2EZOA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezoA00
1JPXA 2P6JA 2EZOA 4N23A 3WFVA 5KA5A 3MHSC 2M7WA 1QCEA 4JGSA 1I5XA 1QR9A 2LP7A 1QR8A 1QBZA 2EBOA 5HFMA 1DLBA 4JPRA 5HFLA 1EBOA 3MHHC 1ENVA 1I5YA 5H9CA 1MG1A 2OT5A 3CP1A 5CN0A 4FIPC 3CYOA 1K34A 3M99B 4G2KA 1Y66A 2MK3A 2X7RB 3P30A 1DF4A 3GWOA 5KA6A 1Y4MA 3B8NA 4JF3A 1K33A 1MOFA 3K9AA 4FK5C 2EZPA 4E2LA 3H01A 3B8MA 3B77A 5CMUA 1SZTA 4N21A 1DF5A 4FJCC 1F23A 1JQ0A
chains in the Genus database with same CATH superfamily
1SESA 3JD1A 4O4IA 2XAFA 1PL4A 5K1XA 5GW7A 3E2EA 1BT8A 2CUGA 1K5SA 1DLBA 1ENVA 3RYFB 1VF5B 5EBLC 1H8EG 4Z1MG 3GWOA 1NU1H 3OT7A 1WPBA 4OGQB 3JCUZ 3CCEV 2F43G 3RGBA 4TQFA 4KFMA 1F51A 1DTOA 3C3TA 1NH2D 3AG2C 3OR6C 2Y0PA 4JI2B 1K9MW 2QR4A 2YI8A 3BAAA 4PA4A 2ZE6A 4FZ1A 4K35A 4QPJA 3RN4A 4JI5O 3K0DA 5KHKA 2DQ3A 5FL7G 1F7YA 2OTLV 4EFEA 3P3PA 4IGGA 1HNZO 1M56C 4B3TO 4DR6O 2LQTA 1VQLV 1R3LC 3T1YO 4KHPO 1K73W 3N2KA 3CCSV 3JAKA 2Q6AA 3ASNB 3WB0A 3B40A 1QBZA 4DR4B 1SKVA 1EBOA 4H0LB 2XOKG 3LDCA 4HAMA 4OPAA 4B08A 2CAZC 2UXNA 4B3RO 1D2DA 2ZR3A 4DR2B 4DYLA 4PI0A 1I94B 1PV0A 2NR5A 3RYHB 1JOYA 4JI0B 1I08A 5IYBO 3RYIA 3LNNA 1H2GA 1RPOA 3F5TA 1NBMG 4P9PA 1QVFU 2Q7GA 3APOA 1J5EO 2ZR2A 3P3NA 3K59A 3JSNA 1BGYH 5LYJA 3FYEB 2EIJB 1B04A 1V9PA 3CC2V 4F6EA 4HNAA 1WAZA 1VP7A 3E22A 2YEVB 4DV0O 4UV9A 2X0LA 4WFEA 1NVPD 4I55B 4R8CA 2AZ0A 1Y6XA 4FLWA 4R7CA 3VQYA 1XMQO 2Z3YA 4I7ZB 4YY3B 1I0HA 5IYDO 4DV6B 2QKCA 3D3QA 2YXLA 5B1AB 3HKDA 4JASA 1QNMA 2JEUA 1PPJH 3ZMTA 4CC5A 4ZKIA 2VWJA 2UU9B 3ABMB 4DUYB 5DEDA 1X4TA 1P4RA 2YICA 1K8AW 4LF7O 2AGAA 2A7WA 1VMGA 1OHHG 5K1PA 1FAFA 1D5AA 4JF3A 4MSWC 5JCOC 1XNRO 3SPIA 2BTOA 1TUBB 5J9PC 4JZGA 1UFIA 5C8YB 3FB5C 3WFVA 5EC2C 1AI5A 2JGDB 1K92A 2Y48A 1JA8A 3ML0A 3L70H 3ASNC 1N33O 1GH6A 3O9OA 4B3MB 4FK5C 1HW7A 4HZ3A 1COWG 5IJ0B 1Q82W 1ZX3A 3F7YC 4GX1A 3BEHA 2B1GA 5GONA 4O2AB 4N23A 1A32A 4ZBMA 1D5NA 4UUJC 4MVZA 2C2AA 4PDVA 1RPRA 2OCCB 4FIPC 1EM1A 2PGGA 2V7QG 2JS5A 2Q5ZA 2UUCO 4RO2A 3ZN0A 4NVPA 4JI8O 3ZHQA 2ARHA 3K9SA 2EIJC 4X1YB 2IJIA 3D36A 3AG3B 2P22C 2Q8VA 1R3KC 4ZOLA 4BW9A 4X20B 2EILB 2W0XA 3CEIA 2F66C 1NT2B 1OCZB 4G28B 4JI5B 3K9AA 1BMFG 3BCCH 1DK1A 1AB3A 2Q0AA 4DV1O 2XAGA 3T1HO 5JH7B 1HNZB 4B3TB 4DR6B 3QVNA 4DRXA 3T1YB 4KHPB 4K8XA 3ABMC 2FL4A 3OEHG 4LFCO 1V55B 4MTXA 4YJ2A 2FMLA 3X2QB 1IBMO 3QO8A 2WLIA 2IM9A 3RBZA 4DV4B 3AG7A 4LCUC 4H37A 1N8RW 2Z0AA 1EN4A 3PN1A 3H1IH 3JD4A 3CXCU 1TUEB 4LWSA 3ZRSA 4UCSA 3SPCA 1AI4A 4GX5A 1AR1B 3ICXA 4R6ZA 2YSUB 4WFAV 4NXNO 4XDJA 4LFBO 2DWEC 3ZRVA 3ZEDA 4DR7O 1J5EB 1AP6A 1XOUA 2GDSA 2Z5UA 1TVKB 1AR4A 4IIJA 4NB5A 2FKXA 4MVQA 2BOCC 2WSSG 3M8AA 4DV0B 3T4DA 5LGUA 5LHGA 1W0JG 4DW0A 1ZL8A 2CH7A 2OCCC 4JAAA 1V54B 1XMOO 2BTQA 1ORQC 5CBHA 1X59A 2A79B 3ABTA 1XMQB 4CBCA 2L35A 1KD1W 1WA8B 3OFNG 5BMVB 3LNMB 4J7JA 4XDLA 3I5DA 2P4KA 2Q4PA 3CS5A 5IJ9A 2M7WA 3LSQA 3K79A 2OIGA 3JALA 3AG3C 4NKGB 3K57A 3A0BZ 4X1IA 5KA6A 4LF7B 2Q9LA 1R6KA 4JTDB 1YJ9V 2EILC 3AG1B 1OCZC 1YDXA 1ZAUA 1XNRB 4YJ3B 3E83A 5H2FZ 4BIUA 1MSWD 3BPZA 3HR0A 3UT5A 1VIBA 1N32O 2HLDG 5IE9A 4MS2A 1PKXA 4TV9B 1Q8IA 2QEXV 3BY6A 1K7DA 1L0LH 4I50B 1N33B 1W59A 1V55C 3CRCA 4ZI7B 3X2QC 4FM1A 3L72H 4GKJO 3Q4HB 5KX5B 3RT3C 4BW5A 1YXBA 1M57B 4P9OA 5H6RA 4D7TA 4UCRA 1R1BA 4DV2O 4O4JA 3CRQA 3CC4V 1U96A 2B1IA 2HP8A 1XL4A 1VQ4V 4CS3A 2WLKA 2B5UA 1KQSU 4UVAA 5EIBD 2UUCB 5IWAO 4JI8B 3OTFA 1XUQA 1XHZA 2OCHA 1GN4A 3RFRA 3K3WA 4X89A 3T1CA 3ASOB 4YIOA 4I9WA 1Y4MA 4PDLA 5DN6G 1FFXB 1B6QA 1XI1A 1EN6A 1V54C 2BCCH 5D5PA 2ZE7A 1QLNA 4DV1B 3T1HB 4JI6O 1W0KG 4LR3A 3DXRB 2LW1A 5LP6A 1MG1A 2NLJC 1S0VA 5L3DA 3FB6C 4GZRB 2PZSA 1SQBH 4LFCB 2W6IG 2D2CB 3CWBH 1B3QA 3PJSK 1IBMB 3ETQA 3UO3A 5CMUA 3CCJV 1VF6C 3AG1C 2ZDIC 3VQVA 4O4HB 2BSKB 1J95A 4LC1A 4I9QA 4X8AA 5LA6B 3B8NA 1M9NA 4GCZA 5TISZ 4NXNB 4LFBB 1M5IA 2RQ6A 3ZIAG 2R70A 4JYYA 3ZMVA 4DO2A 3ZRWB 1S5HC 1H38A 4DR7B 4TUYB 4W4LA 1AI7A 3S3WA 5L3GA 1H2NA 2RN9A 2QWNB 5KLVH 2P6JA 3K04A 2X6AA 3CRAA 1QHTA 3HKCA 4MVOA 4RQEA 5KAFZ 1QU7A 4J11A 2HEPA 1SERA 1I5YA 1NJIW 2B9ZA 3RW0A 4YY3O 1EZVH 4DV6O 1YTFB 4IT5A 1N0JA 1M57C 2IH1C 3HKEB 1TAEA 4AILC 4UFZA 1XMOB 1WNSA 4TQDA 4JI4O 3DC6A 2WA4A 2YIAA 3CX5F 3JARB 5JVDB 3DSQA 4JI1O 2CE4A 2UXDO 2A9HA 2WPDG 4PELA 4J9YB 3ABLB 2MW2B 4FLTA 3ASOC 3T2MA 3IJ4A 2QWQB 5E1AC 1FXVA 5L3FA 1WB8A 5B1OA 3RYCA 4CS2A 2X6BA 5KMGA 2EBOA 4X88A 3EFFK 1URFA 2OYQA 4MVSA 3NXSA 1N32B 4GKKO 3B2EE 2ILMA 2KG7B 4GYCB 1BZKA 1I7FA 3IAYA 4E2LA 2VQFO 2DJVA 4GT1A 1N4CA 1OV9A 4QGPA 3E8GA 5KA5A 4GKJB 4LH6A 4EFBA 1RSOB 1QCEA 3W7XA 1WP7A 2UXCO 2RCVA 4K0KO 1JJOA 4FLXA 1US6A 4DV2B 3EXAA 4NYKA 2OTJV 4J80A 2F1MA 1F4MA 3ZMSA 4NTXA 3OEEG 1BHBA 4I0XA 4FLUA 2WLLA 1K3EA 4Q20A 1IBKO 5IWAB 5EYPB 3U11A 1OJHA 2IJJA 2RMKB 5JJJB 1Q90D 1R3JC 4FM2A 5A2QN 1HNXO 4PJ0Z 2K1EA 4CH3A 2F4VO 3CCLV 2LGWA 1CXZB 2P4VA 3CJHA 3K5MA 1F23A 5GTHZ 2Q73A 3JAMN 1LR1A 4H44B 2PI4A 3W7TA 5KUKA 4KUMA 3OAAG 4PDRA 1IURA 2ADQB 4JI6B 4ZHQB 1QQCA 4DV4O 3W7UA 3FAVB 5CA3A 1MSDA 5AG2A 3APQA 3CB2A 4JI7O 4NXMO 1U97A 3H01A 3MDSA 4I4TB 3TXQA 3ABLC 3JATA 1YITV 3ZHRA 3OR7C 2XASA 3OD4A 1XREA 2YS8A 4FJCC 4TSFG 4X9QA 4X1KA 2Q0OC 1FXKC 3CRMA 2QM4A 1VQ7V 2JK5C 3G71V 1XDCA 1Q81W 1Q43A 4PA9A 5IY5B 4IYIA 5LMUO 1NH2B 3AEIA 5LXTB 2FYUH 2QM7A 4AHCA 5LOVB 2ZM6O 3A0HZ 4IL6Z 2X7RB 3FD9A 2ZQMA 2QM8A 4MTFA 1MZEA 3K5LA 2QA4V 1Q3EA 3RVYA 1L1FA 1BS3A 1HNWO 1WLEA 2QJ1A 5ITZB 4L87A 4O2BB 1Z5VA 1KC8W 2PY5A 4O4LB 2EIKB 2JGUA 4JI4B 3JYCA 1EN5A 4LH7A 5CA1B 2ATKC 3WB2A 3AK2A 4JI1B 2DW4A 1AJPA 2DYSB 2UXDB 5A9GA 3STZC 4EB6B 4QE9A 1Y74B 5J2UB 2XAQA 2GBOA 1Y76B 3LDDA 3C3SA 2P7TC 4JI3O 3TETA 1H2MA 1OZ0A 3ZMZA 1JMKC 5IYZA 1NQTA 4AQYO 4TV8B 4GKKB 4J7ZA 3ZHUA 5LMNO 2VQFB 5LGNA 1JX9A 1MMMA 2EIMB 4EEQA 4Q6GA 1NVPB 3JD3A 4X65O 2Q67A 3AG4B 4J41A 4DR1O 2H8PC 2V1DA 1KMIZ 5JJEB 3M99B 5FNVA 3SPHA 1AI6A 2UXCB 4J42A 4WBNB 3BFRA 2IBZH 3BHPA 4K0KB 2LJ2A 2EINB 4GX2A 1H2KA 5LBQA 1ZTEA 2YIDA 3H1JH 5JQGA 3J81N 1TA8A 4UXNA 3VQXA 1KYOF 4ZIBA 3S3XA 5IDJA 3G4SV 3EVKA 3KCYA 5IY5C 2Q69A 3ETDA 4QJFB 4P2ZA 4ICGA 5CN0A 3RYCB 1IBKB 4DUZO 2XNDG 3JAWA 4XDKA 2FB5A 1K97A 5CA0A 1VEWA 2IH3C 3FX7A 1HNXB 4FM0A 3R65A 4H13B 2IW5A 1SA0A 2F4VB 5B1AC 1PNKA 1IBLO 1H2SB 1SQVH 2YI9A 2P5OA 4O4IB 3HPLC 2EIKC 2A0LA 3N2GA 1YI2V 1Q6UA 3D3IA 4DK0A 3VQWA 3IC9A 4CC6A 4PHZA 2DYSC 4PDMA 4OPHA 2VQEO 4JI7B 1NR1A 4NXMB 1SZXA 2Y69B 4B7KA 4IHJA 2UUAO 1HR0O 2ZIMA 3GB7C 4F6RA 3OMNB 2GTSA 4U3JA 3U0ZA 2F95B 1Y66A 2QWOB 1LUWA 5L3EA 3KCXA 2ADPA 1DGSA 3E86A 3E89A 4GUNA 1YIJV 4JAVA 3CCRV 3SJCC 3WU2Z 4FZ0A 4F4LA 4LFAO 1YJNV 1Z2GA 2EULA 3GWKC 4P30A 4OX9B 1XHXA 3A8TA 5LMUB 1KB9F 3N2KB 1JFFA 3JAKB 3SYPA 1SQPH 5J2TA 3P30A 2ZM6B 3AG4C 2W0FC 4K3AA 4DV7O 3B77A 1IVSA 2EINC 1AP5A 3MAQA 4BIZA 2GTAA 1BHAA 4X62O 1KP2A 3M7MX 4D7SA 3JASA 5EK0A 1HNWB 1IXBA 4RWUA 2XT9A 1JCHA 2R72A 4WFBV 5CB4A 1PP9H 4Z1VA 3L75H 3RYIB 3FFQA 4FFBA 4LNUA 4HBNA 3B09A 5GTIZ 1Q6HA 2R9RB 3OMAB 2ZNJA 3B8MA 2ZIOA 3SYAA 1GMGA 3SYQA 4LF4B 5LYJB 3ETGA 3RYFA 2LO1A 3DGEA 4Z2WA 5H5NA 4HNAB 3AK3A 4YHHB 4LF8O 3E22B 1L0NH 4YIPA 4JI3B 5BR8B 2ITDC 1MOFA 4MVMA 3FYIB 1MA1A 1IXMA 4I5SA 4AQYB 3BA9A 2WWWA 2YXYA 5LMNB 2ZXWB 5JCOA 2JIZG 3KZIZ 3HKDB 1NS1A 2Y69C 2WLHA 2UUBO 2R9IA 1GK9A 2A06H 4X65B 5KUMA 3NR7A 4DR1B 3K06A 3JD0A 2CTQA 4MW8A 3ZHVA 1R3IC 1SZTA 2ETNA 4K8ZA 4DR3O 4J9ZB 1ZLZA 2JS3A 2O57A 1PD3A 1QR9A 4AI8A 5KHGA 1IZ3A 1VQ9V 2M6YA 1Q86W 3WG7B 1XL6A 1N34O 4DUZB 3E35A 3CD6V 3BA8A 3BRCA 3OE7G 1VQMV 3RYHA 4ABMA 2DN9A 4WFGA 1F4NA 2CTRA 2N05A 2E5LO 2Y0IA 3CSXA 4DXWA 4GX0A 2HVKC 2AHZA 2F93B 2WLMA 5GONB 2P06A 1R73A 4KL1A 1IBLB 1OCCB 1BSMA 4DV5O 2UXXA 3RVZA 3CMEV 2YEVA 1P84F 3J7AU 4I55A 5FPOA 2VQEB 3FKSG 2RNBA 5H6QA 4BWAA 4X64O 2UUAB 3CYOA 2XUMA 5BZBA 3THOA 1HR0B 1DF4A 2YXHA 1FFTB 4ZOLB 3O65A 3CC7V 3L9DA 4MVRA 5C93A 2OWOA 2V4DA 2VWKA 4FMTA 1R6NA 3CCVV 1XBLA 4UB8Z 2YDEA 1JPXA 2GUZA 2IU3A 4PA3A 4FVMA 1SRYA 2WLNA 4LFAB 2ZXWC 1GTOA 2WAMA 2GSMB 1VQ5V 1TUBA 5EZYA 3ZBHA 4DRXB 5C8YA 4DW1A 2KKWA 2ZKOA 4W4KA 2OIEA 4YJ2B 1M4UA 3CE2A 3J80N 4DV7B 2WLIB 1MABG 2ZT9B 4OXSA 2JVDA 3TK1A 5CBGA 2JRIA 3MD0A 4LP8A 2Q68A 3CCQV 1GM8A 1SQGA 3ZHTA 4X62B 3ETEA 1SC5B 5IJ0A 2YUAA 4LWSB 4RUFA 3SGIA 3ABKB 5KHHA 1K33A 4MW3A 2NNUA 3OM3B 4O2AA 1TGOA 2GHYA 3WG7C 1RFYA 1SS3A 1YEWA 3K08A 1KBHA 4UB6Z 1W2BU 3AK1A 2HG5C 1H2LA 4IIJB 1CP9A 1KUQA 2AW9A 1BCCH 4D6TH 1GRJA 3GVMA 4PD4F 1K34A 4LF8B 2ZE8A 4XBFA 3DTUB 5B1BB 1NZ6A 1OCCC 3QO7A 4X1YA 2UXBO 1ZL8B 2CH7B 4UV8A 1XQ8A 2BTQB 4X20A 2XAHA 4CZZA 1N0NA 3LSSA 3H1HH 3QG5A 3HKBA 3JASB 5IJ9B 2IU0A 2HJFC 1ZUQA 4H33A 2UUBB 3JALB 2RDCA 3D36C 2BOBC 4B7EA 3LUTB 1WPXA 1PM9A 5JH7A 3G6BA 1GM9A 2RJZA 4X1IB 2Q7EA 2E76B 3BABA 1Q5OA 1N36O 3K58A 5EBWC 5EIBC 4CH4A 4DR3B 2ZINA 4DV3O 5BXZA 1FXHA 3CXHF 4X66O 4GLXA 3UT5B 5B3SB 3SPJA 1MZFA 2QWRB 1N34B 2KSDA 1SQQH 4LF6O 2G38A 3ZMUA 1JQ0A 4MTOA 1GM7A 3JD2A 3MHSC 2CDYA 1AJNA 1K4DC 1PNLA 4TOIA 2E5LB 2MK3A 1TVKA 4JYBA 3OGIB 1AJQA 1AVMA 4DV5B 4O4JB 4QIWF 3ABKC 3WB1A 2R9AA 2A3QA 4JV5B 2QSAA 2CTWA 1G6UA 3CRRA 3UM7A 3QF7A 3E8BA 3EHBB 2ITCC 3I56V 1S77D 4G2KA 4X64B 1JVMA 3SJAC 1WA8A 1LUVA 4PA7A 5BMVA 1NI8A 1ROPA 2QGNA 3ZJZA 3SR2C 4JTCB 5LGTA 2QTSA 5B1BC 2QTOA 4OX9O 1O9HA 2VS0A 5EBMC 2ZNIA 3K03A 1VQOV 1VQPV 1VF6A 1VQ6V 2ZDIA 4PI2A 4YJ3A 1ZSPA 5LP6B 3SJQC 2EZPA 1O9GA 4CH6A 4IYHA 4UVCA 3SJBC 4ASUG 4TV9A 4JGSA 1GAXA 2Y4UA 3OGCC 4YXWG 4I50A 3ZHSA 2CTPA 1E1QG 4ZI7A 1RM1B 2OT5A 2PYLA 2ODMA 3QO5A 3H9VA 1XNQO 3Q4HA 1AILA 5KX5A 3STLC 4LF4O 3HB3B 5B3SC 3W7WA 1DF5A 1SQXH 3ZN1A 4YHHO 2DQ0A 4JYCA 2VRZA 5B66Z 3L73H 2DYRB 3A2FA 2GUZB 2X6CA 5DM6V 1AROP 5BR8O 1FJGO 1Y67A 2HFEC 3F7VC 1YCIA 3HKCB 2XAJA 5EZYB 4J7KA 1PL0A 4UCVA 2CK3G 1E79G 2BE3A 2ZCEA 2UXBB 1WB7A 1HWYA 2DOSA 2JDIG 4DK1A 1FS0G 2NN4A 1T5EA 3UCSC 3CMAV 3QTCA 2L6LA 4NTWA 4TWKA 1QLEB 3K0GA 1FFXA 3KKYA 1KP3A 2PYJA 2CGOA 2Y4TA 1IDSA 5LHIA 2ZD9A 3CHXA 3DXRA 2N74A 2CGNA 3H1KH 3UO2A 3R66A 1M1KW 3SYCA 1N36B 2YIBA 2LGQA 4KXRA 4TT3G 1NTZH 5L3BA 2DWDC 2QKAA 3JCZA 4DV3B 5KMGB 4JYAO 2QKSA 4X66B 2KB1A 3SDLA 1XEQA 1EZJA 5LP6C 1S76D 4O4HA 4B3SO 2BSKA 4WFHA 1YZBA 1WJZA 3L71H 4LF6B 4BIOA 5LA6A 5DECA 3LSUA 1YSCA 3OW2U 4WFFA 1FD9A 5CBFA 4U3FH 1S5JA 3ZRWA 5LHHA 4TUYA 1RM1C 3HKBB 1THZA 1BQZA 2HJDA 3OUSA 4FFKA 1OCOB 4BAYA 1G8MA 2QDOA 2DE0X 2JJ1G 1CPYA 2E74B 1Q7YW 1GKFA 5HFLA 1FKAO 4LF9O 4I0XB 3HKEA 2WLLB 1RP3B 2DYRC 4NTYA 1PNMA 3CCMV 4JZ2A 3UKMA 5IT9N 4B3RB 3OTOO 3CPWU 3JARA 1MNGA 5JWPA 5JVDA 1Q6IA 1WN7A 3CJHB 4FLYA 2HVJC 4JAUA 2EIMC 3FB8C 1B06A 4J10A 3VOUA 4CH5A 1QLEC 2P90A 4E4EA 2AXTZ 1FXKA 3K5NA 4MVUA 3LDEA 4FPPA 3ZRXA 2DMXA 1S3JA 4PV1B 1QVGU 2K9PA 1VARA 3JATB 2GV9A 4UVBA 3TXSA 2KG7A 5IYCO 3ZCCA 2N04A 4X1KB 4C7UA 3IFXA 4LF5O 2E75B 1NTKH 1XNQB 2KQXA 1RSOA 1VQ8V 4HYOA 1FYJA 2QWPB 1GN6A 1M93A 1UJWB 1Z5WA 1BL8A 4WCEV 2LFSA 3JSLA 1SETA 5KAIZ 4FLZA 1FJGB 1YHQV 1XILA 4MTGA 1YVWA 4DR5O 4A5UB 5EYPA 2IJKA 4BR6A 3IC7A 1E1RG 4JTAB 1K4CC 1OCOC 2EJRA 2HHHO 1VQNV 5B1NA 1S5LZ 4U7NA 1YJWV 4G27B 4EKWA 1OCRB 2YIBD 3N27A 1BQ0A 5FLXN 1NR7A 1VF7A 5LL6Y 2EJ7A 2QE7G 4ZHQA 3FAVA 1FPOA 1GN2A 2HKOA 3QNEA 4KP4A 4I4TA 2ZE5A 5D5QA 2FTKA 3OUFA 4JYAB 5IYZB 4N21A 4NR1A 4JI2O 3W7SA 1KKCA 2W6JG 3ABUA 3G80A 4B3SB 4RUEA 1G4YB 4R50A 1BE3H 1QR8A 2LFRA 2JEXA 3F5WC 1IX9A 3CP1A 3TGUH 1UPGA 3IGAC 3T4ZA 3TJTA 4QNHB 2H94A 1YTFD 2Q7HA 1P49A 5F2VO 3RWRD 2P67A 2JJ2G 5LXTA 3E8FA 5FNVB 4JV5O 5E79Z 5LOVA 2IJHA 3I55V 2PF4E 3D8CA 4DR4O 2H3OA 1SF9A 5JQGB 1AR5A 1LNQA 3L74H 1G1XB 3MHHC 3P32A 5H9CA 1GN3A 2PTMA 3ZX6A 3BVOA 4LF9B 4DR2O 2AHYA 4RAIA 5ITZA 4O2BA 5JJNB 4WF9V 1I94O 3G6EV 3JAWB 4QE7A 4O4LA 5BY1A 4JI0O 2YC0A 3SPGA 5CA0B 5CA1A 3FB7C 2PUSA 5KHIA 3OTOB 1CEZA 3G67A 5HFMA 1SA0B 4JPRA 1EFRG 4EB6A 3ZS8C 3H1LH 1Y74A 3DC5A 5J2UA 3VBBA 1KECA 4LBEC 4L8JA 2LW7A 2HR3A 1GO3F 1Y76A 2AZ2A 2WA3A 3N2GB 3AG2B 1OCRC 4U7OA 2JGDA 1R6TA 2E3CA 4QPKA 1KKDA 5L3CA 1I5XA 2LP7A 1K5QA 4PA6A 4TV8A 3UQ8A 4IHJB 3KG2A 2PI5A 1HP8A 1M56B 1JJ2U 3TCUA 4F6RB 3B4SA 4U3JB 4MT8A 4LF5B 1JR9A 5EC1C 2UU9O 4DUYO 3C90A 3U10A 1KU9A 2XHBA 3OMIB 4WBNA 5FPRA 1M90W 4UCOA 4UCTA 5B5EZ 3K5OA 1WP8A 1H8HG 2WLJA 4UCUA 4FLVA 1HDJA 1JFFB 5J2TB 2EX3A 4RQFA 3E8HA 1NKDA 1NTMH 1SQFA 4DR5B 1FXKB 2D3OW 2EZOA 1YF2A 2F23A 4CS4A 1P7BA 5KHJA 1ZWIC 2HHHB 4B3MO 3A0RA 1L8DA 5CB4B 3SYOA 1P7GA 2XTAA 3CCUV 1VQKV 1S72V 4FFBB 4LNUB
chains in the Genus database with same CATH topology
1SESA 3JD1A 4P30A 2XAFA 1QLNA 2DQ0A 4JYCA 5GW7A 3E2EA 2DYRB 1K5SA 1W0KG 1DLBA 2X6CA 5DM6V 1AROP 1ENVA 1MG1A 2NLJC 1S0VA 2HFEC 3F7VC 5EBLC 3SYPA 5L3DA 1H8EG 3FB6C 3P30A 3AG4C 3GWOA 4Z1MG 2W0FC 2XAJA 2W6IG 3PJSK 3CCEV 1PL0A 2F43G 3B77A 5CMUA 2CK3G 1YJNV 3CCJV 2EINC 4KFMA 1E79G 1F51A 3AG1C 4BIZA 1DTOA 2ZDIC 1NH2D 3AG2C 3OR6C 1BHAA 1HWYA 1KP2A 5EK0A 2JDIG 1FS0G 3CMAV 1JCHA 1K9MW 4PA4A 1J95A 4WFBV 4LC1A 4TWKA 4QPJA 1QLEB 3K0GA 4X8AA 3K0DA 2DQ3A 3B8NA 1M9NA 4GCZA 5FL7G 1KP3A 3ZIAG 2R9RB 2OTLV 3OMAB 3ZMVA 4DO2A 3B8MA 3ZRWB 5LHIA 1S5HC 1M56C 3SYAA 1H38A 1GMGA 2ZD9A 3SYQA 1AI7A 5L3GA 3ETGA 1R3LC 1VQLV 2P6JA 3K04A 2X6AA 3CCSV 1K73W 3DGEA 2Q6AA 3ASNB 4MVOA 4RQEA 1QBZA 1M1KW 3SYCA 1EBOA 1SERA 1I5YA 4TT3G 2XOKG 1NJIW 5L3BA 3RW0A 3LDCA 4HAMA 2DWDC 3JCZA 2ITDC 1YTFB 1M57C 2UXNA 1MOFA 2QKSA 4MVMA 3FYIB 2KB1A 2IH1C 1IXMA 4I5SA 2ZR3A 1EZJA 1S76D 2WWWA 2ZXWB 4WFHA 2JIZG 1JOYA 5IYBO 2Y69C 1YSCA 2WLHA 3OW2U 1H2GA 4WFFA 1RPOA 2R9IA 1NBMG 1GK9A 5CBFA 4P9PA 1QVFU 2A9HA 2WPDG 2ZR2A 3ZRWA 4PELA 5LHHA 5KUMA 4J9YB 3ABLB 3ASOC 1RM1C 3K06A 3T2MA 3JD0A 1THZA 3OUSA 3FYEB 2EIJB 5E1AC 3CC2V 4MW8A 1OCOB 1FXVA 1R3IC 1SZTA 4BAYA 5L3FA 2YEVB 1G8MA 5B1OA 4J9ZB 2JJ1G 1CPYA 4UV9A 2X0LA 4WFEA 1PD3A 2X6BA 1NVPD 1QR9A 1Q7YW 1GKFA 2EBOA 4X88A 5HFLA 1VQ9V 3EFFK 4R8CA 2WLLB 4MVSA 3NXSA 2DYRC 1Q86W 4R7CA 3WG7B 1XL6A 2Z3YA 5IYDO 1PNMA 3E35A 4E2LA 3CCMV 4GT1A 3CD6V 3OE7G 5B1AB 1VQMV 3UKMA 4JASA 3CPWU 2JEUA 4WFGA 3E8GA 1F4NA 3ZMTA 4ZKIA 5KA5A 3ABMB 4DXWA 1QCEA 4GX0A 2HVKC 2AHZA 2WLMA 3W7XA 1P4RA 1K8AW 1R73A 2HVJC 4JAUA 2EIMC 1OCCB 2UXXA 3FB8C 1OHHG 4JF3A 3RVZA 3VOUA 4MSWC 3SPIA 3CMEV 1QLEC 2YEVA 2P90A 2OTJV 1FXKA 4MVUA 5J9PC 3LDEA 4FPPA 1F4MA 3ZMSA 3ZRXA 3OEEG 1S3JA 3FB5C 1BHBA 3WFVA 5EC2C 1QVGU 2WLLA 3FKSG 4UVBA 1K3EA 1AI5A 5H6QA 4Q20A 1K92A 2Y48A 2IJJA 3ML0A 5IYCO 3ZCCA 3ASNC 3CYOA 5BZBA 1DF4A 1R3JC 3IFXA 1FFTB 4FK5C 3CC7V 4HZ3A 1COWG 2K1EA 1Q82W 3CCLV 4MVRA 5C93A 3F7YC 1VQ8V 4GX1A 4FMTA 1R6NA 3BEHA 2B1GA 3CCVV 1F23A 4HYOA 1JPXA 4N23A 2IU3A 4PA3A 1SRYA 2WLNA 4ZBMA 1UJWB 2PI4A 4UUJC 3W7TA 5KUKA 4MVZA 2ZXWC 1GTOA 2WAMA 2GSMB 2C2AA 3OAAG 4KUMA 4PDVA 4PDRA 1BL8A 4WCEV 1RPRA 2OCCB 4FIPC 1VQ5V 2LFSA 3W7UA 2V7QG 1SETA 5CA3A 1YHQV 4MTGA 3H01A 4RO2A 3ZN0A 1YITV 3ABLC 3OR7C 2XASA 2WLIB 4FJCC 1MABG 2EIJC 4OXSA 4TSFG 2IJKA 2IJIA 3IC7A 1E1RG 4JTAB 3D36A 1K4CC 3AG3B 3TK1A 3MD0A 1OCOC 5CBGA 4LP8A 2Q68A 2EJRA 3CCQV 1GM8A 1VQNV 1FXKC 5B1NA 1R3KC 3ETEA 4U7NA 1YJWV 2EILB 4G27B 4RUFA 4EKWA 1OCZB 3ABKB 1K33A 1OCRB 4MW3A 4G28B 2NNUA 2JK5C 3K9AA 3G71V 1BMFG 3OM3B 1VQ7V 1Q81W 2GHYA 3WG7C 4PA9A 3K08A 5IY5B 1NR7A 1W2BU 2XAGA 1NH2B 3AEIA 2HG5C 2QE7G 2QM7A 1CP9A 3ABMC 3OEHG 2HKOA 1V55B 3QNEA 4KP4A 1K34A 4MTXA 2X7RB 4XBFA 3X2QB 3QO8A 2WLIA 3DTUB 3RBZA 2ZQMA 5B1BB 1OCCC 3QO7A 2QM8A 4MTFA 2FTKA 3OUFA 4LCUC 4H37A 2QA4V 1N8RW 4N21A 3RVYA 1L1FA 4UV8A 3W7SA 1WLEA 3JD4A 2W6JG 3ABUA 4L87A 3CXCU 1TUEB 2XAHA 1KC8W 4CZZA 3ZRSA 3LSSA 4RUEA 1G4YB 4R50A 2EIKB 3SPCA 1QR8A 2LFRA 2JEXA 1AI4A 3F5WC 3JYCA 4GX5A 1AR1B 4R6ZA 2YSUB 4WFAV 3CP1A 4XDJA 2ATKC 3IGAC 2HJFC 2IU0A 3T4ZA 2H94A 4QNHB 4H33A 2DW4A 1YTFD 1AJPA 2DYSB 2DWEC 2BOBC 3ZRVA 3STZC 2P67A 2JJ2G 1WPXA 3LUTB 4QE9A 3E8FA 1GM9A 2Z5UA 2IJHA 3I55V 2XAQA 4MVQA 2BOCC 3LDDA 2P7TC 5EBWC 1LNQA 3TETA 2WSSG 3MHHC 1OZ0A 3P32A 5H9CA 3T4DA 3ZMZA 5LGUA 1FXHA 5LHGA 1W0JG 1NQTA 2AHYA 5B3SB 3SPJA 2OCCC 4RAIA 1V54B 4WF9V 3G6EV 1ORQC 5CBHA 2A79B 3ABTA 4CBCA 1KD1W 4QE7A 3OFNG 3LNMB 3SPGA 3ZMUA 5LGNA 1JQ0A 4MTOA 4XDLA 1JX9A 1GM7A 3JD2A 3FB7C 2EIMB 3MHSC 2M7WA 1AJNA 1K4DC 1CEZA 3LSQA 3JD3A 1NVPB 2Q67A 3AG4B 3K79A 5HFMA 1PNLA 4JPRA 3AG3C 1EFRG 2H8PC 2V1DA 3M99B 3SPHA 2MK3A 1AI6A 5KA6A 3VBBA 4JYBA 1KECA 4LBEC 1AJQA 1R6KA 4JTDB 1YJ9V 2EILC 2EINB 2HR3A 4GX2A 5LBQA 1GO3F 3AG1B 4QIWF 1OCZC 3ABKC 3AG2B 1OCRC 4U7OA 3E83A 4UXNA 4QPKA 4BIUA 5IDJA 1KKDA 3G4SV 1MSWD 5L3CA 3UM7A 5IY5C 3E8BA 1I5XA 2LP7A 1K5QA 2Q69A 2HLDG 3EHBB 3ETDA 4PA6A 4QJFB 4MS2A 4P2ZA 1PKXA 2ITCC 5CN0A 3I56V 1S77D 2XNDG 4G2KA 2QEXV 3BY6A 3KG2A 2PI5A 1JVMA 1K7DA 1M56B 4PA7A 4XDKA 1JJ2U 1V55C 3TCUA 1K97A 1ROPA 4MT8A 3ZJZA 3X2QC 2IH3C 5EC1C 3R65A 4JTCB 5LGTA 5B1BC 2QTOA 2IW5A 5B1AC 5EBMC 3OMIB 1PNKA 3K03A 4BW5A 1M90W 1M57B 1VQOV 1VQPV 4P9OA 3HPLC 5H6RA 1VQ6V 2EIKC 2A0LA 2ZDIA 1YI2V 3CC4V 2B1IA 3D3IA 1H8HG 2WLJA 1XL4A 3SJQC 1VQ4V 2EZPA 2DYSC 4PDMA 4RQFA 3E8HA 1NKDA 2WLKA 2B5UA 1NR1A 1KQSU 4UVAA 2Y69B 1FXKB 2D3OW 4UVCA 2EZOA 4ASUG 4JGSA 3K3WA 3OGCC 4YXWG 1P7BA 1ZWIC 3GB7C 1E1QG 4X89A 3OMNB 3ASOB 3T1CA 1RM1B 2OT5A 3A0RA 4I9WA 1Y66A 3QO5A 5L3EA 1Y4MA 4PDLA 3E86A 3E89A 3SYOA 5DN6G 3STLC 3HB3B 1YIJV 1B6QA 4JAVA 5B3SC 3CCUV 1VQKV 3CCRV 1S72V 3W7WA 1DF5A 1V54C 4F4LA 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JPX A;  2P6J A;  2EZO A;  4N23 A;  3WFV A;  5KA5 A;  3MHS C;  2M7W A;  1QCE A;  4JGS A;  1I5X A;  1QR9 A;  2LP7 A;  1QR8 A;  1QBZ A;  2EBO A;  5HFM A;  1DLB A;  4JPR A;  5HFL A;  1EBO A;  3MHH C;  1ENV A;  1I5Y A;  5H9C A;  1MG1 A;  2OT5 A;  3CP1 A;  5CN0 A;  4FIP C;  3CYO A;  1K34 A;  3M99 B;  4G2K A;  1Y66 A;  2MK3 A;  2X7R B;  3P30 A;  1DF4 A;  3GWO A;  5KA6 A;  1Y4M A;  3B8N A;  4JF3 A;  1K33 A;  1MOF A;  3K9A A;  4FK5 C;  2EZP A;  4E2L A;  3H01 A;  3B8M A;  3B77 A;  5CMU A;  1SZT A;  4N21 A;  1DF5 A;  4FJC C;  1F23 A;  1JQ0 A; 
#chains in the Genus database with same CATH topology
 1SES A;  3JD1 A;  4O4I A;  2XAF A;  1PL4 A;  5K1X A;  5GW7 A;  3E2E A;  1BT8 A;  2CUG A;  1K5S A;  1DLB A;  1ENV A;  3RYF B;  1VF5 B;  5EBL C;  1H8E G;  4Z1M G;  3GWO A;  1NU1 H;  3OT7 A;  1WPB A;  4OGQ B;  3JCU Z;  3CCE V;  2F43 G;  3RGB A;  4TQF A;  4KFM A;  1F51 A;  1DTO A;  3C3T A;  1NH2 D;  3AG2 C;  3OR6 C;  2Y0P A;  4JI2 B;  1K9M W;  2QR4 A;  2YI8 A;  3BAA A;  4PA4 A;  2ZE6 A;  4FZ1 A;  4K35 A;  4QPJ A;  3RN4 A;  4JI5 O;  3K0D A;  5KHK A;  2DQ3 A;  5FL7 G;  1F7Y A;  2OTL V;  4EFE A;  3P3P A;  4IGG A;  1HNZ O;  1M56 C;  4B3T O;  4DR6 O;  2LQT A;  1VQL V;  1R3L C;  3T1Y O;  4KHP O;  1K73 W;  3N2K A;  3CCS V;  3JAK A;  2Q6A A;  3ASN B;  3WB0 A;  3B40 A;  1QBZ A;  4DR4 B;  1SKV A;  1EBO A;  4H0L B;  2XOK G;  3LDC A;  4HAM A;  4OPA A;  4B08 A;  2CAZ C;  2UXN A;  4B3R O;  1D2D A;  2ZR3 A;  4DR2 B;  4DYL A;  4PI0 A;  1I94 B;  1PV0 A;  2NR5 A;  3RYH B;  1JOY A;  4JI0 B;  1I08 A;  5IYB O;  3RYI A;  3LNN A;  1H2G A;  1RPO A;  3F5T A;  1NBM G;  4P9P A;  1QVF U;  2Q7G A;  3APO A;  1J5E O;  2ZR2 A;  3P3N A;  3K59 A;  3JSN A;  1BGY H;  5LYJ A;  3FYE B;  2EIJ B;  1B04 A;  1V9P A;  3CC2 V;  4F6E A;  4HNA A;  1WAZ A;  1VP7 A;  3E22 A;  2YEV B;  4DV0 O;  4UV9 A;  2X0L A;  4WFE A;  1NVP D;  4I55 B;  4R8C A;  2AZ0 A;  1Y6X A;  4FLW A;  4R7C A;  3VQY A;  1XMQ O;  2Z3Y A;  4I7Z B;  4YY3 B;  1I0H A;  5IYD O;  4DV6 B;  2QKC A;  3D3Q A;  2YXL A;  5B1A B;  3HKD A;  4JAS A;  1QNM A;  2JEU A;  1PPJ H;  3ZMT A;  4CC5 A;  4ZKI A;  2VWJ A;  2UU9 B;  3ABM B;  4DUY B;  5DED A;  1X4T A;  1P4R A;  2YIC A;  1K8A W;  4LF7 O;  2AGA A;  2A7W A;  1VMG A;  1OHH G;  5K1P A;  1FAF A;  1D5A A;  4JF3 A;  4MSW C;  5JCO C;  1XNR O;  3SPI A;  2BTO A;  1TUB B;  5J9P C;  4JZG A;  1UFI A;  5C8Y B;  3FB5 C;  3WFV A;  5EC2 C;  1AI5 A;  2JGD B;  1K92 A;  2Y48 A;  1JA8 A;  3ML0 A;  3L70 H;  3ASN C;  1N33 O;  1GH6 A;  3O9O A;  4B3M B;  4FK5 C;  1HW7 A;  4HZ3 A;  1COW G;  5IJ0 B;  1Q82 W;  1ZX3 A;  3F7Y C;  4GX1 A;  3BEH A;  2B1G A;  5GON A;  4O2A B;  4N23 A;  1A32 A;  4ZBM A;  1D5N A;  4UUJ C;  4MVZ A;  2C2A A;  4PDV A;  1RPR A;  2OCC B;  4FIP C;  1EM1 A;  2PGG A;  2V7Q G;  2JS5 A;  2Q5Z A;  2UUC O;  4RO2 A;  3ZN0 A;  4NVP A;  4JI8 O;  3ZHQ A;  2ARH A;  3K9S A;  2EIJ C;  4X1Y B;  2IJI A;  3D36 A;  3AG3 B;  2P22 C;  2Q8V A;  1R3K C;  4ZOL A;  4BW9 A;  4X20 B;  2EIL B;  2W0X A;  3CEI A;  2F66 C;  1NT2 B;  1OCZ B;  4G28 B;  4JI5 B;  3K9A A;  1BMF G;  3BCC H;  1DK1 A;  1AB3 A;  2Q0A A;  4DV1 O;  2XAG A;  3T1H O;  5JH7 B;  1HNZ B;  4B3T B;  4DR6 B;  3QVN A;  4DRX A;  3T1Y B;  4KHP B;  4K8X A;  3ABM C;  2FL4 A;  3OEH G;  4LFC O;  1V55 B;  4MTX A;  4YJ2 A;  2FML A;  3X2Q B;  1IBM O;  3QO8 A;  2WLI A;  2IM9 A;  3RBZ A;  4DV4 B;  3AG7 A;  4LCU C;  4H37 A;  1N8R W;  2Z0A A;  1EN4 A;  3PN1 A;  3H1I H;  3JD4 A;  3CXC U;  1TUE B;  4LWS A;  3ZRS A;  4UCS A;  3SPC A;  1AI4 A;  4GX5 A;  1AR1 B;  3ICX A;  4R6Z A;  2YSU B;  4WFA V;  4NXN O;  4XDJ A;  4LFB O;  2DWE C;  3ZRV A;  3ZED A;  4DR7 O;  1J5E B;  1AP6 A;  1XOU A;  2GDS A;  2Z5U A;  1TVK B;  1AR4 A;  4IIJ A;  4NB5 A;  2FKX A;  4MVQ A;  2BOC C;  2WSS G;  3M8A A;  4DV0 B;  3T4D A;  5LGU A;  5LHG A;  1W0J G;  4DW0 A;  1ZL8 A;  2CH7 A;  2OCC C;  4JAA A;  1V54 B;  1XMO O;  2BTQ A;  1ORQ C;  5CBH A;  1X59 A;  2A79 B;  3ABT A;  1XMQ B;  4CBC A;  2L35 A;  1KD1 W;  1WA8 B;  3OFN G;  5BMV B;  3LNM B;  4J7J A;  4XDL A;  3I5D A;  2P4K A;  2Q4P A;  3CS5 A;  5IJ9 A;  2M7W A;  3LSQ A;  3K79 A;  2OIG A;  3JAL A;  3AG3 C;  4NKG B;  3K57 A;  3A0B Z;  4X1I A;  5KA6 A;  4LF7 B;  2Q9L A;  1R6K A;  4JTD B;  1YJ9 V;  2EIL C;  3AG1 B;  1OCZ C;  1YDX A;  1ZAU A;  1XNR B;  4YJ3 B;  3E83 A;  5H2F Z;  4BIU A;  1MSW D;  3BPZ A;  3HR0 A;  3UT5 A;  1VIB A;  1N32 O;  2HLD G;  5IE9 A;  4MS2 A;  1PKX A;  4TV9 B;  1Q8I A;  2QEX V;  3BY6 A;  1K7D A;  1L0L H;  4I50 B;  1N33 B;  1W59 A;  1V55 C;  3CRC A;  4ZI7 B;  3X2Q C;  4FM1 A;  3L72 H;  4GKJ O;  3Q4H B;  5KX5 B;  3RT3 C;  4BW5 A;  1YXB A;  1M57 B;  4P9O A;  5H6R A;  4D7T A;  4UCR A;  1R1B A;  4DV2 O;  4O4J A;  3CRQ A;  3CC4 V;  1U96 A;  2B1I A;  2HP8 A;  1XL4 A;  1VQ4 V;  4CS3 A;  2WLK A;  2B5U A;  1KQS U;  4UVA A;  5EIB D;  2UUC B;  5IWA O;  4JI8 B;  3OTF A;  1XUQ A;  1XHZ A;  2OCH A;  1GN4 A;  3RFR A;  3K3W A;  4X89 A;  3T1C A;  3ASO B;  4YIO A;  4I9W A;  1Y4M A;  4PDL A;  5DN6 G;  1FFX B;  1B6Q A;  1XI1 A;  1EN6 A;  1V54 C;  2BCC H;  5D5P A;  2ZE7 A;  1QLN A;  4DV1 B;  3T1H B;  4JI6 O;  1W0K G;  4LR3 A;  3DXR B;  2LW1 A;  5LP6 A;  1MG1 A;  2NLJ C;  1S0V A;  5L3D A;  3FB6 C;  4GZR B;  2PZS A;  1SQB H;  4LFC B;  2W6I G;  2D2C B;  3CWB H;  1B3Q A;  3PJS K;  1IBM B;  3ETQ A;  3UO3 A;  5CMU A;  3CCJ V;  1VF6 C;  3AG1 C;  2ZDI C;  3VQV A;  4O4H B;  2BSK B;  1J95 A;  4LC1 A;  4I9Q A;  4X8A A;  5LA6 B;  3B8N A;  1M9N A;  4GCZ A;  5TIS Z;  4NXN B;  4LFB B;  1M5I A;  2RQ6 A;  3ZIA G;  2R70 A;  4JYY A;  3ZMV A;  4DO2 A;  3ZRW B;  1S5H C;  1H38 A;  4DR7 B;  4TUY B;  4W4L A;  1AI7 A;  3S3W A;  5L3G A;  1H2N A;  2RN9 A;  2QWN B;  5KLV H;  2P6J A;  3K04 A;  2X6A A;  3CRA A;  1QHT A;  3HKC A;  4MVO A;  4RQE A;  5KAF Z;  1QU7 A;  4J11 A;  2HEP A;  1SER A;  1I5Y A;  1NJI W;  2B9Z A;  3RW0 A;  4YY3 O;  1EZV H;  4DV6 O;  1YTF B;  4IT5 A;  1N0J A;  1M57 C;  2IH1 C;  3HKE B;  1TAE A;  4AIL C;  4UFZ A;  1XMO B;  1WNS A;  4TQD A;  4JI4 O;  3DC6 A;  2WA4 A;  2YIA A;  3CX5 F;  3JAR B;  5JVD B;  3DSQ A;  4JI1 O;  2CE4 A;  2UXD O;  2A9H A;  2WPD G;  4PEL A;  4J9Y B;  3ABL B;  2MW2 B;  4FLT A;  3ASO C;  3T2M A;  3IJ4 A;  2QWQ B;  5E1A C;  1FXV A;  5L3F A;  1WB8 A;  5B1O A;  3RYC A;  4CS2 A;  2X6B A;  5KMG A;  2EBO A;  4X88 A;  3EFF K;  1URF A;  2OYQ A;  4MVS A;  3NXS A;  1N32 B;  4GKK O;  3B2E E;  2ILM A;  2KG7 B;  4GYC B;  1BZK A;  1I7F A;  3IAY A;  4E2L A;  2VQF O;  2DJV A;  4GT1 A;  1N4C A;  1OV9 A;  4QGP A;  3E8G A;  5KA5 A;  4GKJ B;  4LH6 A;  4EFB A;  1RSO B;  1QCE A;  3W7X A;  1WP7 A;  2UXC O;  2RCV A;  4K0K O;  1JJO A;  4FLX A;  1US6 A;  4DV2 B;  3EXA A;  4NYK A;  2OTJ V;  4J80 A;  2F1M A;  1F4M A;  3ZMS A;  4NTX A;  3OEE G;  1BHB A;  4I0X A;  4FLU A;  2WLL A;  1K3E A;  4Q20 A;  1IBK O;  5IWA B;  5EYP B;  3U11 A;  1OJH A;  2IJJ A;  2RMK B;  5JJJ B;  1Q90 D;  1R3J C;  4FM2 A;  5A2Q N;  1HNX O;  4PJ0 Z;  2K1E A;  4CH3 A;  2F4V O;  3CCL V;  2LGW A;  1CXZ B;  2P4V A;  3CJH A;  3K5M A;  1F23 A;  5GTH Z;  2Q73 A;  3JAM N;  1LR1 A;  4H44 B;  2PI4 A;  3W7T A;  5KUK A;  4KUM A;  3OAA G;  4PDR A;  1IUR A;  2ADQ B;  4JI6 B;  4ZHQ B;  1QQC A;  4DV4 O;  3W7U A;  3FAV B;  5CA3 A;  1MSD A;  5AG2 A;  3APQ A;  3CB2 A;  4JI7 O;  4NXM O;  1U97 A;  3H01 A;  3MDS A;  4I4T B;  3TXQ A;  3ABL C;  3JAT A;  1YIT V;  3ZHR A;  3OR7 C;  2XAS A;  3OD4 A;  1XRE A;  2YS8 A;  4FJC C;  4TSF G;  4X9Q A;  4X1K A;  2Q0O C;  1FXK C;  3CRM A;  2QM4 A;  1VQ7 V;  2JK5 C;  3G71 V;  1XDC A;  1Q81 W;  1Q43 A;  4PA9 A;  5IY5 B;  4IYI A;  5LMU O;  1NH2 B;  3AEI A;  5LXT B;  2FYU H;  2QM7 A;  4AHC A;  5LOV B;  2ZM6 O;  3A0H Z;  4IL6 Z;  2X7R B;  3FD9 A;  2ZQM A;  2QM8 A;  4MTF A;  1MZE A;  3K5L A;  2QA4 V;  1Q3E A;  3RVY A;  1L1F A;  1BS3 A;  1HNW O;  1WLE A;  2QJ1 A;  5ITZ B;  4L87 A;  4O2B B;  1Z5V A;  1KC8 W;  2PY5 A;  4O4L B;  2EIK B;  2JGU A;  4JI4 B;  3JYC A;  1EN5 A;  4LH7 A;  5CA1 B;  2ATK C;  3WB2 A;  3AK2 A;  4JI1 B;  2DW4 A;  1AJP A;  2DYS B;  2UXD B;  5A9G A;  3STZ C;  4EB6 B;  4QE9 A;  1Y74 B;  5J2U B;  2XAQ A;  2GBO A;  1Y76 B;  3LDD A;  3C3S A;  2P7T C;  4JI3 O;  3TET A;  1H2M A;  1OZ0 A;  3ZMZ A;  1JMK C;  5IYZ A;  1NQT A;  4AQY O;  4TV8 B;  4GKK B;  4J7Z A;  3ZHU A;  5LMN O;  2VQF B;  5LGN A;  1JX9 A;  1MMM A;  2EIM B;  4EEQ A;  4Q6G A;  1NVP B;  3JD3 A;  4X65 O;  2Q67 A;  3AG4 B;  4J41 A;  4DR1 O;  2H8P C;  2V1D A;  1KMI Z;  5JJE B;  3M99 B;  5FNV A;  3SPH A;  1AI6 A;  2UXC B;  4J42 A;  4WBN B;  3BFR A;  2IBZ H;  3BHP A;  4K0K B;  2LJ2 A;  2EIN B;  4GX2 A;  1H2K A;  5LBQ A;  1ZTE A;  2YID A;  3H1J H;  5JQG A;  3J81 N;  1TA8 A;  4UXN A;  3VQX A;  1KYO F;  4ZIB A;  3S3X A;  5IDJ A;  3G4S V;  3EVK A;  3KCY A;  5IY5 C;  2Q69 A;  3ETD A;  4QJF B;  4P2Z A;  4ICG A;  5CN0 A;  3RYC B;  1IBK B;  4DUZ O;  2XND G;  3JAW A;  4XDK A;  2FB5 A;  1K97 A;  5CA0 A;  1VEW A;  2IH3 C;  3FX7 A;  1HNX B;  4FM0 A;  3R65 A;  4H13 B;  2IW5 A;  1SA0 A;  2F4V B;  5B1A C;  1PNK A;  1IBL O;  1H2S B;  1SQV H;  2YI9 A;  2P5O A;  4O4I B;  3HPL C;  2EIK C;  2A0L A;  3N2G A;  1YI2 V;  1Q6U A;  3D3I A;  4DK0 A;  3VQW A;  3IC9 A;  4CC6 A;  4PHZ A;  2DYS C;  4PDM A;  4OPH A;  2VQE O;  4JI7 B;  1NR1 A;  4NXM B;  1SZX A;  2Y69 B;  4B7K A;  4IHJ A;  2UUA O;  1HR0 O;  2ZIM A;  3GB7 C;  4F6R A;  3OMN B;  2GTS A;  4U3J A;  3U0Z A;  2F95 B;  1Y66 A;  2QWO B;  1LUW A;  5L3E A;  3KCX A;  2ADP A;  1DGS A;  3E86 A;  3E89 A;  4GUN A;  1YIJ V;  4JAV A;  3CCR V;  3SJC C;  3WU2 Z;  4FZ0 A;  4F4L A;  4LFA O;  1YJN V;  1Z2G A;  2EUL A;  3GWK C;  4P30 A;  4OX9 B;  1XHX A;  3A8T A;  5LMU B;  1KB9 F;  3N2K B;  1JFF A;  3JAK B;  3SYP A;  1SQP H;  5J2T A;  3P30 A;  2ZM6 B;  3AG4 C;  2W0F C;  4K3A A;  4DV7 O;  3B77 A;  1IVS A;  2EIN C;  1AP5 A;  3MAQ A;  4BIZ A;  2GTA A;  1BHA A;  4X62 O;  1KP2 A;  3M7M X;  4D7S A;  3JAS A;  5EK0 A;  1HNW B;  1IXB A;  4RWU A;  2XT9 A;  1JCH A;  2R72 A;  4WFB V;  5CB4 A;  1PP9 H;  4Z1V A;  3L75 H;  3RYI B;  3FFQ A;  4FFB A;  4LNU A;  4HBN A;  3B09 A;  5GTI Z;  1Q6H A;  2R9R B;  3OMA B;  2ZNJ A;  3B8M A;  2ZIO A;  3SYA A;  1GMG A;  3SYQ A;  4LF4 B;  5LYJ B;  3ETG A;  3RYF A;  2LO1 A;  3DGE A;  4Z2W A;  5H5N A;  4HNA B;  3AK3 A;  4YHH B;  4LF8 O;  3E22 B;  1L0N H;  4YIP A;  4JI3 B;  5BR8 B;  2ITD C;  1MOF A;  4MVM A;  3FYI B;  1MA1 A;  1IXM A;  4I5S A;  4AQY B;  3BA9 A;  2WWW A;  2YXY A;  5LMN B;  2ZXW B;  5JCO A;  2JIZ G;  3KZI Z;  3HKD B;  1NS1 A;  2Y69 C;  2WLH A;  2UUB O;  2R9I A;  1GK9 A;  2A06 H;  4X65 B;  5KUM A;  3NR7 A;  4DR1 B;  3K06 A;  3JD0 A;  2CTQ A;  4MW8 A;  3ZHV A;  1R3I C;  1SZT A;  2ETN A;  4K8Z A;  4DR3 O;  4J9Z B;  1ZLZ A;  2JS3 A;  2O57 A;  1PD3 A;  1QR9 A;  4AI8 A;  5KHG A;  1IZ3 A;  1VQ9 V;  2M6Y A;  1Q86 W;  3WG7 B;  1XL6 A;  1N34 O;  4DUZ B;  3E35 A;  3CD6 V;  3BA8 A;  3BRC A;  3OE7 G;  1VQM V;  3RYH A;  4ABM A;  2DN9 A;  4WFG A;  1F4N A;  2CTR A;  2N05 A;  2E5L O;  2Y0I A;  3CSX A;  4DXW A;  4GX0 A;  2HVK C;  2AHZ A;  2F93 B;  2WLM A;  5GON B;  2P06 A;  1R73 A;  4KL1 A;  1IBL B;  1OCC B;  1BSM A;  4DV5 O;  2UXX A;  3RVZ A;  3CME V;  2YEV A;  1P84 F;  3J7A U;  4I55 A;  5FPO A;  2VQE B;  3FKS G;  2RNB A;  5H6Q A;  4BWA A;  4X64 O;  2UUA B;  3CYO A;  2XUM A;  5BZB A;  3THO A;  1HR0 B;  1DF4 A;  2YXH A;  1FFT B;  4ZOL B;  3O65 A;  3CC7 V;  3L9D A;  4MVR A;  5C93 A;  2OWO A;  2V4D A;  2VWK A;  4FMT A;  1R6N A;  3CCV V;  1XBL A;  4UB8 Z;  2YDE A;  1JPX A;  2GUZ A;  2IU3 A;  4PA3 A;  4FVM A;  1SRY A;  2WLN A;  4LFA B;  2ZXW C;  1GTO A;  2WAM A;  2GSM B;  1VQ5 V;  1TUB A;  5EZY A;  3ZBH A;  4DRX B;  5C8Y A;  4DW1 A;  2KKW A;  2ZKO A;  4W4K A;  2OIE A;  4YJ2 B;  1M4U A;  3CE2 A;  3J80 N;  4DV7 B;  2WLI B;  1MAB G;  2ZT9 B;  4OXS A;  2JVD A;  3TK1 A;  5CBG A;  2JRI A;  3MD0 A;  4LP8 A;  2Q68 A;  3CCQ V;  1GM8 A;  1SQG A;  3ZHT A;  4X62 B;  3ETE A;  1SC5 B;  5IJ0 A;  2YUA A;  4LWS B;  4RUF A;  3SGI A;  3ABK B;  5KHH A;  1K33 A;  4MW3 A;  2NNU A;  3OM3 B;  4O2A A;  1TGO A;  2GHY A;  3WG7 C;  1RFY A;  1SS3 A;  1YEW A;  3K08 A;  1KBH A;  4UB6 Z;  1W2B U;  3AK1 A;  2HG5 C;  1H2L A;  4IIJ B;  1CP9 A;  1KUQ A;  2AW9 A;  1BCC H;  4D6T H;  1GRJ A;  3GVM A;  4PD4 F;  1K34 A;  4LF8 B;  2ZE8 A;  4XBF A;  3DTU B;  5B1B B;  1NZ6 A;  1OCC C;  3QO7 A;  4X1Y A;  2UXB O;  1ZL8 B;  2CH7 B;  4UV8 A;  1XQ8 A;  2BTQ B;  4X20 A;  2XAH A;  4CZZ A;  1N0N A;  3LSS A;  3H1H H;  3QG5 A;  3HKB A;  3JAS B;  5IJ9 B;  2IU0 A;  2HJF C;  1ZUQ A;  4H33 A;  2UUB B;  3JAL B;  2RDC A;  3D36 C;  2BOB C;  4B7E A;  3LUT B;  1WPX A;  1PM9 A;  5JH7 A;  3G6B A;  1GM9 A;  2RJZ A;  4X1I B;  2Q7E A;  2E76 B;  3BAB A;  1Q5O A;  1N36 O;  3K58 A;  5EBW C;  5EIB C;  4CH4 A;  4DR3 B;  2ZIN A;  4DV3 O;  5BXZ A;  1FXH A;  3CXH F;  4X66 O;  4GLX A;  3UT5 B;  5B3S B;  3SPJ A;  1MZF A;  2QWR B;  1N34 B;  2KSD A;  1SQQ H;  4LF6 O;  2G38 A;  3ZMU A;  1JQ0 A;  4MTO A;  1GM7 A;  3JD2 A;  3MHS C;  2CDY A;  1AJN A;  1K4D C;  1PNL A;  4TOI A;  2E5L B;  2MK3 A;  1TVK A;  4JYB A;  3OGI B;  1AJQ A;  1AVM A;  4DV5 B;  4O4J B;  4QIW F;  3ABK C;  3WB1 A;  2R9A A;  2A3Q A;  4JV5 B;  2QSA A;  2CTW A;  1G6U A;  3CRR A;  3UM7 A;  3QF7 A;  3E8B A;  3EHB B;  2ITC C;  3I56 V;  1S77 D;  4G2K A;  4X64 B;  1JVM A;  3SJA C;  1WA8 A;  1LUV A;  4PA7 A;  5BMV A;  1NI8 A;  1ROP A;  2QGN A;  3ZJZ A;  3SR2 C;  4JTC B;  5LGT A;  2QTS A;  5B1B C;  2QTO A;  4OX9 O;  1O9H A;  2VS0 A;  5EBM C;  2ZNI A;  3K03 A;  1VQO V;  1VQP V;  1VF6 A;  1VQ6 V;  2ZDI A;  4PI2 A;  4YJ3 A;  1ZSP A;  5LP6 B;  3SJQ C;  2EZP A;  1O9G A;  4CH6 A;  4IYH A;  4UVC A;  3SJB C;  4ASU G;  4TV9 A;  4JGS A;  1GAX A;  2Y4U A;  3OGC C;  4YXW G;  4I50 A;  3ZHS A;  2CTP A;  1E1Q G;  4ZI7 A;  1RM1 B;  2OT5 A;  2PYL A;  2ODM A;  3QO5 A;  3H9V A;  1XNQ O;  3Q4H A;  1AIL A;  5KX5 A;  3STL C;  4LF4 O;  3HB3 B;  5B3S C;  3W7W A;  1DF5 A;  1SQX H;  3ZN1 A;  4YHH O;  2DQ0 A;  4JYC A;  2VRZ A;  5B66 Z;  3L73 H;  2DYR B;  3A2F A;  2GUZ B;  2X6C A;  5DM6 V;  1ARO P;  5BR8 O;  1FJG O;  1Y67 A;  2HFE C;  3F7V C;  1YCI A;  3HKC B;  2XAJ A;  5EZY B;  4J7K A;  1PL0 A;  4UCV A;  2CK3 G;  1E79 G;  2BE3 A;  2ZCE A;  2UXB B;  1WB7 A;  1HWY A;  2DOS A;  2JDI G;  4DK1 A;  1FS0 G;  2NN4 A;  1T5E A;  3UCS C;  3CMA V;  3QTC A;  2L6L A;  4NTW A;  4TWK A;  1QLE B;  3K0G A;  1FFX A;  3KKY A;  1KP3 A;  2PYJ A;  2CGO A;  2Y4T A;  1IDS A;  5LHI A;  2ZD9 A;  3CHX A;  3DXR A;  2N74 A;  2CGN A;  3H1K H;  3UO2 A;  3R66 A;  1M1K W;  3SYC A;  1N36 B;  2YIB A;  2LGQ A;  4KXR A;  4TT3 G;  1NTZ H;  5L3B A;  2DWD C;  2QKA A;  3JCZ A;  4DV3 B;  5KMG B;  4JYA O;  2QKS A;  4X66 B;  2KB1 A;  3SDL A;  1XEQ A;  1EZJ A;  5LP6 C;  1S76 D;  4O4H A;  4B3S O;  2BSK A;  4WFH A;  1YZB A;  1WJZ A;  3L71 H;  4LF6 B;  4BIO A;  5LA6 A;  5DEC A;  3LSU A;  1YSC A;  3OW2 U;  4WFF A;  1FD9 A;  5CBF A;  4U3F H;  1S5J A;  3ZRW A;  5LHH A;  4TUY A;  1RM1 C;  3HKB B;  1THZ A;  1BQZ A;  2HJD A;  3OUS A;  4FFK A;  1OCO B;  4BAY A;  1G8M A;  2QDO A;  2DE0 X;  2JJ1 G;  1CPY A;  2E74 B;  1Q7Y W;  1GKF A;  5HFL A;  1FKA O;  4LF9 O;  4I0X B;  3HKE A;  2WLL B;  1RP3 B;  2DYR C;  4NTY A;  1PNM A;  3CCM V;  4JZ2 A;  3UKM A;  5IT9 N;  4B3R B;  3OTO O;  3CPW U;  3JAR A;  1MNG A;  5JWP A;  5JVD A;  1Q6I A;  1WN7 A;  3CJH B;  4FLY A;  2HVJ C;  4JAU A;  2EIM C;  3FB8 C;  1B06 A;  4J10 A;  3VOU A;  4CH5 A;  1QLE C;  2P90 A;  4E4E A;  2AXT Z;  1FXK A;  3K5N A;  4MVU A;  3LDE A;  4FPP A;  3ZRX A;  2DMX A;  1S3J A;  4PV1 B;  1QVG U;  2K9P A;  1VAR A;  3JAT B;  2GV9 A;  4UVB A;  3TXS A;  2KG7 A;  5IYC O;  3ZCC A;  2N04 A;  4X1K B;  4C7U A;  3IFX A;  4LF5 O;  2E75 B;  1NTK H;  1XNQ B;  2KQX A;  1RSO A;  1VQ8 V;  4HYO A;  1FYJ A;  2QWP B;  1GN6 A;  1M93 A;  1UJW B;  1Z5W A;  1BL8 A;  4WCE V;  2LFS A;  3JSL A;  1SET A;  5KAI Z;  4FLZ A;  1FJG B;  1YHQ V;  1XIL A;  4MTG A;  1YVW A;  4DR5 O;  4A5U B;  5EYP A;  2IJK A;  4BR6 A;  3IC7 A;  1E1R G;  4JTA B;  1K4C C;  1OCO C;  2EJR A;  2HHH O;  1VQN V;  5B1N A;  1S5L Z;  4U7N A;  1YJW V;  4G27 B;  4EKW A;  1OCR B;  2YIB D;  3N27 A;  1BQ0 A;  5FLX N;  1NR7 A;  1VF7 A;  5LL6 Y;  2EJ7 A;  2QE7 G;  4ZHQ A;  3FAV A;  1FPO A;  1GN2 A;  2HKO A;  3QNE A;  4KP4 A;  4I4T A;  2ZE5 A;  5D5Q A;  2FTK A;  3OUF A;  4JYA B;  5IYZ B;  4N21 A;  4NR1 A;  4JI2 O;  3W7S A;  1KKC A;  2W6J G;  3ABU A;  3G80 A;  4B3S B;  4RUE A;  1G4Y B;  4R50 A;  1BE3 H;  1QR8 A;  2LFR A;  2JEX A;  3F5W C;  1IX9 A;  3CP1 A;  3TGU H;  1UPG A;  3IGA C;  3T4Z A;  3TJT A;  4QNH B;  2H94 A;  1YTF D;  2Q7H A;  1P49 A;  5F2V O;  3RWR D;  2P67 A;  2JJ2 G;  5LXT A;  3E8F A;  5FNV B;  4JV5 O;  5E79 Z;  5LOV A;  2IJH A;  3I55 V;  2PF4 E;  3D8C A;  4DR4 O;  2H3O A;  1SF9 A;  5JQG B;  1AR5 A;  1LNQ A;  3L74 H;  1G1X B;  3MHH C;  3P32 A;  5H9C A;  1GN3 A;  2PTM A;  3ZX6 A;  3BVO A;  4LF9 B;  4DR2 O;  2AHY A;  4RAI A;  5ITZ A;  4O2B A;  5JJN B;  4WF9 V;  1I94 O;  3G6E V;  3JAW B;  4QE7 A;  4O4L A;  5BY1 A;  4JI0 O;  2YC0 A;  3SPG A;  5CA0 B;  5CA1 A;  3FB7 C;  2PUS A;  5KHI A;  3OTO B;  1CEZ A;  3G67 A;  5HFM A;  1SA0 B;  4JPR A;  1EFR G;  4EB6 A;  3ZS8 C;  3H1L H;  1Y74 A;  3DC5 A;  5J2U A;  3VBB A;  1KEC A;  4LBE C;  4L8J A;  2LW7 A;  2HR3 A;  1GO3 F;  1Y76 A;  2AZ2 A;  2WA3 A;  3N2G B;  3AG2 B;  1OCR C;  4U7O A;  2JGD A;  1R6T A;  2E3C A;  4QPK A;  1KKD A;  5L3C A;  1I5X A;  2LP7 A;  1K5Q A;  4PA6 A;  4TV8 A;  3UQ8 A;  4IHJ B;  3KG2 A;  2PI5 A;  1HP8 A;  1M56 B;  1JJ2 U;  3TCU A;  4F6R B;  3B4S A;  4U3J B;  4MT8 A;  4LF5 B;  1JR9 A;  5EC1 C;  2UU9 O;  4DUY O;  3C90 A;  3U10 A;  1KU9 A;  2XHB A;  3OMI B;  4WBN A;  5FPR A;  1M90 W;  4UCO A;  4UCT A;  5B5E Z;  3K5O A;  1WP8 A;  1H8H G;  2WLJ A;  4UCU A;  4FLV A;  1HDJ A;  1JFF B;  5J2T B;  2EX3 A;  4RQF A;  3E8H A;  1NKD A;  1NTM H;  1SQF A;  4DR5 B;  1FXK B;  2D3O W;  2EZO A;  1YF2 A;  2F23 A;  4CS4 A;  1P7B A;  5KHJ A;  1ZWI C;  2HHH B;  4B3M O;  3A0R A;  1L8D A;  5CB4 B;  3SYO A;  1P7G A;  2XTA A;  3CCU V;  1VQK V;  1S72 V;  4FFB B;  4LNU B; 
#chains in the Genus database with same CATH homology
 1SES A;  3JD1 A;  4P30 A;  2XAF A;  1QLN A;  2DQ0 A;  4JYC A;  5GW7 A;  3E2E A;  2DYR B;  1K5S A;  1W0K G;  1DLB A;  2X6C A;  5DM6 V;  1ARO P;  1ENV A;  1MG1 A;  2NLJ C;  1S0V A;  2HFE C;  3F7V C;  5EBL C;  3SYP A;  5L3D A;  1H8E G;  3FB6 C;  3P30 A;  3AG4 C;  3GWO A;  4Z1M G;  2W0F C;  2XAJ A;  2W6I G;  3PJS K;  3CCE V;  1PL0 A;  2F43 G;  3B77 A;  5CMU A;  2CK3 G;  1YJN V;  3CCJ V;  2EIN C;  4KFM A;  1E79 G;  1F51 A;  3AG1 C;  4BIZ A;  1DTO A;  2ZDI C;  1NH2 D;  3AG2 C;  3OR6 C;  1BHA A;  1HWY A;  1KP2 A;  5EK0 A;  2JDI G;  1FS0 G;  3CMA V;  1JCH A;  1K9M W;  4PA4 A;  1J95 A;  4WFB V;  4LC1 A;  4TWK A;  4QPJ A;  1QLE B;  3K0G A;  4X8A A;  3K0D A;  2DQ3 A;  3B8N A;  1M9N A;  4GCZ A;  5FL7 G;  1KP3 A;  3ZIA G;  2R9R B;  2OTL V;  3OMA B;  3ZMV A;  4DO2 A;  3B8M A;  3ZRW B;  5LHI A;  1S5H C;  1M56 C;  3SYA A;  1H38 A;  1GMG A;  2ZD9 A;  3SYQ A;  1AI7 A;  5L3G A;  3ETG A;  1R3L C;  1VQL V;  2P6J A;  3K04 A;  2X6A A;  3CCS V;  1K73 W;  3DGE A;  2Q6A A;  3ASN B;  4MVO A;  4RQE A;  1QBZ A;  1M1K W;  3SYC A;  1EBO A;  1SER A;  1I5Y A;  4TT3 G;  2XOK G;  1NJI W;  5L3B A;  3RW0 A;  3LDC A;  4HAM A;  2DWD C;  3JCZ A;  2ITD C;  1YTF B;  1M57 C;  2UXN A;  1MOF A;  2QKS A;  4MVM A;  3FYI B;  2KB1 A;  2IH1 C;  1IXM A;  4I5S A;  2ZR3 A;  1EZJ A;  1S76 D;  2WWW A;  2ZXW B;  4WFH A;  2JIZ G;  1JOY A;  5IYB O;  2Y69 C;  1YSC A;  2WLH A;  3OW2 U;  1H2G A;  4WFF A;  1RPO A;  2R9I A;  1NBM G;  1GK9 A;  5CBF A;  4P9P A;  1QVF U;  2A9H A;  2WPD G;  2ZR2 A;  3ZRW A;  4PEL A;  5LHH A;  5KUM A;  4J9Y B;  3ABL B;  3ASO C;  1RM1 C;  3K06 A;  3T2M A;  3JD0 A;  1THZ A;  3OUS A;  3FYE B;  2EIJ B;  5E1A C;  3CC2 V;  4MW8 A;  1OCO B;  1FXV A;  1R3I C;  1SZT A;  4BAY A;  5L3F A;  2YEV B;  1G8M A;  5B1O A;  4J9Z B;  2JJ1 G;  1CPY A;  4UV9 A;  2X0L A;  4WFE A;  1PD3 A;  2X6B A;  1NVP D;  1QR9 A;  1Q7Y W;  1GKF A;  2EBO A;  4X88 A;  5HFL A;  1VQ9 V;  3EFF K;  4R8C A;  2WLL B;  4MVS A;  3NXS A;  2DYR C;  1Q86 W;  4R7C A;  3WG7 B;  1XL6 A;  2Z3Y A;  5IYD O;  1PNM A;  3E35 A;  4E2L A;  3CCM V;  4GT1 A;  3CD6 V;  3OE7 G;  5B1A B;  1VQM V;  3UKM A;  4JAS A;  3CPW U;  2JEU A;  4WFG A;  3E8G A;  1F4N A;  3ZMT A;  4ZKI A;  5KA5 A;  3ABM B;  4DXW A;  1QCE A;  4GX0 A;  2HVK C;  2AHZ A;  2WLM A;  3W7X A;  1P4R A;  1K8A W;  1R73 A;  2HVJ C;  4JAU A;  2EIM C;  1OCC B;  2UXX A;  3FB8 C;  1OHH G;  4JF3 A;  3RVZ A;  3VOU A;  4MSW C;  3SPI A;  3CME V;  1QLE C;  2YEV A;  2P90 A;  2OTJ V;  1FXK A;  4MVU A;  5J9P C;  3LDE A;  4FPP A;  1F4M A;  3ZMS A;  3ZRX A;  3OEE G;  1S3J A;  3FB5 C;  1BHB A;  3WFV A;  5EC2 C;  1QVG U;  2WLL A;  3FKS G;  4UVB A;  1K3E A;  1AI5 A;  5H6Q A;  4Q20 A;  1K92 A;  2Y48 A;  2IJJ A;  3ML0 A;  5IYC O;  3ZCC A;  3ASN C;  3CYO A;  5BZB A;  1DF4 A;  1R3J C;  3IFX A;  1FFT B;  4FK5 C;  3CC7 V;  4HZ3 A;  1COW G;  2K1E A;  1Q82 W;  3CCL V;  4MVR A;  5C93 A;  3F7Y C;  1VQ8 V;  4GX1 A;  4FMT A;  1R6N A;  3BEH A;  2B1G A;  3CCV V;  1F23 A;  4HYO A;  1JPX A;  4N23 A;  2IU3 A;  4PA3 A;  1SRY A;  2WLN A;  4ZBM A;  1UJW B;  2PI4 A;  4UUJ C;  3W7T A;  5KUK A;  4MVZ A;  2ZXW C;  1GTO A;  2WAM A;  2GSM B;  2C2A A;  3OAA G;  4KUM A;  4PDV A;  4PDR A;  1BL8 A;  4WCE V;  1RPR A;  2OCC B;  4FIP C;  1VQ5 V;  2LFS A;  3W7U A;  2V7Q G;  1SET A;  5CA3 A;  1YHQ V;  4MTG A;  3H01 A;  4RO2 A;  3ZN0 A;  1YIT V;  3ABL C;  3OR7 C;  2XAS A;  2WLI B;  4FJC C;  1MAB G;  2EIJ C;  4OXS A;  4TSF G;  2IJK A;  2IJI A;  3IC7 A;  1E1R G;  4JTA B;  3D36 A;  1K4C C;  3AG3 B;  3TK1 A;  3MD0 A;  1OCO C;  5CBG A;  4LP8 A;  2Q68 A;  2EJR A;  3CCQ V;  1GM8 A;  1VQN V;  1FXK C;  5B1N A;  1R3K C;  3ETE A;  4U7N A;  1YJW V;  2EIL B;  4G27 B;  4RUF A;  4EKW A;  1OCZ B;  3ABK B;  1K33 A;  1OCR B;  4MW3 A;  4G28 B;  2NNU A;  2JK5 C;  3K9A A;  3G71 V;  1BMF G;  3OM3 B;  1VQ7 V;  1Q81 W;  2GHY A;  3WG7 C;  4PA9 A;  3K08 A;  5IY5 B;  1NR7 A;  1W2B U;  2XAG A;  1NH2 B;  3AEI A;  2HG5 C;  2QE7 G;  2QM7 A;  1CP9 A;  3ABM C;  3OEH G;  2HKO A;  1V55 B;  3QNE A;  4KP4 A;  1K34 A;  4MTX A;  2X7R B;  4XBF A;  3X2Q B;  3QO8 A;  2WLI A;  3DTU B;  3RBZ A;  2ZQM A;  5B1B B;  1OCC C;  3QO7 A;  2QM8 A;  4MTF A;  2FTK A;  3OUF A;  4LCU C;  4H37 A;  2QA4 V;  1N8R W;  4N21 A;  3RVY A;  1L1F A;  4UV8 A;  3W7S A;  1WLE A;  3JD4 A;  2W6J G;  3ABU A;  4L87 A;  3CXC U;  1TUE B;  2XAH A;  1KC8 W;  4CZZ A;  3ZRS A;  3LSS A;  4RUE A;  1G4Y B;  4R50 A;  2EIK B;  3SPC A;  1QR8 A;  2LFR A;  2JEX A;  1AI4 A;  3F5W C;  3JYC A;  4GX5 A;  1AR1 B;  4R6Z A;  2YSU B;  4WFA V;  3CP1 A;  4XDJ A;  2ATK C;  3IGA C;  2HJF C;  2IU0 A;  3T4Z A;  2H94 A;  4QNH B;  4H33 A;  2DW4 A;  1YTF D;  1AJP A;  2DYS B;  2DWE C;  2BOB C;  3ZRV A;  3STZ C;  2P67 A;  2JJ2 G;  1WPX A;  3LUT B;  4QE9 A;  3E8F A;  1GM9 A;  2Z5U A;  2IJH A;  3I55 V;  2XAQ A;  4MVQ A;  2BOC C;  3LDD A;  2P7T C;  5EBW C;  1LNQ A;  3TET A;  2WSS G;  3MHH C;  1OZ0 A;  3P32 A;  5H9C A;  3T4D A;  3ZMZ A;  5LGU A;  1FXH A;  5LHG A;  1W0J G;  1NQT A;  2AHY A;  5B3S B;  3SPJ A;  2OCC C;  4RAI A;  1V54 B;  4WF9 V;  3G6E V;  1ORQ C;  5CBH A;  2A79 B;  3ABT A;  4CBC A;  1KD1 W;  4QE7 A;  3OFN G;  3LNM B;  3SPG A;  3ZMU A;  5LGN A;  1JQ0 A;  4MTO A;  4XDL A;  1JX9 A;  1GM7 A;  3JD2 A;  3FB7 C;  2EIM B;  3MHS C;  2M7W A;  1AJN A;  1K4D C;  1CEZ A;  3LSQ A;  3JD3 A;  1NVP B;  2Q67 A;  3AG4 B;  3K79 A;  5HFM A;  1PNL A;  4JPR A;  3AG3 C;  1EFR G;  2H8P C;  2V1D A;  3M99 B;  3SPH A;  2MK3 A;  1AI6 A;  5KA6 A;  3VBB A;  4JYB A;  1KEC A;  4LBE C;  1AJQ A;  1R6K A;  4JTD B;  1YJ9 V;  2EIL C;  2EIN B;  2HR3 A;  4GX2 A;  5LBQ A;  1GO3 F;  3AG1 B;  4QIW F;  1OCZ C;  3ABK C;  3AG2 B;  1OCR C;  4U7O A;  3E83 A;  4UXN A;  4QPK A;  4BIU A;  5IDJ A;  1KKD A;  3G4S V;  1MSW D;  5L3C A;  3UM7 A;  5IY5 C;  3E8B A;  1I5X A;  2LP7 A;  1K5Q A;  2Q69 A;  2HLD G;  3EHB B;  3ETD A;  4PA6 A;  4QJF B;  4MS2 A;  4P2Z A;  1PKX A;  2ITC C;  5CN0 A;  3I56 V;  1S77 D;  2XND G;  4G2K A;  2QEX V;  3BY6 A;  3KG2 A;  2PI5 A;  1JVM A;  1K7D A;  1M56 B;  4PA7 A;  4XDK A;  1JJ2 U;  1V55 C;  3TCU A;  1K97 A;  1ROP A;  4MT8 A;  3ZJZ A;  3X2Q C;  2IH3 C;  5EC1 C;  3R65 A;  4JTC B;  5LGT A;  5B1B C;  2QTO A;  2IW5 A;  5B1A C;  5EBM C;  3OMI B;  1PNK A;  3K03 A;  4BW5 A;  1M90 W;  1M57 B;  1VQO V;  1VQP V;  4P9O A;  3HPL C;  5H6R A;  1VQ6 V;  2EIK C;  2A0L A;  2ZDI A;  1YI2 V;  3CC4 V;  2B1I A;  3D3I A;  1H8H G;  2WLJ A;  1XL4 A;  3SJQ C;  1VQ4 V;  2EZP A;  2DYS C;  4PDM A;  4RQF A;  3E8H A;  1NKD A;  2WLK A;  2B5U A;  1NR1 A;  1KQS U;  4UVA A;  2Y69 B;  1FXK B;  2D3O W;  4UVC A;  2EZO A;  4ASU G;  4JGS A;  3K3W A;  3OGC C;  4YXW G;  1P7B A;  1ZWI C;  3GB7 C;  1E1Q G;  4X89 A;  3OMN B;  3ASO B;  3T1C A;  1RM1 B;  2OT5 A;  3A0R A;  4I9W A;  1Y66 A;  3QO5 A;  5L3E A;  1Y4M A;  4PDL A;  3E86 A;  3E89 A;  3SYO A;  5DN6 G;  3STL C;  3HB3 B;  1YIJ V;  1B6Q A;  4JAV A;  5B3S C;  3CCU V;  1VQK V;  3CCR V;  1S72 V;  3W7W A;  1DF5 A;  1V54 C;  4F4L A;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...