1R3JC

Potassium channel kcsa-fab complex in high concentration of tl+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3jC00
4H33A 4MTOA 3UM7A 4LCUC 5CBHA 2P7TC 2KB1A 2NLJC 4BW5A 1ZWIC 4PDRA 4WFEA 3OR7C 3AG2C 4RUFA 5EC2C 3R65A 2HVKC 2YEVA 3FB8C 1V54C 5EBMC 1OCZC 3SPGA 2DYRC 5B1BC 5IY5C 1M56C 2HVJC 4GX5A 2A0LA 4JTDB 4MVUA 4MSWC 2A79B 4I9WA 3RW0A 3E83A 1LNQA 3ZRSA 2ITDC 5BZBA 3F5WC 2W0FC 3PJSK 4JTAB 4XDLA 2IH1C 4PDMA 3LNMB 5EK0A 4WFHA 1JVMA 4PA9A 2Q67A 3F7YC 4MVOA 3ABLC 4MTFA 1R3JC 3VOUA 3SYQA 3WG7C 3SPCA 2Q6AA 2Q69A 3K04A 3LDDA 2WLMA 2HJFC 1XL4A 3E8GA 3STZC 4JTCB 4PA6A 3SPJA 4WFFA 3SJQC 4XDJA 3E89A 4P2ZA 3ABKC 3HPLC 3SPHA 1G4YB 2K1EA 3OUSA 4CBCA 2AHYA 3ASNC 3KG2A 4R8CA 4WFGA 5J9PC 2Q68A 3K06A 4QNHB 2QTOA 4H37A 3LDCA 2X6BA 4J9ZB 3LUTB 1XL6A 2WLIB 4MVMA 5EC1C 3SYCA 4EKWA 1ORQC 5B1AC 2DWDC 2EILC 1S5HC 4MVZA 3RVYA 1M57C 3X2QC 5KUKA 4QE9A 2WLHA 4G27B 4MVQA 3K08A 3TCUA 4MTGA 3E8HA 2EIKC 3IGAC 3K03A 3UKMA 1K4CC 2WLNA 2HFEC 2WLIA 3IFXA 4PDLA 4GX1A 5EBLC 4MS2A 3T2MA 3SYOA 1BL8A 4RO2A 2A9HA 3BEHA 3E8BA 3LDEA 4MVSA 2EIJC 4X89A 4MW3A 3FB5C 2X6CA 3OGCC 2ITCC 3FB6C 4XDKA 4P9OA 4LBEC 2ZXWC 4G28B 4RAIA 5B3SC 2R9RB 2ATKC 3RBZA 4DXWA 2JK5C 4TWKA 4X8AA 2X6AA 2QKSA 2H8PC 4X88A 2BOBC 5EBWC 4R6ZA 4HZ3A 1R3LC 2Y69C 3GB7C 4P30A 3AG3C 3SYAA 3RVZA 1OCCC 2DWEC 1R3KC 1QLEC 3F7VC 3TETA 2EIMC 3AG4C 3K0GA 4F4LA 1OCRC 2BOCC 4RUEA 2WLKA 3JYCA 4MVRA 4PA7A 3T1CA 4PA4A 2DYSC 3OUFA 3ZJZA 4QE7A 2EINC 3FB7C 1J95A 2HG5C 4R7CA 3E8FA 5KUMA 3ABMC 2OCCC 4HYOA 1P7BA 4OXSA 2WLJA 5CBGA 4PA3A 1R3IC 3ASOC 1V55C 3E86A 3AG1C 4PDVA 3SYPA 2WLLB 2ZD9A 3STLC 1K4DC 1KKDA 4ZBMA 2AHZA 3T4ZA 4LP8A 5CBFA 4GX2A 1OCOC 4R50A 4UUJC 3OR6C 4J9YB 4KFMA 3K0DA 4P9PA 3T4DA 3EFFK 3SPIA 2WLLA 5E1AC 2IH3C 4MW8A 4GX0A
chains in the Genus database with same CATH superfamily
1XUQA 1HDJA 1JR9A 3KCXA 2UUAO 3ZIAG 2P7TC 2Q73A 4ZHQA 2QWPB 5EC2C 1U97A 1AILA 1SF9A 1NTMH 1AJPA 2Q8VA 5KHJA 1LNQA 2AGAA 1DLBA 3J7AU 5JCOC 4TSFG 1NVPD 1BHBA 4TV8A 1H2LA 2F4VO 5LGNA 4B08A 2RN9A 1K73W 3STZC 3SPJA 1FAFA 1FXKA 2XAHA 1PKXA 4OX9B 3LNNA 2DYRB 5LHIA 4H37A 2WLIB 2IU0A 1CEZA 1XHXA 1EN6A 4FZ0A 2WLHA 1XI1A 2ZT9B 3C3SA 3VQYA 1YSCA 3L72H 3K03A 4OPHA 1SQVH 3CP1A 2Q9LA 3IC9A 4JI2O 1BGYH 5IT9N 4MS2A 1S77D 1Y74B 1NTKH 2XHBA 4BW9A 1TUBA 3M7MX 2ZE8A 4X89A 3CXHF 5CB4B 3K3WA 4JYAO 2XNDG 2R9RB 2ATKC 1VF5B 2A3QA 2PTMA 1WP7A 4Z1MG 4LF8B 3D36C 3WB1A 1QLEC 2UXXA 1E79G 1WPBA 2HKOA 5K1XA 1NVPB 4B3SB 4I0XA 2JVDA 4X65B 3K9SA 5CMUA 4YXWG 4UB6Z 4PDVA 4UCVA 2Y0IA 2ZR3A 1HNWO 1HR0B 3OTOB 4UUJC 4E4EA 1OCOB 2NNUA 1MMMA 1M1KW 1URFA 4X9QA 2QGNA 2B9ZA 1ZX3A 1BT8A 5CBHA 3ZBHA 4O4LA 4LF5B 2QM8A 4ZI7B 1LUVA 4DR7O 4U3JA 1OV9A 4H0LB 4K35A 2AZ2A 3JALB 3QVNA 4NTXA 1VQMV 3Q4HA 4DUZO 5BY1A 4NR1A 2IH1C 1VQ5V 2CH7A 4OGQB 1K5QA 4X20A 2HLDG 2PZSA 4XDJA 4ABMA 5CN0A 5LOVB 4QIWF 3CMEV 3OT7A 2KSDA 5B1OA 1N4CA 1XILA 1M5IA 3A0BZ 1ZL8B 3ZMVA 3RVYA 2XTAA 3ETQA 1JPXA 4KL1A 2OIGA 1SC5B 2B5UA 4IYHA 4IHJB 2UUBB 1XDCA 4FFBB 1KBHA 2RMKB 4HNAA 1Q6HA 2ADPA 3K58A 3B40A 2W6JG 2H8PC 1PL4A 2Q5ZA 4P30A 2W0XA 4JV5O 1DTOA 3CC4V 3K5NA 4PA7A 1VF6C 5LA6A 5K1PA 2DYSB 3CCJV 1SKVA 4J80A 4DR3B 2YIBD 4PA3A 1R3IC 4JAUA 1KD1W 1SQXH 1QU7A 2LW1A 1SQFA 2AHZA 3JD3A 4GX2A 4YJ2B 4LFBO 4EFBA 2L6LA 1P49A 1FYJA 4JAVA 5TISZ 5LHGA 2WLLA 4FLVA 4N23A 1S72V 4X64B 1W2BU 4H33A 1Z5WA 3CRMA 3HKBB 1D5NA 4CC6A 1ZSPA 4RUFA 3AG2B 3KZIZ 3SPGA 5B1BB 4DUZB 1RSOA 3RW0A 4FLZA 4MTXA 3F5WC 1J5EB 2W0FC 2G38A 3PJSK 4IIJB 5JQGB 4JPRA 4DR1O 3K57A 5LYJA 3OM3B 5H6RA 4JTCB 4WFFA 4XBFA 3ABKC 3HKEB 4I50A 2PF4E 2EZOA 2EJ7A 2QTOA 1MZEA 3K59A 4DV7B 1Q86W 1F4NA 5EC1C 4EKWA 5EYPB 2WPDG 5ITZB 1FS0G 1S3JA 3K08A 1TA8A 1WB7A 3TCUA 4DV3O 1WPXA 3BY6A 1VQ4V 4RO2A 3U0ZA 1NBMG 5KHIA 2ADQB 2ITCC 1FXVA 2WWWA 4DV1B 1W0JG 5CA1B 2B1IA 1HP8A 2YI9A 3TETA 1SA0A 1SQPH 4F4LA 3AG4B 2BOCC 2UXBB 3S3XA 2IJHA 2HG5C 3THOA 2PYJA 3LSQA 2R9IA 2CGNA 3AG1C 2HJDA 3I5DA 1VF6A 4LF4O 2AW9A 2F1MA 4LNUA 4NTWA 4KFMA 3HB3B 1VQPV 3K0DA 1SQGA 3CCEV 2GTSA 3T4DA 1N32O 1QVGU 5D5QA 4NTYA 1QLEB 3RYFA 4DR5O 4ZOLB 1ZWIC 1GRJA 3B09A 3CJHA 5LGUA 2F43G 3CCMV 1Q6IA 3B77A 2GV9A 3CRAA 5D5PA 2VS0A 3NXSA 3W7WA 4JYCA 3SYQA 1D2DA 1E1RG 1XL4A 2D2CB 3T1YO 2IM9A 1YI2V 2EJRA 1G4YB 4FM1A 5IJ0A 5J9PC 2HHHB 1NH2D 2OCHA 1XMOB 5IDJA 4MVMA 3D3QA 1XL6A 4UCRA 3TJTA 2EILB 1IXBA 5GONA 3WB0A 4MVQA 2RCVA 2PUSA 4Q6GA 3AG7A 3UKMA 3RFRA 2WSSG 3E22B 4FLTA 1F23A 3JAWB 3QO7A 2Y48A 4O4HB 2EIJC 1XBLA 4DR2O 1M90W 5J2UB 1FD9A 2ZDIC 4CZZA 1S0VA 4X66O 1SETA 3FFQA 1GN3A 3CHXA 1YJNV 1N36O 1R3LC 1YIJV 2DWEC 3ABTA 2QE7G 2QA4V 1RP3B 2BTQB 2IU3A 2W6IG 1WN7A 1B3QA 1NTZH 2RNBA 2CTPA 3BVOA 4LH6A 1OCOC 2Y4TA 1JMKC 1Q8IA 2QJ1A 3N2KB 5LMUO 1MABG 2P6JA 1GM9A 4Z1VA 1R1BA 2N05A 4FZ1A 1VQ7V 2IBZH 5J2TA 5B1NA 1SZXA 1XEQA 3ZMZA 1Y4MA 2JGDA 3R65A 1HW7A 1GH6A 1V54B 1QBZA 5FLXN 4MSWC 1XNRO 1H2SB 1BMFG 4EEQA 4FJCC 4PDMA 3LNMB 3BRCA 1AI6A 2VWJA 3ABLB 3GWOA 3G6BA 1UJWB 1BQZA 1AI7A 4BWAA 4O2BA 2QWQB 1VARA 4GCZA 4UXNA 3LUTB 1K8AW 4ZKIA 3OTFA 1TVKA 2CTWA 5JJNB 1I08A 3KKYA 2N04A 3T1HO 2ZNIA 4UFZA 4B3MO 2UUCO 5C93A 2WLIA 4FMTA 5A9GA 3UCSC 2ZQMA 1L8DA 1NU1H 3ABKB 3UT5B 1HNZO 5H9CA 1K7DA 4LF6O 4RAIA 1KECA 4X66B 1I7FA 3MD0A 3RYHA 1N36B 2QKSA 4R6ZA 3RYCB 5B66Z 1EM1A 3H1JH 4J42A 5CB4A 4LF7B 2Q7HA 4MVRA 3BA8A 2DYSC 3OUFA 1ZAUA 4X1KB 2VQEB 1MG1A 4WFBV 4DW0A 1E1QG 2ZD9A 4CS3A 2BSKB 1AJNA 5IJ9B 1XMQB 4EFEA 2QWNB 1M9NA 4JI7O 3A2FA 5E1AC 1JQ0A 3H1LH 5KX5B 4LCUC 4X1YB 4FVMA 4GLXA 3G80A 3AG2C 5KAIZ 3ZHUA 5HFLA 1IX9A 4I55B 5B1BC 1NZ6A 4F6EA 2HVJC 1N0JA 1OHHG 4ZI7A 3A8TA 3JALA 2P90A 4UCUA 5LMNB 3WB2A 3K04A 3VQVA 1RM1B 1H2MA 4FM2A 5KHKA 3ZHRA 4FLXA 5GTHZ 1GMGA 1VQNV 1UPGA 1ZUQA 2HEPA 2AHYA 1Q90D 3LDCA 4ICGA 4DV6O 1S5HC 1RPRA 4B7EA 4G27B 3T1HB 3RT3C 1MZFA 1ZL8A 3A0RA 2UU9O 2F93B 5EBLC 1A32A 4C7UA 5L3BA 2NN4A 4AQYO 1HNZB 1YITV 1KP2A 2X6CA 3FAVA 4IHJA 4I7ZB 4LBEC 4FFBA 3B2EE 3HKCB 2JEUA 1HWYA 1OCCC 2DQ0A 3AG4C 3K0GA 3K9AA 4BIOA 2P4KA 2Y4UA 4PA4A 3DGEA 1WLEA 4CH4A 4R7CA 3E8FA 5FPOA 1AROP 1Q81W 4HYOA 4OXSA 4DUYO 2EIJB 4DW1A 1SZTA 2RQ6A 3L71H 3JAKB 3JATB 1VQ9V 2QM4A 1NS1A 1WA8B 1PNMA 2V4DA 3FD9A 3UO2A 2M6YA 4GX0A 4YJ2A 4HAMA 2H3OA 1WJZA 4TUYB 4TV9B 5EBMC 1OCZC 4WFAV 2CUGA 5IY5B 1M56B 2H94A 1WAZA 4JTDB 4CH6A 3EHBB 4I9WA 3SJAC 3ZRSA 2PI5A 2Q7GA 3M8AA 3OAAG 1VQ8V 4X1IB 2V7QG 4LFCO 4MT8A 4K8ZA 4MTFA 2KKWA 1I5XA 2Z3YA 1R6KA 1Q82W 1JJOA 4RQFA 2XAQA 1ROPA 3E8GA 3LSUA 2UUAB 4I4TB 4IIJA 5JQGA 3CSXA 3P30A 4RWUA 1M4UA 1YTFD 3ASNC 2DW4A 1IVSA 4QNHB 4BAYA 4RQEA 4NXMO 2PGGA 3HKEA 1KYOF 1ORQC 2DWDC 2EILC 1M57B 1N34O 3JD0A 2YIBA 1B6QA 2GHYA 3ZRWA 2F4VB 2UU9B 5EYPA 5ITZA 4FIPC 4UCTA 1GTOA 4AQYB 4JI8O 1GN6A 1I5YA 4DV2O 1K33A 1KUQA 5IYZA 5JCOA 5GTIZ 4O4IB 4MW3A 1BHAA 3OMAB 4G28B 5B3SC 3CMAV 3AK3A 3SYAA 3BFRA 4NB5A 2YXLA 4JI2B 3ZRXA 1NR1A 3JD2A 5BXZA 2ILMA 5CA1A 1AR4A 4TQFA 3CX5F 1QVFU 4QJFB 5HFMA 1K97A 3ABMC 5CBGA 5LBQA 3CWBH 1OJHA 3A0HZ 5IWAO 1YTFB 4JYAB 2K9PA 1AI4A 3OR6C 4P9PA 3VQXA 3QO5A 3QO8A 3NR7A 2DN9A 3SDLA 4MTOA 3U10A 3U11A 3AEIA 1F51A 2ODMA 2EX3A 5JH7B 3D36A 1V54C 1K9MW 3DC5A 4CH3A 2XAFA 2X0LA 2XT9A 1HNWB 1QLNA 4ZOLA 4J7JA 4A5UB 4JI4O 1P4RA 1SERA 1QHTA 4AILC 4LH7A 4O4JB 1XQ8A 1AR1B 3F7YC 4K0KO 3ABLC 1R3JC 4DV5O 3P3NA 3C3TA 3HPLC 4DR7B 1F7YA 2XOKG 4NKGB 4H13B 2ZM6O 3IC7A 3B4SA 5IYDO 4KUMA 4NXMB 1GN2A 3BABA 5B1AC 1N34B 4X62O 2XASA 3AK2A 3JCZA 5LP6C 4FM0A 4KHPO 3ETDA 5KHHA 5LL6Y 1EN4A 5KMGB 4JI8B 4DV2B 1NR7A 1VIBA 3E8BA 4K3AA 1QR9A 1RPOA 4B3TO 3E22A 5EZYB 4PI2A 1JFFB 3KCYA 4O4LB 3QNEA 1VP7A 1IURA 5F2VO 1ENVA 3K5OA 5J2UA 3Q4HB 1EFRG 2YIDA 4J7ZA 2C2AA 1R6TA 4LWSB 3C90A 2R70A 4BIZA 3ASOC 2JS3A 4LFAO 1K4DC 3CCLV 1AJQA 1KMIZ 2BTQA 4QGPA 2LGWA 4JZ2A 3E2EA 3E35A 3G67A 4F6RB 3EFFK 4JV5B 1OCCB 3AK1A 5BMVA 1I94O 2E5LO 1P84F 3MDSA 4PV1B 3N2KA 1KB9F 1OZ0A 4TQDA 3RWRD 4J11A 4WF9V 4CH5A 3F5TA 2E74B 2A0LA 4G2KA 1KQSU 2JRIA 4JI4B 1VMGA 2HR3A 4LFBB 4IL6Z 2EZPA 4LC1A 2IJKA 2KG7A 5E79Z 4EB6A 1Y76B 1EN5A 2P22C 5IE9A 4JAAA 2QTSA 4JASA 2WLMA 1RM1C 3ZMTA 2YICA 1YHQV 3HR0A 4QPKA 3DXRB 1OCZB 5KA6A 2YIAA 4X62B 1ZLZA 1NI8A 2E76B 4DR1B 2B1GA 3E8HA 2QEXV 2E75B 3ZMUA 1K5SA 3APOA 4DV0O 1AP5A 3P32A 4B3TB 4DYLA 3ABUA 1MSDA 3ASNB 3FB6C 3HKDA 4QPJA 4XDKA 3CCVV 2ZXWB 1H2KA 2JK5C 1DGSA 2LJ2A 2CGOA 1GM7A 5EBWC 4I5SA 2Y69C 1LUWA 4I9QA 2LGQA 5CA0B 4DV3B 1BS3A 1LR1A 2WLKA 4PELA 3ZRVA 1H8HG 4PHZA 1L0LH 3ETEA 4NVPA 3RYCA 4DRXB 2JJ1G 3OE7G 2EULA 1Q43A 1RFYA 5B3SB 4I50B 1SS3A 3OD4A 1AP6A 3DC6A 1TUEB 2YEVB 3SPIA 2BSKA 2YXHA 5IJ9A 1BE3H 1PPJH 5LXTB 1PNLA 3FYIB 1QR8A 1NT2B 4UV8A 4YIPA 1IBLO 3ABMB 5KX5A 5IY5C 1M56C 5BR8O 3H9VA 1MOFA 4X1YA 4LF4B 4BIUA 1MSWD 1NKDA 2YDEA 4I55A 1N32B 5H5NA 1JJ2U 4N21A 3WG7C 1XNQO 5JVDB 4DR5B 2UXNA 3O9OA 3OGIB 2F66C 2Q0AA 4DV4O 2AXTZ 4FLUA 4R8CA 2L35A 3CB2A 1YEWA 2X6BA 4J9ZB 2JIZG 3SYCA 1M57C 5FNVB 4JI6O 1FFXB 2Q7EA 2WA3A 2WLNA 2BCCH 4NXNO 3T1YB 4CC5A 4DR4O 4DV0B 1N8RW 2WA4A 4UVBA 2CDYA 5DECA 3RYIB 3JCUZ 4D7SA 2OTJV 1F4MA 2OIEA 3ETGA 3RYFB 4O2AB 2QM7A 2OT5A 4DXWA 5B1AB 2FKXA 3K79A 3RVZA 4PI0A 5LP6B 2ARHA 2EIMC 4RUEA 2A7WA 3CRQA 3H1HH 3CD6V 2XUMA 3HKCA 3N2GB 5DM6V 5KUMA 2OCCB 2WLJA 2KQXA 2R72A 4AHCA 1Y67A 4AI8A 4DR2B 5CBFA 2BTOA 1Y74A 4R50A 4GKKO 2GDSA 4CS2A 1FXKC 5KA5A 2DQ3A 5B5EZ 2WAMA 2IH3C 1TAEA 4YJ3B 3JAKA 2ZE6A 2EBOA 2ZDIA 3JATA 4JGSA 3OR7C 4WBNB 1WA8A 4OX9O 1GO3F 2GSMB 2QKCA 3ASOB 4GX5A 2MK3A 2A79B 2VWKA 2ITDC 4JTAB 1KC8W 4TV9A 4LR3A 1NQTA 3TGUH 1JVMA 4PA9A 5LMUB 2JEXA 3OW2U 5FPRA 4D6TH 2LQTA 2LW7A 1DK1A 4DV4B 3ZMSA 4X1IA 4CBCA 2ZIMA 1B06A 3ZEDA 1XNRB 1N0NA 3OFNG 2RDCA 4JI6B 4TT3G 3CCUV 2EIKB 1T5EA 2ZCEA 4GX1A 3T2MA 3SYOA 3S3WA 3LDEA 4X65O 3FYEB 1AVMA 3RGBA 2QDOA 4DR6O 1WNSA 4U7OA 3OTOO 4JI3O 5LOVA 4O4IA 2CTQA 3GB7C 3ZHQA 3AG3C 3SGIA 1YJWV 4B3MB 2UUCB 2NR5A 2IJJA 3JYCA 1K92A 3T1CA 1KKCA 2Q4PA 4LF5O 2EINB 1M93A 4JYYA 1V55C 1G8MA 4LF6B 3CRCA 4GKKB 2JDIG 3OEEG 3G71V 3D8CA 3QTCA 5JJEB 4O2BB 4YHHO 2Y69B 1ZTEA 1PV0A 1CXZB 1PNKA 3CE2A 4BW5A 4WFEA 1TVKB 2FYUH 4IT5A 4LF9O 4YIOA 1PM9A 4JF3A 3QF7A 3JD1A 4OPAA 2JS5A 5JH7A 2PI4A 2D3OW 4W4KA 4JI7B 2ZE5A 1W0KG 3CC7V 4GUNA 1IXMA 3LDDA 3BAAA 2R9AA 2UUBO 4UCSA 1FPOA 3E89A 4FFKA 4L8JA 3RYHB 3EVKA 4O4JA 2LFSA 3JASB 3M99B 2ETNA 3L73H 5L3GA 3K5MA 3HKBA 4J7KA 3JARB 4MVZA 3SR2C 2ZE7A 4GYCB 1US6A 3WG7B 3CCSV 1BL8A 1Z5VA 4DR3O 5L3FA 4DR6B 3ZS8C 3FB5C 1COWG 1HNXO 2YUAA 4P9OA 2ZXWC 5KMGA 4JI3B 4DV6B 4X8AA 1Q3EA 4UVCA 2X6AA 3OEHG 4X88A 4CS4A 2M7WA 4FLWA 5EZYA 2P5OA 4X64O 2FB5A 5C8YB 2X7RB 2Z5UA 1W59A 1JFFA 2CAZC 1OCRB 2PYLA 3ZX6A 2LO1A 2GUZB 1TGOA 1CPYA 3J81N 1SQQH 3E86A 3UQ8A 1H8EG 1PD3A 4BR6A 3P3PA 5DN6G 2UXCO 4LWSA 1Q7YW 1J5EO 4YHHB 5CA3A 3IJ4A 4ZHQB 1Y66A 5JWPA 1L0NH 4MW8A 4B3RO 2EIMB 3OMIB 2NLJC 2P4VA 4F6RA 3FB8C 3JSNA 4DUYB 1G1XB 4LF9B 1O9HA 4KXRA 4TV8B 3ZHVA 4DV7O 1BCCH 1WB8A 2OYQA 2Y0PA 3CRRA 2V1DA 3O65A 1FXKB 3TXSA 3CS5A 3FAVB 3K5LA 1FJGO 2JGUA 3SPCA 2Q69A 4TOIA 1Y76A 1GM8A 3CYOA 1IBKO 1BZKA 3K06A 3MHHC 1GK9A 1KP3A 3MHSC 4DV1O 5KUKA 4FPPA 4LFCB 1B04A 3DXRA 1TUBB 2FTKA 5L3EA 4PDLA 1VQLV 2UXBO 1GAXA 1AI5A 1I0HA 3BHPA 4L87A 3APQA 1HNXB 5KLVH 2QSAA 1K34A 4I0XB 5LHHA 3B8NA 1EZVH 4HZ3A 2AZ0A 3GVMA 3ZCCA 1R3KC 3R66A 1FFTB 3ZJZA 4J41A 1J95A 1SRYA 2OCCC 2UXDO 5CA0A 2P67A 4DO2A 4LP8A 3WU2Z 4H44B 2VQFO 4JYBA 2UXCB 1G6UA 3ZN0A 2YS8A 2ZINA 3JAWA 3LSSA 3ZHTA 4DRXA 2GTAA 4O4HA 3MAQA 1Q5OA 4D7TA 4U3JB 3AG3B 4B3RB 1EBOA 1JOYA 2CTRA 4Z2WA 2KB1A 4ASUG 4PDRA 2IJIA 3VBBA 2YEVA 2QWOB 3ZRWB 1V55B 2CH7B 5IWAB 1VQKV 2HHHO 5LXTA 1XMOO 2LP7A 4X20B 4XDLA 1U96A 1PP9H 3H1KH 3ML0A 5EK0A 4GKJO 5IYZB 1FJGB 1YXBA 4KP4A 1YVWA 5KAFZ 2Q6AA 3TXQA 2DJVA 4DK0A 4P2ZA 3OUSA 1IBKB 1H2GA 2OWOA 5FL7G 1QCEA 4DK1A 5JVDA 2P06A 3L70H 2QKAA 1S76D 2DMXA 3X2QC 2IW5A 4W4LA 4HNAB 4K0KB 1KU9A 5EIBC 2EIKC 4DV5B 4UV9A 1K4CC 4HBNA 2HFEC 1NJIW 3IFXA 1H38A 1YF2A 3OMNB 1JCHA 3ZHSA 5FNVA 3JSLA 1IBMO 5A2QN 1GN4A 1FFXA 2ZNJA 2YXYA 2ZM6B 1FKAO 3RBZA 5H6QA 2LFRA 2JJ2G 1L1FA 5LA6B 1UFIA 2YSUB 1XHZA 3RYIA 4PJ0Z 2N74A 2BOBC 2ZR2A 4KHPB 1N33O 3H1IH 4YY3O 3UO3A 4O2AA 4WCEV 1XOUA 4JZGA 4QE7A 2EINC 3QG5A 2ZIOA 1AR5A 1VQ6V 2UXDB 1P7BA 5LP6A 3IAYA 2WLLB 1FXHA 5H2FZ 2RJZA 3CCQV 1KKDA 2VQFB 2VRZA 1BSMA 4PD4F 3N2GA 5GW7A 2OTLV 3BA9A 4JI5O 3UT5A 1RSOB 1VEWA 3G6EV 5IYCO 2F95B 4LFAB 2DYRC 4YJ3A 5LYJB 3L74H 3W7SA 4MVUA 3BCCH 5BZBA 1YZBA 4WBNA 4Q20A 5IYBO 2A06H 4X1KA 4IGGA 4GKJB 4K8XA 4JI0O 1VQOV 3VOUA 3DSQA 2GBOA 1I94B 2E5LB 2F23A 1SQBH 1YDXA 4PA6A 3ZN1A 3SJQC 1YCIA 1Q6UA 2BE3A 1JA8A 3KG2A 1DF5A 1GKFA 4WFGA 1S5JA 1MNGA 3FKSG 1THZA 3RN4A 3GWKC 4QE9A 2O57A 4LF7O 1X4TA 4B7KA 5L3DA 4JI1O 3BEHA 3CCRV 1IBMB 3DTUB 2VQEO 2QWRB 4IYIA 3JAMN 3OGCC 3CEIA 4FK5C 1SA0B 1PL0A 3ICXA 1XMQO 5L3CA 3TK1A 5BMVB 1NH2B 1H2NA 2PY5A 1Z2GA 1IZ3A 5AG2A 1X59A 1N33B 4YY3B 1OCRC 4LNUB 2KG7B 3L75H 1DF4A 4EB6B 4GT1A 1O9GA 2QR4A 3J80N 3JD4A 2Q0OC 4ZBMA 2MW2B 1MA1A 3WFVA 1YJ9V 1XREA 1JX9A 2FL4A 2FMLA 4UVAA 4JI5B 2Z0AA 4UCOA 3CJHB 5LMNO 3UM7A 2XAJA 1K3EA 4ZIBA 3I55V 3I56V 2HVKC 4UB8Z 2HP8A 1EZJA 5KHGA 3SJBC 3B8MA 3G4SV 3E83A 1BQ0A 1SESA 5EIBD 4JI0B 4WFHA 2Q67A 3SJCC 4MVOA 4NYKA 5IJ0B 1VF7A 2ZKOA 2CE4A 4FLYA 3HKDB 2HJFC 1CP9A 5DEDA 1P7GA 3D3IA 2E3CA 3SPHA 1IDSA 2K1EA 3W7TA 1IBLB 5GONB 1V9PA 2DE0X 1R73A 5BR8B 2Q68A 3FX7A 1QQCA 1WP8A 1QNMA 3JASA 4TUYA 2CK3G 4MTGA 3W7XA 3IGAC 1XNQB 4U7NA 4E2LA 3CPWU 1D5AA 3JARA 5LGTA 4JI1B 2A9HA 3VQWA 5JJJB 4MVSA 3W7UA 3EXAA 2DOSA 4I4TA 4TWKA 1AB3A 2YC0A 3X2QB 4GZRB 2XAGA 4LF8O 1Y6XA 3BPZA 3F7VC 4NXNB 3L9DA 4DR4B 3CXCU 4B3SO 3FB7C 3H01A 2YI8A 3SYPA 5C8YA 3AG1B 3STLC 3T4ZA 4U3FH 3PN1A 3N27A 5J2TB 2GUZA 4J9YB 1HR0O 3CC2V 1S5LZ 4J10A 1R6NA 2JGDB
chains in the Genus database with same CATH topology
2EIMB 5B1NA 3OMIB 3ZIAG 2P7TC 2NLJC 3ZMZA 1Y4MA 1OZ0A 5EC2C 3R65A 3FB8C 1V54B 1QBZA 4WF9V 1AJPA 2A0LA 4MSWC 4G2KA 1KQSU 1LNQA 2HR3A 1BMFG 2EZPA 4LC1A 2IJKA 4FJCC 4PDMA 3LNMB 1DLBA 2V1DA 4TSFG 1AI6A 1FXKB 1NVPD 3ABLB 3GWOA 1BHBA 4JASA 3SPCA 2Q69A 5LGNA 1UJWB 2WLMA 1RM1C 1K73W 3STZC 3SPJA 3ZMTA 1AI7A 1YHQV 1FXKA 2XAHA 1PKXA 1GM8A 3CYOA 4QPKA 4GCZA 1OCZB 4UXNA 2DYRB 3K06A 5LHIA 3MHHC 1GK9A 4H37A 5KA6A 1KP3A 3MHSC 3LUTB 2WLIB 2IU0A 1CEZA 1K8AW 4ZKIA 5KUKA 4FPPA 2WLHA 2B1GA 1YSCA 3E8HA 2FTKA 2QEXV 3K03A 3ZMUA 3CP1A 1K5SA 5L3EA 5C93A 2WLIA 4FMTA 4PDLA 1VQLV 4MS2A 1S77D 2ZQMA 1AI5A 3ABKB 3P32A 4X89A 3ABUA 4L87A 5H9CA 1K7DA 3ASNB 3FB6C 3K3WA 4QPJA 4XDKA 2XNDG 4RAIA 1KECA 2R9RB 2ATKC 2ZXWB 3CCVV 1K34A 2JK5C 3MD0A 4Z1MG 5LHHA 3B8NA 2QKSA 1GM7A 5EBWC 4I5SA 4HZ3A 2Y69C 4R6ZA 3ZCCA 1R3KC 1QLEC 2UXXA 1E79G 1FFTB 2HKOA 2WLKA 4PELA 3ZRVA 1H8HG 4MVRA 1NVPB 2DYSC 3OUFA 3ETEA 3ZJZA 1J95A 1SRYA 2JJ1G 2OCCC 1MG1A 4WFBV 5CMUA 4YXWG 1E1QG 4PDVA 3OE7G 2P67A 4DO2A 2ZD9A 1AJNA 2ZR3A 4LP8A 4JYBA 3ZN0A 4UUJC 1OCOB 3LSSA 5B3SB 2NNUA 1M1KW 1M9NA 3SPIA 1TUEB 2YEVB 5E1AC 1JQ0A 3AG3B 1EBOA 1JOYA 4LCUC 5CBHA 1PNLA 3FYIB 1QR8A 2KB1A 4ASUG 4PDRA 2QM8A 2IJIA 3VBBA 3AG2C 5HFLA 2YEVA 4UV8A 3ABMB 5B1BC 5IY5C 1M56C 3ZRWB 1V55B 1VQKV 2HVJC 1VQMV 1MOFA 2LP7A 1OHHG 4BIUA 1MSWD 4XDLA 1NKDA 2IH1C 3ML0A 5EK0A 1JJ2U 2P90A 1VQ5V 4N21A 4KP4A 3WG7C 1K5QA 2Q6AA 3K04A 2HLDG 1RM1B 2UXNA 4XDJA 4P2ZA 5CN0A 4QIWF 3CMEV 1GMGA 1VQNV 3OUSA 1H2GA 2AHYA 4R8CA 5B1OA 5FL7G 1QCEA 3LDCA 2X6BA 4J9ZB 3ZMVA 2JIZG 3SYCA 1S76D 3RVYA 1S5HC 3X2QC 1M57C 1RPRA 1JPXA 2IW5A 4G27B 2EIKC 4UV9A 2B5UA 1K4CC 2WLNA 2HFEC 3A0RA 1NJIW 3IFXA 1H38A 5EBLC 3OMNB 1JCHA 5L3BA 1N8RW 4UVBA 2OTJV 1F4MA 1YITV 1KP2A 2X6CA 3ETGA 2W6JG 4LBEC 2QM7A 3RBZA 2OT5A 4DXWA 5H6QA 2LFRA 2JJ2G 1L1FA 2YSUB 5B1AB 2H8PC 3K79A 2BOBC 2ZR2A 2JEUA 4P30A 1HWYA 1DTOA 3RVZA 1OCCC 3CC4V 2DQ0A 2EIMC 3AG4C 3K0GA 3K9AA 4RUEA 4WCEV 3CD6V 4PA7A 4PA4A 2DYSB 3DGEA 4QE7A 1WLEA 2EINC 3CCJV 4R7CA 3E8FA 5DM6V 5KUMA 1AROP 1Q81W 1VQ6V 4HYOA 1P7BA 2OCCB 2WLJA 4OXSA 4PA3A 1R3IC 2EIJB 1FXHA 2WLLB 4JAUA 1SZTA 3CCQV 1KD1W 1KKDA 2AHZA 3JD3A 5CBFA 4GX2A 4R50A 5GW7A 4JAVA 1VQ9V 2OTLV 1FXKC 5KA5A 2DQ3A 5LHGA 2WLLA 2WAMA 4N23A 2IH3C 1S72V 1PNMA 1W2BU 4GX0A 4H33A 4HAMA 2EBOA 2ZDIA 3G6EV 4JGSA 3OR7C 5IYCO 4RUFA 3AG2B 5EBMC 1OCZC 3SPGA 2DYRC 4WFAV 1GO3F 2GSMB 5B1BB 3ASOB 5IY5B 1M56B 2H94A 4GX5A 3W7SA 2MK3A 4JTDB 4MVUA 3RW0A 2A79B 3EHBB 4I9WA 3ZRSA 2PI5A 2ITDC 4MTXA 3F5WC 5BZBA 2W0FC 3PJSK 4JTAB 4Q20A 5IYBO 3OAAG 1KC8W 1NQTA 1VQ8V 2V7QG 4JPRA 1JVMA 4PA9A 4MT8A 2JEXA 4MTFA 1VQOV 3VOUA 1I5XA 2Z3YA 3OW2U 1R6KA 1Q82W 4RQFA 2XAQA 3OM3B 1ROPA 3E8GA 4JTCB 4PA6A 5H6RA 3ZN1A 4WFFA 3SJQC 3ZMSA 4XBFA 3ABKC 3P30A 4CBCA 3ASNC 1DF5A 1GKFA 3KG2A 1YTFD 4WFGA 2DW4A 2EZOA 4QNHB 3FKSG 2QTOA 4BAYA 1THZA 4RQEA 1Q86W 1F4NA 5EC1C 4EKWA 1ORQC 2DWDC 2EILC 3OFNG 2WPDG 1M57B 4QE9A 1FS0G 1S3JA 3K08A 3JD0A 4TT3G 3TCUA 3CCUV 1B6QA 2GHYA 2EIKB 3ZRWA 4GX1A 1WPXA 3BY6A 3T2MA 3SYOA 4FIPC 5L3DA 4RO2A 3BEHA 1VQ4V 3CCRV 1GTOA 3DTUB 1NBMG 1I5YA 3LDEA 1K33A 3FYEB 4MW3A 3OGCC 2ITCC 4FK5C 1BHAA 3OMAB 1FXVA 1PL0A 5L3CA 4G28B 4U7OA 3TK1A 2WWWA 5B3SC 3CMAV 1NH2B 1W0JG 2B1IA 3SYAA 3GB7C 3AG3C 1YJWV 3TETA 3ZRXA 4F4LA 3AG4B 1OCRC 1NR1A 2BOCC 2IJJA 3JD2A 3JYCA 1K92A 3T1CA 2IJHA 2EINB 2HG5C 1DF4A 1QVFU 4QJFB 5HFMA 1K97A 3ABMC 3LSQA 5CBGA 2R9IA 5LBQA 1V55C 1G8MA 3AG1C 4GT1A 3JD4A 4ZBMA 1YTFB 3WFVA 1AI4A 3OR6C 1YJ9V 2JDIG 1JX9A 3OEEG 4KFMA 4UVAA 3HB3B 3G71V 1VQPV 3K0DA 4P9PA 3CCEV 3T4DA 3QO5A 3QO8A 2Y69B 1QVGU 1QLEB 1PNKA 4MTOA 3UM7A 2XAJA 3AEIA 4BW5A 1K3EA 1ZWIC 1F51A 4WFEA 3I55V 3I56V 2HVKC 3D36A 1V54C 5LGUA 2F43G 3CCMV 3B77A 1K9MW 1EZJA 4JF3A 2XAFA 2X0LA 3B8MA 3G4SV 3JD1A 1QLNA 3E83A 2PI4A 1P4RA 2D3OW 1SERA 1SESA 4WFHA 2Q67A 1W0KG 3F7YC 1AR1B 4MVOA 3ABLC 3CC7V 3NXSA 3W7WA 1R3JC 4JYCA 3SYQA 1E1RG 1IXMA 3LDDA 2HJFC 1XL4A 1CP9A 1YI2V 3E89A 2EJRA 3D3IA 3HPLC 3SPHA 1G4YB 2LFSA 2K1EA 3W7TA 2XOKG 3M99B 3IC7A 1R73A 5J9PC 5IYDO 2Q68A 4KUMA 5L3GA 1NH2D 5IDJA 4MVMA 1XL6A 5B1AC 4MVZA 2EILB 2XASA 3JCZA 4MVQA 2CK3G 4MTGA 3W7XA 3ETDA 3IGAC 3UKMA 4U7NA 2WSSG 4E2LA 3CPWU 3WG7B 3CCSV 1F23A 5LGTA 3QO7A 1BL8A 2Y48A 2A9HA 1NR7A 3E8BA 1QR9A 4MVSA 2EIJC 5L3FA 3FB5C 1RPOA 3W7UA 1COWG 4P9OA 2ZXWC 1M90W 2ZDIC 4CZZA 4TWKA 4X8AA 1S0VA 1SETA 4UVCA 2X6AA 3OEHG 3X2QB 4X88A 3QNEA 1YJNV 2XAGA 1R3LC 2M7WA 1YIJV 1ENVA 2DWEC 3F7VC 3ABTA 2QE7G 2QA4V 2X7RB 2Z5UA 1EFRG 1OCRB 2C2AA 3CXCU 2IU3A 2W6IG 1CPYA 3FB7C 3H01A 4BIZA 3SYPA 3ASOC 3E86A 1H8EG 1PD3A 3AG1B 3STLC 1K4DC 3CCLV 1AJQA 3T4ZA 3E2EA 5DN6G 1OCOC 3E35A 4J9YB 1Q7YW 3CC2V 5CA3A 1Y66A 3EFFK 1R6NA 1MABG 2P6JA 1GM9A 1OCCB 4MW8A 1VQ7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H33 A;  4MTO A;  3UM7 A;  4LCU C;  5CBH A;  2P7T C;  2KB1 A;  2NLJ C;  4BW5 A;  1ZWI C;  4PDR A;  4WFE A;  3OR7 C;  3AG2 C;  4RUF A;  5EC2 C;  3R65 A;  2HVK C;  2YEV A;  3FB8 C;  1V54 C;  5EBM C;  1OCZ C;  3SPG A;  2DYR C;  5B1B C;  5IY5 C;  1M56 C;  2HVJ C;  4GX5 A;  2A0L A;  4JTD B;  4MVU A;  4MSW C;  2A79 B;  4I9W A;  3RW0 A;  3E83 A;  1LNQ A;  3ZRS A;  2ITD C;  5BZB A;  3F5W C;  2W0F C;  3PJS K;  4JTA B;  4XDL A;  2IH1 C;  4PDM A;  3LNM B;  5EK0 A;  4WFH A;  1JVM A;  4PA9 A;  2Q67 A;  3F7Y C;  4MVO A;  3ABL C;  4MTF A;  1R3J C;  3VOU A;  3SYQ A;  3WG7 C;  3SPC A;  2Q6A A;  2Q69 A;  3K04 A;  3LDD A;  2WLM A;  2HJF C;  1XL4 A;  3E8G A;  3STZ C;  4JTC B;  4PA6 A;  3SPJ A;  4WFF A;  3SJQ C;  4XDJ A;  3E89 A;  4P2Z A;  3ABK C;  3HPL C;  3SPH A;  1G4Y B;  2K1E A;  3OUS A;  4CBC A;  2AHY A;  3ASN C;  3KG2 A;  4R8C A;  4WFG A;  5J9P C;  2Q68 A;  3K06 A;  4QNH B;  2QTO A;  4H37 A;  3LDC A;  2X6B A;  4J9Z B;  3LUT B;  1XL6 A;  2WLI B;  4MVM A;  5EC1 C;  3SYC A;  4EKW A;  1ORQ C;  5B1A C;  2DWD C;  2EIL C;  1S5H C;  4MVZ A;  3RVY A;  1M57 C;  3X2Q C;  5KUK A;  4QE9 A;  2WLH A;  4G27 B;  4MVQ A;  3K08 A;  3TCU A;  4MTG A;  3E8H A;  2EIK C;  3IGA C;  3K03 A;  3UKM A;  1K4C C;  2WLN A;  2HFE C;  2WLI A;  3IFX A;  4PDL A;  4GX1 A;  5EBL C;  4MS2 A;  3T2M A;  3SYO A;  1BL8 A;  4RO2 A;  2A9H A;  3BEH A;  3E8B A;  3LDE A;  4MVS A;  2EIJ C;  4X89 A;  4MW3 A;  3FB5 C;  2X6C A;  3OGC C;  2ITC C;  3FB6 C;  4XDK A;  4P9O A;  4LBE C;  2ZXW C;  4G28 B;  4RAI A;  5B3S C;  2R9R B;  2ATK C;  3RBZ A;  4DXW A;  2JK5 C;  4TWK A;  4X8A A;  2X6A A;  2QKS A;  2H8P C;  4X88 A;  2BOB C;  5EBW C;  4R6Z A;  4HZ3 A;  1R3L C;  2Y69 C;  3GB7 C;  4P30 A;  3AG3 C;  3SYA A;  3RVZ A;  1OCC C;  2DWE C;  1R3K C;  1QLE C;  3F7V C;  3TET A;  2EIM C;  3AG4 C;  3K0G A;  4F4L A;  1OCR C;  2BOC C;  4RUE A;  2WLK A;  3JYC A;  4MVR A;  4PA7 A;  3T1C A;  4PA4 A;  2DYS C;  3OUF A;  3ZJZ A;  4QE7 A;  2EIN C;  3FB7 C;  1J95 A;  2HG5 C;  4R7C A;  3E8F A;  5KUM A;  3ABM C;  2OCC C;  4HYO A;  1P7B A;  4OXS A;  2WLJ A;  5CBG A;  4PA3 A;  1R3I C;  3ASO C;  1V55 C;  3E86 A;  3AG1 C;  4PDV A;  3SYP A;  2WLL B;  2ZD9 A;  3STL C;  1K4D C;  1KKD A;  4ZBM A;  2AHZ A;  3T4Z A;  4LP8 A;  5CBF A;  4GX2 A;  1OCO C;  4R50 A;  4UUJ C;  3OR6 C;  4J9Y B;  4KFM A;  3K0D A;  4P9P A;  3T4D A;  3EFF K;  3SPI A;  2WLL A;  5E1A C;  2IH3 C;  4MW8 A;  4GX0 A; 
#chains in the Genus database with same CATH topology
 1XUQ A;  1HDJ A;  1JR9 A;  3KCX A;  2UUA O;  3ZIA G;  2P7T C;  2Q73 A;  4ZHQ A;  2QWP B;  5EC2 C;  1U97 A;  1AIL A;  1SF9 A;  1NTM H;  1AJP A;  2Q8V A;  5KHJ A;  1LNQ A;  2AGA A;  1DLB A;  3J7A U;  5JCO C;  4TSF G;  1NVP D;  1BHB A;  4TV8 A;  1H2L A;  2F4V O;  5LGN A;  4B08 A;  2RN9 A;  1K73 W;  3STZ C;  3SPJ A;  1FAF A;  1FXK A;  2XAH A;  1PKX A;  4OX9 B;  3LNN A;  2DYR B;  5LHI A;  4H37 A;  2WLI B;  2IU0 A;  1CEZ A;  1XHX A;  1EN6 A;  4FZ0 A;  2WLH A;  1XI1 A;  2ZT9 B;  3C3S A;  3VQY A;  1YSC A;  3L72 H;  3K03 A;  4OPH A;  1SQV H;  3CP1 A;  2Q9L A;  3IC9 A;  4JI2 O;  1BGY H;  5IT9 N;  4MS2 A;  1S77 D;  1Y74 B;  1NTK H;  2XHB A;  4BW9 A;  1TUB A;  3M7M X;  2ZE8 A;  4X89 A;  3CXH F;  5CB4 B;  3K3W A;  4JYA O;  2XND G;  2R9R B;  2ATK C;  1VF5 B;  2A3Q A;  2PTM A;  1WP7 A;  4Z1M G;  4LF8 B;  3D36 C;  3WB1 A;  1QLE C;  2UXX A;  1E79 G;  1WPB A;  2HKO A;  5K1X A;  1NVP B;  4B3S B;  4I0X A;  2JVD A;  4X65 B;  3K9S A;  5CMU A;  4YXW G;  4UB6 Z;  4PDV A;  4UCV A;  2Y0I A;  2ZR3 A;  1HNW O;  1HR0 B;  3OTO B;  4UUJ C;  4E4E A;  1OCO B;  2NNU A;  1MMM A;  1M1K W;  1URF A;  4X9Q A;  2QGN A;  2B9Z A;  1ZX3 A;  1BT8 A;  5CBH A;  3ZBH A;  4O4L A;  4LF5 B;  2QM8 A;  4ZI7 B;  1LUV A;  4DR7 O;  4U3J A;  1OV9 A;  4H0L B;  4K35 A;  2AZ2 A;  3JAL B;  3QVN A;  4NTX A;  1VQM V;  3Q4H A;  4DUZ O;  5BY1 A;  4NR1 A;  2IH1 C;  1VQ5 V;  2CH7 A;  4OGQ B;  1K5Q A;  4X20 A;  2HLD G;  2PZS A;  4XDJ A;  4ABM A;  5CN0 A;  5LOV B;  4QIW F;  3CME V;  3OT7 A;  2KSD A;  5B1O A;  1N4C A;  1XIL A;  1M5I A;  3A0B Z;  1ZL8 B;  3ZMV A;  3RVY A;  2XTA A;  3ETQ A;  1JPX A;  4KL1 A;  2OIG A;  1SC5 B;  2B5U A;  4IYH A;  4IHJ B;  2UUB B;  1XDC A;  4FFB B;  1KBH A;  2RMK B;  4HNA A;  1Q6H A;  2ADP A;  3K58 A;  3B40 A;  2W6J G;  2H8P C;  1PL4 A;  2Q5Z A;  4P30 A;  2W0X A;  4JV5 O;  1DTO A;  3CC4 V;  3K5N A;  4PA7 A;  1VF6 C;  5LA6 A;  5K1P A;  2DYS B;  3CCJ V;  1SKV A;  4J80 A;  4DR3 B;  2YIB D;  4PA3 A;  1R3I C;  4JAU A;  1KD1 W;  1SQX H;  1QU7 A;  2LW1 A;  1SQF A;  2AHZ A;  3JD3 A;  4GX2 A;  4YJ2 B;  4LFB O;  4EFB A;  2L6L A;  1P49 A;  1FYJ A;  4JAV A;  5TIS Z;  5LHG A;  2WLL A;  4FLV A;  4N23 A;  1S72 V;  4X64 B;  1W2B U;  4H33 A;  1Z5W A;  3CRM A;  3HKB B;  1D5N A;  4CC6 A;  1ZSP A;  4RUF A;  3AG2 B;  3KZI Z;  3SPG A;  5B1B B;  4DUZ B;  1RSO A;  3RW0 A;  4FLZ A;  4MTX A;  3F5W C;  1J5E B;  2W0F C;  2G38 A;  3PJS K;  4IIJ B;  5JQG B;  4JPR A;  4DR1 O;  3K57 A;  5LYJ A;  3OM3 B;  5H6R A;  4JTC B;  4WFF A;  4XBF A;  3ABK C;  3HKE B;  4I50 A;  2PF4 E;  2EZO A;  2EJ7 A;  2QTO A;  1MZE A;  3K59 A;  4DV7 B;  1Q86 W;  1F4N A;  5EC1 C;  4EKW A;  5EYP B;  2WPD G;  5ITZ B;  1FS0 G;  1S3J A;  3K08 A;  1TA8 A;  1WB7 A;  3TCU A;  4DV3 O;  1WPX A;  3BY6 A;  1VQ4 V;  4RO2 A;  3U0Z A;  1NBM G;  5KHI A;  2ADQ B;  2ITC C;  1FXV A;  2WWW A;  4DV1 B;  1W0J G;  5CA1 B;  2B1I A;  1HP8 A;  2YI9 A;  3TET A;  1SA0 A;  1SQP H;  4F4L A;  3AG4 B;  2BOC C;  2UXB B;  3S3X A;  2IJH A;  2HG5 C;  3THO A;  2PYJ A;  3LSQ A;  2R9I A;  2CGN A;  3AG1 C;  2HJD A;  3I5D A;  1VF6 A;  4LF4 O;  2AW9 A;  2F1M A;  4LNU A;  4NTW A;  4KFM A;  3HB3 B;  1VQP V;  3K0D A;  1SQG A;  3CCE V;  2GTS A;  3T4D A;  1N32 O;  1QVG U;  5D5Q A;  4NTY A;  1QLE B;  3RYF A;  4DR5 O;  4ZOL B;  1ZWI C;  1GRJ A;  3B09 A;  3CJH A;  5LGU A;  2F43 G;  3CCM V;  1Q6I A;  3B77 A;  2GV9 A;  3CRA A;  5D5P A;  2VS0 A;  3NXS A;  3W7W A;  4JYC A;  3SYQ A;  1D2D A;  1E1R G;  1XL4 A;  2D2C B;  3T1Y O;  2IM9 A;  1YI2 V;  2EJR A;  1G4Y B;  4FM1 A;  5IJ0 A;  5J9P C;  2HHH B;  1NH2 D;  2OCH A;  1XMO B;  5IDJ A;  4MVM A;  3D3Q A;  1XL6 A;  4UCR A;  3TJT A;  2EIL B;  1IXB A;  5GON A;  3WB0 A;  4MVQ A;  2RCV A;  2PUS A;  4Q6G A;  3AG7 A;  3UKM A;  3RFR A;  2WSS G;  3E22 B;  4FLT A;  1F23 A;  3JAW B;  3QO7 A;  2Y48 A;  4O4H B;  2EIJ C;  1XBL A;  4DR2 O;  1M90 W;  5J2U B;  1FD9 A;  2ZDI C;  4CZZ A;  1S0V A;  4X66 O;  1SET A;  3FFQ A;  1GN3 A;  3CHX A;  1YJN V;  1N36 O;  1R3L C;  1YIJ V;  2DWE C;  3ABT A;  2QE7 G;  2QA4 V;  1RP3 B;  2BTQ B;  2IU3 A;  2W6I G;  1WN7 A;  1B3Q A;  1NTZ H;  2RNB A;  2CTP A;  3BVO A;  4LH6 A;  1OCO C;  2Y4T A;  1JMK C;  1Q8I A;  2QJ1 A;  3N2K B;  5LMU O;  1MAB G;  2P6J A;  1GM9 A;  4Z1V A;  1R1B A;  2N05 A;  4FZ1 A;  1VQ7 V;  2IBZ H;  5J2T A;  5B1N A;  1SZX A;  1XEQ A;  3ZMZ A;  1Y4M A;  2JGD A;  3R65 A;  1HW7 A;  1GH6 A;  1V54 B;  1QBZ A;  5FLX N;  4MSW C;  1XNR O;  1H2S B;  1BMF G;  4EEQ A;  4FJC C;  4PDM A;  3LNM B;  3BRC A;  1AI6 A;  2VWJ A;  3ABL B;  3GWO A;  3G6B A;  1UJW B;  1BQZ A;  1AI7 A;  4BWA A;  4O2B A;  2QWQ B;  1VAR A;  4GCZ A;  4UXN A;  3LUT B;  1K8A W;  4ZKI A;  3OTF A;  1TVK A;  2CTW A;  5JJN B;  1I08 A;  3KKY A;  2N04 A;  3T1H O;  2ZNI A;  4UFZ A;  4B3M O;  2UUC O;  5C93 A;  2WLI A;  4FMT A;  5A9G A;  3UCS C;  2ZQM A;  1L8D A;  1NU1 H;  3ABK B;  3UT5 B;  1HNZ O;  5H9C A;  1K7D A;  4LF6 O;  4RAI A;  1KEC A;  4X66 B;  1I7F A;  3MD0 A;  3RYH A;  1N36 B;  2QKS A;  4R6Z A;  3RYC B;  5B66 Z;  1EM1 A;  3H1J H;  4J42 A;  5CB4 A;  4LF7 B;  2Q7H A;  4MVR A;  3BA8 A;  2DYS C;  3OUF A;  1ZAU A;  4X1K B;  2VQE B;  1MG1 A;  4WFB V;  4DW0 A;  1E1Q G;  2ZD9 A;  4CS3 A;  2BSK B;  1AJN A;  5IJ9 B;  1XMQ B;  4EFE A;  2QWN B;  1M9N A;  4JI7 O;  3A2F A;  5E1A C;  1JQ0 A;  3H1L H;  5KX5 B;  4LCU C;  4X1Y B;  4FVM A;  4GLX A;  3G80 A;  3AG2 C;  5KAI Z;  3ZHU A;  5HFL A;  1IX9 A;  4I55 B;  5B1B C;  1NZ6 A;  4F6E A;  2HVJ C;  1N0J A;  1OHH G;  4ZI7 A;  3A8T A;  3JAL A;  2P90 A;  4UCU A;  5LMN B;  3WB2 A;  3K04 A;  3VQV A;  1RM1 B;  1H2M A;  4FM2 A;  5KHK A;  3ZHR A;  4FLX A;  5GTH Z;  1GMG A;  1VQN V;  1UPG A;  1ZUQ A;  2HEP A;  2AHY A;  1Q90 D;  3LDC A;  4ICG A;  4DV6 O;  1S5H C;  1RPR A;  4B7E A;  4G27 B;  3T1H B;  3RT3 C;  1MZF A;  1ZL8 A;  3A0R A;  2UU9 O;  2F93 B;  5EBL C;  1A32 A;  4C7U A;  5L3B A;  2NN4 A;  4AQY O;  1HNZ B;  1YIT V;  1KP2 A;  2X6C A;  3FAV A;  4IHJ A;  4I7Z B;  4LBE C;  4FFB A;  3B2E E;  3HKC B;  2JEU A;  1HWY A;  1OCC C;  2DQ0 A;  3AG4 C;  3K0G A;  3K9A A;  4BIO A;  2P4K A;  2Y4U A;  4PA4 A;  3DGE A;  1WLE A;  4CH4 A;  4R7C A;  3E8F A;  5FPO A;  1ARO P;  1Q81 W;  4HYO A;  4OXS A;  4DUY O;  2EIJ B;  4DW1 A;  1SZT A;  2RQ6 A;  3L71 H;  3JAK B;  3JAT B;  1VQ9 V;  2QM4 A;  1NS1 A;  1WA8 B;  1PNM A;  2V4D A;  3FD9 A;  3UO2 A;  2M6Y A;  4GX0 A;  4YJ2 A;  4HAM A;  2H3O A;  1WJZ A;  4TUY B;  4TV9 B;  5EBM C;  1OCZ C;  4WFA V;  2CUG A;  5IY5 B;  1M56 B;  2H94 A;  1WAZ A;  4JTD B;  4CH6 A;  3EHB B;  4I9W A;  3SJA C;  3ZRS A;  2PI5 A;  2Q7G A;  3M8A A;  3OAA G;  1VQ8 V;  4X1I B;  2V7Q G;  4LFC O;  4MT8 A;  4K8Z A;  4MTF A;  2KKW A;  1I5X A;  2Z3Y A;  1R6K A;  1Q82 W;  1JJO A;  4RQF A;  2XAQ A;  1ROP A;  3E8G A;  3LSU A;  2UUA B;  4I4T B;  4IIJ A;  5JQG A;  3CSX A;  3P30 A;  4RWU A;  1M4U A;  1YTF D;  3ASN C;  2DW4 A;  1IVS A;  4QNH B;  4BAY A;  4RQE A;  4NXM O;  2PGG A;  3HKE A;  1KYO F;  1ORQ C;  2DWD C;  2EIL C;  1M57 B;  1N34 O;  3JD0 A;  2YIB A;  1B6Q A;  2GHY A;  3ZRW A;  2F4V B;  2UU9 B;  5EYP A;  5ITZ A;  4FIP C;  4UCT A;  1GTO A;  4AQY B;  4JI8 O;  1GN6 A;  1I5Y A;  4DV2 O;  1K33 A;  1KUQ A;  5IYZ A;  5JCO A;  5GTI Z;  4O4I B;  4MW3 A;  1BHA A;  3OMA B;  4G28 B;  5B3S C;  3CMA V;  3AK3 A;  3SYA A;  3BFR A;  4NB5 A;  2YXL A;  4JI2 B;  3ZRX A;  1NR1 A;  3JD2 A;  5BXZ A;  2ILM A;  5CA1 A;  1AR4 A;  4TQF A;  3CX5 F;  1QVF U;  4QJF B;  5HFM A;  1K97 A;  3ABM C;  5CBG A;  5LBQ A;  3CWB H;  1OJH A;  3A0H Z;  5IWA O;  1YTF B;  4JYA B;  2K9P A;  1AI4 A;  3OR6 C;  4P9P A;  3VQX A;  3QO5 A;  3QO8 A;  3NR7 A;  2DN9 A;  3SDL A;  4MTO A;  3U10 A;  3U11 A;  3AEI A;  1F51 A;  2ODM A;  2EX3 A;  5JH7 B;  3D36 A;  1V54 C;  1K9M W;  3DC5 A;  4CH3 A;  2XAF A;  2X0L A;  2XT9 A;  1HNW B;  1QLN A;  4ZOL A;  4J7J A;  4A5U B;  4JI4 O;  1P4R A;  1SER A;  1QHT A;  4AIL C;  4LH7 A;  4O4J B;  1XQ8 A;  1AR1 B;  3F7Y C;  4K0K O;  3ABL C;  1R3J C;  4DV5 O;  3P3N A;  3C3T A;  3HPL C;  4DR7 B;  1F7Y A;  2XOK G;  4NKG B;  4H13 B;  2ZM6 O;  3IC7 A;  3B4S A;  5IYD O;  4KUM A;  4NXM B;  1GN2 A;  3BAB A;  5B1A C;  1N34 B;  4X62 O;  2XAS A;  3AK2 A;  3JCZ A;  5LP6 C;  4FM0 A;  4KHP O;  3ETD A;  5KHH A;  5LL6 Y;  1EN4 A;  5KMG B;  4JI8 B;  4DV2 B;  1NR7 A;  1VIB A;  3E8B A;  4K3A A;  1QR9 A;  1RPO A;  4B3T O;  3E22 A;  5EZY B;  4PI2 A;  1JFF B;  3KCY A;  4O4L B;  3QNE A;  1VP7 A;  1IUR A;  5F2V O;  1ENV A;  3K5O A;  5J2U A;  3Q4H B;  1EFR G;  2YID A;  4J7Z A;  2C2A A;  1R6T A;  4LWS B;  3C90 A;  2R70 A;  4BIZ A;  3ASO C;  2JS3 A;  4LFA O;  1K4D C;  3CCL V;  1AJQ A;  1KMI Z;  2BTQ A;  4QGP A;  2LGW A;  4JZ2 A;  3E2E A;  3E35 A;  3G67 A;  4F6R B;  3EFF K;  4JV5 B;  1OCC B;  3AK1 A;  5BMV A;  1I94 O;  2E5L O;  1P84 F;  3MDS A;  4PV1 B;  3N2K A;  1KB9 F;  1OZ0 A;  4TQD A;  3RWR D;  4J11 A;  4WF9 V;  4CH5 A;  3F5T A;  2E74 B;  2A0L A;  4G2K A;  1KQS U;  2JRI A;  4JI4 B;  1VMG A;  2HR3 A;  4LFB B;  4IL6 Z;  2EZP A;  4LC1 A;  2IJK A;  2KG7 A;  5E79 Z;  4EB6 A;  1Y76 B;  1EN5 A;  2P22 C;  5IE9 A;  4JAA A;  2QTS A;  4JAS A;  2WLM A;  1RM1 C;  3ZMT A;  2YIC A;  1YHQ V;  3HR0 A;  4QPK A;  3DXR B;  1OCZ B;  5KA6 A;  2YIA A;  4X62 B;  1ZLZ A;  1NI8 A;  2E76 B;  4DR1 B;  2B1G A;  3E8H A;  2QEX V;  2E75 B;  3ZMU A;  1K5S A;  3APO A;  4DV0 O;  1AP5 A;  3P32 A;  4B3T B;  4DYL A;  3ABU A;  1MSD A;  3ASN B;  3FB6 C;  3HKD A;  4QPJ A;  4XDK A;  3CCV V;  2ZXW B;  1H2K A;  2JK5 C;  1DGS A;  2LJ2 A;  2CGO A;  1GM7 A;  5EBW C;  4I5S A;  2Y69 C;  1LUW A;  4I9Q A;  2LGQ A;  5CA0 B;  4DV3 B;  1BS3 A;  1LR1 A;  2WLK A;  4PEL A;  3ZRV A;  1H8H G;  4PHZ A;  1L0L H;  3ETE A;  4NVP A;  3RYC A;  4DRX B;  2JJ1 G;  3OE7 G;  2EUL A;  1Q43 A;  1RFY A;  5B3S B;  4I50 B;  1SS3 A;  3OD4 A;  1AP6 A;  3DC6 A;  1TUE B;  2YEV B;  3SPI A;  2BSK A;  2YXH A;  5IJ9 A;  1BE3 H;  1PPJ H;  5LXT B;  1PNL A;  3FYI B;  1QR8 A;  1NT2 B;  4UV8 A;  4YIP A;  1IBL O;  3ABM B;  5KX5 A;  5IY5 C;  1M56 C;  5BR8 O;  3H9V A;  1MOF A;  4X1Y A;  4LF4 B;  4BIU A;  1MSW D;  1NKD A;  2YDE A;  4I55 A;  1N32 B;  5H5N A;  1JJ2 U;  4N21 A;  3WG7 C;  1XNQ O;  5JVD B;  4DR5 B;  2UXN A;  3O9O A;  3OGI B;  2F66 C;  2Q0A A;  4DV4 O;  2AXT Z;  4FLU A;  4R8C A;  2L35 A;  3CB2 A;  1YEW A;  2X6B A;  4J9Z B;  2JIZ G;  3SYC A;  1M57 C;  5FNV B;  4JI6 O;  1FFX B;  2Q7E A;  2WA3 A;  2WLN A;  2BCC H;  4NXN O;  3T1Y B;  4CC5 A;  4DR4 O;  4DV0 B;  1N8R W;  2WA4 A;  4UVB A;  2CDY A;  5DEC A;  3RYI B;  3JCU Z;  4D7S A;  2OTJ V;  1F4M A;  2OIE A;  3ETG A;  3RYF B;  4O2A B;  2QM7 A;  2OT5 A;  4DXW A;  5B1A B;  2FKX A;  3K79 A;  3RVZ A;  4PI0 A;  5LP6 B;  2ARH A;  2EIM C;  4RUE A;  2A7W A;  3CRQ A;  3H1H H;  3CD6 V;  2XUM A;  3HKC A;  3N2G B;  5DM6 V;  5KUM A;  2OCC B;  2WLJ A;  2KQX A;  2R72 A;  4AHC A;  1Y67 A;  4AI8 A;  4DR2 B;  5CBF A;  2BTO A;  1Y74 A;  4R50 A;  4GKK O;  2GDS A;  4CS2 A;  1FXK C;  5KA5 A;  2DQ3 A;  5B5E Z;  2WAM A;  2IH3 C;  1TAE A;  4YJ3 B;  3JAK A;  2ZE6 A;  2EBO A;  2ZDI A;  3JAT A;  4JGS A;  3OR7 C;  4WBN B;  1WA8 A;  4OX9 O;  1GO3 F;  2GSM B;  2QKC A;  3ASO B;  4GX5 A;  2MK3 A;  2A79 B;  2VWK A;  2ITD C;  4JTA B;  1KC8 W;  4TV9 A;  4LR3 A;  1NQT A;  3TGU H;  1JVM A;  4PA9 A;  5LMU B;  2JEX A;  3OW2 U;  5FPR A;  4D6T H;  2LQT A;  2LW7 A;  1DK1 A;  4DV4 B;  3ZMS A;  4X1I A;  4CBC A;  2ZIM A;  1B06 A;  3ZED A;  1XNR B;  1N0N A;  3OFN G;  2RDC A;  4JI6 B;  4TT3 G;  3CCU V;  2EIK B;  1T5E A;  2ZCE A;  4GX1 A;  3T2M A;  3SYO A;  3S3W A;  3LDE A;  4X65 O;  3FYE B;  1AVM A;  3RGB A;  2QDO A;  4DR6 O;  1WNS A;  4U7O A;  3OTO O;  4JI3 O;  5LOV A;  4O4I A;  2CTQ A;  3GB7 C;  3ZHQ A;  3AG3 C;  3SGI A;  1YJW V;  4B3M B;  2UUC B;  2NR5 A;  2IJJ A;  3JYC A;  1K92 A;  3T1C A;  1KKC A;  2Q4P A;  4LF5 O;  2EIN B;  1M93 A;  4JYY A;  1V55 C;  1G8M A;  4LF6 B;  3CRC A;  4GKK B;  2JDI G;  3OEE G;  3G71 V;  3D8C A;  3QTC A;  5JJE B;  4O2B B;  4YHH O;  2Y69 B;  1ZTE A;  1PV0 A;  1CXZ B;  1PNK A;  3CE2 A;  4BW5 A;  4WFE A;  1TVK B;  2FYU H;  4IT5 A;  4LF9 O;  4YIO A;  1PM9 A;  4JF3 A;  3QF7 A;  3JD1 A;  4OPA A;  2JS5 A;  5JH7 A;  2PI4 A;  2D3O W;  4W4K A;  4JI7 B;  2ZE5 A;  1W0K G;  3CC7 V;  4GUN A;  1IXM A;  3LDD A;  3BAA A;  2R9A A;  2UUB O;  4UCS A;  1FPO A;  3E89 A;  4FFK A;  4L8J A;  3RYH B;  3EVK A;  4O4J A;  2LFS A;  3JAS B;  3M99 B;  2ETN A;  3L73 H;  5L3G A;  3K5M A;  3HKB A;  4J7K A;  3JAR B;  4MVZ A;  3SR2 C;  2ZE7 A;  4GYC B;  1US6 A;  3WG7 B;  3CCS V;  1BL8 A;  1Z5V A;  4DR3 O;  5L3F A;  4DR6 B;  3ZS8 C;  3FB5 C;  1COW G;  1HNX O;  2YUA A;  4P9O A;  2ZXW C;  5KMG A;  4JI3 B;  4DV6 B;  4X8A A;  1Q3E A;  4UVC A;  2X6A A;  3OEH G;  4X88 A;  4CS4 A;  2M7W A;  4FLW A;  5EZY A;  2P5O A;  4X64 O;  2FB5 A;  5C8Y B;  2X7R B;  2Z5U A;  1W59 A;  1JFF A;  2CAZ C;  1OCR B;  2PYL A;  3ZX6 A;  2LO1 A;  2GUZ B;  1TGO A;  1CPY A;  3J81 N;  1SQQ H;  3E86 A;  3UQ8 A;  1H8E G;  1PD3 A;  4BR6 A;  3P3P A;  5DN6 G;  2UXC O;  4LWS A;  1Q7Y W;  1J5E O;  4YHH B;  5CA3 A;  3IJ4 A;  4ZHQ B;  1Y66 A;  5JWP A;  1L0N H;  4MW8 A;  4B3R O;  2EIM B;  3OMI B;  2NLJ C;  2P4V A;  4F6R A;  3FB8 C;  3JSN A;  4DUY B;  1G1X B;  4LF9 B;  1O9H A;  4KXR A;  4TV8 B;  3ZHV A;  4DV7 O;  1BCC H;  1WB8 A;  2OYQ A;  2Y0P A;  3CRR A;  2V1D A;  3O65 A;  1FXK B;  3TXS A;  3CS5 A;  3FAV B;  3K5L A;  1FJG O;  2JGU A;  3SPC A;  2Q69 A;  4TOI A;  1Y76 A;  1GM8 A;  3CYO A;  1IBK O;  1BZK A;  3K06 A;  3MHH C;  1GK9 A;  1KP3 A;  3MHS C;  4DV1 O;  5KUK A;  4FPP A;  4LFC B;  1B04 A;  3DXR A;  1TUB B;  2FTK A;  5L3E A;  4PDL A;  1VQL V;  2UXB O;  1GAX A;  1AI5 A;  1I0H A;  3BHP A;  4L87 A;  3APQ A;  1HNX B;  5KLV H;  2QSA A;  1K34 A;  4I0X B;  5LHH A;  3B8N A;  1EZV H;  4HZ3 A;  2AZ0 A;  3GVM A;  3ZCC A;  1R3K C;  3R66 A;  1FFT B;  3ZJZ A;  4J41 A;  1J95 A;  1SRY A;  2OCC C;  2UXD O;  5CA0 A;  2P67 A;  4DO2 A;  4LP8 A;  3WU2 Z;  4H44 B;  2VQF O;  4JYB A;  2UXC B;  1G6U A;  3ZN0 A;  2YS8 A;  2ZIN A;  3JAW A;  3LSS A;  3ZHT A;  4DRX A;  2GTA A;  4O4H A;  3MAQ A;  1Q5O A;  4D7T A;  4U3J B;  3AG3 B;  4B3R B;  1EBO A;  1JOY A;  2CTR A;  4Z2W A;  2KB1 A;  4ASU G;  4PDR A;  2IJI A;  3VBB A;  2YEV A;  2QWO B;  3ZRW B;  1V55 B;  2CH7 B;  5IWA B;  1VQK V;  2HHH O;  5LXT A;  1XMO O;  2LP7 A;  4X20 B;  4XDL A;  1U96 A;  1PP9 H;  3H1K H;  3ML0 A;  5EK0 A;  4GKJ O;  5IYZ B;  1FJG B;  1YXB A;  4KP4 A;  1YVW A;  5KAF Z;  2Q6A A;  3TXQ A;  2DJV A;  4DK0 A;  4P2Z A;  3OUS A;  1IBK B;  1H2G A;  2OWO A;  5FL7 G;  1QCE A;  4DK1 A;  5JVD A;  2P06 A;  3L70 H;  2QKA A;  1S76 D;  2DMX A;  3X2Q C;  2IW5 A;  4W4L A;  4HNA B;  4K0K B;  1KU9 A;  5EIB C;  2EIK C;  4DV5 B;  4UV9 A;  1K4C C;  4HBN A;  2HFE C;  1NJI W;  3IFX A;  1H38 A;  1YF2 A;  3OMN B;  1JCH A;  3ZHS A;  5FNV A;  3JSL A;  1IBM O;  5A2Q N;  1GN4 A;  1FFX A;  2ZNJ A;  2YXY A;  2ZM6 B;  1FKA O;  3RBZ A;  5H6Q A;  2LFR A;  2JJ2 G;  1L1F A;  5LA6 B;  1UFI A;  2YSU B;  1XHZ A;  3RYI A;  4PJ0 Z;  2N74 A;  2BOB C;  2ZR2 A;  4KHP B;  1N33 O;  3H1I H;  4YY3 O;  3UO3 A;  4O2A A;  4WCE V;  1XOU A;  4JZG A;  4QE7 A;  2EIN C;  3QG5 A;  2ZIO A;  1AR5 A;  1VQ6 V;  2UXD B;  1P7B A;  5LP6 A;  3IAY A;  2WLL B;  1FXH A;  5H2F Z;  2RJZ A;  3CCQ V;  1KKD A;  2VQF B;  2VRZ A;  1BSM A;  4PD4 F;  3N2G A;  5GW7 A;  2OTL V;  3BA9 A;  4JI5 O;  3UT5 A;  1RSO B;  1VEW A;  3G6E V;  5IYC O;  2F95 B;  4LFA B;  2DYR C;  4YJ3 A;  5LYJ B;  3L74 H;  3W7S A;  4MVU A;  3BCC H;  5BZB A;  1YZB A;  4WBN A;  4Q20 A;  5IYB O;  2A06 H;  4X1K A;  4IGG A;  4GKJ B;  4K8X A;  4JI0 O;  1VQO V;  3VOU A;  3DSQ A;  2GBO A;  1I94 B;  2E5L B;  2F23 A;  1SQB H;  1YDX A;  4PA6 A;  3ZN1 A;  3SJQ C;  1YCI A;  1Q6U A;  2BE3 A;  1JA8 A;  3KG2 A;  1DF5 A;  1GKF A;  4WFG A;  1S5J A;  1MNG A;  3FKS G;  1THZ A;  3RN4 A;  3GWK C;  4QE9 A;  2O57 A;  4LF7 O;  1X4T A;  4B7K A;  5L3D A;  4JI1 O;  3BEH A;  3CCR V;  1IBM B;  3DTU B;  2VQE O;  2QWR B;  4IYI A;  3JAM N;  3OGC C;  3CEI A;  4FK5 C;  1SA0 B;  1PL0 A;  3ICX A;  1XMQ O;  5L3C A;  3TK1 A;  5BMV B;  1NH2 B;  1H2N A;  2PY5 A;  1Z2G A;  1IZ3 A;  5AG2 A;  1X59 A;  1N33 B;  4YY3 B;  1OCR C;  4LNU B;  2KG7 B;  3L75 H;  1DF4 A;  4EB6 B;  4GT1 A;  1O9G A;  2QR4 A;  3J80 N;  3JD4 A;  2Q0O C;  4ZBM A;  2MW2 B;  1MA1 A;  3WFV A;  1YJ9 V;  1XRE A;  1JX9 A;  2FL4 A;  2FML A;  4UVA A;  4JI5 B;  2Z0A A;  4UCO A;  3CJH B;  5LMN O;  3UM7 A;  2XAJ A;  1K3E A;  4ZIB A;  3I55 V;  3I56 V;  2HVK C;  4UB8 Z;  2HP8 A;  1EZJ A;  5KHG A;  3SJB C;  3B8M A;  3G4S V;  3E83 A;  1BQ0 A;  1SES A;  5EIB D;  4JI0 B;  4WFH A;  2Q67 A;  3SJC C;  4MVO A;  4NYK A;  5IJ0 B;  1VF7 A;  2ZKO A;  2CE4 A;  4FLY A;  3HKD B;  2HJF C;  1CP9 A;  5DED A;  1P7G A;  3D3I A;  2E3C A;  3SPH A;  1IDS A;  2K1E A;  3W7T A;  1IBL B;  5GON B;  1V9P A;  2DE0 X;  1R73 A;  5BR8 B;  2Q68 A;  3FX7 A;  1QQC A;  1WP8 A;  1QNM A;  3JAS A;  4TUY A;  2CK3 G;  4MTG A;  3W7X A;  3IGA C;  1XNQ B;  4U7N A;  4E2L A;  3CPW U;  1D5A A;  3JAR A;  5LGT A;  4JI1 B;  2A9H A;  3VQW A;  5JJJ B;  4MVS A;  3W7U A;  3EXA A;  2DOS A;  4I4T A;  4TWK A;  1AB3 A;  2YC0 A;  3X2Q B;  4GZR B;  2XAG A;  4LF8 O;  1Y6X A;  3BPZ A;  3F7V C;  4NXN B;  3L9D A;  4DR4 B;  3CXC U;  4B3S O;  3FB7 C;  3H01 A;  2YI8 A;  3SYP A;  5C8Y A;  3AG1 B;  3STL C;  3T4Z A;  4U3F H;  3PN1 A;  3N27 A;  5J2T B;  2GUZ A;  4J9Y B;  1HR0 O;  3CC2 V;  1S5L Z;  4J10 A;  1R6N A;  2JGD B; 
#chains in the Genus database with same CATH homology
 2EIM B;  5B1N A;  3OMI B;  3ZIA G;  2P7T C;  2NLJ C;  3ZMZ A;  1Y4M A;  1OZ0 A;  5EC2 C;  3R65 A;  3FB8 C;  1V54 B;  1QBZ A;  4WF9 V;  1AJP A;  2A0L A;  4MSW C;  4G2K A;  1KQS U;  1LNQ A;  2HR3 A;  1BMF G;  2EZP A;  4LC1 A;  2IJK A;  4FJC C;  4PDM A;  3LNM B;  1DLB A;  2V1D A;  4TSF G;  1AI6 A;  1FXK B;  1NVP D;  3ABL B;  3GWO A;  1BHB A;  4JAS A;  3SPC A;  2Q69 A;  5LGN A;  1UJW B;  2WLM A;  1RM1 C;  1K73 W;  3STZ C;  3SPJ A;  3ZMT A;  1AI7 A;  1YHQ V;  1FXK A;  2XAH A;  1PKX A;  1GM8 A;  3CYO A;  4QPK A;  4GCZ A;  1OCZ B;  4UXN A;  2DYR B;  3K06 A;  5LHI A;  3MHH C;  1GK9 A;  4H37 A;  5KA6 A;  1KP3 A;  3MHS C;  3LUT B;  2WLI B;  2IU0 A;  1CEZ A;  1K8A W;  4ZKI A;  5KUK A;  4FPP A;  2WLH A;  2B1G A;  1YSC A;  3E8H A;  2FTK A;  2QEX V;  3K03 A;  3ZMU A;  3CP1 A;  1K5S A;  5L3E A;  5C93 A;  2WLI A;  4FMT A;  4PDL A;  1VQL V;  4MS2 A;  1S77 D;  2ZQM A;  1AI5 A;  3ABK B;  3P32 A;  4X89 A;  3ABU A;  4L87 A;  5H9C A;  1K7D A;  3ASN B;  3FB6 C;  3K3W A;  4QPJ A;  4XDK A;  2XND G;  4RAI A;  1KEC A;  2R9R B;  2ATK C;  2ZXW B;  3CCV V;  1K34 A;  2JK5 C;  3MD0 A;  4Z1M G;  5LHH A;  3B8N A;  2QKS A;  1GM7 A;  5EBW C;  4I5S A;  4HZ3 A;  2Y69 C;  4R6Z A;  3ZCC A;  1R3K C;  1QLE C;  2UXX A;  1E79 G;  1FFT B;  2HKO A;  2WLK A;  4PEL A;  3ZRV A;  1H8H G;  4MVR A;  1NVP B;  2DYS C;  3OUF A;  3ETE A;  3ZJZ A;  1J95 A;  1SRY A;  2JJ1 G;  2OCC C;  1MG1 A;  4WFB V;  5CMU A;  4YXW G;  1E1Q G;  4PDV A;  3OE7 G;  2P67 A;  4DO2 A;  2ZD9 A;  1AJN A;  2ZR3 A;  4LP8 A;  4JYB A;  3ZN0 A;  4UUJ C;  1OCO B;  3LSS A;  5B3S B;  2NNU A;  1M1K W;  1M9N A;  3SPI A;  1TUE B;  2YEV B;  5E1A C;  1JQ0 A;  3AG3 B;  1EBO A;  1JOY A;  4LCU C;  5CBH A;  1PNL A;  3FYI B;  1QR8 A;  2KB1 A;  4ASU G;  4PDR A;  2QM8 A;  2IJI A;  3VBB A;  3AG2 C;  5HFL A;  2YEV A;  4UV8 A;  3ABM B;  5B1B C;  5IY5 C;  1M56 C;  3ZRW B;  1V55 B;  1VQK V;  2HVJ C;  1VQM V;  1MOF A;  2LP7 A;  1OHH G;  4BIU A;  1MSW D;  4XDL A;  1NKD A;  2IH1 C;  3ML0 A;  5EK0 A;  1JJ2 U;  2P90 A;  1VQ5 V;  4N21 A;  4KP4 A;  3WG7 C;  1K5Q A;  2Q6A A;  3K04 A;  2HLD G;  1RM1 B;  2UXN A;  4XDJ A;  4P2Z A;  5CN0 A;  4QIW F;  3CME V;  1GMG A;  1VQN V;  3OUS A;  1H2G A;  2AHY A;  4R8C A;  5B1O A;  5FL7 G;  1QCE A;  3LDC A;  2X6B A;  4J9Z B;  3ZMV A;  2JIZ G;  3SYC A;  1S76 D;  3RVY A;  1S5H C;  3X2Q C;  1M57 C;  1RPR A;  1JPX A;  2IW5 A;  4G27 B;  2EIK C;  4UV9 A;  2B5U A;  1K4C C;  2WLN A;  2HFE C;  3A0R A;  1NJI W;  3IFX A;  1H38 A;  5EBL C;  3OMN B;  1JCH A;  5L3B A;  1N8R W;  4UVB A;  2OTJ V;  1F4M A;  1YIT V;  1KP2 A;  2X6C A;  3ETG A;  2W6J G;  4LBE C;  2QM7 A;  3RBZ A;  2OT5 A;  4DXW A;  5H6Q A;  2LFR A;  2JJ2 G;  1L1F A;  2YSU B;  5B1A B;  2H8P C;  3K79 A;  2BOB C;  2ZR2 A;  2JEU A;  4P30 A;  1HWY A;  1DTO A;  3RVZ A;  1OCC C;  3CC4 V;  2DQ0 A;  2EIM C;  3AG4 C;  3K0G A;  3K9A A;  4RUE A;  4WCE V;  3CD6 V;  4PA7 A;  4PA4 A;  2DYS B;  3DGE A;  4QE7 A;  1WLE A;  2EIN C;  3CCJ V;  4R7C A;  3E8F A;  5DM6 V;  5KUM A;  1ARO P;  1Q81 W;  1VQ6 V;  4HYO A;  1P7B A;  2OCC B;  2WLJ A;  4OXS A;  4PA3 A;  1R3I C;  2EIJ B;  1FXH A;  2WLL B;  4JAU A;  1SZT A;  3CCQ V;  1KD1 W;  1KKD A;  2AHZ A;  3JD3 A;  5CBF A;  4GX2 A;  4R50 A;  5GW7 A;  4JAV A;  1VQ9 V;  2OTL V;  1FXK C;  5KA5 A;  2DQ3 A;  5LHG A;  2WLL A;  2WAM A;  4N23 A;  2IH3 C;  1S72 V;  1PNM A;  1W2B U;  4GX0 A;  4H33 A;  4HAM A;  2EBO A;  2ZDI A;  3G6E V;  4JGS A;  3OR7 C;  5IYC O;  4RUF A;  3AG2 B;  5EBM C;  1OCZ C;  3SPG A;  2DYR C;  4WFA V;  1GO3 F;  2GSM B;  5B1B B;  3ASO B;  5IY5 B;  1M56 B;  2H94 A;  4GX5 A;  3W7S A;  2MK3 A;  4JTD B;  4MVU A;  3RW0 A;  2A79 B;  3EHB B;  4I9W A;  3ZRS A;  2PI5 A;  2ITD C;  4MTX A;  3F5W C;  5BZB A;  2W0F C;  3PJS K;  4JTA B;  4Q20 A;  5IYB O;  3OAA G;  1KC8 W;  1NQT A;  1VQ8 V;  2V7Q G;  4JPR A;  1JVM A;  4PA9 A;  4MT8 A;  2JEX A;  4MTF A;  1VQO V;  3VOU A;  1I5X A;  2Z3Y A;  3OW2 U;  1R6K A;  1Q82 W;  4RQF A;  2XAQ A;  3OM3 B;  1ROP A;  3E8G A;  4JTC B;  4PA6 A;  5H6R A;  3ZN1 A;  4WFF A;  3SJQ C;  3ZMS A;  4XBF A;  3ABK C;  3P30 A;  4CBC A;  3ASN C;  1DF5 A;  1GKF A;  3KG2 A;  1YTF D;  4WFG A;  2DW4 A;  2EZO A;  4QNH B;  3FKS G;  2QTO A;  4BAY A;  1THZ A;  4RQE A;  1Q86 W;  1F4N A;  5EC1 C;  4EKW A;  1ORQ C;  2DWD C;  2EIL C;  3OFN G;  2WPD G;  1M57 B;  4QE9 A;  1FS0 G;  1S3J A;  3K08 A;  3JD0 A;  4TT3 G;  3TCU A;  3CCU V;  1B6Q A;  2GHY A;  2EIK B;  3ZRW A;  4GX1 A;  1WPX A;  3BY6 A;  3T2M A;  3SYO A;  4FIP C;  5L3D A;  4RO2 A;  3BEH A;  1VQ4 V;  3CCR V;  1GTO A;  3DTU B;  1NBM G;  1I5Y A;  3LDE A;  1K33 A;  3FYE B;  4MW3 A;  3OGC C;  2ITC C;  4FK5 C;  1BHA A;  3OMA B;  1FXV A;  1PL0 A;  5L3C A;  4G28 B;  4U7O A;  3TK1 A;  2WWW A;  5B3S C;  3CMA V;  1NH2 B;  1W0J G;  2B1I A;  3SYA A;  3GB7 C;  3AG3 C;  1YJW V;  3TET A;  3ZRX A;  4F4L A;  3AG4 B;  1OCR C;  1NR1 A;  2BOC C;  2IJJ A;  3JD2 A;  3JYC A;  1K92 A;  3T1C A;  2IJH A;  2EIN B;  2HG5 C;  1DF4 A;  1QVF U;  4QJF B;  5HFM A;  1K97 A;  3ABM C;  3LSQ A;  5CBG A;  2R9I A;  5LBQ A;  1V55 C;  1G8M A;  3AG1 C;  4GT1 A;  3JD4 A;  4ZBM A;  1YTF B;  3WFV A;  1AI4 A;  3OR6 C;  1YJ9 V;  2JDI G;  1JX9 A;  3OEE G;  4KFM A;  4UVA A;  3HB3 B;  3G71 V;  1VQP V;  3K0D A;  4P9P A;  3CCE V;  3T4D A;  3QO5 A;  3QO8 A;  2Y69 B;  1QVG U;  1QLE B;  1PNK A;  4MTO A;  3UM7 A;  2XAJ A;  3AEI A;  4BW5 A;  1K3E A;  1ZWI C;  1F51 A;  4WFE A;  3I55 V;  3I56 V;  2HVK C;  3D36 A;  1V54 C;  5LGU A;  2F43 G;  3CCM V;  3B77 A;  1K9M W;  1EZJ A;  4JF3 A;  2XAF A;  2X0L A;  3B8M A;  3G4S V;  3JD1 A;  1QLN A;  3E83 A;  2PI4 A;  1P4R A;  2D3O W;  1SER A;  1SES A;  4WFH A;  2Q67 A;  1W0K G;  3F7Y C;  1AR1 B;  4MVO A;  3ABL C;  3CC7 V;  3NXS A;  3W7W A;  1R3J C;  4JYC A;  3SYQ A;  1E1R G;  1IXM A;  3LDD A;  2HJF C;  1XL4 A;  1CP9 A;  1YI2 V;  3E89 A;  2EJR A;  3D3I A;  3HPL C;  3SPH A;  1G4Y B;  2LFS A;  2K1E A;  3W7T A;  2XOK G;  3M99 B;  3IC7 A;  1R73 A;  5J9P C;  5IYD O;  2Q68 A;  4KUM A;  5L3G A;  1NH2 D;  5IDJ A;  4MVM A;  1XL6 A;  5B1A C;  4MVZ A;  2EIL B;  2XAS A;  3JCZ A;  4MVQ A;  2CK3 G;  4MTG A;  3W7X A;  3ETD A;  3IGA C;  3UKM A;  4U7N A;  2WSS G;  4E2L A;  3CPW U;  3WG7 B;  3CCS V;  1F23 A;  5LGT A;  3QO7 A;  1BL8 A;  2Y48 A;  2A9H A;  1NR7 A;  3E8B A;  1QR9 A;  4MVS A;  2EIJ C;  5L3F A;  3FB5 C;  1RPO A;  3W7U A;  1COW G;  4P9O A;  2ZXW C;  1M90 W;  2ZDI C;  4CZZ A;  4TWK A;  4X8A A;  1S0V A;  1SET A;  4UVC A;  2X6A A;  3OEH G;  3X2Q B;  4X88 A;  3QNE A;  1YJN V;  2XAG A;  1R3L C;  2M7W A;  1YIJ V;  1ENV A;  2DWE C;  3F7V C;  3ABT A;  2QE7 G;  2QA4 V;  2X7R B;  2Z5U A;  1EFR G;  1OCR B;  2C2A A;  3CXC U;  2IU3 A;  2W6I G;  1CPY A;  3FB7 C;  3H01 A;  4BIZ A;  3SYP A;  3ASO C;  3E86 A;  1H8E G;  1PD3 A;  3AG1 B;  3STL C;  1K4D C;  3CCL V;  1AJQ A;  3T4Z A;  3E2E A;  5DN6 G;  1OCO C;  3E35 A;  4J9Y B;  1Q7Y W;  3CC2 V;  5CA3 A;  1Y66 A;  3EFF K;  1R6N A;  1MAB G;  2P6J A;  1GM9 A;  1OCC B;  4MW8 A;  1VQ7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...