3P3PA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1997-2016) peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3pA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3pA01
3P3NA 2ILMA 3P3PA 3OD4A 1H2MA 4BIOA 4JAAA 1MZEA 2CGOA 4Z1VA 2Y0IA 3KCYA 1H2NA 1MZFA 2WA4A 3D8CA 2CGNA 2YC0A 4B7KA 4Z2WA 4QU2A 4B7EA 1H2LA 5JWPA 2WA3A 2XUMA 3KCXA 2YDEA 4NR1A 1IZ3A 2W0XA 4AI8A 1YCIA 1H2KA
chains in the Genus database with same CATH superfamily
4COVA 3PHMA 1OF4A 1ST8A 1BMV1 3NV4A 2HWB2 4GQ7A 1PVC2 1BYHA 1LOFC 2YI8A 1XHZA 2R072 4YHHB 5FZCA 3OTFA 4XE9A 1SPPA 2ORZA 1W2BU 1KQSU 4CDWC 3PTRB 3SYPA 2QCSB 2Q5ZA 3MW3A 1NR1A 5FK8A 5IVYA 1GOFA 4NRQA 2D43A 1DF4A 3LEKA 2EVXA 4A45A 4D7YA 5JZGC 4AI3A 2C1FA 1RUE1 2PAEA 1V9U2 1YJLA 2PTMA 2YDEA 4FFGA 1GKBA 3FC0A 1WLCA 4AEMA 2PI4A 3W7UA 5BR8B 4IE7A 5KHKA 1FS0G 4CS2A 1CESA 2VD7A 5E1RA 1X82A 4YJ3A 1ZBE3 4I01A 4CXWA 2KG7B 4HONA 4DV2B 2BNOA 3R05A 1XRUA 3ZHRA 2XAQA 4ET7A 3CJIC 4L8QA 5LA2A 5C5UA 4X1IB 5C3QA 4F6RB 1SLBA 1UY1A 1W6MA 2QE3A 1ZBA2 5EYPB 5LHIA 4JYAO 4M3CA 4FZ0A 4TQDA 4IEXA 4LK7A 1CAWA 5CVRA 1W8OA 5A3MA 1OPOA 5DN2A 3R4UA 2FCVA 3RVYA 3MLLA 2Y4TA 3VBFC 4ZOLA 5FQ0B 2E9QA 4LHNA 1GP5A 2QGNA 3USSA 2N05A 5H2FZ 2BBVA 2X6CA 3I2JA 3WW1A 5FY1A 1HN0A 1DGRN 4HVRA 3SH3A 3ZFGA 1E5IA 1GU3A 2PHXA 2F43G 3FKSG 2P3KA 2WABA 3ZXGA 4FFBA 3D3QA 4MVQA 1LODA 5D8AC 4P9YA 4EN8B 4GKKB 4B4PA 3VLBB 4D69A 3FYEB 2JGUA 4CDUC 1ULFA 3NRUA 3WZ1A 4LO7A 2QM4A 2IXLA 4DRRA 5JMOA 2R041 2JGDA 1WWYA 1K3IA 1W8HA 3BEHA 2AUYA 3WDWA 3Q8AA 4XBQA 4BWOA 3O65A 2NQYA 1W0PA 1R082 1V6NA 2VTFA 3VV1A 2B1GA 4YJ2A 1AR82 3BY6A 2X5IA 5FZAA 3T1YO 1LOGA 2Q30A 2OYQA 4MVMA 1CPYA 1ZSPA 2XAHA 1W2OA 4YIOA 4NRMA 3UNPA 1M4UA 4Z1VA 2ZM6B 4Q1RA 1JJ2U 1QMJA 2ETNA 1K5QA 3CCJV 2N7GA 1IBKB 3N7MA 5LEJA 1HP8A 2GV9A 5LGUA 4IV3C 4DFSA 2DYRB 5FPLA 1RUC3 5IHRA 3AZYA 1E5RA 5DUUA 1ONAA 1VBA3 2YFUA 2RR12 1KRIA 2ZABA 4B3RB 4EV0A 1MEC2 2PYLA 2VUCA 2SBAA 2R70A 1GZWA 5CADA 4LKFA 4AVVA 3WFVA 2VVDA 2E7QA 2DVBA 4FM0A 2MEV1 1DU3D 2HWD1 4LITA 1WNSA 5J2TB 4XUPA 3VBUB 4LBQA 3FLPA 1WB7A 4IEOA 4PDWA 4UW5A 5T54A 2R9AA 5C5TA 2E26A 5A3OA 5CBFA 2XDVA 1SZBA 1ZL8A 3B40A 3JCIA 2ZS6B 4QNHB 4PBPA 4QX8A 4AW7A 1AVBA 4RWUA 4XETA 1EP0A 2TBVA 3BPSA 2XVLA 3S5AA 1JI6A 2WNVC 4WVZA 1R6NA 2XJQA 3WHTA 2A6XA 2YI9A 2XJUA 2ET1A 3ES4A 5DG1A 5CEHA 1HXS2 4JI1O 3J81N 3H9AA 5BUVA 1UYPA 4DS0A 2PAKA 4XJZA 1ZRCA 3WB0A 2X05A 1WMEA 4DUZB 2VS0A 2FYUH 5FZMA 5KUKA 4LF4O 1UW8A 2ZTNA 5J7MA 1VRBA 2EIGA 1S4CA 4QPGA 3BKZA 1V6LA 4AVCA 4HZFA 2VNRA 5GZEA 4B3SO 1QU7A 5IYZB 3SKVA 3LE0A 3ZX7A 2HJFC 1AR91 3JBG2 3X2QB 4CUBA 2QNKA 1GM7A 1CIYA 2HLEA 2Z4FA 1MS8A 1HV1A 2IU3A 4QIWF 2EZOA 2JICA 4TQFA 3V0BA 1D2SA 3HKEB 4LBNA 4MSVA 5IVFA 1AI4A 4OVEA 4XBLA 1PGW2 3WD5A 2IFWA 1Q86W 5BNOB 2DE0X 1XBFA 1LTEA 2VW2A 1G9DA 5CMUA 3LUTB 3Q8FA 4XFIA 3WP5A 3AJYA 5J96B 5IK4A 2WZPP 3V0AA 3P30A 4MTXA 5A7SA 3AK3A 2FQPA 3EMRA 3SCFA 2CTQA 5ACA1 1VRH2 2FB5A 3SCGA 1FJGO 3VZKA 2CWSA 1BK1A 1SG3A 3VL8A 4CCJA 2DOSA 5DUWA 4Q4W2 4OPHA 2ZDIC 3CWBH 1LNQA 4XVHA 4LMFA 1NCQA 2QQMA 2W9XA 4N43C 4UVAA 5F5QA 4IEQA 5CA0B 2GTSA 1A8MA 5FLJA 1JYXA 4AFAA 3GHMA 2YUEA 4YZ3A 5CZKA 3J8F2 2P37A 2DF7A 1QJZA 4XC9A 1DTOA 3BTAA 2JIGA 3FHQA 4RFRB 1QXPA 5KXCA 4XACA 4BW5A 1K3EA 1YHQV 5KHHA 4YVSB 4AE2A 2G1MA 1W2TA 3H1YA 4Q27A 1HIXA 3MIEA 1ALYA 1EAH2 3FWEA 1AX2A 3FFQA 2QUOA 3AYDA 3SXWA 3BGAA 4PIZA 1YUDA 4ASMB 4JGSA 4CU8A 1BVP1 5AFBA 4RR3C 3PUSA 3JD1A 4J80A 2CTRA 1IBMO 1CAVB 4WBBA 3DL3A 5FPOA 1ODNA 2BP6A 4BM8A 1XHXA 4B1MA 4QXHA 1J5EB 1C8M1 4Y4YA 5FFOC 1VMGA 2Q0AA 2VVEA 4I0XB 3SQOA 5LATA 2Y6HA 1O5LA 3HNBM 2DVAA 4B29A 3OEEG 5FREA 3L75H 4FBFA 4QX7A 1G9FA 2X6AA 4LT5A 4AHZA 1RUH1 5LMNB 1GV9A 5JSRA 3F5WC 2EINB 3CO2A 3PL0A 5A3NA 4MOAA 4DV0B 2ADPA 1TNRA 1YC61 4YG0A 4PQ9A 4LF8O 4WFFA 3LSEA 4QB2A 5HCAA 3WDVA 1IHMA 5ITZA 1JYNA 2CTWA 2UU9O 4O7XA 1QJU3 3RMXA 3RZGA 4LA2A 4JI3B 4OQ8A 4OI2A 2FZ2A 2WWSA 3KCXA 1WW7A 2A06H 4Q2FA 2D3SA 1QVGU 4QD2A 1P7GA 1N1SA 3M7AA 4TXWA 2VCCA 1MVQA 2WT2A 3I49A 3CC7V 3NAPC 2Q67A 5FYHA 2FMDA 3OGIB 2RDQA 4AYUA 2HWE1 3J26N 4EN6B 1F5FA 2R16A 3H42B 3K06A 4MW3A 1OOPB 1QJX3 1OUXA 4XHBA 5JAXA 4FIPC 5LP6C 2LROA 1DLBA 2BFUS 3WEZA 4QPWA 1AYM1 1V6OA 3AZXA 4J11A 3D0JA 3AFGA 1AJPA 4QGNA 1SEFA 1UZ0A 1HRI3 3JU9A 1K73W 4QDQA 2OZJA 1RPOA 5LYJA 2RMKB 5EWSA 3UKNA 4Q4Y2 4BMBA 3TXQA 2QA4V 5L3DA 4OHYA 2C0ZA 2GN7A 2JDNA 1UAIA 5DDJ3 3VD5A 2UUAO 2Y6KA 1ASJ2 3I56V 3ML0A 3WCSA 5T5OA 5GLTA 3SMHA 5EYXA 1ACCA 4ASLA 1JODA 3POJA 1PGL2 4CA9A 1YXBA 2PHUA 2B46X 3OGJA 4HK8A 2FHRA 2OUHA 3OPWA 2Z3YA 1JFFA 5CFCA 3ABKB 1G7YA 3E22B 3I2IA 1ZZ6A 1CQ9A 1FXHA 5IJ0B 3N9QA 3WF0A 3GWOA 1R1ZA 5TSWA 2RDSA 2RS31 3MLKA 4GX2A 1RFYA 3H8UA 3WY6A 2ADQB 5H5NA 2B45X 2W52A 2UYBA 2LP7A 1DGWX 5F5IA 2P06A 1NE4A 4KU8A 1Y43B 4X88A 3TOJA 1ZRRA 1JOYA 4JGYB 1W6PB 5D2AA 3GGLA 2D44A 3VDDA 2WFPA 5C8WA 2UYAA 1J84A 1TUBB 4WVVA 4NN0A 2DMXA 1BGYH 1X36A 3WT3A 5K0UA 3SYOA 2QQWA 4OI4A 1FFXA 2W1UA 1Q8IA 2YHJA 1LGCA 1UIKA 4FT8A 3MEPA 5J36A 1AB3A 1VBE3 3TCUA 5LA6A 1VQ7V 1PK6A 4NXMO 2RDCA 3OGGA 1VBB1 2A3YA 5B1BB 4R8HA 1XNQO 2RVAA 2WO1A 1A32A 3DKQA 1VBC1 1GMGA 4TT3G 2HWF3 1W6NA 1WMDA 1JHNA 1G86A 4L0PA 4OCTA 4A3ZA 4QJFB 2AW9A 5JDBA 4FOQA 4JTCB 4L11A 4AGRA 1K9MW 5A3UA 1OKQA 2WLIA 1PO21 3N9PA 2IBZH 5A1LA 4JI8O 1B3QA 1BL8A 1GN2A 5T3NA 4OHZA 1WBFA 1SS3A 4CS4A 1IXMA 2A3QA 4AFDA 2WFF3 4YPJA 3VDAA 4OYUA 4MVSA 4RAIA 2WQZC 4OHXA 5FZOB 2J1SA 4HXCA 3O1TA 1TME1 3A8TA 4KGGA 2VOKA 1DHKB 5CNAA 2A6ZA 2A79B 3U75A 3ZMUA 4FZ1A 4IEPA 3VBHA 4XFFA 2HWC1 1CZVA 1HQNA 1KBHA 2Q8CA 3FL7A 1DLCA 2FBEA 1NA1A 3KKYA 1FYUA 1XMOO 2BRTA 5JI9A 2UXCO 1DDLA 1NBMG 1P84F 3HKBB 1ODMA 2FCUA 1O7FA 3MBWA 2XJTA 4YARA 1UWWA 4LNVA 2ZNIA 1PVXA 1BZWA 4D6SA 1ZZ9A 3EVKA 3RI9A 1RMU1 4K1YA 4G2KA 4J6GA 3ZFFA 1XE0A 1F9KA 3ZIAG 4KG8A 1R1BA 4O4LB 3P3NA 1FT9A 2GP5A 1K34A 1HR0O 1PVC1 4M3CE 2R071 1HQLA 1M56C 2JXAA 2F4VB 3OYWB 4CUAA 1DCSA 4J41A 4IIJB 2JDIG 4B7KA 2PHLA 3OY8A 4X8PA 1JH5A 1LHVA 3T4ZA 1IOAA 2WSVA 2R32A 4Y33A 2BNNA 4A42A 5C8CA 4AVAA 3ASOB 4EROA 1MS5A 1UYXA 1RVF2 1V9U1 3RQ0A 3F5TA 2YIBA 4R9CA 3QD6A 2V4DA 3ZS8C 4JV4A 1H2GA 4PA7A 2CYFA 2VQTA 4X1YA 2XT9A 3RYFA 2FZ1A 3T2QA 4BIZA 1UOFA 4DV6B 1JZ8A 5AVAA 3M70A 2ZJCA 4ZHQA 2C9AA 4M4RA 3VQYA 3W21A 1VJ2A 4DUVA 4C1XA 3H3LA 4LFCB 3R4SA 1GWKA 2QQNA 2BVVA 3JAWA 3MIDA 1Y76A 3SR2C 4XJWA 3VDBA 2QFEA 3U14A 1ZBA1 2YPJA 1UIJA 2XJVA 3KZ4C 1ULDA 4AQ2A 3OR6C 4IDZA 5FP7A 3WNMA 1Q5OA 5J09A 2V73A 3V64A 4TTGA 1B35A 4FLUA 2VZSA 3Q4HB 1LOEA 4O4IA 1KKCA 4G3YC 4HMZA 3E97A 4ITCA 3MFAA 4IE4A 3K9AA 4PHZA 4OHWA 3F7YC 1N33O 4GWNA 2ZGRA 3A0HZ 5GLUA 1HNZB 3K0GA 1EZVH 4UCSA 1RXFA 3RYHA 3KQ4B 4YW4A 2TNFA 2UWAA 1A8DA 2VXRA 3CC4V 5CIRA 4Z82A 1ZZ8A 5F3GA 2YBPA 4Y1VA 4CU7A 1D4M3 3NVCA 3QO5A 3ZSLA 1QR9A 1BMFG 4FTBA 3O0XA 4BAYA 3E83A 1IBLO 1XYPA 4LF5O 4R9AA 3M3OA 1H4GA 1AR81 3HR0A 3H8XA 3DUIA 4X9QA 2KG7A 4DW0A 4XAAA 3CJHA 3J80N 2UXBO 2QQJA 4DR3O 2ZZJA 3SISA 4BCUA 2IXHA 4MVOA 4X1IA 2OIEA 4KNCA 2K46A 4GB32 1LGBA 5IK5A 2AZ0A 1W8ZA 3V56A 2HBUA 2RR11 1N36B 1MEC1 2Q73A 5IWAO 2V72A 4M00A 3USUB 1GZ9A 2OYZA 5FQ0A 4UCUA 4QB6A 1WLTA 1UOJA 3WG3A 5FZGA 3J7MA 3SJAC 4NAMA 5A32A 5A2QN 1FOD2 4YLZA 2FKXA 3O0WA 4U7OA 1IX9A 3OEAA 5A7QA 1DIWA 5HCHA 1JYTA 4O4HB 2ZHLA 1EN4A 4QE7A 4LIVA 4PCRA 2EINC 5BNNB 4KFMA 1ND2C 4IEVA 5FZDA 1W2AX 3W20A 3ON7A 4FQZA 2ZHNA 3VGIA 3ZYHA 2XJPA 1YCIA 3QVNA 2IC1A 4BH9A 2VCMA 1N4CA 4JI6O 1HXS1 1KU9A 2OUJA 2R49A 2VQAA 5BNPC 4E4SA 4OI0A 3M7MX 2BE3A 1Z2GA 1UCXA 1H2LA 4CSWA 4PBOA 4YGBA 2WNOA 4AI8A 1HV0A 4H7LA 1SACA 4AQYB 1PHMA 2VZPA 4JI4B 2XWJB 4RHV2 3WG1A 4CP9B 4EE2A 1X50A 2D3RA 3ZMVA 2WT0A 2CSGA 5FZ9A 1V00A 3JBG1 1RUNA 2ZE5A 4BQ1A 2VMFA 4CEYA 2PF4E 3POEA 1W59A 3A4UA 3T0BA 5EK0A 1NCRB 1EBOA 1TQ5A 5EYYA 3STZC 1RUJ2 4NJ4A 1S2BA 1OOPC 1QR8A 3LEMA 1O5UA 4CYDA 5J2TA 3NXSA 2AR6A 1PGW1 4D3WA 1FAFA 3VBUA 2VNGA 2WRAA 4NPLA 2XASA 4J9ZB 5JJNB 2GMMA 1V9PA 2KR2A 5FMCA 2BYVE 5E16A 5AC93 5J2UA 4AHWA 4DV2O 1SESA 2HR3A 5FZ0A 2JDAA 5KMGB 3VL9A 3ZVXA 4FFKA 4R50A 1R64A 2RMU2 1VRH1 5L7OA 1JN2P 1K12A 1L0LH 3MPBA 2D6MA 1URXA 1DYKA 1QY4A 1FAYA 4HKWA 4Q4W1 4YG6A 2ZMLA 4FPYA 4LXLA 3G6JB 4BQ5A 1G6UA 1QGLA 3MLJA 1VB4A 4WVMB 2ZBJA 5EPAA 3VHPA 5E89A 2WAMA 4AHCA 2ZEXA 1UMHA 3LCPA 5F9TA 5KXEA 4ZS2A 2FMYA 4MXVA 3MIFA 3SPGA 3H3UA 1KKDA 3WDTA 3J8F1 4DIQA 3IMNA 3G7DA 1OH3A 3H1WA 4DUWA 1WMFA 3RVZA 2M7WA 5C4WC 1HJFA 5BZBA 2GC1A 2IW5A 4GKKO 4WFEA 1XMQB 3FMGA 3M8LA 3OM3B 1EAH1 1J1LA 2HG5C 1D7PM 2BGOA 5FLHA 3H9VA 2JD4A 1GQHA 1GLHA 1R6TA 4JGZC 1PIV2 4N53B 1S0FA 2AGSA 2K9ZA 5KWRA 2VAUA 3AKQA 4HLTA 4ZIBA 1AR5A 2P3JA 5T5PA 5BNOA 3B01A 2YC4A 4Q8KA 2QQKA 4FOVA 1L8DA 3EJKA 3AMHA 3HIFA 2ZM6O 2XR4A 3WQBA 1UPIA 1QQP3 5C71A 1VEWA 1ZBE2 3LB9A 2YSUB 3A0KA 4WM7B 1XE7A 5B1BC 4X62B 3TRSB 3RGBA 4GXLA 1X9TA 3SH5A 3HBZA 5I8SA 2SLIA 1BBT3 1NTKH 3ZFEC 4ISRA 3PTYA 2P4VA 2NZ9A 2JDMA 4B3RO 4HN1A 3JALB 2EIJB 2IXKA 1AR63 3T1HB 2B5UA 3MI8A 3WG2A 1KMIZ 4R4ZA 4FAGA 4RA0A 4WM8C 1UO9A 1HNWO 3ROUA 4C90A 3CCEV 5IAVA 1W6OB 1MQTB 2YXHA 4CDXB 3LDRA 4YW2A 3WW4A 5KUMA 2QZ2A 1K97A 3WHUA 2P90A 5LZ6A 5HV4A 2JG9B 1EYBA 4AZZA 1NAEA 2JDPA 4P14A 4YVSA 1H8TB 3NJZA 3EXUA 3HMYA 4K9SA 3WLUA 4HVQA 5EHDA 2Q5TA 2W1QA 1HWYA 4LO5B 5FAXA 3SEPA 5BV6A 2V09A 1Y9QA 4FXGB 3LDEA 2CWMA 3MGUA 1CONA 1QJY3 5FUPA 3ETGA 1CAVA 3NNMA 3ZHSA 2FDKA 1WLEA 3APQA 1SA0B 3MHHC 3H0OA 2AH2A 4Z07A 2QKDA 4DUZO 1AYN3 3OUSA 5LEKA 5FUIA 4PELA 3AG3C 5T5LA 3VQWA 4NXNB 1YO8A 1VP7A 5JOZA 3K03A 1A34A 4IQPA 3BA8A 3LEIA 3AK1A 1WN7A 4Q4Y1 4K0KB 2EX3A 1ZAUA 4LFBB 2OCCB 1Q8SA 4YW3A 5FZLA 1ASJ1 1G9CA 2UUCB 3LA3A 3JD73 3LNMB 3S7IA 4CCNA 1VBA2 2IM9A 3BCCH 1OPMA 1GICA 1OA3A 2O14A 3SJBC 3AVRA 1UN1A 1V70A 4FPPA 1FMD2 3BTYA 3PLQA 4AFBA 3MDSA 2A75A 3MHSC 2NPIA 2P1BA 4JCKA 2H0BA 5GW7A 4QU2A 3POWA 4Q29A 3GVMA 3IMMA 1MZ5A 1F31A 3SYCA 2XAGA 2QWPB 5FZ6A 1NZ6A 2IUWA 4GX0A 1ZA7A 5FMDA 5FMOS 5LBBA 2PZSA 4X64B 2B1IA 4DR4B 4YVWB 4PI2A 4E27A 1Q82W 1I3HA 5A7OA 1DZTA 3KT1A 4BXFA 1S5LZ 1J3QA 1C1LA 4NHXA 3K4AA 4JYAB 5BXXA 4DR6O 3KD4A 1RUE3 5IYDO 4I3PA 4DPNA 4LF9B 3JB4C 4HAMA 4KI5M 4X6QB 3CC2V 3DPRB 2QBXA 5JVDA 1O8PA 4JKLA 4WBNA 2Q7EA 2E74B 2WNUB 2ADEA 1BHGA 1YWKA 5JPNB 3UGHA 1YITV 3CCQV 3ALQA 4CEWA 1LCLA 3N4MA 1VF5B 1BQPA 1YQ6A 4AGVA 3T08A 5GZGA 5A7NA 1ENXA 3F95A 3ZN6B 1UNBA 4OQ9A 2M6YA 4CP1A 1J5EO 1H6YA 3C8XA 3PUIA 3E22A 3GDBA 3QBQA 4ARXA 3O1RA 3SH4A 4UCTA 1GSLA 1UJWB 4FJCC 1ND3A 1KXGA 4TV9B 1JTZX 4O2BB 5IJ0A 5E1AC 2D7FA 3CCVV 2EBOA 1IZ3A 4XURA 2GSMB 3T1YB 1RUG2 1QNYA 3FB5C 4XJAA 5LMNO 3JSNA 3ZXLA 5J9PC 2P5OA 4EZHA 3CRQA 3BI3A 4UXAA 1Q8PA 1NY72 5CKQA 1NR7A 4LBKA 4XZPA 3LWCA 1D4VB 1HDJA 5IYBO 4JGYA 4KBZA 1JXNA 1W6PA 2ZX0A 1Y66A 2R043 1GP4A 4B1LA 2R9RB 1XYNA 3B69A 3ELNA 2LGWA 1RIRA 5FZ8A 1TUBA 1NQJA 5FPUA 1HB4A 4UV8A 5FOJB 3I7DA 1OCRB 4XMAA 1FPN3 3VUOA 1LUWA 1TAEA 4JI2O 4FPCA 1T6BX 3BTZA 1GNYA 1NXD1 2ARXA 3WOGA 4I2OA 2HHHB 4E2QA 4XQ4A 3BHPA 2X6BA 4CH6A 3U07A 2ZD9A 4LA3A 1KITA 4MGYE 3RZJA 4JHTA 4ATEA 3FHIB 3ZMTA 4AL9A 3POSA 1D0GA 2F95B 1MNGA 2Y0OA 1AL0G 3AMMA 3SPHA 4Z2AA 5FPAA 2MEV3 3OE7G 2LW7A 4A44A 3KM5A 2GAUA 1B06A 4H2AA 1UZWA 1YSCA 5GZFA 1RSOB 4IE0A 1WW4A 4JI1B 4CDQB 3MPPG 3RDIA 3CRMA 2AZ2A 3EO6A 3OEBA 1V0AA 2BZDA 2VMDA 2XG3A 2HYKA 2V1DA 4A2UA 2ZKNA 2WWWA 2D3PA 3HN1A 4RQPA 5T52A 2GUZB 3NKTA 1NT2B 5HCFA 1V55B 3DTUB 3NMBA 1EFRG 5EJ3A 4YRDA 4Z92B 4IEYA 3K4DA 1O6UA 3CNAA 4PQQA 4AI9A 4GCZA 3RMYA 3HKBA 4LC1A 4IE6A 3HNMA 1SZTA 4EN7B 2BSKA 1PO13 1DF5A 1O4ZA 4LQRA 1UYYA 4NHMA 4D6RA 1ZRDA 4CXYA 3W5NA 1AR93 4O4LA 1AJNA 2V7QG 4PF1A 3WDXA 2XHKA 1RP3B 5KX5A 4COWA 5DABA 4CEYC 2B8MA 3STLC 2X8KA 1LUVA 3VHRA 3N9OA 2CUGA 2PMWB 5B1NA 1BHBA 3T2OA 1I5YA 2D5HA 2WQ4A 4HG6B 3JARA 1BCCH 1RHI3 1R3JC 3RWNA 4FVVA 3L72H 4J7KA 1YFXA 3FLTA 3WF1A 1H2NA 1XNDA 2ZINA 4MVRA 1WA8A 3OGCC 2GP3A 1JUHA 1CR7A 2Y60A 3D36C 1WP8A 3DKWA 3BPZA 1M57B 1SMVA 2NN4A 3ZR6A 5FZBA 4R8CA 5CBHA 4O2AA 1TZOA 1WMXA 3OMIB 5H6RA 3MHZA 4LK6A 5K1XA 4L87A 4ZKTB 3KV4A 3S3WA 1U96A 1E5SA 3JB8A 1PNLA 5B4XA 3W7SA 1O4TA 2R1DA 5FBZA 4UW4A 3IAYA 2VCBA 4NVPA 4N53C 3AXDA 4UFZA 2XAJA 4QDRA 2QKSA 3OGVA 1AR4A 5K9YA 3OT7A 1JYWA 3Q4HA 4IEZA 1XXNA 1FOD1 1KGYA 1ZUQA 3H01A 1UU5A 5A7WA 1UY3A 2N74A 5F6KA 4ASKA 2JWPA 4WM7C 4FLZA 5GONB 5T55A 1VF6C 3HKCB 1XI1A 2QR4A 5FP9A 1U0AA 4IGGA 3HEIA 3B2EE 5LBCA 2X53S 4U3JB 3VBSC 4NWVA 3M3IA 2A7AA 5HPOA 3R6SA 3UETA 4IHJA 3WW3A 2UU9B 3L9JT 3NNGA 4MS2A 4AAXA 2VMEA 4KUMA 3PUAA 1JOJA 4CDXC 5LL6Y 2WIIB 4GMP3 2VRZA 2P2KA 4ZXKA 1WB8A 1XJAA 1BS3A 5EV7A 5C9AB 4RS5B 1EUUA 4COZA 1JS9A 1VBE2 1S2EA 3VBRB 1RUH3 5ISLA 4RHV1 1Q90D 4I9WA 2J1TA 5IVVA 3N2KB 4QPIB 3T30A 1W2NA 1RUI3 4CDWB 1VPHA 4UFJA 3N2GA 4QT6A 4CPBD 5FKCA 1S55A 3DYOA 4PA9A 3ORJA 3VHOA 5BY1A 3RSJA 1QNMA 1JZ4A 3C90A 4J1XA 1RUJ1 3EFFK 2XGXA 4P9LA 4N9IA 3JD3A 1XNBA 1Q6IA 2WZEA 3JD2A 1LGNA 2P34A 3FB8C 4DV6O 1GWMA 5GZDA 4XF0A 3CMGA 4P9IA 4LORA 3K51A 4CP0A 3G71V 2R72A 5FO9B 4O4HA 3KGLA 4QQPA 3CJIB 1OA4A 1UYZA 1FV2A 2QWOB 2RCVA 5BNNA 1FXKA 2W2IA 2RMU1 2VUJA 3AG4C 1JYVA 3CRRA 1NZIA 3D3IA 1ULGA 2ZGNA 2XOKG 4IETA 5LB6A 2GNBA 4QM8A 3E5QA 2YC2A 5BNQA 3GJAA 5AVPA 4CCMA 4K7JA 2L6LA 2WJSA 3AL6A 4Q4X3 2ZHKA 4U36A 1SFNA 3HNYM 5F6LB 5JR2A 4N7UA 3I97A 1HB2A 2FDJA 1F4NA 4TN7A 4A6SA 1DQ1A 4L8JA 1IS6A 3ZXFA 2LUWA 2C6SA 2XTAA 2BOIA 1GYKA 5IW0A 2P4KA 1HNZO 4XUQA 5DUVA 3VD7A 3FBYA 4IESA 5D8AB 1MZEA 4Q0QA 1IGOA 3AG1C 3TB0A 3TN93 2OT7A 3K5OA 4CDUB 1W03A 4YVWC 1SKVA 1NCRA 5IT6A 1PIV1 1R6KA 4Y22B 4UFIA 1SQGA 1ROPA 1YIFA 3WU2Z 1E1RG 5IFPA 2VC9A 4DXTA 4RYDA 4HKOA 5A6XA 2IXIA 1QWRA 3DPRC 2RS33 3LDDA 3EB7A 4JVAA 1YLLA 2CH7B 5FY0A 2WNUC 4FPHA 3SEEA 2YGLA 1ZBE1 3THPA 3O1MA 5H9CA 1LKNA 3ZOIA 3JQWA 4IV3B 2FMLA 4AVTA 3HQUA 2FTKA 1THZA 1OJHA 3LOBA 5FYVA 1N36O 3AP5A 4JQTA 4C8DA 1YVWA 4D0QA 4WVMA 2BV4A 3TAYA 4E8CA 4UV9A 4X20B 3OUIA 3B93A 2G9FA 4XQDA 1QLEB 3O1SA 3B77A 5FYMA 4OZOA 5A6ZA 2JB8A 3JZVA 5F2WA 1U5IA 4JI8B 1VBB3 1S3JA 3LSQA 1S0JA 1NTZH 3RWRD 2E32A 1XNRB 3W59A 4PA3A 2RJ2A 4HNAB 5I0SA 1ULEA 2PY5A 2L9LA 2UXNA 4DEVA 2LS6A 1XC6A 4CC5A 1K7DA 5L3FA 4DRVA 1RYYA 2WNVB 4PA4A 1APNA 2RM22 1YEWA 1VQLV 1XMOB 3PU8A 5A1FA 1PO23 2VM9A 3DYMA 2UXCB 1OCRC 3VN4A 4X6RB 5A3LA 3E8GA 5FLIA 2DV9A 3VBOA 1CD3G 1QH6A 2VQFO 5JXGA 4GYCB 1D2QA 4AQYO 2CK3G 1X8MA 4JI4O 5JH7B 4X66B 4FFFA 1UOGA 2AGAA 4DNYA 2YYOA 4X8AA 1D0HA 2KQXA 3ACHA 4CCOA 4EEQA 2W47A 2VECA 4LWSB 2XJSA 2HWC3 4XF3A 3APBA 1FX5A 2WPDG 4MGSA 3JALA 3I59B 4KXRA 1VBA1 5LK7B 2JDYA 4K8FA 4TV8A 2CY6A 2W0XA 2VWKA 4MADA 1FMD1 4FK5C 1AR1B 5EC1C 3WNKA 1MQTA 2XBO2 3AP4A 4LPLA 2LO1A 2F17A 4JI5B 2N04A 4W4LA 3GBGA 4DEQA 4NPMA 1NKDA 2BGCA 5LY1A 4LNUB 4NB5A 1OCZB 2ZOEB 1K4CC 5JCOA 2ITDC 2ZGLA 2JG9A 2A71A 4WV8A 3MFCA 1H8TA 4W50A 2HWB3 5KA6A 3ZYFA 3P32A 4JASA 2R073 1GN6A 1LEDA 2NLRA 2PHWA 4GX1A 2JG8A 2CGNA 4X1KB 1L0NH 3WG7C 1IKQA 2XLGA 1NKGA 1MMMA 2BNMA 4N43B 3TEWA 1URFA 1W0JG 4Q6GA 3FYIB 3SDLA 4AAPA 3DXRB 3ASNB 5IDJA 4N90A 2YXYA 2D3OW 1YQCA 2ET7A 1X7NA 3LDKA 5H6QA 3HD8B 3J7AU 3ZKYA 2WN2A 3VDCA 1XMQO 2AZ5A 4P9JA 1PZ7A 3POBA 4GA9A 1M5IA 1XNAA 3WF4A 3ZHQA 3SLIA 1Q8QA 2BFUL 4LHLA 3VKLA 4W6XA 1WLDA 2IWGB 3BCWA 4RR3B 3HBKA 2KB1A 3GM8A 3SPCA 4ISQA 2KA3A 4R4XA 2DBNA 2UXDO 3UKTA 4LUMA 2ZGTA 5FNVB 3LOIA 1XDCA 2GZWA 4Q20A 3ZCCA 3NQHA 2E5LB 3P3PA 4XQWA 3UT5B 2QWQB 3KHBA 2GNMA 3O14A 1IBLB 4Y3OA 3LD8A 2RJKA 4IEUA 3L71H 5AC92 1MSDA 5ABJC 2ZMNA 4MGZE 4NWWA 4I0BA 1I0HA 2JECA 4WFBV 3CCLV 1P49A 4X62O 2C9KA 3GXUA 4AG4A 1QF3A 5D5PA 4XOGA 4CUGA 5DAPA 2UXBB 1NY71 1YRZA 4DR3B 1LHWA 1LAJA 1FD9A 4EJRA 3LKJA 4FLWA 3ZRXA 5JVVA 5DM6V 1VQKV 4M3CF 3POFA 2YG0A 2VL4A 4V2VA 5EQUA 2Y48A 1Q7YW 2ERFA 2OXBA 2G9GA 4IV1C 4C91A 3THOA 1R083 5JLVA 5CA1B 4BQWA 1AR83 2VTXA 1CX4A 4EN9B 1VQ8V 3GBWA 2JX9A 4BQXA 2XLFA 4EZ4A 2CTPA 3LQCA 4Y20B 3MV11 4GLXA 1GFF2 2ID4A 1QJFA 1VBD3 3RFRA 4RGAA 2PYJA 3TJTA 3BRCA 4RL7A 3NAPB 5IUQA 2JDUA 4RQEA 3ZRWA 5FIXA 3AJZA 3DF0A 2CAVA 4YFWA 2EJ7A 3S7EA 3PVEA 1POV0 3R66A 5L3GA 4FM2A 3KLSA 2ZZQA 2O57A 4G28B 3ZYJB 5IE9A 2CNAA 3K5NA 2XHBA 1LU2A 5M0TA 5EBLC 1SDDB 3I2HA 1W9YA 2W46A 1Y74B 5IATA 3DV8A 3SHRA 1IPJA 4XFBA 4XCBA 4TV9A 4O2BA 2O8QA 1R73A 1AR73 3K4ZA 3PVNA 4FP3A 4FPEA 2JIJA 4LFBO 5E8AA 4A3XA 2RS53 3VBRC 4URAA 2CL2A 3C7EA 3OBAA 4DV5B 4UVCA 3S30A 4JKMA 2Y26A 1AXYA 4XJ9A 2UUCO 1YTFB 4QPIC 1FATA 3JASB 1CWPA 1BBT2 1COV2 3UO3A 3KT7A 4P5HA 3CB2A 4MT8A 2BJSA 1WZXA 1PM9A 1UF2C 3N7LA 4GH4A 5DECA 4LP8A 1AR62 2JJ1G 1AJQA 2OPKA 3L74H 3RBZA 2O0OA 4JTDB 1L7QA 2HJIA 1SRYA 1QJU1 3WF3A 1MS3A 1QNWA 3OG2A 1CJPA 1YI7A 4XJ8A 2JJ2G 3EBRA 5FYYA 2LW1A 5CG8A 2R7EB 1S0EA 2Z0AA 3JD4A 3ZX6A 3JBG3 1FXVA 1H9PA 4G9SB 1JOPA 1W6QA 4X64O 4DR4O 3FLRA 1HB1A 4Q8LA 1MVEA 4JI0O 3PN1A 1SQXH 3WXPA 3B7MA 3QH7A 1J95A 4LF9O 1IKPA 4CU9A 1GKFA 2QQLA 1QJX1 1DG6A 3T3YA 5EC2C 2Q69A 3ZXAC 1TMF2 4QHOA 3D82A 3SNMA 4Y5Z0 3JAKA 2XHNA 4CDQA 4YW7A 1O3TA 1HRI1 1NE6A 3FAVB 2WO7A 2ZEZA 1QDOA 5B1OA 5CU1A 4YJ3B 1IS3A 2YMZA 4Q0UA 3IPVB 3K08A 5A3WA 3CSXA 4XABA 3ZYIB 5A6YA 3AB0A 1I6XA 1CZSA 1HX6A 1N1YA 2FCTA 2OCHA 4E4DX 4I9QA 3HN3A 4M0NA 4Q4W3 2Q8EA 1WBLA 1GR3A 4HT1T 5FZ1A 4FAHA 3QACA 2JK5C 4HSLA 2WYFA 4M3CB 1H8EG 1LULA 1JHJA 2XPJA 3MIGA 1S0CA 5FMBA 5B2GB 1CAWB 1AP6A 4P30A 1EPWA 4ZOLB 4TUYA 3J8F3 1CXZB 3RYCB 1LOCA 2A5ZA 4XILA 1HQWA 2YY1A 4FCAA 3JYCA 2BOCC 4DR2B 4NHYA 1XPWA 5EBMC 4MGQA 4FPFA 2UWCA 1IPSA 5GM0A 2GU9A 2Y0IA 3IFXA 1EAH3 4AQ6A 4DV4B 5DMYA 1N3PA 1Z7S2 1OLRA 2E7AA 4ICGA 4QHBA 4CCDA 3FUQA 1KYOF 2Q8VA 3MF9A 1N1TA 4HETA 5FOBB 3T2MA 3AP6A 1K5MC 5L9RA 1B04A 2CDOA 5APAA 2VG9A 2W5FA 5KHIA 3G6BA 3T4DA 4ORFA 1G9AA 2G19A 4MVTA 1EN6A 1QLEC 2P4EA 4Q5OA 2BTOA 1C4RA 4DK1A 4YJ2B 1NXMA 2X29A 5F3IA 1HNWB 1KJRA 2X5IB 4XDKA 3ZM8A 1Q8VA 2JEUA 1I94B 5FK7A 2HHHO 4L2NA 2J1VA 3MZHA 5IK8A 4YZ2A 1VBE1 2Z42A 3WCRA 1ULOA 2J1EA 3IDAA 2VOWA 5FXVA 4LO6B 3CD6V 2LFRA 1TG7A 1R3IC 3K2OA 5FP4A 1KS4A 5LCWL 3G4SV 3UV9A 4GWJA 1M56B 4Y1ZA 2JE7A 4OFGA 5FR3A 4UB6Z 1BQ0A 1AROP 1XSQA 2ZHMA 3O9OA 5HBAA 4Q0SA 2QTSA 5DAVA 2D98A 2PHFA 1DGSA 4XF1A 1ZRFA 4LR3A 5LMUB 2ZGOA 1GZWB 4CH5A 4S2FA 3HPNA 1ZZCA 4AXOA 4LTAA 5JSPA 4UFKA 4LBQB 4TSVA 4B7EA 2LM3A 2PYTA 2WINB 4PDWB 5B1AC 3UKVA 1H2KA 5LRSA 2QQPA 4CH4A 3PIGA 4FPOB 4MVZA 2ZX1A 1ZL8B 2HVKC 4YW1A 1PMHX 5JOYA 3HKCA 1RITA 2IH3C 1K45A 3WX5A 5FZIA 1IG0A 2DURA 4U3JA 1RUF2 4EKWA 4PDVA 5I0TA 4CZSA 1G6NA 4MYEA 2BTQB 4TWTA 2JDHA 4AR2A 4CU6A 2JDKA 2ZR2A 2UY9A 2XB6C 3A21A 1NZCA 5ANNA 3CHXA 3IZOA 2B9VA 1MS9A 1FPN2 4EB6A 4CVUA 2VCAA 1UKGA 5C9AA 3ACIA 5FO8B 4RS5A 4H7MA 4OPAA 1JZ5A 4FI9A 4BISA 1OCZC 4D6TH 2BVBA 1F8VA 3FJSA 5GALA 3A7QA 1LOFA 2ES3A 1ASJ3 5F39A 3FB6C 1GOHA 2EIBA 5JXIA 5JQGA 4CDWA 3ZDVA 2HP8A 1S0VA 5BMVB 3AK0A 3K46A 3P5BA 3KQRA 1T2XA 2JIZG 1QDCA 5KBFA 1NLQA 3V0BB 2FDHA 2QQOA 5L36A 5JZGA 4ZZ5A 5GTHZ 2AYHA 1O91A 4JC1A 3ZMOA 4DR6B 1RGSA 3RI8A 5CB7A 4X65O 2DCTA 1IQDC 1GP6A 3M1HA 3E6CC 1SBDA 1W04A 3R4DB 1B6QA 3ASNC 3TBDA 2BUKA 4R7CA 3LPGA 4W65A 3UJQA 4Z8BA 3DSQA 4ZI7B 1OXCA 2WNEA 3V0AB 5JCOC 5EP9A 2W1WA 4OHVA 1ZNPA 1SFPA 3CJIA 1XL4A 4DV3B 3OBRA 1SQBH 4WCEV 4QX3A 3ZHTA 4ES8A 3HQRA 5F8PA 4LF6O 2E51A 4C0HA 4WVWA 1WCKA 3DC6A 5CISA 3E86A 1JYIA 1AL23 5IVEA 3K3OA 2Z2SB 2VPVA 2WLQA 4QAWA 4I55B 5C7GA 3RN4A 1KDMA 3VBFA 1JBCA 3WP3A 5FUNA 2UY8A 1PO12 4HFSA 1O8SA 4GKXA 5LA9A 1SLIA 3I2FA 4JHZA 3BVOA 3AYEA 1REEA 2OPWA 1HDKA 1VP6A 2DW4A 3T1LA 2VZVA 2VOTA 4Y1XA 5D8AA 2Z5UA 2ZA9A 5FYTA 3PMSA 1OLQA 3QLQA 1KS5A 4CS3A 1ND2B 4QM9A 3ENRA 1TEIA 4CDUA 2QWRB 4PD4F 5T5JA 1US3A 4DXZA 2P67A 1G8MA 4UOJA 1DQ5A 3ZSEA 2JS5A 5CA6A 2DQ0A 2RM21 4OMCA 1OCOB 1RHI2 1ZX5A 4W4ZA 3KHCA 4XYXA 5BNPB 5B3SC 3Q8CA 3WNPA 4JI2B 3W9AA 2YFZA 4PDLA 5DPNA 1GQGA 1POQA 2CH7A 3BUCA 1RXGA 1EPZA 1OA2A 4OUEA 1OHFA 2ZGMA 4O9EA 3IN9A 5LOVB 1R1A2 4H13B 4JF3A 2VOVA 3D8CA 4AI0A 1UPGA 4FPGA 1S2KA 4IV3A 1N32B 5A1AA 5FZFA 1C57A 4Q4V3 3I2OA 2I74A 1RPRA 4KL1A 5DAWA 4D94A 2QJ1A 4AEDA 2E33A 5ITZB 4XIOA 4AGGA 1OZ0A 3M4FA 4RQFA 2VUDA 5FV3A 4LH7A 2XBO1 5SV8A 2VZTA 2A1XA 1XREA 2LFSA 2ZAAA 2VUAA 1HW5A 3WQ0A 1H6XA 4MTFA 4MH0E 2WL1A 4GWIA 3AZVA 3KB5A 4HNAA 1QHTA 3OF1A 2WLLA 2R30A 4LIUA 3I2GA 4J7JA 5IVJA 1MZ6A 4YYOA 3AK2A 3AMNA 3L73H 4H37A 1XNKA 1F51A 3K75B 3EQEA 2WSSG 2YZ4A 4ARYA 1BQZA 2WNVA 3TETA 3C2UA 1L1FA 3OMAB 1BEV3 3I54A 2VTXJ 1KP3A 4XFAA 2X10A 1NUKA 2TUNA 1RUD3 1RVF3 3I2DA 3GNEA 4DQAA 4XXAA 5LBQA 5JH7A 5A70A 2ZKLA 5LYJB 4JI7B 1PL4A 4KWJA 5C4WB 5KC5A 3RNSA 3ZSMA 2BWAA 1HRV2 1UXXX 3WINE 4UFLA 4UI9L 4LWSA 1QH7A 3UCSC 4YM2A 3CL1A 4YM0A 3H1KH 4XJUA 1RUI2 3C3TA 3WP4A 3H3ZA 1VMJA 4CH3A 4JGZB 1Q3EA 4YIPA 1AJKA 3IDBB 2VNVA 2RJZA 1QCEA 5J98B 1REDA 1L7RA 3M3EA 2ZXWC 3ZSKA 2VNOA 4XUNA 2J1UA 5EBWC 4S2GA 1RM1C 4LJHA 1N0NA 1NH2B 1ZM1A 1QXRA 1D2DA 4MZUA 1OV9A 4QXKA 1VMFA 5EFUA 2YUAA 2VXJA 1R3KC 3VD4A 4BOWA 5AC91 2E7TA 3UJOA 1W90A 4K8ZA 1AI7A 4ZZ8A 2VMGA 3ZN4A 2Y64A 5JSOA 1KD7A 4TWKA 2CV6A 5A6QA 3E6BA 4DUXA 1IS5A 2ZDIA 3ZFEB 3K9SA 1Q56A 4DUYB 1YJ9V 4XTMA 2R0HA 4KWUA 1WJZA 2JRIA 3I5DA 2B4KA 4BWAA 3I4IA 4LUKA 4N43A 2YXSA 5FZKA 4KP4A 1U12A 4WM8B 3ZYBA 4Q4X2 5K0UB 1SERA 4GKYA 3DXRA 3KCCA 1FFXB 4PJ0Z 4WFAV 1N1VA 1P7BA 4HOOA 1JVMA 4D6QA 4DR1B 2IJKA 4MTGA 5FMOL 3GCWA 2AHZA 3T1CA 2KM2A 1XNRO 5JCTA 1YJKA 3BAAA 4C0BA 3NO8A 5IWFA 1RJ8A 5LXTB 4CRQA 3ZFGC 1UX7A 2JDZA 3ZR5A 3E1F1 3DECA 5LASA 5L73A 4GB33 3FB7C 1W6NB 3TN92 3ZYPA 2D6NA 4RR3A 5I8TA 1F4MA 4KWLA 2EIMB 3TNQA 2ILMA 3U4XA 3T1MA 3NJVA 4UF0A 4F4LA 5LK5A 2HEYF 1OFNA 2QTOA 3CBNA 5JWPA 2ZE7A 4F8AA 2WLIB 5FXWA 1PNKA 4C7UA 3PJQA 5HV0A 1GN3A 1FOD3 3AG3B 4AI2A 4N21A 4X66O 4FXKB 5FCCA 1BK0A 3T4HB 2X5IC 1XE8A 5FJHA 3N35A 4XBNA 1WLWA 4U3FH 1SFYA 4I09A 5JIAA 1X9PA 4M01A 2WO2A 3KV9A 1W8UA 1BVVA 1DQ6A 1NI8A 3IIAA 3B09A 1PV0A 1PX3A 4Q1PA 1XNCA 3VBHB 1BBT1 1COV1 4DO0A 2OT5A 2WZ8A 4Q0PA 1GNZA 3T09A 2H3OA 1NA1B 4SBVA 4UBGA 4AI1A 4BYYA 2WLMA 4GZ9A 1AR61 4P00B 2V4VA 4QX2A 3F2ZA 4E4HA 4P2ZA 5K4LA 5CA1A 3NNFA 5FP3A 4JI5O 3HKDA 3WG4A 2ARAA 2EJRA 1O3SA 5L3EA 3CJXA 2TEPA 3AG7A 2C2AA 1VQ5V 5CFDA 4PDWC 3IJ4A 4JZRA 3WV6A 1S1AA 1OCCB 2F4PA 1O9HA 2GN3A 1GANA 1JMUB 2IJIA 2ZMKA 4EWEA 3NAPA 4JAAA 4QXBA 5GLVA 3MYXA 3MIBA 3F7VC 1BZKA 1EZJA 1Z5WA 5EZYB 3CXHF 5EXOA 1VQOV 4JV5B 1EM1A 3IBMA 1XB9A 3OY8B 3AMQA 3GB7C 1DGWA 5J48A 4HVOA 1MS4A 5DUXA 1Y74A 4DW1A 1X4TA 5LP6A 5C8CB 4SLIA 3L9DA 2VBDA 3WF2A 1TMF1 1XNTA 4LKSA 2Y38A 3RZZA 3RYFB 2PLV2 2Y6GA 3ECQA 3NNJA 1IPKA 4P08A 5FZ7A 3T0AA 3U4SA 4QPGC 1COWG 4QB1A 1KC8W 4ZHQB 4J25A 1R093 2RMU3 2CGPA 1RL3A 1UPSA 3JAWB 1KJLA 3H50A 4RUEA 1Y76B 1VARA 1XEQA 4K8RB 1OFSA 4COUA 5IYCO 5B4NA 2EXHA 4A7YA 1MOFA 2RE9A 1OUSA 2V4AA 2PHDA 4IEWA 2D93A 2E5LO 1DF0A 2Y69C 1B35B 3WNOA 2B42B 2XOMA 4O4IB 1Y67A 2VOXA 3GZAA 3OOXA 3ZIXA 2BTVC 4DINB 4E2GA 4K8XA 1OVPA 5LBFA 3JATB 4JKKA 3KCYA 1D5AA 3RYHB 2RS12 1W0NA 4F6RA 4UW3A 1Z7S1 3ST7A 2WZR2 2LW8A 5C70A 2QEXV 2IH1C 3NJXA 4RSUA 3VKMA 1BT8A 1PIV3 4FFHA 3VQVA 3QH6A 5EYPA 2VULA 2ZX3A 2F6BA 4K20A 5FY4A 3S6PA 1G8WA 2HYXA 3ETPA 1OHHG 2QM8A 1NCQC 3OMNB 5A3TA 5FYUA 5LHHA 3N9NA 4EYUA 3B4SA 2JJ6A 1ENRA 4XW3A 1JZ2A 1ULPA 4BQ3A 3FAVA 2DCJA 1OQEA 4UFHA 5B66Z 1X33A 4YWAA 3CJHB 3IPVA 1UFIA 4F3JA 3CLPA 3WDYA 5EIBC 5FZEA 2BCCH 1WCQA 1R3LC 4MVUA 3ZLIA 3LAGA 1AXZA 5JJEB 1LNSA 1GZCA 1YTFD 3ZXKA 3BALA 3K5LA 1OCOC 1TVKB 4ZU7A 1DGRA 4UCOA 2KD7A 3M99B 4YGCA 1VMHA 3RYCA 2ZE8A 1TE1B 4MW8A 1G9BA 2EIKC 4KGQA 4EQVA 2WWJA 3CRAA 5A32B 4N23A 1UY0A 4WF9V 2VQFB 3PMEA 4FVMA 5FBJA 3NW4A 4Y24A 1C28A 3KMHA 3ZKUA 1UKRA 4DV5O 2JB4A 4NUBA 4OGQB 4LH6A 1B09A 1QLNA 3ZEDA 3C3VA 4QQLA 1FXZA 2V5DA 5F7UA 2E76B 3NR7A 1UZYA 4AFCA 4GKJB 1ZLZA 2JKXA 3NV3A 3T2TA 1RUF1 3M2MA 1M1KW 2VW1A 4ATFA 3RPQA 3ZMNA 3DXUA 3E8FA 3NWKA 4P9PA 1BCXA 4GD4A 1PM4A 4JYYA 3RS6A 1SQVH 3QTCA 4KG0A 3UGGA 1FPN1 4CCKA 3ETQA 2XONA 2GC3A 4JTNA 1X8EA 3WUDA 1P4RA 2XVKA 1VBD2 1V54C 2GH2A 5I91A 3OAAG 3BB6A 4LHSA 1OURA 2QZ3A 2QSAA 1V6IA 2ZX4A 4DOUA 4CEYB 3RJ2X 4Z1MG 2W91A 4QKFA 3J4UH 4DB5A 5LA0A 2ZR3A 3W7TA 2I2SA 2P6CA 2KKWA 3VZOA 2NM1A 2R062 3CZUA 4AEDC 2FD8A 1CAUB 3I3QA 5GZCA 4K40A 3BIWE 4ZU4A 2IU0A 1FMD3 1CPMA 3I8TA 2WT1A 1DYOA 5GTIZ 4CTEA 4CP2A 2VZ1A 1UMZA 3WP6A 4BIFA 5JXHA 4NPRA 1AR72 2IJHA 5FL7G 5J2UB 3S57A 1V6MA 3ABZA 3W7WA 4A41A 1NS1A 2RS52 5IYZA 2CDPA 4KWKA 3SC7X 2GDFA 2ZEWA 3ABLB 3IAPA 4BDVB 1K92A 5L7OB 2XKPA 1Y4MA 1BKZA 4J10A 3C7FA 3JQXA 4ES9A 3RT3C 5KLVH 3MAQA 3LF7A 2BTQA 2CAUA 3ZSJA 4FLXA 3H7YA 4UAPA 5EIYB 4OI1A 1YJNV 3CEIA 1U97A 1I08A 2HKOA 1N3OA 3BVCA 3HKEA 3U10A 4RGKA 1WPBA 3U0ZA 1OQ1A 2BW8A 4W8JA 5C6CA 2UXDB 4O61A 5CFCC 2Y6LA 1PZ9A 4QPKA 1PO11 1EV13 1W3VA 4QGLA 1UQXA 4DY5A 4DR2O 2DCKA 2BOJA 4D7SA 2X7RB 4LKEA 3IIIA 3AFKA 4FM1A 5I0DA 2EULA 1H8VA 1QEXA 4NIDA 3O0VA 4DV4O 3MW2A 4QKNA 3CYOA 3INAA 2W39A 4CXXA 3EYPA 5BMVA 4BIOA 4C1WA 3MD0A 4FOWA 1BE3H 3VBSB 3BIEA 2UUBO 4A7ZA 2GMPA 3BA9A 2ATKC 5CA0A 2VVFA 3VDDC 2YICA 1MABG 1RHI1 2Y4UA 1WD4A 4P5YA 3KV5A 1BSMA 4XBFA 1FNZA 5LY2A 5K0UC 5JXJA 1I94O 3FD9A 1LESA 4HSJA 3ABUA 1PL0A 2DQ3A 1UZVA 4ZI7A 2CHHA 1RUG3 1PK6C 3ZXDA 3OFNG 4BHPA 1XOUA 4LBQD 4OLLA 1YYNA 4GX5A 1R1A1 2NYYA 4DXSA 4IYIA 5A7PA 1M90W 1POV3 2BU9A 1VB2A 2G4IA 5F3CA 2XL7A 3RYIB 4JYCA 3OCPA 3JCUZ 2PQSA 2EIMC 3IDCB 1PMJX 5LMUO 2GMEA 2ZGPA 5LHGA 3BOWA 1J83A 5F2VO 4I55A 1DZRA 2VR4A 1A78A 1JUIA 2WS93 3OW2U 1Q8OA 4UWDA 2VBPA 2L35A 4I0XA 2F1MA 3EXAA 5ERLA 4BK5A 4R52A 3CX5F 3JCZA 1LHUA 2DVFA 1YFYA 2R9IA 3AZZA 5FWEA 5LRRA 5JJJB 3FBMA 1WKYA 2VGDA 2PN5A 1W8WA 3W5MA 1NVPB 1ND2A 1OD5A 4AVBA 3TEZA 3OD0A 3AG4B 4UCVA 4M4PA 3O7OA 2CE4A 1S77D 3I3DA 5EJ1B 1RUC2 3VBHC 1QQCA 4FFIA 1O59A 1QOOA 2Y34A 1NA1C 4UXNA 4LE3A 2DWEC 5SV5A 3OB8A 5BNPA 3MUZ1 2AENA 4I50B 1Q81W 4META 4QMAA 5FO7B 4I0WB 4GMP1 1WW5A 1OCCC 4H14A 4U7NA 2DCZA 5LOVA 3POGA 4YGDA 1W9FA 3ZFFC 4AEJA 4RD7A 1AUYA 1GMMA 1VR3A 1HRV1 3CCSV 2WYSA 3QF7A 1NYWA 3JSLA 3AG1B 1RJ7A 4GJYA 4KQ7A 3K58A 2XUMA 1UXZA 3U78A 1RUI1 2I45A 3KZIZ 2ZPXA 2WQ8A 3D4KA 4JI0B 3OUJA 4HYOA 1OOPA 3CCRV 2H6BA 3OR7C 3K48A 4NROA 4BJ0A 3ZXEA 3DYPA 3B94A 5C8CC 4DRXB 4LLFA 3LSSA 4UW6A 1S0BA 3ABTA 3MICA 1BJQA 2A3XA 1N34B 4HK9A 4MTOA 1HKDA 3RZLA 5CFDC 4GMP0 3UESA 2PI5A 4DV3O 2VO5A 3K3NA 1W05A 5DZEA 3AX4A 4QWNA 4BK4A 3OBTA 2XUEA 1ZRIA 2LRPA 2OTJV 3LA7A 5FYBA 4KHPO 3PU3A 1ZZBA 2D97A 4B08A 2JENA 3AG2B 2WAAA 5EIBD 3QCWA 3B02A 2EALA 2P3YA 4AK3A 3PVOA 1PX4A 5J37A 4R6ZA 1OC1A 3AKSA 2BDRA 4GALA 4Q4X1 2YU1A 5FPRA 3RZHA 1XU1A 1B35C 5JVDB 3TYJA 5CKMA 4URTA 5F5CA 4YM3A 4LR4A 4WBNB 1QJEA 3AKTA 1YDXA 2KSDA 1JMKC 5C4WA 2DN9A 1YQ5A 4HANA 2VMHA 5FPXA 4DY3A 4B3MB 2R0FA 1MSWD 1Y7BA 3IT8A 2Z69A 5L3CA 2EICA 2W0FC 3FFZA 3K0DA 4W4KA 4CEWB 4DXRA 4PDRA 3TN91 1VE0A 2ARBA 4JGZA 5CA3A 5JIUA 4NTYA 4IGQA 1NU1H 4H0LB 2ODMA 4EFBA 5H9SA 1OI6A 1PD3A 1SF9A 1JR9A 5FYIA 1FYJA 4NO4A 4K3AA 1W3XA 3LFMA 1PKXA 2HEWF 3FX7A 3OEHG 1F15A 1KD1W 2J1RA 4NE9A 2DYSB 1ND3B 4XXPA 1W39A 4J7ZA 1W8FA 2EXJA 5IFTA 1OMIA 4PLOA 2DDUA 2XQRA 4FO9A 3UK9A 1N32O 1ENSA 3Q8EA 2ADDA 1JJOA 4JTOA 3NSTA 1LHOA 3ZFEA 5C33A 1SQQH 1XQ8A 2OX0A 4YW5A 1CJDA 3VHNA 1AL22 2ZXQA 1GWLA 4LFAB 1S5HC 4QKDA 4O9GA 2DVDA 4WM8A 1LJ7A 2HWD3 1XU2A 1QU0A 2HVJC 4TSFG 3PUQA 4UBHA 3OTOB 2E63A 4BW9A 3FUOA 2IVJA 1HN1A 3HJRA 4Z2WA 1KUQA 3ZYGA 5LXTA 3TEYA 4OUSA 4H3WA 5FZOA 1Q6UA 1YFUA 5JR7B 2G38A 1C5IA 4QXCA 3SITA 1P8JA 4GJZA 3HT1A 1XSRA 1KFUL 3WG7B 2OKXA 1YIJV 3AKPA 3K79A 4KBBA 3TXSA 1TNFA 4WZFA 4YSFA 1C8NA 3CDZB 3BU0A 5FLXN 3VD9A 5J3UA 1N8RW 1QJU2 3KF5A 2PXJA 5CAZA 4AQTA 1N3QA 2Y6JA 3RYRA 4JI7O 4KMQA 5I8YA 1VQMV 2PLV1 4ZY9A 2JE9A 5K8SA 1NH2D 1OLMA 4Y5TA 2HJDA 4MV2A 1F5JA 1IQAA 2ZNJA 3O12A 1ZZ7A 4O65A 4RQPB 3B5LB 3M8AA 5A33B 4E9KA 3QO7A 2DYRC 4Q4V2 2HKXA 3OYWA 1HNXO 2J1AA 4IIJA 5F5AA 1OVSA 4D8MA 4IERA 2EZPA 2WWUA 2VMCA 4EN0A 1QJX2 3ES1A 2JS3A 4IL7A 3WDUA 2LJ2A 2BSKB 4CC6A 3RRDA 3VBUC 4A5UB 3P6BA 4X65B 2ZCEA 4Y4RA 1HRI2 4TZDA 4W6WA 2VY0A 5ABJB 3ZPYA 2IXJA 4CPBA 4OUMA 5ACA3 1UD1A 2HWB1 2EIEA 4AILC 5FRAA 3ABLC 1GUIA 5DDJ2 5EZYA 5KX5B 5FY7A 4PDMA 2OIGA 5L7OC 2RS11 4DUYO 2Q9LA 5HFMA 4LF6B 3MF6A 2WZR1 3QG5A 1VAKA 5FYZA 3W7XA 1Z0HA 1BEV2 1E5HA 2ZGQA 4GAZA 3JARB 1WAZA 1H30A 4AVSA 4IV1B 1RUD2 2YC0A 2F66C 4A7KA 2Q1ZB 4DR1O 4FPKA 1AHSA 3ASIA 4DR5B 1Y3TA 1WA8B 1CPNA 2RDRA 3S5QA 3NL1A 1H8HG 1QVFU 1TVGA 4FP2A 5JMCA 3CCMV 4O2AB 3LNNA 2VZ3A 4L92A 4YFZA 3X2QC 4NIAA 5G05L 4P9GA 3HQXA 4MXWB 5D1IA 1UY4A 4PI0A 3LPFA 3T2PA 4Q26A 1JPXA 4AOCA 4CCCA 3KVBA 3A0NA 4IL6Z 4MSWC 4NIIA 3ABMB 5C3SA 4ABMA 1CX1A 1H4HA 1C8M3 2C26A 2UURA 3H7JA 3ETDA 4OX9B 4KU7A 4B3NA 3CS5A 4DV1B 3C7GA 3U1XA 1QKQA 1KB9F 5BNOC 4LE4A 1QIQA 3A23A 3AZWA 5IT9N 3ILFA 5CYYA 1N0JA 2FDGA 2WLPA 2Q0OC 4XAEA 5A7WB 4XDQA 3JATA 2H94A 4BB3A 3OD4A 5ANQA 4LF7O 2ZAHA 2IVIB 4CCEA 1GAXA 2HWF2 5GJ6A 2E75B 1AI5A 2JVDA 4IYHA 5FYCA 4BPZA 2RM23 1SZXA 1K4DC 5IVBA 5CG9A 5C3OA 2QDOA 5H9PA 3J9SA 4IHJB 2YXLA 5KA5A 3USUA 2IXCA 4DYLA 2ZIMA 2Y33A 1UY2A 1SQPH 2MW2B 5JPMB 1RUOA 1WA4A 1XUQA 1R081 2RJLA 3ZJZA 4I7ZB 1ZX3A 1Y9MA 3M3QA 2YROA 3LSUA 4HPKB 1LB2A 4CZZA 1S76D 2WFF2 4LEJA 1SLAA 3KF3A 1W0OA 3WW2A 1PNGA 1VBD1 3M3CA 5KXDA 2YIBD 3IC9A 4RN5A 4YVSC 1K42A 3QNEA 2XXZA 3PUHA 4NR1A 2B5HA 4MGIE 4JV5O 3URFA 2DWDC 4N7IA 5J1XA 3C3SA 2DTWA 2XNDG 2VQEO 2HWE3 3OBZA 4ZU5A 2P6HA 3N2GB 3JUUA 3SJCC 2GSYA 1VIWB 4E2LA 4XEZA 1IURA 2R061 1MZFA 3CKHA 2XWBB 3N3HA 1TVKA 3WNXA 2P3IA 2Q1MA 1AYM3 1DZQA 1DK1A 2XBO3 4PLNA 1YJWV 2GNDA 1OKOA 1JU4A 3CCUV 3G6EV 3E35A 3N7JA 5IY5B 2DU1A 2DVGA 1E79G 1SCRA 2DU0A 5GKAC 1AR71 4MGKE 4JPRA 3CIHA 4CP9A 2NNUA 4ASUG 4BR6A 2RS51 2ORXA 1FXKB 4HKLA 2JKBA 1S5JA 4PLMA 3SPIA 1LECA 5LBEA 4KH9A 2YS8A 3OPTA 1KEXA 3HVDA 4COYA 1F23A 5BYNA 2XJRA 2EF6A 1VALA 2I07B 1ORQC 3MDPA 3ZO0B 5LA1A 2BWCA 4D7TA 1SBFA 4DK0A 1W9TA 3I2KA 1KQRA 1JZ6A 2EILB 2D40A 5KMGA 2O1QA 4B8EA 1O4YA 1KFXL 3CPWU 1ZWIC 4WFHA 4YHHO 3BYWA 5IJ9B 1FKAO 5JUVA 3CU7A 3LDBA 1WCSA 4Y1UA 2NMNA 4F6EA 3RG0A 3R0RA 1K5MB 1CAUA 4QHZA 2LTNA 3AG2C 2GBOA 4PA6A 2Q8DA 3SYQA 4FOYA 5FWJA 4XFCA 1WGPA 2LQTA 4PF5A 4BU2A 3I55V 5DAXA 5BR8O 4LBOA 5K7PA 1I1EA 1AF9A 4B4QA 3D36A 1QBZA 4TYSA 5FKBA 1ZA4A 4JAVA 2FL4A 4YW6A 5CBLA 4MGTA 1F2NA 2JEMA 2GTAA 3ZBHA 1LRHA 5KAFZ 3MO4A 1VBC3 1R092 3JXSA 2C5DA 3J7HA 2NP0A 3ZRVA 4YNIA 4WZCA 4CEWC 3A22A 2ITCC 3L2YA 4YZ5A 2DUPA 2WN3A 3CZJA 4N53A 1ZREA 2DYCA 2VQ0A 4S2DA 4DV7B 1Z78A 4DR7B 3D5OA 5C93A 5CB4B 3MW4A 2JD9A 1D4M2 1NG0A 2WKKA 2GC2A 2AREA 3ABKC 1AX0A 1JOBA 4JDNA 4ZHNA 2WA4A 4XUTA 3AXEA 2K2SA 5B1AB 2DYSC 1ND3C 2PHTA 1HW7A 3J7LA 3S0MA 4MLOA 5JOWA 1S72V 4NTWA 2DFBA 5DAQA 2E6VA 2VQUA 1TME3 3NV1A 4WM7A 5EZWA 1VF6A 2NMOA 2VW0A 2YBKA 1H1AA 2OIIA 3B9IA 2EAKA 2GHYA 3ZRSA 4GKJO 2D6LX 4LBJA 5IK7A 1MA1A 4FLTA 3VBSA 4BQ2A 3AM2A 4JGYC 3O1UA 4IXLA 3D6EA 4FPLA 1RUC1 1MS0A 2D6OX 2YEVB 4B3TB 1VQ9V 1TUEB 1LOAA 3E8HA 5IAXA 4JYBA 1ULCA 2CU5A 4QQOA 1DYPA 1W6OA 5F1RA 4CDXA 3VBOB 1QOTA 1HJGA 1W8TA 1GQPA 1RMU3 4IGOA 4ZXEA 4AHXA 1E57A 2G9ZA 2PHRA 1W9WA 5DQ0A 1IBKO 1PVC3 1UZZA 4P9XA 4FTSA 4HL0A 4YY3B 3LEGA 2D5FA 2ENRA 3E6DA 3WNNA 1COV3 3B8NA 2RDNA 3ZXJA 2J7MA 3GZUC 5FP8A 3RYIA 4XHXA 2P22C 3OUHA 1VLNA 4JX0A 1TGOA 1K5SA 1OD3A 3E5XA 3ME2A 5KR7A 3H1JH 3RYKA 1KP2A 3NV2A 4IGPA 3E8BA 4TV8B 1JX9A 1SA0A 4AF9A 1AVMA 4YXWG 1V9U3 3ACGA 3K57A 1PPJH 1L7LA 1GN4A 1MS1A 3LFIA 1GM9A 4JZGA 2HLDG 4M0HA 1A6CA 1IVSA 1AZDA 5CBGA 1GZTA 3NKGA 4A6OA 1YF2A 4UB8Z 4GIQA 2VJXA 3BABA 3ZDSA 2WLJA 1VQNV 2JG8B 4RQPC 3WQ1A 3BU7A 2OQ7A 2R1BA 1X59A 1ZBA3 4UUJC 2Q6AA 2FDFA 3ATGA 1TMF3 2MNGA 4GZRB 5E6HA 4HZ3A 4I50A 4OMDA 2VMIA 3GWKC 2P6JA 3U11A 1VQ4V 3UL2A 3VOUA 4XFHA 2WC2A 1M93A 2K1EA 1W06A 2NR5A 1VAMA 3N27A 1LENA 3KGZA 4BA6A 1OSGA 3IGAC 1DQ2A 2W68A 4EWDA 3K5MA 1Y4WA 3HR9A 1H0BA 5A80A 1AI6A 1SCSA 4YVWA 1NX9A 2AC1A 3UT0A 2Q7GA 2GH8A 2FDIA 2VE1A 1PGL1 3CE2A 3BTXA 3HB3B 1VAVA 5DXDA 4J9YB 3B8MA 1OF3A 4XTPA 2Q7HA 4MHRA 1V6JA 4DRXA 3ASOC 5F37A 3PNAA 3GBFA 2EIDA 1WCDJ 5B3SB 5I93A 1EUTA 3ZMZA 3DPRA 4X89A 2E3CA 3N7KA 4MO3M 3VD3A 4H55A 4I5SA 1O9GA 1LU1A 3LGRA 2D6PA 1SLLA 2WNUA 2OA2A 2XKOA 2QDRA 2XMLA 4ONUA 1CAXB 3ZYRA 3OPZA 2QQVA 5GLWA 4MHUA 2NN8A 4CUCA 5FJKA 1GTOA 4JZ2A 1Z7S3 2E31A 2WR9A 4XPVA 5FDBA 4JRAA 3ZMSA 4LULA 4O4JB 1H2SB 2RR13 3KG2A 1DQ0A 3WSOA 5FTTC 1MEC3 1YQ2A 1NVPD 3ZN6A 1AL21 4AQSA 1DBNA 4I4TB 2ARHA 4NAOA 3RZMA 4XMIA 2IJJA 3ABMC 1AJOA 2BQPA 3GJBA 3L2HA 1J59A 2DFCA 1EV12 3VQXA 1FFTB 1OLME 1NJIW 3P1IA 3TEXA 4TLGA 4RUFA 4R9DA 4IUGA 3GF6A 3ZN0A 1K33A 3ZHUA 4E8DA 4N9HA 1D5NA 1IS4A 1QQP2 4MG2A 2HFEC 1J58A 3H8OA 4NIGA 1ZVFA 1OQDA 5CKNA 5C8YB 3ZRWB 1T6GC 3MV01 3AMPA 3W58A 2P7TC 4N8MA 2V5YA 4QU1A 1YQ8A 3Q8BA 4YGEA 3CEWA 2W94A 4B4RA 5I0UA 4ZKIA 2MK3A 1PZ8A 2H0VA 1HXS3 5HXMA 4QX5A 1WPXA 1UOBA 4XDJA 3ICXA 3IB3A 2CAZC 1IG3A 2RNBA 4UCRA 1S0IA 3J7NA 4LHKA 1YNAA 3BFRA 4DO2A 4IT5A 3NNLA 4INDA 2ETEA 5TISZ 1JU3A 1O3QA 1I5PA 1NLRA 5L3BA 3Q9OA 3HOBA 2PAMA 4DV0O 2A3WA 1H9WA 4TOIA 3POYA 1XOYA 1US6A 1G1XB 2ZCWA 4DZGA 2DCYA 2QE7G 1WW6A 1RUF3 1SPPB 1F35A 4DXWA 4BLIA 3HWJA 4Q4V1 3SCHA 4GH4B 2P5BA 4XF4A 1QJY2 1W8NA 1UX6A 3H1IH 4U2AA 1VQ6V 4JI3O 4AFMA 1W2UA 2ZXWB 1CIWA 2WBKA 2DBIA 4F7ZA 3RW0A 1RM1B 3GZEA 3E2EA 2Q4SA 4L9BA 3LIHA 3POIA 5FPBA 2WS92 1N34O 4NYKA 1SQ4A 1RSOA 1KDKA 2XQXA 2ZQMA 1AYN2 1GOGA 5IY5C 5HXVA 2DJVA 5JOXA 1XBLA 2BERA 1Q6HA 3RYPA 1Z5VA 3PJYA 1VRH3 2GALA 1U5YA 3DGEA 1W6QB 5DDJ1 5BNNC 1FXKC 2GUZA 2ZACA 2OTLV 3ACLA 1PM7A 5LGTA 3JD72 1W6MB 3VB9A 5KHGA 2J22A 2WUHA 1BEV1 3LSDA 2WLHA 1I7FA 5DG2A 1RINA 3EHKA 3IWZA 1RUD1 4UT5A 3WQ7A 2IFRA 3ILRA 1RVF1 2UWBA 3JAKB 2W6JG 4QPJA 2DTYA 4XDOA 2EXKA 1TA8A 3LIGA 4OXSA 2MPFA 1SDWA 3BODA 4XFGA 4A4AA 4LF4B 3DC5A 3I3BA 4DMIA 3UQ8A 2Q68A 2R6QA 3FZ3A 4NIHA 3ZFGB 4B3MO 2EILC 5BPXA 1BMV2 1VQPV 4FFBB 4P9OA 4B3SB 4JTAB 2C24A 4ZS3A 3FX3A 5D21A 5FY8A 3VKOA 1J3RA 1STMA 5A33A 3NJYA 3JAMN 3O5SA 1YI2V 1H2MA 1IDSA 4CBCA 2UUBB 1NCRC 2JGDB 2H8PC 2W6IG 1RUE2 3AL5A 4L97A 4TUYB 1AP5A 2XLAA 2F4LA 3ZIWA 4BLJA 4XDLA 2ZE6A 3CRCA 3AP9A 5ABJA 3VZNA 1U5XA 2C4XA 2Y8KA 3HT2A 1C3HA 1L3JA 4ZPIA 5AFEA 1FNYA 3UGFA 2ZX2A 4V2WA 3GALA 3GZTB 2HEPA 1FJGB 2HWF1 2O8OA 2E53A 1NT0A 4LFAO 2B7YA 3G80A 5BXZA 2DUQA 4K6BA 3KVAA 4IV1A 3A2FA 3KT4A 5IVCA 2QTWB 2XH6A 4LO4B 3OTOO 4IW3A 3IAQA 1BXHA 1NQDA 1S0DA 2YBSA 4BQ4A 4GWMA 1GBGA 2Q1FA 2LALA 4RGGA 5H9QA 3THTA 2OW4A 2AHYA 2WFF1 5I0RA 3RJRA 1R1A3 1F4AA 3FE5A 5GONA 1UU6A 3IDEA 2PA7A 1REFA 5B5EZ 4MXWA 4FPJA 4GB31 3N36A 1SQFA 5FXZA 2VBBA 1RC6A 2R042 4H33A 3CXCU 2HH9A 3C7HA 5KAIZ 5F2SA 1T5EA 2OWOA 2WDBA 1IBMB 3E89A 3K3WA 4PIYA 5T50A 2Q8OA 1CGPA 2ZKOA 3I3MA 2RG4A 3VBOC 4K1ZA 4XF9A 3SJQC 3H1MA 3JD0A 4Q4Y3 2GC0A 3VBRA 1EY2A 2YU2A 4QPGB 2YIDA 2W08A 4JAUA 2JEXA 4NHKA 1V6KA 2YV8A 5DN6G 3N2KA 3N9LA 4QPIA 2W87A 1YI9A 2A9HA 2HBTA 4E4ZA 1QXJA 3PIJA 2W1SA 3KWVA 3KSCA 5D5QA 2GNTA 4LF8B 1NOVA 2EIJC 2QWNB 4CCLA 4G4FA 4JRLA 4OZXA 3O1PA 3SPJA 2MEV2 1WP7A 2HWD2 4QQHA 5LWBA 1JZ7A 2AXTZ 2Q4PA 2Y69B 3BOPA 1CN1A 4EB6B 1MQTC 4BMEA 3WB1A 4HPKA 5FZHA 4PT6A 4E2SA 1XILA 3B9CA 3AP7A 1HRV3 3ZN5A 5KC6A 2JG9C 4R9BA 2BBAA 1DGLA 2BEOA 1H8TC 2QJVA 3C7OA 4YZ4A 3DN7A 5GLZA 4ZBMA 3VBBA 2F4VO 1UL9A 2WO3A 3OGSA 1HB3A 4H44B 5JQGB 2K0GA 3K59A 2JG8C 4KHPB 3U37A 3B3QE 2ZEYA 1PNMA 3DXTA 3CMEV 4V1PA 2B9UA 3RVHA 1NCQB 5JZGB 3H8RA 1PP9H 2BOBC 5C3PA 1J3PA 4DR5O 5HFLA 3K77A 4BIUA 4QX0A 3THCA 5EJZB 2NLJC 1JQ0A 3GYDA 3D0SA 1MACA 3DCQA 5A3PA 5FPVA 1GNHA 2EXIA 3OGRA 5L19A 1ENVA 1AR92 4LFCO 1RB8G 4BQYA 3L70H 4RFT0 2OCCC 4Y1YA 1R091 3ETEA 2UUAB 2ZGKA 1BHAA 4QPYA 2D2CB 4GULA 4S2HA 1SBEA 2KXLA 4FSJA 4Y22A 2JE8A 1LEMA 3RZKA 4OX9O 1M9NA 4DV1O 1D4M1 3VBFB 4F83A 2AACA 4QKBA 2W92A 1OH4A 3D3AA 4E4EA 5L9VA 1W9SA 2EIKB 5IYYA 3HPLC 1JYCA 1UMIA 4QX1A 5FY9A 1BLZA 3K04A 1JZ3A 3HAGA 1AILA 5KXBA 2A73B 2CTVA 5C3RA 3PVBB 2BPA2 5ACA2 4YM1A 4LLOA 1IXBA 5IJ9A 3KS7A 4EWAA 5H9RA 3TWIA 2UU8A 1MG1A 1MR5A 2QKCA 1K5MA 5KHJA 1PGSA 4LKDA 3RWKX 1UU4A 1C5HA 4JDMA 2OZ6A 1K8AW 1YXWA 4X20A 3WVJA 4QGPA 2B9ZA 1NLSA 2VZQA 3VKNA 2ATFA 4WFGA 3OJBA 1SC5B 4PV1B 1CVNA 2A70A 1NTMH 1JA8A 3LA2A 4AEKA 5FPZA 4LBEC 4YG3A 3G67A 3DGTA 1Q43A 3A0RA 4OULA 2Z79A 2LGQA 1V54B 4NXMB 4K35A 2AEYA 2GDSA 1XNQB 5F32A 1W0KG 4BXSV 3UM7A 3WUCA 4L99A 1M06G 4NRPA 2DUOA 1US2A 5JI7A 2XL9A 1WD3A 4AEDB 4LOSA 2YB7A 5CB4A 1J1TA 2WAOA 4GUNA 1OBNA 5E79Z 1C8M2 3UO2A 4MX3A 3T0DA 1F7YA 4JDOA 3THDA 4X8NA 3S3XA 4I30A 4PJYA 3PURA 3QO8A 5DZGA 5IJRA 2YGMA 5HI0A 2RV9A 1JW6A 1XQNA 4MUVA 1CEZA 1LHNA 2BGPA 1RUH2 3SYAA 3IKWA 4QGMA 2X0LA 2WLLB 1CP9A 4RO2A 4NTXA 2VZOA 1CZTA 3B00A 3FHAA 2QDNA 1W28A 3WR0A 3I59A 2RHPA 2ZIOA 3AYCA 4UYBA 3PDQA 4TLFA 2YEVA 4BE3A 4GH4C 3AEIA 4GT1A 3ACFA 1HNXB 2EA7A 1ZTEA 2OVUA 2PGGA 1WA6X 4PIXA 3R65A 1DFQA 3VKFC 1JFFB 5CFCB 2B39A 1M4WA 2F93B 4LBMA 2QQIA 1FV3A 2HEVF 1GO3F 2PLV3 3TK1A 4LNUA 1N47A 3I3EA 2CDYA 4P02B 2Y0PA 1U5ZA 2W95A 5A9GA 4Y26A 3CF6E 3BN6A 1HR0B 5K1PA 2VZUA 4X1KA 2AEZA 5FZ4A 5LGNA 1ZYBA 2HWE2 4I0AA 2CGOA 2H6CA 1WCUA 2EAAA 1SHWB 5FZ3A 5HCBA 2PUSA 1YIPA 3VZLA 1I5XA 1EN5A 5G04L 3VDDB 3VZJA 4AHYA 1GK9A 3OUFA 1AYM2 3CP1A 4HBNA 5AG2A 3T4VA 4XDPA 2PQQA 1GM8A 4CDQC 2YPDA 3TGUH 1F4HA 4NHLA 1XL6A 1H1IA 2ZT9B 4I3GA 2P17A 4FLVA 3DEMA 4HN0A 5LA6B 1PNFA 1PK6B 2QKAA 1C1FA 1K5JA 2VWJA 3TNPB 2RN9A 1O3RA 3PJSK 2RS13 2A0LA 3FN9A 2A6VA 2WZR3 3MUY1 1Y9GA 1V55C 2Y6FA 2UXXA 4DV7O 4DR7O 1A3KA 5BY5A 4LO8A 3GHNA 2MHFA 1LR1A 2IZWA 3AYAA 4P9WA 1WUVA 4XIKA 4EFEA 3H1LH 3ZN1A 1G4YB 3ZPOA 1H1MA 4ZONA 4NOTA 5FNVA 5FYSA 3ITQA 4BZ4A 1SLCA 1YZBA 2Z5WA 2QVSB 3UT5A 2VH9A 4K3UA 4J1WA 1EV11 5L9BA 2ARCA 2RS32 4W6YA 1SLTA 2XVGA 4NMIA 1SETA 1QQP1 3SKJE 1N33B 2PELA 3WB2A 3E5UA 4YZ1A 3O1OA 5LW9A 4XUOA 4LF7B 4K21A 3AVSA 1NQTA 4B3TO 5FXXA 3ILNA 4UF0B 1I5ZA 2DWRA 3CQOA 2WLNA 1GH6A 2QM7A 4QE9A 3GCXA 1RTVA 1I9RA 5E88A 1AXKA 1HLCA 1QOSA 2YIAA 4J42A 3A0BZ 4LF5B 1JCHA 3SGIA 4Q0VA 3H1HH 4Y20A 2A7WA 1S0GA 4FMTA 1VBB2 3IM0A 5FY5A 2PFWA 1M57C 1CAXA 1RUG1 4RHV3 3IC7A 4UFMA 3ZFFB 4G27B 4YY3O 3APOA 4XCAA 3EHBB 1VBC2 4UVBA 2VU9A 1GRJA 4FLYA 3QOPA 4FQ4A 4O4JA 5F3EA 2VZRA 1LR5A 1POV1 1OT5A 3T1HO 2F23A 3MIHA 2VQEB 3N9MA 3CMAV 2D6KA 4I4TA 1QJY1 5DEDA 4I02A 1H38A 2X09A 1RUJ3 3WNLA 1MPXA 2J42A 3UYJA 5CN0A 4IE5A 5IWAB 1PO22 3HKDB 1DQ4A 4JQRA 2WS91 2WSUA 3KV6A 1DLLA 2WLKA 1AYN1 2A6WA 1PMIA 4X1YB 5CFDB 1KECA 1VF7A 4QQ2A 4XZUG 1VIBA 3LDCA 1AX1A 1YHFA 3UKMA 1TME2 2OQ6A 2WA3A 3O1VA 2W3JA 3AC0A 4QDSA 5C8YA 3OSDA 3ZHVA 3LZZA 4LOTA 3JASA 4Y5SA 2A6YA 1ENQA 4LCUC 2HWC2 4LBLA 1E1QG 2R063 1FPOA 3VZMA 3X29B 1Y6XA 3JD71 5DZFA 1LOBA 4FTEA 1XYOA 5LP6B 2ZGUA 4NKGB 1QHDA 1FI2A 4AWDA 1YFWA 4CE8A 3AKRA 4NXNO 1DP0A 4JI6B 2QQUA 1W99A 2K9PA 1RMU2 5C9AC 4RS5C 2OS2A 4K0KO 2XAFA 3V65A 2ZGSA 2RQ6A
chains in the Genus database with same CATH topology
2DTWA 3DPRB 2HWE3 4COVA 3PHMA 4ZU5A 1RHI2 1BMV1 3NV4A 2HWB2 1ZX5A 1PVC2 4GQ7A 1BYHA 1LOFC 3JUUA 2GSYA 1VIWB 4XEZA 4XYXA 2R072 2WNUB 5BNPB 2R061 3OTFA 1MZFA 4XE9A 2XWBB 3N3HA 3WNXA 1YWKA 2P3IA 3W9AA 4CDWC 2Q1MA 5JPNB 1AYM3 1DZQA 2QCSB 3MW3A 2XBO3 4PLNA 1GQGA 2GNDA 1EPZA 1OA2A 3ALQA 4CEWA 1LCLA 1OHFA 3N4MA 2D43A 2ZGMA 3N7JA 4O9EA 3IN9A 2EVXA 1R1A2 2DU1A 4D7YA 5JZGC 1BQPA 2DVGA 4AGVA 2VOVA 3D8CA 1SCRA 4AI0A 4AI3A 2C1FA 1RUE1 1AR71 2DU0A 2PAEA 4FPGA 5GKAC 4MGKE 5GZGA 1S2KA 1V9U2 4IV3A 1YJLA 1ENXA 2PTMA 3ZN6B 2YDEA 1GKBA 3FC0A 4CP1A 1C57A 1WLCA 4Q4V3 2I74A 4AEMA 2RS51 4KL1A 4D94A 5KHKA 4AEDA 3QBQA 4HKLA 2JKBA 1CESA 3SH4A 5E1RA 4XIOA 1GSLA 1X82A 4AGGA 1ZBE3 4I01A 4PLMA 1ND3A 1LECA 1KXGA 2BNOA 1XRUA 3R05A 1JTZX 4KH9A 3M4FA 1GY9A 3CJIC 4L8QA 2D7FA 1IZ3A 4COYA 1DRYA 1RUG2 1QNYA 2XBO1 5SV8A 4XJAA 5BYNA 3ZXLA 2ZAAA 2VUAA 1SLBA 2XJRA 1W6MA 1HW5A 3WQ0A 4UXAA 2EF6A 1Q8PA 2QE3A 1VALA 2I07B 1ZBA2 1NY72 4M3CA 4LBKA 3MDPA 3ZO0B 4MH0E 4XZPA 2WL1A 2BWCA 3LWCA 1D4VB 4IEXA 4JGYA 1JXNA 3AZVA 3KB5A 3OF1A 1W6PA 1CAWA 2R30A 5CVRA 2ZX0A 1OPOA 1SBFA 4D7TA 5A3MA 3R4UA 2R043 3MLLA 3VBFC 1XYNA 1MZ6A 3B69A 1KQRA 5FQ0B 3ELNA 4YYOA 2D40A 1RIRA 3AMNA 1NQJA 1XNKA 2E9QA 2O1QA 4LHNA 3EQEA 1O4YA 2YZ4A 4B8EA 1KFXL 3USSA 2WNVA 5FOJB 3I7DA 4XMAA 2BBVA 1FPN3 3C2UA 3WW1A 3VUOA 1BEV3 1DGRN 4HVRA 3SH3A 3ZFGA 3CU7A 3I54A 1WCSA 4FPCA 2PHXA 4Y1UA 4XFAA 2NMNA 2P3KA 3ZXGA 2TUNA 3RG0A 1NXD1 1RUD3 2ARXA 3R0RA 1K5MB 1LODA 5D8AC 4P9YA 1CAUA 1RVF3 3WOGA 2LTNA 4EN8B 4B4PA 4I2OA 4E2QA 4FOYA 3I2DA 3GNEA 3VLBB 4XQ4A 4XFCA 2OG6A 3U07A 4D69A 4DQAA 4XXAA 4CDUC 1ULFA 1WGPA 1NX4A 3WZ1A 2ZKLA 4LO7A 4LA3A 4PF5A 1KITA 4MGYE 2OG5A 2IXLA 4DRRA 2R041 4ATEA 4LBOA 3FHIB 4KWJA 5C4WB 5KC5A 3RNSA 5K7PA 3ZSMA 2BWAA 1HRV2 1I1EA 1AF9A 2AUYA 3WINE 3WDWA 4B4QA 4XBQA 4TYSA 1ZA4A 4BWOA 1QH7A 3POSA 1D0GA 5CBLA 1F2NA 2JEMA 2NQYA 1W0PA 4YM2A 1R082 1LRHA 3CL1A 4YM0A 1V6NA 2Y0OA 3VV1A 1AL0G 3AMMA 1AR82 2X5IA 4XJUA 1RUI2 2MEV3 1VBC3 3WP4A 1LOGA 2Q30A 3H3ZA 1R092 4C5WA 3KM5A 2GAUA 4JGZB 1Q3EA 5GZFA 1AJKA 3IDBB 2C5DA 2NP0A 4Z1VA 1WW4A 4YNIA 4CDQB 5J98B 4Q1RA 1REDA 1QMJA 4WZCA 3M3EA 3MPPG 4CEWC 3L2YA 3RDIA 3ZSKA 2VNOA 4YZ5A 3EO6A 2N7GA 2DUPA 4S2GA 3N7MA 4N53A 4M26A 5LEJA 2XG3A 1ZREA 2DYCA 2HYKA 1ZM1A 1QXRA 4MZUA 4IV3C 2VQ0A 4S2DA 4DFSA 1Z78A 3D5OA 4QXKA 4A2UA 1RUC3 3MW4A 5EFUA 1D4M2 1NG0A 2WKKA 3AZYA