1R3JC

Potassium channel kcsa-fab complex in high concentration of tl+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3jC00
3GB7C 4BW5A 3T2MA 5CBFA 3OR6C 3E86A 3OUSA 4QE9A 3RVYA 1JVMA 1R3KC 1M57C 5J9PC 4MS2A 3SPHA 2A9HA 3AG2C 4MVZA 4LP8A 3AG1C 4EKWA 4R8CA 3T4DA 1OCRC 3F7VC 4UUJC 2BOBC 4MVUA 4P9PA 2HFEC 3RW0A 2BOCC 4PA9A 4KFMA 1ZWIC 2WLIA 4QE7A 3UKMA 4P9OA 2DYSC 2WLLB 1R3IC 4RAIA 5E1AC 2DWEC 4X89A 5EC1C 2A0LA 2X6CA 3IGAC 1OCOC 3JYCA 3K0GA 4F4LA 2A79B 2P7TC 1KKDA 4MTFA 3SPGA 2DWDC 4MW8A 4TWKA 3FB6C 4LCUC 2X6BA 4MW3A 3TCUA 3TETA 4R7CA 2WLJA 3LDEA 3T4ZA 4R50A 3E89A 4JTCB 5EC2C 4CBCA 4RO2A 5IY5C 3E8GA 2NLJC 3ASOC 5CBGA 3E83A 3LDDA 3LNMB 3FB7C 2DYRC 4PDMA 2EILC 5EBMC 4GX5A 3SPIA 3T1CA 4ZBMA 3K08A 4GX0A 3AG3C 3SYOA 2ITCC 2Q69A 3K03A 3SPJA 2K1EA 3SYPA 2X6AA 4MTGA 4R6ZA 4H33A 4QNHB 3OR7C 2HVKC 4PDVA 3X2QC 2HG5C 2AHYA 4JTAB 4XDKA 1K4CC 4PDRA 4PA3A 2ZD9A 3FB5C 4WFGA 3SYQA 1M56C 2H8PC 3E8FA 4HYOA 2KB1A 4OXSA 4P30A 4PDLA 3VOUA 3BEHA 2R9RB 2Q67A 4WFHA 4MVSA 4X88A 4J9YB 2WLHA 1ORQC 1R3LC 2EINC 1XL4A 4I9WA 1S5HC 3WG7C 2IH3C 3E8HA 4XDLA 4P2ZA 4XDJA 5EBLC 4G28B 1J95A 1OCCC 3R65A 4GX2A 1V55C 4JTDB 2EIJC 4PA4A 3K06A 3F5WC 4X8AA 2QKSA 4HZ3A 3SJQC 3ZRSA 3OUFA 4J9ZB 4GX1A 4H37A 1QLEC 2HVJC 2WLIB 4MTOA 3IFXA 1G4YB 3SYCA 2HJFC 3PJSK 4MVMA 1BL8A 3RBZA 3ABLC 1R3JC 3EFFK 3F7YC 4G27B 3ABMC 3UM7A 4RUEA 3RVZA 2WLKA 4LBEC 1OCZC 5BZBA 3K0DA 5B1BC 2Q68A 3SPCA 3AG4C 2ZXWC 3E8BA 3LDCA 4WFEA 4MVRA 1LNQA 2AHZA 2WLNA 3STLC 4MVOA 2JK5C 2ATKC 1K4DC 2OCCC 2YEVA 2EIKC 2Q6AA 5B1AC 2W0FC 2Y69C 2WLMA 4DXWA 3ABKC 3STZC 2WLLA 3ASNC 3KG2A 1V54C 2EIMC 3FB8C 3OGCC 3HPLC 2IH1C 4RUFA 2QTOA 2ITDC 5EK0A 3LUTB 3SYAA 4PA6A 1XL6A 3K04A 4WFFA 5B3SC 4MVQA 5EBWC 5KUMA 3ZJZA 4PA7A 5KUKA 5CBHA 1P7BA 4MSWC
chains in the Genus database with same CATH superfamily
2Y4TA 4DV6O 1IBKB 1ZX3A 3E35A 1MNGA 1VIBA 4MS2A 2VQEB 3VBBA 4R8CA 4DV0B 2DQ3A 3W7SA 4PA9A 1Q86W 1IX9A 4A5UB 2WLLB 4IT5A 1G1XB 1GTOA 3JALB 3JAMN 4G2KA 5JVDB 3A0BZ 1XNQB 5JH7A 2E74B 4JTCB 4X62B 3T1HO 2EJRA 2RQ6A 5FLXN 3E8GA 2H3OA 2YXHA 1K9MW 1N34O 4QPJA 5GW7A 2VS0A 4JGSA 5EYPA 2IJIA 1NS1A 1NTZH 5JCOC 1S77D 1FJGO 4PDVA 3J81N 4JTAB 4PDRA 1J5EO 2YIBD 1VQ4V 1PKXA 1SA0A 1VF5B 4DW1A 4Z2WA 5KMGB 4O4LA 2EINC 5DECA 3ZX6A 1Q81W 1DGSA 5E79Z 4TUYB 3BY6A 1GN4A 1OCCC 5H9CA 2P67A 4X66B 3KZIZ 4HZ3A 3SJQC 4J9ZB 1M4UA 2QGNA 2VQFO 1AROP 2ZDIC 4MTOA 1YDXA 1G4YB 3OT7A 1VF7A 3W7TA 1MMMA 3HKDB 4UCOA 4DR1O 3ZMZA 1K34A 4WFEA 3CWBH 4B08A 3IJ4A 4FZ0A 4IGGA 2P90A 2QA4V 2R9IA 1COWG 2Q6AA 3RYHB 1ZTEA 2FL4A 4LFBB 1QLEB 1Y74B 2JDIG 3TK1A 3ABMB 2CTRA 5KHHA 4YY3O 3RYCA 4X64B 2B9ZA 4ZI7A 1XQ8A 2CTPA 3EVKA 3G71V 1I94B 1VQ6V 1YF2A 1Q82W 3OAAG 4QJFB 2L35A 2A9HA 2F95B 1GRJA 3ABKB 1SQQH 3U11A 3F7VC 3L71H 4UUJC 2ZKOA 5CA1B 4JI1O 1EN5A 3QO7A 4I5SA 2Q73A 3IGAC 1KBHA 1K8AW 2A79B 3U10A 2ZINA 3VQVA 1VARA 3M7MX 1RSOA 3VQYA 5JJNB 2CTWA 2OTLV 4FJCC 1NTMH 5IJ9A 4CC6A 2DYSB 3P3NA 5ITZB 2H94A 2E75B 3SYPA 4JI5O 4K8ZA 3AK3A 3E8FA 1VQKV 3TGUH 3JCZA 5J2TA 4XDLA 4P2ZA 1XUQA 2R70A 4G28B 1F51A 2DYRB 1O9HA 3K06A 3OUFA 4DV1O 2Q9LA 3OFNG 4DV5B 2XHBA 5LA6B 1PP9H 4F6EA 1XOUA 3NR7A 2PY5A 3ETGA 5CA0A 4PI0A 2E76B 5JH7B 4YJ2A 2YI8A 2D2CB 4EEQA 1JX9A 1YZBA 3M99B 2Y69C 3I5DA 1CEZA 3D36A 5CMUA 1JCHA 2EZOA 2Q7GA 4KUMA 5EYPB 2QWOB 1WP7A 3CRCA 3DC6A 3K57A 3G67A 3LUTB 4JZ2A 4DR4B 2A3QA 2BTQA 1TUEB 5LMUB 3AG4B 1H8HG 1Q6IA 4JI8B 1SA0B 3A2FA 4O4LB 1OZ0A 3CRAA 3AG2C 2YXLA 3THOA 4P9PA 2ARHA 3ZBHA 4I50A 1I5YA 2K9PA 2RN9A 4B3SB 5EC1C 5EZYA 1KKCA 2XAGA 4UCTA 1BSMA 4CS2A 3CCEV 4PV1B 1M1KW 4HNAA 4D7SA 4X1KA 2XAHA 1RM1C 2OWOA 1YSCA 4JPRA 2ZM6O 4DV6B 1PNKA 2HEPA 4X20B 5A9GA 4O4HA 3K9AA 3T1CA 4FLUA 1DK1A 2ITCC 3L70H 3SJCC 3OR7C 3ZIAG 3D3IA 3FYIB 2V4DA 1KMIZ 2Y48A 3BPZA 1Z5VA 3I56V 1MSWD 2A06H 4J9YB 4N21A 3RYCB 1RPOA 4B7EA 4ZI7B 3T1HB 3R65A 3CCRV 2EIJC 4PI2A 3AG3B 1PNMA 1N34B 3O65A 1UJWB 1H8EG 1VQ8V 2Q7HA 4CH6A 3HKEA 3CX5F 1BL8A 1FJGB 3RBZA 3ABLC 4FFKA 3F7YC 4G27B 3ZHSA 1J5EB 3QG5A 3RVZA 4JI0O 1GM9A 3JARA 1RSOB 4TT3G 3A0RA 2E3CA 2YEVA 2V1DA 4DXWA 2EULA 4J11A 4UV8A 1SQVH 4UCSA 5IJ9B 2Y4UA 4EB6A 1FXVA 3IC7A 2VQFB 3K5NA 3NXSA 2AGAA 4J41A 1P7BA 3TXSA 1PL4A 1VEWA 2HR3A 1AP5A 4BIOA 4DR1B 3RVYA 4LH7A 1XREA 2BCCH 5J2TB 3BCCH 2LGQA 4MVZA 1Q8IA 4EKWA 1AILA 2BOCC 5H6QA 4JYBA 1EM1A 1U97A 4NR1A 2QM8A 1WPBA 2JVDA 5FNVA 1T5EA 2HP8A 4YY3B 3LDEA 1F7YA 1M57B 3RFRA 4JAVA 4DR3O 1DF5A 3ASOC 4TQDA 4FMTA 4YJ2B 2PF4E 4PDMA 1NZ6A 2D3OW 4GX0A 2Q69A 2LW1A 2YIDA 1OCOB 1KQSU 2QKCA 4X9QA 3FB5C 4JI1B 4Q20A 3W7XA 1S3JA 3CRRA 4JV5O 2BTQB 1ORQC 1QR8A 5K1PA 2GTSA 2X7RB 3PN1A 4CH4A 2XTAA 3E2EA 2QKSA 1M90W 1W0KG 4I50B 1YVWA 2FB5A 4JI5B 4MVMA 4B7KA 1R6NA 2OYQA 1BT8A 3J80N 5EZYB 2VRZA 5BZBA 4NXNO 5DN6G 2YC0A 4HNAB 4X1KB 3SDLA 3B8NA 4JI6O 5BXZA 3DC5A 2XAFA 2WLLA 1V54C 4O4HB 3F5TA 3HPLC 1NVPB 2CK3G 4O2AB 4GKKO 3ZRXA 2LGWA 4DV1B 3ZJZA 2V7QG 4UVBA 1URFA 1H38A 1IDSA 5KA5A 2QR4A 1QQCA 2EIKB 2XAQA 5TISZ 4LP8A 2HFEC 2EIMB 3G6BA 4BR6A 3UKMA 1F4NA 5B3SB 3CYOA 4LWSA 1CP9A 2WWWA 2QTSA 2WPDG 4R7CA 5IYZA 5EC2C 1YITV 1SQFA 4UVCA 3AG1B 2JRIA 1K7DA 2OCHA 3JARB 2DE0X 4O2BA 2AZ0A 1HR0O 3LNMB 2YEVB 3RT3C 3C3TA 2PI4A 4R6ZA 1TA8A 3C90A 2Y0IA 3HKDA 3K5LA 4EB6B 1BQZA 1V9PA 5GTIZ 5B5EZ 1GN6A 1JMKC 3B8MA 1JOYA 2Q67A 1PNLA 1S5HC 1G8MA 1NBMG 4EFEA 3OMAB 5EBLC 2ZM6B 4DV3O 3CMAV 1VQMV 1QU7A 1EZVH 4AHCA 5L3CA 1FS0G 1FFXA 1SC5B 3OMIB 2PYJA 3QF7A 3ABTA 1NVPD 5FNVB 1OV9A 1US6A 3CSXA 2UXCO 3E8BA 4O4JA 2M7WA 3QTCA 4DR6O 5A2QN 1X4TA 1A32A 5KX5A 3JAKA 5LOVA 2LJ2A 2IM9A 4TOIA 3ZS8C 4GLXA 1GN3A 3TXQA 5KUKA 4LFCO 4I0XA 4O4IB 2QWQB 1JVMA 4JI0B 4TQFA 1H2KA 5LXTA 1IURA 1ZL8B 1OCRC 4MTXA 5LP6A 4JYAO 1XMOO 5JQGA 2CTQA 4GT1A 4RAIA 2ZE8A 4LF6O 4RQFA 3FKSG 2KQXA 1X59A 3BHPA 3TETA 1Q6UA 1YTFB 3MDSA 3BA8A 2XNDG 4HAMA 3E83A 4X1IA 3LNNA 5KAFZ 3SPJA 1K5SA 3Q4HB 4XDKA 1XNRO 5JWPA 1KU9A 5LA6A 3P30A 2YDEA 2IJHA 2ZNJA 4BIUA 1KP2A 4OX9O 1MA1A 3E8HA 4DR3B 1WP8A 5KAIZ 4X8AA 1VQPV 4OPAA 4JYCA 2LFSA 3KCYA 4BW9A 4LWSB 3I55V 1OCZC 4WFAV 4LF7O 1SQBH 2W6JG 4JV5B 2WLNA 2X0LA 4GZRB 3ZHRA 5IYZB 1K4DC 2OCCC 2C2AA 4UV9A 4O2BB 3CEIA 3H1IH 1Z2GA 1Y76A 3JD3A 5F2VO 5KUMA 1BMFG 4H44B 3T2MA 4NXNB 1HDJA 4X20A 3RYFA 1KKDA 4DV2O 3ASNB 2BOBC 3QVNA 2AW9A 4JI6B 3JSNA 2BE3A 1K73W 3H1KH 1R3IC 3H1LH 4RWUA 1MZEA 3SJBC 4NYKA 4DV4O 1FFXB 4GKKB 2P7TC 3CCVV 1K92A 2DWDC 4TWKA 3FB6C 2X6BA 3D3QA 1XILA 1JPXA 4R50A 5IWAO 4CH3A 2W6IG 4CC5A 3J7AU 4O4JB 2ZDIA 1GMGA 2AXTZ 4JI2O 1F23A 4J80A 3L73H 2K1EA 5KX5B 3JAKB 5LOVB 3BRCA 3WFVA 3SYQA 4HYOA 1BE3H 2WLHA 4NXMO 2Q0OC 1EZJA 5IY5B 1Y67A 1L8DA 2PGGA 4I0XB 3SGIA 1EN6A 5LXTB 5D5QA 3ZRWA 1HR0B 2EJ7A 4FM1A 4WFBV 5LP6B 5D5PA 4GX1A 3WU2Z 5GTHZ 4DR2O 1S0VA 5JQGB 4NVPA 4IYIA 2Z3YA 2CAZC 4ZOLB 2YICA 2ZR3A 5C93A 1EFRG 5EIBD 3R66A 2L6LA 4MVOA 1QVGU 4UCVA 1IXBA 3BAAA 2UUAO 2UXDO 5B1AC 5L3BA 2WLMA 4DV3B 1WPXA 2Y0PA 3KKYA 1KB9F 1WAZA 4X1IB 2IH1C 3LSQA 3D36C 2ZQMA 1SESA 4UVAA 2ZR2A 2DQ0A 4UCRA 4CZZA 3B09A 2LO1A 3OR6C 1HNXO 2UXCB 1ROPA 1TUBA 2ZT9B 4B3MO 1E1RG 2UUBO 1B06A 1YHQV 1BHBA 2ADPA 4DR6B 2VWJA 1VQ5V 5E1AC 2A0LA 1AI6A 3APOA 2KSDA 1FXKC 5LYJB 2QSAA 4MW3A 4CBCA 3MD0A 2QDOA 4LFCB 2Q7EA 5KHKA 4E2LA 1AB3A 2Q0AA 3FB7C 4FIPC 2EILC 3ML0A 5KLVH 3L74H 2OTJV 3K03A 2F43G 4MTGA 3CXCU 4JYAB 1XMOB 3X2QC 5LHHA 1K4CC 1JR9A 1KECA 5CB4A 4Z1VA 1Y76B 5IDJA 4BWAA 2PYLA 4LF6B 3UT5A 1ENVA 3DSQA 1VF6C 1RPRA 2HKOA 3N2KA 2ADQB 3DXRA 4FPPA 2QKAA 5BY1A 4GX2A 3RYIB 3RYFB 1P49A 3IC9A 3F5WC 2MK3A 4B3TO 4QGPA 4ZKIA 4O2AA 2HJFC 2LW7A 3BA9A 4TV9B 2QWNB 1XNRB 2EINB 4LC1A 1B04A 2O57A 2QE7G 1Y66A 2ZXWC 3KCXA 4FFBB 2F4VO 4MVRA 1VQNV 1OCCB 1S72V 2JJ2G 1KP3A 4OX9B 1I5XA 2Z5UA 2WA3A 1S5LZ 2QTOA 1YI2V 1YJ9V 2EBOA 5HFLA 4ZHQA 4LF7B 1Q7YW 1YIJV 2GDSA 3RN4A 3AK2A 1LUVA 3QO5A 4KFMA 1WB8A 3OEHG 2ZNIA 4IL6Z 3ZRWB 4CS3A 5CA3A 2X6CA 4FLWA 4F4LA 1XMQO 2P4KA 2FMLA 1Y6XA 3TCUA 1MZFA 2YSUB 2WLJA 3GVMA 3ETDA 1D5AA 4NTWA 2NLJC 3QNEA 3BFRA 3OW2U 2JIZG 2CGOA 4ZBMA 4DV2B 3UM7A 5L3GA 3MAQA 4QNHB 2HVKC 2IJJA 3B2EE 5IYCO 1M56C 2HLDG 3HKCA 4DV4B 3BEHA 5IT9N 4MVSA 3RGBA 4JI3O 2P5OA 4JF3A 4JAAA 3WG7C 4DK0A 4XDJA 5IWAB 1O9GA 1TUBB 1V55C 4K35A 3AG7A 1DLBA 4PA4A 1P7GA 2JS5A 5HFMA 2YIAA 4JI2B 1U96A 1VQ7V 2KKWA 4AI8A 4D6TH 1SQXH 2NNUA 1FKAO 2EX3A 1FXHA 2XT9A 3H1HH 4O4IA 1MSDA 4DUYO 2ZE6A 1PM9A 1LUWA 4NXMB 4CS4A 1ZL8A 2B5UA 2YIBA 2RCVA 2W0FC 3OE7G 2VWKA 3D8CA 4OPHA 1M9NA 1ZLZA 3K04A 4IYHA 3CCQV 4DR2B 3T1YO 3OM3B 1EBOA 4X65O 5CB4B 4LF5O 3CJHA 3UT5B 5LGUA 5KHJA 2Y69B 3N2KB 5BR8O 3DXRB 4W4KA 4MVUA 2UUAB 3ETQA 2UXDB 2ZE5A 3E22A 3Q4HA 1HP8A 2UUCO 1GKFA 3JYCA 2BTOA 1IXMA 1H2SB 4Z1MG 4KHPO 2HHHO 3AG2B 4KL1A 4FLVA 5AG2A 1HNXB 2HJDA 4B3MB 1FYJA 2UUBB 2CH7A 3K08A 1Q43A 4LF4O 3H01A 5H2FZ 1ZSPA 4H33A 5L3DA 4YJ3A 1RM1B 2KB1A 1P4RA 4D7TA 2R9RB 4X88A 3APQA 1PPJH 4IHJA 1NT2B 4YIOA 2IH3C 3UO3A 3ZHUA 4ZHQB 3FD9A 2OIGA 1PD3A 4J10A 4WCEV 2LQTA 4YHHO 4LF8O 5JJEB 1QLEC 3K59A 3IFXA 5BMVA 4L87A 2CUGA 3ABMC 2IBZH 4RUEA 2YS8A 2NR5A 3MHHC 1AI5A 4K0KO 3HB3B 1WNSA 2AHZA 3STLC 2EIJB 3C3SA 1VQ9V 2DOSA 1B6QA 3ABKC 2PI5A 4U3JA 4B3TB 3W7UA 2UU9O 3ABLB 2FKXA 1YJNV 3BABA 4DUZO 1XHZA 3GB7C 1GM7A 3HKCB 3L72H 3JCUZ 1UFIA 3JASA 1BCCH 4DO2A 3A0HZ 3UCSC 2OT5A 2F4VB 1RFYA 5LL6Y 5LMNO 2WA4A 3B77A 2WLIA 4DYLA 4P9OA 2DYSC 4AQYB 1GN2A 5DM6V 3K0GA 5LGNA 3ZN1A 4MTFA 3QO8A 3SPGA 1IBMO 4K8XA 1N36O 2PUSA 4RO2A 2ZIMA 5CBGA 4X1YB 1N4CA 4OGQB 2ZCEA 4ASUG 2DYRC 4UB6Z 3SPIA 3G4SV 4DR5O 3SYOA 1QR9A 3ZMVA 4ZOLA 1OHHG 3BVOA 1YCIA 4DRXA 2ETNA 3SR2C 2B1IA 1Q6HA 1XMQB 3K9SA 1SQPH 5IE9A 4I9WA 1WN7A 3ASOB 3OTFA 3ZMTA 3CJHB 2GUZA 2QEXV 1PL0A 5CN0A 2CGNA 3CCUV 2RNBA 3E22B 3EFFK 1B3QA 5IYDO 1ZUQA 1AR1B 2WLKA 3AG4C 4K3AA 3OTOO 1SETA 4I7ZB 1TAEA 1NQTA 4JI3B 2IJKA 4KP4A 4FLZA 1M5IA 2P4VA 1AI4A 3CXHF 2JGDA 1H2LA 3FB8C 1IZ3A 3HR0A 1Q5OA 2CH7B 4F6RA 4GKJO 3ZN0A 4MVQA 2YUAA 5LYJA 4YJ3B 5CBHA 1HW7A 3HKBA 2A7WA 3CP1A 1K33A 3P32A 1OJHA 2QWPB 1NR1A 5IYBO 3VQWA 3OUSA 3ZMUA 1SQGA 5J9PC 5H6RA 4IHJB 5L3EA 4DUYB 4DR7O 2ILMA 2JEXA 4BAYA 4U7OA 4UFZA 1KYOF 1V54B 2KG7A 1Z5WA 4FLTA 2EZPA 4FLYA 2W0XA 4IIJB 3RWRD 5BMVB 1K3EA 3T1YB 4X65B 4LF5B 2QM4A 4L8JA 3JATA 3RYIA 1AVMA 5JCOA 1QVFU 1YTFD 3SJAC 5BR8B 3AG3C 4U3JB 1WA8A 4LNUB 4TV9A 1AJPA 2UUCB 2R9AA 3WB0A 4WFGA 4OXSA 1W2BU 4PDLA 3VOUA 4FFBA 4BIZA 2YI9A 4I4TA 4UXNA 1XL4A 4KHPB 3EXAA 1GM8A 2E5LO 1KD1W 2HHHB 3JASB 1VMGA 3A8TA 1NH2B 4Q6GA 1NR7A 2Q4PA 1SRYA 4QPKA 3CC7V 5GONA 1GO3F 3DTUB 2WLIB 4RQEA 4LF4B 1E1QG 3EHBB 2JJ1G 2RMKB 1SERA 1E79G 4TSFG 4ZIBA 1VQOV 3L9DA 1NI8A 3STZC 3L75H 1NTKH 2B1GA 2Q8VA 2ITDC 4YHHB 4LF8B 1BGYH 2N05A 4KXRA 5EBWC 1AR5A 2N04A 4PA7A 1TVKA 4DRXB 3TJTA 2GHYA 4U7NA 5B66Z 2CDYA 1M57C 4K0KB 3JAWA 1JFFA 1M93A 4JI4O 3T4DA 2GUZB 3N2GB 5B1NA 1ZWIC 4JI7O 2Z0AA 1P84F 1K97A 4LR3A 1H2MA 2XAJA 3IAYA 1OCOC 2UU9B 1I0HA 3JD4A 1N32O 1UPGA 4FVMA 4DUZB 2JEUA 1OCRB 4WF9V 3WB2A 3CC4V 1WB7A 3MHSC 3LDDA 3W7WA 5LMNB 2X6AA 2JGDB 3FX7A 2HG5C 3GWKC 1NH2D 4PJ0Z 3ABUA 2H8PC 1D5NA 4F6RB 1Q3EA 4P30A 1VQLV 3CCSV 2GBOA 1R3LC 2F23A 3O9OA 3S3WA 1IBMB 3HKBB 3ZHQA 3DGEA 1N36B 1HNZO 4JTDB 3CMEV 4N23A 1AJNA 4QIWF 1FPOA 3ZRSA 3OD4A 4C7UA 4H37A 2KG7B 4DR5B 4FLXA 1NJIW 4FZ1A 3CHXA 3SYCA 2JGUA 2JS3A 3K5OA 3CC2V 1KUQA 4GUNA 2PTMA 1VP7A 1AJQA 3S3XA 5B1BC 2Q68A 3SPCA 4AILC 2P22C 3LDCA 4DV7O 2M6YA 2R72A 2GTAA 2F93B 4LFAO 4YXWG 5KA6A 2EIKC 3UO2A 2DN9A 3JATB 3JSLA 1FXKA 2EIMC 4RUFA 1NU1H 5EK0A 3SYAA 1XL6A 1GH6A 4WFFA 5B3SC 1WA8B 3H1JH 1OCZB 3GWOA 4I55A 1G6UA 5LBQA 4MT8A 1JQ0A 2ODMA 4TV8A 4UB8Z 1QNMA 4FM0A 1I08A 4BW5A 1CXZB 3ETEA 5C8YA 2OCCB 1R3KC 2LP7A 4I4TB 3P3PA 4WBNA 3OTOB 3AG1C 5LGTA 1NKDA 4B3RO 1MABG 4ABMA 4QE7A 4AQYO 1IBLO 2DWEC 1R6TA 3AEIA 4X89A 1HNWO 1VF6A 5GONB 1SS3A 4GKJB 1YEWA 4MW8A 4J7ZA 4H13B 2F1MA 2MW2B 4JASA 4DR7B 4GX5A 1N33O 3JD0A 2AHYA 3ZMSA 1KC8W 1N0NA 4NTYA 3LSUA 1LR1A 3K5MA 1TVKB 1SZXA 1XHXA 4YIPA 1S5JA 5FL7G 2IU3A 4PELA 1SZTA 1QBZA 1GAXA 3CPWU 2UXBO 2YXYA 3OEEG 3K79A 1J95A 4ICGA 3JAWB 1JFFB 4DW0A 4LF9O 2F66C 3H9VA 1RP3B 3FAVA 1QHTA 3PJSK 3ZHVA 1IBKO 4JZGA 4FK5C 4U3FH 1BS3A 5JJJB 1R73A 2VQEO 2JK5C 3UQ8A 4DV0O 2E5LB 3KG2A 1W0JG 3OGCC 4JYYA 2PZSA 1D2DA 1H2GA 2AZ2A 4CH5A 1DTOA 1XNQO 4NTXA 4E4EA 1JJOA 4X62O 5FPRA 5CBFA 1L0LH 4XBFA 2OIEA 2IU0A 5CA0B 4X1YA 1QLNA 5B1AB 3SPHA 2N74A 1DF4A 1IVSA 2CE4A 2BSKA 3RW0A 1QCEA 2QWRB 5J2UA 3CE2A 1I7FA 2RJZA 1H2NA 3N27A 2GSMB 1THZA 3CCMV 4EFBA 3CRQA 3T4ZA 5IJ0A 2UXXA 2FTKA 1S76D 1ZAUA 3ZRVA 4UCUA 4NKGB 4GYCB 4X66O 1AP6A 5DEDA 1R6KA 5EBMC 4JI4B 3CCLV 1JJ2U 1SKVA 4JI7B 3LSSA 1FXKB 4W4LA 3ZEDA 4NB5A 1EN4A 4H0LB 3FYEB 3VQXA 1YXBA 1CPYA 1N32B 4WFHA 5H5NA 4I55B 2XOKG 3K3WA 4TV8B 1Y4MA 1PV0A 5C8YB 2EILB 3ZCCA 4WBNB 4LFBO 1XBLA 3X2QB 3CS5A 3JALA 5JVDA 4J42A 1MOFA 3G80A 4I9QA 3G6EV 3AK1A 5B1BB 4X64O 5EIBC 2WSSG 1I94O 3K0DA 2P6JA 2GV9A 1XEQA 1R1BA 2G38A 1HNZB 3FFQA 3ASNC 1AI7A 4IIJA 5KHIA 3HKEB 4PHZA 5KMGA 2ZXWB 4DK1A 2FYUH 2ZE7A 3WB1A 2IW5A 4TUYA 4J7JA 3E86A 4QE9A 2UXNA 3CD6V 4DV7B 1MG1A 2ZIOA 4LFAB 1XI1A 4GCZA 5KHGA 4LNUA 3ICXA 1YJWV 2QM7A 1L1FA 5LHIA 3CRMA 2NN4A 4J7KA 3FAVB 4LH6A 1XDCA 2DJVA 4LCUC 1BZKA 3E89A 3RYHA 5IY5C 5LHGA 3B40A 1Y74A 1L0NH 4B3RB 1K5QA 4DV5O 1SF9A 5LP6C 2P06A 1IBLB 4PA3A 5L3FA 1AR4A 5B1OA 1HNWB 1WJZA 1WLEA 3JD2A 1FD9A 1JA8A 3OGIB 4PD4F 5CA1A 2DMXA 3JD1A 2XUMA 3OMNB 2DW4A 2BSKB 2XASA 3U0ZA 4DR4O 2HVJC 1N33B 1N8RW 1N0JA 1BQ0A 1M56B 5J2UB 5LMUO 3ZHTA 1R3JC 3K58A 4FM2A 4HBNA 4JI8O 4LBEC 1F4MA 4JAUA 3WG7B 3CCJV 2Q5ZA 3B4SA 1LNQA 2LFRA 1W59A 2ATKC 5IJ0B 1V55B 3M8AA 5FPOA 5ITZA 3N2GA 2UXBB 1TGOA 2QJ1A 5K1XA 2WAMA 4B3SO 1GK9A 4LF9B 4PA6A 1Q90D 1BHAA 1FAFA 3CB2A 1FFTB 1HWYA 2RDCA 2ZD9A 4MSWC
chains in the Genus database with same CATH topology
2GHYA 4U7NA 3E35A 5KA5A 1M57C 2EIKB 2XAQA 4MS2A 4LP8A 1Q7YW 3VBBA 4R8CA 3T4DA 1YIJV 2DQ3A 2HFEC 3W7SA 2EIMB 3QO5A 4PA9A 4KFMA 5B1NA 1ZWIC 3UKMA 1F4NA 3OEHG 1Q86W 5B3SB 2WLLB 3ZRWB 1GTOA 1K97A 3CYOA 5CA3A 2X6CA 2XAJA 1OCOC 1CP9A 2WWWA 3JD4A 4G2KA 4F4LA 2WPDG 3TCUA 2YSUB 2WLJA 4R7CA 4JTCB 5EC2C 1YITV 2EJRA 3ETDA 2JEUA 3E8GA 4UVCA 2NLJC 3AG1B 3QNEA 1OCRB 4WF9V 1K9MW 1K7DA 3CC4V 3OW2U 3MHSC 3LDDA 2JIZG 3LNMB 4QPJA 4JGSA 5GW7A 3W7WA 2YEVB 4ZBMA 3UM7A 2IJIA 5L3GA 2X6AA 2PI4A 4R6ZA 4QNHB 1S77D 2HVKC 4PDVA 2HG5C 1NH2D 2IJJA 4JTAB 4PDRA 5IYCO 3ABUA 1M56C 2H8PC 2HLDG 1VQ4V 1PKXA 3B8MA 4P30A 1VQLV 3BEHA 1JOYA 2Q67A 4MVSA 3CCSV 1R3LC 4JF3A 2EINC 1PNLA 1S5HC 3WG7C 1G8MA 1NBMG 1Q81W 3DGEA 3OMAB 4XDJA 5EBLC 3BY6A 1OCCC 4JTDB 1V55C 3CMAV 4N23A 5H9CA 2P67A 1DLBA 1AJNA 4PA4A 3CMEV 1VQMV 4QIWF 5HFMA 4HZ3A 3SJQC 3ZRSA 4J9ZB 5L3CA 1FS0G 1AROP 4H37A 3OMIB 2ZDIC 1NJIW 4MTOA 1VQ7V 1G4YB 3SYCA 2NNUA 3W7TA 3CC2V 1FXHA 3ABTA 1NVPD 1AJQA 5B1BC 3ZMZA 2Q68A 1K34A 3SPCA 3E8BA 3LDCA 4WFEA 2M7WA 2P90A 2QA4V 2B5UA 2R9IA 4YXWG 1COWG 5KA6A 2EIKC 2Q6AA 2W0FC 3OE7G 1FXKA 1QLEB 2EIMC 4RUFA 1M9NA 5EK0A 2JDIG 3SYAA 1XL6A 3K04A 4WFFA 5B3SC 3TK1A 3ABMB 3CCQV 5KUKA 1OCZB 3OM3B 3GWOA 1EBOA 5LBQA 4MT8A 1JQ0A 4BW5A 3ETEA 3G71V 5LGUA 1VQ6V 1Q82W 2OCCB 1JVMA 1R3KC 2LP7A 3OAAG 4QJFB 2A9HA 2Y69B 3ABKB 3AG1C 5LGTA 1OCRC 3F7VC 4MTXA 1NKDA 4MVUA 4UUJC 1MABG 4QE7A 4GT1A 4RAIA 3QO7A 2DWEC 3AEIA 4I5SA 4X89A 1GKFA 3IGAC 3JYCA 1K8AW 2A79B 4RQFA 3FKSG 1IXMA 4MW8A 3TETA 1YTFB 4Z1MG 3AG2B 2OTLV 2XNDG 4HAMA 4JASA 4FJCC 3E83A 4GX5A 2DYSB 3K08A 2H94A 3SPJA 3SYPA 3H01A 3JD0A 1K5SA 4H33A 5L3DA 2AHYA 4XDKA 3ZMSA 1RM1B 3E8FA 1KC8W 2KB1A 1VQKV 3P30A 1P4RA 2R9RB 4X88A 2IJHA 3JCZA 5FL7G 2IU3A 4PELA 4BIUA 2IH3C 1SZTA 1KP2A 1QBZA 3E8HA 4XDLA 4P2ZA 3CPWU 4G28B 1F51A 2DYRB 3K79A 3OEEG 1J95A 3K06A 4X8AA 1PD3A 1VQPV 4WCEV 3OUFA 4JYCA 1QLEC 2LFSA 3IFXA 3OFNG 4L87A 3PJSK 3ABMC 3I55V 4RUEA 3MHHC 1OCZC 1AI5A 4WFAV 4FK5C 2W6JG 3HB3B 3ETGA 1R73A 2WLNA 2AHZA 3STLC 2X0LA 2JK5C 1K4DC 2EIJB 1JX9A 2OCCC 3M99B 2C2AA 1VQ9V 2Y69C 1B6QA 3ABKC 2PI5A 4UV9A 1CEZA 3D36A 5CMUA 1JCHA 2EZOA 3KG2A 1W0JG 4KUMA 3OGCC 3W7UA 3LUTB 3ABLB 3JD3A 1H2GA 5KUMA 1BMFG 1YJNV 1DTOA 1TUEB 3AG4B 1H8HG 3GB7C 1GM7A 3T2MA 5CBFA 4XBFA 2IU0A 4DO2A 1QLNA 1OZ0A 2OT5A 5B1AB 3AG2C 3SPHA 1DF4A 1KKDA 3ASNB 2BOBC 4P9PA 3RW0A 3B77A 2WLIA 1QCEA 1I5YA 1K73W 4P9OA 2DYSC 1R3IC 5EC1C 2XAGA 5DM6V 3CCEV 3K0GA 2P7TC 1M1KW 5LGNA 3ZN1A 3CCVV 1K92A 4MTFA 2GSMB 2XAHA 3QO8A 3SPGA 2DWDC 4TWKA 3FB6C 1RM1C 1THZA 2X6BA 3CCMV 1JPXA 3T4ZA 2UXXA 2FTKA 4R50A 1YSCA 1S76D 4JPRA 4RO2A 3ZRVA 1PNKA 2W6IG 5CBGA 2ZDIA 4ASUG 1GMGA 1R6KA 2DYRC 5EBMC 3SPIA 3G4SV 1F23A 3K9AA 3T1CA 3SYOA 3CCLV 1JJ2U 1QR9A 2ITCC 2K1EA 3OR7C 3ZMVA 3LSSA 3ZIAG 1FXKB 1OHHG 3D3IA 3FYIB 3WFVA 3SYQA 3FYEB 2Y48A 4HYOA 2B1IA 3I56V 1CPYA 1MSWD 4WFHA 4J9YB 2WLHA 2XOKG 3K3WA 4N21A 1EZJA 5IY5B 4I9WA 1RPOA 3ASOB 1Y4MA 3ZMTA 2EILB 3R65A 3ZCCA 3CCRV 2QEXV 1PL0A 2EIJC 5CN0A 3AG3B 1PNMA 3ZRWA 3X2QB 1UJWB 4WFBV 1H8EG 1VQ8V 4GX1A 3CCUV 1S0VA 1MOFA 2Z3YA 3G6EV 1BL8A 3RBZA 3ABLC 3EFFK 5B1BB 5IYDO 2ZR3A 3F7YC 4G27B 5C93A 1AR1B 1EFRG 2WSSG 3RVZA 2WLKA 3K0DA 2P6JA 3AG4C 1SETA 1GM9A 1NQTA 4MVOA 1QVGU 2IJKA 4TT3G 3A0RA 4KP4A 2YEVA 2V1DA 5B1AC 1AI4A 5L3BA 4DXWA 2WLMA 4UV8A 1WPXA 3ASNC 1AI7A 3FB8C 2IH1C 3LSQA 1FXVA 2ZQMA 3IC7A 1SESA 4MVQA 4UVAA 3ZN0A 3NXSA 2ZR2A 5CBHA 1P7BA 2DQ0A 2HR3A 2ZXWB 3CP1A 4CZZA 1K33A 3P32A 5IYBO 1NR1A 2IW5A 3OR6C 3E86A 3OUSA 4QE9A 3RVYA 3ZMUA 5J9PC 2UXNA 1ROPA 5H6RA 5L3EA 3CD6V 1E1RG 1MG1A 4MVZA 2JEXA 4BAYA 4U7OA 4EKWA 1V54B 4GCZA 2BOCC 1YHQV 1BHBA 5H6QA 4JYBA 2QM8A 1VQ5V 1YJWV 2EZPA 2QM7A 5E1AC 1L1FA 2A0LA 1AI6A 5LHIA 1FXKC 1K3EA 4LCUC 4MW3A 3LDEA 4CBCA 1M57B 3E89A 4JAVA 3MD0A 5IY5C 5LHGA 1DF5A 3ASOC 4E2LA 4FMTA 1QVFU 3FB7C 1YTFD 4FIPC 2EILC 3ML0A 4PDMA 2D3OW 4GX0A 3AG3C 2Q69A 3K03A 2OTJV 2F43G 1K5QA 4MTGA 3CXCU 3X2QC 1OCOB 1KQSU 5LHHA 1K4CC 1AJPA 4PA3A 3FB5C 1KECA 5L3FA 4Q20A 4WFGA 3W7XA 5B1OA 1S3JA 5IDJA 4OXSA 1W2BU 4PDLA 3VOUA 1WLEA 1ENVA 4BIZA 4UXNA 1ORQC 1RPRA 4UVBA 1XL4A 3JD2A 1QR8A 2HKOA 4FPPA 2X7RB 1GM8A 1KD1W 4GX2A 3JD1A 1NH2B 1NR7A 3OMNB 3F5WC 3E2EA 2MK3A 2QKSA 2DW4A 1SRYA 4QPKA 4ZKIA 3CC7V 2XASA 1GO3F 1W0KG 3DTUB 1M90W 2WLIB 2HVJC 4RQEA 1N8RW 1M56B 2HJFC 4MVMA 1R6NA 1E1QG 1R3JC 3EHBB 4LBEC 2EINB 4LC1A 5BZBA 5DN6G 2JJ1G 1F4MA 2QE7G 1Y66A 4JAUA 3WG7B 1SERA 3CCJV 2ZXWC 3B8NA 1E79G 1LNQA 4MVRA 2LFRA 4TSFG 1VQNV 2ATKC 1OCCB 1S72V 1V55B 2JJ2G 1KP3A 1VQOV 3STZC 1I5XA 2Z5UA 2B1GA 2XAFA 2WAMA 2WLLA 1V54C 1GK9A 3HPLC 1NVPB 2CK3G 2QTOA 2ITDC 4PA6A 3ZRXA 1YI2V 5EBWC 1YJ9V 3ZJZA 1BHAA 4PA7A 2V7QG 1FFTB 1HWYA 2EBOA 5HFLA 2ZD9A 1H38A 4MSWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GB7 C;  4BW5 A;  3T2M A;  5CBF A;  3OR6 C;  3E86 A;  3OUS A;  4QE9 A;  3RVY A;  1JVM A;  1R3K C;  1M57 C;  5J9P C;  4MS2 A;  3SPH A;  2A9H A;  3AG2 C;  4MVZ A;  4LP8 A;  3AG1 C;  4EKW A;  4R8C A;  3T4D A;  1OCR C;  3F7V C;  4UUJ C;  2BOB C;  4MVU A;  4P9P A;  2HFE C;  3RW0 A;  2BOC C;  4PA9 A;  4KFM A;  1ZWI C;  2WLI A;  4QE7 A;  3UKM A;  4P9O A;  2DYS C;  2WLL B;  1R3I C;  4RAI A;  5E1A C;  2DWE C;  4X89 A;  5EC1 C;  2A0L A;  2X6C A;  3IGA C;  1OCO C;  3JYC A;  3K0G A;  4F4L A;  2A79 B;  2P7T C;  1KKD A;  4MTF A;  3SPG A;  2DWD C;  4MW8 A;  4TWK A;  3FB6 C;  4LCU C;  2X6B A;  4MW3 A;  3TCU A;  3TET A;  4R7C A;  2WLJ A;  3LDE A;  3T4Z A;  4R50 A;  3E89 A;  4JTC B;  5EC2 C;  4CBC A;  4RO2 A;  5IY5 C;  3E8G A;  2NLJ C;  3ASO C;  5CBG A;  3E83 A;  3LDD A;  3LNM B;  3FB7 C;  2DYR C;  4PDM A;  2EIL C;  5EBM C;  4GX5 A;  3SPI A;  3T1C A;  4ZBM A;  3K08 A;  4GX0 A;  3AG3 C;  3SYO A;  2ITC C;  2Q69 A;  3K03 A;  3SPJ A;  2K1E A;  3SYP A;  2X6A A;  4MTG A;  4R6Z A;  4H33 A;  4QNH B;  3OR7 C;  2HVK C;  4PDV A;  3X2Q C;  2HG5 C;  2AHY A;  4JTA B;  4XDK A;  1K4C C;  4PDR A;  4PA3 A;  2ZD9 A;  3FB5 C;  4WFG A;  3SYQ A;  1M56 C;  2H8P C;  3E8F A;  4HYO A;  2KB1 A;  4OXS A;  4P30 A;  4PDL A;  3VOU A;  3BEH A;  2R9R B;  2Q67 A;  4WFH A;  4MVS A;  4X88 A;  4J9Y B;  2WLH A;  1ORQ C;  1R3L C;  2EIN C;  1XL4 A;  4I9W A;  1S5H C;  3WG7 C;  2IH3 C;  3E8H A;  4XDL A;  4P2Z A;  4XDJ A;  5EBL C;  4G28 B;  1J95 A;  1OCC C;  3R65 A;  4GX2 A;  1V55 C;  4JTD B;  2EIJ C;  4PA4 A;  3K06 A;  3F5W C;  4X8A A;  2QKS A;  4HZ3 A;  3SJQ C;  3ZRS A;  3OUF A;  4J9Z B;  4GX1 A;  4H37 A;  1QLE C;  2HVJ C;  2WLI B;  4MTO A;  3IFX A;  1G4Y B;  3SYC A;  2HJF C;  3PJS K;  4MVM A;  1BL8 A;  3RBZ A;  3ABL C;  1R3J C;  3EFF K;  3F7Y C;  4G27 B;  3ABM C;  3UM7 A;  4RUE A;  3RVZ A;  2WLK A;  4LBE C;  1OCZ C;  5BZB A;  3K0D A;  5B1B C;  2Q68 A;  3SPC A;  3AG4 C;  2ZXW C;  3E8B A;  3LDC A;  4WFE A;  4MVR A;  1LNQ A;  2AHZ A;  2WLN A;  3STL C;  4MVO A;  2JK5 C;  2ATK C;  1K4D C;  2OCC C;  2YEV A;  2EIK C;  2Q6A A;  5B1A C;  2W0F C;  2Y69 C;  2WLM A;  4DXW A;  3ABK C;  3STZ C;  2WLL A;  3ASN C;  3KG2 A;  1V54 C;  2EIM C;  3FB8 C;  3OGC C;  3HPL C;  2IH1 C;  4RUF A;  2QTO A;  2ITD C;  5EK0 A;  3LUT B;  3SYA A;  4PA6 A;  1XL6 A;  3K04 A;  4WFF A;  5B3S C;  4MVQ A;  5EBW C;  5KUM A;  3ZJZ A;  4PA7 A;  5KUK A;  5CBH A;  1P7B A;  4MSW C; 
#chains in the Genus database with same CATH topology
 2Y4T A;  4DV6 O;  1IBK B;  1ZX3 A;  3E35 A;  1MNG A;  1VIB A;  4MS2 A;  2VQE B;  3VBB A;  4R8C A;  4DV0 B;  2DQ3 A;  3W7S A;  4PA9 A;  1Q86 W;  1IX9 A;  4A5U B;  2WLL B;  4IT5 A;  1G1X B;  1GTO A;  3JAL B;  3JAM N;  4G2K A;  5JVD B;  3A0B Z;  1XNQ B;  5JH7 A;  2E74 B;  4JTC B;  4X62 B;  3T1H O;  2EJR A;  2RQ6 A;  5FLX N;  3E8G A;  2H3O A;  2YXH A;  1K9M W;  1N34 O;  4QPJ A;  5GW7 A;  2VS0 A;  4JGS A;  5EYP A;  2IJI A;  1NS1 A;  1NTZ H;  5JCO C;  1S77 D;  1FJG O;  4PDV A;  3J81 N;  4JTA B;  4PDR A;  1J5E O;  2YIB D;  1VQ4 V;  1PKX A;  1SA0 A;  1VF5 B;  4DW1 A;  4Z2W A;  5KMG B;  4O4L A;  2EIN C;  5DEC A;  3ZX6 A;  1Q81 W;  1DGS A;  5E79 Z;  4TUY B;  3BY6 A;  1GN4 A;  1OCC C;  5H9C A;  2P67 A;  4X66 B;  3KZI Z;  4HZ3 A;  3SJQ C;  4J9Z B;  1M4U A;  2QGN A;  2VQF O;  1ARO P;  2ZDI C;  4MTO A;  1YDX A;  1G4Y B;  3OT7 A;  1VF7 A;  3W7T A;  1MMM A;  3HKD B;  4UCO A;  4DR1 O;  3ZMZ A;  1K34 A;  4WFE A;  3CWB H;  4B08 A;  3IJ4 A;  4FZ0 A;  4IGG A;  2P90 A;  2QA4 V;  2R9I A;  1COW G;  2Q6A A;  3RYH B;  1ZTE A;  2FL4 A;  4LFB B;  1QLE B;  1Y74 B;  2JDI G;  3TK1 A;  3ABM B;  2CTR A;  5KHH A;  4YY3 O;  3RYC A;  4X64 B;  2B9Z A;  4ZI7 A;  1XQ8 A;  2CTP A;  3EVK A;  3G71 V;  1I94 B;  1VQ6 V;  1YF2 A;  1Q82 W;  3OAA G;  4QJF B;  2L35 A;  2A9H A;  2F95 B;  1GRJ A;  3ABK B;  1SQQ H;  3U11 A;  3F7V C;  3L71 H;  4UUJ C;  2ZKO A;  5CA1 B;  4JI1 O;  1EN5 A;  3QO7 A;  4I5S A;  2Q73 A;  3IGA C;  1KBH A;  1K8A W;  2A79 B;  3U10 A;  2ZIN A;  3VQV A;  1VAR A;  3M7M X;  1RSO A;  3VQY A;  5JJN B;  2CTW A;  2OTL V;  4FJC C;  1NTM H;  5IJ9 A;  4CC6 A;  2DYS B;  3P3N A;  5ITZ B;  2H94 A;  2E75 B;  3SYP A;  4JI5 O;  4K8Z A;  3AK3 A;  3E8F A;  1VQK V;  3TGU H;  3JCZ A;  5J2T A;  4XDL A;  4P2Z A;  1XUQ A;  2R70 A;  4G28 B;  1F51 A;  2DYR B;  1O9H A;  3K06 A;  3OUF A;  4DV1 O;  2Q9L A;  3OFN G;  4DV5 B;  2XHB A;  5LA6 B;  1PP9 H;  4F6E A;  1XOU A;  3NR7 A;  2PY5 A;  3ETG A;  5CA0 A;  4PI0 A;  2E76 B;  5JH7 B;  4YJ2 A;  2YI8 A;  2D2C B;  4EEQ A;  1JX9 A;  1YZB A;  3M99 B;  2Y69 C;  3I5D A;  1CEZ A;  3D36 A;  5CMU A;  1JCH A;  2EZO A;  2Q7G A;  4KUM A;  5EYP B;  2QWO B;  1WP7 A;  3CRC A;  3DC6 A;  3K57 A;  3G67 A;  3LUT B;  4JZ2 A;  4DR4 B;  2A3Q A;  2BTQ A;  1TUE B;  5LMU B;  3AG4 B;  1H8H G;  1Q6I A;  4JI8 B;  1SA0 B;  3A2F A;  4O4L B;  1OZ0 A;  3CRA A;  3AG2 C;  2YXL A;  3THO A;  4P9P A;  2ARH A;  3ZBH A;  4I50 A;  1I5Y A;  2K9P A;  2RN9 A;  4B3S B;  5EC1 C;  5EZY A;  1KKC A;  2XAG A;  4UCT A;  1BSM A;  4CS2 A;  3CCE V;  4PV1 B;  1M1K W;  4HNA A;  4D7S A;  4X1K A;  2XAH A;  1RM1 C;  2OWO A;  1YSC A;  4JPR A;  2ZM6 O;  4DV6 B;  1PNK A;  2HEP A;  4X20 B;  5A9G A;  4O4H A;  3K9A A;  3T1C A;  4FLU A;  1DK1 A;  2ITC C;  3L70 H;  3SJC C;  3OR7 C;  3ZIA G;  3D3I A;  3FYI B;  2V4D A;  1KMI Z;  2Y48 A;  3BPZ A;  1Z5V A;  3I56 V;  1MSW D;  2A06 H;  4J9Y B;  4N21 A;  3RYC B;  1RPO A;  4B7E A;  4ZI7 B;  3T1H B;  3R65 A;  3CCR V;  2EIJ C;  4PI2 A;  3AG3 B;  1PNM A;  1N34 B;  3O65 A;  1UJW B;  1H8E G;  1VQ8 V;  2Q7H A;  4CH6 A;  3HKE A;  3CX5 F;  1BL8 A;  1FJG B;  3RBZ A;  3ABL C;  4FFK A;  3F7Y C;  4G27 B;  3ZHS A;  1J5E B;  3QG5 A;  3RVZ A;  4JI0 O;  1GM9 A;  3JAR A;  1RSO B;  4TT3 G;  3A0R A;  2E3C A;  2YEV A;  2V1D A;  4DXW A;  2EUL A;  4J11 A;  4UV8 A;  1SQV H;  4UCS A;  5IJ9 B;  2Y4U A;  4EB6 A;  1FXV A;  3IC7 A;  2VQF B;  3K5N A;  3NXS A;  2AGA A;  4J41 A;  1P7B A;  3TXS A;  1PL4 A;  1VEW A;  2HR3 A;  1AP5 A;  4BIO A;  4DR1 B;  3RVY A;  4LH7 A;  1XRE A;  2BCC H;  5J2T B;  3BCC H;  2LGQ A;  4MVZ A;  1Q8I A;  4EKW A;  1AIL A;  2BOC C;  5H6Q A;  4JYB A;  1EM1 A;  1U97 A;  4NR1 A;  2QM8 A;  1WPB A;  2JVD A;  5FNV A;  1T5E A;  2HP8 A;  4YY3 B;  3LDE A;  1F7Y A;  1M57 B;  3RFR A;  4JAV A;  4DR3 O;  1DF5 A;  3ASO C;  4TQD A;  4FMT A;  4YJ2 B;  2PF4 E;  4PDM A;  1NZ6 A;  2D3O W;  4GX0 A;  2Q69 A;  2LW1 A;  2YID A;  1OCO B;  1KQS U;  2QKC A;  4X9Q A;  3FB5 C;  4JI1 B;  4Q20 A;  3W7X A;  1S3J A;  3CRR A;  4JV5 O;  2BTQ B;  1ORQ C;  1QR8 A;  5K1P A;  2GTS A;  2X7R B;  3PN1 A;  4CH4 A;  2XTA A;  3E2E A;  2QKS A;  1M90 W;  1W0K G;  4I50 B;  1YVW A;  2FB5 A;  4JI5 B;  4MVM A;  4B7K A;  1R6N A;  2OYQ A;  1BT8 A;  3J80 N;  5EZY B;  2VRZ A;  5BZB A;  4NXN O;  5DN6 G;  2YC0 A;  4HNA B;  4X1K B;  3SDL A;  3B8N A;  4JI6 O;  5BXZ A;  3DC5 A;  2XAF A;  2WLL A;  1V54 C;  4O4H B;  3F5T A;  3HPL C;  1NVP B;  2CK3 G;  4O2A B;  4GKK O;  3ZRX A;  2LGW A;  4DV1 B;  3ZJZ A;  2V7Q G;  4UVB A;  1URF A;  1H38 A;  1IDS A;  5KA5 A;  2QR4 A;  1QQC A;  2EIK B;  2XAQ A;  5TIS Z;  4LP8 A;  2HFE C;  2EIM B;  3G6B A;  4BR6 A;  3UKM A;  1F4N A;  5B3S B;  3CYO A;  4LWS A;  1CP9 A;  2WWW A;  2QTS A;  2WPD G;  4R7C A;  5IYZ A;  5EC2 C;  1YIT V;  1SQF A;  4UVC A;  3AG1 B;  2JRI A;  1K7D A;  2OCH A;  3JAR B;  2DE0 X;  4O2B A;  2AZ0 A;  1HR0 O;  3LNM B;  2YEV B;  3RT3 C;  3C3T A;  2PI4 A;  4R6Z A;  1TA8 A;  3C90 A;  2Y0I A;  3HKD A;  3K5L A;  4EB6 B;  1BQZ A;  1V9P A;  5GTI Z;  5B5E Z;  1GN6 A;  1JMK C;  3B8M A;  1JOY A;  2Q67 A;  1PNL A;  1S5H C;  1G8M A;  1NBM G;  4EFE A;  3OMA B;  5EBL C;  2ZM6 B;  4DV3 O;  3CMA V;  1VQM V;  1QU7 A;  1EZV H;  4AHC A;  5L3C A;  1FS0 G;  1FFX A;  1SC5 B;  3OMI B;  2PYJ A;  3QF7 A;  3ABT A;  1NVP D;  5FNV B;  1OV9 A;  1US6 A;  3CSX A;  2UXC O;  3E8B A;  4O4J A;  2M7W A;  3QTC A;  4DR6 O;  5A2Q N;  1X4T A;  1A32 A;  5KX5 A;  3JAK A;  5LOV A;  2LJ2 A;  2IM9 A;  4TOI A;  3ZS8 C;  4GLX A;  1GN3 A;  3TXQ A;  5KUK A;  4LFC O;  4I0X A;  4O4I B;  2QWQ B;  1JVM A;  4JI0 B;  4TQF A;  1H2K A;  5LXT A;  1IUR A;  1ZL8 B;  1OCR C;  4MTX A;  5LP6 A;  4JYA O;  1XMO O;  5JQG A;  2CTQ A;  4GT1 A;  4RAI A;  2ZE8 A;  4LF6 O;  4RQF A;  3FKS G;  2KQX A;  1X59 A;  3BHP A;  3TET A;  1Q6U A;  1YTF B;  3MDS A;  3BA8 A;  2XND G;  4HAM A;  3E83 A;  4X1I A;  3LNN A;  5KAF Z;  3SPJ A;  1K5S A;  3Q4H B;  4XDK A;  1XNR O;  5JWP A;  1KU9 A;  5LA6 A;  3P30 A;  2YDE A;  2IJH A;  2ZNJ A;  4BIU A;  1KP2 A;  4OX9 O;  1MA1 A;  3E8H A;  4DR3 B;  1WP8 A;  5KAI Z;  4X8A A;  1VQP V;  4OPA A;  4JYC A;  2LFS A;  3KCY A;  4BW9 A;  4LWS B;  3I55 V;  1OCZ C;  4WFA V;  4LF7 O;  1SQB H;  2W6J G;  4JV5 B;  2WLN A;  2X0L A;  4GZR B;  3ZHR A;  5IYZ B;  1K4D C;  2OCC C;  2C2A A;  4UV9 A;  4O2B B;  3CEI A;  3H1I H;  1Z2G A;  1Y76 A;  3JD3 A;  5F2V O;  5KUM A;  1BMF G;  4H44 B;  3T2M A;  4NXN B;  1HDJ A;  4X20 A;  3RYF A;  1KKD A;  4DV2 O;  3ASN B;  2BOB C;  3QVN A;  2AW9 A;  4JI6 B;  3JSN A;  2BE3 A;  1K73 W;  3H1K H;  1R3I C;  3H1L H;  4RWU A;  1MZE A;  3SJB C;  4NYK A;  4DV4 O;  1FFX B;  4GKK B;  2P7T C;  3CCV V;  1K92 A;  2DWD C;  4TWK A;  3FB6 C;  2X6B A;  3D3Q A;  1XIL A;  1JPX A;  4R50 A;  5IWA O;  4CH3 A;  2W6I G;  4CC5 A;  3J7A U;  4O4J B;  2ZDI A;  1GMG A;  2AXT Z;  4JI2 O;  1F23 A;  4J80 A;  3L73 H;  2K1E A;  5KX5 B;  3JAK B;  5LOV B;  3BRC A;  3WFV A;  3SYQ A;  4HYO A;  1BE3 H;  2WLH A;  4NXM O;  2Q0O C;  1EZJ A;  5IY5 B;  1Y67 A;  1L8D A;  2PGG A;  4I0X B;  3SGI A;  1EN6 A;  5LXT B;  5D5Q A;  3ZRW A;  1HR0 B;  2EJ7 A;  4FM1 A;  4WFB V;  5LP6 B;  5D5P A;  4GX1 A;  3WU2 Z;  5GTH Z;  4DR2 O;  1S0V A;  5JQG B;  4NVP A;  4IYI A;  2Z3Y A;  2CAZ C;  4ZOL B;  2YIC A;  2ZR3 A;  5C93 A;  1EFR G;  5EIB D;  3R66 A;  2L6L A;  4MVO A;  1QVG U;  4UCV A;  1IXB A;  3BAA A;  2UUA O;  2UXD O;  5B1A C;  5L3B A;  2WLM A;  4DV3 B;  1WPX A;  2Y0P A;  3KKY A;  1KB9 F;  1WAZ A;  4X1I B;  2IH1 C;  3LSQ A;  3D36 C;  2ZQM A;  1SES A;  4UVA A;  2ZR2 A;  2DQ0 A;  4UCR A;  4CZZ A;  3B09 A;  2LO1 A;  3OR6 C;  1HNX O;  2UXC B;  1ROP A;  1TUB A;  2ZT9 B;  4B3M O;  1E1R G;  2UUB O;  1B06 A;  1YHQ V;  1BHB A;  2ADP A;  4DR6 B;  2VWJ A;  1VQ5 V;  5E1A C;  2A0L A;  1AI6 A;  3APO A;  2KSD A;  1FXK C;  5LYJ B;  2QSA A;  4MW3 A;  4CBC A;  3MD0 A;  2QDO A;  4LFC B;  2Q7E A;  5KHK A;  4E2L A;  1AB3 A;  2Q0A A;  3FB7 C;  4FIP C;  2EIL C;  3ML0 A;  5KLV H;  3L74 H;  2OTJ V;  3K03 A;  2F43 G;  4MTG A;  3CXC U;  4JYA B;  1XMO B;  3X2Q C;  5LHH A;  1K4C C;  1JR9 A;  1KEC A;  5CB4 A;  4Z1V A;  1Y76 B;  5IDJ A;  4BWA A;  2PYL A;  4LF6 B;  3UT5 A;  1ENV A;  3DSQ A;  1VF6 C;  1RPR A;  2HKO A;  3N2K A;  2ADQ B;  3DXR A;  4FPP A;  2QKA A;  5BY1 A;  4GX2 A;  3RYI B;  3RYF B;  1P49 A;  3IC9 A;  3F5W C;  2MK3 A;  4B3T O;  4QGP A;  4ZKI A;  4O2A A;  2HJF C;  2LW7 A;  3BA9 A;  4TV9 B;  2QWN B;  1XNR B;  2EIN B;  4LC1 A;  1B04 A;  2O57 A;  2QE7 G;  1Y66 A;  2ZXW C;  3KCX A;  4FFB B;  2F4V O;  4MVR A;  1VQN V;  1OCC B;  1S72 V;  2JJ2 G;  1KP3 A;  4OX9 B;  1I5X A;  2Z5U A;  2WA3 A;  1S5L Z;  2QTO A;  1YI2 V;  1YJ9 V;  2EBO A;  5HFL A;  4ZHQ A;  4LF7 B;  1Q7Y W;  1YIJ V;  2GDS A;  3RN4 A;  3AK2 A;  1LUV A;  3QO5 A;  4KFM A;  1WB8 A;  3OEH G;  2ZNI A;  4IL6 Z;  3ZRW B;  4CS3 A;  5CA3 A;  2X6C A;  4FLW A;  4F4L A;  1XMQ O;  2P4K A;  2FML A;  1Y6X A;  3TCU A;  1MZF A;  2YSU B;  2WLJ A;  3GVM A;  3ETD A;  1D5A A;  4NTW A;  2NLJ C;  3QNE A;  3BFR A;  3OW2 U;  2JIZ G;  2CGO A;  4ZBM A;  4DV2 B;  3UM7 A;  5L3G A;  3MAQ A;  4QNH B;  2HVK C;  2IJJ A;  3B2E E;  5IYC O;  1M56 C;  2HLD G;  3HKC A;  4DV4 B;  3BEH A;  5IT9 N;  4MVS A;  3RGB A;  4JI3 O;  2P5O A;  4JF3 A;  4JAA A;  3WG7 C;  4DK0 A;  4XDJ A;  5IWA B;  1O9G A;  1TUB B;  1V55 C;  4K35 A;  3AG7 A;  1DLB A;  4PA4 A;  1P7G A;  2JS5 A;  5HFM A;  2YIA A;  4JI2 B;  1U96 A;  1VQ7 V;  2KKW A;  4AI8 A;  4D6T H;  1SQX H;  2NNU A;  1FKA O;  2EX3 A;  1FXH A;  2XT9 A;  3H1H H;  4O4I A;  1MSD A;  4DUY O;  2ZE6 A;  1PM9 A;  1LUW A;  4NXM B;  4CS4 A;  1ZL8 A;  2B5U A;  2YIB A;  2RCV A;  2W0F C;  3OE7 G;  2VWK A;  3D8C A;  4OPH A;  1M9N A;  1ZLZ A;  3K04 A;  4IYH A;  3CCQ V;  4DR2 B;  3T1Y O;  3OM3 B;  1EBO A;  4X65 O;  5CB4 B;  4LF5 O;  3CJH A;  3UT5 B;  5LGU A;  5KHJ A;  2Y69 B;  3N2K B;  5BR8 O;  3DXR B;  4W4K A;  4MVU A;  2UUA B;  3ETQ A;  2UXD B;  2ZE5 A;  3E22 A;  3Q4H A;  1HP8 A;  2UUC O;  1GKF A;  3JYC A;  2BTO A;  1IXM A;  1H2S B;  4Z1M G;  4KHP O;  2HHH O;  3AG2 B;  4KL1 A;  4FLV A;  5AG2 A;  1HNX B;  2HJD A;  4B3M B;  1FYJ A;  2UUB B;  2CH7 A;  3K08 A;  1Q43 A;  4LF4 O;  3H01 A;  5H2F Z;  1ZSP A;  4H33 A;  5L3D A;  4YJ3 A;  1RM1 B;  2KB1 A;  1P4R A;  4D7T A;  2R9R B;  4X88 A;  3APQ A;  1PPJ H;  4IHJ A;  1NT2 B;  4YIO A;  2IH3 C;  3UO3 A;  3ZHU A;  4ZHQ B;  3FD9 A;  2OIG A;  1PD3 A;  4J10 A;  4WCE V;  2LQT A;  4YHH O;  4LF8 O;  5JJE B;  1QLE C;  3K59 A;  3IFX A;  5BMV A;  4L87 A;  2CUG A;  3ABM C;  2IBZ H;  4RUE A;  2YS8 A;  2NR5 A;  3MHH C;  1AI5 A;  4K0K O;  3HB3 B;  1WNS A;  2AHZ A;  3STL C;  2EIJ B;  3C3S A;  1VQ9 V;  2DOS A;  1B6Q A;  3ABK C;  2PI5 A;  4U3J A;  4B3T B;  3W7U A;  2UU9 O;  3ABL B;  2FKX A;  1YJN V;  3BAB A;  4DUZ O;  1XHZ A;  3GB7 C;  1GM7 A;  3HKC B;  3L72 H;  3JCU Z;  1UFI A;  3JAS A;  1BCC H;  4DO2 A;  3A0H Z;  3UCS C;  2OT5 A;  2F4V B;  1RFY A;  5LL6 Y;  5LMN O;  2WA4 A;  3B77 A;  2WLI A;  4DYL A;  4P9O A;  2DYS C;  4AQY B;  1GN2 A;  5DM6 V;  3K0G A;  5LGN A;  3ZN1 A;  4MTF A;  3QO8 A;  3SPG A;  1IBM O;  4K8X A;  1N36 O;  2PUS A;  4RO2 A;  2ZIM A;  5CBG A;  4X1Y B;  1N4C A;  4OGQ B;  2ZCE A;  4ASU G;  2DYR C;  4UB6 Z;  3SPI A;  3G4S V;  4DR5 O;  3SYO A;  1QR9 A;  3ZMV A;  4ZOL A;  1OHH G;  3BVO A;  1YCI A;  4DRX A;  2ETN A;  3SR2 C;  2B1I A;  1Q6H A;  1XMQ B;  3K9S A;  1SQP H;  5IE9 A;  4I9W A;  1WN7 A;  3ASO B;  3OTF A;  3ZMT A;  3CJH B;  2GUZ A;  2QEX V;  1PL0 A;  5CN0 A;  2CGN A;  3CCU V;  2RNB A;  3E22 B;  3EFF K;  1B3Q A;  5IYD O;  1ZUQ A;  1AR1 B;  2WLK A;  3AG4 C;  4K3A A;  3OTO O;  1SET A;  4I7Z B;  1TAE A;  1NQT A;  4JI3 B;  2IJK A;  4KP4 A;  4FLZ A;  1M5I A;  2P4V A;  1AI4 A;  3CXH F;  2JGD A;  1H2L A;  3FB8 C;  1IZ3 A;  3HR0 A;  1Q5O A;  2CH7 B;  4F6R A;  4GKJ O;  3ZN0 A;  4MVQ A;  2YUA A;  5LYJ A;  4YJ3 B;  5CBH A;  1HW7 A;  3HKB A;  2A7W A;  3CP1 A;  1K33 A;  3P32 A;  1OJH A;  2QWP B;  1NR1 A;  5IYB O;  3VQW A;  3OUS A;  3ZMU A;  1SQG A;  5J9P C;  5H6R A;  4IHJ B;  5L3E A;  4DUY B;  4DR7 O;  2ILM A;  2JEX A;  4BAY A;  4U7O A;  4UFZ A;  1KYO F;  1V54 B;  2KG7 A;  1Z5W A;  4FLT A;  2EZP A;  4FLY A;  2W0X A;  4IIJ B;  3RWR D;  5BMV B;  1K3E A;  3T1Y B;  4X65 B;  4LF5 B;  2QM4 A;  4L8J A;  3JAT A;  3RYI A;  1AVM A;  5JCO A;  1QVF U;  1YTF D;  3SJA C;  5BR8 B;  3AG3 C;  4U3J B;  1WA8 A;  4LNU B;  4TV9 A;  1AJP A;  2UUC B;  2R9A A;  3WB0 A;  4WFG A;  4OXS A;  1W2B U;  4PDL A;  3VOU A;  4FFB A;  4BIZ A;  2YI9 A;  4I4T A;  4UXN A;  1XL4 A;  4KHP B;  3EXA A;  1GM8 A;  2E5L O;  1KD1 W;  2HHH B;  3JAS B;  1VMG A;  3A8T A;  1NH2 B;  4Q6G A;  1NR7 A;  2Q4P A;  1SRY A;  4QPK A;  3CC7 V;  5GON A;  1GO3 F;  3DTU B;  2WLI B;  4RQE A;  4LF4 B;  1E1Q G;  3EHB B;  2JJ1 G;  2RMK B;  1SER A;  1E79 G;  4TSF G;  4ZIB A;  1VQO V;  3L9D A;  1NI8 A;  3STZ C;  3L75 H;  1NTK H;  2B1G A;  2Q8V A;  2ITD C;  4YHH B;  4LF8 B;  1BGY H;  2N05 A;  4KXR A;  5EBW C;  1AR5 A;  2N04 A;  4PA7 A;  1TVK A;  4DRX B;  3TJT A;  2GHY A;  4U7N A;  5B66 Z;  2CDY A;  1M57 C;  4K0K B;  3JAW A;  1JFF A;  1M93 A;  4JI4 O;  3T4D A;  2GUZ B;  3N2G B;  5B1N A;  1ZWI C;  4JI7 O;  2Z0A A;  1P84 F;  1K97 A;  4LR3 A;  1H2M A;  2XAJ A;  3IAY A;  1OCO C;  2UU9 B;  1I0H A;  3JD4 A;  1N32 O;  1UPG A;  4FVM A;  4DUZ B;  2JEU A;  1OCR B;  4WF9 V;  3WB2 A;  3CC4 V;  1WB7 A;  3MHS C;  3LDD A;  3W7W A;  5LMN B;  2X6A A;  2JGD B;  3FX7 A;  2HG5 C;  3GWK C;  1NH2 D;  4PJ0 Z;  3ABU A;  2H8P C;  1D5N A;  4F6R B;  1Q3E A;  4P30 A;  1VQL V;  3CCS V;  2GBO A;  1R3L C;  2F23 A;  3O9O A;  3S3W A;  1IBM B;  3HKB B;  3ZHQ A;  3DGE A;  1N36 B;  1HNZ O;  4JTD B;  3CME V;  4N23 A;  1AJN A;  4QIW F;  1FPO A;  3ZRS A;  3OD4 A;  4C7U A;  4H37 A;  2KG7 B;  4DR5 B;  4FLX A;  1NJI W;  4FZ1 A;  3CHX A;  3SYC A;  2JGU A;  2JS3 A;  3K5O A;  3CC2 V;  1KUQ A;  4GUN A;  2PTM A;  1VP7 A;  1AJQ A;  3S3X A;  5B1B C;  2Q68 A;  3SPC A;  4AIL C;  2P22 C;  3LDC A;  4DV7 O;  2M6Y A;  2R72 A;  2GTA A;  2F93 B;  4LFA O;  4YXW G;  5KA6 A;  2EIK C;  3UO2 A;  2DN9 A;  3JAT B;  3JSL A;  1FXK A;  2EIM C;  4RUF A;  1NU1 H;  5EK0 A;  3SYA A;  1XL6 A;  1GH6 A;  4WFF A;  5B3S C;  1WA8 B;  3H1J H;  1OCZ B;  3GWO A;  4I55 A;  1G6U A;  5LBQ A;  4MT8 A;  1JQ0 A;  2ODM A;  4TV8 A;  4UB8 Z;  1QNM A;  4FM0 A;  1I08 A;  4BW5 A;  1CXZ B;  3ETE A;  5C8Y A;  2OCC B;  1R3K C;  2LP7 A;  4I4T B;  3P3P A;  4WBN A;  3OTO B;  3AG1 C;  5LGT A;  1NKD A;  4B3R O;  1MAB G;  4ABM A;  4QE7 A;  4AQY O;  1IBL O;  2DWE C;  1R6T A;  3AEI A;  4X89 A;  1HNW O;  1VF6 A;  5GON B;  1SS3 A;  4GKJ B;  1YEW A;  4MW8 A;  4J7Z A;  4H13 B;  2F1M A;  2MW2 B;  4JAS A;  4DR7 B;  4GX5 A;  1N33 O;  3JD0 A;  2AHY A;  3ZMS A;  1KC8 W;  1N0N A;  4NTY A;  3LSU A;  1LR1 A;  3K5M A;  1TVK B;  1SZX A;  1XHX A;  4YIP A;  1S5J A;  5FL7 G;  2IU3 A;  4PEL A;  1SZT A;  1QBZ A;  1GAX A;  3CPW U;  2UXB O;  2YXY A;  3OEE G;  3K79 A;  1J95 A;  4ICG A;  3JAW B;  1JFF B;  4DW0 A;  4LF9 O;  2F66 C;  3H9V A;  1RP3 B;  3FAV A;  1QHT A;  3PJS K;  3ZHV A;  1IBK O;  4JZG A;  4FK5 C;  4U3F H;  1BS3 A;  5JJJ B;  1R73 A;  2VQE O;  2JK5 C;  3UQ8 A;  4DV0 O;  2E5L B;  3KG2 A;  1W0J G;  3OGC C;  4JYY A;  2PZS A;  1D2D A;  1H2G A;  2AZ2 A;  4CH5 A;  1DTO A;  1XNQ O;  4NTX A;  4E4E A;  1JJO A;  4X62 O;  5FPR A;  5CBF A;  1L0L H;  4XBF A;  2OIE A;  2IU0 A;  5CA0 B;  4X1Y A;  1QLN A;  5B1A B;  3SPH A;  2N74 A;  1DF4 A;  1IVS A;  2CE4 A;  2BSK A;  3RW0 A;  1QCE A;  2QWR B;  5J2U A;  3CE2 A;  1I7F A;  2RJZ A;  1H2N A;  3N27 A;  2GSM B;  1THZ A;  3CCM V;  4EFB A;  3CRQ A;  3T4Z A;  5IJ0 A;  2UXX A;  2FTK A;  1S76 D;  1ZAU A;  3ZRV A;  4UCU A;  4NKG B;  4GYC B;  4X66 O;  1AP6 A;  5DED A;  1R6K A;  5EBM C;  4JI4 B;  3CCL V;  1JJ2 U;  1SKV A;  4JI7 B;  3LSS A;  1FXK B;  4W4L A;  3ZED A;  4NB5 A;  1EN4 A;  4H0L B;  3FYE B;  3VQX A;  1YXB A;  1CPY A;  1N32 B;  4WFH A;  5H5N A;  4I55 B;  2XOK G;  3K3W A;  4TV8 B;  1Y4M A;  1PV0 A;  5C8Y B;  2EIL B;  3ZCC A;  4WBN B;  4LFB O;  1XBL A;  3X2Q B;  3CS5 A;  3JAL A;  5JVD A;  4J42 A;  1MOF A;  3G80 A;  4I9Q A;  3G6E V;  3AK1 A;  5B1B B;  4X64 O;  5EIB C;  2WSS G;  1I94 O;  3K0D A;  2P6J A;  2GV9 A;  1XEQ A;  1R1B A;  2G38 A;  1HNZ B;  3FFQ A;  3ASN C;  1AI7 A;  4IIJ A;  5KHI A;  3HKE B;  4PHZ A;  5KMG A;  2ZXW B;  4DK1 A;  2FYU H;  2ZE7 A;  3WB1 A;  2IW5 A;  4TUY A;  4J7J A;  3E86 A;  4QE9 A;  2UXN A;  3CD6 V;  4DV7 B;  1MG1 A;  2ZIO A;  4LFA B;  1XI1 A;  4GCZ A;  5KHG A;  4LNU A;  3ICX A;  1YJW V;  2QM7 A;  1L1F A;  5LHI A;  3CRM A;  2NN4 A;  4J7K A;  3FAV B;  4LH6 A;  1XDC A;  2DJV A;  4LCU C;  1BZK A;  3E89 A;  3RYH A;  5IY5 C;  5LHG A;  3B40 A;  1Y74 A;  1L0N H;  4B3R B;  1K5Q A;  4DV5 O;  1SF9 A;  5LP6 C;  2P06 A;  1IBL B;  4PA3 A;  5L3F A;  1AR4 A;  5B1O A;  1HNW B;  1WJZ A;  1WLE A;  3JD2 A;  1FD9 A;  1JA8 A;  3OGI B;  4PD4 F;  5CA1 A;  2DMX A;  3JD1 A;  2XUM A;  3OMN B;  2DW4 A;  2BSK B;  2XAS A;  3U0Z A;  4DR4 O;  2HVJ C;  1N33 B;  1N8R W;  1N0J A;  1BQ0 A;  1M56 B;  5J2U B;  5LMU O;  3ZHT A;  1R3J C;  3K58 A;  4FM2 A;  4HBN A;  4JI8 O;  4LBE C;  1F4M A;  4JAU A;  3WG7 B;  3CCJ V;  2Q5Z A;  3B4S A;  1LNQ A;  2LFR A;  1W59 A;  2ATK C;  5IJ0 B;  1V55 B;  3M8A A;  5FPO A;  5ITZ A;  3N2G A;  2UXB B;  1TGO A;  2QJ1 A;  5K1X A;  2WAM A;  4B3S O;  1GK9 A;  4LF9 B;  4PA6 A;  1Q90 D;  1BHA A;  1FAF A;  3CB2 A;  1FFT B;  1HWY A;  2RDC A;  2ZD9 A;  4MSW C; 
#chains in the Genus database with same CATH homology
 2GHY A;  4U7N A;  3E35 A;  5KA5 A;  1M57 C;  2EIK B;  2XAQ A;  4MS2 A;  4LP8 A;  1Q7Y W;  3VBB A;  4R8C A;  3T4D A;  1YIJ V;  2DQ3 A;  2HFE C;  3W7S A;  2EIM B;  3QO5 A;  4PA9 A;  4KFM A;  5B1N A;  1ZWI C;  3UKM A;  1F4N A;  3OEH G;  1Q86 W;  5B3S B;  2WLL B;  3ZRW B;  1GTO A;  1K97 A;  3CYO A;  5CA3 A;  2X6C A;  2XAJ A;  1OCO C;  1CP9 A;  2WWW A;  3JD4 A;  4G2K A;  4F4L A;  2WPD G;  3TCU A;  2YSU B;  2WLJ A;  4R7C A;  4JTC B;  5EC2 C;  1YIT V;  2EJR A;  3ETD A;  2JEU A;  3E8G A;  4UVC A;  2NLJ C;  3AG1 B;  3QNE A;  1OCR B;  4WF9 V;  1K9M W;  1K7D A;  3CC4 V;  3OW2 U;  3MHS C;  3LDD A;  2JIZ G;  3LNM B;  4QPJ A;  4JGS A;  5GW7 A;  3W7W A;  2YEV B;  4ZBM A;  3UM7 A;  2IJI A;  5L3G A;  2X6A A;  2PI4 A;  4R6Z A;  4QNH B;  1S77 D;  2HVK C;  4PDV A;  2HG5 C;  1NH2 D;  2IJJ A;  4JTA B;  4PDR A;  5IYC O;  3ABU A;  1M56 C;  2H8P C;  2HLD G;  1VQ4 V;  1PKX A;  3B8M A;  4P30 A;  1VQL V;  3BEH A;  1JOY A;  2Q67 A;  4MVS A;  3CCS V;  1R3L C;  4JF3 A;  2EIN C;  1PNL A;  1S5H C;  3WG7 C;  1G8M A;  1NBM G;  1Q81 W;  3DGE A;  3OMA B;  4XDJ A;  5EBL C;  3BY6 A;  1OCC C;  4JTD B;  1V55 C;  3CMA V;  4N23 A;  5H9C A;  2P67 A;  1DLB A;  1AJN A;  4PA4 A;  3CME V;  1VQM V;  4QIW F;  5HFM A;  4HZ3 A;  3SJQ C;  3ZRS A;  4J9Z B;  5L3C A;  1FS0 G;  1ARO P;  4H37 A;  3OMI B;  2ZDI C;  1NJI W;  4MTO A;  1VQ7 V;  1G4Y B;  3SYC A;  2NNU A;  3W7T A;  3CC2 V;  1FXH A;  3ABT A;  1NVP D;  1AJQ A;  5B1B C;  3ZMZ A;  2Q68 A;  1K34 A;  3SPC A;  3E8B A;  3LDC A;  4WFE A;  2M7W A;  2P90 A;  2QA4 V;  2B5U A;  2R9I A;  4YXW G;  1COW G;  5KA6 A;  2EIK C;  2Q6A A;  2W0F C;  3OE7 G;  1FXK A;  1QLE B;  2EIM C;  4RUF A;  1M9N A;  5EK0 A;  2JDI G;  3SYA A;  1XL6 A;  3K04 A;  4WFF A;  5B3S C;  3TK1 A;  3ABM B;  3CCQ V;  5KUK A;  1OCZ B;  3OM3 B;  3GWO A;  1EBO A;  5LBQ A;  4MT8 A;  1JQ0 A;  4BW5 A;  3ETE A;  3G71 V;  5LGU A;  1VQ6 V;  1Q82 W;  2OCC B;  1JVM A;  1R3K C;  2LP7 A;  3OAA G;  4QJF B;  2A9H A;  2Y69 B;  3ABK B;  3AG1 C;  5LGT A;  1OCR C;  3F7V C;  4MTX A;  1NKD A;  4MVU A;  4UUJ C;  1MAB G;  4QE7 A;  4GT1 A;  4RAI A;  3QO7 A;  2DWE C;  3AEI A;  4I5S A;  4X89 A;  1GKF A;  3IGA C;  3JYC A;  1K8A W;  2A79 B;  4RQF A;  3FKS G;  1IXM A;  4MW8 A;  3TET A;  1YTF B;  4Z1M G;  3AG2 B;  2OTL V;  2XND G;  4HAM A;  4JAS A;  4FJC C;  3E83 A;  4GX5 A;  2DYS B;  3K08 A;  2H94 A;  3SPJ A;  3SYP A;  3H01 A;  3JD0 A;  1K5S A;  4H33 A;  5L3D A;  2AHY A;  4XDK A;  3ZMS A;  1RM1 B;  3E8F A;  1KC8 W;  2KB1 A;  1VQK V;  3P30 A;  1P4R A;  2R9R B;  4X88 A;  2IJH A;  3JCZ A;  5FL7 G;  2IU3 A;  4PEL A;  4BIU A;  2IH3 C;  1SZT A;  1KP2 A;  1QBZ A;  3E8H A;  4XDL A;  4P2Z A;  3CPW U;  4G28 B;  1F51 A;  2DYR B;  3K79 A;  3OEE G;  1J95 A;  3K06 A;  4X8A A;  1PD3 A;  1VQP V;  4WCE V;  3OUF A;  4JYC A;  1QLE C;  2LFS A;  3IFX A;  3OFN G;  4L87 A;  3PJS K;  3ABM C;  3I55 V;  4RUE A;  3MHH C;  1OCZ C;  1AI5 A;  4WFA V;  4FK5 C;  2W6J G;  3HB3 B;  3ETG A;  1R73 A;  2WLN A;  2AHZ A;  3STL C;  2X0L A;  2JK5 C;  1K4D C;  2EIJ B;  1JX9 A;  2OCC C;  3M99 B;  2C2A A;  1VQ9 V;  2Y69 C;  1B6Q A;  3ABK C;  2PI5 A;  4UV9 A;  1CEZ A;  3D36 A;  5CMU A;  1JCH A;  2EZO A;  3KG2 A;  1W0J G;  4KUM A;  3OGC C;  3W7U A;  3LUT B;  3ABL B;  3JD3 A;  1H2G A;  5KUM A;  1BMF G;  1YJN V;  1DTO A;  1TUE B;  3AG4 B;  1H8H G;  3GB7 C;  1GM7 A;  3T2M A;  5CBF A;  4XBF A;  2IU0 A;  4DO2 A;  1QLN A;  1OZ0 A;  2OT5 A;  5B1A B;  3AG2 C;  3SPH A;  1DF4 A;  1KKD A;  3ASN B;  2BOB C;  4P9P A;  3RW0 A;  3B77 A;  2WLI A;  1QCE A;  1I5Y A;  1K73 W;  4P9O A;  2DYS C;  1R3I C;  5EC1 C;  2XAG A;  5DM6 V;  3CCE V;  3K0G A;  2P7T C;  1M1K W;  5LGN A;  3ZN1 A;  3CCV V;  1K92 A;  4MTF A;  2GSM B;  2XAH A;  3QO8 A;  3SPG A;  2DWD C;  4TWK A;  3FB6 C;  1RM1 C;  1THZ A;  2X6B A;  3CCM V;  1JPX A;  3T4Z A;  2UXX A;  2FTK A;  4R50 A;  1YSC A;  1S76 D;  4JPR A;  4RO2 A;  3ZRV A;  1PNK A;  2W6I G;  5CBG A;  2ZDI A;  4ASU G;  1GMG A;  1R6K A;  2DYR C;  5EBM C;  3SPI A;  3G4S V;  1F23 A;  3K9A A;  3T1C A;  3SYO A;  3CCL V;  1JJ2 U;  1QR9 A;  2ITC C;  2K1E A;  3OR7 C;  3ZMV A;  3LSS A;  3ZIA G;  1FXK B;  1OHH G;  3D3I A;  3FYI B;  3WFV A;  3SYQ A;  3FYE B;  2Y48 A;  4HYO A;  2B1I A;  3I56 V;  1CPY A;  1MSW D;  4WFH A;  4J9Y B;  2WLH A;  2XOK G;  3K3W A;  4N21 A;  1EZJ A;  5IY5 B;  4I9W A;  1RPO A;  3ASO B;  1Y4M A;  3ZMT A;  2EIL B;  3R65 A;  3ZCC A;  3CCR V;  2QEX V;  1PL0 A;  2EIJ C;  5CN0 A;  3AG3 B;  1PNM A;  3ZRW A;  3X2Q B;  1UJW B;  4WFB V;  1H8E G;  1VQ8 V;  4GX1 A;  3CCU V;  1S0V A;  1MOF A;  2Z3Y A;  3G6E V;  1BL8 A;  3RBZ A;  3ABL C;  3EFF K;  5B1B B;  5IYD O;  2ZR3 A;  3F7Y C;  4G27 B;  5C93 A;  1AR1 B;  1EFR G;  2WSS G;  3RVZ A;  2WLK A;  3K0D A;  2P6J A;  3AG4 C;  1SET A;  1GM9 A;  1NQT A;  4MVO A;  1QVG U;  2IJK A;  4TT3 G;  3A0R A;  4KP4 A;  2YEV A;  2V1D A;  5B1A C;  1AI4 A;  5L3B A;  4DXW A;  2WLM A;  4UV8 A;  1WPX A;  3ASN C;  1AI7 A;  3FB8 C;  2IH1 C;  3LSQ A;  1FXV A;  2ZQM A;  3IC7 A;  1SES A;  4MVQ A;  4UVA A;  3ZN0 A;  3NXS A;  2ZR2 A;  5CBH A;  1P7B A;  2DQ0 A;  2HR3 A;  2ZXW B;  3CP1 A;  4CZZ A;  1K33 A;  3P32 A;  5IYB O;  1NR1 A;  2IW5 A;  3OR6 C;  3E86 A;  3OUS A;  4QE9 A;  3RVY A;  3ZMU A;  5J9P C;  2UXN A;  1ROP A;  5H6R A;  5L3E A;  3CD6 V;  1E1R G;  1MG1 A;  4MVZ A;  2JEX A;  4BAY A;  4U7O A;  4EKW A;  1V54 B;  4GCZ A;  2BOC C;  1YHQ V;  1BHB A;  5H6Q A;  4JYB A;  2QM8 A;  1VQ5 V;  1YJW V;  2EZP A;  2QM7 A;  5E1A C;  1L1F A;  2A0L A;  1AI6 A;  5LHI A;  1FXK C;  1K3E A;  4LCU C;  4MW3 A;  3LDE A;  4CBC A;  1M57 B;  3E89 A;  4JAV A;  3MD0 A;  5IY5 C;  5LHG A;  1DF5 A;  3ASO C;  4E2L A;  4FMT A;  1QVF U;  3FB7 C;  1YTF D;  4FIP C;  2EIL C;  3ML0 A;  4PDM A;  2D3O W;  4GX0 A;  3AG3 C;  2Q69 A;  3K03 A;  2OTJ V;  2F43 G;  1K5Q A;  4MTG A;  3CXC U;  3X2Q C;  1OCO B;  1KQS U;  5LHH A;  1K4C C;  1AJP A;  4PA3 A;  3FB5 C;  1KEC A;  5L3F A;  4Q20 A;  4WFG A;  3W7X A;  5B1O A;  1S3J A;  5IDJ A;  4OXS A;  1W2B U;  4PDL A;  3VOU A;  1WLE A;  1ENV A;  4BIZ A;  4UXN A;  1ORQ C;  1RPR A;  4UVB A;  1XL4 A;  3JD2 A;  1QR8 A;  2HKO A;  4FPP A;  2X7R B;  1GM8 A;  1KD1 W;  4GX2 A;  3JD1 A;  1NH2 B;  1NR7 A;  3OMN B;  3F5W C;  3E2E A;  2MK3 A;  2QKS A;  2DW4 A;  1SRY A;  4QPK A;  4ZKI A;  3CC7 V;  2XAS A;  1GO3 F;  1W0K G;  3DTU B;  1M90 W;  2WLI B;  2HVJ C;  4RQE A;  1N8R W;  1M56 B;  2HJF C;  4MVM A;  1R6N A;  1E1Q G;  1R3J C;  3EHB B;  4LBE C;  2EIN B;  4LC1 A;  5BZB A;  5DN6 G;  2JJ1 G;  1F4M A;  2QE7 G;  1Y66 A;  4JAU A;  3WG7 B;  1SER A;  3CCJ V;  2ZXW C;  3B8N A;  1E79 G;  1LNQ A;  4MVR A;  2LFR A;  4TSF G;  1VQN V;  2ATK C;  1OCC B;  1S72 V;  1V55 B;  2JJ2 G;  1KP3 A;  1VQO V;  3STZ C;  1I5X A;  2Z5U A;  2B1G A;  2XAF A;  2WAM A;  2WLL A;  1V54 C;  1GK9 A;  3HPL C;  1NVP B;  2CK3 G;  2QTO A;  2ITD C;  4PA6 A;  3ZRX A;  1YI2 V;  5EBW C;  1YJ9 V;  3ZJZ A;  1BHA A;  4PA7 A;  2V7Q G;  1FFT B;  1HWY A;  2EBO A;  5HFL A;  2ZD9 A;  1H38 A;  4MSW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...