4OX9O

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ox9O00
1XNRO 4LFAO 2UXBO 4DV0O 1IBKO 1XNQO 1R1BA 4DV3O 4DV6O 4DV7O 4DR5O 1DK1A 5BR8O 3R66A 4JI8O 1XEQA 4NXMO 4B3MO 2N74A 4B3TO 4DR2O 1IBLO 1F7YA 2DJVA 4AQYO 2UUBO 4DV4O 2DOSA 2F4VO 1NS1A 1HR0O 2Z0AA 4DR6O 4LF7O 3T1HO 4GKKO 4B3RO 1X59A 3J80N 4LF6O 1FJGO 1HNWO 4JI0O 4A5UB 4DR1O 4X66O 1N34O 4OPAA 1I94O 4LF8O 4JI6O 4JI1O 1FYJA 4GKJO 3JAMN 4JI7O 1XMOO 3F5TA 4YY3O 3RT3C 4DUZO 2ZM6O 2UXCO 2ZKOA 5FLXN 3O65A 1FKAO 4NXNO 1HNXO 1J5EO 1N33O 5BXZA 1AILA 1KUQA 5IT9N 4JV5O 3SDLA 4X65O 1R6TA 3M8AA 5IWAO 4X62O 4DR3O 4JI2O 4LF4O 4LFBO 2E5LO 3T1YO 1YZBA 5LMNO 1N32O 4OPHA 4K0KO 2VQEO 2HHHO 4DUYO 2FKXA 2JRIA 4X64O 4DR7O 4DV1O 4LFCO 4JYAO 1G1XB 2AGAA 1D2DA 1IBMO 4LF9O 4JI4O 4DR4O 5A2QN 3J81N 5BY1A 4OX9O 1AB3A 2UXDO 2LW7A 2VQFO 3OTOO 4B3SO 4JI3O 4LF5O 4JI5O 1A32A 4DV2O 2UUAO 4KHPO 4YHHO 2UU9O 3J7AU 1XMQO 5LMUO 1HNZO 5H5NA 4DV5O 1N36O 2UUCO 5LL6Y
chains in the Genus database with same CATH superfamily
2L35A 1R6KA 2BOCC 3AG2C 1SQBH 2EIKB 3E22B 1D5NA 4MVRA 2UXDB 1SA0A 2VQFB 3RWRD 4DV3O 1BQZA 4PJ0Z 1OCRB 3ZRWA 4E2LA 2N74A 4Q6GA 4FLVA 2EIMB 3JAKA 1V55B 3ASNC 5JQGB 4DV5B 3PN1A 3A2FA 4TV8A 1X59A 2ZXWB 2P6JA 3HKCB 2EZPA 1BS3A 2F43G 5B1AC 3TETA 1XILA 1XREA 1NBMG 4CC6A 3QTCA 4BW5A 4B3MB 2WLIA 1EM1A 3WB1A 5IY5C 2F4VB 4I5SA 5GONB 1UPGA 4NYKA 3BAAA 4KUMA 3IC7A 4X1YB 3LSSA 4CS4A 4CC5A 4LH7A 1QR8A 5CBHA 1M56B 2KG7A 3ABLB 2DW4A 4LWSB 5C8YA 1VQLV 4JI7B 1PPJH 3OW2U 1H2SB 1VQMV 4DR3O 2XAQA 4UB6Z 4X1IB 4K35A 2VQEO 3FYEB 2FL4A 1YHQV 4JYAO 5H9CA 1GTOA 3UM7A 2ILMA 3W7XA 4R7CA 5FPRA 3WG7B 2D2CB 4W4KA 4TV9A 2UXDO 2VQFO 1OV9A 4P9OA 5EIBD 4K0KB 4D7SA 3JARA 3E89A 2DWDC 4YJ2B 2WWWA 4J41A 3F7YC 2WA3A 4HNAA 1Q43A 2OTJV 1HWYA 2LGQA 1GM7A 4DV5O 4X89A 1KC8W 2QWQB 5CA3A 1WAZA 3SPCA 3QVNA 3DXRB 4YJ3B 4DV2B 4YHHB 3UT5A 1AI4A 3L73H 3RYFA 4PA7A 4PDVA 1Z5VA 4B3MO 1SA0B 3E8FA 2V7QG 3ZEDA 3CMAV 2F4VO 2DWEC 3S3XA 5IYBO 1EZJA 3AG1C 4OGQB 3ZRWB 2DN9A 4O4JA 1P49A 3CCJV 3JAKB 3I55V 1NVPB 1IDSA 3BHPA 5AG2A 1H38A 1W0KG 3AG4C 4NB5A 4TV8B 1NH2B 1QBZA 3IGAC 4JI7O 3AK1A 3SYAA 4E4EA 1H8HG 5LXTB 3B77A 4UCUA 4RQFA 3HR0A 2P90A 2WLIB 3G67A 3DGEA 4QE7A 3SJAC 4JI0B 3ZX6A 1GRJA 4WFBV 1KUQA 1TAEA 3KCYA 1SQFA 1BGYH 3T4DA 2Q5ZA 4O4HA 2KG7B 3D3QA 3OMNB 5C8YB 4K0KO 2WLKA 3FB6C 4X88A 4X20A 2PYJA 3BEHA 3JSLA 1J95A 2LP7A 3K59A 1G1XB 2ADQB 3ABKC 2WSSG 3APQA 4P2ZA 1YVWA 5KX5A 4X65B 1GO3F 1NJIW 1GK9A 2E5LB 1Q90D 3CRMA 3SPJA 1YXBA 3D3IA 4DV2O 2BE3A 3LNMB 4YHHO 2OCCB 1YIJV 4TV9B 3CCEV 1CP9A 3ZCCA 3MHHC 1YTFB 4HNAB 1I0HA 1Q3EA 3OUSA 3ETGA 2PI5A 1G8MA 1R1BA 3CSXA 2DYSB 1SS3A 4I9QA 3C90A 4ZI7A 2F95B 4I4TA 1KKDA 3W7WA 3STZC 2UU9B 2HVJC 5LMUB 1F4NA 4G27B 1VF7A 1IBKB 1AJPA 3ML0A 4UXNA 4P9PA 3AK2A 4DV7B 1Y66A 2LQTA 3CRRA 4DR5B 4JI0O 3H1HH 1W2BU 1THZA 5KHHA 2UUBB 1B04A 3TGUH 4QIWF 1F23A 4JYBA 4ZBMA 2IU3A 1FXKC 2Q8VA 3D36C 4IIJA 1FJGB 2P4VA 2BTQA 1VQ8V 2LGWA 4EB6A 5BXZA 1IXMA 4LF8B 3N2KB 1GN6A 4X65O 2ZQMA 5B1BB 4WFFA 3L9DA 2E5LO 3CRAA 1E1RG 1H2KA 1SQGA 3OFNG 5KLVH 3B40A 2PF4E 2IBZH 2ZNJA 1D2DA 1BMFG 4PI0A 2XAFA 4G2KA 3RGBA 1NTMH 3N2GA 4B7EA 3CEIA 1SQXH 3RYCA 1K5SA 1Q8IA 4J7JA 3LNNA 4FLTA 1YSCA 2UU9O 2OT5A 3J7AU 4Z2WA 5LMUO 2EJ7A 1ZSPA 4KXRA 2ITDC 4WF9V 1IBKO 2W0XA 4UCSA 4TSFG 4DV7O 4JI5B 3JCZA 3CPWU 4L87A 2R9AA 5IYZA 3WB2A 4DR5O 1JX9A 3RYHA 4O4IA 3K0GA 4FVMA 5JVDA 2UUBO 1PNKA 1XQ8A 2UXBB 4X8AA 2YEVB 1QCEA 5FNVB 3S3WA 1OCOC 4RO2A 1FJGO 1K97A 3BA9A 3KG2A 3E2EA 1AR1B 4LF8O 1K8AW 5B1AB 1TVKB 1S77D 2ZE6A 5EK0A 2ZIOA 4LP8A 1WLEA 2K1EA 4WBNA 3H1JH 4MSWC 5IY5B 4LF6B 3VBBA 5IDJA 3ZMSA 4BAYA 2CTRA 2AZ2A 1MSDA 4IIJB 1EN5A 1K5QA 4EB6B 1AP5A 4PV1B 2RQ6A 3I56V 1Q6HA 1IURA 1K4CC 4D6TH 4JV5B 2VRZA 5L3DA 5IWAB 1H2GA 3B4SA 1WB7A 5CN0A 5IJ9A 2JDIG 3RBZA 3CD6V 4JI5O 5J2TA 5L3GA 4DUYB 4TT3G 1JA8A 3HKDA 2XOKG 5K1PA 3N2GB 4CH3A 4FM1A 1N0JA 2PY5A 2E74B 4GLXA 5LL6Y 2EILC 2UXBO 3ZHRA 1FXVA 1N0NA 1AI5A 4TUYA 3K5OA 3G71V 3CCQV 1CEZA 1L0NH 4FFKA 1BL8A 4MW3A 1GM9A 5LOVB 2AXTZ 1PNLA 5IYZB 5J9PC 2EZOA 1Y67A 3JSNA 3HKBA 3FX7A 3RYHB 4LF6O 2QDOA 4J10A 4GZRB 1PV0A 2RMKB 4U3JA 3OGCC 1IBLB 2EJRA 3EXAA 3FFQA 4DO2A 4MTOA 3QO8A 3RT3C 1KMIZ 3LDEA 1XHXA 4PA9A 4DR6B 1FXKA 1EBOA 3D36A 4FJCC 3B2EE 1TA8A 4XDLA 4MVUA 4WFGA 1AILA 4WBNB 4TQFA 2GTAA 4JV5O 3TK1A 3JD3A 4F6RB 3AK3A 4UCOA 4X1KB 1S72V 5IWAO 3E8HA 2O57A 1GM8A 3JD0A 1YI2V 1PD3A 5KHIA 1Y4MA 3E83A 5LMNO 4H37A 2JIZG 4DUYO 3CC4V 3GWOA 2EIJC 1B3QA 3UO3A 2XUMA 1R3KC 1SRYA 1AI6A 1QNMA 4JI2B 3ABKB 4MTXA 2LW1A 2XNDG 3L72H 1MNGA 2R9RB 3JALA 4IL6Z 1CXZB 4UB8Z 2Y69B 3CXCU 1SQPH 2QKSA 1EZVH 2UXXA 5J2UA 2PZSA 4GX5A 5J2TB 4H0LB 1M90W 1PNMA 1V9PA 2QSAA 2ZE5A 3HKDB 4JYYA 1MABG 4DYLA 3SYCA 1MMMA 4MW8A 4I50A 3CS5A 2UUAB 3GB7C 4JAVA 3ZN0A 3W7SA 1IBLO 1YCIA 1EN4A 2DJVA 3WU2Z 4MVQA 2QTSA 3RVZA 4AHCA 4DR6O 1AR5A 3JAWA 3OUFA 5LBQA 2PTMA 5FPOA 4R50A 2CH7B 1OZ0A 2QWNB 5LP6C 1JOYA 3K5LA 2IW5A 4KL1A 4LF7B 3O65A 2ZR3A 4GCZA 3CJHA 3ZN1A 1KD1W 4RQEA 1FXKB 1Z2GA 3EHBB 2GBOA 3BRCA 1LUVA 2KQXA 3Q4HB 2YICA 4NVPA 3CP1A 3H1LH 2Y0IA 3NR7A 3M8AA 4IYHA 1Q82W 4FPPA 1LR1A 4JI2O 1YDXA 3F5WC 3OR6C 2H94A 5LGTA 1BCCH 3MD0A 2Q7EA 1XL4A 4QPKA 4QE9A 2XAGA 2YI8A 1PKXA 3ZS8C 1BSMA 2XT9A 3SJQC 2HVKC 4ZHQA 3T1YB 1AB3A 2LW7A 2B5UA 1A32A 3A8TA 1VQ6V 2GUZA 2Q6AA 2UUAO 1QLEC 2YXHA 1URFA 3A0BZ 2QKAA 2WLLA 2V4DA 3W7UA 2PGGA 3ABMC 2RNBA 5HFMA 1WP7A 4NTWA 2A3QA 3G80A 5EBWC 5J2UB 5LA6A 4RUEA 1F4MA 4JI8O 2JEXA 1F7YA 4UV8A 2NN4A 2CDYA 4IT5A 5B1NA 5CB4A 1K34A 1Q6UA 4H44B 3T1CA 4LF7O 2CGNA 1XNRB 3K58A 4DV6B 1P7BA 3JCUZ 3OTFA 4WFAV 5H6RA 4X9QA 1P84F 3ICXA 1GN2A 3JAWB 3X2QC 3MAQA 4AQYB 1S5JA 2QWPB 3BVOA 3C3TA 3ZHSA 3VQWA 2Z3YA 4FM0A 5KA6A 5L3CA 3JD1A 3ZHTA 1LNQA 5JH7A 1KB9F 3JASA 1H2MA 3MHSC 3KCXA 3CHXA 3VQYA 2DE0X 4FK5C 2NR5A 3CJHB 4DUZB 1SZTA 1V54C 2P22C 1WPBA 1ZAUA 4BW9A 3W7TA 3T1YO 1VARA 3SPIA 1HP8A 3E8BA 1YJWV 2P4KA 4O2AA 1H2LA 1ROPA 1RSOA 4I0XA 3KKYA 3A0RA 1B6QA 1FFTB 1MG1A 4BIZA 4PA4A 1GN3A 1QR9A 2Q67A 3K5NA 4ZHQB 2A0LA 4MS2A 1SQVH 3OD4A 3VQXA 3N27A 4PHZA 1XNRO 1M93A 1F51A 4UVBA 3ZMUA 1I7FA 1WP8A 3LSUA 1D5AA 3M7MX 4DV6O 2CE4A 4HAMA 2WLLB 2EILB 3K06A 4J80A 1O9HA 4O4LA 1XEQA 1IZ3A 2WLJA 2Q0AA 4AQYO 5LA6B 2PYLA 2W6JG 2YDEA 3ZMZA 1H2NA 3AG3C 3ZBHA 1OCCC 1YITV 3JARB 5E1AC 2YC0A 3GVMA 1R3LC 2IJKA 2OIEA 5IE9A 5LP6A 2R70A 5BR8B 5CB4B 3JAMN 4K8ZA 3RYIA 1YF2A 2ADPA 5B66Z 4CH6A 4DUZO 1XHZA 2X0LA 1JQ0A 3OAAG 2ZKOA 2XTAA 5KUMA 2GTSA 2M6YA 4PDRA 3UT5B 2R9IA 2YS8A 3RYFB 4X66B 1AJNA 5KUKA 4D7TA 4QNHB 4B7KA 1R6TA 4O4JB 1QVGU 1SQQH 3JASB 1SESA 1Y76A 1DF4A 1NR7A 3SPHA 1HDJA 4H33A 4HBNA 4RAIA 3CCSV 3CCMV 1VQKV 2RDCA 3ASOC 1XI1A 2KB1A 5JJJB 5ITZA 2F1MA 2EIJB 1Q5OA 1JJOA 2QGNA 3ZHVA 4TWKA 1K33A 5H2FZ 4O2AB 5BZBA 3CRCA 1RSOB 4MVOA 4I0XB 3SJCC 2Y4TA 4R8CA 3K3WA 4O2BA 1I5XA 4LFCB 4JAUA 5LHGA 4MTGA 4O4HB 4DR4B 4GT1A 1P7GA 2YIDA 4X20B 2YXLA 5KMGA 4UUJC 1X4TA 5BR8O 5A9GA 2IJJA 5KX5B 1HNZB 2C2AA 1KECA 2Q0OC 2Z0AA 5LYJA 4O4LB 1JVMA 2JK5C 2B1IA 2FMLA 2LJ2A 1QHTA 4FLYA 1OCZB 1VMGA 4X66O 3K57A 1KKCA 3SYQA 1NTKH 4FLXA 3AG2B 3QNEA 2ZT9B 4TQDA 4GKKB 5D5PA 4GX2A 4JGSA 2XAJA 3I5DA 2X7RB 4ZI7B 1VP7A 3WG7C 1HNXO 3T2MA 4I4TB 3RYIB 4MVMA 3CX5F 1IVSA 1N34B 3ASNB 4CH4A 1I94B 4JI6B 5EBMC 4JASA 2YIAA 1XMOB 1M5IA 4GX1A 4PDMA 1DF5A 2B1GA 1S3JA 5KAIZ 4BWAA 2FKXA 2K9PA 4DRXA 1FFXA 1Y76B 2A7WA 4U7OA 4LFCO 3BA8A 1GMGA 5KAFZ 2FB5A 4DR4O 1K92A 3EVKA 1Q7YW 1QVFU 2BTQB 1VQ7V 2YXYA 2XHBA 2M7WA 1MOFA 5B1OA 2ITCC 1XDCA 3C3SA 1HNZO 2XASA 5F2VO 1IXBA 4OX9B 1NKDA 3OT7A 4PA6A 1TUBA 2ARHA 1K7DA 3ABMB 2HFEC 3CCUV 1Q6IA 5LMNB 4H13B 3ZMTA 2EX3A 4CS3A 2HG5C 1DLBA 2W0FC 3EFFK 3MDSA 1NT2B 2E75B 2B9ZA 3FKSG 1W59A 4GKKO 1XNQB 3RYCB 1NR1A 1SETA 1FPOA 3OMIB 2WLMA 1QQCA 4UVAA 3RN4A 1VQ4V 1AVMA 5EYPA 1N34O 1I94O 5LYJB 4JI6O 4HZ3A 3B8NA 1XMOO 3OGIB 3X2QB 5K1XA 4U7NA 3IC9A 4B3RB 2H8PC 1FKAO 1VQOV 3CC2V 2Q7GA 1KP3A 4EFBA 5D5QA 1ZWIC 4DR1B 4O4IB 2IH3C 5JVDB 3K9AA 3AG1B 4GKJB 3SDLA 1M9NA 2OCCC 5E79Z 2A9HA 1QU7A 1LUWA 4FM2A 1YZBA 3E22A 3AG4B 1B06A 4OPHA 1V54B 2AHZA 1WNSA 2VWJA 4W4LA 2DYSC 1XL6A 3CXHF 2LO1A 1IBMO 2IM9A 5JQGA 5A2QN 4DRXB 1N4CA 5B3SC 3J81N 1FFXB 4LF4B 4OX9O 3JD2A 3ZHQA 5LGNA 1SERA 5GTHZ 3A0HZ 3FD9A 2YUAA 1OJHA 2Z5UA 3APOA 5KA5A 1BZKA 4LNUA 2V1DA 2X6AA 1TUEB 4ZIBA 3K5MA 1RPRA 5BMVA 4JI4B 3FB7C 4JF3A 1P4RA 1L1FA 1S5HC 2BSKA 1AR4A 3ZMVA 2QM8A 1XNQO 4CS2A 4B3SB 3L71H 3H01A 3VQVA 2GDSA 4N23A 1TUBB 4IYIA 5IYDO 5IJ9B 1N8RW 4B3RO 3B8MA 4QGPA 3IJ4A 3UCSC 5LGUA 3P3NA 1WN7A 4X1IA 1HNWO 3AG3B 3O9OA 4DR1O 3DSQA 4FLZA 4J9ZB 4GKJO 5GTIZ 1HR0B 5EYPB 2X6CA 1FAFA 2CTQA 4TUYB 1UFIA 1JR9A 4PD4F 3QF7A 4F4LA 2GHYA 1KU9A 2P67A 4U3FH 3U0ZA 4CBCA 2Y4UA 1JCHA 3WFVA 4JI8B 3HKBB 3JD4A 5L3BA 4PDLA 2UXCB 3CRQA 4LF4O 2QE7G 2L6LA 4U3JB 5LHIA 1J5EB 1DGSA 1ZL8A 3ZRVA 1R3JC 4UCTA 3DXRA 5FL7G 2Q68A 3OEEG 3JYCA 2Q9LA 4JI4O 3ASOB 4LFBB 1FS0G 3KZIZ 3OM3B 4B3SO 4C7UA 2XAHA 3ZHUA 1ENVA 5JJEB 1EFRG 1L8DA 2F93B 1AI7A 4UCVA 2Q4PA 2QJ1A 1TGOA 5DEDA 5LXTA 1RP3B 4LNUB 1YJ9V 3UKMA 5EC1C 4JI3B 4J42A 2ZNIA 5BMVB 5H6QA 4DXWA 2BTOA 2BSKB 5DN6G 2JJ2G 1I5YA 4UCRA 5HFLA 2N05A 1HR0O 1VIBA 2CAZC 4FZ1A 4DV0B 1QLNA 2H3OA 3IAYA 3J80N 1NTZH 4DK1A 3JALB 3BY6A 1S5LZ 2Q69A 1AROP 3FYIB 3WB0A 4B3TB 2KKWA 3HPLC 3SYOA 2ZCEA 3F5TA 3FAVA 3H1IH 1M57C 2Y0PA 3T1HB 2IU0A 2UXCO 4ICGA 4I50B 4ABMA 3DC5A 4YIPA 4XDJA 2JEUA 1J5EO 2CK3G 3B09A 2HJDA 4JI1B 5IJ0A 3QO5A 4PELA 5JCOC 2OIGA 3G6EV 2IJHA 2AZ0A 1OCOB 4R6ZA 3TXQA 1VQ9V 3QG5A 4LFBO 4PA3A 3LUTB 1OHHG 1VF6C 4WFEA 4QJFB 1K3EA 1BHBA 2JRIA 1G4YB 4IHJA 4AILC 2QTOA 1R3IC 1ZL8B 1RM1C 3U10A 1VQPV 1BE3H 2X6BA 3STLC 3K9SA 4F6EA 2WLHA 4DW1A 2WPDG 4JI3O 1AP6A 1NU1H 3D8CA 3SJBC 4ASUG 4LR3A 4FLWA 4Z1VA 4X64B 1KYOF 2Y48A 2OTLV 3CCLV 3P30A 4HYOA 2AW9A 2CTWA 5H5NA 4JZGA 2NNUA 4DV0O 3CC7V 4LF5B 2N04A 3H1KH 5KHJA 3CE2A 1VQ5V 4B3TO 3DTUB 3N2KA 1GKFA 2JVDA 3ETQA 2WA4A 4J9YB 3T1HO 1Q86W 1KQSU 3K79A 3CCVV 1R6NA 3PJSK 2GUZB 2EINC 1H8EG 4MVZA 4JTCB 2ZINA 2P7TC 4JZ2A 4JI1O 4DR2B 2ETNA 4LBEC 2QR4A 2BOBC 1XUQA 2AHYA 1K73W 1WA8A 1S76D 3E35A 1AJQA 5FLXN 1I08A 1ZTEA 4JPRA 5EZYA 3CMEV 2CTPA 2IH1C 1XOUA 4JYCA 1EN6A 4MVSA 2QKCA 3FAVB 3ETEA 2HLDG 3SR2C 2HR3A 3U11A 2YSUB 4YY3B 2Y69C 2ZM6B 1T5EA 1BT8A 3H9VA 5IJ0B 2DYRC 4CZZA 4MTFA 2DMXA 3K08A 1NQTA 3ZRSA 4EKWA 4X64O 3ETDA 2ATKC 5C93A 1NVPD 2AGAA 5CBFA 1MZFA 3CWBH 2PUSA 3E86A 3ABUA 1NH2D 3E8GA 2ZIMA 3OEHG 4IHJB 3ZJZA 1JMKC 3CB2A 1N32B 4LF5O 2YEVA 5JH7B 5FNVA 2HHHB 5CBGA 5B3SB 1FD9A 1HNXB 2F23A 2EIKC 3JATA 1TVKA 2OYQA 4I55A 3LSQA 1OCRC 5EIBC 3UQ8A 2MW2B 4Q20A 2EIMC 4YIOA 1DK1A 2FYUH 1V55C 3OMAB 3R66A 1SF9A 4FFBA 4DR2O 4JTDB 1U97A 2EBOA 1M1KW 2ZXWC 2UUCB 2F66C 2GSMB 3R65A 2RJZA 4LFAB 3T4ZA 4LC1A 4OPAA 1PM9A 2YI9A 1R73A 2ZDIC 4YY3O 2ODMA 3P32A 2ZM6O 2D3OW 1M56C 3ABLC 1PL0A 1YTFD 2ZR2A 5EBLC 1WA8B 5JCOA 1Z5WA 2KSDA 5EZYB 1MA1A 1K9MW 5IT9N 1NI8A 2YIBA 3HKEA 5EC2C 1VF6A 1HW7A 1PL4A 2HEPA 2ZD9A 1DTOA 1N32O 5CMUA 5LP6B 4NXNB 5CA0A 2HHHO 1N33B 4K3AA 3OE7G 3AEIA 5B5EZ 3ZRXA 4Z1MG 1JFFA 1L0LH 4NR1A 2JGUA 1BQ0A 1MZEA 5LOVA 4GUNA 4X62B 5BY1A 2JS3A 1ZLZA 1ORQC 1ZUQA 4DR7B 1BHAA 2VS0A 1RPOA 1W0JG 2JS5A 1GN4A 4KFMA 2P5OA 4FMTA 4LF9B 4PI2A 2UUCO 4P30A 4K8XA 4AI8A 4LFAO 1WPXA 2ZE7A 5GW7A 3CCRV 3JATB 3M99B 3P3PA 3LDDA 4I55B 4KHPB 1Y6XA 2QWOB 4J7KA 4JTAB 2A79B 4GX0A 5ITZB 1WB8A 2OWOA 3CYOA 2VWKA 2PI4A 1MSWD 2WAMA 2DOSA 5TISZ 1NS1A 4G28B 1G6UA 3RFRA 3G6BA 3K04A 4F6RA 4X1KA 4UFZA 2QM4A 1IBMB 4FFBB 4WCEV 4DW0A 1QLEB 4BIOA 3F7VC 2EULA 3SGIA 3TJTA 4O2BB 2BCCH 4CH5A 4NXMB 1KBHA 1Y74A 4DV4B 1UJWB 1COWG 4I7ZB 5KHGA 5KMGB 2LFRA 4J7ZA 1VEWA 1JJ2U 2JJ1G 4NXNO 4FZ0A 2GV9A 3BFRA 5JJNB 1M57B 1SKVA 1N33O 1SZXA 2R72A 4OXSA 1O9GA 2QA4V 2JGDA 2Q73A 3OR7C 1PP9H 3GWKC 4ZOLA 3G4SV 4X62O 4WFHA 1YEWA 1E79G 2HP8A 2ZE8A 1S0VA 1ZX3A 4DR7O 3HKEB 4TOIA 3FB5C 2FTKA 2QEXV 2NLJC 1HNWB 4XDKA 2DQ0A 2W6IG 4GYCB 5CA0B 4YXWG 4LH6A 5IYCO 1NZ6A 4LF9O 3L74H 1JFFB 1JPXA 1VF5B 2MK3A 3NXSA 3BCCH 2HJFC 3UO2A 5CA1A 1RM1B 2A06H 2IJIA 4DV1B 1VQNV 4KHPO 4DK0A 2CH7A 4IGGA 3TCUA 3RW0A 1K4DC 2G38A 4NTXA 4EEQA 2Q7HA 3ABTA 2CUGA 1E1QG 3OTOB 1FXHA 2WLNA 1RFYA 5LHHA 2RCVA 4BIUA 3TXSA 4FIPC 1WJZA 4NXMO 1XMQB 3HKCA 5KHKA 3FB8C 3Q4HA 4DV4O 1N36B 3RVYA 3SPGA 2CGOA 4B08A 3THOA 3DC6A 3VOUA 2LFSA 4DV3B 2P06A 4MT8A 1GAXA 5GONA 2QM7A 3BPZA 4A5UB 3K0DA 4FLUA 1FYJA 1M4UA 2EINB 2ZDIA 3SYPA 3LDCA 3IFXA 4X1YA 3QO7A 1CPYA 1SC5B 3L75H 2OCHA 2YIBD 4J11A 2DQ3A 4LWSA 4I9WA 1Y74B 4XBFA 5B1BC 4UV9A 1OCCB 5JWPA 4RUFA 4KP4A 2RN9A 2HKOA 1US6A 3ZIAG 1XBLA 4BR6A 4NKGB 3K03A 2JGDB 2QWRB 3BABA 5L3EA 4N21A 1GH6A 3AG7A 4ZOLB 2UXNA 4LCUC 4DV1O 4UVCA 2DYRB 4RWUA 3HB3B 3L70H 5DECA 4YJ2A 5L3FA 4EFEA 4L8JA 4DR3B 1YJNV 1IX9A 4ZKIA 3OTOO 2VQEB 4JAAA 2E3CA 4QPJA 5DM6V 1KP2A 2E76B 4JYAB 1XMQO 4NTYA 5CA1B 1OCZC 1N36O 1Q81W 4YJ3A 1U96A
chains in the Genus database with same CATH topology
1XNRO 4LFAO 2UXBO 4DV0O 1IBKO 1XNQO 1R1BA 4DV3O 4DV6O 4DV7O 4DR5O 1DK1A 5BR8O 3R66A 4JI8O 1XEQA 4NXMO 4B3MO 2N74A 4B3TO 4DR2O 1IBLO 1F7YA 2DJVA 4AQYO 2UUBO 4DV4O 2DOSA 2F4VO 1NS1A 1HR0O 2Z0AA 4DR6O 4LF7O 3T1HO 4GKKO 4B3RO 1X59A 3J80N 4LF6O 1FJGO 1HNWO 4JI0O 4A5UB 4DR1O 4X66O 1N34O 4OPAA 1I94O 4LF8O 4JI6O 4JI1O 1FYJA 4GKJO 3JAMN 4JI7O 1XMOO 3F5TA 4YY3O 3RT3C 4DUZO 2ZM6O 2UXCO 2ZKOA 5FLXN 3O65A 1FKAO 4NXNO 1HNXO 1J5EO 1N33O 5BXZA 1AILA 1KUQA 5IT9N 4JV5O 3SDLA 4X65O 1R6TA 3M8AA 5IWAO 4X62O 4DR3O 4JI2O 4LF4O 4LFBO 2E5LO 3T1YO 1YZBA 5LMNO 1N32O 4OPHA 4K0KO 2VQEO 2HHHO 4DUYO 2FKXA 2JRIA 4X64O 4DR7O 4DV1O 4LFCO 4JYAO 1G1XB 2AGAA 1D2DA 1IBMO 4LF9O 4JI4O 4DR4O 5A2QN 3J81N 5BY1A 4OX9O 1AB3A 2UXDO 2LW7A 2VQFO 3OTOO 4B3SO 4JI3O 4LF5O 4JI5O 1A32A 4DV2O 2UUAO 4KHPO 4YHHO 2UU9O 3J7AU 1XMQO 5LMUO 1HNZO 5H5NA 4DV5O 1N36O 2UUCO 5LL6Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  4LFA O;  2UXB O;  4DV0 O;  1IBK O;  1XNQ O;  1R1B A;  4DV3 O;  4DV6 O;  4DV7 O;  4DR5 O;  1DK1 A;  5BR8 O;  3R66 A;  4JI8 O;  1XEQ A;  4NXM O;  4B3M O;  2N74 A;  4B3T O;  4DR2 O;  1IBL O;  1F7Y A;  2DJV A;  4AQY O;  2UUB O;  4DV4 O;  2DOS A;  2F4V O;  1NS1 A;  1HR0 O;  2Z0A A;  4DR6 O;  4LF7 O;  3T1H O;  4GKK O;  4B3R O;  1X59 A;  3J80 N;  4LF6 O;  1FJG O;  1HNW O;  4JI0 O;  4A5U B;  4DR1 O;  4X66 O;  1N34 O;  4OPA A;  1I94 O;  4LF8 O;  4JI6 O;  4JI1 O;  1FYJ A;  4GKJ O;  3JAM N;  4JI7 O;  1XMO O;  3F5T A;  4YY3 O;  3RT3 C;  4DUZ O;  2ZM6 O;  2UXC O;  2ZKO A;  5FLX N;  3O65 A;  1FKA O;  4NXN O;  1HNX O;  1J5E O;  1N33 O;  5BXZ A;  1AIL A;  1KUQ A;  5IT9 N;  4JV5 O;  3SDL A;  4X65 O;  1R6T A;  3M8A A;  5IWA O;  4X62 O;  4DR3 O;  4JI2 O;  4LF4 O;  4LFB O;  2E5L O;  3T1Y O;  1YZB A;  5LMN O;  1N32 O;  4OPH A;  4K0K O;  2VQE O;  2HHH O;  4DUY O;  2FKX A;  2JRI A;  4X64 O;  4DR7 O;  4DV1 O;  4LFC O;  4JYA O;  1G1X B;  2AGA A;  1D2D A;  1IBM O;  4LF9 O;  4JI4 O;  4DR4 O;  5A2Q N;  3J81 N;  5BY1 A;  4OX9 O;  1AB3 A;  2UXD O;  2LW7 A;  2VQF O;  3OTO O;  4B3S O;  4JI3 O;  4LF5 O;  4JI5 O;  1A32 A;  4DV2 O;  2UUA O;  4KHP O;  4YHH O;  2UU9 O;  3J7A U;  1XMQ O;  5LMU O;  1HNZ O;  5H5N A;  4DV5 O;  1N36 O;  2UUC O;  5LL6 Y; 
#chains in the Genus database with same CATH topology
 2L35 A;  1R6K A;  2BOC C;  3AG2 C;  1SQB H;  2EIK B;  3E22 B;  1D5N A;  4MVR A;  2UXD B;  1SA0 A;  2VQF B;  3RWR D;  4DV3 O;  1BQZ A;  4PJ0 Z;  1OCR B;  3ZRW A;  4E2L A;  2N74 A;  4Q6G A;  4FLV A;  2EIM B;  3JAK A;  1V55 B;  3ASN C;  5JQG B;  4DV5 B;  3PN1 A;  3A2F A;  4TV8 A;  1X59 A;  2ZXW B;  2P6J A;  3HKC B;  2EZP A;  1BS3 A;  2F43 G;  5B1A C;  3TET A;  1XIL A;  1XRE A;  1NBM G;  4CC6 A;  3QTC A;  4BW5 A;  4B3M B;  2WLI A;  1EM1 A;  3WB1 A;  5IY5 C;  2F4V B;  4I5S A;  5GON B;  1UPG A;  4NYK A;  3BAA A;  4KUM A;  3IC7 A;  4X1Y B;  3LSS A;  4CS4 A;  4CC5 A;  4LH7 A;  1QR8 A;  5CBH A;  1M56 B;  2KG7 A;  3ABL B;  2DW4 A;  4LWS B;  5C8Y A;  1VQL V;  4JI7 B;  1PPJ H;  3OW2 U;  1H2S B;  1VQM V;  4DR3 O;  2XAQ A;  4UB6 Z;  4X1I B;  4K35 A;  2VQE O;  3FYE B;  2FL4 A;  1YHQ V;  4JYA O;  5H9C A;  1GTO A;  3UM7 A;  2ILM A;  3W7X A;  4R7C A;  5FPR A;  3WG7 B;  2D2C B;  4W4K A;  4TV9 A;  2UXD O;  2VQF O;  1OV9 A;  4P9O A;  5EIB D;  4K0K B;  4D7S A;  3JAR A;  3E89 A;  2DWD C;  4YJ2 B;  2WWW A;  4J41 A;  3F7Y C;  2WA3 A;  4HNA A;  1Q43 A;  2OTJ V;  1HWY A;  2LGQ A;  1GM7 A;  4DV5 O;  4X89 A;  1KC8 W;  2QWQ B;  5CA3 A;  1WAZ A;  3SPC A;  3QVN A;  3DXR B;  4YJ3 B;  4DV2 B;  4YHH B;  3UT5 A;  1AI4 A;  3L73 H;  3RYF A;  4PA7 A;  4PDV A;  1Z5V A;  4B3M O;  1SA0 B;  3E8F A;  2V7Q G;  3ZED A;  3CMA V;  2F4V O;  2DWE C;  3S3X A;  5IYB O;  1EZJ A;  3AG1 C;  4OGQ B;  3ZRW B;  2DN9 A;  4O4J A;  1P49 A;  3CCJ V;  3JAK B;  3I55 V;  1NVP B;  1IDS A;  3BHP A;  5AG2 A;  1H38 A;  1W0K G;  3AG4 C;  4NB5 A;  4TV8 B;  1NH2 B;  1QBZ A;  3IGA C;  4JI7 O;  3AK1 A;  3SYA A;  4E4E A;  1H8H G;  5LXT B;  3B77 A;  4UCU A;  4RQF A;  3HR0 A;  2P90 A;  2WLI B;  3G67 A;  3DGE A;  4QE7 A;  3SJA C;  4JI0 B;  3ZX6 A;  1GRJ A;  4WFB V;  1KUQ A;  1TAE A;  3KCY A;  1SQF A;  1BGY H;  3T4D A;  2Q5Z A;  4O4H A;  2KG7 B;  3D3Q A;  3OMN B;  5C8Y B;  4K0K O;  2WLK A;  3FB6 C;  4X88 A;  4X20 A;  2PYJ A;  3BEH A;  3JSL A;  1J95 A;  2LP7 A;  3K59 A;  1G1X B;  2ADQ B;  3ABK C;  2WSS G;  3APQ A;  4P2Z A;  1YVW A;  5KX5 A;  4X65 B;  1GO3 F;  1NJI W;  1GK9 A;  2E5L B;  1Q90 D;  3CRM A;  3SPJ A;  1YXB A;  3D3I A;  4DV2 O;  2BE3 A;  3LNM B;  4YHH O;  2OCC B;  1YIJ V;  4TV9 B;  3CCE V;  1CP9 A;  3ZCC A;  3MHH C;  1YTF B;  4HNA B;  1I0H A;  1Q3E A;  3OUS A;  3ETG A;  2PI5 A;  1G8M A;  1R1B A;  3CSX A;  2DYS B;  1SS3 A;  4I9Q A;  3C90 A;  4ZI7 A;  2F95 B;  4I4T A;  1KKD A;  3W7W A;  3STZ C;  2UU9 B;  2HVJ C;  5LMU B;  1F4N A;  4G27 B;  1VF7 A;  1IBK B;  1AJP A;  3ML0 A;  4UXN A;  4P9P A;  3AK2 A;  4DV7 B;  1Y66 A;  2LQT A;  3CRR A;  4DR5 B;  4JI0 O;  3H1H H;  1W2B U;  1THZ A;  5KHH A;  2UUB B;  1B04 A;  3TGU H;  4QIW F;  1F23 A;  4JYB A;  4ZBM A;  2IU3 A;  1FXK C;  2Q8V A;  3D36 C;  4IIJ A;  1FJG B;  2P4V A;  2BTQ A;  1VQ8 V;  2LGW A;  4EB6 A;  5BXZ A;  1IXM A;  4LF8 B;  3N2K B;  1GN6 A;  4X65 O;  2ZQM A;  5B1B B;  4WFF A;  3L9D A;  2E5L O;  3CRA A;  1E1R G;  1H2K A;  1SQG A;  3OFN G;  5KLV H;  3B40 A;  2PF4 E;  2IBZ H;  2ZNJ A;  1D2D A;  1BMF G;  4PI0 A;  2XAF A;  4G2K A;  3RGB A;  1NTM H;  3N2G A;  4B7E A;  3CEI A;  1SQX H;  3RYC A;  1K5S A;  1Q8I A;  4J7J A;  3LNN A;  4FLT A;  1YSC A;  2UU9 O;  2OT5 A;  3J7A U;  4Z2W A;  5LMU O;  2EJ7 A;  1ZSP A;  4KXR A;  2ITD C;  4WF9 V;  1IBK O;  2W0X A;  4UCS A;  4TSF G;  4DV7 O;  4JI5 B;  3JCZ A;  3CPW U;  4L87 A;  2R9A A;  5IYZ A;  3WB2 A;  4DR5 O;  1JX9 A;  3RYH A;  4O4I A;  3K0G A;  4FVM A;  5JVD A;  2UUB O;  1PNK A;  1XQ8 A;  2UXB B;  4X8A A;  2YEV B;  1QCE A;  5FNV B;  3S3W A;  1OCO C;  4RO2 A;  1FJG O;  1K97 A;  3BA9 A;  3KG2 A;  3E2E A;  1AR1 B;  4LF8 O;  1K8A W;  5B1A B;  1TVK B;  1S77 D;  2ZE6 A;  5EK0 A;  2ZIO A;  4LP8 A;  1WLE A;  2K1E A;  4WBN A;  3H1J H;  4MSW C;  5IY5 B;  4LF6 B;  3VBB A;  5IDJ A;  3ZMS A;  4BAY A;  2CTR A;  2AZ2 A;  1MSD A;  4IIJ B;  1EN5 A;  1K5Q A;  4EB6 B;  1AP5 A;  4PV1 B;  2RQ6 A;  3I56 V;  1Q6H A;  1IUR A;  1K4C C;  4D6T H;  4JV5 B;  2VRZ A;  5L3D A;  5IWA B;  1H2G A;  3B4S A;  1WB7 A;  5CN0 A;  5IJ9 A;  2JDI G;  3RBZ A;  3CD6 V;  4JI5 O;  5J2T A;  5L3G A;  4DUY B;  4TT3 G;  1JA8 A;  3HKD A;  2XOK G;  5K1P A;  3N2G B;  4CH3 A;  4FM1 A;  1N0J A;  2PY5 A;  2E74 B;  4GLX A;  5LL6 Y;  2EIL C;  2UXB O;  3ZHR A;  1FXV A;  1N0N A;  1AI5 A;  4TUY A;  3K5O A;  3G71 V;  3CCQ V;  1CEZ A;  1L0N H;  4FFK A;  1BL8 A;  4MW3 A;  1GM9 A;  5LOV B;  2AXT Z;  1PNL A;  5IYZ B;  5J9P C;  2EZO A;  1Y67 A;  3JSN A;  3HKB A;  3FX7 A;  3RYH B;  4LF6 O;  2QDO A;  4J10 A;  4GZR B;  1PV0 A;  2RMK B;  4U3J A;  3OGC C;  1IBL B;  2EJR A;  3EXA A;  3FFQ A;  4DO2 A;  4MTO A;  3QO8 A;  3RT3 C;  1KMI Z;  3LDE A;  1XHX A;  4PA9 A;  4DR6 B;  1FXK A;  1EBO A;  3D36 A;  4FJC C;  3B2E E;  1TA8 A;  4XDL A;  4MVU A;  4WFG A;  1AIL A;  4WBN B;  4TQF A;  2GTA A;  4JV5 O;  3TK1 A;  3JD3 A;  4F6R B;  3AK3 A;  4UCO A;  4X1K B;  1S72 V;  5IWA O;  3E8H A;  2O57 A;  1GM8 A;  3JD0 A;  1YI2 V;  1PD3 A;  5KHI A;  1Y4M A;  3E83 A;  5LMN O;  4H37 A;  2JIZ G;  4DUY O;  3CC4 V;  3GWO A;  2EIJ C;  1B3Q A;  3UO3 A;  2XUM A;  1R3K C;  1SRY A;  1AI6 A;  1QNM A;  4JI2 B;  3ABK B;  4MTX A;  2LW1 A;  2XND G;  3L72 H;  1MNG A;  2R9R B;  3JAL A;  4IL6 Z;  1CXZ B;  4UB8 Z;  2Y69 B;  3CXC U;  1SQP H;  2QKS A;  1EZV H;  2UXX A;  5J2U A;  2PZS A;  4GX5 A;  5J2T B;  4H0L B;  1M90 W;  1PNM A;  1V9P A;  2QSA A;  2ZE5 A;  3HKD B;  4JYY A;  1MAB G;  4DYL A;  3SYC A;  1MMM A;  4MW8 A;  4I50 A;  3CS5 A;  2UUA B;  3GB7 C;  4JAV A;  3ZN0 A;  3W7S A;  1IBL O;  1YCI A;  1EN4 A;  2DJV A;  3WU2 Z;  4MVQ A;  2QTS A;  3RVZ A;  4AHC A;  4DR6 O;  1AR5 A;  3JAW A;  3OUF A;  5LBQ A;  2PTM A;  5FPO A;  4R50 A;  2CH7 B;  1OZ0 A;  2QWN B;  5LP6 C;  1JOY A;  3K5L A;  2IW5 A;  4KL1 A;  4LF7 B;  3O65 A;  2ZR3 A;  4GCZ A;  3CJH A;  3ZN1 A;  1KD1 W;  4RQE A;  1FXK B;  1Z2G A;  3EHB B;  2GBO A;  3BRC A;  1LUV A;  2KQX A;  3Q4H B;  2YIC A;  4NVP A;  3CP1 A;  3H1L H;  2Y0I A;  3NR7 A;  3M8A A;  4IYH A;  1Q82 W;  4FPP A;  1LR1 A;  4JI2 O;  1YDX A;  3F5W C;  3OR6 C;  2H94 A;  5LGT A;  1BCC H;  3MD0 A;  2Q7E A;  1XL4 A;  4QPK A;  4QE9 A;  2XAG A;  2YI8 A;  1PKX A;  3ZS8 C;  1BSM A;  2XT9 A;  3SJQ C;  2HVK C;  4ZHQ A;  3T1Y B;  1AB3 A;  2LW7 A;  2B5U A;  1A32 A;  3A8T A;  1VQ6 V;  2GUZ A;  2Q6A A;  2UUA O;  1QLE C;  2YXH A;  1URF A;  3A0B Z;  2QKA A;  2WLL A;  2V4D A;  3W7U A;  2PGG A;  3ABM C;  2RNB A;  5HFM A;  1WP7 A;  4NTW A;  2A3Q A;  3G80 A;  5EBW C;  5J2U B;  5LA6 A;  4RUE A;  1F4M A;  4JI8 O;  2JEX A;  1F7Y A;  4UV8 A;  2NN4 A;  2CDY A;  4IT5 A;  5B1N A;  5CB4 A;  1K34 A;  1Q6U A;  4H44 B;  3T1C A;  4LF7 O;  2CGN A;  1XNR B;  3K58 A;  4DV6 B;  1P7B A;  3JCU Z;  3OTF A;  4WFA V;  5H6R A;  4X9Q A;  1P84 F;  3ICX A;  1GN2 A;  3JAW B;  3X2Q C;  3MAQ A;  4AQY B;  1S5J A;  2QWP B;  3BVO A;  3C3T A;  3ZHS A;  3VQW A;  2Z3Y A;  4FM0 A;  5KA6 A;  5L3C A;  3JD1 A;  3ZHT A;  1LNQ A;  5JH7 A;  1KB9 F;  3JAS A;  1H2M A;  3MHS C;  3KCX A;  3CHX A;  3VQY A;  2DE0 X;  4FK5 C;  2NR5 A;  3CJH B;  4DUZ B;  1SZT A;  1V54 C;  2P22 C;  1WPB A;  1ZAU A;  4BW9 A;  3W7T A;  3T1Y O;  1VAR A;  3SPI A;  1HP8 A;  3E8B A;  1YJW V;  2P4K A;  4O2A A;  1H2L A;  1ROP A;  1RSO A;  4I0X A;  3KKY A;  3A0R A;  1B6Q A;  1FFT B;  1MG1 A;  4BIZ A;  4PA4 A;  1GN3 A;  1QR9 A;  2Q67 A;  3K5N A;  4ZHQ B;  2A0L A;  4MS2 A;  1SQV H;  3OD4 A;  3VQX A;  3N27 A;  4PHZ A;  1XNR O;  1M93 A;  1F51 A;  4UVB A;  3ZMU A;  1I7F A;  1WP8 A;  3LSU A;  1D5A A;  3M7M X;  4DV6 O;  2CE4 A;  4HAM A;  2WLL B;  2EIL B;  3K06 A;  4J80 A;  1O9H A;  4O4L A;  1XEQ A;  1IZ3 A;  2WLJ A;  2Q0A A;  4AQY O;  5LA6 B;  2PYL A;  2W6J G;  2YDE A;  3ZMZ A;  1H2N A;  3AG3 C;  3ZBH A;  1OCC C;  1YIT V;  3JAR B;  5E1A C;  2YC0 A;  3GVM A;  1R3L C;  2IJK A;  2OIE A;  5IE9 A;  5LP6 A;  2R70 A;  5BR8 B;  5CB4 B;  3JAM N;  4K8Z A;  3RYI A;  1YF2 A;  2ADP A;  5B66 Z;  4CH6 A;  4DUZ O;  1XHZ A;  2X0L A;  1JQ0 A;  3OAA G;  2ZKO A;  2XTA A;  5KUM A;  2GTS A;  2M6Y A;  4PDR A;  3UT5 B;  2R9I A;  2YS8 A;  3RYF B;  4X66 B;  1AJN A;  5KUK A;  4D7T A;  4QNH B;  4B7K A;  1R6T A;  4O4J B;  1QVG U;  1SQQ H;  3JAS B;  1SES A;  1Y76 A;  1DF4 A;  1NR7 A;  3SPH A;  1HDJ A;  4H33 A;  4HBN A;  4RAI A;  3CCS V;  3CCM V;  1VQK V;  2RDC A;  3ASO C;  1XI1 A;  2KB1 A;  5JJJ B;  5ITZ A;  2F1M A;  2EIJ B;  1Q5O A;  1JJO A;  2QGN A;  3ZHV A;  4TWK A;  1K33 A;  5H2F Z;  4O2A B;  5BZB A;  3CRC A;  1RSO B;  4MVO A;  4I0X B;  3SJC C;  2Y4T A;  4R8C A;  3K3W A;  4O2B A;  1I5X A;  4LFC B;  4JAU A;  5LHG A;  4MTG A;  4O4H B;  4DR4 B;  4GT1 A;  1P7G A;  2YID A;  4X20 B;  2YXL A;  5KMG A;  4UUJ C;  1X4T A;  5BR8 O;  5A9G A;  2IJJ A;  5KX5 B;  1HNZ B;  2C2A A;  1KEC A;  2Q0O C;  2Z0A A;  5LYJ A;  4O4L B;  1JVM A;  2JK5 C;  2B1I A;  2FML A;  2LJ2 A;  1QHT A;  4FLY A;  1OCZ B;  1VMG A;  4X66 O;  3K57 A;  1KKC A;  3SYQ A;  1NTK H;  4FLX A;  3AG2 B;  3QNE A;  2ZT9 B;  4TQD A;  4GKK B;  5D5P A;  4GX2 A;  4JGS A;  2XAJ A;  3I5D A;  2X7R B;  4ZI7 B;  1VP7 A;  3WG7 C;  1HNX O;  3T2M A;  4I4T B;  3RYI B;  4MVM A;  3CX5 F;  1IVS A;  1N34 B;  3ASN B;  4CH4 A;  1I94 B;  4JI6 B;  5EBM C;  4JAS A;  2YIA A;  1XMO B;  1M5I A;  4GX1 A;  4PDM A;  1DF5 A;  2B1G A;  1S3J A;  5KAI Z;  4BWA A;  2FKX A;  2K9P A;  4DRX A;  1FFX A;  1Y76 B;  2A7W A;  4U7O A;  4LFC O;  3BA8 A;  1GMG A;  5KAF Z;  2FB5 A;  4DR4 O;  1K92 A;  3EVK A;  1Q7Y W;  1QVF U;  2BTQ B;  1VQ7 V;  2YXY A;  2XHB A;  2M7W A;  1MOF A;  5B1O A;  2ITC C;  1XDC A;  3C3S A;  1HNZ O;  2XAS A;  5F2V O;  1IXB A;  4OX9 B;  1NKD A;  3OT7 A;  4PA6 A;  1TUB A;  2ARH A;  1K7D A;  3ABM B;  2HFE C;  3CCU V;  1Q6I A;  5LMN B;  4H13 B;  3ZMT A;  2EX3 A;  4CS3 A;  2HG5 C;  1DLB A;  2W0F C;  3EFF K;  3MDS A;  1NT2 B;  2E75 B;  2B9Z A;  3FKS G;  1W59 A;  4GKK O;  1XNQ B;  3RYC B;  1NR1 A;  1SET A;  1FPO A;  3OMI B;  2WLM A;  1QQC A;  4UVA A;  3RN4 A;  1VQ4 V;  1AVM A;  5EYP A;  1N34 O;  1I94 O;  5LYJ B;  4JI6 O;  4HZ3 A;  3B8N A;  1XMO O;  3OGI B;  3X2Q B;  5K1X A;  4U7N A;  3IC9 A;  4B3R B;  2H8P C;  1FKA O;  1VQO V;  3CC2 V;  2Q7G A;  1KP3 A;  4EFB A;  5D5Q A;  1ZWI C;  4DR1 B;  4O4I B;  2IH3 C;  5JVD B;  3K9A A;  3AG1 B;  4GKJ B;  3SDL A;  1M9N A;  2OCC C;  5E79 Z;  2A9H A;  1QU7 A;  1LUW A;  4FM2 A;  1YZB A;  3E22 A;  3AG4 B;  1B06 A;  4OPH A;  1V54 B;  2AHZ A;  1WNS A;  2VWJ A;  4W4L A;  2DYS C;  1XL6 A;  3CXH F;  2LO1 A;  1IBM O;  2IM9 A;  5JQG A;  5A2Q N;  4DRX B;  1N4C A;  5B3S C;  3J81 N;  1FFX B;  4LF4 B;  4OX9 O;  3JD2 A;  3ZHQ A;  5LGN A;  1SER A;  5GTH Z;  3A0H Z;  3FD9 A;  2YUA A;  1OJH A;  2Z5U A;  3APO A;  5KA5 A;  1BZK A;  4LNU A;  2V1D A;  2X6A A;  1TUE B;  4ZIB A;  3K5M A;  1RPR A;  5BMV A;  4JI4 B;  3FB7 C;  4JF3 A;  1P4R A;  1L1F A;  1S5H C;  2BSK A;  1AR4 A;  3ZMV A;  2QM8 A;  1XNQ O;  4CS2 A;  4B3S B;  3L71 H;  3H01 A;  3VQV A;  2GDS A;  4N23 A;  1TUB B;  4IYI A;  5IYD O;  5IJ9 B;  1N8R W;  4B3R O;  3B8M A;  4QGP A;  3IJ4 A;  3UCS C;  5LGU A;  3P3N A;  1WN7 A;  4X1I A;  1HNW O;  3AG3 B;  3O9O A;  4DR1 O;  3DSQ A;  4FLZ A;  4J9Z B;  4GKJ O;  5GTI Z;  1HR0 B;  5EYP B;  2X6C A;  1FAF A;  2CTQ A;  4TUY B;  1UFI A;  1JR9 A;  4PD4 F;  3QF7 A;  4F4L A;  2GHY A;  1KU9 A;  2P67 A;  4U3F H;  3U0Z A;  4CBC A;  2Y4U A;  1JCH A;  3WFV A;  4JI8 B;  3HKB B;  3JD4 A;  5L3B A;  4PDL A;  2UXC B;  3CRQ A;  4LF4 O;  2QE7 G;  2L6L A;  4U3J B;  5LHI A;  1J5E B;  1DGS A;  1ZL8 A;  3ZRV A;  1R3J C;  4UCT A;  3DXR A;  5FL7 G;  2Q68 A;  3OEE G;  3JYC A;  2Q9L A;  4JI4 O;  3ASO B;  4LFB B;  1FS0 G;  3KZI Z;  3OM3 B;  4B3S O;  4C7U A;  2XAH A;  3ZHU A;  1ENV A;  5JJE B;  1EFR G;  1L8D A;  2F93 B;  1AI7 A;  4UCV A;  2Q4P A;  2QJ1 A;  1TGO A;  5DED A;  5LXT A;  1RP3 B;  4LNU B;  1YJ9 V;  3UKM A;  5EC1 C;  4JI3 B;  4J42 A;  2ZNI A;  5BMV B;  5H6Q A;  4DXW A;  2BTO A;  2BSK B;  5DN6 G;  2JJ2 G;  1I5Y A;  4UCR A;  5HFL A;  2N05 A;  1HR0 O;  1VIB A;  2CAZ C;  4FZ1 A;  4DV0 B;  1QLN A;  2H3O A;  3IAY A;  3J80 N;  1NTZ H;  4DK1 A;  3JAL B;  3BY6 A;  1S5L Z;  2Q69 A;  1ARO P;  3FYI B;  3WB0 A;  4B3T B;  2KKW A;  3HPL C;  3SYO A;  2ZCE A;  3F5T A;  3FAV A;  3H1I H;  1M57 C;  2Y0P A;  3T1H B;  2IU0 A;  2UXC O;  4ICG A;  4I50 B;  4ABM A;  3DC5 A;  4YIP A;  4XDJ A;  2JEU A;  1J5E O;  2CK3 G;  3B09 A;  2HJD A;  4JI1 B;  5IJ0 A;  3QO5 A;  4PEL A;  5JCO C;  2OIG A;  3G6E V;  2IJH A;  2AZ0 A;  1OCO B;  4R6Z A;  3TXQ A;  1VQ9 V;  3QG5 A;  4LFB O;  4PA3 A;  3LUT B;  1OHH G;  1VF6 C;  4WFE A;  4QJF B;  1K3E A;  1BHB A;  2JRI A;  1G4Y B;  4IHJ A;  4AIL C;  2QTO A;  1R3I C;  1ZL8 B;  1RM1 C;  3U10 A;  1VQP V;  1BE3 H;  2X6B A;  3STL C;  3K9S A;  4F6E A;  2WLH A;  4DW1 A;  2WPD G;  4JI3 O;  1AP6 A;  1NU1 H;  3D8C A;  3SJB C;  4ASU G;  4LR3 A;  4FLW A;  4Z1V A;  4X64 B;  1KYO F;  2Y48 A;  2OTL V;  3CCL V;  3P30 A;  4HYO A;  2AW9 A;  2CTW A;  5H5N A;  4JZG A;  2NNU A;  4DV0 O;  3CC7 V;  4LF5 B;  2N04 A;  3H1K H;  5KHJ A;  3CE2 A;  1VQ5 V;  4B3T O;  3DTU B;  3N2K A;  1GKF A;  2JVD A;  3ETQ A;  2WA4 A;  4J9Y B;  3T1H O;  1Q86 W;  1KQS U;  3K79 A;  3CCV V;  1R6N A;  3PJS K;  2GUZ B;  2EIN C;  1H8E G;  4MVZ A;  4JTC B;  2ZIN A;  2P7T C;  4JZ2 A;  4JI1 O;  4DR2 B;  2ETN A;  4LBE C;  2QR4 A;  2BOB C;  1XUQ A;  2AHY A;  1K73 W;  1WA8 A;  1S76 D;  3E35 A;  1AJQ A;  5FLX N;  1I08 A;  1ZTE A;  4JPR A;  5EZY A;  3CME V;  2CTP A;  2IH1 C;  1XOU A;  4JYC A;  1EN6 A;  4MVS A;  2QKC A;  3FAV B;  3ETE A;  2HLD G;  3SR2 C;  2HR3 A;  3U11 A;  2YSU B;  4YY3 B;  2Y69 C;  2ZM6 B;  1T5E A;  1BT8 A;  3H9V A;  5IJ0 B;  2DYR C;  4CZZ A;  4MTF A;  2DMX A;  3K08 A;  1NQT A;  3ZRS A;  4EKW A;  4X64 O;  3ETD A;  2ATK C;  5C93 A;  1NVP D;  2AGA A;  5CBF A;  1MZF A;  3CWB H;  2PUS A;  3E86 A;  3ABU A;  1NH2 D;  3E8G A;  2ZIM A;  3OEH G;  4IHJ B;  3ZJZ A;  1JMK C;  3CB2 A;  1N32 B;  4LF5 O;  2YEV A;  5JH7 B;  5FNV A;  2HHH B;  5CBG A;  5B3S B;  1FD9 A;  1HNX B;  2F23 A;  2EIK C;  3JAT A;  1TVK A;  2OYQ A;  4I55 A;  3LSQ A;  1OCR C;  5EIB C;  3UQ8 A;  2MW2 B;  4Q20 A;  2EIM C;  4YIO A;  1DK1 A;  2FYU H;  1V55 C;  3OMA B;  3R66 A;  1SF9 A;  4FFB A;  4DR2 O;  4JTD B;  1U97 A;  2EBO A;  1M1K W;  2ZXW C;  2UUC B;  2F66 C;  2GSM B;  3R65 A;  2RJZ A;  4LFA B;  3T4Z A;  4LC1 A;  4OPA A;  1PM9 A;  2YI9 A;  1R73 A;  2ZDI C;  4YY3 O;  2ODM A;  3P32 A;  2ZM6 O;  2D3O W;  1M56 C;  3ABL C;  1PL0 A;  1YTF D;  2ZR2 A;  5EBL C;  1WA8 B;  5JCO A;  1Z5W A;  2KSD A;  5EZY B;  1MA1 A;  1K9M W;  5IT9 N;  1NI8 A;  2YIB A;  3HKE A;  5EC2 C;  1VF6 A;  1HW7 A;  1PL4 A;  2HEP A;  2ZD9 A;  1DTO A;  1N32 O;  5CMU A;  5LP6 B;  4NXN B;  5CA0 A;  2HHH O;  1N33 B;  4K3A A;  3OE7 G;  3AEI A;  5B5E Z;  3ZRX A;  4Z1M G;  1JFF A;  1L0L H;  4NR1 A;  2JGU A;  1BQ0 A;  1MZE A;  5LOV A;  4GUN A;  4X62 B;  5BY1 A;  2JS3 A;  1ZLZ A;  1ORQ C;  1ZUQ A;  4DR7 B;  1BHA A;  2VS0 A;  1RPO A;  1W0J G;  2JS5 A;  1GN4 A;  4KFM A;  2P5O A;  4FMT A;  4LF9 B;  4PI2 A;  2UUC O;  4P30 A;  4K8X A;  4AI8 A;  4LFA O;  1WPX A;  2ZE7 A;  5GW7 A;  3CCR V;  3JAT B;  3M99 B;  3P3P A;  3LDD A;  4I55 B;  4KHP B;  1Y6X A;  2QWO B;  4J7K A;  4JTA B;  2A79 B;  4GX0 A;  5ITZ B;  1WB8 A;  2OWO A;  3CYO A;  2VWK A;  2PI4 A;  1MSW D;  2WAM A;  2DOS A;  5TIS Z;  1NS1 A;  4G28 B;  1G6U A;  3RFR A;  3G6B A;  3K04 A;  4F6R A;  4X1K A;  4UFZ A;  2QM4 A;  1IBM B;  4FFB B;  4WCE V;  4DW0 A;  1QLE B;  4BIO A;  3F7V C;  2EUL A;  3SGI A;  3TJT A;  4O2B B;  2BCC H;  4CH5 A;  4NXM B;  1KBH A;  1Y74 A;  4DV4 B;  1UJW B;  1COW G;  4I7Z B;  5KHG A;  5KMG B;  2LFR A;  4J7Z A;  1VEW A;  1JJ2 U;  2JJ1 G;  4NXN O;  4FZ0 A;  2GV9 A;  3BFR A;  5JJN B;  1M57 B;  1SKV A;  1N33 O;  1SZX A;  2R72 A;  4OXS A;  1O9G A;  2QA4 V;  2JGD A;  2Q73 A;  3OR7 C;  1PP9 H;  3GWK C;  4ZOL A;  3G4S V;  4X62 O;  4WFH A;  1YEW A;  1E79 G;  2HP8 A;  2ZE8 A;  1S0V A;  1ZX3 A;  4DR7 O;  3HKE B;  4TOI A;  3FB5 C;  2FTK A;  2QEX V;  2NLJ C;  1HNW B;  4XDK A;  2DQ0 A;  2W6I G;  4GYC B;  5CA0 B;  4YXW G;  4LH6 A;  5IYC O;  1NZ6 A;  4LF9 O;  3L74 H;  1JFF B;  1JPX A;  1VF5 B;  2MK3 A;  3NXS A;  3BCC H;  2HJF C;  3UO2 A;  5CA1 A;  1RM1 B;  2A06 H;  2IJI A;  4DV1 B;  1VQN V;  4KHP O;  4DK0 A;  2CH7 A;  4IGG A;  3TCU A;  3RW0 A;  1K4D C;  2G38 A;  4NTX A;  4EEQ A;  2Q7H A;  3ABT A;  2CUG A;  1E1Q G;  3OTO B;  1FXH A;  2WLN A;  1RFY A;  5LHH A;  2RCV A;  4BIU A;  3TXS A;  4FIP C;  1WJZ A;  4NXM O;  1XMQ B;  3HKC A;  5KHK A;  3FB8 C;  3Q4H A;  4DV4 O;  1N36 B;  3RVY A;  3SPG A;  2CGO A;  4B08 A;  3THO A;  3DC6 A;  3VOU A;  2LFS A;  4DV3 B;  2P06 A;  4MT8 A;  1GAX A;  5GON A;  2QM7 A;  3BPZ A;  4A5U B;  3K0D A;  4FLU A;  1FYJ A;  1M4U A;  2EIN B;  2ZDI A;  3SYP A;  3LDC A;  3IFX A;  4X1Y A;  3QO7 A;  1CPY A;  1SC5 B;  3L75 H;  2OCH A;  2YIB D;  4J11 A;  2DQ3 A;  4LWS A;  4I9W A;  1Y74 B;  4XBF A;  5B1B C;  4UV9 A;  1OCC B;  5JWP A;  4RUF A;  4KP4 A;  2RN9 A;  2HKO A;  1US6 A;  3ZIA G;  1XBL A;  4BR6 A;  4NKG B;  3K03 A;  2JGD B;  2QWR B;  3BAB A;  5L3E A;  4N21 A;  1GH6 A;  3AG7 A;  4ZOL B;  2UXN A;  4LCU C;  4DV1 O;  4UVC A;  2DYR B;  4RWU A;  3HB3 B;  3L70 H;  5DEC A;  4YJ2 A;  5L3F A;  4EFE A;  4L8J A;  4DR3 B;  1YJN V;  1IX9 A;  4ZKI A;  3OTO O;  2VQE B;  4JAA A;  2E3C A;  4QPJ A;  5DM6 V;  1KP2 A;  2E76 B;  4JYA B;  1XMQ O;  4NTY A;  5CA1 B;  1OCZ C;  1N36 O;  1Q81 W;  4YJ3 A;  1U96 A; 
#chains in the Genus database with same CATH homology
 1XNR O;  4LFA O;  2UXB O;  4DV0 O;  1IBK O;  1XNQ O;  1R1B A;  4DV3 O;  4DV6 O;  4DV7 O;  4DR5 O;  1DK1 A;  5BR8 O;  3R66 A;  4JI8 O;  1XEQ A;  4NXM O;  4B3M O;  2N74 A;  4B3T O;  4DR2 O;  1IBL O;  1F7Y A;  2DJV A;  4AQY O;  2UUB O;  4DV4 O;  2DOS A;  2F4V O;  1NS1 A;  1HR0 O;  2Z0A A;  4DR6 O;  4LF7 O;  3T1H O;  4GKK O;  4B3R O;  1X59 A;  3J80 N;  4LF6 O;  1FJG O;  1HNW O;  4JI0 O;  4A5U B;  4DR1 O;  4X66 O;  1N34 O;  4OPA A;  1I94 O;  4LF8 O;  4JI6 O;  4JI1 O;  1FYJ A;  4GKJ O;  3JAM N;  4JI7 O;  1XMO O;  3F5T A;  4YY3 O;  3RT3 C;  4DUZ O;  2ZM6 O;  2UXC O;  2ZKO A;  5FLX N;  3O65 A;  1FKA O;  4NXN O;  1HNX O;  1J5E O;  1N33 O;  5BXZ A;  1AIL A;  1KUQ A;  5IT9 N;  4JV5 O;  3SDL A;  4X65 O;  1R6T A;  3M8A A;  5IWA O;  4X62 O;  4DR3 O;  4JI2 O;  4LF4 O;  4LFB O;  2E5L O;  3T1Y O;  1YZB A;  5LMN O;  1N32 O;  4OPH A;  4K0K O;  2VQE O;  2HHH O;  4DUY O;  2FKX A;  2JRI A;  4X64 O;  4DR7 O;  4DV1 O;  4LFC O;  4JYA O;  1G1X B;  2AGA A;  1D2D A;  1IBM O;  4LF9 O;  4JI4 O;  4DR4 O;  5A2Q N;  3J81 N;  5BY1 A;  4OX9 O;  1AB3 A;  2UXD O;  2LW7 A;  2VQF O;  3OTO O;  4B3S O;  4JI3 O;  4LF5 O;  4JI5 O;  1A32 A;  4DV2 O;  2UUA O;  4KHP O;  4YHH O;  2UU9 O;  3J7A U;  1XMQ O;  5LMU O;  1HNZ O;  5H5N A;  4DV5 O;  1N36 O;  2UUC O;  5LL6 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...