3P3PA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1997-2016) peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3pA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3pA01
1H2LA 5JWPA 4B7EA 1IZ3A 2CGOA 3OD4A 2WA3A 1MZFA 1MZEA 4B7KA 4Z1VA 4BIOA 4AI8A 2WA4A 2Y0IA 1H2NA 3KCYA 1YCIA 1H2KA 2ILMA 2XUMA 2YC0A 2CGNA 3D8CA 3KCXA 2YDEA 4Z2WA 4NR1A 4JAAA 3P3NA 2W0XA 3P3PA 4QU2A 1H2MA
chains in the Genus database with same CATH superfamily
1VF7A 1EYBA 3I3BA 3VBFA 3DXRB 4URTA 2F23A 3B77A 3K58A 4KWLA 2DFCA 3U0ZA 4IL7A 4RGKA 3KQ4B 5JOZA 1WA6X 4UFHA 2GC3A 4X8NA 4UXAA 2FD8A 1OA2A 3A7QA 1THZA 4DW1A 1WMDA 2RR13 2CE4A 4KBBA 2JG9A 5HPOA 2YI8A 3WNXA 3ZHVA 3UYJA 1OOPC 4BCUA 3NL1A 2JICA 4N8MA 5J48A 4CXYA 3AEIA 3ZFFB 2CDOA 5I0DA 4AGVA 4OZOA 4XMAA 1WP8A 5GZFA 4UW5A 5I0RA 4I9WA 2WZR1 2C2AA 4K35A 3GVMA 1POV0 5LHGA 3IIAA 1GLHA 1E1RG 1YWKA 1QJU3 3M8AA 2X29A 4PELA 4W4LA 1S5HC 4XJWA 1M1KW 1M90W 4I55B 2GDFA 2OCHA 1EN5A 2VUAA 3H1WA 3GB7C 3HR0A 1W9FA 1JR9A 5FMDA 5JI7A 3H9AA 3BU0A 3RG0A 2CUGA 2RR12 5BXXA 2CDYA 4OMCA 5CFCC 4LBQA 1SESA 3JAWA 3NO8A 5LXTB 3N9NA 5DDJ3 1TME2 1PK6B 1CAUA 4LBMA 2UXXA 1DP0A 1L0LH 2EALA 1IPJA 1NXD1 1ONAA 3SKJE 2JG8C 3H3ZA 2OIGA 4UBHA 3Q8FA 4DV1O 4X62O 3ZFGA 1QJU2 3RS6A 4OXSA 3TN91 3CKHA 4LKSA 3SYPA 2P4EA 1QJEA 1RUE3 2XB6C 2ZS6B 3SQOA 4JV5B 2Z5UA 5JXGA 4IV1C 3DC5A 5DAVA 4AZZA 2ADPA 1XNRB 2LFRA 4DXZA 3MHHC 4QM8A 1D5NA 1DZTA 1GKBA 2EF6A 4XILA 4FJCC 2FMDA 3RYIB 5FKCA 4WCEV 3NWKA 5J9PC 5DDJ2 3FYIB 5FYVA 3WCRA 3E6BA 2VZTA 4GALA 5A3WA 4JASA 1ZBA1 3CCJV 2HYKA 4WVZA 5A1FA 5ITZA 1C4RA 4JI6O 3GDBA 4XPVA 4JI3O 4G3YC 3AJZA 1OSGA 2VC9A 3LDCA 1GZWB 3ZXDA 1NOVA 3V0BB 2R9AA 2B9VA 1RUE2 2VU9A 1W6NB 1ZUQA 5FPRA 4ASUG 2Q30A 4WVMB 1A8MA 4OHYA 1IBLO 2GV9A 1QKQA 3SJCC 4J6GA 2Q5TA 3FN9A 2WZR3 5LA2A 2Z3YA 1H9WA 3AVRA 2BVBA 1UQXA 2YB7A 5EZYA 4FLTA 3AP9A 3TBDA 1Y9MA 4QPKA 3ITQA 3WY6A 4Q0PA 4XW3A 3RW0A 4PV1B 2QQIA 4XF4A 4UFKA 3T30A 1BVVA 2QM8A 4AQYB 4LNUA 2B5UA 4MO3M 2AGAA 1H8VA 3WUCA 2NN4A 3NNLA 1AYM3 3H42B 3ZYHA 3UKVA 1GP5A 2ITDC 2QWNB 2IFWA 4BQ5A 2B1GA 4TQDA 2WZR2 2QWOB 4JTNA 4X1YB 4FPEA 4U7OA 1LOCA 4YNIA 2HJFC 3WQ0A 2AGSA 4PIXA 2AHZA 1OQ1A 2YUAA 3U11A 1WA8B 1QHDA 4NTWA 4Y1UA 1C28A 1OCZC 4BMEA 1P49A 2Q0OC 1KQSU 1GKFA 1DF5A 3TCUA 1S76D 3WW3A 3VQYA 4YPJA 4QGNA 4YSFA 5C8CC 3ACGA 4UI9L 2JJ1G 3PLQA 1AYM2 3E5UA 1HIXA 4J7ZA 2VL4A 2WT0A 2A3YA 4E2SA 3JU9A 4ZI7B 4AAXA 3VBBA 1UIJA 1O5LA 3AYDA 1AP6A 5CB4B 4UFMA 4MHUA 5FUIA 3DYMA 4UW6A 3VBFC 5C4WB 2Q6AA 1MG1A 1H2MA 4AAPA 2G4IA 1Z5VA 2V09A 2JGDB 5C8YB 2Q1MA 3T4HB 2GDSA 4GZRB 1T6BX 4XFGA 4A7YA 5EC2C 3RZZA 3KZIZ 3RMYA 4C1WA 5BNOA 4JAVA 2Z79A 4MT8A 1S77D 2OW4A 4I5SA 4OI1A 4BM8A 1RM1C 1Z2GA 3FLPA 4XUPA 4M00A 2ZX2A 4DIQA 2AACA 5F5IA 4GMP3 1VEWA 2DYCA 2GC1A 3CP1A 2WN3A 5DUWA 3GF6A 3JQXA 2W08A 4ZS2A 1CJPA 5IJ9B 4R4ZA 1F31A 2CU5A 1PO21 1S0EA 4O65A 5EIBC 2VMEA 2P3IA 4A2UA 1QDOA 3WF2A 1UPGA 1O8PA 3DYPA 3ZX7A 3V56A 5JSOA 2ZE8A 3FE5A 1R3KC 1EFRG 3UKTA 4EWEA 5IT9N 5A6ZA 4F6RB 1VQPV 5EHDA 1GP4A 2YXLA 1UPIA 4FXGB 2ZR3A 4H7MA 1AR1B 3ZXJA 1HRI1 2DMXA 3N2GB 1PO11 3PU8A 3SYOA 2RVAA 3MV01 2EIKB 4YJ2A 2IJJA 1HNZB 1Y76A 1PGL1 4LMFA 4ZXKA 1RMU1 1PMIA 2BFUS 1XYOA 3I3EA 2ZD9A 4X66B 4MSWC 1BKZA 1JYXA 4X1KB 3RBZA 4P02B 4E8DA 4JV5O 1JOPA 3ZYRA 1DQ2A 3MAQA 4ZPIA 1XNRO 3L74H 1AROP 3UL2A 3U1XA 2CDPA 1XI1A 3JCZA 2KB1A 4I0BA 3IZOA 4FPJA 4PDWA 1I3HA 2K9PA 3CU7A 4FPLA 1UKRA 5LMUB 2HKOA 1YJLA 5F2VO 2H3OA 2WWSA 2XHKA 2CWMA 4XVHA 2LUWA 1V9U3 4UXNA 2NN8A 2TBVA 1A6CA 4WFBV 2ZEXA 1EAH3 2WABA 5EYPA 4KG0A 2O8OA 4A4AA 1YLLA 3T2MA 1YTFD 1PNFA 3POYA 1S0GA 4R8HA 1XJAA 1AR4A 5LCWL 2ZOEB 1SG3A 2QKAA 5IVJA 2D40A 4JI1O 1QEXA 4DV5B 4JX0A 4NVPA 4TV8B 2YPJA 3HT2A 4IGGA 2BOCC 4MTGA 3SYAA 2E32A 4ARYA 3A0KA 2WFPA 4BZ4A 2OA2A 4CDXA 1COWG 3JASB 2MEV1 4NIGA 3CPWU 4CUAA 4QX5A 2VMFA 3BCWA 3G7DA 1V9U2 5EBWC 4QDSA 3K4AA 1G4YB 1EAH2 2WFF3 2P3YA 5KUKA 4L97A 4G27B 4ZHQA 3NAPA 2ADQB 2NM1A 3JAKB 1Q86W 4HPKA 4DYLA 4XDOA 2QZ3A 2VAUA 3OD0A 1QCEA 1UNBA 4FFGA 1HRI3 1H1IA 1PO13 2Z4FA 2A6ZA 4FTSA 5GLTA 3I3MA 1BS3A 1H2LA 3OUFA 1S0CA 2AZ5A 1WLDA 3RZHA 1GMMA 3R65A 2C1FA 1UJWB 4YW7A 2WLIB 1X8MA 5T54A 2YU1A 4PHZA 3AK3A 4QM9A 1S5JA 5FXWA 1JPXA 2VULA 4NPRA 3ZPYA 4M01A 4E4ZA 2JKXA 4K1ZA 3ZS8C 2MNGA 3LNNA 2A6WA 3LD8A 1DGSA 1NE4A 1TUBB 4B7KA 2EAAA 1FFXB 2Z69A 4HK9A 2WFF2 3A0HZ 3IAYA 1HB4A 3ZSKA 4XUOA 1O5UA 2YGLA 3MFAA 3WVJA 2P6JA 1PHMA 4HETA 4DPNA 5J3UA 4GXLA 3W20A 4SLIA 1C5IA 1PO12 4DK0A 1RUF1 1WW4A 2HJIA 3HKBB 1SC5B 5GTIZ 1LHUA 4FFFA 1H0BA 4FPOB 2V5DA 3AG2C 3ZXFA 4EWAA 5DZGA 5FXXA 4KWUA 1T5EA 2IW5A 3AKSA 1XHZA 4LHSA 4JI0B 5FYYA 5DAQA 3AG3B 4AHCA 3ZHSA 1GR3A 4AQ2A 4LK6A 4JHZA 3OPZA 2JJ2G 5D1IA 1CVNA 3OG2A 2WAOA 5JJEB 4IERA 4I50B 3SXWA 5BNOC 2RMU2 2D3OW 3BRCA 3ENRA 4NIHA 3AX4A 1NBMG 2V4AA 2JS3A 2JWPA 1JZ3A 3BY6A 4LFBO 3WP6A 4L87A 5J1XA 3BAAA 1GOHA 1H4HA 5I0TA 1LU2A 4FFBA 3OGJA 4GQ7A 1YUDA 3H0OA 4F6EA 3AJYA 2IJKA 2X5IB 3AP7A 1VQ4V 4JI8O 2FDJA 4XJ8A 4NHYA 3SPJA 3ETQA 1NKDA 5GLVA 2CTQA 4TV9A 3LB9A 2FTKA 2VQTA 3CRCA 3OFNG 2UWBA 1CPYA 1V6JA 4EN7B 2UXDO 5LA9A 5A6YA 1O3QA 2DWRA 4YZ3A 5FQ0A 4IL6Z 3EJKA 2LW8A 4RR3A 3BABA 2FBEA 2H0BA 4AEDB 5CNAA 1W6QA 1HNWB 5FL7G 1LOFC 2E76B 5BNNB 1DZQA 2VNRA 1PIV1 5ANQA 2ZZQA 1ULFA 4LBLA 3IC9A 3THPA 2VZSA 3OGSA 1H1AA 3QO7A 3WU2Z 4LF9O 2VECA 3ZEDA 1PNGA 4TN7A 3TRSB 4HXCA 5KXBA 1OCOB 1UY1A 4FM1A 1MNGA 1Q8OA 1NT2B 1FPN1 1NXMA 2GNTA 2ERFA 3PNAA 1QHTA 1TVKA 4LHLA 2EILC 2BNMA 2BVVA 5LY2A 3ZN6B 5LMUO 5GTHZ 1VJ2A 3ASIA 4PDLA 1LB2A 4DRVA 2E7TA 4NO4A 1RUC1 1S55A 2UXBO 1K12A 4F3JA 3CEIA 3TJTA 4AGGA 3BUCA 3JB4C 3ELNA 2JRIA 2XLAA 1N0JA 1YI7A 5FZOB 2Q0AA 1Q7YW 4MVTA 2HWC1 3RYCB 3CJIB 5FPAA 4HVOA 1FXHA 5CKNA 4WFEA 3D3QA 3R4SA 1JODA 3MW3A 2RS31 3BCCH 3H1YA 3L9DA 3WHTA 4JI5B 1UWWA 1HX6A 4LA2A 3PN1A 4DV5O 5FYSA 4WVWA 1ENSA 3E22B 2JB8A 1DLBA 3GBGA 3JB8A 4CDXC 4OUSA 1RC6A 1SDWA 2X6BA 4LF6B 1K5MA 2JDPA 1HW5A 3ZN5A 2EIGA 5J96B 4BISA 3TEWA 3RZLA 1W2UA 1N3OA 4B3RO 2CH7B 2VZRA 2R1DA 3J7AU 5EBLC 4PI2A 4RUEA 3JATA 1KB9F 3NAPC 5AC92 3O5SA 3LEKA 1IX9A 1ZZBA 2UU8A 5A7OA 5L9VA 3H1JH 4D69A 1XEQA 3VL9A 1MOFA 3I59B 4MLOA 2BU9A 2P4KA 3THOA 2Q1ZB 2YDEA 4NWVA 2H94A 5FPBA 3LPGA 5KR7A 5L73A 1T2XA 3AKTA 2F4LA 2B4KA 2B5HA 3ACLA 3UJOA 2FDGA 3ASNB 1POV1 2W46A 3KWVA 4E8CA 1OCRB 3QH6A 1ZX3A 3RZMA 1KD1W 1FPN3 4XZPA 4Y4YA 3H8OA 1MZEA 4EN6B 4UAPA 1QXJA 2DYSB 4N7IA 2G1MA 1ZVFA 5D2AA 3B94A 3MDSA 3ZSMA 4I0WB 5IAXA 1R083 4KUMA 1G7YA 4W65A 4KWKA 4CDQB 4KNCA 4M3CB 3W7UA 3BPSA 3VOUA 3BIEA 3BTYA 1H2NA 1V6OA 5GLWA 4CCMA 2HWC3 2AZ2A 5L19A 1UZVA 3FHAA 1EM1A 2NR5A 4CU9A 3RYFA 1S0VA 2ZEWA 3DPRB 2WQ4A 3MW2A 5HI0A 4S2DA 3K3NA 5KAIZ 2VWKA 1R6KA 1WUVA 2PYTA 5CKQA 4UFIA 3VZOA 4DR1O 1YTFB 1BBT1 1FPN2 4MGSA 1RVF1 2VQUA 2PMWB 2FDIA 2KG7B 1BQPA 1LEDA 3CQOA 3WQBA 2F66C 3O7OA 1EPZA 4MVMA 4LE3A 3H8XA 1PM7A 2RQ6A 1R082 4LH7A 1ODNA 2DDUA 1WLWA 3STLC 1VBD2 4Q4V1 1TMF1 3SPCA 3M99B 4HSLA 4PA4A 1Z5WA 4O4HA 1PGW1 4AW7A 1I5YA 4HFSA 2ZR2A 3NJVA 2HWC2 2VNGA 3KCCA 2PN5A 3T4VA 4H3WA 4IE7A 3POFA 5HCAA 5L7OA 1MA1A 3C8XA 5DZFA 3B3QE 4BIFA 4YARA 2W9XA 3C90A 1W8UA 1G1XB 1QNWA 3ZO0B 4Q0SA 2FKXA 5JJNB 4XF0A 4RR3C 3CXCU 2IXCA 1UMZA 3RJ2X 2E3CA 4Q4Y3 3VV1A 2LGQA 4DR3B 3CX5F 3SPGA 1LOAA 1POV3 1XNCA 1Q3EA 3RYHB 5CA3A 2BERA 4S2FA 4XDKA 5B4NA 3ZSEA 3NRUA 5A33B 3O12A 3BA9A 1OH4A 1SACA 1XXNA 5ACA3 4FVVA 2VO5A 4WF9V 5BPXA 3SNMA 4QPIC 2VMIA 1YFUA 4KP4A 2IC1A 4OHZA 3SH4A 4M0NA 1IPSA 2GBOA 4IEOA 1U5ZA 1O9HA 3LDBA 3KCXA 3CJHA 4XJUA 4A6OA 1O3SA 3K77A 5JZGA 1OD3A 4NAOA 2P17A 3DSQA 2C9AA 4Q4Y2 4J1WA 1IS3A 1N36B 3RI9A 1LU1A 3DF0A 4LF5B 1BBT3 3HNMA 1ZRRA 1DYPA 5ACA2 3CO2A 3CRAA 2FMYA 1AXZA 1SRYA 1Q6IA 4OFGA 1W03A 4YFWA 3Q4HB 3UGHA 1HNXB 1WLTA 3MW4A 2QQMA 3KT7A 3ZRWB 1B35A 5A3OA 4H37A 4JI5O 1VBB1 1I9RA 1G9BA 1XNQB 1TMF3 1F15A 4D6SA 5IAVA 2JE9A 1C57A 5SV5A 4YW1A 3N7KA 1LHOA 2V7QG 4ARXA 2GH2A 5GZCA 1QQP1 3WEZA 1SPPB 2XJSA 3ZJZA 3EQEA 2JDYA 3CRMA 1N32B 4K20A 5CFDB 3AG4C 4XDJA 4JTDB 4XFBA 1VQ9V 1L1FA 4BOWA 3E1F1 3ZIAG 1BBT2 2ENRA 3T4DA 3A21A 4Y22B 2P90A 2X6AA 4CDWB 4WFGA 1D2SA 1ULEA 4DW0A 1LEMA 3MIEA 1B04A 2YBPA 4N23A 4BQXA 1YJWV 1TMF2 2WC2A 4HG6B 3ILFA 4META 2XOMA 5J2TA 2W6IG 3AKPA 2V4DA 3RPQA 2ZIOA 3TEYA 2WLHA 2CHHA 4BJ0A 4JPRA 4MOAA 5DEDA 4QX7A 2X6CA 1OI6A 1KC8W 2YICA 1FX5A 2D93A 4XBNA 2CYFA 3T1CA 2BTVC 2WKKA 3OD4A 5CN0A 4AOCA 4IEUA 2W87A 5FAXA 1R3LC 1PGSA 2WNVA 3N4MA 2ZINA 5K0UB 1GFF2 3VQXA 5FRAA 2D44A 2QBXA 3GHNA 5A9GA 3B40A 1VF6A 1OQDA 1LOGA 2YIBA 1GMGA 4K7JA 3I2KA 2WLMA 5A3PA 5EPAA 3WDYA 1G9AA 3O14A 1M56B 5HFLA 3CB2A 1IQDC 3P32A 3H8UA 4AFAA 2XVLA 4KU7A 3M7AA 1ND2A 2P5BA 4OULA 3PUQA 4AR2A 3S30A 4H33A 4ZS3A 2HVKC 2QE7G 2YXYA 2G9ZA 1N33B 2WAMA 4IYHA 4Y20B 1FJGB 3HB3B 1VBB3 1CONA 2ZTNA 1SQ4A 4OMDA 5BUVA 1YSCA 1AR72 4LF7B 1NA1A 4NXNO 1ZA4A 1BZWA 1AVBA 1IS6A 5LBQA 1DLCA 3OPWA 2CTRA 2WS91 1FD9A 5JCOC 1CAVB 2CGNA 1F5JA 5F6LB 4JGYA 4JF3A 1AVMA 1FXKC 2WQ8A 4N9HA 1VE0A 4QGLA 4JKKA 4CXXA 2VTFA 1K5QA 3IPVB 3IDEA 4D6QA 3WP5A 4AHXA 2RMKB 3OT7A 1U96A 3E8FA 2WL1A 2P22C 2LGWA 5L7OC 2EXIA 2OPKA 4P14A 2Y8KA 4LPLA 1VBB2 4PF5A 4YM3A 2UUAB 3JAMN 2EZPA 1DFQA 2D6PA 4BAYA 4IGOA 4CCOA 3ZN1A 1EUTA 4UV9A 3I3QA 3U10A 3RZGA 2BNOA 2W2IA 3PVNA 4MUVA 1W2BU 2CK3G 4QE7A 1DBNA 4JRAA 3USSA 2J42A 3FBMA 2UUBO 4JI2O 5FCCA 2Y60A 3MLLA 1JMKC 3CWBH 3MEPA 3B2EE 2WO3A 5FXZA 4XE9A 4LBOA 5CA0B 1K8AW 2YBKA 4XAAA 2XAFA 3CL1A 4LE4A 1LKNA 3LEIA 2D6LX 5FYUA 1GQHA 1SFNA 2GP5A 3UNPA 1NAEA 1UMIA 3OTFA 3NJXA 1IXMA 4DR6O 1W8ZA 1KFUL 2JEXA 2JDUA 2ARHA 1N3PA 3D5OA 5JZGC 4YHHB 3MLJA 2DYRC 1TVGA 5A3LA 4MGYE 1FYJA 5FMBA 4A41A 4CCNA 2J1SA 3C3SA 1BHGA 1US3A 1N36O 2R32A 2VUJA 5CZKA 3PUHA 1QR9A 5FY4A 5F39A 1F8VA 3ZMZA 3ZHRA 4UCOA 4Y5SA 4YYOA 4LF8B 3A0NA 5LXTA 3NJZA 1FPOA 1PK6A 2R9IA 3K51A 2WA4A 4QPGA 3UT5A 1AHSA 5CAZA 1AILA 1HNXO 2WO2A 3PL0A 3M3IA 1JX9A 1IDSA 5BZBA 1DK1A 2R9RB 3ZCCA 4Q4X2 2YUEA 4Y4RA 2GTSA 5I8TA 1BEV3 1K3IA 2WINB 3K2OA 3WOGA 1WZXA 3USUB 3CHXA 2RDQA 5IVYA 3PURA 1I0HA 1NY71 4QGPA 2YS8A 1N32O 4GJZA 5B66Z 1HKDA 2B45X 4DV4O 2PHTA 4LORA 4FFKA 1GM8A 4MTFA 3RYIA 3BA8A 4M0HA 2QWRB 1QY4A 1BVP1 2PLV1 3QVNA 3CCVV 2BOBC 2W0FC 1CQ9A 3OYWB 1W0PA 3VBOA 4I0AA 4RAIA 2WZPP 2Y64A 3LDRA 5FJHA 3SGIA 3LFIA 3AFGA 4URAA 4GWIA 2BGOA 1BEV2 5IWFA 1OD5A 3DKWA 1U5YA 2VPVA 3VB9A 4QB2A 4DR5O 2WUHA 1X36A 2FB5A 3H3UA 2GC0A 2ZXWC 3O1RA 1AR81 4LO6B 3TEXA 4CUCA 5FP8A 4M3CE 4ZHNA 3KV4A 4S2HA 5F3GA 2WNVC 4CCKA 4QKFA 4DRRA 1K92A 2OTLV 2PHUA 1NG0A 3SEEA 2XR4A 2ZMKA 2XDVA 2YFZA 2QWQB 2GALA 4RL7A 1XU2A 3F2ZA 2X0LA 2VW0A 2Q8OA 4XBLA 1ND2C 5LK7B 3I97A 4UFLA 2WA3A 2QQWA 1LOEA 2P06A 4LCUC 4DV0B 3JD71 4I09A 3NNJA 1COV1 4MXWA 4MVZA 2VNOA 5FZCA 4GCZA 1SF9A 3Q8CA 5JMCA 3HKCB 3ZMTA 1FJGO 3LPFA 3TNQA 2ZZJA 2R071 4XETA 1V70A 1NA1C 4AFCA 4KGGA 4E4DX 4MS2A 1Q8QA 3W58A 2RJ2A 2F43G 3VDDB 2I2SA 3WNNA 4H14A 4PJ0Z 1S1AA 3G80A 3E89A 3LA7A 3PVBB 3O1TA 1Q6HA 1OVSA 4EZ4A 4NPMA 4H55A 2YHJA 3GJBA 3MF9A 4XFAA 5C33A 4QAWA 4I3PA 4B4QA 5BNPA 3VZMA 2GN7A 1ZM1A 2W0XA 1IBMO 4CS3A 1ACCA 3MI8A 4DZGA 4LBKA 3O0XA 1OV9A 3DEMA 3WW2A 4AI9A 3L71H 4Q4W2 3I2FA 2IU0A 2ID4A 4O4IB 3B01A 2OCCB 5KMGB 4JQTA 1AR61 3AZYA 2VXJA 2AH2A 4FK5C 2F4PA 3P5BA 3U78A 1NCRA 3EXUA 4ISQA 5C9AB 2JGDA 1AR5A 3PUSA 5JR7B 4HZFA 2SBAA 3VBRA 4JYAB 4TUYA 1XQNA 5IWAO 5DZEA 1RB8G 3HKDA 2H6BA 1D4M3 1STMA 3S5QA 2W6JG 5CU1A 2VTXA 3Q8AA 4DV6B 2OS2A 3ZXKA 5JVDB 5JH7A 4COUA 2QKDA 4OI4A 4RFRB 5CISA 1GAXA 4QB1A 1W06A 2JGUA 3LSDA 2WLJA 1HV1A 2IFRA 3POBA 4Q0QA 5IFTA 3U4XA 3HBZA 1IS5A 1VR3A 2E5LB 1I08A 1VBC3 4P9JA 1W9TA 4IW3A 3JD73 3SR2C 1MR5A 3K46A 2A73B 2ZGUA 4UWDA 1D4M2 3T1HB 1W8NA 4QHZA 5F3CA 2LP7A 4TOIA 2WBKA 3ZVXA 4QPGC 4AYUA 1F5FA 1VMJA 3KHCA 3OUJA 5L3BA 1FV3A 1GANA 2O8QA 4LBQD 4QHOA 2PYLA 3OGIB 2AEYA 2EVXA 1H2KA 2EULA 1PNLA 3RI8A 2LFSA 3PU3A 2HKXA 4DXWA 4NRQA 1VBC2 1KXGA 4X1KA 3WR0A 5DUVA 1C8NA 4PQQA 3AG1B 1PM9A 2LALA 3JD72 1QU7A 3KF5A 4QKBA 1X82A 2OXBA 1KITA 2KQXA 1ZBE3 1CX4A 2VVDA 2JDMA 1AJNA 3K3WA 3K0DA 3M70A 2L35A 4XF9A 1HLCA 5CVRA 4QJFB 1AR63 1SQPH 3WV6A 4K0KB 3OE7G 4EQVA 5LW9A 1V6MA 3VBOC 1AR93 4FMTA 3I54A 1JUHA 4XCBA 5IDJA 2WNEA 1XYNA 5LBFA 1W6MA 1PX4A 3N7MA 4O2BB 2Q69A 4AI8A 3R0RA 4JI4O 2W39A 4N43B 3FUQA 1XOYA 3POGA 3U07A 5FY7A 4QX2A 5FY5A 3I2HA 4O61A 1OLMA 1SMVA 2B39A 4IGPA 1GTOA 1ZBE2 2Y6JA 1J3QA 1GN3A 5D5QA 3PVOA 1KDMA 4DV7B 3ZHUA 5CBFA 4P00B 4CVUA 4DR2O 1FT9A 2BOIA 3BN6A 3S7EA 5C3QA 1AR62 4XFCA 3JASA 4PIYA 2VMCA 4OPHA 5IYBO 5FZFA 5KC5A 5CA1B 1LODA 3J7MA 1AR92 1WNSA 5A1LA 1JYNA 4UF0A 1OOPB 4TTGA 4I7ZB 3L73H 5JSRA 4AHYA 4CEWB 3QTCA 1UU5A 1UIKA 3NV1A 1PVC2 3CSXA 5FMCA 3I5DA 5KHJA 1US2A 4MTOA 2WLLB 4DV0O 2PQSA 4NE9A 5JPNB 4CRQA 1U0AA 1XNAA 4FT8A 3TEZA 4YRDA 3AZVA 4JZGA 3CNAA 4XIKA 4LBJA 1D0GA 3ZXAC 5M0TA 3CYOA 2HEWF 3VQWA 2ORZA 1Y74B 1UY3A 3FLTA 4IT5A 5FZDA 3CC7V 2GN3A 1AYN1 5A7WA 5LHHA 1MACA 4YGDA 4NPLA 4HKLA 4CU7A 5IE9A 4O2AB 1HB1A 4DMIA 3SJAC 3RN4A 3CE2A 5CFCB 2GNBA 3ABLC 1GV9A 1LGNA 3WNOA 1C3HA 4L99A 5BNPC 3ZR5A 1MZ5A 4H7LA 4X64B 3LE0A 3MO4A 1E5IA 3D0SA 3O1MA 5GONB 2JG8B 1Y6XA 3F5TA 1WBFA 5FZ6A 1TNRA 1N34B 3HKBA 1MEC1 2HWE2 4CP9B 4DOUA 3NVCA 2EA7A 4ES8A 3LA2A 2IXIA 3QACA 5E6HA 2ZHKA 1R1A2 5B3SC 3MPBA 4IV1B 2H8PC 1O9GA 1FNZA 1NCRC 1VRH3 4NRPA 5G05L 1RGSA 2IZWA 2JDIG 3VBRC 2ARXA 5FPXA 4FLUA 1K7DA 4ASLA 2DF7A 5LA6A 2A1XA 4YFZA 3AYCA 3BVOA 3OEAA 3W7WA 3APQA 3AK1A 3ST7A 1K34A 1Q6UA 1RUH1 5IUQA 2Q8EA 4OQ8A 3K57A 4DV6O 1F4MA 1KECA 3VHOA 2VOKA 4QKNA 5A6QA 1QVFU 1K45A 5D21A 5JXJA 5T3NA 2OZJA 3MD0A 1AI4A 3PVEA 1QLNA 2CY6A 1WJZA 1VMGA 3RNSA 1UYXA 3WDUA 3C3TA 5KHKA 1VBA1 5F32A 1ZAUA 1K5SA 3CCLV 4DEVA 2WZEA 2OIEA 4FP2A 1VRH2 1BSMA 1W0OA 2YC2A 2X5IA 4YZ2A 1C8M1 2VTXJ 4O9GA 1KQRA 2D3SA 3ZYIB 3DXUA 2XHNA 3B9IA 3QD6A 2GC2A 2AREA 1YC61 4DB5A 3K06A 3IAQA 3T1HO 4LIUA 4K6BA 1MS9A 4AHZA 4JI7B 1QJX2 4CS4A 2RDCA 1VQ8V 1W6PA 1NX9A 1AYN3 5K7PA 1AI5A 3JD2A 1KRIA 3KLSA 2DWEC 1XC6A 1R64A 4PI0A 1DDLA 5IYYA 3OMNB 2ZJCA 1SDDB 1UXXX 2V1DA 1Q81W 3SHRA 5BNNA 4DUVA 1XMQB 1GP6A 2ZGNA 2AUYA 2DVGA 2F4VB 1QJY1 3HEIA 4UCSA 1W8HA 3A0BZ 1K33A 3N9LA 4R52A 1R6NA 2O57A 2LW1A 3T2TA 2Q7EA 2EINC 1ENQA 4IEQA 3FUOA 3EVKA 5JIAA 4JZRA 3OSDA 4BPZA 1HR0B 4AEMA 2D3RA 3LDEA 3LGRA 2ZKLA 4IEVA 5EK0A 3ZN6A 1PMJX 1J59A 1GSLA 4ZZ8A 3SISA 3ZIXA 5JLVA 3I2OA 3MPPG 5C8CB 2VOXA 3OMAB 2E9QA 1QOTA 3ATGA 5KXDA 4WFHA 4LWSB 5FZAA 4QX3A 3RYCA 2V73A 3CCSV 1TQ5A 2DCKA 1DIWA 3O1VA 1AXYA 3UQ8A 1QWRA 2BW8A 3CIHA 4PDMA 4ONUA 1W9SA 3KCYA 1O8SA 1KUQA 1VBA3 4ORFA 1ULPA 1WW6A 3UV9A 3WQ1A 2Q73A 4R50A 4DV2B 3H50A 1WB7A 1NZCA 1KBHA 4NROA 1YITV 4A6SA 1C8M3 2ZAAA 3KV5A 4BXSV 5LK5A 2CH7A 3VD9A 2IM9A 4QQLA 1GRJA 3VBHC 2Q1FA 3B7MA 4YVSA 4CSWA 4LFAO 1IHMA 4MXVA 4RS5B 4DEQA 1U5XA 3ZMUA 1RM1B 2J22A 1QNYA 5FPLA 2ZGSA 1AL22 1MS0A 3URFA 5DAXA 2BYVE 3UESA 2RDRA 1H6XA 3I59A 2FDKA 1L7QA 3FB5C 1CIYA 4BB3A 1S0FA 4X9QA 4Z82A 2W52A 4CEYA 1RYYA 1UF2C 3MIFA 1OHFA 1VBA2 4YXWG 2VMGA 1GZTA 3ZKUA 4FPGA 1UXZA 4ZKTB 3OMIB 1QJY3 1C8M2 1MZ6A 2JDZA 4JGZA 1O3RA 3MFCA 2XBO1 1Q56A 4U36A 4LBQB 2RS13 2VGDA 4LO5B 3JAWB 4CH6A 3J7HA 5F5QA 3OBRA 2I45A 4UB8Z 1JJ2U 1BK1A 4KQ7A 1V9PA 3QO5A 1HWYA 4C90A 4X64O 1SQVH 3FKSG 1I7FA 4JTCB 1R1ZA 4IETA 5FZLA 3OY8B 3JBG1 4DR7B 4QKDA 2IXHA 2WSVA 3JSLA 1YIPA 2PELA 4LR3A 1SZTA 3KZ4C 3B4SA 3ZMOA 5K8SA 2WNUA 4P9LA 3WG1A 1BZKA 3IFXA 4I3GA 1QJY2 2PHXA 3AG3C 4YW3A 1BMV1 3ZN4A 1OZ0A 4R7CA 1J5EO 5JWPA 2ZKNA 4CYDA 1J1TA 1HN1A 1YYNA 3DPRA 4DUXA 5D8AB 2VCBA 1RUI1 4U3FH 2RS12 5CBLA 1SKVA 4NIIA 4DV1B 4X62B 4R9BA 2LQTA 4RHV1 4K8FA 3AL6A 2MK3A 2XPJA 3HQUA 4DY3A 2KG7A 5L3GA 5ITZB 4O4LB 2Q7HA 4PDVA 5FV3A 4FI9A 1YQCA 2XASA 4TXWA 1PV0A 2R49A 2EIBA 1SETA 3ZR6A 3ES1A 1AL0G 3BIWE 4LO8A 1JH5A 4Q0VA 1H9PA 4LFCO 1IPKA 5EC1C 2GSYA 1OPMA 3WB2A 1ODMA 1W3XA 4BIUA 3QO8A 3J81N 2Y6KA 4EB6B 1YQ6A 4JI6B 5F7UA 1H2GA 5CBHA 4ITCA 5E1RA 3ASOC 5EZYB 5IYZB 3SPHA 1GOFA 1RHI3 5DABA 4GX2A 2ZE6A 4J80A 3LSEA 2E7AA 1PZ9A 1W9YA 2R041 4RA0A 1IBLB 2NZ9A 5IJ0B 4LNUB 5E8AA 4ZU4A 4JKLA 3CRQA 1GNYA 4JKMA 4A45A 5BNNC 4W6WA 3ILRA 4PF1A 4UCVA 1VIBA 2L6LA 1Y9QA 1ZA7A 1AF9A 1KDKA 3NW4A 1GOGA 4NTXA 1XSRA 3AKQA 3SPIA 2JIJA 1WBLA 5IATA 3JBG3 3JZVA 4LO7A 2F1MA 5FK8A 2A3XA 4ZKIA 1BL8A 5ISLA 4LK7A 1RHI2 4YGCA 1MS5A 3WF3A 5BXZA 4BK4A 4BW9A 3GBFA 4IE0A 1JOBA 1VQLV 5LY1A 4PDRA 4R4XA 3OEBA 3ABUA 1S2KA 4TSFG 1H30A 1GNZA 3H3LA 1KU9A 2RS53 4DR4B 4RHV3 3HJRA 3GBWA 4MZUA 3QCWA 4C7UA 2FZ1A 1LGCA 4NYKA 3BKZA 1PD3A 3Q4HA 2XH6A 5FYHA 2LW7A 1VQ6V 1F7YA 2PAKA 3BYWA 3ZRWA 4G4FA 4I30A 3VN4A 1CWPA 3D6EA 3AG2B 5L3DA 3KMHA 1IKQA 1MS3A 2P2KA 2E31A 4P9WA 4LTAA 3WG7C 1MQTA 3PMEA 1VB2A 4CCEA 2HJDA 1RUG3 5IY5C 4DV2O 4Z2AA 2BWAA 3CRRA 5CG9A 2XKPA 1SPPA 1SBEA 4P9OA 4YVSC 4XF1A 3M3EA 5BNOB 4OUMA 3U4SA 3ZFEA 2RS52 4UOJA 2Y0OA 4RHV2 1BJQA 1N1SA 4OQ9A 1OBNA 4E27A 3U14A 2IH3C 5IK4A 1GM9A 2IWGB 1A32A 5FBJA 4ISRA 1JTZX 2W5FA 2DUOA 3TGUH 2A5ZA 4CEYC 4UB6Z 4KFMA 4EN0A 4JTOA 1KEXA 1IG0A 2RJKA 4FP3A 3E5XA 4Q1RA 4XFIA 3E6CC 5FZEA 4ASKA 2R16A 1A8DA 4INDA 4FPFA 4I0XA 1RUG2 1GM7A 4XCAA 3RYRA 4JGZC 1FMD1 3PJQA 2W47A 5FZIA 5H6QA 5FO7B 2TUNA 3WB0A 3UT0A 3CCEV 3H8RA 2VWJA 4Q1PA 3W5MA 3LIGA 1OCRC 2ZNJA 2G9FA 4YIPA 2QQKA 1CPNA 1NKGA 5LGNA 4BU2A 5L9BA 5CBGA 2K2SA 5K0UA 1W8TA 3SMHA 3POEA 2BTQA 4LKEA 2VS0A 1UOJA 4YJ2B 1J83A 1XMOO 1Y76B 4RYDA 4B1MA 2E6VA 4BK5A 3CMAV 5KXCA 2ZDIA 3OUIA 2EIMC 2JENA 3EXAA 3WB1A 4HT1T 3WT3A 3BB6A 3KV6A 1XPWA 4DR7O 3FHQA 2VUCA 2ZQMA 4BQ1A 4ABMA 5KC6A 4LKDA 3ORJA 2ZGLA 1NT0A 1B3QA 4K9SA 3N35A 2WNUC 2Q68A 2HLDG 3BODA 1JFFA 3O1UA 2D6OX 1BGYH 1NU1H 3M7MX 2VQAA 2ZGOA 1PL4A 3DPRC 1NR1A 1B06A 3A0RA 4RWUA 4FBFA 2Y6GA 2IXLA 2A70A 2EILB 4GKKB 1JN2P 3A23A 4F83A 3SH3A 2GU9A 1ZSPA 1LESA 4KMQA 1H2SB 4DQAA 4AGRA 3J26N 3E6DA 1K42A 5KX5A 4E9KA 1DQ5A 2VR4A 2VQEO 3IM0A 2GZWA 1M4UA 4H2AA 3ZKYA 2ZHMA 4ZIBA 2LTNA 3CD6V 4GJYA 3LAGA 4U3JA 1WCUA 5EIYB 4K21A 4XEZA 4DY5A 2DTWA 3J9SA 4CH5A 2OUHA 5CYYA 4XDPA 4CDXB 1JW6A 1Z7S1 5FZMA 1JS9A 4XFFA 1XDCA 2ILMA 1YNAA 5FZ3A 2WLPA 2VZ3A 1LR5A 3JD4A 3OPTA 3ZYPA 2ZEYA 2DOSA 2XG3A 1FMD3 2JKBA 4UV8A 3F7YC 4JI1B 2QE3A 4ZHQB 3NAPB 1BCCH 4HPKB 3G67A 2HYXA 1TGOA 2CNAA 2W92A 1X59A 4W50A 3SJBC 2DWDC 1SHWB 3ZRVA 3EHBB 1BHAA 1OCCB 3FYEB 4FVMA 5JOYA 3BOPA 4CP2A 4LHNA 5C3RA 1RSOA 3NKGA 5A32A 4LF4O 2GUZA 1SLAA 1W90A 5IVCA 1YFWA 4JGSA 4UW3A 2ZHNA 1NQJA 1XNBA 4EFBA 4CCLA 2RCVA 1A78A 3HR9A 1IKPA 1DQ6A 4QGMA 2WDBA 1FXZA 4D94A 2FCTA 4XF3A 3I2JA 4R6ZA 1EV11 1DQ4A 3DYOA 2J1RA 4DR4O 3TN93 4FOQA 3VL8A 1W05A 3I8TA 3AMQA 1BE3H 2P6HA 3DTUB 2ZIMA 3PIJA 5CB7A 4JTAB 4RO2A 5LMNO 5A3TA 1DQ0A 1QLEC 4Y5TA 4N53A 2GNDA 3BEHA 2EJ7A 1MQTC 5HCFA 2EIDA 1JOYA 2ZKOA 1OF4A 2CGPA 1VBE1 4EROA 3EHKA 1VAKA 1ZBA3 2BCCH 1W59A 4AQSA 1BXHA 3VKFC 4QXBA 3LWCA 3ZFEC 4AHWA 1WB8A 5FLJA 2JIZG 3TN92 4J1XA 4J41A 3F5WC 4HAMA 1HP8A 3WF0A 4X88A 2ZEZA 3OYWA 1WCQA 1TAEA 5A7PA 3I55V 2CSGA 3BVCA 1JI6A 1XNKA 2JG9C 5FP7A 1YRZA 4Z07A 2BGPA 5KHHA 3K48A 2R061 3CS5A 3JUUA 4E4SA 4ATEA 1FOD1 1GO3F 1ZBA2 1CZTA 4TV9B 3ZLIA 3L72H 4LFBB 3EMRA 5EFUA 1QJZA 2PHFA 1KMIZ 3SCHA 4QU2A 5K0UC 1DQ1A 4B08A 5FQ0B 1NLRA 1UYYA 3OTOO 2JK5C 3WINE 5AFBA 2FL4A 4HN0A 1W6QB 3LZZA 4N9IA 3AXDA 4JI8B 1QGLA 2DCZA 4FLXA 1Y66A 1B09A 3R05A 2A9HA 3SITA 1VAVA 3WP3A 2EIEA 2N05A 5H2FZ 4P5YA 3AMPA 1S2EA 4AVVA 2YIBD 1V55C 3BGAA 2UXDB 5GW7A 3N2KB 4QPIB 2O14A 1QH6A 3TAYA 3ILNA 4EJRA 1JU4A 1NTKH 3HKCA 3ZFGC 2XUEA 4FLVA 3WD5A 4GKKO 1YXWA 1W0JG 1Y67A 3MGUA 4RGGA 2Z5WA 3HWJA 3H1HH 4PA6A 2X53S 4YY3B 4LF9B 3OEHG 1HXS1 1VBE3 5A6XA 3MF6A 1KKCA 5ABJB 1LJ7A 5H9QA 3O1OA 4NJ4A 2DU0A 4D3WA 1FV2A 3KG2A 3WF4A 1NQTA 2JDNA 3AP6A 2FDHA 2C9KA 4PA3A 3WHUA 2BZDA 5FPOA 4ZU5A 3ABKB 3H7JA 2ZE5A 1W0NA 1LHWA 2UXBB 5FWEA 4YZ5A 5GLUA 4QQHA 4Q26A 3MIGA 3RT3C 3OR7C 5KMGA 2V4VA 3IN9A 1G9CA 2NPIA 4B3SO 1REDA 3M1HA 1K4CC 3AG4B 4LR4A 4B4RA 3JATB 3BHPA 4CPBA 3VKNA 2Q8DA 4G2KA 4ES9A 3OGGA 4MVRA 4XQ4A 1HN0A 3WX5A 4ZONA 3FL7A 4I01A 2BUKA 1RPRA 1AZDA 5FZKA 3SLIA 4DO2A 1PO23 3WNPA 4B3RB 1DTOA 2OYZA 2WJSA 4QMAA 3OB8A 4AVCA 4MGKE 3P1IA 3VQVA 4G9SB 1SBFA 1SZBA 2W91A 4LQRA 2P6CA 2JIGA 2J1EA 1CP9A 2VRZA 5FR3A 4IV3A 5LP6A 5B1BC 3DKQA 2WNOA 2RN9A 1X7NA 4COVA 4MH0E 1I94O 3VBUA 1QQCA 4DV3O 4D8MA 4DINB 1DG6A 4BQ4A 4FCAA 1ZREA 4AQTA 1RMU3 2OVUA 5GZGA 4FM0A 4FZ1A 1AX2A 4EEQA 3ETEA 1NCQB 1OLQA 2HWB1 1PO22 2QR4A 1PVXA 1HXS3 4B3TB 2A06H 5T50A 2VW2A 1AB3A 5I8SA 5F37A 2VQ0A 3N9QA 1VF5B 5IK7A 3HPNA 4N53C 4AQ6A 1XE0A 1VMFA 2YY1A 3IMMA 1IQAA 2BPA2 1O59A 2CAVA 3CZJA 1H1MA 3ZXGA 1HRI2 4LOTA 2Q8VA 4WFAV 5K4LA 3UGGA 1LULA 4CA9A 3I49A 2Y69C 3G6BA 3AZZA 1GUIA 4IIJA 3M3CA 3K0GA 1PGL2 5AVPA 1EUUA 3S6PA 4F8AA 3OAAG 1MPXA 1RMU2 4O7XA 2B9UA 3IB3A 3ZXEA 2A6VA 2ZMNA 5FZ8A 3W5NA 4GB31 5A70A 4DRXB 3RVZA 1HXS2 4YLZA 1FXKB 4BWAA 4O4HB 4AL9A 3N7LA 2NMOA 3L70H 5FKBA 2ODMA 4DR1B 4EV0A 1GK9A 5BMVA 1EBOA 4IHJA 2HEVF 4O2BA 1UKGA 2PTMA 3VZLA 3SJQC 2IXKA 5L7OB 2HHHO 3FWEA 2D98A 4N43A 2MEV3 2O0OA 2YEVB 3WFVA 4XBFA 3CJXA 2MHFA 2XMLA 3S0MA 2CAZC 4PLMA 4OYUA 4EN9B 2BBAA 2EIJC 1SS3A 2FCUA 2A7WA 1W99A 4JYYA 1PZ7A 2DE0X 5AG2A 4MVUA 4B1LA 5IK8A 5LGTA 1ND3A 4P9IA 3EFFK 3IDAA 1WGPA 4QQOA 5CA1A 5CG8A 1YJKA 3A2FA 1JA8A 5KAFZ 3FHIB 1BHBA 3VHNA 4EZHA 4CEWA 4ZZ5A 1KKDA 5CMUA 1V00A 4NRMA 3SCFA 1M9NA 4GZ9A 2XGXA 2XAHA 2XLFA 4WM7A 1S2BA 1U97A 4G28B 4Y1YA 3MIHA 2RM21 3ETPA 4W6XA 3IGAC 2MEV2 3O0WA 1SA0B 5CKMA 3LUTB 1GZCA 2HWB3 2QTSA 4HVQA 5JUVA 4ZBMA 5FYTA 3E2EA 1XHXA 4FLZA 4X6QB 4NHLA 2VH9A 5JZGB 3IDCB 4X1IB 1H8TA 2OKXA 1Y74A 5LRSA 2DYRB 5F8PA 3ABMC 3TXQA 5FP3A 3B5LB 4YY3O 4MV2A 5APAA 4O2AA 1SQFA 1LGBA 2IVJA 1RUF3 3AZXA 1HJGA 3ROUA 3RJRA 4PDWC 2VBPA 2Q4SA 5J2UA 2Y26A 2A0LA 3RGBA 2DQ0A 3DN7A 2HWB2 1E1QG 1EY2A 3M3QA 2X05A 3LF7A 5JQGB 3FFQA 2ET1A 3FMGA 4NHKA 1PP9H 4HSJA 2OWOA 1Q8VA 2ZXQA 4FOWA 4NWWA 4QB6A 1R73A 1RJ8A 4KG8A 4GX5A 1YQ8A 1QIQA 1RUF2 2WO1A 4C8DA 2VD7A 1WW7A 2DJVA 2PXJA 3T08A 1XRUA 5K9YA 1P8JA 2XQXA 3HIFA 1VB4A 2A71A 4FAHA 3HPLC 3WF1A 5C3SA 1NZ6A 4QT6A 2P5OA 1JBCA 2XKOA 4Q8KA 3KVAA 3IJ4A 3PDQA 4NIDA 4IV3C 5LP6C 5HV4A 2ZXWB 3W9AA 4KHPO 4I4TB 2RM23 2RR11 4WVVA 3VGIA 4PCRA 1WPBA 5SV8A 5LRRA 2WNVB 2Y0IA 3H1IH 4O4JB 2R30A 3VBUC 1YQ2A 3QF7A 4PD4F 1TME1 4EYUA 4UCTA 4PIZA 1PIV3 2ZHLA 3HOBA 2Q4PA 3O1PA 4GWJA 5CADA 1GN4A 4HNAB 1POQA 1ULCA 3RRDA 4MYEA 2YG0A 2A7AA 1QJU1 1H8EG 4B3TO 5EJ3A 3E35A 1FXVA 1D7PM 5LA0A 1ND2B 5DN2A 3JALB 3K79A 2PAEA 1CJDA 2ZM6O 1YI2V 2NQYA 2HLEA 2D2CB 4Q20A 3CC4V 4CUBA 3AG1C 2VUDA 2ET7A 1C1LA 1DYKA 5EBMC 4C91A 4KU8A 1NA1B 1RUC3 3NMBA 4HBNA 2KXLA 5DDJ1 3R66A 4AK3A 1FS0G 3GXUA 3OEEG 1KD7A 5LWBA 2NNUA 1PIV2 5B1AC 1JU3A 1P7BA 4IEWA 5I8YA 2ZMLA 1D5AA 3HN1A 4BMBA 5KLVH 1UOBA 4IEPA 2RS33 2ZT9B 4HZ3A 4K3UA 1RUE1 5F6KA 1H8HG 5FXVA 4TWKA 5IHRA 3IWZA 4NXNB 2DCTA 4LWSA 4PJYA 1DF0A 2XONA 2UY8A 3OGVA 3I56V 1X4TA 4LITA 4YM1A 3OW2U 1XUQA 2HBTA 5FZ1A 5H9RA 1AP5A 1RUC2 1RUJ1 3LSQA 4XJ9A 2KM2A 3QOPA 4C0HA 4YW4A 2J1UA 1URFA 2PA7A 3ZHQA 5FFOC 1QU0A 3HT1A 4EE2A 1ND3C 4LO4B 3HD8B 1VPHA 2PI4A 4L8QA 3L9JT 2RS32 3WNMA 2DVFA 3FBYA 2DBIA 2HEYF 4NHMA 2WN2A 4CEWC 1CX1A 3ZMSA 1PM4A 1TME3 4BWOA 4RS5A 1NTMH 4WM7C 1IG3A 4X20A 3UGFA 1HJFA 4QXCA 3AK0A 3GCWA 4LA3A 4OHXA 3MUY1 4LEJA 3VD3A 3GGLA 1X33A 4YG6A 4B3MB 3HQXA 1CIWA 1JYVA 3V65A 4CCCA 5FYBA 3ZIWA 4AG4A 4GKXA 3UO2A 3UM7A 1H8TC 4WM8A 2GHYA 2UUBB 4R9AA 1UO9A 4JI2B 4YVWA 4K40A 1UCXA 1FI2A 1Y3TA 4E2LA 2BQPA 2PZSA 4NTYA 1X8EA 2PHWA 4AI3A 4BH9A 1AYM1 2ETNA 4KL1A 2XOKG 4QPGB 3T2QA 3UT5B 4DR6B 1AJOA 3LEGA 2VVFA 4FAGA 2VE1A 1VQKV 4SBVA 2CAUA 3GM8A 1QOSA 5KHIA 1WLCA 3N9OA 3GWKC 3KSCA 3RWKX 5H9PA 4FFHA 2DW4A 3E97A 3OY8A 4WZFA 4C0BA 3VD7A 3M3OA 3WDTA 5KBFA 2VG9A 3Q8BA 1HRV1 1M5IA 2OQ6A 1JZ6A 1KYOF 4XXPA 3RSJA 2WR9A 1RVF3 1BCXA 4MG2A 1JMUB 1FYUA 1RUNA 4QHBA 2RHPA 4PBPA 2N7GA 3WG3A 1QDCA 1F4HA 1N1TA 2VZVA 1GWMA 2W1SA 5D8AA 2DU1A 4QXHA 4LLOA 5I0UA 1SCSA 4TWTA 1RUJ3 4Q4V3 3VUOA 1ULDA 1QF3A 3PJSK 2D5FA 4X6RB 1LR1A 1OA3A 3QNEA 4O4LA 1K5MC 3VBOB 4QPWA 4CS2A 2VQFB 2W68A 4HN1A 3OCPA 1RUOA 4DV4B 4Y33A 1OQEA 4RD7A 5AFEA 2BJSA 3E8BA 3NNMA 3VD5A 3NV4A 1I6XA 4XJZA 2OZ6A 5A3MA 2HG5C 4CDUA 1RVF2 2Y4TA 2HVJC 3DECA 4Q29A 4EB6A 4IYIA 3PTRB 4AVSA 1KS5A 2PGGA 4GLXA 4ZXEA 5B5EZ 5GZEA 2JD9A 3CMEV 1RUJ2 4Q4V2 1K9MW 2WO7A 3L2YA 1URXA 5IYZA 1PGW2 3AMNA 3OUSA 3TWIA 3JARB 1R6TA 3MUZ1 3MIDA 1UZYA 3S57A 2IJHA 2AR6A 2ZNIA 1V6IA 4DR5B 5BY1A 4Q0UA 3B02A 2GMMA 4GMP1 4ICGA 5IJ0A 1D0HA 3RVHA 3HN3A 2VZ1A 2FDFA 1XILA 4A3ZA 1UU4A 1UYZA 3W59A 3EBRA 3JXSA 4MXWB 1V0AA 2Y6LA 3NR7A 1YHQV 3C7OA 1CAWA 3WDVA 5IYCO 2GSMB 2C4XA 5FOJB 3MIBA 1MSDA 1X9PA 1UX7A 1IBKB 4KXRA 1HRV3 4Y1XA 5FBZA 4AI1A 3POIA 1IXBA 5JSPA 5FUNA 5LOVA 2CGOA 4D7SA 1WMXA 3ZSJA 2NLJC 3ABLB 3HQRA 4MGTA 3WG2A 3GCXA 1N4CA 1CAXB 5DG2A 3QLQA 2IXJA 5BNPB 1CN1A 4K3AA 4Y1VA 1VQNV 1JZ7A 3RMXA 5BR8O 5IT6A 2JDAA 4GH4B 3FB7C 1QQP3 1N1VA 4Z8BA 2Q7GA 1HQLA 2YYOA 4M3CF 1T6GC 5B3SB 3E83A 4B3NA 3B69A 1YEWA 1HRV2 1NCRB 2OPWA 4BDVB 1RUD1 5F9TA 5LYJA 2JDKA 2Y34A 1V9U1 3UKMA 1CEZA 1IBMB 3VBRB 5KWRA 4HVRA 4TUYB 1EAH1 1UMHA 2CWSA 4M4RA 1ZL8A 1S0DA 4DUZB 1XYPA 3T3YA 4XTPA 3HKDB 2BOJA 2A3QA 4QPJA 5JDBA 1NTZH 1F4NA 3LQCA 3TETA 2A6XA 1IVSA 4KWJA 3ML0A 3DC6A 4RS5C 3CDZB 5J37A 1N47A 3DXRA 5JH7B 3GJAA 4GD4A 3VZKA 1J84A 3GHMA 2YIAA 2QNKA 3ZYJB 1QQP2 3C7GA 5DAPA 1SZXA 2P7TC 3GALA 3N27A 2R72A 3AKRA 5T5JA 5IWAB 2OT7A 5FO8B 4B3MO 4I02A 3T0BA 1M57C 4AVTA 4J9ZB 4WM8C 5FZBA 5F5AA 2KKWA 2P34A 4YVWC 3ES4A 4HK8A 1Q90D 3TB0A 2WFF1 4O9EA 3ZFFA 3WNLA 4Q27A 1MZFA 5DM6V 1Y4WA 5J36A 2ATFA 3CCMV 1TZOA 1QXRA 3HKEB 4PBOA 2XL9A 4NXMB 4LBNA 3AP5A 1UU6A 4JYBA 4L2NA 4WFFA 1OUXA 3K4ZA 4I55A 5A3UA 3HBKA 1PX3A 2GNMA 2HH9A 3E8HA 2VJXA 5EXOA 1LOFA 4LC1A 5L3EA 4GA9A 3K4DA 2XJQA 2RJZA 2UYAA 3CC2V 4IE6A 5HXVA 3U37A 2E7QA 3OF1A 2EXJA 1D2QA 2J1VA 2QZ2A 1U12A 1W0KG 3AG7A 1WAZA 1ZYBA 2ZX4A 1LOBA 2WS93 4W4KA 5D8AC 5KUMA 1B35C 2EINB 3VBSB 2RMU1 4FTBA 4BIZA 1US6A 5K1PA 2RNBA 3BPZA 1YVWA 3C7EA 1X50A 3WDWA 1RUD3 3LOBA 5FPVA 2ADEA 2R1BA 2VQFO 5FLHA 5E1AC 1F23A 2G19A 1W6MB 1DLLA 2X10A 2XQRA 5FY1A 1QBZA 3WDXA 2OQ7A 2Y4UA 4MGIE 4PA7A 3UETA 4CDUC 1UZ0A 3R6SA 1YIJV 2J1AA 5IVEA 1SLTA 2VCMA 2XAQA 5CEHA 2Y6FA 1NH2D 4RN5A 2DUQA 4RQPB 3UKNA 3RYPA 4A5UB 2WS92 3T1LA 4JYCA 3SDLA 3NV3A 3NXSA 2BGCA 3H1MA 3KD4A 3LCPA 1GZWA 3CZUA 3WG4A 3X2QC 1NQDA 1XU1A 1V54C 1RUD2 3V0BA 3ZYGA 1M4WA 1XSQA 4B29A 1W6NA 4JI4B 4UF0B 4WVMA 3VBHB 1JXNA 4AQYO 2FYUH 2YIDA 3LEMA 2P3JA 2IUWA 2ARCA 1OC1A 3AVSA 1RJ7A 1K97A 1EN4A 1S5LZ 3SH5A 1JZ2A 4DR2B 1OT5A 2VVEA 3W7SA 1ZRFA 2HR3A 4FLYA 4FOVA 1VF6C 3J80N 1OPOA 4JHTA 3N7JA 5TSWA 4D7TA 4DFSA 3K08A 1LNQA 1REEA 2YZ4A 3CLPA 5A2QN 1RTVA 2BSKB 3OR6C 2QTWB 1MSWD 3W7XA 5A7NA 5JR2A 1IBKO 1SEFA 5A7WB 3THTA 1QNMA 2GTAA 3A4UA 1E5HA 3O1SA 1I5XA 4XDLA 1J1LA 3GZEA 1ZZ8A 5FUPA 4JC1A 3UJQA 5IVFA 1EZJA 4MVQA 2Y6HA 1FAYA 1YHFA 4D0QA 2RMU3 3IIIA 1RINA 1W2OA 4X1YA 4BQ3A 1WLEA 3K59A 2AEZA 4NKGB 4LJHA 2EAKA 4EWDA 3OJBA 1WA8A 4AE2A 3AMMA 3LDDA 2B7YA 1RPOA 1Q82W 3GNEA 2NLRA 3LOIA 1RP3B 4JGYC 4A7ZA 5JPMB 2D3PA 1UZWA 2G9GA 2YU2A 1WWYA 1DYOA 3WW1A 3K75B 1QR8A 3K5MA 1GBGA 3STZC 2W1UA 4WBNB 2HEPA 2Y33A 5EYXA 3MYXA 2VCCA 3AK2A 2PLV3 2WYSA 5LA6B 5TISZ 3GZUC 4TZDA 1J95A 4DUZO 1S0IA 4ZI7A 4ET7A 5AC91 4N7UA 2TEPA 1D2DA 5CB4A 1JQ0A 3K5LA 3ZYBA 3ZRSA 2VNVA 2W94A 4OHWA 5FPZA 5C4WA 1XQ8A 1ZRCA 2KA3A 4DUWA 4XOGA 5C8YA 1O6UA 3POSA 1L0NH 3H9VA 2A3WA 1NY72 1AR83 3J4UH 2AW9A 5D5PA 4Z92B 5C7GA 4COZA 3K9AA 3ZFFC 2PLV2 1IS4A 3THDA 1CZSA 3BTAA 3DCQA 3VLBB 3ASOB 1U5IA 1GH6A 2ZACA 2YI9A 1W6PB 2OTJV 2FHRA 4Y24A 4NXMO 2A6YA 4J11A 4ZOLB 2WWUA 3S3XA 4GKYA 5IJ9A 4HYOA 1HNZO 1XL4A 3C2UA 3I2DA 3S5AA 4HANA 1COV3 2QFEA 2DVBA 1AR82 3RZKA 2QQUA 4XXAA 1PNKA 4X66O 1Z0HA 5GALA 5LA1A 2E63A 2R073 1NVPD 4F6RA 1YXBA 4OZXA 2P1BA 1PK6C 5EIBD 3N2KA 4QPIA 3K9SA 3N2GA 5JOWA 3MLKA 2QJ1A 2EXKA 2GAUA 1QJFA 4HOOA 3N3HA 4BIOA 4JV4A 4YW6A 1L7RA 1XBLA 1W6OB 1R081 2JD4A 4QD2A 3ZM8A 5LHIA 1XE7A 4L11A 1VBD1 1UY4A 3DGEA 1R091 2OUJA 4DXSA 2XLGA 1BQ0A 4BLJA 1COV2 1RL3A 1TNFA 3I7DA 1GN2A 5C5TA 4MADA 5ABJA 5AC93 2Z2SB 2C24A 3B8MA 3PJYA 1AX1A 3OGCC 2BV4A 2R072 3VKLA 1AI6A 5HBAA 3N9PA 2R70A 1BT8A 4J9YB 4LIVA 2WWJA 4P08A 3N36A 3WUDA 1YI9A 5FO9B 2NMNA 3NNFA 1MABG 4K8ZA 1DU3D 3WG7B 1UPSA 5L9RA 1NE6A 2YSUB 5AVAA 1ZZCA 2P67A 3VHRA 1OHHG 4QX0A 5IY5B 4AFBA 2GP3A 2JECA 4IEYA 4L8JA 2VOWA 4YVSB 2BDRA 1ZZ9A 4OVEA 5FNVB 1WMEA 2UXCB 4BYYA 3T2PA 2JE7A 3FAVB 2UY9A 5LBCA 5FP4A 4TV8A 3OBAA 4AI0A 4FSJA 1KS4A 3QH7A 4CXWA 3IAPA 4E4EA 4OUEA 1H38A 1SCRA 4NUBA 1OCCC 2UXNA 1L7LA 1NJIW 5FOBB 4CEYB 1UOFA 4AILC 3MHZA 1WW5A 1OF3A 2GMPA 1CZVA 3IMNA 4LFAB 3WZ1A 1NS1A 5KA6A 2QQNA 5T5LA 4LUKA 1IOAA 5JOXA 1VALA 5DQ0A 2Y38A 3W7TA 4AFDA 4WV8A 3KKYA 2QVSB 1O7FA 4XBQA 3H7YA 3JAKA 4P5HA 3WNKA 4JGZB 4Q4Y1 4XUTA 1CXZB 4Y26A 2ARAA 3HVDA 5T5OA 3VZJA 1RIRA 1PMHX 3ETDA 2C0ZA 3C7HA 2Z42A 4TLGA 3K5OA 5ACA1 1LUVA 2WLIA 5C93A 3RVYA 2XL7A 2X7RB 3D8CA 1W2AX 2PF4E 3KT4A 2EIMB 2XNDG 1NR7A 1VBD3 4FM2A 1NCQA 1R093 5LEKA 3G6EV 1S0BA 2X8KA 1TUBA 1FFXA 3JYCA 3S7IA 2ZX3A 4NOTA 2WNUB 2XVGA 3ACHA 4YM2A 3LSSA 4MGQA 5EJZB 1DGRA 1MVQA 4JI0O 1AJPA 5H6RA 4UYBA 4ATFA 5LZ6A 3F7VC 3Q8EA 4XTMA 2QSAA 1XOUA 4NMIA 2ZGQA 5GKAC 2CTWA 1SLBA 3SKVA 3L75H 3PUAA 5C4WC 1EZVH 1Y7BA 4RGAA 3HMYA 2HP8A 4YM0A 1NH2B 4L92A 5JCOA 3EYPA 4DRXA 1K73W 1TEIA 2D6KA 5EQUA 1R092 1J5EB 2UU9B 5ERLA 1LRHA 1FXKA 3R4DB 1QXPA 4XZUG 4CUGA 1KJRA 4GULA 3KF3A 4FO9A 2VBDA 1ENXA 1SERA 4ZU7A 4I50A 1E57A 3R4UA 4D7YA 1OA4A 1ZZ7A 2YEVA 4BA6A 1WP7A 1WD3A 4CCJA 3OM3B 1JYIA 1E5SA 3CF6E 5HFMA 4D6RA 2L9LA 4LFCB 2AENA 1YIFA 2DN9A 3J8F1 5E89A 1K5JA 5F2WA 4UVBA 5FLXN 1HNWO 2F93B 2I74A 2ORXA 4Y5Z0 5HCHA 3FX3A 4PLNA 3B00A 4A3XA 4XHXA 1O4TA 3MDPA 2FZ2A 2RE9A 4MHRA 2VXRA 1UN1A 2YBSA 5C5UA 2Y0PA 1SA0A 5JI9A 2HWD1 3LA3A 5FY0A 4GUNA 1F2NA 2EIKC 4AEDA 2LM3A 4YIOA 1AR71 4FQZA 4FIPC 5HV0A 4BQYA 2B1IA 5GJ6A 1MS8A 1REFA 4ASMB 4BHPA 4YJ3B 3CCRV 1VQOV 3C3VA 2H0VA 4TT3G 2QDOA 5GLZA 4AFMA 4X1IA 1F9KA 1OLME 1TUEB 5JCTA 2WPDG 1WCSA 1ORQC 5FIXA 2WIIB 2DURA 5BY5A 5ABJC 5E79Z 2B8MA 1MEC3 1VQ7V 1MS1A 2ADDA 4C1XA 1R1BA 3X29B 3ZMNA 2QGNA 3ME2A 3V0AB 1AXKA 4XHBA 2ZGTA 1M93A 1DGWX 5CA6A 3L2HA 1OCZB 2XJUA 1AYN2 2W1WA 3ABKC 1QLEB 4BQWA 2V5YA 1MQTB 5LBBA 5JQGA 4JCKA 3LNMB 1ASJ1 1JJOA 1NLQA 3ZDVA 2FMLA 4LF6O 4X8PA 3QG5A 5FZOA 5J98B 5EYYA 3B8NA 2RG4A 3CJIA 1RUH3 4QDRA 4J7JA 2PHRA 4A42A 1D4VB 1XBFA 3LKJA 3P3PA 2VZOA 3ZFEB 3VBFB 3GYDA 2UXCO 1MEC2 4OGQB 4AVAA 3ZPOA 3V64A 3NQHA 3E22A 1P84F 3AMHA 1Y43B 4YGEA 4WBBA 2XAGA 3J8F3 2EJRA 3FB8C 4BR6A 2D43A 4CPBD 2XTAA 1R3IC 2JG9B 5BV6A 1WCKA 4XACA 1LNSA 1PKXA 4I0XB 3IDBB 3KQRA 3KB5A 3FZ3A 1ZWIC 4UT5A 3H1KH 3ZHTA 1RUH2 2O1QA 4I4TA 4F7ZA 5DECA 4NN0A 3WSOA 1UAIA 2HWD3 1FKAO 1F51A 4O4JA 1AR73 2JJ6A 2BEOA 3IBMA 2BTQB 1NVPB 1DCSA 4Y1ZA 5G04L 2PFWA 4UUJC 4CH4A 3J8F2 3T1MA 4Q4X1 1NCQC 2XWBB 2XJTA 5JMOA 4HNAA 2ITCC 2EICA 1DHKB 1JZ4A 3JALA 2AHYA 4LOSA 3AP4A 1V55B 4QDQA 4MVOA 2X09A 3AYEA 5C71A 1JFFB 1CR7A 1CAUB 3RWRD 3D3AA 4J7KA 1Y4MA 4LXLA 1XMOB 3KM5A 4Q8LA 3CMGA 2F6BA 5T5PA 2Q8CA 2HWD2 3BALA 3ZFGB 3CBNA 1OFSA 1W04A 2KR2A 4CDQA 4CP0A 5I0SA 4M3CA 4R9CA 4X65B 1F35A 1ASJ3 4COYA 4CC5A 3ON7A 2XUMA 5KX5B 3TNPB 1S72V 4LBEC 3VDCA 2QJVA 4R8CA 4TYSA 3DL3A 5LB6A 2UU9O 4BLIA 1BEV1 1CD3G 1X9TA 2VBBA 1JCHA 1UZZA 2VOVA 4UCUA 2KD7A 1UY2A 1FATA 2Q9LA 2UURA 1GU3A 4U3JB 2QEXV 2MW2B 1JZ5A 5H9CA 1W9WA 4LKFA 5FJKA 4TSVA 4IDZA 2DVAA 1P4RA 1YFXA 2OIIA 2VQEB 1JYTA 4XC9A 5EZWA 1ASJ2 1B6QA 3AC0A 4QE9A 4RQFA 4W4ZA 2EX3A 4UFZA 2X5IC 4RFT0 1CGPA 2DVDA 2E74B 4DR3O 2DCJA 2C26A 5E88A 1FAFA 1WCDJ 2VZQA 2D6NA 4CC6A 4UFJA 2AZ0A 3POJA 4QWNA 4DUYB 3BTXA 2XHBA 1RSOB 4LH6A 1SLIA 1V6LA 2HBUA 1ENVA 5A32B 4Q4X3 3JCUZ 2GUZB 1SLLA 4AEDC 3M8LA 4L0PA 2VZUA 1EPWA 1SQQH 5LBEA 2R7EB 2XBO3 1JHNA 4OPAA 3KV9A 3RYHA 5FZ9A 4HL0A 4AF9A 5B1BB 2QCSB 1YO8A 5A33A 3BTZA 1G9DA 4F4LA 5FZ7A 5F2SA 2YC0A 2PUSA 4P9PA 4JDOA 1EN6A 4IE4A 3T09A 2E33A 4GYCB 2QA4V 3SCGA 1OCOC 2VZPA 4GIQA 4LF4B 4LF5O 1APNA 2SLIA 3NNGA 3D4KA 4H44B 4HKOA 1VRBA 1TA8A 1O4ZA 1F4AA 4Q4W1 3CEWA 2DUPA 4N53B 1XNQO 4COWA 1RXFA 2VMHA 2XBO2 4FPPA 1RUI3 1VP6A 4Z2WA 4JDNA 3CJIC 3ECQA 1YJ9V 1S4CA 2ZCWA 2Y69B 5FDBA 2HWF1 4J25A 4FTEA 5LMNB 3JQWA 4GWNA 3JBG2 2YGMA 4JAAA 2WAAA 1JUIA 5IW0A 4OLLA 1N3QA 1I5ZA 2XJPA 2G38A 5FYMA 4D6TH 4B4PA 1A3KA 1E5RA 2MPFA 4DS0A 2R6QA 5DG1A 5F3IA 4EN8B 1BMV2 1MVEA 1HB3A 2E75B 5CFDA 1RUI2 4N21A 2R0HA 2ZBJA 3B09A 4QQ2A 3APBA 4Y22A 3IKWA 5DPNA 2A75A 2ETEA 3TYJA 4CDWA 2R043 1D4M1 2EIJB 4KH9A 4XDQA 2DQ3A 4TLFA 3IT8A 4GKJB 1WD4A 1NZIA 3LSUA 5FREA 2KSDA 3JARA 3THCA 3POWA 1QOOA 4GT1A 2D7FA 4PA9A 4FFIA 3VKMA 4E4HA 3H1LH 2UUCB 4E2QA 4XUQA 4AWDA 1LHVA 3ASNC 1HQNA 2VY0A 1O91A 3DGTA 4BXFA 1VBC1 1VQMV 2ZE7A 2ES3A 1QH7A 3ABTA 5FWJA 5T55A 1GQPA 1ULGA 3OTOB 3HAGA 3U75A 5JAXA 1XNDA 3I4IA 5HXMA 2DYSC 1Q8IA 1VARA 1N33O 3ALQA 4Q4W3 3I2IA 2CTPA 2R042 1ALYA 4JDMA 3SYCA 1ZX5A 3A22A 3INAA 4CDQC 4LF7O 4XURA 3ABMB 2AXTZ 1RXGA 4X65O 3VKOA 1Q5OA 4QU1A 1LUWA 2P4VA 2F17A 4UVAA 5C8WA 2WLNA 1JHJA 1GICA 2F95B 3AM2A 1Q8PA 2JX9A 2HWF3 5IFPA 1UX6A 4RQEA 2UYBA 1CAXA 4Y20A 4EFEA 3SYQA 2ZABA 4AEKA 5BNQA 4PDWB 1RITA 3APOA 4HMZA 3P3NA 1S3JA 4BW5A 2B46X 3LIHA 2QKSA 1W3VA 3NSTA 1SFYA 4HKWA 3K04A 3KGZA 3F95A 3TOJA 2ZPXA 4NAMA 4RUFA 1OKOA 4IUGA 3FX7A 1J3RA 1ZBE1 3ZBHA 5E16A 2YMZA 4JZ2A 3SEPA 4GH4A 4DNYA 2ZGMA 4CU8A 5EYPB 1CAVA 2UUAO 3WXPA 5L36A 4KGQA 1FNYA 3M4FA 2VOTA 1PPJH 2XJVA 1HB2A 1AR91 3IPVA 2AC1A 2XJRA 2PQQA 1LENA 1CESA 1YQ5A 4IGQA 1UYPA 2HWF2 2K46A 1K3EA 2JDHA 5FYZA 4FPYA 1XNTA 3WW4A 1LECA 1PVC1 4J42A 3UCSC 1AJQA 1Y9GA 3JD0A 1FFTB 4UBGA 4DUYO 3I2GA 2P3KA 4B3SB 4X8AA 2ZGPA 4GAZA 2JB4A 2ZX0A 1IGOA 2BTOA 2NP0A 2PAMA 2M7WA 5FP9A 4FPHA 4ZY9A 1G86A 1G8MA 1G6NA 3AXEA 5FZGA 1PNMA 4XYXA 3O65A 3GWOA 1Q8SA 2PYJA 2BNNA 4IV3B 5LP6B 1C5HA 5J7MA 1YZBA 3VZNA 4YHHO 1YFYA 5F1RA 3LDKA 3ZN0A 5DUUA 1P7GA 1SFPA 4XUNA 2FCVA 1DF4A 3VBUB 4CP1A 3OGRA 5LGUA 1BQZA 2DTYA 2E51A 5CA0A 2QQPA 2QDNA 3HKEA 2LRPA 2IU3A 3D0JA 4LF8O 1I5PA 1IURA 4AEJA 4LULA 4Q5OA 5JIUA 1NLSA 4JRLA 5EWSA 2XXZA 4FPCA 4L9BA 2YV8A 3AZWA 1WA4A 2HWE1 5GM0A 1ROPA 1Z78A 4PQ9A 4U2AA 3ICXA 2EZOA 2OX0A 1FMD2 1JZ8A 2DCYA 1W2NA 1HV0A 1N8RW 1I94B 1R1A1 3AFKA 1SQBH 4DV3B 3A8TA 3OUHA 4UW4A 3FLRA 4OI0A 4YW5A 4Q6GA 2WZ8A 3NJYA 1WMFA 4B8EA 4IIJB 2ZAHA 3AYAA 3VBSA 5I91A 2QQOA 4AVBA 4U7NA 2D97A 2BP6A 5B1AB 1OH3A 4Z1VA 3JCIA 2W3JA 1VQ5V 1BYHA 3MV11 5GZDA 3USUA 4GWMA 5BMVB 5A7SA 1ZLZA 4P9XA 5H9SA 4IHJB 5CFDC 3E86A 5FZ4A 3CXHF 1UD1A 3EO6A 1AUYA 4M4PA 4DO0A 2UWCA 3Q9OA 1PVC3 1VRH1 1J58A 5LEJA 4W8JA 5IVBA 1OFNA 1Z7S3 4V2WA 4CDWC 3T2OA 5IK5A 1O4YA 3FC0A 4RQPA 1SBDA 4XQDA 4FFBB 4FLWA 4BE3A 1HDJA 1QJX1 5C3OA 2VCAA 2YROA 1H4GA 1ND3B 4GKJO 3OOXA 5FMOL 1ZRDA 2JVDA 4HLTA 3E8GA 2XVKA 2HHHB 4IQPA 1GN6A 3O0VA 5FPUA 4GMP0 3VBHA 1WN7A 1M06G 2UUCO 5EV7A 2OT5A 1CPMA 4WM7B 5FZ0A 1NI8A 1DZRA 3FD9A 2B42B 3HNBM 3HNYM 5LATA 3T0DA 4W6YA 5DUXA 1Z7S2 3LFMA 4RR3B 2XWJB 2AYHA 2HWE3 3FJSA 2EXHA 4Y3OA 4YG0A 4XQWA 1OMIA 2QUOA 1XE8A 2ATKC 2ZDIC 4UVCA 4GX0A 5FY9A 1L8DA 4QQPA 4MTXA 1H8TB 2IJIA 1R1A3 1M56C 2BSKA 1LHNA 2Q5ZA 2QM7A 1EV13 2WT2A 3B93A 4CTEA 5KXEA 1OKQA 3N9MA 2R0FA 5IYDO 1VMHA 4CE8A 5L3CA 2CL2A 3WCSA 4LT5A 4LLFA 3BU7A 2QQLA 3O9OA 1TVKB 3E5QA 1S0JA 5J2UB 2RV9A 3PMSA 3VD4A 2C5DA 2XT9A 2JXAA 2LO1A 4XIOA 4HONA 3VDDA 1XL6A 1UW8A 3B9CA 4GH4C 1AX0A 1WPXA 3T0AA 1W8FA 5A1AA 1J3PA 3D36A 4K1YA 2IBZH 2FQPA 2I07B 4YG3A 1JOJA 1L3JA 5HCBA 1EV12 3J7NA 2VM9A 4P2ZA 4V1PA 4FXKB 4WBNA 1UL9A 2WSSG 2BE3A 4UCRA 4JYAO 1GWKA 3J7LA 3ABZA 4PLOA 5K1XA 1A34A 4O4IA 1QJX3 4I2OA 5FTTC 1AL21 1ZTEA 1K5MB 4LP8A 1GYKA 2R063 1C1FA 2ZGRA 4JQRA 4BQ2A 5JXHA 3ACFA 3WLUA 1FOD3 5C9AA 1ST8A 1VBE2 4XJAA 3ZOIA 3D3IA 3TXSA 3VDBA 3T1YB 2E5LO 3I3DA 4NB5A 2IVIB 5DMYA 3KT1A 3DUIA 1IZ3A 3OBTA 5FZHA 5F5CA 3G4SV 5B1OA 5JVDA 5A80A 1GQGA 4IEZA 1V6KA 3MZHA 2WT1A 4OX9B 3SC7X 5KA5A 2VMDA 4ZOLA 2R062 1W8WA 5JJJB 3K5NA 4IESA 3WQ7A 4KHPB 1OURA 1FOD2 1G8WA 2M6YA 1OUSA 1HDKA 5B2GB 4H0LB 2K1EA 2PY5A 1ULOA 4P9YA 5FYCA 4P9GA 4KBZA 3C7FA 5C70A 3RWNA 4K8XA 1K4DC 2RS11 4CBCA 2XAJA 3VBSC 3NKTA 3PHMA 2LS6A 4Q2FA 1WKYA 4CZSA 2TNFA 1N0NA 4DK1A 1ZNPA 2C6SA 4K0KO 2PHLA 3QBQA 2ZM6B 1W6OA 4S2GA 3RYFB 5CIRA 5JXIA 5DAWA 1ZZ6A 3RZJA 1XB9A 4QPYA 1KP2A 1E79G 1AI7A 1W39A 3G6JB 4XAEA 2Q67A 1KGYA 2WYFA 4MGZE 4OHVA 2EBOA 5FYIA 2NYYA 5L3FA 4Z1MG 2N74A 2V72A 3PIGA 2DV9A 1AL23 4YZ4A 2YPDA 3KGLA 3NV2A 1N1YA 3PUIA 4H13B 4I9QA 2WQZC 1LAJA 5J09A 4RQPC 2RDNA 3JSNA 5FK7A 1NYWA 4DV7O 1AJKA 2B9ZA 2W95A 1HW7A 4NIAA 3K3OA 1W28A 2WLQA 4IEXA 4X89A 5EP9A 4DXRA 1SLCA 3JD1A 4CH3A 4AI2A 5LASA 5FNVA 3ZX6A 1I1EA 3FAVA 1UOGA 4X20B 5H5NA 4P30A 5I93A 4B7EA 1OLRA 2JEMA 5IJRA 5F3EA 2QWPB 3ZYFA 3P6BA 1M57B 2JEUA 1VAMA 3AL5A 4WM8B 1RHI1 1OOPA 4QX8A 4FOYA 2YFUA 4YVWB 3M2MA 4MSVA 3GZTB 3RDIA 2ZA9A 1DGWA 2BBVA 2ZGKA 1H6YA 1O3TA 2QQVA 3DV8A 1OXCA 2BWCA 4YW2A 1YJNV 3K03A 1ENRA 2WLLA 5BYNA 2QDRA 2ARBA 2YXSA 1LCLA 1GZ9A 2H6CA 4MW8A 1ZRIA 3CJHB 1YDXA 3CCUV 4MVSA 4FPKA 3VDDC 4TQFA 1BMFG 1NUKA 1N34O 1R3JC 1RFYA 1KP3A 3KS7A 1OJHA 1Q43A 4EKWA 5B4XA 3S3WA 3D36C 2Y48A 1YCIA 4J10A 1LTEA 5CFCA 4LHKA 2JS5A 2A79B 4N90A 1UFIA 3KHBA 2E53A 3P30A 4IXLA 5DXDA 3ACIA 4YWAA 1B35B 3ZSLA 5GONA 2JG8A 3OBZA 2E26A 4FQ4A 4GB33 3RFRA 4WZCA 2RS51 2OYQA 5FY8A 2GH8A 2PHDA 3DXTA 3CCQV 1JVMA 4CP9A 4K8RB 3FFZA 5C6CA 3RYKA 2OCCC 5B1NA 1EP0A 1VP7A 2QQJA 4IV1A 2WRAA 4OCTA 5C3PA 1PZ8A 5C9AC 3UO3A 3BI3A 2D5HA 1JYCA 4NR1A 3VDAA 4FZ0A 2W1QA 2HFEC 4JAUA 2WLKA 4CDUB 1HQWA 3GZAA 4QIWF 1RUG1 5ANNA 4OI2A 4CU6A 3T1YO 4YZ1A 4XFHA 2ZX1A 1MS4A 5FMOS 2LJ2A 4CZZA 4V2VA 4JI3B 4JVAA 2K0GA 4GB32 1BK0A 2RDSA 3W21A 4JI7O 3X2QB 2YXHA 5IVVA 1V54B 5J2TB 4QX1A 4XMIA 4OX9O 2N04A 3D82A 3UK9A 4R9DA 5A3NA 3BFRA 1SQGA 4A7KA 3WP4A 3H01A 2LROA 1W2TA 3ZXLA 4XABA 2QKCA 2K9ZA 4LUMA 3T4ZA 3BOWA 5DN6G 4YGBA 2YC4A 1XMQO 4QNHB 4CCDA 5FLIA 1CAWB 2J7MA 2F4VO 3ETGA 4KI5M 4IE5A 3VHPA 3TK1A 4AXOA 4QXKA 4NHXA 5LL6Y 2UWAA 2D6MA 5JVVA 5KHGA 1VLNA 1GWLA 5EJ1B 1KFXL 1OVPA 5T52A 2WWWA 4GX1A 1PL0A 2VW1A 1HR0O 3ZMVA 5LOVB 4YJ3A 2P37A 3G71V 3AB0A 1GNHA 4RSUA 2WSUA 3JD3A 2RM22 2ZCEA 2GMEA 2DFBA 1DGRN 1XREA 3PTYA 2JE8A 2BFUL 1TE1B 1G6UA 1KJLA 3ZDSA 1SQXH 1TG7A 4DXTA 1UY0A 2CV6A 3V0AA 4MW3A 1QVGU 2CTVA 4LNVA 4JGYB 4MX3A 1VIWB 2RJLA 1W8OA 3RQ0A 3FB6C 1V6NA 2BRTA 2Z0AA 4A44A 2IH1C 5LYJB 3MBWA 5C8CA 2QM4A 3EB7A 1JYWA 1DGLA 4E2GA 1ZL8B 3KVBA 4PT6A 1BLZA 1G9FA 3MHSC 2QTOA 2DBNA 3MICA 3ZRXA 5BR8B 1YF2A 1QMJA 4N43C 2J1TA 5A7QA 3IC7A 1MMMA 2PI5A
chains in the Genus database with same CATH topology
1G9CA 2NPIA 1CQ9A 1ENXA 1EYBA 3OYWB 4FFAA 1W0PA 1REDA 4I0AA 3VBOA 3VBFA 4ZU7A 3M1HA 2WZPP 4URTA 4BHGA 1E57A 4LR4A 3AFGA 4B4RA 4KWLA 1BEV2 1OIJA 3R4UA 4D7YA 2DFCA 4IL7A 1OA4A 1OD5A 3VKNA 3U0ZA 3SWTA 1ZZ7A 5JOZA 4BA6A 4ES9A 3DKWA 1U5YA 4NE0A 2GC3A 3OGGA 4UXAA 4X8NA 1OA2A 2VPVA 1WD3A 1JYIA 4XQ4A 1WMDA 3WX5A 3CF6E 1X36A 3H3UA 4I01A 2RR13 2GC0A 4KBBA 2AENA 2JG9A 1AR81 2BUKA 3WNXA 4LO6B 1OOPC 1YIFA 4M3CE 1AZDA 4BCUA 3SLIA 1PO23 3J8F1 5E89A 3NL1A 2JICA 4S2HA 1DRTA 5J48A 2WNVC 3ZFFB 2OYZA 2WJSA 4QMAA 4AVCA 4AGVA 4MGKE 4DRRA 2I74A 4XMAA 4G9SB 1SBFA 4Y5Z0 5GZFA 2PHUA 4UW5A 5I0RA 1NG0A 2WZR1 1POV0 2ZMKA 3FX3A 3IIAA 1GLHA 1YWKA 2GALA 4PLNA 4RL7A 1QJU3 1XU2A 4IV3A 3B00A 4A3XA 2X29A 4XHXA 1O4TA 3MDPA 2VW0A 4XJWA 2FZ2A 2RE9A 2VXRA 2Q8OA 4XBLA 1UN1A 1ND2C 2GDFA 5LK7B 1X7NA 4COVA 5JI9A 2HWD1 3LA3A 4MH0E 3VBUA 2VUAA 2WA3A 3H1WA 1F2NA 4AEDA 2LM3A 4DINB 1DG6A 1LOEA 1AR71 5JI7A 4FQZA 3H9AA 4FCAA 1ZREA 4AQTA 1RMU3 2OVUA 3JD71 4I09A 1COV1 4MXWA 2VNOA 3RG0A 2RR12 5GJ6A 1MS8A 5GZGA 5BXXA 1REFA 4M27A 4ASMB 4BHPA 5CFCC 5JMCA 1AX2A 3C3VA 2H0VA 5GLZA 4LBQA 1NCQB 1OLQA 4AFMA 2HWB1 1PO22 1PVXA 1HXS3 3TNQA 1F9KA 3NO8A 2ZZJA 2R071 5JCTA 5DDJ3 1TME2 4XETA 5T50A 1PK6B 2VW2A 5I8SA 1V70A 1NA1C 4AFCA 2VQ0A 1CAUA 4KGGA 4LBMA 4E4DX 5IK7A 3V15A 4N53C 1Q8QA 1WCSA 3W58A 4AQ6A 2EALA 2WIIB 2DURA 3VDDB 1IPJA 1NXD1 1ONAA 2I2SA 2YY1A 5BY5A 5ABJC 2JG8C 2B8MA 3H3ZA 1MEC3 4H14A 4UBHA 1IQAA 1MS1A 2BPA2 3ZFGA 1QJU2 1S1AA 3RS6A 2CAVA 3X29B 3ZMNA 4C1XA 3V17A 3TN91 3LA7A 3PVBB 3ME2A 3V0AB 1H1MA 4Y0EA 1AXKA 3ZXGA 4BGMA 1HRI2 2ZGTA 4XHBA 1DGWX 1RUE3 4H55A 5CA6A 2XB6C 2YHJA 3MF9A 4XFAA 1LULA 3L2HA 5C33A 2ZS6B 4I3PA 2XJUA 3AZZA 1AYN2 4IV1C 4B4QA 5BNPA 3VZMA 2GN7A 3M3CA 1PGL2 5AVPA 1ZM1A 2V5YA 3S6PA 2W0XA 4F8AA 1MQTB 1RMU2 2B9UA 4DXZA 3ZXEA 2A6VA 4QM8A 3MI8A 4DZGA 4LBKA 3O0XA 4JCKA 2ZMNA 1ASJ1 3WW2A 1DZTA 1GKBA 4GB31 4Q4W2 4X8PA 2EF6A 4XILA 5J98B 2FMDA 5EYYA 1HXS2 4M2CA 3B01A 3CJIA 4YLZA 3NWKA 1RUH3 5DDJ2 3WCRA 3E6BA 4GALA 2PHRA 3N7LA 1D4VB 2NMOA 1ZBA1 1AR61 2HYKA 3AZYA 3LKJA 3P3PA 2AH2A 4WVZA 3ZFEB 1C4RA 4EV0A 2F4PA 3VBFB 3GYDA 4XPVA 1NCRA 3EXUA 4ISQA 1MEC2 5C9AB 4G3YC 3AJZA 4AVAA 4CWDA 2HEVF 1OSGA 1UKGA 2PTMA 4M26A 3VZLA 5JR7B 2IXKA 1OIJB 1GZWB 4HZFA 3V64A 2SBAA 3FWEA 3VBRA 3ZXDA 5L7OB 1NOVA 2D98A 4N43A 2MEV3 3AMHA 2O0OA 1XQNA 3V0BB 1Y43B 4YGEA 1RUE2 2VU9A 5DZEA 1RB8G