3P3PA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1997-2016) peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3pA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3pA01
1H2LA 1H2NA 3KCYA 1MZEA 1YCIA 4AI8A 4Z2WA 2YDEA 4JAAA 3P3NA 2WA3A 4BIOA 1H2KA 4B7KA 1IZ3A 3OD4A 4Z1VA 3P3PA 4B7EA 2YC0A 4QU2A 2ILMA 2WA4A 1MZFA 3D8CA 2W0XA 1H2MA 2CGNA 5JWPA 2CGOA 3KCXA 2XUMA 2Y0IA 4NR1A
chains in the Genus database with same CATH superfamily
2DCZA 4LF8O 3M7AA 3I59B 1N34B 3VDDA 2ZKLA 1ZVFA 4DR4O 1YEWA 2FB5A 3EXAA 3WG2A 1WW4A 2EIGA 4XDPA 1MZFA 1G8WA 2QDRA 1RUE2 2I2SA 2A7AA 3OUFA 4U3JA 3HNYM 5FZIA 2ES3A 4NHXA 5EFUA 2EVXA 2WDBA 1SESA 3ETDA 4LF9B 3AG1C 3ZYIB 1JOBA 3MDSA 4EJRA 4F4LA 4DR5O 2B5HA 3ZPOA 2XOKG 1DBNA 4HPKB 4SBVA 2BZDA 5D21A 4YW1A 2VBDA 3SH4A 1V70A 3ES1A 3WP6A 3ZMSA 5GTIZ 1KJRA 1NU1H 1ZRIA 3FMGA 2EZPA 1JYTA 1M1KW 5FZ9A 2FCVA 2B1GA 3ZYFA 4HKLA 1VQ6V 2W68A 3IWZA 4XEZA 4CCDA 2J1AA 3T1HB 5DMYA 2GMPA 3WG3A 1YHQV 3U0ZA 3VHNA 5B4XA 2HWC1 3USUA 3VQWA 1YC61 3OT7A 3OOXA 3ATGA 5LOVA 2R073 1UU6A 4W4KA 3CYOA 4LCUC 3AYCA 1RJ8A 2ZAAA 4KU8A 4TV8A 4U7NA 3R05A 2BYVE 1QY4A 3LGRA 2XG3A 3UV9A 4NVPA 1K7DA 5LCWL 4XTMA 4MGIE 5FMDA 3D8CA 4ES8A 2CUGA 2DYRB 3N27A 2WL1A 4YFZA 3NW4A 3L9DA 4ZS3A 1W2BU 1G1XB 5EJ1B 2RS52 2R32A 1V9U2 2JKBA 1X7NA 2F4LA 5C70A 3SYPA 1GWLA 1K73W 3NNLA 2WYSA 4QM8A 3C90A 4ZZ5A 2YSUB 4E2LA 4Q4W1 1AR62 2A71A 1OOPA 1TEIA 2A75A 4RS5C 1HN1A 1CXZB 5IY5C 5BNQA 1OLMA 1VF6C 1SFPA 3RYHB 2BDRA 4UB8Z 3OMIB 5FZOB 2V1DA 2GN3A 5JI7A 4RQPC 1AROP 2AR6A 1ZRFA 3CCLV 3K5NA 2W39A 3AP4A 5IVBA 3OGSA 3N9NA 1ZX3A 3GB7C 1YUDA 4I09A 2BRTA 3V56A 3PJQA 3JSNA 1H4HA 1YF2A 2ZHKA 3AYDA 1WB8A 3M99B 4TV8B 5JPNB 2Y6HA 3E6BA 3KCYA 5AC93 3T2PA 2VTXJ 2GUZB 4DFSA 3PIJA 3R66A 4CDWB 2J22A 3RYIA 4AWDA 4CDUC 3O1RA 4KWUA 4HSJA 3THCA 4AVBA 1O8PA 4L87A 2Y69B 1LU2A 4JV5B 5KXBA 3WB1A 5FZHA 4LH6A 2FDHA 4IYIA 4KP4A 5LASA 4NTXA 1LOBA 3TXQA 2WKKA 3TEWA 1Y9GA 1N0NA 4MYEA 2HEVF 4A6SA 1NCQB 1TAEA 2KR2A 1UN1A 1QQP3 3VBUC 1YTFD 1YXBA 3ZSKA 1GN4A 4O2AB 1H4GA 4DUYB 1S2EA 5J2TB 1X50A 3RYCB 2GUZA 4H37A 1W9FA 1E1RG 1RM1C 1YTFB 5I0TA 1L3JA 5DAPA 5LXTA 3PMSA 4K1ZA 1JVMA 5B3SB 2E5LO 5A3OA 3Q8CA 1W6MA 2JG9C 4X62O 3QACA 2ZGSA 2EJRA 3HT1A 1YFWA 4LO5B 4WM7A 4RQPA 2UY9A 2BOCC 4P00B 3M1HA 1WCQA 3CU7A 1GYKA 1Q86W 1NS1A 3LEMA 1VF7A 1JZ8A 3ZLIA 4OLLA 4TXWA 3BODA 5LY1A 4K1YA 1DYKA 4WF9V 2OT5A 2HEWF 3JB4C 1TUEB 3M3IA 1ENQA 4AI0A 1XQ8A 1TGOA 5JI9A 4IV1A 1XBLA 4K8RB 4HBNA 2XBO3 1SQPH 1XHXA 3FD9A 3WQ1A 1CPNA 2OCHA 2DUQA 1H1AA 4JI8O 1J3RA 2ARAA 3EYPA 1WLCA 5A33A 5EZYA 4YW7A 2XQRA 5B5EZ 4Y5TA 1L7LA 1JODA 4MGQA 3LSQA 1WWYA 1O4TA 5DUUA 2RDQA 2YC4A 4OI4A 3DYOA 3SJAC 4Y5SA 2BUKA 1W9TA 5LA6B 4R8CA 2VO5A 1EBOA 1Q56A 1W06A 2CTVA 4CUGA 3POGA 3OEEG 1AR1B 4OHVA 4DK1A 5A7OA 2X0LA 2MPFA 3CXCU 1JFFA 3ZDSA 1Q8PA 3B7MA 2PQSA 1QHDA 1ROPA 1TME1 3T2MA 5L73A 1CD3G 3OMAB 2ZA9A 1GM9A 2F43G 5KMGB 2RS12 4ZBMA 2A1XA 3ETPA 4R9CA 5C8CA 5JZGB 4FM0A 5GLTA 1PL4A 3KQ4B 1KP3A 4M3CA 3JAKA 1E57A 4B4QA 2YUEA 2ZX0A 4IEUA 2PA7A 1IURA 2WLNA 4NIDA 4BLIA 2X6CA 1J1LA 5L36A 4Q4W3 5FWEA 4ZHNA 3CB2A 4AXOA 3CCJV 2LS6A 4ZZ8A 3OBRA 5C6CA 3RSJA 1MMMA 1VBD3 2ZNJA 5H5NA 4XQ4A 4QXCA 3T4HB 4NRMA 3SEPA 3RZLA 2AHZA 2WYFA 3KV9A 1EFRG 1D7PM 2XASA 1EZVH 3U4SA 4QQLA 2GN7A 3DXTA 5FTTC 1GAXA 3R4SA 2HWE3 1IS4A 2YFUA 3LE0A 5IVEA 1LHNA 1PX4A 3ZBHA 2QWOB 4A41A 4X1YB 3RYPA 2RNBA 4AZZA 4JRAA 1QCEA 1D4M2 4GWNA 2W0XA 2A6XA 1LNQA 1G8MA 4HKWA 4QIWF 1CZSA 4NXMO 5LBFA 4XF0A 2YXLA 4PDMA 5IVYA 4X1IB 2YXSA 1HRV2 4CDXA 2GC1A 2WPDG 2LRPA 1ST8A 4HN0A 3I3EA 1GFF2 1GLHA 4Q0SA 1G7YA 3PVOA 1IPSA 5FK8A 3WCSA 3ZFGB 4YGEA 1EV13 1VMFA 1FXVA 2PGGA 5A3TA 4CE8A 3NO8A 1FD9A 1XNRB 1SEFA 2JG9B 3EHBB 5HI0A 2BW8A 3SPIA 3ZSJA 2UYBA 5CA1B 3K08A 5CNAA 2AENA 3DL3A 5E16A 5EC2C 4BXSV 4ITCA 1VE0A 4YVWC 2XMLA 1UYPA 3DV8A 4MTOA 4KU7A 1V9PA 5EP9A 1UAIA 1PO12 4X66B 2XHNA 1DG6A 2VG9A 3SISA 5IY5B 2H0VA 2QQPA 3C7HA 1N8RW 1FXKB 2Q1ZB 3WNXA 4TSVA 2CH7A 4AEDC 1XNRO 4OI0A 1EM1A 3CCQV 1W8WA 4M4RA 5IVJA 3ZSMA 2ZGQA 3MV01 2H94A 4TOIA 4UFHA 4WFBV 3QO5A 4D0QA 1LOAA 1MG1A 1CPMA 4KBBA 3VHRA 4QPJA 1JOJA 4CEYB 2ARCA 2YBSA 4R4XA 3SDLA 3TNQA 4CDWC 4Q1PA 4JX0A 3MF9A 2YBPA 4DEQA 4JI0B 1AR93 2XWJB 2P6HA 2BJSA 4QU2A 4C91A 4LO4B 4GWJA 3ILRA 5A1FA 5JUVA 1YCIA 4GX1A 2F1MA 4QKDA 4AFBA 1L0LH 3E86A 3SPHA 1NR7A 2MW2B 3GF6A 2B7YA 1A8MA 3MFAA 1RMU3 5ITZA 1RP3B 5AC91 1XUQA 4QJFB 2WAAA 5JR2A 4GH4C 2OXBA 1ENRA 3HQRA 4COWA 1R3KC 2KXLA 4HLTA 4UVCA 3RGBA 1PM4A 2WC2A 5BYNA 2D6PA 1QU0A 4B08A 1PNMA 1RHI2 3IT8A 1RINA 1XU2A 1DCSA 3B02A 4LKEA 2YC2A 4YGDA 2OVUA 2ZM6B 1SDWA 4DXWA 3MFCA 2W94A 1WGPA 5CB7A 3WF0A 2YG0A 3JD73 1MA1A 1FI2A 4MT8A 3P6BA 3SEEA 1SA0B 3WNOA 4V2WA 4KXRA 4Y1ZA 2D6MA 1ZRDA 3OG2A 5FZAA 2EF6A 4RGAA 1RUH3 3LSUA 1K5MB 3I2DA 4MXWB 4C8DA 2QDNA 3WLUA 2ZEXA 3OYWA 1TZOA 5F6LB 3BY6A 3M8LA 1LHOA 1VLNA 4YSFA 4I50A 1S0JA 2VM9A 4XBQA 1GO3F 3V0AA 1XREA 4DV5O 4YPJA 1W8NA 1KDKA 2E6VA 1H8TA 3L74H 4MVMA 1D2SA 5FZ8A 5EHDA 3LA7A 3B40A 4R9BA 5F37A 3UGHA 2WR9A 5KUMA 3F5WC 1BL8A 5CA0B 3AL6A 3Q9OA 3HBZA 4IEPA 1UOFA 3N3HA 3T3YA 4ZS2A 5KLVH 2VCAA 5BNOA 5E1RA 4Q4V2 3N7JA 1HV1A 1Q81W 3T4DA 5IFPA 4B3SB 3K5OA 1R6NA 4IEYA 2E3CA 1W8ZA 5KA5A 1QIQA 3HNBM 1H8TC 1W3XA 2VZUA 3CNAA 4UW4A 2TNFA 2ZD9A 5FP8A 3ILFA 3DEMA 1ZRRA 3MHZA 5JPMB 4DXZA 3AEIA 3KF5A 4A7ZA 3NJXA 2Z5WA 4JYYA 3RZGA 4QX5A 1G9FA 3KG2A 5JOZA 2BGPA 2P6JA 5FKCA 2FL4A 4OUSA 3WG7C 2AH2A 5EIBC 3BN6A 5FLXN 4M0NA 2ZGLA 4P9WA 2XXZA 4GX5A 4EB6B 3LDDA 2YPJA 3FLPA 1AR61 2ADEA 3T1YO 1W2TA 4XJWA 3ML0A 3G67A 4K8FA 4Q4X2 2Y4UA 4IERA 3LF7A 3TRSB 2YZ4A 4DXSA 1PIV1 4JKKA 1OCRC 3WDUA 1F23A 3VBSB 4KWKA 4O4IA 4RO2A 5FYHA 1ZBA3 5B66Z 1XDCA 2X8KA 4JV4A 2QTWB 4PIZA 2WZPP 1Y6XA 5LW9A 1FPOA 2IVIB 1SACA 2WFF2 5GZCA 1V0AA 3S3WA 1UPIA 2AZ2A 4JI1O 3ON7A 1BT8A 1Z7S3 2E53A 3FKSG 2WA3A 4B7KA 4JGZB 4TUYA 4KWLA 1IGOA 3CCRV 1Y67A 3MPBA 1LHWA 1BBT1 4GKJB 4RR3C 1NH2D 3DYMA 2ITDC 2CTRA 4P9XA 4JKMA 4L2NA 2V5DA 3RYFA 4GMP0 4QXBA 2ZGUA 3ZYBA 3RMYA 3ACIA 1QF3A 3U11A 2D5HA 1AL0G 3OSDA 1PMHX 4UXAA 3NJZA 1MEC3 1PMJX 4FPKA 1NTZH 1SERA 3HKEA 3C2UA 1HJFA 3WNNA 1UMIA 2JDNA 1VBB1 3GBGA 3TEZA 2ZGOA 3N7MA 3NNGA 1LUWA 5F1RA 3QCWA 2X10A 4XUNA 4NPMA 2WNUB 5C8CB 5JZGA 2ERFA 1EAH2 1LRHA 2DV9A 3N9QA 5HCAA 4CDXC 1XNAA 3AG3C 1KFXL 4K20A 3T1CA 2FKXA 5IYZB 1JS9A 1VQLV 1NA1B 1AI4A 3PUAA 1AXYA 3CWBH 3LPGA 5A3MA 1HJGA 5C8CC 3R4UA 1XNQO 4D8MA 3QBQA 1H1IA 3OUJA 1VAMA 1UWWA 1OMIA 3D4KA 5JSOA 2G4IA 2VTFA 1RUD2 2J1RA 4LHSA 5CFCB 4I0BA 1OFNA 2JIZG 4O2AA 1K3IA 3DPRC 4R9DA 5EZYB 2RDNA 2XVGA 4YY3O 2ZBJA 2PELA 4IUGA 1CAUA 4ZY9A 3M3CA 3CSXA 3DF0A 1NLQA 2C9KA 5CA0A 1UPSA 3MZHA 2FZ2A 3M2MA 5SV8A 4PQ9A 4URTA 3Q4HA 1YJNV 5LK7B 2R7EB 3H1YA 4RQFA 3IC7A 3W7WA 5FO9B 2R071 5IWAB 3O1TA 4RD7A 4UI9L 5LZ6A 3KV6A 1JJOA 2DMXA 4BB3A 3VKOA 4F3JA 4PT6A 1VARA 3JBG1 3L2HA 5E6HA 1BXHA 4EFEA 4GCZA 1LEMA 2DCTA 2PFWA 5LBQA 1DQ0A 3A0HZ 1SPPA 3KZ4C 1SMVA 1R082 1PPJH 4ZHQB 3FUQA 3A8TA 1D4VB 4AR2A 5IWAO 3CJIB 4HVOA 4H44B 4QWNA 2RS13 3ILNA 3I3BA 3CCSV 3D3IA 3WV6A 1F2NA 4AI1A 3RS6A 2WNUC 3N9LA 1BZKA 1AJKA 3NAPC 2DWEC 5T55A 4NYKA 4Q0VA 3FYEB 1JHNA 5CA6A 3AXEA 2ZGMA 4LIVA 2B4KA 3A23A 4NRPA 3B09A 3WF3A 1NT2B 4XXAA 2VL4A 1ZX5A 3UO2A 4ASLA 4CP9A 3MW4A 4L9BA 1UL9A 4DUVA 4DV4B 1EN4A 4IL6Z 1O3SA 1GM8A 4EROA 2BBAA 4G9SB 1OQEA 1PM9A 3G80A 4XFAA 2B9UA 3MIDA 2R16A 4BQ3A 4IE4A 2IXCA 2ZIOA 3E8GA 2PI4A 2Y6FA 4IV3B 5HV0A 2WLJA 4E27A 4NHLA 3TNPB 2DBIA 4BMEA 1DGRA 4CH3A 2L9LA 1VALA 2OQ7A 5APAA 1GANA 4NIIA 4IEZA 1SF9A 3LQCA 1B35B 2JG8B 5L3CA 3J8F2 5HCFA 3VD5A 2B9ZA 5IK4A 4HN1A 5LL6Y 2R072 1I94O 1N34O 5JVVA 2GSMB 5F9TA 3WW4A 3CMEV 2XKOA 1QJU1 4WCEV 2WWSA 3OGVA 5FZ1A 2RVAA 1S2BA 1W8UA 3JXSA 4E4SA 5J09A 4Z2WA 1S1AA 3AP5A 2WQ4A 4IGPA 4YJ3A 2WAMA 3THTA 2A06H 3SYQA 4O4JA 1DGWA 2BVVA 2OX0A 4YW6A 1UD1A 2FZ1A 3TCUA 2ATFA 3POFA 2BV4A 4PLOA 2RS31 4UFLA 3M3EA 4LORA 3SNMA 4QPWA 1AX1A 5FY5A 2C26A 5LHIA 1J83A 2HHHB 3P3PA 4GXLA 5DECA 3FE5A 3RNSA 5FZ3A 4DUZB 1G9DA 3E89A 3OR7C 3FUOA 1XU1A 1EUTA 2Q1FA 3WD5A 1GOHA 4I2OA 1AYM1 1V6OA 3C3VA 3D82A 3TK1A 5JZGC 4NIAA 2EIMC 3HEIA 4LEJA 3ZPYA 3HJRA 3RT3C 2VMGA 2NP0A 1QNYA 4Z2AA 2PHTA 5I8SA 4BIFA 1AYN3 1WB7A 3VKNA 2HEPA 3GALA 1F8VA 1BCXA 4LF7B 3ASOC 1EN6A 3S0MA 4XABA 2IFWA 3UT0A 3N2GB 4AW7A 4E9KA 3CZUA 3ZN4A 1STMA 1AR92 2WZEA 2NYYA 5HPOA 4JAAA 2QJVA 3I2KA 4X65B 4CEWC 1C5IA 1ONAA 1REFA 3S5AA 4EWEA 4L92A 3UKTA 2O1QA 3HKEB 2EILB 2WAOA 4FPLA 2RJ2A 2JEXA 1CIYA 5T50A 3CRQA 2QFEA 4LWSB 1JBCA 5ISLA 3I7DA 4FIPC 2C5DA 3JQXA 5FLJA 4DV6O 3K51A 4YG0A 4D69A 5BNOC 5AFBA 1N32O 4HETA 1AI5A 3UKNA 3HKDB 3J7HA 2RV9A 1K3EA 2SLIA 2VMEA 5I0SA 3ZN6A 1K33A 1DZRA 3CCUV 3JQWA 4CTEA 1MQTA 4ZU7A 1X8EA 3H1WA 2HWC3 3HKBB 3KQRA 1QQP2 3OGRA 1MSDA 4Q8LA 2DQ3A 4KHPB 2ZE6A 1VMJA 3ZN0A 1G6UA 3OR6C 4Q8KA 1ZBE3 5JAXA 4UT5A 1TQ5A 3SLIA 1NZ6A 3CJHA 3UGFA 4QQOA 1WBLA 4UB6Z 1NTKH 2P2KA 5KHHA 4YNIA 3NVCA 3E22B 4YHHO 4BISA 1UYXA 1QJY1 2E32A 3OTFA 2OIEA 4XF9A 4AQSA 3ICXA 3TXSA 3TBDA 4HAMA 3IAPA 2DF7A 1OHHG 4XF4A 2IJHA 3ZMZA 5T5PA 3CRRA 2QM8A 2GDFA 1M4UA 2Z3YA 4XXPA 4CXWA 2VR4A 1ND2B 1U96A 4LNUA 5H9PA 3DUIA 4NMIA 3M4FA 1P49A 2UYAA 1WJZA 1WP7A 3I8TA 1KXGA 1AZDA 2Q4PA 4XJAA 3ASIA 2LJ2A 1JJ2U 3AP6A 5FQ0A 2VVFA 3KHCA 4DV3O 2M6YA 1MABG 1HB2A 2YIDA 4Q26A 3ZIWA 5CEHA 1GV9A 4LFBO 2NN4A 2VOWA 5C8WA 3RPQA 4ZKTB 2QQMA 5DUVA 3ZFFC 4IL7A 1O9GA 5FPRA 1Q8QA 5BR8B 4CP1A 1VBA2 2QKSA 4AFDA 2DDUA 3P32A 2UXDO 4RFT0 1R3LC 3CPWU 2J1TA 3O1OA 1OCZB 2O57A 3NNJA 1LKNA 4J42A 1LOFC 4XE9A 5FY9A 4DRVA 2FMYA 2BVBA 1HX6A 3ZFFB 4TQFA 1RVF2 3LSEA 2PLV3 4NXNB 3T1MA 1ASJ3 3D6EA 1N1YA 4TN7A 2YYOA 2W2IA 5J98B 5FZMA 4AQYO 1HW5A 4Q1RA 5ANQA 4X1IA 2BU9A 4QPGA 1W9YA 2RDRA 1NOVA 1UMHA 3K0GA 1ZRCA 3WDVA 2PTMA 1QNMA 2BGCA 1X9TA 1KMIZ 2VUDA 1ZAUA 1IXMA 4G4FA 5I8TA 1KEXA 4LO6B 4WVMA 2J7MA 5BXXA 3MLJA 5FMBA 4Y4YA 4AL9A 4A3ZA 4OHXA 5DDJ3 4DV1O 2MEV1 5C5UA 3N9OA 3IIAA 2EZOA 2AHYA 1LECA 4LITA 2ZZQA 5DXDA 5JH7A 1YLLA 4YVWB 3MBWA 1V6JA 3QG5A 1K12A 5T5OA 4OHYA 4FPYA 4AQTA 4UBHA 2I45A 3HAGA 5CYYA 3SKJE 3I49A 1PV0A 4RQPB 2ARXA 4I9WA 2H8PC 2OYQA 1OD3A 1T2XA 2H6CA 4I4TB 1FXKA 1O6UA 4ARXA 1JZ7A 3FN9A 1KUQA 2DOSA 1OA4A 4TLGA 4IV3A 2OIGA 2Q73A 4IV1C 1OH3A 4NE9A 2QR4A 2DVAA 5F6KA 2R1BA 3CC4V 1FXHA 2ITCC 1WMEA 2IXLA 2VW0A 4GULA 4Y1VA 3LA3A 4UCUA 1XMOB 4LBJA 1PIV3 3VDBA 1B35A 4IEXA 2WO3A 2QQLA 2UXDB 1ZL8A 5A7NA 4JGYB 1YWKA 3ASNB 4DY3A 3BKZA 4K0KO 1OCZC 2TBVA 2JVDA 4FLTA 1OCOB 4N53C 4W4LA 2ZCWA 5L7OC 4H14A 3ZRXA 4B1MA 1YDXA 4MGKE 2JENA 4NWWA 3JASA 4CDQA 2PAKA 4YVSB 3M3OA 2PYJA 1DQ2A 4Z92B 3I3QA 2LTNA 2WT1A 4QPIA 3P1IA 4YM2A 2CDOA 3E5QA 4KI5M 1XILA 3HNMA 1ENVA 3U75A 3VBBA 2E5LB 2H6BA 4GB31 4BWOA 3O1UA 1HW7A 4X62B 1Y74A 4DR3O 2VCCA 3OEBA 1JYWA 3UYJA 2R9RB 2A9HA 1HRI3 1N3OA 2EXIA 3VZMA 5KC5A 2RHPA 5F32A 4SLIA 4NR1A 4XW3A 2GAUA 1V55B 4D7TA 4QXKA 4WVVA 1F4AA 5JR7B 1YI2V 2W91A 2GP3A 2VZSA 3THOA 2RJKA 3Q8BA 2X29A 2VQFB 3CCMV 1XSRA 3PLQA 4XJ9A 2HJDA 4CEYA 1CAVA 1VRH2 2XUMA 2UXCB 4QGNA 4BK5A 5LA1A 4X20A 4ZHQA 4KNCA 4C90A 3WT3A 3CLPA 4PQQA 5BXZA 4L11A 3JCUZ 4LNUB 3AK0A 3MW2A 2MEV2 2C0ZA 1H2MA 5JIUA 2D3RA 3MICA 2XLFA 3CS5A 3NJVA 3H1MA 3JARA 5BNNA 5CBHA 2HP8A 5LGTA 2HWE2 4K6BA 5B1AC 3PHMA 4GWMA 3POSA 4BQ1A 2HG5C 1A6CA 1SDDB 3QTCA 2D93A 4FVMA 4XFGA 4I0XA 3KV4A 1W03A 2WZR3 5DN6G 1RITA 5FP9A 1TME3 4MZUA 4IIJB 5FJHA 4TTGA 2GSYA 2UXBB 4RUEA 1YIFA 3RVZA 5ABJC 2WNEA 5L7OA 3MIGA 1VQ9V 5CB4B 3GZTB 2AW9A 3ZCCA 3POYA 3KV5A 5EWSA 4QHZA 3I59A 4LBOA 4Y4RA 5C33A 2P3JA 4CEWA 4R50A 4A44A 3GZEA 3T1YB 4O61A 2WNVA 4RGKA 2ZR2A 2DVDA 5LATA 5A32A 1PZ7A 1QR9A 1CP9A 3P5BA 4DR1B 1KD7A 5K1XA 3HPNA 2MK3A 3TAYA 2B42B 4B29A 5A3PA 4Q4X1 4Q4Y3 2RR12 1EV11 3P3NA 4LHKA 3MLLA 4DZGA 2WWUA 1H38A 3ETQA 2WLQA 1WPBA 3BPZA 3ORJA 4HYOA 1DGLA 2VOXA 1O91A 5ACA3 2IM9A 1QJY2 1PVC2 1OUXA 3AXDA 1QJFA 4XFCA 1X9PA 2EIDA 1XMOO 1UY2A 1GQPA 2QGNA 4FO9A 4FQZA 4FT8A 4KG8A 4IGQA 2ETNA 2EIBA 1VB4A 3CJHB 3WF2A 5CZKA 3VOUA 4Q29A 5IJ0B 4Z82A 2PQQA 3AFKA 2CSGA 1QLEB 2QBXA 4DW0A 4C7UA 1JOYA 1Y76A 5EJZB 2KM2A 4UW3A 4MGZE 4NJ4A 2D44A 4FPHA 2DU0A 5JJEB 3EXUA 2D98A 3BOPA 1B35C 5FIXA 4BIUA 1RIRA 3UKVA 4JI8B 5LGNA 2D5FA 1VRH1 5FXWA 3PUQA 1S0CA 3IAYA 1T5EA 2CTPA 3ACFA 3I5DA 2LFSA 3E6DA 4WZCA 4U7OA 1IBKB 3WW1A 2JECA 3K03A 4YZ4A 4ASKA 1LUVA 3H9VA 1CZTA 1SPPB 1EZJA 3NJYA 1YXWA 3D36C 3RYIB 3WEZA 3NNFA 1PO22 5FMCA 3JD72 2GTAA 5KWRA 2AEYA 1NA1C 4D6QA 3W9AA 3IDEA 1JU4A 3ZXKA 3WINE 3IJ4A 1VAKA 2DJVA 1W2AX 4EN8B 4IW3A 5FZGA 3MEPA 4M00A 4X6RB 2EICA 2IXKA 2WNVB 2XKPA 3Q8EA 1K4DC 1H8HG 4PA9A 4H55A 4P5YA 4ATEA 5CFDA 2V09A 4QXHA 1A32A 5FYVA 4XAEA 1ND3B 3POEA 4FLWA 4JI0O 4MUVA 4GMP1 3TGUH 2EJ7A 4B3RB 1OHFA 5L3GA 4CP2A 4DO0A 2IXJA 4IGGA 3RBZA 1JZ4A 3USUB 1AJNA 3VDDB 4BLJA 2W95A 4A4AA 1ZA4A 2GH2A 3WXPA 1AR81 2QQUA 3RW0A 3BCWA 2A79B 3CQOA 3EFFK 1GKBA 1LTEA 3P30A 1EUUA 4WM8A 1KRIA 5F2VO 2BOJA 2HWC2 2DUOA 2ZDIA 2HKXA 3O0WA 1GBGA 3K4DA 1SKVA 1PGW2 4JAVA 5E79Z 5LY2A 3ZRWA 3JARB 3IAQA 4GB32 3NRUA 3U10A 1YJ9V 4B4PA 2WO2A 4CP0A 4PJ0Z 1UX7A 4DIQA 3BB6A 1J58A 3EHKA 1QOOA 1R1A3 1QDCA 5J1XA 1OLME 3N2KA 3M8AA 2P6CA 2D43A 4QPGC 4UOJA 3ZXJA 4CDUB 4COZA 1PO21 5LMUO 1UYYA 2LW1A 4CCMA 5C3RA 3ABLC 1LENA 2XJTA 3AG1B 4Q4X3 3SCHA 5IYCO 1ULFA 2FMLA 5DUXA 1A78A 1RUC3 5FPLA 1COWG 1FMD3 2PHDA 2Q1MA 2JIGA 3ZVXA 1QWRA 5FYSA 3X2QC 1NX9A 4WFGA 1Z7S1 5ANNA 3S6PA 2DVBA 4JI3O 3BFRA 3QVNA 5EYXA 1ZBA2 2E75B 2BCCH 4GYCB 4FLUA 3PN1A 3WW2A 3ZYGA 2DTYA 1RXFA 3QNEA 4C0HA 3BPSA 4XIKA 4JYAO 4DR6O 4IHJA 3JZVA 1ULPA 4XPVA 1REDA 1ZZ6A 3VDDC 1KFUL 2OIIA 3ZJZA 3CBNA 4H2AA 4R52A 5LA0A 2CTWA 2A3YA 4FPOB 4F8AA 4UAPA 4WVMB 4E8DA 4UYBA 3I56V 1NLRA 3VDCA 2OW4A 1WAZA 3Q8FA 1BMFG 1W2UA 4X8PA 4ZOLB 4CS3A 5K1PA 3T4ZA 1E79G 5FZBA 4OVEA 3AMPA 5FYMA 3HBKA 3FFZA 1B3QA 1GMGA 2AUYA 1BHBA 3LAGA 2PHXA 1SZBA 3K46A 4S2FA 1I5YA 1DGRN 4ISQA 4CU8A 4W6XA 1Q5OA 4AVTA 1G9CA 5FY8A 2YEVB 2RMKB 5JQGA 4FLXA 5BPXA 2UY8A 3KT7A 1LJ7A 2VW2A 1CAXB 1IDSA 3UO3A 4CCOA 3NWKA 3VGIA 4P5HA 5E89A 4P2ZA 1LULA 4YW5A 3GBFA 1L7RA 4XVHA 1UU4A 4Q0QA 5BZBA 5FO7B 1US3A 3W5NA 3O12A 3NL1A 3NV2A 1C4RA 1M9NA 4HFSA 5D8AC 3VBFC 1DQ5A 5H9RA 4XDQA 5BNPA 1D0GA 4FZ0A 1ZUQA 1MS4A 4DYLA 1S77D 4JKLA 4H0LB 2Q30A 2NLRA 4O4LA 1WUVA 3W21A 2HHHO 5LP6C 1RUF1 1AR91 2X09A 3WSOA 3BVOA 2UU9B 4JDOA 2BPA2 4QGMA 2WBKA 4CUBA 4QAWA 4A7YA 4AHYA 3VKLA 1W0OA 2OYZA 5IK8A 2VZRA 3EB7A 4RAIA 4AEDA 1MZ5A 1C5HA 3FB8C 3WDXA 3CP1A 4GT1A 4YZ5A 3GWOA 4O65A 2BOIA 1XJAA 3K75B 3VBOC 1XL4A 5C3SA 3S30A 2VUAA 4XMIA 4Q4Y1 4X64B 4IEQA 2P67A 2EINB 5FRAA 2E63A 1JYIA 2WNUA 2Y0IA 1VBB3 1NTMH 3ZRSA 3KD4A 1UZWA 2Y4TA 1GWKA 5IYYA 1Q8SA 5ACA1 5AVAA 2DW4A 2XJRA 2EXJA 4KUMA 2V73A 2CH7B 4BQXA 5TSWA 1VP6A 1IOAA 5HFLA 2Y33A 4FSJA 4OHZA 3FAVB 1AR72 1JH5A 4X65O 5T3NA 3WQ0A 4K8XA 1LR5A 2D6NA 4EN9B 2PMWB 1XNDA 3JALB 1Q6IA 5JXIA 2DCKA 4LBEC 1GMMA 4BA6A 1JA8A 1I0HA 2OUHA 1J95A 1X82A 1RTVA 4TYSA 2O14A 2ZXWB 1GQHA 1XPWA 2A0LA 2OPWA 4XFFA 1FPN2 4XBNA 3U07A 2WZ8A 1TVGA 3THDA 3VL8A 2FTKA 4YM1A 3E5XA 3OW2U 2BSKB 3AM2A 2VZ1A 1YITV 1BJQA 2Y8KA 4IE7A 5KAIZ 3I4IA 4TLFA 1XYNA 2DTWA 3WY6A 4PA7A 5CKQA 4KHPO 1DYPA 2KKWA 3LA2A 2WRAA 4HL0A 2W3JA 3BU7A 4C1XA 4AI3A 2EIKC 2R30A 5LGUA 3GHNA 3ZHVA 3B93A 4IV1B 4CC5A 2GALA 2XAJA 1PK6B 3BEHA 1PHMA 5JCOC 4O4IB 1M57C 3AG2C 4RS5A 1NVPD 2QQKA 3AVSA 1N33O 3LDEA 5CAZA 1R6KA 5B1OA 4QPIB 4N43A 3N2GA 1AVMA 4F7ZA 1S72V 1WCUA 4XETA 3ABMB 4YVSA 2PYTA 1O5UA 1ZM1A 1QLEC 1QKQA 2JB4A 4X64O 4FFHA 1UIKA 2ZGPA 4MO3M 4E4HA 3K59A 4CZSA 2EINC 3GNEA 3W59A 4DUZO 1GZWA 4PCRA 1EN5A 1XYPA 5LYJA 1RUNA 2R042 4BW5A 3K79A 4P02B 3J9SA 5A7WB 1JN2P 2WLLA 4PD4F 5FMOS 1Q6HA 3OTOB 3RDIA 2A7WA 2Q0OC 4CDUA 4XBFA 5JMOA 2ZCEA 3K0DA 1R3JC 2PAMA 4I7ZB 3S3XA 2EAAA 1VIBA 4AVCA 2QWRB 1U5XA 3UETA 2VTXA 3D0SA 2CWMA 2E26A 2PXJA 4X20B 1S0FA 3SCGA 1AXZA 4FPPA 5CG9A 4AAXA 5J96B 3VZOA 3LEIA 1H2KA 3N4MA 4WVZA 3KCCA 1TNFA 1RFYA 2EIJC 2CAZC 4Q4Y2 4X9QA 1OQ1A 5LBCA 2D40A 5FCCA 5J7MA 2C6SA 2RMU2 4XYXA 5IAVA 3WNPA 2Q8EA 1KBHA 4H3WA 4JASA 4IEOA 3W7TA 5ACA2 4BQ2A 2ZACA 4WFFA 1QJY3 5F2WA 1G9AA 1AJPA 1Z5VA 4IHJB 1GNZA 1AYN2 1VBE1 3FFQA 1W04A 1CJDA 1RUH2 4QQHA 2R1DA 4HT1T 4PDVA 1QEXA 4MW3A 1QJZA 4FTBA 3OE7G 4FMTA 3H1KH 3MUZ1 3MF6A 3N9MA 3VBOB 3WUDA 2BEOA 2QUOA 3APOA 3OB8A 4FLYA 3BU0A 4MGYE 1SC5B 1I7FA 4KH9A 1OFSA 3LUTB 5CU1A 1KGYA 4YY3B 2AC1A 2GNBA 4M3CB 1C8M2 3CRCA 1FJGO 3B3QE 1I5XA 4WVWA 4Q20A 3OPWA 3SMHA 4JI6B 2VWKA 4JTDB 1F9KA 2B5UA 2XBO2 1N3PA 3BI3A 1YIJV 4YG6A 3TN93 5F3GA 2VECA 3FZ3A 3NV3A 1NYWA 1GSLA 1OCRB 1VPHA 4ZU4A 4OMCA 3KM5A 2R062 1ENSA 2ZHLA 4DOUA 4AG4A 4GKKB 2XUEA 1M4WA 4FOVA 1NR1A 1C1LA 2W47A 5FZ0A 4ASUG 1H9PA 1N47A 3X2QB 2GC2A 2R0FA 2AYHA 4K3AA 1I08A 4FOQA 4N7UA 4JTAB 1VB2A 1YFUA 2HLEA 4WFAV 1BEV1 2WS93 4LO7A 4J11A 1VQ8V 5SV5A 5JH7B 5H6RA 3B01A 1BZWA 4AFCA 2E74B 4X6QB 1XMQB 4H7MA 2LM3A 2LP7A 3K2OA 4NAMA 2K9ZA 1N36B 5CFDB 4OI2A 2Z69A 4YIPA 4LBQD 4IESA 4EE2A 4WBNA 1JUHA 2DCJA 2P5OA 1JMUB 2K9PA 4YIOA 3POWA 3RVHA 3C8XA 5A7QA 5EZWA 3DKQA 3A0NA 1KQRA 5LBBA 4UW5A 3L73H 1GZCA 4Y20A 2P34A 4IE0A 2BWAA 5CBLA 3LOBA 3LKJA 4QNHB 1Q8IA 2A3WA 5KC6A 2GNMA 2Q8DA 4XCAA 5KXEA 1GKFA 1P7BA 4TQDA 4XJZA 4JGYC 3ROUA 3AB0A 2Y48A 1RUI3 5JCOA 3ZOIA 4XQWA 1US6A 3I3MA 3D0JA 4QQ2A 1D0HA 1K34A 4LF8B 3VD7A 3MV11 1DU3D 3ZX6A 1AR83 4AVSA 2BNNA 2YXHA 4GA9A 4WM7B 5FPUA 5FYYA 1VBE2 3AYAA 3ZYHA 4QMAA 4JGSA 2Q69A 2VS0A 3AMMA 4B8EA 3F2ZA 1VQKV 1YI9A 4IE5A 4WM8B 2XJVA 1MEC2 2VRZA 3LD8A 3B77A 4LQRA 3CZJA 4HPKA 5FZ6A 4AGRA 3K4ZA 1QOSA 1D4M3 1K45A 3IPVB 1FMD2 4CCJA 1DTOA 1W6OA 5HXVA 3OGJA 3AKPA 2GZWA 2DU1A 1ENXA 4DW1A 1RHI1 4W50A 3WQBA 4D7SA 3QD6A 2MNGA 4TZDA 1WCSA 4HANA 3JAWA 3PUSA 3SH5A 2OZ6A 1HDJA 1PGW1 1OVSA 3E97A 4NB5A 5L3DA 1ZSPA 1ACCA 1UZYA 3SKVA 4IV3C 3O7OA 4C1WA 2Y6KA 4FPEA 1ND2C 3RJRA 4OPAA 3ZMUA 1VAVA 5J2UA 1POV1 2HBTA 1DF0A 1BHAA 4XDOA 4ZXKA 3VBHC 3QO8A 4HK8A 3OM3B 4Q4W2 2J42A 1NZCA 3GJBA 2BFUL 2DN9A 4FTSA 1MZEA 4KGGA 1DZQA 4PHZA 3VBOA 3FHIB 4LFCB 1TA8A 1W2OA 2B1IA 2Q8OA 1K5QA 3K77A 3D3QA 4JI6O 3VBUA 5K8SA 3BTXA 2VMCA 2QQVA 3MPPG 5A3NA 1FFXA 4FVVA 3LEGA 3IBMA 1H1MA 3S7IA 2FDIA 4GAZA 3L70H 2UUAO 1QXJA 2YUAA 4CCKA 4G27B 2W0FC 1DK1A 4OZOA 3RI9A 4XIOA 2JX9A 5FZ7A 2AGAA 4MXVA 3RWKX 1BMV2 5EBWC 1VQOV 4FXKB 2F4VO 1R091 3BAAA 4O9EA 1OBNA 3AK3A 1VQNV 2WQZC 1S0EA 3SHRA 3JASB 3KS7A 3GYDA 1GOGA 1TMF2 4JYAB 3CE2A 3ABKC 1OV9A 2QKDA 1PVC1 1BQZA 2BBVA 2JDIG 1DYOA 1W3VA 2WN2A 4LBQA 5F3IA 4BQ4A 1JZ2A 3IKWA 5AG2A 1ZL8B 3RYCA 4QPYA 1N36O 1FT9A 1M06G 2GMEA 4DK0A 3FLTA 1LODA 3WHUA 3ZXLA 3NNMA 2RS53 2AGSA 4TUYB 3NV4A 3MAQA 1SA0A 5EYYA 5LA2A 3IDCB 2NMNA 1J59A 4DB5A 1E5HA 2MHFA 3CRAA 4LE4A 1NUKA 3ZKYA 1PO13 3VBFB 4DY5A 4WBBA 2HVKC 3FHAA 1W0KG 2MEV3 2F95B 1NKDA 3ZSLA 5EBMC 2FYUH 2DFCA 4K40A 2YGLA 4HSLA 4HZ3A 4B7EA 2CV6A 2VH9A 3ZR6A 4OYUA 4LOTA 4YG3A 4M4PA 4MXWA 3SJQC 2HWF3 3H01A 4BXFA 2X5IA 3FX7A 2WWWA 3THPA 3CHXA 1C57A 2HWD3 3DC6A 2GU9A 4WV8A 1VQ5V 4Y3OA 3QO7A 1Q8OA 1ODMA 3ETEA 4ZKIA 1WA6X 1QJX1 1QBZA 4FOYA 5L7OB 4JPRA 1Z78A 4XZUG 1NAEA 5JJNB 3I2HA 2DURA 3K3NA 4JZGA 2RS33 4AE2A 3IGAC 1DQ1A 4JI2B 2CDYA 1UQXA 1WA8A 5EXOA 2ZHMA 1H8TB 4RR3A 1MS9A 1H2NA 4YFWA 3UJQA 3VKMA 1TVKB 1WLEA 2JGDA 4NHYA 1AR5A 4TWTA 1XOYA 3LSDA 4N43B 3WDYA 3GWKC 3MD0A 2R49A 4GQ7A 1DF4A 2VQEB 5BMVA 1BVP1 3WP4A 2WINB 1F15A 4TV9B 4B3TB 2VNGA 4AEKA 5FREA 1WMDA 1W05A 1PO23 4UVBA 4CPBD 5KX5A 1DQ6A 4MV2A 1GOFA 1I3HA 3L71H 5A7WA 3OBZA 1VF6A 3CC2V 5C9AA 4Q2FA 1Z5WA 3KLSA 1VQ4V 2P3YA 4BE3A 2HWE1 5FYUA 3DXRA 1REEA 3PIGA 3M70A 1PVC3 2FDGA 2DYSB 1NG0A 2RE9A 4LOSA 4QKNA 1XE8A 2ZGNA 2D6KA 2ENRA 1AHSA 4J1WA 5JSRA 1N32B 1EPZA 2QSAA 5FKBA 3ZHTA 1R64A 2HWB3 5HBAA 1N1VA 1W6QB 1QJU2 1XL6A 4D6TH 4IETA 2ATKC 4B1LA 1XYOA 2PF4E 4E2GA 4UFKA 2AZ0A 3OUHA 4Z1VA 1SFNA 4AFMA 5D2AA 5K4LA 4BZ4A 1JHJA 1HLCA 2X53S 1WZXA 3MIEA 4NPRA 2BP6A 4BM8A 5D5PA 3UT5B 5D5QA 4Q4V3 3DECA 4QHOA 2XLAA 2QQWA 1NE4A 4LR4A 5LB6A 2BSKA 2BTVC 4L0PA 5D8AB 4Z07A 4RGGA 1B6QA 5C93A 1ASJ2 1HXS2 5BV6A 3S57A 1FXZA 4TWKA 4JGZA 4LT5A 5FUIA 1IS6A 3KKYA 2VZQA 5H9CA 4DV2O 1OCCC 4R4ZA 4X66O 1X36A 1HRV1 4M0HA 2JS5A 4YGBA 5F5CA 3OGCC 4Y1YA 3LEKA 3G7DA 2ID4A 5IW0A 5FR3A 5A1AA 1OKQA 4PF5A 4QE9A 1UY3A 2IVJA 3LWCA 3ZEDA 4LLOA 1WLTA 3ZN1A 1GNYA 4BH9A 5DM6V 4I55B 1OURA 2WNVC 3H8RA 1OF3A 2ZE7A 2L6LA 2VUJA 2Y26A 1I5ZA 1W0NA 1V54B 2RM22 1UKRA 2IH1C 4CH6A 5FPBA 3PVNA 5BNNC 1P4RA 3H1HH 2NZ9A 4META 4L8QA 2XVLA 2VCBA 4QX3A 3ZS8C 2HYXA 4N9HA 5A70A 2LGQA 2DVFA 1G86A 1FX5A 4I9QA 2W1SA 3OY8B 1L8DA 4E4ZA 2W1UA 5I0UA 1TUBB 4LC1A 3OCPA 4MG2A 1PNFA 1NBMG 3LCPA 1QHTA 1EP0A 4WM8C 3T0DA 2EBOA 3A0RA 1PNLA 4LUKA 5B1NA 3FLRA 3TYJA 4EN0A 4A7KA 1AP5A 3SJCC 1L0NH 2PLV1 3B9CA 2M7WA 3LFMA 4RA0A 1PMIA 1CIWA 1JTZX 5DZFA 3B9IA 1NQDA 4XACA 2RJLA 4RYDA 1XOUA 5GLVA 3POBA 3GCXA 2JXAA 3VZJA 3VZKA 4JHZA 4QB6A 1ULEA 4XQDA 2R063 1PO11 3QLQA 3WDTA 1RUC1 4B3SO 2PY5A 4ZOLA 4AHZA 1QJEA 3H0OA 2ARHA 1FAFA 2JD9A 2ZHNA 3AMQA 5DAQA 4KGQA 4Q0UA 4IQPA 1IBMB 3JAWB 4D7YA 4UCVA 2XHKA 2OWOA 2YDEA 3KVAA 1FOD2 5ABJA 4QGPA 3FX3A 4OX9B 1PM7A 3RFRA 2DUPA 3EO6A 1BEV2 2G9FA 2Q68A 3NMBA 3AJYA 4LKFA 2EA7A 1KS5A 4HONA 4JI5B 5LMNO 1V55C 1R1A1 5EK0A 1WD4A 1WA4A 1OZ0A 3STLC 4CXXA 2YU2A 1FYUA 4GUNA 3K5LA 3DXUA 3RMXA 4HNAA 4C0BA 1ZWIC 5LHGA 2DWDC 3E8BA 2CYFA 3HIFA 4LK7A 3BTYA 5FWJA 3MIHA 4QKBA 3HPLC 2GH8A 1CEZA 4JI7B 2NNUA 1V9U3 3V65A 1RUG3 3WG4A 3C3TA 1VQPV 5B1BC 3FJSA 5C9AB 5CVRA 3KB5A 1QH6A 2JE9A 4GMP3 1FXKC 4FPFA 3R6SA 2QTSA 4XTPA 1C8NA 1RSOB 1HRI1 3FHQA 1A34A 5FL7G 4Y33A 5JMCA 3K9AA 1WMFA 5KXCA 2YB7A 4MGSA 5LRSA 3E8HA 5TISZ 4JI1B 3O5SA 1XXNA 4BCUA 2XJQA 3GZAA 2A3QA 1CONA 1FYJA 1NY72 4QM9A 2V4DA 2PHLA 1KS4A 2ZGKA 2Q5ZA 4PDLA 3ZMNA 5B1BB 5L19A 3FYIB 1Y9MA 4M3CF 3UT5A 2X7RB 2NQYA 2VVDA 1AF9A 2Q8CA 4QHBA 1O5LA 3AL5A 5K0UB 3D3AA 1YQ8A 4M01A 2CAUA 1I9RA 3VN4A 4MOAA 5LP6A 2JK5C 5JCTA 3ITQA 3WVJA 2PHUA 2IBZH 2JDKA 2VGDA 4J25A 4CCCA 3HQXA 2UU8A 3B94A 3UL2A 2XJUA 1HNZO 5BNPB 2IZWA 5GZEA 3V0BB 1GUIA 1D5NA 3ABKB 2IJJA 5FBZA 2IJKA 1MQTC 2X6AA 2QNKA 4QX2A 4ARYA 4GJZA 4WZFA 1AILA 2HBUA 4QPKA 1GZ9A 3CIHA 4DS0A 1GR3A 4LK6A 4FM2A 3JD3A 1Q7YW 2HH9A 2UWAA 1YRZA 3ZFEB 3U14A 3BABA 2VW1A 5GLWA 1I94B 5IVVA 3CJIA 3H8OA 1RB8G 2XAFA 2CGNA 3Q8AA 5FXZA 2EIEA 5CA1A 4LF5B 4CCEA 5FZCA 5IK7A 5F39A 2NR5A 3UCSC 4UCRA 3MIFA 5LWBA 1UZZA 3V0BA 2VNRA 4XF3A 1D4M1 2QQNA 3ZHUA 2VQUA 1W0PA 5CFCA 1SBFA 4J10A 1UKGA 2G19A 5ITZB 2I74A 1SLBA 2W08A 1SRYA 1PK6C 3ZYRA 3AK1A 4RHV2 1G6NA 2ZINA 1XBFA 3ES4A 5JOYA 2QTOA 3RN4A 1X4TA 2CTQA 5DAVA 4MTXA 5KHKA 4XUTA 4PI2A 3WNKA 2GTSA 3B00A 3WF1A 1P7GA 1VR3A 4GD4A 4QB1A 1W6PB 2QZ3A 1RUG1 3RWNA 1IS5A 3ZXDA 1RUI1 1OLRA 5CADA 1XQNA 4OUMA 1ZTEA 1GM7A 1V6IA 1QQP1 4P9YA 2BFUS 1E1QG 4DR5B 1MVQA 4ASMB 2Z0AA 3VD9A 1FNYA 4A2UA 3SPJA 2KQXA 2QE7G 2QQJA 3DYPA 4FPGA 5DG1A 3AMNA 4OX9O 2OZJA 2KG7A 1N1SA 1BHGA 3IDAA 5GALA 5FZ4A 4MVZA 2LFRA 1HIXA 4JI5O 1V00A 3ACGA 1QVFU 1Q3EA 1ZZBA 5BY1A 4NPLA 4AEDB 3ZYJB 3V64A 4DV0O 2B8MA 3RZMA 1GTOA 3K3WA 3G6JB 1ZBE2 4OXSA 5I0RA 5JLVA 1OSGA 3I54A 2P1BA 1HV0A 5GZGA 1UOBA 4BAYA 3H3LA 5HCBA 4CDWA 2E9QA 1F5JA 1MZ6A 5LOVB 5A1LA 5A6QA 1WNSA 3IPVA 1WN7A 5EV7A 1XI1A 4OZXA 2HJIA 3JCZA 1KJLA 1X8MA 2SBAA 3I97A 2UUAB 3CF6E 4JYCA 1M57B 2PN5A 4FFKA 1FFTB 3R4DB 3ZR5A 4X8AA 2G9ZA 5JIAA 1NVPB 1L1FA 3LIGA 2ZJCA 4ATFA 3K06A 3HR0A 4CXYA 1UX6A 2XJPA 4RHV1 2JKXA 4XFBA 3JU9A 1P8JA 4JTCB 1KDMA 2AEZA 1ZNPA 2DQ0A 1JYCA 2WLPA 2AZ5A 4CEYC 1F35A 2WT0A 4BK4A 1PK6A 1ZZ7A 1KITA 1P84F 3ECQA 2VOVA 3AJZA 3VV1A 3SXWA 3DXRB 3JATA 2QA4V 4E8CA 5EYPB 3J7LA 4I0WB 3HB3B 3NXSA 4RQEA 1CPYA 5JJJB 1R093 2N7GA 1PL0A 2YIBA 3POJA 3PVEA 3KZIZ 3O0VA 3OPZA 1U0AA 1B06A 3E83A 1DZTA 1V54C 2RQ6A 5IT6A 1LOFA 3APBA 2G9GA 1ZBE1 4DUWA 2TUNA 1PNKA 3VBRC 1XC6A 2XPJA 2ZNIA 2FD8A 3N7LA 4EYUA 1W99A 1OD5A 2QM4A 3H3ZA 1W39A 2XHBA 1DDLA 3ZFEC 4JC1A 5CIRA 2VCMA 2P06A 3NV1A 2RMU1 4XMAA 1RC6A 5BNOB 4UV9A 1GP5A 2ADPA 2YMZA 5EIBD 4IDZA 4P9IA 3T2OA 2WUHA 1VEWA 3T0BA 5IHRA 1OPMA 4XURA 2JS3A 3KGLA 2IC1A 3LB9A 2BTQA 1Z0HA 3BUCA 1LEDA 3H7JA 1RJ7A 3ST7A 2XNDG 5C4WB 5C3OA 2FBEA 4R8HA 5GZDA 1QDOA 4XHBA 4U3JB 2ZPXA 5FYCA 3HKBA 1AYN1 3KT4A 1J5EO 2JICA 2VC9A 3NKTA 2QQIA 1W9SA 1KKDA 3APQA 1HQLA 3SPGA 3ZN6B 1WW7A 5F5QA 3DGEA 3K9SA 4CA9A 1MS3A 1S5HC 4NTWA 1GRJA 4OHWA 4H7LA 3V0AB 4N23A 5LMUB 4J7KA 2IUWA 5GONB 3AMHA 4V1PA 3PTYA 4JZ2A 3CO2A 2XAHA 2ZDIC 3UESA 4LF6O 1BYHA 1ASJ1 2W9XA 4O4HB 4LO8A 2F23A 5HFMA 4J1XA 4NO4A 4XUQA 1TE1B 4F6RA 3K4AA 1CESA 1KD1W 1IBKO 2VNVA 4CPBA 2EIJB 2E7QA 2VXJA 4B3MO 4EB6A 2YBKA 2P22C 4NWVA 3E5UA 5DABA 2VPVA 3X29B 5KXDA 1AL23 3CMGA 2F4PA 3CL1A 3VBRB 3RG0A 3A7QA 2XR4A 1PD3A 2JE7A 2WLMA 1O4ZA 5T5JA 1JYNA 4LF4B 4RUFA 1OPOA 1CWPA 4V2VA 3L75H 2Q7GA 3TEXA 1L7QA 3T0AA 3UJOA 5BNNB 4ZI7B 4UVAA 4COUA 5D1IA 4CCLA 3STZC 2Q8VA 1VBD1 4BHPA 4LE3A 1S2KA 1WD3A 4M3CE 4FCAA 2YV8A 3M3QA 1GZTA 1TNRA 2XTAA 1NCRB 1CN1A 5A9GA 3VBUB 1IKQA 3HOBA 1VBA1 1B09A 4YWAA 2XLGA 4CS4A 3UQ8A 4FM1A 3ABMC 1FNZA 3I2GA 5GJ6A 5J3UA 2PHRA 4F83A 3MHHC 5E88A 4LIUA 1H2SB 4DO2A 1VBB2 5FJKA 1PKXA 2NPIA 3N2KB 4F6RB 2IFRA 2VVEA 1Q82W 2ZABA 2IH3C 3AZZA 4JI4B 4Q4V1 1LCLA 3ZFGA 4J80A 2OQ6A 4QX7A 2DBNA 2QEXV 5AC92 4YW4A 3J8F3 1UZVA 4NXNO 1RUJ3 2EXKA 1YQ2A 1TMF3 1GP4A 3EJKA 4TT3G 5FPVA 1BSMA 4W8JA 1LGBA 4AQYB 1JI6A 5IYDO 1NLSA 4AOCA 5B3SC 4XFHA 4W65A 3RYHA 1YHFA 4LBKA 4JGYA 3C3SA 2A6WA 3AVRA 4MVRA 5KHGA 5J2TA 1ND2A 3LZZA 1U97A 4AFAA 5DQ0A 4DINB 2EALA 2K2SA 3J7MA 4PA6A 1I6XA 2WSVA 4DV3B 2WLHA 4CCNA 1KB9F 4FXGB 2BOBC 3RRDA 4LTAA 2VQEO 4DV7O 2BNMA 4PA3A 3H1JH 3O1SA 4J6GA 3J80N 2XOMA 4R6ZA 4OQ9A 4YYOA 2JDAA 1H8EG 1M56B 3UGGA 5HV4A 3OUIA 1NA1A 2B46X 4G2KA 3MI8A 1SLLA 3OD4A 4CEWB 2OT7A 4COYA 1HR0B 3O14A 1YZBA 1AJQA 2W52A 4E4DX 4O9GA 2ZXQA 1JUIA 1YFXA 3T30A 2A5ZA 4UV8A 1OA2A 4XAAA 3W7XA 2XB6C 1V6NA 2HWF2 4XUOA 1NCQC 3JAKB 4A45A 5A3LA 1VJ2A 1FS0G 1NY71 3SPCA 3A0KA 2V7QG 3DSQA 4FJCC 4OQ8A 4QDRA 4P08A 3JD71 4A42A 4FAHA 2D6LX 2QE3A 2KA3A 2XJSA 4QT6A 3OUSA 1IBLO 1QVGU 4FP2A 5FZLA 2P5BA 5C71A 4MS2A 2EAKA 5FFOC 5LMNB 3ZMVA 3L9JT 1E5RA 2FDKA 3JYCA 4LP8A 1YSCA 2ADQB 3G71V 4K3UA 1NCRA 4X1YA 1VBD2 4BQ5A 4HNAB 4PF1A 5F3CA 2YS8A 1DHKB 5FLHA 1IKPA 4K7JA 3VDAA 4KQ7A 2Z4FA 2IJIA 2R72A 2LGWA 4URAA 4PLNA 4JCKA 5I91A 2PAEA 4BJ0A 5IJ0A 3B69A 1R1ZA 4EN6B 4G3YC 3JAMN 1O4YA 5F5IA 3CCVV 3SITA 1QR8A 2CAVA 1APNA 4LKSA 4XHXA 3EVKA 4LUMA 1IZ3A 5BNPC 2UXXA 1CAVB 1NCRC 1MSWD 2E33A 4GKKO 5AFEA 2RN9A 2LROA 4BQWA 3VUOA 2BTOA 1N33B 2XWBB 3WCRA 5FZDA 1D2DA 5EPAA 3HKDA 2YI9A 1PX3A 1OF4A 3VL9A 2BGOA 3W7SA 1W8FA 2VZTA 1DGSA 3JD1A 5FDBA 4DV7B 1OA3A 1ULCA 4RHV3 2RDCA 3O65A 1EAH3 4MTFA 1XMQO 1HNXO 3AKQA 1QJX3 3LFIA 4K0KB 4LFCO 2DYCA 4YM3A 1GN2A 2WIIB 5D8AA 1JX9A 4AQ2A 3OBTA 4Y1UA 2XL9A 3PDQA 1BE3H 1QJU3 1NH2B 5G04L 3BIEA 3I2IA 4FFBB 1GU3A 2ZR3A 1QH7A 3E6CC 4ET7A 3EBRA 1OVPA 3VQXA 4Z1MG 4JI4O 1SQQH 2QJ1A 4GX0A 3VB9A 4DPNA 1RYYA 5FV3A 1JW6A 1PGL2 3OGIB 5CB4A 1PP9H 2ZMKA 2NLJC 2YPDA 1RXGA 4J9ZB 2A3XA 2YHJA 5FYTA 4TV9A 1YQCA 4CU7A 2JG8A 1E5SA 4DV5B 4FTEA 2HKOA 5FOBB 2BERA 2VQAA 3KHBA 1IBMO 5A7PA 5F5AA 4CC6A 3FL7A 2KSDA 2YIBD 1NQJA 1LGCA 5I8YA 2YFZA 3IMNA 1K5MC 3BGAA 2IU0A 2WLKA 3ZFGC 1MNGA 5H9QA 3VQVA 5IK5A 2P3KA 4I30A 4MSVA 2EXHA 4EKWA 1YNAA 3VHOA 1W2NA 4AEJA 1KKCA 2ZAHA 3SQOA 1WA8B 1GWMA 3LDCA 4BOWA 1LHVA 3E35A 4XJUA 4PDRA 3FB5C 1QOTA 5FAXA 2WN3A 3VD4A 4PI0A 1YYNA 2RMU3 4JTOA 3AZWA 5L3FA 4ONUA 1H2LA 2H3OA 1K5MA 2RJZA 4N90A 5JOWA 1LB2A 2J1UA 3VZNA 1SZXA 2Y6LA 2JB8A 3KF3A 3KVBA 1DLCA 4EWDA 2ZOEB 5FMOL 4HK9A 4AF9A 2XT9A 3LNMB 3NSTA 2WLIB 3AKTA 4QPIC 5FPZA 3BIWE 4JRLA 1VBC2 1UOGA 1MS0A 3C7FA 3OF1A 2E7TA 3D5OA 4LBQB 4LLFA 1HN0A 1Y3TA 3RZZA 5B4NA 3B2EE 1GNHA 2ZTNA 2XH6A 5KX5B 3BYWA 4FI9A 4AEMA 2XAQA 5C3PA 1POV3 3CRMA 4QU1A 5A2QN 1WKYA 3EMRA 1F7YA 2CHHA 5FP3A 1SETA 3OTOO 1W6NA 1JZ5A 4P9PA 5KA6A 3PL0A 2JGDB 3I55V 5A33B 2A6ZA 2DCYA 3WX5A 2DE0X 4PDWA 4FFFA 1Y4WA 3PJSK 1PIV2 2VMDA 3TN92 1LOGA 1UOJA 4MW8A 4E2QA 1SS3A 3WNLA 1RUOA 3FBMA 4CRQA 3H8XA 1CAUB 1XB9A 5EYPA 2EULA 2FHRA 4JF3A 2TEPA 3ZMTA 2XVKA 2WLIA 2F4VB 1A8DA 1W6NB 1T6GC 1JZ3A 1AR71 3F95A 4CP9B 1WCDJ 3AG4C 2R0HA 3CEIA 1AX0A 3RJ2X 4YLZA 4JQRA 1S0BA 4O2BA 2E76B 1DIWA 1Q8VA 3W20A 5M0TA 2RM21 3ZRWB 2Y69C 5FY0A 3H3UA 3WHTA 5FZEA 1R081 1MPXA 4DV4O 3GCWA 5DPNA 3T08A 3Q4HB 1S55A 4X89A 4YW3A 1AUYA 2D3SA 1RHI3 2WZR1 2ZGTA 1IG3A 1CR7A 5I0DA 5GTHZ 1U5IA 3WG1A 4YVWA 5F2SA 4AHCA 2HYKA 1NE6A 1Q6UA 5DUWA 2LQTA 5FP4A 4GALA 5GLUA 2ZIMA 5J2UB 1LU1A 1AR63 2P17A 3H9AA 3QF7A 2QKAA 3JSLA 2P90A 1OKOA 4ZONA 4LA2A 4DR1O 1QQCA 1Y66A 3GDBA 4DR2O 4PA4A 5IATA 1MVEA 5DAXA 4JTNA 3HQUA 1RSOA 2BTQB 3PURA 1SQ4A 4YZ3A 2ILMA 1FKAO 3MHSC 1K5JA 3A2FA 3J4UH 4Y22A 5L9RA 4CUAA 1JQ0A 3RYFB 4UCTA 4LFAO 3ZIXA 1HQNA 3B8NA 1AVBA 2JDHA 5T54A 4L8JA 1DLBA 4JI7O 3ZX7A 3AG2B 5IE9A 4UFMA 4RWUA 1LAJA 3C7GA 3VQYA 3NAPA 1ZREA 1RM1B 3MO4A 4E4EA 5GLZA 1TME2 4OPHA 4DUXA 1IXBA 2R061 5EQUA 4J41A 1DP0A 5CFCC 4OUEA 5CFDC 3BVCA 3S7EA 1H6XA 2ZKNA 4A3XA 4H13B 1C28A 1WP8A 1F4NA 2AACA 3JBG3 1LOCA 1MACA 3WFVA 1ULDA 1V6LA 3ZDVA 3URFA 4AGVA 2HLDG 3TN91 4BMBA 4NIHA 1RUG2 4LKDA 1KQSU 4P30A 2UUBB 5LA6A 4G28B 5JXGA 2RS11 5I93A 4IXLA 4YZ1A 4JQTA 2WSUA 2WQ8A 3OGGA 4P9OA 2ET7A 3HKCA 4NAOA 1D5AA 4NOTA 1FFXB 4N7IA 4DR6B 4YM0A 4CDQC 1PGL1 1WLDA 3EQEA 3HVDA 1XNCA 2YC0A 5ABJB 3ASNC 5BUVA 1HNZB 3WP3A 5FYZA 2HVJC 1C1FA 1JFFB 1SLCA 4JHTA 1H2GA 4D6RA 4B3MB 5A6YA 1J3QA 4FFGA 4A6OA 2LUWA 1SQGA 1XRUA 2L35A 2VQTA 1B04A 3AP7A 2JG9A 2WFF3 1M90W 4BIZA 5H2FZ 2D3PA 2VUCA 3W7UA 4CVUA 4AAPA 2ZX4A 2B45X 4LPLA 3I2FA 4OGQB 3GBWA 2CL2A 2Q6AA 1MQTB 1RUH1 3PNAA 4NTYA 4A5UB 1HQWA 2WFF1 2VJXA 3J26N 1RUJ1 5J37A 2ZEWA 5LP6B 1JYVA 2VBBA 1H6YA 4ZXEA 3GJAA 1LR1A 3LOIA 1HB1A 3JALA 5IVFA 4AI8A 1W8TA 4KFMA 4KBZA 5L9VA 5C4WC 3ETGA 4P9LA 4NUBA 1FV2A 1AYM3 4ORFA 3OD0A 3U37A 1A3KA 2WO7A 1UFIA 1COV2 2VWJA 4DV2B 2KG7B 4K9SA 4GH4A 2FDJA 1PZ8A 1W6OB 2ZMLA 4FPJA 1Z2GA 2Y34A 5CBFA 4MTGA 4ICGA 4L99A 3SR2C 4MVUA 1UU5A 5IJRA 3DC5A 2HWB1 4FLVA 1VMHA 5F3EA 5IAXA 2Z2SB 1N1TA 4NRQA 1OJHA 2IXHA 4W6YA 3UKMA 2G1MA 4JYBA 4J7ZA 1Y9QA 3ZXGA 5C8YB 4D94A 4RSUA 4U36A 4P14A 2D2CB 1WMXA 5A32B 3HD8B 2A6VA 1XEQA 2O8OA 3KGZA 4S2DA 2JEUA 2HJFC 3DCQA 4LWSA 1H0BA 2CU5A 5DN2A 4LA3A 1UCXA 1ALYA 2QWNB 1WBFA 1CGPA 1EV12 1Y74B 1S0IA 1VQ7V 3TETA 2X05A 4X88A 1TMF1 1S0GA 3CDZB 4MVSA 3G4SV 5IYBO 1BVVA 3E1F1 4JI3B 1KU9A 4J9YB 3CKHA 1VIWB 1C8M1 4YJ2B 4GZRB 2GNTA 2A6YA 1UY1A 2FCUA 2LW8A 4XC9A 1RVF1 3N9PA 4K8ZA 4GKYA 2C2AA 1HWYA 1RL3A 4O4JB 4JZRA 1ZBA1 2E7AA 1SCRA 2RS32 3R0RA 1Q90D 5LYJB 4F6EA 1MEC1 3ZFEA 5JXJA 3O1PA 1C8M3 3ZXAC 4CBCA 1UMZA 1ZA7A 3SGIA 2ET1A 4GJYA 4BWAA 3OYWB 1YI7A 3H8UA 5EBLC 4X1KB 2DFBA 1XSQA 2K46A 4I0AA 3CD6V 4YJ2A 3WDWA 2F17A 5F7UA 3OPTA 4QDQA 2PI5A 4PIYA 1V9U1 2XAGA 3GZUC 4FAGA 4DV6B 3JCIA 1CAWA 2BNOA 1QXPA 4TSFG 4NIGA 3OJBA 5FUPA 3T2QA 1ZYBA 4X1KA 3DPRB 5FPAA 4R7CA 2YIAA 1HP8A 5J36A 1GN3A 2JJ6A 2UUBO 5J9PC 4OCTA 1LNSA 5GKAC 1R083 2F66C 3OBAA 1S5LZ 1YQ6A 4Q5OA 4PDWC 4EZ4A 3C7OA 1RPOA 2ZX2A 2JG8C 2GNDA 3ELNA 2NM1A 4QQPA 2OS2A 1HRV3 3WOGA 5FNVB 5GZFA 2OCCC 1JXNA 1RMU2 1JYXA 5BR8O 2R041 1OOPB 2CGOA 1COV1 1NQTA 3MDPA 2DYSC 3WF4A 2Q67A 5DZGA 2X5IC 2BE3A 4XDKA 2WFPA 3RYRA 5FOJB 2HWB2 2WO1A 4IT5A 4MVQA 3ZXEA 1N4CA 1OQDA 1R6TA 5EC1C 2VZ3A 2XGXA 1HB4A 3WR0A 2HR3A 4WM7C 2OPKA 3USSA 1BCCH 1JR9A 3BALA 2GHYA 2Z79A 1RUF2 3CXHF 5B2GB 5FO8B 2C24A 3IB3A 2OTLV 2JJ1G 3K5MA 1PGSA 4AVVA 1OCOC 2KB1A 1V6MA 1KECA 1U12A 2Y0OA 2Q9LA 2Y6JA 4BR6A 2ZT9B 1VBE3 4YHHB 1ZZ9A 1R092 4AGGA 3I2JA 4IEWA 4BPZA 4XCBA 1CZVA 3WUCA 2RDSA 1ND3A 4MHRA 5LEKA 3NQHA 4E2SA 2UURA 4ZPIA 1F5FA 1O3RA 4COVA 2JIJA 5LHHA 2QWQB 4DR7O 4W4ZA 2WZR2 3KSCA 1US2A 3FWEA 1Y4MA 1S3JA 4BYYA 1AI7A 5CMUA 5IJ9A 1SBEA 3ZO0B 5FYBA 4DRXB 5H9SA 2VQ0A 1IS3A 4HG6B 4YW2A 1WCKA 3WQ7A 4NXMB 1V6KA 3QH6A 4INDA 2R6QA 5B1AB 2Y60A 1CJPA 4HXCA 1VBC3 1VF5B 5FXXA 1DF5A 1UXXX 4RS5B 1OLQA 3PMEA 1W28A 1AP6A 4MVTA 2P37A 4Q27A 1FPN1 4LF7O 1KYOF 1QGLA 5L3BA 2V4VA 1DFQA 3KT1A 4LF5O 1RUE1 3IN9A 5KAFZ 1IX9A 4XOGA 5DG2A 3AYEA 4EWAA 4KL1A 4IE6A 5JOXA 4DV1B 1LESA 3DN7A 4UF0B 3GXUA 1FATA 4XUPA 4XILA 3VD3A 3T4VA 4QPGB 5C8YA 4JDMA 3AP9A 1BK0A 4AI2A 4UUJC 3H7YA 4N53A 1H9WA 4CZZA 2ZX1A 1CQ9A 5DDJ1 4MADA 4UXNA 4CYDA 4I3GA 3ZHSA 3WW3A 3N7KA 4BDVB 1HR0O 1IHMA 1ZZ8A 1AX2A 3IFXA 3K48A 3ME2A 3BHPA 4N8MA 1QMJA 5C5TA 3WG7B 2WWJA 3WU2Z 4BU2A 2JE8A 2VAUA 1OH4A 4JAUA 3AG3B 2W1WA 5GONA 1FJGB 1IPKA 3T1HO 2K1EA 2AREA 3WNMA 2IU3A 3IDBB 4N43C 4QX0A 2FMDA 4ABMA 3VBRA 1WW5A 2W5FA 4DXRA 1T6BX 5FQ0B 5FY1A 4EEQA 1AR73 4CH5A 2Y6GA 2A70A 1VBA3 4NN0A 4GKXA 1BEV3 5IWFA 1CX1A 1IQDC 3GM8A 2EIMB 5A80A 2VQFO 2ZQMA 1F51A 3HMYA 3BTAA 2Q7HA 2JGUA 2VMHA 3O9OA 4O7XA 3A22A 3AX4A 4U3FH 1RVF3 5C4WA 2PHWA 1R3IC 5C3QA 5C9AC 3OFNG 1FPN3 1W8HA 3DTUB 4DV0B 4JGZC 5FY7A 2Z5UA 2OTJV 2R70A 5BY5A 1SBDA 4RR3B 2RG4A 4UF0A 2P3IA 4PJYA 3BCCH 1UIJA 3OEAA 1HNXB 4WBNB 1PVXA 1K4CC 5IFTA 2ETEA 2C1FA 4PLMA 2JJ2G 3UM7A 1OC1A 3VBSA 2VZPA 2ZEZA 2QKCA 2LW7A 1O3QA 2OUJA 1NJIW 3RYKA 2CY6A 3JD2A 1EPWA 1YFYA 4LFBB 1R73A 2VOKA 2Q7EA 3IC9A 1YIPA 2ZKOA 4GZ9A 1K9MW 4MX3A 3FC0A 2VZVA 4AVAA 3PVBB 2WA4A 3LNNA 4Q6GA 1MS8A 1O7FA 2QWPB 4LF6B 1SQXH 4UFZA 1HB3A 3MGUA 3ZHRA 1THZA 3J7NA 2DWRA 1W6MB 5G05L 3IM0A 3VLBB 3IZOA 4CS2A 1SHWB 3ABUA 5F8PA 2VE1A 5LEJA 4I4TA 1DGWX 2JDPA 1E5IA 4B4RA 4BQYA 3ZRVA 4I01A 2Y64A 3AKSA 2YEVA 4LBMA 3W5MA 2VMIA 1OXCA 4EQVA 4GWIA 2EILC 3A21A 1W8OA 4PELA 4OFGA 3KCXA 1XNTA 5CA3A 1HKDA 5AVPA 4DR4B 3JBG2 2EIKB 1X33A 3B5LB 4LF4O 2ZZJA 3J8F1 4IIJA 3OEHG 1TVKA 2UWCA 4LHNA 4YGCA 4GB33 4LH7A 1NCQA 1WW6A 4UW6A 4IYHA 2AXTZ 5FK7A 4I0XB 4S2GA 2Q4SA 1GH6A 4FPCA 1W6PA 3E2EA 4NHMA 1S0VA 1S4CA 3NKGA 3PU8A 2P4EA 1CAXA 5FLIA 1BQPA 3ZKUA 1LHUA 2F93B 4XJ8A 4Y1XA 2YU1A 1IQAA 2Y0PA 1XE0A 2Q0AA 3QH7A 5IUQA 1SLIA 1W0JG 4JI2O 4EFBA 4B3NA 3J81N 3OMNB 3H50A 1U5YA 4CSWA 3PU3A 2YXYA 2X5IB 3DGTA 2WT2A 5GW7A 3KWVA 1N0JA 4FOWA 1YJLA 3M7MX 3H1IH 5HCHA 3T2TA 2H0BA 5JXHA 1UJWB 3JD4A 2CK3G 3WZ1A 4DUYO 3AG7A 2OCCB 1MS1A 1K42A 1NI8A 5T5LA 1UXZA 4GLXA 1WPXA 2VXRA 4H33A 3ZIAG 3HR9A 3T09A 3VBFA 2CDPA 1ZLZA 2UUCO 5J48A 3SYOA 3IMMA 3ZYPA 1J1TA 4KG0A 2QDOA 1J5EB 1M93A 3K04A 2HWD2 1AXKA 1BBT2 2IWGB 2D7FA 3RWRD 1VRH3 2ARBA 3N35A 1POQA 4CU9A 2P7TC 3CMAV 1UW8A 4RFRB 3MW3A 3RZHA 4AHXA 2WLLB 3DKWA 4CU6A 5LK5A 3D36A 1RUE3 1OT5A 1GICA 2LO1A 1UNBA 2CNAA 2VD7A 2G38A 5DEDA 4WFEA 1GN6A 1I5PA 1ULGA 2FQPA 4S2HA 3JB8A 2R9IA 3POIA 3SYAA 4RL7A 4QGLA 1XHZA 3ENRA 2CWSA 1M56C 4FFIA 2K0GA 1LOEA 3ACHA 2NMOA 4XF1A 3SYCA 4GIQA 2YROA 4PBPA 1VRBA 4YRDA 4DQAA 2R9AA 3PUHA 1OOPC 4AI9A 1F4MA 2UXCO 1OI6A 5IDJA 4LBNA 2WS92 5KMGA 5IVCA 5C7GA 1ND3C 2W92A 2O0OA 2X6BA 2RM23 3BA8A 1CX4A 1SG3A 4PDWB 2JD4A 3TWIA 2O8QA 5FP7A 3ZHQA 1BK1A 4DMIA 3L2YA 3HKCB 4AILC 1RUD1 5E8AA 4JV5O 2FDFA 2VZOA 1JCHA 5DAWA 1CAWB 3CJIC 1HNWB 4DRRA 4K21A 1NXD1 2J1EA 1Y76B 3TOJA 3ASOB 4QX8A 1JZ6A 3AK2A 2CGPA 2RR13 3VHPA 2N74A 3U1XA 1QXRA 4HZFA 1UY0A 3A0BZ 2HWD1 1FV3A 4RN5A 3C7EA 2YI8A 4ZIBA 1ODNA 1NXMA 3WP5A 3WB2A 5KHIA 3JATB 3ZM8A 2C4XA 2WJSA 1FAYA 3A4UA 4I02A 5LRRA 5FPXA 4B3RO 4UCOA 2E51A 4B3TO 3F7YC 1N3QA 1R1BA 4GX2A 3MUY1 1FOD1 2RCVA 1HXS3 1JMKC 2GBOA 4KMQA 3E8FA 4LFAB 3R65A 3KMHA 2WSSG 1F31A 4LR3A 5CG8A 4PV1B 2BQPA 3SJBC 2GC0A 5LBEA 4D6SA 2JEMA 5K7PA 3LDKA 2XDVA 2PUSA 1AL22 1FOD3 3JD0A 4Y5Z0 1AI6A 2WS91 2NN8A 2QQOA 1DQ4A 1BGYH 5A7SA 4D3WA 3LPFA 1I1EA 2WNOA 1C3HA 5FZKA 3G6BA 5IYZA 4OULA 4BIOA 3RZKA 1HDKA 1POV0 5FBJA 1XNBA 4UFJA 2J1SA 2GDSA 4K35A 3ZSEA 4YVSC 4FK5C 4YXWG 2N05A 2VULA 5CKMA 3K57A 1XE7A 3J7AU 5FY4A 3WB0A 3T1LA 1GK9A 5JVDA 2XQXA 1WLWA 2UUCB 1O8SA 3U78A 3G6EV 4N53B 1RUF3 4Q0PA 3UNPA 2B39A 4LJHA 1RPRA 4I55A 1MS5A 4XFIA 3VKFC 3QOPA 4LXLA 4Y20B 2ZGRA 1OUSA 4IGOA 1VQMV 4CDQB 4BW9A 3RI8A 4L97A 3HN1A 3K3OA 3PJYA 3HT2A 3PTRB 4Y22B 2JDUA 3S5QA 3E22A 2EX3A 4FLZA 3B8MA 4UFIA 1Y43B 4P9GA 4AQ6A 1UY4A 3B4SA 5JVDB 5ERLA 3RZJA 4DEVA 1RMU1 1S0DA 2ZXWC 4O4LB 5L3EA 3LIHA 1YQ5A 2W6IG 2QM7A 3PUIA 3SH3A 2UXNA 1QLNA 4PIXA 5FNVA 4ISRA 2I07B 2RR11 4HKOA 5CISA 5FZFA 4QE7A 3SCFA 4Y24A 4DRXA 1RUJ2 2R043 1LGNA 1Z7S2 2QCSB 2GC3A 5JWPA 4MLOA 3ABLB 2B9VA 1S5JA 2VU9A 1NKGA 5E1AC 2KD7A 1QU7A 4LHLA 3O1MA 1SFYA 2UU9O 3AC0A 2LALA 4HVRA 1JU3A 2C9AA 3VBHB 4DR2B 1BS3A 1EY2A 1BMV1 3I2OA 4UWDA 2V5YA 1H8VA 3K58A 2YICA 4EZHA 3SC7X 3OAAG 4FQ4A 1UZ0A 2JWPA 4W6WA 1YO8A 2PLV2 2ZS6B 3ZN5A 4DXTA 4XZPA 4NKGB 3ZXFA 2YGMA 4XDJA 1PNGA 2ODMA 3HN3A 1NZIA 2VOTA 1ORQC 2ZEYA 5IJ9B 1AL21 1HNWO 2RS51 4QX1A 5KBFA 1RUC2 3FB7C 3OY8A 3FAVA 1CVNA 2YY1A 3GHMA 3F7VC 1EAH1 4CUCA 2VY0A 3CX5F 3VZLA 5DDJ2 4ES9A 5LA9A 1O3TA 4KWJA 5FYIA 4O2BB 2HEYF 4PBOA 5IT9N 1PZ9A 2JDYA 4FP3A 2DYRC 4I50B 1YJWV 2QVSB 3RVYA 1S76D 3H42B 2ZE5A 3ZMOA 2VBPA 4MHUA 4QB2A 4DR3B 2PYLA 5BMVB 2VNOA 1URFA 2XONA 1YVWA 3NAPB 1G4YB 4XBLA 4CH4A 5T52A 5GM0A 2UWBA 4ZI7A 3CJXA 3HWJA 2GP5A 2P4VA 1D2QA 4QKFA 1W9WA 3TEYA 5K0UA 4AYUA 3MYXA 5DZEA 2D6OX 4EV0A 4U2AA 5FPOA 4UBGA 2W6JG 2FCTA 4MGTA 1OCCB 4LULA 5LXTB 2D97A 4LNVA 3L72H 5L9BA 3AZXA 4NROA 1ULOA 4Y26A 4YJ3B 3N36A 4R9AA 2HFEC 5A6XA 1XNKA 1RGSA 1X59A 3BRCA 5KHJA 5CKNA 3CCEV 3AZVA 3AKRA 2ORZA 3AG4B 3MIBA 4WFHA 1MOFA 3H1LH 1TG7A 1KC8W 2GV9A 4QDSA 2ZE8A 5FXVA 5CN0A 1JOPA 1IPJA 1GP6A 3F5TA 4QD2A 1XNQB 1K8AW 2J1VA 4JVAA 1K5SA 2WABA 4MVOA 1W90A 2IW5A 1R1A2 2A73B 4NHKA 3VBHA 2PHFA 4I3PA 1VBC1 4MH0E 2W46A 4N9IA 1GZWB 5FUNA 2BWCA 2IXIA 4DNYA 5CBGA 2UXBO 2GMMA 1UYZA 4OMDA 3DPRA 5EIYB 1EYBA 2JDMA 3FB6C 2E31A 1HXS1 2JDZA 1IBLB 1F4HA 3GVMA 3I3DA 1JPXA 1IVSA 1SQBH 1URXA 3LDRA 4J7JA 4GH4B 4O4HA 1U5ZA 1SLTA 3IIIA 4HVQA 1HRI2 3JUUA 1SZTA 3W58A 4YARA 1O59A 4XDLA 4P9JA 1ZZCA 4CDXB 3U4XA 4AHWA 1K97A 3UK9A 5A3UA 2Y38A 2Z42A 4Z8BA 4ZU5A 1VP7A 2F6BA 4FBFA 4N21A 3O1VA 1BQ0A 1SLAA 3VBSC 3TB0A 5KUKA 3GGLA 4LBLA 5FZOA 4LMFA 1RUI2 4UCSA 4LF9O 2ZMNA 3BTZA 1AB3A 1J3PA 1IG0A 5K0UC 4I5SA 5JSPA 2Q5TA 4JDNA 2QZ2A 4MSWC 4HMZA 1AR82 3BA9A 1W6QA 3CEWA 1RUD3 3AFGA 1SQFA 5JQGB 1MR5A 3MLKA 3ZFFA 5A3WA 1VMGA 1AR4A 1AYM2 2ZM6O 4IEVA 1O9HA 1GQGA 3FBYA 1COV3 3LDBA 1SCSA 2V4AA 4X8NA 4EN7B 1H30A 1K92A 4HOOA 1FMD1 5K9YA 1SQVH 1UO9A 1TUBA 1Q43A 3NR7A 4GKJO 5H6QA 1UPGA 3ACLA 4YZ2A 2XBO1 4DR7B 2JRIA 1M5IA 4AK3A 3INAA 5A6ZA 4FFBA 2W1QA 1UF2C 1KP2A 2XL7A 3ABZA 3ABTA 3ALQA 2W87A 3AZYA 2HWF1 1G9BA 3TJTA 2P4KA 2ADDA 4OI1A 2DVGA 5HXMA 1W59A 5EJ3A 1YJKA 1BLZA 1QJX2 1BKZA 1Y7BA 1DLLA 3BOWA 3RQ0A 2CE4A 2V72A 2PZSA 1NT0A 1J84A 2VMFA 5JDBA 4FZ1A 3O0XA 5KR7A 2OKXA 3LSSA 1QNWA 1BBT3 2ZX3A 3CC7V 2OA2A 2D3OW 2N04A 1AJOA 2ORXA
chains in the Genus database with same CATH topology
1MS9A 1H2NA 4G4FA 5I8TA 3ZIXA 2DCZA 4YFWA 1HQNA 4LO6B 3UJQA 4WVMA 3VKMA 3M7AA 3I59B 5BXXA 1AVBA 2ZKLA 3VDDA 1ZVFA 3MLJA 3ZFEC 5T54A 3WG2A 4Y4YA 3ZX7A 1GQWA 4TWTA 1WW4A 2EIGA 4OHXA 5DDJ3 1MZFA 1G8WA 2QDRA 2MEV1 3LSDA 3IIAA 1RUE2 4N43B 3WDYA 2I2SA 3NAPA 2A7AA 1ZREA 2R49A 1NX4A 4GQ7A 1LECA 2ES3A 2ZZQA 5EFUA 5DXDA 2EVXA 1BVP1 1YLLA 4YVWB 3WP4A 1V6JA 2WINB 5GLZA 3ZYIB 2VNGA 5T5OA 1TME2 4AEKA 5FREA 4EJRA 4CWDA 4OHYA 1WMDA 2B5HA 4FPYA 4AQTA 1DBNA 1PO23 4HPKB 4UBHA 2I45A 3HAGA 4M25A 4SBVA 4RQPB 2ARXA 2R061 4YW1A 1DQ6A 4MV2A 1V70A 3SH4A 5CFCC 3ES1A 3WP6A 1I3HA 2H6CA 5CFDC 3S7EA 1KJRA 2ZKNA 3FMGA 4A3XA 1OA4A 1C28A 5C9AA 4Q2FA 4IV3A 3JBG3 3KLSA 1LOCA 1MACA 1ULDA 4IV1C 4HKLA 4BE3A 1V6LA 2W68A 2HWE1 3IWZA 4XEZA 3URFA 1REEA 4AGVA 3M70A 1PVC3 2GMPA 3WG3A 4M2FA 3TN91 4BMBA 1NG0A 3U0ZA 3VHNA 1RUG2 2RE9A 2HWC1 2DVAA 1XE8A 5F6KA 2ZGNA 3USUA 2R1BA 2D6KA 2ENRA 1AHSA 4J1WA 1WMEA 2IXLA 2VW0A 4GULA 3ATGA 2R073 5JSRA 4Y1VA 1UU6A 3LA3A 1EPZA 2RS11 4LBJA 5I93A 1PIV3 4IXLA 3AYCA 4YZ1A 2HWB3 1RJ8A 2ZAAA 2WSUA 5HBAA 1B35A 4KU8A 4IEXA 3OGGA 1N1VA 1W6QB 1QJU2 2ET7A 4NOTA 4N7IA 3R05A 2BYVE 4IETA 4JGYB 4YM0A 2WBQA 1YWKA 4CDQC 4DY3A 1PGL1 1QY4A 3LGRA 2TBVA 2XG3A 3UV9A 1XYOA 1WLDA 4E2GA 3EQEA 4NVPA 1XNCA 4Z1VA 4XTMA 1SFNA 2YC0A 4MGIE 4AFMA 5ABJB 3D8CA 5BUVA 4N53C 4ES8A 3WP3A 2ZCWA 4BZ4A 1HLCA 2X53S 1C1FA 5L7OC 4H14A 2WL1A 4MGKE 3MIEA 1SLCA 2JENA 3NW4A 4NPRA 4YFZA 4BM8A 4NWWA 4CDQA 4Q4V3 2RS52 4BG1A 2R32A 2PAKA 1V9U2 2JKBA 1J3QA 1X7NA 2LUWA 4YVSB 3M3OA 1DQ2A 1XRUA 4QM8A 4Z92B 3AP7A 2JG9A 2XLAA 2WFF3 1NE4A 4LR4A 2LTNA 2WT1A 4QPIA 2BTVC 5D8AB 2D3PA 4RGGA 4Z07A 4Q4W1 4YM2A 1ASJ2 1AR62 1HXS2 2A71A 5BV6A 3E5QA 1FXZA 1OOPA 1TEIA 2ZX4A 2A75A 2B45X 4RS5C 4JGZA 3GBWA 4LT5A 1IS6A 2CL2A 2H6BA 4R4ZA 1MQTB 1RUH1 4GB31 4BWOA 3PNAA 1X36A 1HRV1 4M0HA 4YGBA 5BNQA 1HQWA 2WFF1 4Y1YA 1HRI3 1N3OA 2EXIA 3J26N 3VZMA 5KC5A 1RUJ1 2RHPA 3G7DA 5J37A 4SLIA 2GN3A 5JI7A 4NR1A 4XW3A 4RQPC 2GAUA 2AR6A 1OKQA 1ZRFA 4D7TA 4PF5A 3LOIA 4QXKA 2W39A 4WVVA 3AP4A 3LWCA 4AI8A 5JR7B 4LLOA 5C4WC 1WLTA 1YUDA 4P9LA 2RJKA 1FV2A 4I09A 3V56A 4BH9A 2X29A 3PJQA 1H4HA 1AYM3 2ZHKA 3AYDA 3OD0A 4ORFA 3PLQA 4XJ9A 2WNVC 4CEYA 1CAVA 1A3KA 5JPNB 1VRH2 1COV2 2XUMA 4BHIA 4QGNA 2VUJA 4K9SA 4GH4A 3E6BA 2Y26A 1PZ8A 3KCYA 1I5ZA 1W6OB 4KNCA 2RM22 2ZMLA 4FPJA 1UKRA 3CLPA 3WT3A 4C90A 4DFSA 5AC93 4L11A 3PVNA 4CDWB 4L99A