV B;  2ATK C;  1NH2 D;  5DM6 V;  2X6B A;  4MSW C;  1P4R A;  4MVR A;  5B1N A;  3HB3 B;  1K73 W;  2ZXW C;  1OCZ C;  1R6N A;  2KB1 A;  4JTC B;  2A79 B;  4PEL A;  1ROP A;  2OTJ V;  4P9P A;  2EBO A;  1S72 V;  1DF5 A;  4UV8 A;  2W6I G;  1K8A W;  1EFR G;  1XL4 A;  5LHG A;  2BOB C;  1VQP V;  4JYC A;  4JAU A;  1L1F A;  2EZO A;  2X0L A;  1QCE A;  1R3L C;  2WLN A;  3E83 A;  4GT1 A;  5B3S B;  2WPD G;  4EKW A;  4G27 B;  2DWD C;  4JAV A;  4RUE A;  3RVZ A;  3LNM B;  2PI4 A;  2IU3 A;  1GM7 A;  2OT5 A;  1MAB G;  5L3F A;  2X6A A;  2M7W A;  3X2Q B;  3AG2 C;  3STL C;  3OEH G;  1VQL V;  5KA5 A;  5B1A C;  2XND G;  1S0V A;  3ZJZ A;  1G4Y B;  3FB7 C;  4GX5 A;  1AR1 B;  2GSM B;  1I5X A;  1MOF A;  2EZP A;  2IJJ A;  4E2L A;  3W7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...