3P3PA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1997-2016) peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3pA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3pA01
2W0XA 4AI8A 4NR1A 5JWPA 3KCYA 3D8CA 2CGNA 1H2KA 1YCIA 2ILMA 2WA4A 2CGOA 2XUMA 2YC0A 4BIOA 3P3NA 1MZEA 4Z1VA 3P3PA 3OD4A 1IZ3A 1H2NA 1MZFA 4QU2A 2WA3A 2YDEA 4Z2WA 4JAAA 4B7EA 1H2LA 2Y0IA 4B7KA 3KCXA 1H2MA
chains in the Genus database with same CATH superfamily
3CB2A 5JOZA 2XG3A 4CZSA 4C7UA 4PQ9A 2VVFA 2RDCA 2XAQA 3BFRA 1AVBA 4FPLA 2ARBA 3KHCA 4HVOA 5FXZA 5B1OA 1PL0A 3CIHA 3W7TA 1RUH3 3BABA 1P7GA 2RDSA 2FKXA 2OYZA 2IZWA 4HG6B 1W6QB 1ZA4A 1J5EB 1ENVA 1QU7A 4X66B 3KZIZ 3OTFA 4OMCA 2QTSA 1UKRA 2B5HA 2ZACA 3S3XA 4JHTA 1GWKA 3WNPA 1YLLA 2JICA 3ZHSA 1D0GA 3PJYA 4IE4A 5L19A 4RQPB 1GNHA 3ABUA 2R16A 3CCEV 4O9GA 3VBRA 4K6BA 4YPJA 2VMIA 5FTTC 3HR9A 4BA6A 1VBB2 3K9SA 1W2TA 3J81N 3ABZA 3UM7A 1LOFC 3OGIB 4XDQA 5LBFA 4QU2A 4MXWB 4YSFA 4P08A 2DJVA 4NHXA 4QPWA 1KP2A 2YYOA 1S72V 3PN1A 1KQRA 4RN5A 1GM9A 4CPBA 2UU9O 3AC0A 1ND2C 3RW0A 4NTWA 1QJU3 1XHXA 2YXHA 5FZCA 1IBLO 4WVVA 3QH7A 3RQ0A 2FD8A 2OKXA 4MHRA 3TGUH 4NPMA 5T5JA 1IPJA 4IE6A 4KL1A 1HRI1 2EULA 2CH7A 4H2AA 5C7GA 1RUG3 4DV1O 3T0DA 1G9FA 1ZRRA 3J7MA 5JCTA 2WLKA 1RUF2 3AP6A 1SLLA 4MTOA 1UW8A 4BM8A 5LHHA 1OLRA 1OF3A 4OVEA 2B4KA 4DMIA 4TSFG 4GWIA 2RDNA 3FFQA 2PY5A 1AI6A 4J41A 2EICA 3NNLA 1W8FA 4LWSB 2DYSC 1YUDA 1VMJA 2YY1A 4EQVA 4KGQA 4N43C 3M4FA 2OS2A 3LNMB 3WNMA 1XNAA 4KU7A 1TVGA 1ZNPA 4XC9A 3F7VC 1RL3A 4A45A 1ASJ2 5LL6Y 3ABTA 5LA9A 1W8OA 1HB4A 1AJOA 2HKOA 5GLVA 4MVOA 2BWAA 5EIBD 1XNCA 1AZDA 3ZYHA 4H3WA 4CS3A 5JXJA 2F17A 4WFHA 1H8TC 5H6RA 2ZGSA 2CYFA 3GNEA 2BW8A 2DFBA 3OYWA 3STLC 2F6BA 3SYCA 3ZFFC 3DXRB 4OFGA 4DR4O 3STZC 3ZEDA 3WCRA 3JBG1 2E31A 2W3JA 1NBMG 1ND3A 4NXMO 5FOJB 5IUQA 2BERA 1NE4A 4JI7O 5B4XA 3I54A 1SZTA 1N8RW 4NE9A 3NJYA 4DRVA 2YEVB 2VW0A 5GLZA 5BY5A 4QAWA 4KG0A 1AR1B 1Z0HA 4MHUA 2RJ2A 3ASOC 3FX3A 3POJA 4YJ3A 3CJHB 5LA0A 1VBC3 1PX4A 4K8RB 3TYJA 1R092 2ZR3A 4Y1VA 5B3SC 4M0HA 3VN4A 4AQYO 3VBBA 4LF9B 4WM7B 1BT8A 2E9QA 1NCQB 3R4DB 4DV2O 4CDQB 5C4WB 1UPGA 4LHLA 3V0AB 1GH6A 1WCDJ 4COUA 4EJRA 2DF7A 1NH2D 4JI0B 5A1LA 5HI0A 4B3SB 2GNMA 3I2DA 3M3CA 1EAH2 3QVNA 3JD3A 1VF5B 3CRCA 3PVEA 4MTFA 4HPKA 5IJ9B 4HANA 1NU1H 3CJIA 4WVMA 4UBGA 2XBO3 3FMGA 4V2WA 3CXHF 4XEZA 1DCSA 4LNUB 2ZGRA 1OFSA 5E8AA 1QH7A 1DGRN 2A70A 3UT5B 1UMIA 4IGOA 1MPXA 1NA1C 5IK8A 4TUYA 3OOXA 3S3WA 1VQPV 3VBRC 5FZGA 4CEWB 2Z69A 4BPZA 3VKMA 4Q8KA 2WT0A 2ZXWB 5JQGB 1QQP1 1BSMA 3AYDA 2BU9A 2GNBA 3BRCA 3JAKA 1Y9GA 1GU3A 4XPVA 3E8GA 3ZDSA 2VMCA 5IE9A 2ETNA 1W8TA 3DPRC 2JDIG 4EZ4A 1AR61 4JVAA 3JZVA 1B09A 2CUGA 1HNXO 2E74B 1WW6A 1W8WA 4Q4V1 5LBBA 1W6PB 4DW0A 3FAVA 5C3QA 1GFF2 4LT5A 1XYOA 4TUYB 2GTSA 3ZSMA 4QGMA 5HV0A 4CC5A 3QH6A 3GM8A 4BJ0A 2VUAA 4CZZA 3E89A 1MEC3 1N36O 2R1DA 4UFLA 4DV7O 1I94B 4AI0A 3C3TA 2AH2A 3ZRWB 5FZ4A 1W3XA 4XUNA 3CCJV 2RS32 2WA3A 3AG2B 1W0OA 2NQYA 3VBHC 4CU6A 5J09A 2XH6A 4QU1A 5D1IA 1AHSA 2UUAO 1HNXB 4GKXA 4H14A 3TEXA 3W21A 4BHPA 4QB2A 4COZA 3VBHB 2J7MA 3AYCA 1FMD2 3OMIB 2NZ9A 1FD9A 2D5FA 2RV9A 5GZEA 3NAPA 4PHZA 2X09A 3GGLA 2UXCB 4YJ3B 2TBVA 3I3MA 1B3QA 4LOSA 1QJFA 3FKSG 2VQFB 4E2LA 1IS4A 1XILA 5FZDA 1DLBA 4HN1A 2LFRA 3CDZB 4LFCO 4BWAA 5KHIA 1S55A 2WL1A 3NWKA 2VOWA 1B06A 4ZI7B 1DF4A 3VD9A 1WMFA 4HVRA 1UO9A 2QQPA 2HWB2 1J1LA 4ZXKA 2WZ8A 2EJ7A 4O4JB 1VBE3 3K79A 1W6QA 2QQIA 1D5AA 2KKWA 5DDJ1 4YVWC 1DP0A 3ELNA 4YW3A 1XNRB 4JTDB 1AXKA 4KHPO 3OTOB 5FO9B 1W05A 4RS5C 4M3CF 4FPFA 1V6NA 4N53B 3ALQA 1WP7A 5CU1A 5L7OA 2OIGA 2PAKA 4LHSA 5DAVA 3USSA 4DXZA 2HBUA 3THPA 5FNVA 1VF6A 5BR8O 2A73B 2LJ2A 3LSSA 4DR6O 1UXXX 5IVCA 2J1UA 2ZZJA 2ZGLA 3DGEA 1UPSA 1C8M1 2GMMA 2WN2A 3KVAA 1VMGA 4BQYA 3L75H 5CBHA 2E6VA 2OCCB 4MSVA 4ASUG 4Q4X2 1SLAA 1T6BX 5D8AC 1AR62 4CDUC 3ZXJA 4Q4W1 1HRI3 2WSUA 4LF5O 1QNYA 1OFNA 3KV6A 4FVMA 3RYIA 5J9PC 1LKNA 2R042 1J3QA 2VMHA 3N2GA 3ZXFA 3QACA 4JTOA 1LRHA 1LESA 3H1HH 1LHOA 2PQQA 3T4ZA 1OA2A 1PO13 4FBFA 2VNVA 4LKFA 1AL21 2ADPA 3L9JT 3WP5A 1WB8A 5JZGA 4EN7B 1K4DC 1PMHX 2W47A 3LEIA 1CJPA 5E1AC 2Y0PA 4YJ2A 4XQDA 5CFCC 4MX3A 4JI5B 2VNOA 2OCHA 2VPVA 3KF3A 4UT5A 5F37A 4LFBB 2L9LA 1XE7A 1IS6A 1SLTA 2GAUA 1SS3A 3J8F1 3ZO0B 3TN93 1QLEB 5CG9A 1MS9A 3NV4A 1FX5A 1FKAO 1J58A 4BW9A 3ZYBA 2FDIA 3RWRD 4XDPA 3ZLIA 2BBVA 1OKQA 1SZBA 2VY0A 2I45A 5L3DA 5C6CA 4XJWA 1FI2A 3MIFA 4XIOA 5BUVA 2LTNA 5C8CB 5EJ3A 1AR5A 1FMD3 1W9SA 3WFVA 4PF5A 1M57C 2JKBA 3RFRA 1R1ZA 1PNFA 1L0NH 1K5SA 4FPGA 4FK5C 3ZHUA 1X82A 3JCUZ 1NQTA 4BQXA 5B4NA 3ZSKA 3DYPA 3QNEA 3TETA 4IEUA 2YDEA 1JZ2A 2EA7A 1YJNV 5HBAA 4NMIA 3RYHB 2AXTZ 5FNVB 3BB6A 5L3FA 4LP8A 2LQTA 2V5DA 4ZS2A 4LBKA 5BNNA 5EIYB 5JJEB 1XBFA 5AVAA 2QR4A 2NNUA 2QM4A 1TUBA 3ZPOA 1FYJA 2CAZC 4OPAA 3KWVA 5A70A 2WWWA 4MW8A 2FMDA 4N90A 4KUMA 4LEJA 4CXWA 1PIV2 4LO8A 3B09A 4QD2A 1Y74B 2AEYA 1AJPA 3FLTA 1R1A2 3AEIA 4QIWF 2XB6C 4BK4A 1WGPA 4OYUA 5LEJA 2LW8A 4N23A 1RJ7A 1AI4A 5M0TA 3OE7G 4IEOA 3ENRA 3JQWA 2BZDA 3KGLA 3GBFA 1TUEB 3AG2C 1SBEA 2VR4A 3SJQC 4TQFA 2BEOA 1WLEA 3ZMNA 4OXSA 1W99A 1PVC1 1YITV 4DR3O 5IYBO 4NROA 1RPOA 2D6PA 2HFEC 3BTXA 4B3SO 2XT9A 3PVNA 3B2EE 2NP0A 3A0BZ 3OUJA 4FP3A 5JVDB 3JASB 1BLZA 2Y34A 1EZVH 5A3LA 1Z2GA 5IK5A 3CD6V 3WQ1A 3POSA 3EB7A 3O0XA 3TNPB 3D3QA 1LHNA 1I3HA 2O14A 4OI1A 1MS8A 4P02B 3KZ4C 3WNXA 2E5LB 5F3EA 1CX1A 3OGCC 2XQXA 1XREA 4JDMA 3VDBA 1BBT3 4YG3A 4CS2A 4QT6A 4Q26A 1HR0B 2H8PC 4X65B 2ZX2A 4DR2O 1H6YA 2Y6FA 1QJY2 4TQDA 4ZHNA 3PIJA 4N9IA 3C7FA 2QE7G 2XJSA 4Q0UA 5T52A 5CFDA 3SCGA 5EJ1B 2W6JG 2V73A 5BXZA 1XMQB 1VE0A 2XL7A 1KS5A 3MW2A 1NVPD 4JTNA 4I01A 4X65O 2ZOEB 1UFIA 3Q9OA 3E2EA 2QM7A 5FQ0A 5B1NA 4DV5O 5H9SA 3BVCA 4JYAB 1Q90D 4D6TH 4FPEA 1IKQA 3ABMB 3M3EA 2Y26A 2W68A 1H2NA 4CCLA 2RM23 3WG7B 1E5SA 2WFF1 2V4DA 5CB4B 4BQWA 1LTEA 3AP4A 4JYCA 1UZYA 4FT8A 4LA3A 3I2HA 3VZKA 4Y24A 1AL22 1K12A 3IZOA 3KG2A 4YW2A 4HETA 4WM8A 3QG5A 5K1XA 1GKBA 4EROA 1AR72 1OBNA 4LF8O 5IT6A 2AZ5A 3C7OA 3PMSA 4CEWA 2HWD2 3UKNA 5LMUO 4NHKA 2XR4A 1OVPA 1GQGA 2QDRA 1I5ZA 2J1RA 4FLYA 3ZBHA 3J26N 3WXPA 2UYAA 2E53A 3ZMTA 2VOKA 5BV6A 4FMTA 2JE9A 3BTZA 1RITA 1HB3A 5FPAA 1Z7S1 4RGKA 1JOBA 1V6LA 3OTOO 1RHI1 4XDOA 3ETEA 1V55C 5EYXA 1AXYA 3AZXA 4YVWA 2E26A 1ZREA 1ZZCA 3WG2A 2G4IA 5A7WB 2FDGA 4UCOA 3CCSV 2RQ6A 4B3MB 2WQZC 4Y5SA 2FCVA 3N4MA 1J3PA 5T5PA 3OCPA 5FP7A 2XQRA 2XDVA 3TXSA 5C8YA 4ASKA 3R6SA 4FPHA 2EZOA 2JDKA 5K0UA 2VQAA 2QJ1A 5A7SA 1F9KA 4FIPC 5J96B 2VCAA 5DN2A 3E8FA 4DR6B 4LR3A 3O1OA 2JS3A 1NAEA 1X8EA 1S0EA 4XF3A 3K0GA 4J10A 1R3KC 2DYCA 5DABA 2ZR2A 2YC2A 2YHJA 3ZIAG 3HOBA 5ANQA 5CMUA 5C8YB 3BVOA 1U12A 4WF9V 3BGAA 4PQQA 2WABA 1AP6A 2Q9LA 5I91A 3PURA 4MG2A 3EMRA 2CTRA 3WW3A 5IVVA 1NVPB 5K9YA 5ABJC 1SBFA 1O5LA 1GK9A 1WN7A 3WP3A 1LR1A 3FB6C 3WNKA 2YS8A 1MS0A 2DCTA 1Y6XA 2ZBJA 1QH6A 5E88A 1OQEA 1GLHA 2ILMA 3OYWB 4QKFA 3K4ZA 4DXRA 1O4YA 1YHQV 3QOPA 1GWLA 2EAKA 1S5JA 1YQ5A 2KSDA 3M3OA 4J9ZB 4MADA 1P4RA 1RUE2 3L74H 2Y69C 3ETQA 2KM2A 1VBC1 5FYSA 5JOXA 3I59B 1XE0A 2XWBB 1H9WA 4LLFA 1XHZA 1VRH3 4JGZB 2QM8A 5J7MA 2ATKC 3ASIA 1Y76A 5BNPB 4DRXB 3MLKA 3POYA 2PHRA 1NS1A 2DTWA 1DQ1A 3G6BA 1RVF1 2DW4A 3CCMV 1RXGA 5C9AC 4DUZB 2OIEA 3JAWB 1UY3A 3JQXA 3SYQA 3DYMA 4R9DA 1GOHA 4AGRA 4GIQA 3C90A 4H13B 1SFPA 1OLQA 4CE8A 3SR2C 2W95A 2GTAA 4AFBA 4CCOA 3WDWA 1IBLB 1G1XB 1QJY1 5BNPA 2HWC1 4JCKA 5IYZB 2PLV1 4P00B 2R071 4I4TA 3GJBA 1R6TA 2ET7A 1BVP1 3B77A 5T5OA 4QX0A 5DAQA 5L9RA 1LGCA 2JIJA 3I2GA 2IXKA 3OBZA 5T3NA 5DPNA 4E8DA 2WUHA 2AEZA 2VH9A 5FZEA 1Y76B 1H6XA 4DY3A 4K8FA 2OVUA 1AJNA 4HKWA 1D5NA 1SHWB 3THTA 1HX6A 5CB7A 3MW3A 1QJU2 1KU9A 1Q8OA 4YVSC 2UXDB 4CUCA 3T2MA 1HQLA 1GAXA 3I55V 4NN0A 4TV8B 4D7YA 3T1HO 2FB5A 5D5PA 2PI5A 1B6QA 1BXHA 4XUTA 4K35A 2QDOA 4COWA 4LOTA 3RYFB 4DUWA 3GZUC 4KBZA 3KV5A 1O9GA 1M93A 4R9AA 4UFMA 4CBCA 1G9AA 3O65A 1N34B 3UYJA 3SH5A 1SDDB 1IBKO 1ZRFA 4I9WA 1UF2C 1JXNA 2C9KA 4DR3B 4IGGA 5HCFA 1C8M3 4ABMA 4CC6A 4D69A 5FUNA 4ZXEA 3Q8BA 5JH7A 1WNSA 2YU1A 2PZSA 4YW1A 3B4SA 5BNQA 1WA6X 1PGSA 2BNOA 3OG2A 4JC1A 3ICXA 5A7WA 1HRV3 2AC1A 4RSUA 3THOA 2WS92 5GLUA 5ANNA 4YYOA 5JJNB 5C33A 5BNOB 1K5QA 4Z8BA 5CISA 3H9AA 3RN4A 1RIRA 1OCRC 4IIJB 1VBD1 4GKYA 4A7KA 4X20A 5C8CC 1R3LC 2GUZB 4IW3A 3X29B 2R062 2X7RB 2WT1A 4UYBA 4FAHA 3J7LA 5FPUA 1MVQA 1LHWA 3H1JH 2BOJA 5L3CA 4W4LA 5FY0A 4O2AB 1HB2A 1NCRB 2A3YA 2VMGA 4Y22B 1HR0O 3NL1A 5LK7B 1YYNA 3HT2A 4X6RB 1QJX3 1GMMA 2FCUA 1JZ8A 1N0NA 3F5TA 4RR3B 5E1RA 1VAKA 1Q6HA 1QLEC 3B3QE 2QQUA 1FXKB 1IOAA 1N4CA 3GJAA 1P8JA 3JUUA 2F4PA 1IVSA 4I9QA 1S2EA 4OUSA 1QXPA 1QJZA 1OJHA 2JDNA 1ZZ6A 3ZX7A 4AWDA 2CDOA 2FDHA 2VUJA 4MLOA 5A7OA 1S0BA 1ND2A 3WNNA 1DYOA 1YFWA 1JYWA 1H2SB 3KCXA 4QX2A 1FMD1 3CRQA 1NTZH 4GJYA 3R0RA 1LOGA 3AFGA 3ML0A 1DQ2A 1COV2 4MO3M 3BOWA 4LF8B 1QMJA 2XVGA 1TME3 1S0VA 1BBT1 1BEV3 3WG1A 4RHV3 4Y3OA 3BA9A 4F6EA 3E22A 2VCBA 4IE5A 1K42A 3SYAA 2PGGA 1WMXA 5F5QA 5LMUB 1NCRC 1ZUQA 1SKVA 4R50A 1LHUA 4MGKE 2WZR1 1AR93 2GMEA 5K1PA 2GSYA 1XQ8A 3N9NA 4AVVA 4AVAA 4KP4A 2Q1ZB 4JZGA 3MPBA 2X6AA 5J2TB 1RHI2 1PKXA 4FPPA 1HRV2 3IBMA 3PTYA 4MVSA 4E2QA 4OHXA 4DV1B 1F23A 1V6KA 3N9OA 1LEDA 2IH1C 3OR7C 3WDUA 4P9WA 1K5MB 2H6BA 5DDJ2 1SRYA 3C7GA 4TYSA 3EXAA 5FPXA 5JZGC 2GP5A 2GNDA 1CD3G 2XBO1 2GUZA 4UUJC 2HWD1 1R3IC 5JIAA 3B9CA 4YY3B 1NY71 2JGUA 3CXCU 1IKPA 1UY2A 2CDYA 1Q8VA 3IAPA 3T2TA 5FYHA 4LF7O 3RNSA 4GX0A 4DW1A 5ITZB 2H94A 3O12A 4QGNA 5FJHA 2Q0AA 3H8XA 1DLLA 2ITCC 1WLWA 4PDWA 2ZHLA 2A71A 3VBUB 4P5HA 1LU1A 4EEQA 2DWRA 4S2DA 2EINB 3BY6A 2A3WA 5FPRA 1L7LA 2ZJCA 2D93A 3GYDA 1K73W 1FV2A 1KD7A 4E2GA 1ST8A 1UY0A 5JXIA 2YPJA 3G7DA 1JS9A 3HNBM 4FSJA 1SPPA 2K9PA 2Q67A 4YW4A 3HN1A 4ZPIA 5JCOA 4IEYA 4GYCB 4GX1A 5I8SA 2RS53 4E27A 3A0KA 4JRLA 4TLGA 1P7BA 4MGIE 2YI9A 4K9SA 3WVJA 5CADA 4FXGB 5HCAA 1OA3A 5HPOA 2HEPA 3FB5C 3ZYFA 3LIGA 4GB32 4FVVA 2DYRC 5IWAB 1VQ9V 2EIJC 3VKNA 1EZJA 1R1BA 1OH4A 2GH2A 4YW6A 4U7OA 1Y74A 4XACA 5FXXA 3V0BA 1FXKC 2ZGNA 1RFYA 2QKSA 1ZL8B 5FYYA 1S0CA 1YQ8A 5DUXA 2ZHMA 3CC7V 4FOVA 2DMXA 2XXZA 1RSOB 3WW4A 2DVDA 1VQ7V 5BY1A 4PLNA 3ABKB 3WB0A 1N3PA 2PYLA 3IAQA 1U97A 3LPFA 3CU7A 3RRDA 3GZTB 1VBA1 3ABKC 4QE7A 3ZIXA 1COV3 1MEC2 4X64B 3QD6A 2UY8A 4AI9A 4A4AA 3OBTA 4XTMA 1U5YA 3MUZ1 2DE0X 1ZL8A 2BOBC 2IJKA 2WAAA 5A7QA 4DR5B 3AKQA 1MQTB 3K59A 1ZBA2 4QHZA 1UMZA 2BV4A 4X1IA 1CZSA 2YC0A 1GRJA 2W1UA 5GW7A 3K48A 2TNFA 1PM9A 4ES8A 3ST7A 4W65A 2WLJA 2R49A 2QZ3A 4DV4B 5C5UA 3CCUV 1EN5A 1J59A 3GWOA 4JYBA 4AHCA 2ZGOA 4WBNA 4JGSA 1OHFA 2YPDA 3HAGA 3WDVA 1GN3A 2AENA 2BP6A 5CFDC 1LNSA 4PJYA 2JB4A 4WFFA 2BVVA 4BU2A 5BZBA 1N36B 1U0AA 3MO4A 2YIBA 1GQPA 1OQDA 3O0WA 1ULEA 5LBEA 3BOPA 4N53A 2DU1A 2R30A 2LW7A 1XSQA 3DXUA 4XUPA 4CCJA 5F9TA 1RUC1 3GBGA 4CP1A 2HKXA 2JG8C 4JZ2A 3AMPA 4DR7O 3OGJA 4U3JA 5C4WA 1SZXA 2LGWA 3CLPA 3WZ1A 1K8AW 5KXBA 3FB7C 4ZOLA 1JYIA 4NWWA 2UXXA 1FYUA 4XILA 4XFHA 2X6CA 2D5HA 1VMFA 1W06A 2P6JA 3LEKA 1WD3A 3ZKYA 4MT8A 1W8NA 3KHBA 2BE3A 1JJ2U 1NH2B 1CPMA 4YIOA 4YRDA 3OD4A 4AI2A 1XMOB 5IAVA 5CA3A 4IUGA 1FAYA 4XDKA 2VMDA 1H1AA 2N05A 2L35A 3WR0A 5FY8A 3G4SV 2VNRA 3RS6A 5LP6A 1VQKV 2WLHA 1JZ3A 4DV2B 1JTZX 1GOGA 5H9CA 3AK1A 4P9OA 3OGGA 3POBA 2Y0OA 4XZUG 2E3CA 4O7XA 1S3JA 3SC7X 3DKQA 5B5EZ 4UW4A 1VQMV 3W5MA 2Q30A 2ZE8A 4XDLA 1TZOA 2V5YA 1C3HA 1QXRA 2QWRB 2NLRA 2C24A 1PIV1 2IXJA 2XVKA 3AJZA 1TNRA 1UOBA 5I0UA 4YFZA 1PNKA 2BFUS 4FLVA 5A7NA 1PM7A 1Q56A 4Y4RA 4QQLA 4DUXA 3AMQA 1OMIA 1CGPA 1K33A 1MZFA 1PNMA 3K04A 4L8QA 2W94A 1G9BA 1POV0 1VMHA 5FLHA 3N7LA 2YBSA 3H1WA 1Q7YW 1REDA 4LA2A 2ZE7A 4R4XA 3APOA 1RUG2 1S0FA 5EV7A 4CP9A 5K7PA 5FPBA 2VQ0A 4QXCA 1W2OA 1XNKA 5EYPB 1AR83 5JVVA 3UT0A 4PLOA 3PL0A 4YY3O 2EALA 1KRIA 2YGMA 2V72A 2LM3A 1MVEA 3L70H 5LYJA 2EIDA 1PZ9A 4TOIA 1PP9H 1XNQO 3FAVB 4ZZ8A 3RYKA 3JD1A 2LFSA 4KQ7A 3ZXDA 3DXTA 1BHAA 1TE1B 5DEDA 3R4SA 5FUPA 3D36C 5EXOA 1JMKC 3AK2A 2XOMA 2Y33A 1LAJA 2BNNA 1CAWB 4U36A 1HP8A 4X89A 3GXUA 3PVBB 4M00A 3USUA 1CR7A 1UY4A 4Y4YA 1Q6IA 3AG4B 3KVBA 2B42B 1NKGA 2XJVA 1DGLA 3ES4A 4ZY9A 1US6A 4Q4W2 1F5FA 4OHVA 1PK6C 1RJ8A 5DAXA 3POIA 1Q86W 1FFTB 5E6HA 2WKKA 1URFA 1VQ6V 2EAAA 3CJIC 5EHDA 1RC6A 1H1MA 1AJKA 2ZDIC 3PIGA 3U0ZA 2ZE6A 2ZPXA 1UPIA 3P3NA 2QNKA 1O5UA 2QE3A 2OT5A 1GTOA 3AM2A 1W04A 4B8EA 1V9U2 4N43A 2MEV1 3HR0A 2C4XA 3BODA 2JEXA 4KHPB 1OQ1A 2KXLA 1KD1W 5F6LB 4Q20A 4KGGA 1AYM3 2VUDA 2C2AA 3MIGA 3ES1A 4O2BB 2RS12 1LOEA 3Q8AA 4L9BA 4FM2A 3CC2V 2D3PA 1JPXA 2F1MA 2JK5C 1XL6A 3ZKUA 3FLRA 5FMBA 3WF1A 1DF5A 1ZRCA 2RCVA 1CJDA 3TN92 2EXHA 1UIJA 4N53C 3AP7A 2ADEA 4ZI7A 1I1EA 1K97A 4Q8LA 3CMAV 1YQCA 2O8QA 1IXBA 5IYYA 1WMEA 2JENA 2QVSB 2HG5C 4DIQA 5FZHA 3NV1A 1SLIA 4MGSA 2RJZA 1PZ8A 1M4UA 4I0XB 1EV13 1RUG1 5FP4A 1AR92 4R9CA 5AG2A 3X2QB 3BU7A 2CTPA 1YJ9V 3CP1A 1XUQA 4LF5B 1VQNV 1V54C 5J2UA 5LP6B 1NI8A 4NPRA 4NXNB 1J95A 2CV6A 1YDXA 3NO8A 1LOBA 4NOTA 5KUMA 1DK1A 2RHPA 3RVZA 4CP2A 2JE8A 2JD4A 2E5LO 2ZEYA 1GQHA 3CS5A 3HKEB 4CH6A 4I2OA 3J7HA 3JARB 4JRAA 1CX4A 3ZYPA 3SPIA 2GP3A 4DR2B 3FB8C 4UWDA 4Q4V3 3K9AA 5HV4A 4FTSA 3U07A 4E4HA 5DZFA 3RWKX 4XJUA 2QJVA 3I4IA 1POV3 2ID4A 2DN9A 1F2NA 5D8AB 3OW2U 2RR11 3IPVB 5FZ9A 4KWUA 3M70A 4NAOA 1A8MA 4LUKA 2JEMA 3VBOA 5C3RA 3QBQA 4JAAA 2OQ7A 4CCNA 5J2UB 3CRMA 2PA7A 1J83A 2Q69A 1JVMA 1CESA 4NIDA 1RP3B 1YI9A 3T4HB 3LE0A 1H0BA 1FOD2 3QO7A 1FXHA 1M1KW 2FQPA 1CIYA 3N35A 2RM22 4LF6B 1QOSA 4QXHA 3K3WA 2QWQB 4FFBB 3GCWA 5FZ6A 1RUD1 1ZBE1 4BIOA 4FPCA 4EN8B 3T30A 1VALA 2BJSA 3JBG2 1Q8SA 5A3PA 1L7QA 1PVC2 5FY7A 1WCKA 1VBD3 3BU0A 4QM9A 1ULFA 5ACA3 3NNFA 3SYOA 1B35A 1KFXL 1R64A 2YZ4A 4PIYA 4X8NA 2E75B 3ZFGC 1QDCA 5DZGA 3MV11 1XNRO 1C5HA 4LBMA 1APNA 4FFIA 3A0HZ 2WZEA 2XJUA 1JYNA 4AVBA 3RMYA 3H8OA 3C8XA 4XJ9A 4NIIA 4K0KB 1UYXA 5J1XA 1WPXA 5KHHA 2EVXA 1VQOV 3ORJA 5FZ3A 5A3OA 4EN9B 2BOIA 4J1WA 2GMPA 3VDDA 4AEDC 1NCQC 1F5JA 4K1ZA 1UOFA 2VC9A 4LO6B 3LF7A 1T5EA 4QXBA 4CH5A 2YROA 3PLQA 5F2WA 4M0NA 3DC5A 1P84F 5GZCA 1R081 3PUSA 1NTKH 5L9BA 1HLCA 3ZFFA 1WLDA 4D8MA 4ASLA 2VMEA 4W4KA 5FK7A 4KG8A 1I5XA 3JD0A 3JAKB 1DGWA 4C91A 4P9JA 4QDRA 2A3QA 2Q5TA 3WDYA 2O57A 5F5CA 2A06H 4AE2A 4IEZA 3AKTA 3JCIA 4S2HA 2VOXA 4LE3A 1JZ7A 1E5HA 1RHI3 3PUAA 4CUBA 4Z92B 1W6NA 2D43A 2Z4FA 1V54B 4JV4A 3W7UA 5LY1A 1FJGO 2MHFA 3E97A 2PELA 2WZPP 4HPKB 2DTYA 3T1LA 2P1BA 3OGSA 2YXYA 3APBA 2A75A 2Q8CA 4Y26A 4B4PA 4YM3A 3K4AA 5J37A 3UQ8A 2OXBA 2A6VA 3NXSA 3ZHTA 1D2DA 2X10A 3WNOA 2F66C 2XJTA 4Y33A 1RM1C 3ZN5A 4K40A 3WU2Z 1VBE2 4DZGA 4YGEA 2WFF3 4BK5A 2VQFO 1M56C 2HP8A 3JU9A 5GLTA 4GWJA 4PA9A 5IK7A 3AYEA 1ZBA1 2C0ZA 3DYOA 2XNDG 1XEQA 4E2SA 1HRI2 2ZCEA 2JG9C 4QNHB 2CTWA 3A2FA 2P17A 5FLXN 4D7SA 4LMFA 1S2BA 1QR9A 2MNGA 2VRZA 1WP8A 2WRAA 1JOJA 5KXEA 3BALA 2HWF2 2FZ2A 2G19A 1AR82 5GKAC 2BGPA 3WCSA 3K77A 3KMHA 1OCZC 3CCVV 1Y4MA 4CA9A 3VBFA 3OBRA 1EFRG 2UWAA 5FZOA 4YZ1A 2OWOA 3LSDA 3J4UH 1EY2A 3ATGA 3T4VA 4AXOA 3AZVA 3HN3A 3FD9A 1F51A 4DV6O 3HKDA 2HWE2 1JOPA 1WA8A 2EIMC 2HVKC 2DVFA 1RUH1 2HWF1 3IC7A 1DF0A 1KXGA 4Y1UA 2QKCA 3ME2A 5I0SA 3E5QA 2R70A 4EN0A 4BIZA 4IXLA 2DQ0A 2A6WA 5C5TA 4HBNA 3TRSB 5J36A 3KQRA 3DC6A 3G67A 4YM1A 1KFUL 5IK4A 4NHMA 5J3UA 1HDKA 1SQFA 4DR4B 5JR2A 2Z5WA 1VQ5V 5JUVA 2JWPA 1PK6B 1UOGA 1UD1A 1SQXH 2F43G 1VBC2 2W1WA 4DYLA 4QPIA 4OI4A 2P6CA 4TV9A 2WJSA 1Y66A 2KD7A 3MICA 1V6IA 3ITQA 2B9ZA 2UWBA 5L9VA 1F4HA 5KAIZ 4KWJA 2BGCA 4CUAA 4NTXA 1OLME 1XU1A 4QPGB 1I9RA 3I2KA 2E33A 4CCDA 4GH4A 2DVGA 4AGVA 4JI1B 3IT8A 1GOFA 3U1XA 3UKTA 4QPGC 2XBO2 4EYUA 4GUNA 3RZMA 1XNBA 3A7QA 1ONAA 1ENRA 1ULOA 4CCKA 3WF4A 1YZBA 3OR6C 4KH9A 1ULPA 3ZXAC 4X1KA 2WLIA 4A3ZA 1BBT2 1JCHA 1NQJA 1YVWA 4AAPA 1HXS3 1L7RA 4QX8A 1REEA 1W9FA 1YTFD 2VZ1A 2BWCA 1MS3A 3CMGA 4FTEA 2DQ3A 1HJFA 3BPSA 4Q6GA 1QNMA 1ALYA 3T08A 4LK6A 2YICA 2VD7A 2WNOA 3FE5A 4I4TB 2QTOA 5KX5B 3ZXKA 4FLUA 1VRH1 3NKTA 3OSDA 2YUEA 5JXHA 5DUVA 2JDZA 2J1TA 1K9MW 3B69A 2X5IB 3IMNA 2LW1A 4ARYA 2DBNA 3WP6A 3L73H 5A80A 3WF3A 3LA3A 3A23A 3VDCA 1H38A 4AEDA 4BQ2A 4UVAA 2W08A 1HIXA 2RS13 2XJQA 3I59A 3M8AA 5B1BB 1C28A 1GO3F 1DQ4A 2R72A 4JI8B 2PI4A 3ACHA 4MVZA 3ETGA 4LO4B 4F6RB 3FUOA 3UKVA 3IFXA 1MS4A 1UZVA 4XJAA 4DXSA 2E63A 2JEUA 3LWCA 1AXZA 4PDMA 4A5UB 2VQUA 2WZR3 4TWTA 3LNNA 4QPKA 4AFMA 1U96A 2AW9A 3DTUB 4CH4A 1HN1A 2J22A 5JMOA 3GZEA 2VBBA 5L7OB 2V4AA 3OT7A 4IEPA 2ARAA 2V1DA 1EV11 1QQP2 4NRPA 3Q8EA 2YFUA 2B8MA 4IEQA 1O8PA 5LOVB 4IL6Z 3VOUA 3IAYA 3CC4V 1R082 3A22A 2DDUA 1RUJ2 2V4VA 2WLLB 1TEIA 4I50A 4IT5A 3SH3A 4E4SA 4B3RB 1WKYA 2FBEA 4LBQD 4YZ4A 3OB8A 1GN6A 1CZTA 4CEYC 1OCRB 1HWYA 1N34O 1H9PA 3D3IA 1ZRDA 5BNOC 3VDDC 5JI7A 3POWA 1XMOO 4MUVA 1EPWA 4XFFA 4AAXA 4BLIA 2JXAA 1SERA 4CVUA 4LH7A 5D21A 3VD4A 3THCA 1BHBA 2FMLA 4DV0B 1PGL1 1OPOA 3L72H 2WDBA 1KKDA 5KA6A 4L87A 3GBWA 4CDXA 2P4KA 3K5LA 3NQHA 3IMMA 3B9IA 4JI6O 4UFZA 1FOD1 2OPWA 1I08A 2XJPA 5K8SA 4BCUA 3MF6A 5FPZA 3M7AA 1AB3A 3I2JA 3HKEA 3OEHG 2WPDG 5CAZA 4LFAB 3RZHA 5BPXA 2OCCC 2VJXA 3VGIA 3L9DA 3CZUA 1AJQA 1F4AA 5LY2A 4B29A 2KG7A 1VIBA 4GULA 5K4LA 2D44A 3VKOA 2HWD3 1SA0B 5C3PA 5EQUA 4HLTA 1OD5A 5FYVA 3GHMA 1GM8A 4EWEA 4N21A 2EIGA 3AMHA 1DZRA 1PO21 2PXJA 4COVA 2Y0IA 2SLIA 1S1AA 3VZNA 2VVEA 1KYOF 2DUOA 2HEVF 2JDPA 5A3MA 1VP6A 3O0VA 5C8CA 2XWJB 4XYXA 4G2KA 1SQBH 1D4VB 2PHDA 2XJRA 3ZM8A 3KSCA 3CPWU 5BNNC 1AX0A 4MV2A 2WO2A 4CU9A 5CA1B 2A9HA 3K5MA 2PYJA 1G86A 2WS93 2D6NA 4JAUA 5KHJA 1VBB1 3ACGA 2ZXQA 4PA4A 3VB9A 4UFJA 2RDQA 3VL8A 4PF1A 2WNEA 1SA0A 4MS2A 3P1IA 4O4IB 5FPVA 3DUIA 5A1AA 3ZCCA 3U11A 4MGYE 5A6QA 3T1YO 4NR1A 1XYPA 5CA0A 3ZSEA 1A32A 2DUPA 2VUCA 3VD7A 4NPLA 1ZTEA 5C9AA 2Y4TA 1UU5A 1ZX5A 4PI0A 4QPIB 5F39A 3HMYA 4HKLA 1G6UA 5AC93 5L36A 5EC2C 2P6HA 1W6OA 4OUMA 1ACCA 3AKPA 2WO1A 2EIBA 4Z2AA 4LBEC 2IM9A 2QQKA 3CJHA 1RUE3 2QQWA 4CCCA 4XAEA 4RA0A 3VBHA 2YC4A 4B3NA 1K5MA 3TK1A 4LBLA 3HPLC 3O1TA 4M3CB 5FP3A 3QO5A 3SCFA 5FRAA 3PHMA 2ZHNA 3TXQA 3K2OA 4BXSV 3T1CA 5K0UC 1OA4A 5ABJA 4YVWB 4FOQA 5H5NA 2WA4A 4Z1MG 4NIHA 2HLDG 3FZ3A 2W0FC 5IVEA 1NA1B 2CAVA 5D5QA 3EJKA 2X29A 2Y38A 1QVGU 3VQWA 3KT4A 1WAZA 4JGYB 4LPLA 2VOTA 1QBZA 1TUBB 1JJOA 3HKDB 3RBZA 2VZ3A 1L0LH 3RYIB 5FZMA 2WQ4A 2XAGA 1X9TA 2Y6GA 5IVBA 4ZZ5A 4JAVA 5L3GA 1CZVA 2W5FA 4TXWA 3WW1A 2F93B 3ETPA 1Z5VA 2D6LX 5LA6B 4DUZO 2P5BA 1X8MA 3M1HA 2JRIA 5LGTA 5KMGA 5JQGA 1C1LA 1OSGA 2VQTA 1LEMA 2A0LA 2VVDA 1SACA 5LW9A 3MFAA 1JYCA 1ULCA 3S7EA 5FV3A 1WW7A 4OGQB 5LA1A 4DXWA 1V6JA 3AKSA 5F6KA 2AGSA 5FLIA 2CL2A 4PIZA 5CKNA 3ZRSA 2VU9A 2D6MA 3HVDA 5LWBA 2VTFA 4DPNA 5LB6A 3WB2A 2BVBA 4R8CA 3SJCC 3FHAA 1V00A 1YJKA 1W6MA 5DMYA 2H3OA 3KT1A 1PGW1 5A3UA 4DUVA 2TUNA 2XLFA 4W50A 4WBNB 2RS31 4PLMA 3B8MA 3J7NA 3S6PA 1D2SA 2RDRA 5GZDA 4MGZE 2JDYA 2JE7A 1JFFB 1W9TA 2IVIB 3UGHA 2VZRA 1IGOA 5LA6A 3ECQA 4LXLA 3UO3A 3VBSB 1SCSA 1NY72 3TJTA 4DV5B 1W0NA 1WB7A 4JI3B 1O4ZA 4URAA 1EV12 4FP2A 2CTQA 4JX0A 5EIBC 3RPQA 4LNUA 1MACA 4MXWA 1B04A 1YFYA 1PO23 3UJOA 4LKEA 2RJKA 1VQ8V 1LJ7A 4GT1A 2ZIOA 4AFCA 2R043 2NYYA 3QO8A 2F95B 4GWNA 1HQNA 1C4RA 1CAXA 3SHRA 3VZMA 3QLQA 3FL7A 4DV7B 4OHZA 4IIJA 4HNAB 2DU0A 2P7TC 4B3TB 4B4RA 3INAA 4N7IA 1OI6A 1I0HA 3ZN6A 4MVRA 3IGAC 5F2SA 3KQ4B 1GKFA 2YXLA 3B7MA 4IGPA 1H4GA 3TEYA 1UX7A 3EXUA 3N7KA 3CO2A 3OJBA 3ZYJB 3LCPA 2OIIA 3KV4A 3MDSA 4WM7C 1DGSA 3M7MX 4XBQA 2Q0OC 4JI4B 1FS0G 4YHHB 3AKRA 4GKKO 5EC1C 4I09A 3SGIA 1NLQA 3C3VA 4UCVA 3O1VA 5FMCA 4BQ5A 5JOYA 1Z7S2 2BTQB 1TG7A 4BLJA 4LBJA 5A1FA 3CEIA 4ISRA 4CDXC 5FCCA 4P30A 2OZJA 1UMHA 1S5LZ 4X66O 3WF0A 5GLWA 4WFEA 2DUQA 4L92A 1SF9A 2ZD9A 4YHHO 4N8MA 3ZMUA 3VZJA 5LGNA 3EVKA 5F2VO 1W39A 4EKWA 1JI6A 1UCXA 2CHHA 4AI1A 5FZAA 2RNBA 5FP8A 4RQPC 5B2GB 4WVWA 3JD72 3NSTA 2HWF3 3UKMA 5CKQA 4I50B 4N7UA 4YM0A 1ASJ3 1GM7A 1ODNA 2HYXA 3D3AA 4JGZC 4AI3A 4CCEA 5F3IA 1NYWA 2UWCA 2XAJA 2CTVA 3T09A 4QXKA 3FYEB 4LHKA 2E7QA 1CAUA 4FZ0A 1QOTA 4NRQA 3OBAA 1NTMH 3DPRB 4EN6B 2QQLA 1YFXA 1Q43A 4H33A 1WW5A 4GWMA 4GCZA 4JV5O 3BYWA 2R1BA 2EJRA 1V55B 2LALA 1FPOA 1GP4A 4Y5Z0 3K58A 4CEWC 5H2FZ 4LIUA 1SLBA 3VBOC 4GKJB 4DEQA 2ZGKA 3AZYA 1KP3A 4ZU7A 4Y1ZA 1LENA 1XQNA 2DCYA 2CGNA 3IN9A 4IESA 4TWKA 5C3OA 2X05A 1HW5A 1ZZBA 1C8NA 4XQWA 3MUY1 3GWKC 3AXEA 3S30A 1YEWA 4IV3C 4FFGA 3SPJA 4DR5O 1EAH1 5IATA 1VRH2 2K1EA 1G6NA 3HNYM 3V0BB 3RWNA 2CWMA 2V09A 3TBDA 1XB9A 2BDRA 1HNZO 3U14A 2FTKA 1RUNA 5KBFA 3H1MA 3UETA 5G04L 1IXMA 2GSMB 3VL9A 3ABMC 4Q1RA 5CFDB 2Q1FA 4YIPA 5A6YA 4UFKA 4IL7A 3PJQA 1O3SA 4U3FH 1Q8PA 5LMNO 3JAWA 2WNUC 1FXZA 3VHNA 3WOGA 5CBFA 1R083 3T2OA 4LF4O 4H44B 3T0AA 4V1PA 5KHGA 1BZWA 3FFZA 2ES3A 1KJLA 1AYN3 5A32A 2UUCO 5IT9N 5FAXA 4AHZA 3ILRA 1J84A 1WA4A 2ZGMA 2HWC3 5FO7B 4FLTA 3WG3A 1YXWA 4X62B 3E6DA 2DVBA 3SKVA 2DYRB 2VWJA 3G6EV 2PHWA 2YXSA 1EN4A 1Q3EA 3BIEA 4LBQB 2RMU3 2VZVA 2UUCB 3MAQA 2GC0A 2XVLA 4HKOA 1VQLV 4QMAA 4LF9O 4LUMA 2BGOA 1AR63 1F35A 1US3A 3AG1B 3I7DA 2B9UA 4P9LA 3OEAA 5FY4A 4X62O 5IY5C 3OD0A 2EIKC 2YI8A 2C1FA 5F3CA 3NV3A 3FC0A 1FFXA 4BQ3A 1A8DA 2FDKA 1KS4A 4A2UA 3JD4A 2QBXA 3WY6A 2QWPB 3FJSA 1S77D 1OHHG 4JZRA 2UUBB 1PO22 5FKBA 3GZAA 4GJZA 4O4JA 4OI0A 2LP7A 1QEXA 1O59A 5FUIA 2VULA 4C8DA 3JD2A 4RQFA 1ZAUA 4Q4Y1 1ENXA 3OMNB 2ZGQA 5CVRA 4CDWC 4CDUA 5FY1A 4J25A 3P6BA 1ND3B 4XDJA 2Z0AA 1SFYA 4RWUA 4JI1O 4M3CA 1MZ5A 3RI8A 4RHV2 4ZKTB 1JFFA 2XUMA 5LK5A 2PYTA 1ZYBA 1T2XA 4SLIA 2EX3A 2Q8VA 4YFWA 5J2TA 2ZQMA 1JN2P 3WUCA 3PVOA 3VBOB 2LGQA 5FYIA 2WC2A 2BFUL 2PHXA 4ZKIA 1VBD2 3SJAC 3M99B 3ZX6A 3UJQA 2BTOA 3EO6A 1O9HA 1K3IA 2DYSB 3OGRA 4CDXB 2RMU2 2WNVA 2R061 2EIJB 2NMNA 4R6ZA 4FFKA 3ZSLA 4XUOA 4F83A 5EP9A 2LUWA 4UI9L 4UOJA 1WBFA 1QR8A 1ZBE2 1PD3A 3GCXA 3MI8A 4MZUA 2Y69B 4J7JA 2Y60A 3CE2A 3PU3A 2F4LA 2YFZA 5CFCB 1OH3A 3TEWA 2VZUA 2ZABA 2QKDA 1E57A 4EB6B 4DO0A 4IQPA 2HLEA 5FKCA 2HR3A 3KF5A 1JYVA 3F2ZA 4QB1A 5JR7B 3DL3A 2R9IA 1VLNA 3VQYA 4C0BA 2JDMA 1A78A 4QX5A 3DN7A 4GAZA 3J8F3 4EWDA 4G9SB 3I2FA 1KC8W 5JSPA 4PA7A 1EM1A 1QXJA 1OCOB 1LUVA 3F7YC 3SKJE 5H9RA 4YVSB 1UN1A 1UQXA 3POGA 3NNJA 4UW3A 1H2GA 4C1WA 2ZNJA 5IDJA 4LF7B 3JB4C 3VBSA 5AFBA 1DYPA 2D3OW 1S0GA 4UVBA 3A8TA 1OOPC 4M01A 1IBMO 1KMIZ 5JOWA 4QPJA 3K3OA 4BMEA 3S0MA 1UAIA 1D4M2 2RS51 4AI8A 4LFCB 4KMQA 1BMFG 1CAWA 1MSDA 4LO7A 4X1KB 5BXXA 1IPKA 3K4DA 1NKDA 1HN0A 1CEZA 5F5IA 5T50A 3LSEA 3ZN0A 3I3BA 3RJRA 2B9VA 5IYCO 1YNAA 3ZXGA 3W7WA 4QGLA 4NO4A 4LIVA 2EXJA 2XONA 2WAMA 1POV1 4I7ZB 2WINB 3ZN6B 1CN1A 3D8CA 3N7MA 1PPJH 3KB5A 4BQ1A 3IDAA 4IV1A 3H1YA 2WLNA 3NR7A 2JJ1G 5DECA 5CIRA 5F7UA 5FY9A 1B35B 1XOYA 4OUEA 3LUTB 4H7LA 3DCQA 1RSOA 4JYYA 2Y8KA 3E8HA 1DGWX 1GWMA 1RUD2 1Y43B 4ZHQB 4WBBA 4CP9B 4CRQA 2BUKA 2WT2A 1W6PA 2Q4SA 2PF4E 2VQEB 4GKJO 1AX1A 4RUFA 3ZMOA 2PQSA 4NHYA 3CL1A 1YJWV 4XFAA 4DO2A 2ZX4A 4HL0A 1RUJ1 3ZMSA 1G7YA 5EYPA 4XFGA 3NRUA 5T55A 1DDLA 5JCOC 3URFA 3RT3C 4XETA 4XFBA 1LU2A 1MABG 4FFFA 1BQZA 5KXDA 4F7ZA 2HH9A 4LFBO 4ICGA 1W8ZA 5LYJB 2RVAA 1MNGA 1FOD3 4XCAA 3ZXEA 3HKBA 3ZFEA 2GNTA 4HVQA 4MH0E 4ATEA 1AR81 1JR9A 4MGQA 5ISLA 4J11A 3BEHA 5C93A 1YRZA 3BN6A 3ACLA 1Q82W 3PNAA 4QDSA 3NNMA 3VD5A 3MGUA 4OQ8A 2I2SA 3ZRVA 3OPTA 2JGDA 5FP9A 4CU8A 3LD8A 1CXZB 4K3UA 1LODA 4F8AA 3DPRA 4TLFA 1EN6A 3KS7A 2IXHA 3VKFC 3LOIA 2R6QA 4RO2A 3D6EA 2X8KA 4EV0A 5FYTA 5L73A 3V56A 3RJ2X 1KUQA 3WSOA 4BQ4A 4FAGA 1J1TA 2I74A 1M06G 3RZKA 4JKMA 4QGPA 2EILB 1W6NB 4A3XA 5A3NA 3HEIA 1JZ5A 4QQPA 4WFGA 4KWLA 3I5DA 3M3IA 5IFTA 4UW6A 4HT1T 1S0DA 4XHBA 4AILC 1S4CA 1DU3D 5H9PA 1E5RA 2YMZA 1MQTA 3PDQA 1AUYA 4I55A 2DFCA 1JBCA 1TQ5A 2WNUB 3PUHA 5JSOA 4E9KA 1BGYH 5A3WA 3NJXA 4P14A 1ZA7A 4TV9B 4PDWB 4MTGA 4AZZA 4BISA 3RZLA 1QWRA 5FK8A 4LTAA 1R73A 1Q81W 2ZM6B 3D82A 2GC1A 4NTYA 3RZJA 4A7YA 2RMKB 3C3SA 1PMJX 4YARA 3SCHA 5FY5A 3O1SA 2FYUH 2XLGA 1OOPA 3SISA 1C8M2 3T1HB 4I02A 1TMF1 3I8TA 4PBOA 1PZ7A 4U2AA 4KWKA 2FCTA 3K06A 2BSKB 5C4WC 4MVUA 2RS11 2QEXV 2R0HA 5EWSA 4D0QA 4QX7A 1O3TA 2RG4A 3AL6A 1WLCA 1RUF3 1UXZA 2ITDC 3I3QA 2R9RB 2ZA9A 1N1TA 1AROP 1X33A 5IY5B 5LGUA 1N3OA 1BL8A 1WPBA 3FLPA 4MXVA 4PDLA 4QQOA 4OQ9A 3AL5A 2ZXWC 4BH9A 4Y1YA 1CPNA 4IV3A 1GICA 4PJ0Z 5LXTA 2HJFC 1N1VA 4BOWA 5E16A 5C71A 2FDFA 2R7EB 4L8JA 1JZ4A 1JH5A 4RAIA 1EAH3 1HQWA 1THZA 1DQ0A 3MLJA 2ODMA 4ZU5A 4ES9A 4CXXA 5EBWC 2YUAA 3H7YA 1HRV1 4IEXA 3ZRWA 2B46X 1Q6UA 3AVRA 1HNWB 1K5MC 3NJZA 2IWGB 4ET7A 1LULA 2W6IG 3CRRA 2J42A 4JI6B 1E1QG 5IVFA 4XF0A 2I07B 2WIIB 3LPGA 1SESA 1QKQA 1R093 2O8OA 3LDDA 1UJWB 4AFDA 4E4ZA 4YNIA 2P90A 2VCMA 1MZ6A 2P67A 1JU4A 2B39A 3PTRB 5EYYA 3PUIA 2HHHO 2Y6LA 1QGLA 2OW4A 1IX9A 2MK3A 4AQ6A 1SQVH 2Q8DA 2LO1A 4ARXA 4A7ZA 3CSXA 1F4MA 2CGOA 3MDPA 1AYM1 2J1VA 3S7IA 3TAYA 1M4WA 3T3YA 3ZVXA 2Q8EA 1PL4A 2Q7EA 4LNVA 2UXBO 2KQXA 4CU7A 5B3SB 1VRBA 1QF3A 1E1RG 1OC1A 3JALB 2CU5A 4E4EA 1SQGA 4OZOA 1QHTA 1XNTA 4F3JA 1PO12 2W52A 3FYIB 4H0LB 3IM0A 2RS52 2OUJA 4AEDB 3KCCA 2EBOA 4QKNA 5IAXA 1VR3A 3VBSC 5LASA 2C9AA 1LECA 1WWYA 1KITA 4RGAA 1X7NA 1OKOA 3J80N 1UNBA 3H1IH 3WG7C 4CH3A 2ORXA 2E7AA 1M5IA 4L99A 2A3XA 2IU3A 2VS0A 4IV3B 2H0BA 2EXKA 5JSRA 2QZ2A 2BBAA 1IBMB 3S57A 3B01A 4CS4A 2EZPA 2NN4A 4JGYA 4KNCA 4FPYA 3NAPB 5EJZB 1OPMA 3HKCB 2ZMNA 4XJ8A 2XUEA 5HXMA 4O4LA 4A44A 3V0AA 4K8ZA 4C0HA 5FZLA 4DV3O 1AR4A 3AB0A 3WQ0A 5BR8B 1TMF3 2IFRA 4JI4O 3D0SA 1QLNA 4GB33 3ZFGA 2JS5A 2IXCA 1CQ9A 3ACIA 4CCMA 3SPGA 2RM21 4NRMA 2HJDA 2B45X 2IFWA 3HB3B 5FYMA 4DXTA 5KHKA 5APAA 1GR3A 2K46A 3ETDA 5IVYA 3VBRB 1GUIA 4RFT0 3OPZA 4UB6Z 4Q27A 3ZHVA 4NJ4A 3C7HA 2KR2A 4X1YB 5TSWA 2Z42A 2ARXA 4B1MA 4QX3A 2VZPA 5A7PA 3JAMN 2RR12 2EIMB 3GDBA 4D6SA 3SEPA 3LSQA 4XF4A 1V0AA 2JG9B 3OY8A 1VIWB 3VUOA 5JH7B 5DQ0A 4YM2A 2MEV3 5FOBB 1ZRIA 1WMDA 3TNQA 2AUYA 2VWKA 1GMGA 4BDVB 1MEC1 3B40A 3U78A 3MBWA 4LO5B 3OUFA 2UU9B 1QCEA 5LZ6A 3H8RA 1KGYA 1EP0A 4MGTA 2CY6A 3P32A 2VZQA 1GN2A 1WCSA 5BMVA 4Q1PA 1IQAA 2WYFA 2NR5A 3H3ZA 3PMEA 5F5AA 2DBIA 1N47A 3AZWA 1PV0A 3Q4HB 3O7OA 1OURA 2J1AA 4J9YB 1GZTA 5F3GA 3ZOIA 3RYCA 1XOUA 1BE3H 2C6SA 2VGDA 3H9VA 4QWNA 1KJRA 4UXNA 4BB3A 4FPJA 4INDA 2XKOA 2K2SA 5FZ7A 2TEPA 3HWJA 5IJ0B 4X88A 3S5AA 1UYPA 2GC3A 5BMVB 3MHSC 2JG9A 1PMIA 1X9PA 3T2PA 1JMUB 1IG0A 5JZGB 5G05L 3WQBA 3ZYRA 1B35C 3I3DA 2JDUA 3L2HA 3W9AA 4R4ZA 4B08A 1ZWIC 3SQOA 3P30A 2QSAA 3AG7A 2EF6A 3AP9A 5I8TA 3WINE 3K03A 1O4TA 5HCHA 1AL23 4FZ1A 2H0VA 1ND2B 1OCCB 2P22C 4O4HB 3VV1A 3HQUA 1H2LA 5T54A 5J98B 1NOVA 4EFBA 3CBNA 1O3RA 1GZWB 3I49A 4J42A 4AEKA 2ZM6O 1ZVFA 4XBNA 1NZCA 2WZR2 4LR4A 3LFIA 2R063 2XOKG 5LBCA 1VP7A 1D7PM 4XXAA 3MF9A 4FOYA 3I97A 1RGSA 5JXGA 2JIGA 2AZ0A 2AZ2A 2MEV2 1YCIA 1HJGA 2Q7HA 2ZX3A 2JECA 2BYVE 4R7CA 5CYYA 1GYKA 5LHGA 1ZX3A 1BHGA 2ZT9B 4LITA 3DECA 4P5YA 2WLQA 3IKWA 3RSJA 1ZSPA 4UFIA 1U5IA 3OM3B 1K3EA 2XMLA 1ZZ7A 1W0KG 3JBG3 4MW3A 4OCTA 4PDWC 3DEMA 5A6ZA 1SFNA 5LRRA 1YC61 1G8WA 1P49A 3CCLV 1WZXA 3OAAG 4Q4X1 4P9IA 3IDBB 4WFBV 4WVMB 3HPNA 1L1FA 1Y4WA 4RHV1 3SEEA 1W9WA 5FZFA 4GMP3 3CCRV 4G28B 1IBKB 2D98A 1DLCA 2A6YA 2VG9A 1SG3A 3NAPC 1OVSA 3DXRA 3K57A 1GP6A 2YIAA 3NV2A 2G9FA 4OPHA 2WSSG 5EZYB 1BKZA 3N36A 3H1LH 2HWE3 3PJSK 3DGTA 1XSRA 1Y7BA 5ACA1 1YXBA 2ZHKA 2ETEA 2VW2A 2NPIA 1N33B 3E6BA 2PHTA 2RS33 1W59A 2D6OX 3FN9A 4W6YA 2YBPA 1M56B 3OUSA 1SLCA 5E89A 5CB4A 2P4EA 4QX1A 5FYCA 5GM0A 4X8PA 4LCUC 5IJRA 4JI0O 2GZWA 3VQXA 4UAPA 2ZMLA 3O9OA 1NLRA 4IE7A 1SEFA 1XMQO 1VB2A 1X36A 3MLLA 4IERA 5FZBA 2HBTA 5FWEA 4XMAA 3VHPA 1R1A3 4ONUA 4RS5B 5KUKA 3VDDB 5FPOA 4CDWB 1K34A 1BYHA 2WNVC 2WO7A 5FLJA 4P9YA 3T4DA 1JQ0A 2W46A 5DG2A 4D94A 1YQ2A 5FWJA 5CKMA 4LORA 5CEHA 1QIQA 4XZPA 2PHLA 4ATFA 4Q0QA 4E8CA 1XU2A 3LA2A 5LXTB 3OMAB 4W6XA 1AVMA 2QFEA 2ZTNA 2LROA 1MSWD 2YIBD 5I0TA 1CWPA 4RQPA 2NN8A 3IB3A 4CDWA 2YG0A 1JZ6A 4QM8A 3MYXA 3K3NA 4CUGA 2WFPA 2GDFA 5FDBA 1LUWA 1AI5A 3N9QA 2QA4V 1ZLZA 3LOBA 4RQEA 4PI2A 4ZOLB 4ITCA 4AHWA 4YJ2B 3T0BA 3IWZA 1WW4A 1TA8A 1Z5WA 3AZZA 4UXAA 1QOOA 5DZEA 4DR1B 4PT6A 4TT3G 2ADDA 1GZ9A 1WCUA 3UNPA 1SETA 3CEWA 1PVXA 4PELA 4LHNA 1VARA 4AHXA 1KB9F 1UX6A 2FDJA 1FNZA 1O3QA 4NWVA 3BTYA 2NMOA 2BPA2 4CEYA 4QHBA 4EWAA 4DR1O 4I0AA 1UKGA 2ZCWA 3ABLB 1AR73 2UY9A 1IHMA 1UZZA 1DZTA 4EZHA 2QWOB 2EILC 3BA8A 2P5OA 1PM4A 1W90A 4DUYB 3JD73 3FHIB 5JVDA 3JD71 2CWSA 4LC1A 4QDQA 2Y48A 4L11A 4LBOA 4Y20B 4ZONA 5B1BC 1JX9A 4COYA 5LA2A 1SQ4A 2VZTA 2UURA 4CEYB 2A6ZA 4O4HA 1OF4A 1QJU1 1BMV2 4J7KA 2DOSA 1QJX1 4YGDA 1KDMA 3N9LA 3SITA 3FWEA 3CYOA 4BIFA 2A6XA 5HCBA 3VBFB 2PLV3 1VBB3 1MR5A 2IJJA 1STMA 1RVF2 1Z7S3 2KB1A 3ZN1A 4YXWG 2G9ZA 5IWFA 2EIKB 3CJIB 1LOAA 1JUHA 3IIIA 4WFAV 4U3JB 3RG0A 4K21A 4HN0A 1WA8B 1SBDA 4NXMB 2E76B 1LHVA 5B66Z 3AJYA 4UV8A 1YTFB 2BTQA 1GBGA 4A42A 1UY1A 1G4YB 3CHXA 2WNVB 1MOFA 1RMU1 4DS0A 3UGGA 4LE4A 3J7AU 4Q0PA 3ZS8C 1W8HA 3HD8B 1QJX2 3E22B 1O8SA 5IJ0A 3B93A 1TME1 2PLV2 5FZ0A 4P2ZA 3GB7C 3MIDA 1S0JA 2GALA 2UUBO 1PNLA 2AHYA 4DOUA 1RUF1 5FL7G 1D2QA 1YO8A 1UU4A 1W03A 2PFWA 4AK3A 2VNGA 3G71V 4KFMA 3VQVA 2KA3A 2IXLA 3CJXA 3POEA 3RVHA 5FFOC 3JALA 5CA0B 1SMVA 2JB8A 1K92A 1RUE1 2UXNA 4GA9A 3LDEA 2XGXA 3K51A 1XL4A 2WO3A 4XXPA 5KA5A 2D97A 1BQ0A 2X53S 3AMNA 3WQ7A 4HZ3A 5DN6G 1RTVA 4AGGA 4CDQA 1LGNA 2K9ZA 4JGZA 2WWUA 1TVKB 4XIKA 5CBLA 2IW5A 2ZEXA 3CWBH 2Q73A 5GZGA 2NM1A 2VECA 2P3KA 3W5NA 1BJQA 1M9NA 2P06A 3ZMZA 1NT0A 2LRPA 5IJ9A 5KX5A 2HHHB 2GN3A 3BCCH 3CKHA 3AXDA 5JMCA 5FQ0B 4JI2B 4CYDA 1NR1A 3M8LA 3ACFA 2DWDC 2R041 2FZ1A 4FO9A 3D36A 3E83A 4WCEV 3ZYGA 2VO5A 1Y67A 1NA1A 4BR6A 2G38A 5IVJA 1ZM1A 4IEVA 4ZIBA 3TCUA 3DSQA 1ULGA 4O2BA 1I6XA 4AG4A 3VBUA 1XC6A 4QE9A 1YI7A 4F6RA 1UU6A 2ARHA 4QKDA 4X1IB 2YEVA 1JHNA 3GALA 2X5IC 3VDAA 5KR7A 3OFNG 5FZ1A 3EHBB 4Y22A 1MS1A 2OQ6A 2ZNIA 5EZYA 3P3PA 3VD3A 2D2CB 4Q4Y3 4FM1A 3VZOA 1RB8G 2SBAA 2IBZH 3QCWA 1VEWA 5KC6A 4C90A 2B5UA 3SDLA 1YJLA 2QWNB 1X50A 4HK8A 4JTAB 4AF9A 5F32A 4B3RO 4AQSA 1N33O 4URTA 3EQEA 3MIEA 3CF6E 3E86A 2PHFA 5I0RA 2Y6HA 4HZFA 2FL4A 4G3YC 2YBKA 1I7FA 2ORZA 4PDVA 3MZHA 4DFSA 2CE4A 1YFUA 1K5JA 1FNYA 1N3QA 4L0PA 1U5ZA 1H8TB 1F8VA 1N32O 1Y9QA 3K46A 1M57B 3MHHC 1OUXA 4AVTA 3ZR6A 2HWE1 2HYKA 5LRSA 3LFMA 1BEV2 3ZPYA 1NXD1 3BPZA 1LGBA 3KV9A 3HJRA 2OTLV 4JV5B 3FHQA 1ROPA 2HWB3 2ZKLA 1H8EG 4UCSA 2ZAHA 3ON7A 2CSGA 1UYZA 4D7TA 1N32B 3N9PA 4Q4X3 2ZEZA 4TZDA 2CNAA 5FREA 4HSLA 3A4UA 1FATA 1RUD3 1AR71 4K3AA 1HB1A 3QTCA 4O2AA 1BCXA 4L2NA 5LATA 4QKBA 3O1RA 3SJBC 2P3IA 4HFSA 4XJZA 3LZZA 4YW5A 3H8UA 3DKWA 3TB0A 2K0GA 5CFCA 5A6XA 2WFF2 3OF1A 1VBE1 1SQQH 1YIFA 2O0OA 4I0WB 4B7KA 2PUSA 1DGRA 2QQNA 1LB2A 1GZWA 1REFA 4O4IA 1AILA 1IG3A 2ARCA 1OCZB 1RMU3 1TAEA 1N1YA 1C5IA 3KD4A 2WLIB 3CCQV 3RGBA 2Y64A 4LK7A 2BOCC 1EUTA 1K45A 4UCTA 4RFRB 4AVSA 2GH8A 4RR3C 5AC91 1FJGB 5KLVH 4AYUA 3WF2A 3H3UA 1VAMA 5FXWA 4YZ5A 5FBZA 2J1EA 1WLTA 4IHJB 1OV9A 5LMNB 4K20A 3U10A 3OGVA 1W3VA 4HMZA 3B5LB 4YLZA 3E1F1 4Z07A 3U4SA 4XBFA 3HQXA 2DCKA 4GD4A 3MPPG 4I3PA 1NZIA 4Y20A 2XTAA 2GDSA 1AX2A 5JJJB 5KWRA 4DUYO 2ZEWA 3E6CC 2M7WA 3N2KB 4P9GA 2BRTA 1LR5A 4OI2A 2VAUA 3O5SA 3WX5A 2W39A 1ENQA 4DQAA 4RGGA 3WP4A 2WYSA 5A3TA 3BKZA 2B1IA 1QJY3 5B1AB 3E35A 5L3EA 4UV9A 3LDRA 5EBLC 2WS91 2JD9A 4YZ2A 2QDNA 2E7TA 3N3HA 4FJCC 4JDOA 4DV0O 5A9GA 2ZINA 3F95A 3L71H 4CDQC 5A2QN 2P3JA 1AP5A 3FBYA 1R3JC 3WB1A 4FLWA 2WQ8A 4DB5A 2NLJC 3ZSJA 3HNMA 3H42B 5FMOL 1JA8A 5KMGB 1EPZA 4GALA 4TTGA 4G27B 4J80A 4XCBA 2AREA 1DBNA 3CX5F 3MD0A 5CBGA 1FAFA 4LKDA 5ERLA 1TNFA 3T1MA 1I5YA 3S5QA 3W59A 4DV3B 1XNDA 4CXYA 1IDSA 3TEZA 2EIEA 4LFAO 1Z78A 2F23A 3WEZA 3CNAA 4B7EA 3CZJA 1Q5OA 3RDIA 4EB6A 1YSCA 3I56V 4S2GA 1XYNA 4IYIA 1QQCA 2ZIMA 1PX3A 3JXSA 4X8AA 1Q8IA 4OX9B 4HONA 5AFEA 4OULA 1X59A 1NLSA 4DRXA 1NQDA 5FR3A 3A0RA 3RYHA 3GHNA 1KKCA 1AYM2 1RUH2 4Y1XA 2Q68A 4IEWA 1A6CA 1U5XA 1V9U3 5BNNB 1XJAA 5FYZA 3OEBA 2E51A 2Q5ZA 3UESA 2JGDB 3KGZA 3WT3A 4MTXA 3AMMA 4OHWA 4BYYA 3SPHA 3P5BA 4UF0A 4X20B 5IYZA 1IQDC 4RL7A 3G80A 1ZBE3 1PGL2 3SLIA 4HXCA 1OLMA 1O91A 4FXKB 3UL2A 1D4M3 5EFUA 1F31A 4JKLA 4X64O 2WBKA 1PO11 5L7OC 1F4NA 4HNAA 5BNPC 1TME2 2D3RA 2VTXJ 1GP5A 3MEPA 2RE9A 1DFQA 4BZ4A 4M4RA 1NX9A 2JDAA 2XLAA 3V64A 3N27A 4ORFA 1WUVA 3WHTA 1YI2V 2QGNA 3K5OA 5JPNB 1I94O 1W28A 1ZZ8A 1GNZA 2WNUA 1DG6A 4D6RA 2J1SA 1YQ6A 5GTIZ 5LP6C 4HK9A 1O6UA 5A33A 4K7JA 4L97A 2XKPA 2IU0A 1PIV3 3C7EA 5FBJA 1PGW2 4AEMA 5CA6A 5I0DA 4Q29A 4I0BA 2Y4UA 1UOJA 2WLMA 2Q4PA 3MW4A 1EBOA 5CN0A 1QJEA 2GBOA 3LA7A 4RS5A 4MOAA 4QB6A 4DR7B 1LOCA 1J3RA 1W2AX 4B3TO 1RINA 3WV6A 5AVPA 1BMV1 3AP5A 4Q0SA 1RUI3 1JODA 2JDHA 1AYN2 4O65A 1QY4A 2X5IA 3ZFGB 4AFAA 1W2NA 4FCAA 5SV8A 4BWOA 3LGRA 2G1MA 1ULDA 1FPN1 3K5NA 4Y5TA 3UO2A 4HSJA 4QQ2A 4Z82A 3GVMA 2YU2A 5DXDA 5DAWA 3BHPA 3WNLA 1S5HC 3HBKA 1POQA 4GH4B 2QQOA 1PHMA 3JCZA 3EFFK 4LKSA 4EFEA 1GSLA 1MS5A 3ZFFB 4AVCA 1VQ4V 1UWWA 1RVF3 3IDEA 5DAPA 2ZMKA 5D2AA 4IDZA 1E79G 4UW5A 2DURA 4ASMB 2GC2A 4Z2WA 2C26A 3VZLA 3X2QC 2R072 2ATFA 4MSWC 2JJ2G 5I93A 1MA1A 4MVTA 3NVCA 4DK1A 1ND3C 2ZGTA 1UYYA 1ODMA 3ZYIB 3N9MA 5I8YA 1NZ6A 4P9XA 1G8MA 4XMIA 3TN91 1BS3A 1CIWA 2VE1A 4LBQA 4B3MO 4YZ3A 4I3GA 4B1LA 3CRAA 2QQJA 4XBLA 4AQTA 1A3KA 4ISQA 4BIUA 1XXNA 2VXRA 4HYOA 1DZQA 4F4LA 2VQEO 1JUIA 5JWPA 3RYCB 1E5IA 3PU8A 3RYFA 2FMYA 2QQMA 3WD5A 2A7AA 3D5OA 4JHZA 3IDCB 2HWB1 3NMBA 3LDKA 3JARA 4IGQA 1IURA 4PA3A 4JGYC 1WCQA 2N04A 4GX2A 5DDJ3 4GH4C 4XTPA 4AL9A 2QTWB 3E5XA 1X4TA 4IETA 4CTEA 5FYUA 3LQCA 5FMOS 2ZAAA 3HT1A 1PK6A 2XASA 1Y9MA 1MG1A 1ENSA 1JHJA 3WLUA 1Y3TA 5EPAA 1WD4A 4J6GA 2AACA 4JQRA 4YG0A 3E5UA 5FO8B 1RM1B 4IHJA 3D4KA 1CPYA 5CA1A 2VM9A 1C1FA 4JI3O 5FXVA 3ROUA 2HJIA 4UF0B 1G9CA 4FQ4A 3LSUA 2Y6KA 2R32A 5LEKA 3VHRA 2ENRA 4AEJA 2UUAB 1HNZB 1LOFA 1N0JA 2WN3A 1VB4A 2WLPA 4Q4W3 2JG8A 1XRUA 2AYHA 3OUHA 3W20A 2ZS6B 1F15A 1FPN3 1XE8A 1F7YA 1GV9A 2BQPA 1XNQB 4JKKA 1R1A1 3I3EA 1OZ0A 3FUQA 1IPSA 1TMF2 1JU3A 3OEEG 4ZBMA 1NE6A 2P34A 5C9AB 3MIHA 2ZKNA 2GHYA 2UXBB 4A6SA 4S2FA 2A1XA 4TN7A 4DV6B 4OZXA 3QF7A 2ZX1A 4FQZA 3B94A 4GKKB 3R05A 4X6QB 3BAAA 3ZFEC 2VBDA 1QDOA 4IV1B 1VF6C 4KXRA 3D0JA 2VTXA 3H50A 4JASA 1L3JA 1GNYA 3L2YA 4PCRA 1HXS1 3BI3A 1BK1A 3LAGA 3FX7A 1YIJV 4NB5A 3JASA 3JSNA 3M3QA 1W2BU 2W92A 4I5SA 2AR6A 4DV4O 1COWG 2ADQB 4XHXA 4QHOA 3AG3C 3T1YB 5FZKA 1XBLA 3ASNC 4WV8A 1EYBA 1UZ0A 2BNMA 1H8HG 3H7JA 4KU8A 2X0LA 1KBHA 1RMU2 4H7MA 3VHOA 2Z5UA 3K0DA 3AVSA 4CDUB 2W1QA 2AGAA 4META 1DQ5A 1V70A 4GB31 3I2IA 1J5EO 1LCLA 2R0FA 4XVHA 2FHRA 4W4ZA 2XHNA 1RUJ3 4QQHA 1MZEA 1W2UA 2ZGPA 4XE9A 4XF9A 3W58A 1US2A 1CAUB 1GN4A 2D3SA 5FZOB 2MPFA 5L3BA 4XQ4A 5J48A 3EYPA 1NR7A 3AG3B 1YHFA 1YWKA 2Y6JA 4OMDA 4AW7A 5JIUA 4O4LB 5B1AC 2WAOA 3O14A 4YG6A 4GMP0 4BAYA 2C5DA 3ZHRA 1QHDA 4Q5OA 1JYTA 2RMU1 4HOOA 3UCSC 3Q4HA 4AR2A 2DCJA 2XAFA 3HKCA 5C3SA 2OZ6A 5DUUA 5KAFZ 1EUUA 1GANA 2VXJA 3POFA 3RVYA 3MV01 4PDRA 2B1GA 1SCRA 4WM8B 2HWC2 3ILFA 2HVJC 1H2KA 5GALA 5A33B 3ZIWA 1D4M1 4UB8Z 4YGBA 1C57A 1DYKA 1H1IA 2ZZQA 2VZOA 1R091 1R6NA 5IYDO 3UV9A 2IH3C 5GTHZ 2JIZG 2L6LA 4XW3A 4R52A 5LCWL 2Z3YA 4IV1C 2Q7GA 4D6QA 3ZMVA 1SC5B 3T2QA 1BZKA 4I30A 2OT7A 1W8UA 4Q4Y2 2PAMA 2CDPA 5DM6V 4XUQA 1KEXA 3BCWA 2OTJV 4J1XA 2WR9A 3H3LA 5SV5A 3SNMA 1AYN1 1UIKA 1DQ6A 3JATA 3WG4A 4BMBA 1NXMA 3F5WC 4JI2O 3U75A 2KG7B 1ORQC 1PVC3 3N2GB 3E8BA 4FM0A 1BCCH 1XDCA 3KCYA 1BQPA 2XAHA 3ZRXA 2ZX0A 5EK0A 2YGLA 5IFPA 2P37A 4DEVA 4K1YA 2RN9A 1W0JG 1VBA3 3VBUC 1S2KA 2UXCO 3SXWA 5IHRA 3WDXA 3CMEV 2WWJA 4NKGB 2P3YA 4HAMA 2VW1A 4H55A 4JI8O 4MVMA 3AFKA 3IC9A 2IXIA 4OLLA 2YB7A 3Q8FA 5H9QA 4N43B 2ZE5A 3LKJA 4DK0A 1NT2B 2IJIA 1AF9A 4P9PA 4LQRA 1QU0A 2RR13 1VAVA 3HBZA 4FI9A 2YIDA 4Z1VA 3BIWE 1SQPH 3SYPA 4KBBA 3R66A 1JOYA 2B7YA 1M90W 1KQSU 2JX9A 3N7JA 3RYPA 3WDTA 1VF7A 4K0KO 3O1UA 1RPRA 2QCSB 3J8F2 2CAUA 5HFMA 5JI9A 5FYBA 2Z2SB 1SPPB 4TSVA 3R65A 1V9PA 4DINB 4DNYA 2N7GA 4XURA 2A5ZA 3ASNB 5A32B 4R9BA 2GV9A 3HKBB 3ZFEB 3WHUA 3NW4A 3ILNA 3R4UA 3AG4C 1CAXB 1CONA 4FFHA 4A41A 5HXVA 3AK3A 1W0PA 2IJHA 3NKGA 3SH4A 4YVSA 1QVFU 1RUI2 2W1SA 2BCCH 1H2MA 4JDNA 1CAVA 1OT5A 2QKAA 4FLXA 1W6OB 1S0IA 3TWIA 5LHIA 3ASOB 2W9XA 4XF1A 4XABA 4KI5M 4A6OA 1COV1 3EBRA 4W6WA 2RJLA 3LIHA 5K0UB 3JATB 3MHZA 2LS6A 3ZJZA 3K75B 5DUWA 4V2VA 1TVKA 4YW7A 2O1QA 5IW0A 3H01A 5C70A 5BYNA 3B8NA 4K8XA 4GX5A 4JQTA 5C8WA 4U7NA 2PHUA 3VLBB 1OD3A 3PUQA 4DRRA 2ZGUA 4JYAO 4PBPA 2ET1A 4LJHA 4B4QA 1KECA 1Q8QA 2VBPA 4XFCA 3WW2A 4LLOA 4FTBA 2F4VO 4LWSA 5F8PA 3BTAA 2WSVA 1LNQA 4NHLA 1RXFA 4NVPA 1IS3A 3AX4A 1YF2A 1HW7A 1NJIW 3C2UA 3FBMA 1H8VA 4LULA 4I0XA 1HKDA 4QPIC 4NIAA 3I2OA 1FXKA 4TV8A 5FPLA 3KKYA 4ZHQA 1BK0A 2Q6AA 3ZDVA 4N9HA 4O9EA 3O1MA 2VZSA 4QPYA 1IS5A 3KT7A 2IVJA 1RYYA 1FV3A 3RYRA 2VMFA 2F4VB 2IC1A 3ZN4A 2BTVC 2QUOA 4Q0VA 3U37A 4H37A 1NG0A 5FJKA 2R9AA 2IUWA 2OA2A 5CZKA 2W0XA 3J9SA 2P4VA 4PIXA 1NUKA 3AK0A 1BVVA 4CSWA 4PD4F 4X9QA 3VBFC 4NAMA 3UK9A 3HIFA 5TISZ 5GONA 2D7FA 3MIBA 2UXDO 2XHKA 3U4XA 4WM8C 5CNAA 4WZCA 1OXCA 2V7QG 2CH7B 2OPKA 1TGOA 5KXCA 1DIWA 5ITZA 2PN5A 4IYHA 1K4CC 4X1YA 2BSKA 2Z79A 1OCCC 4LF4B 1CAVB 2X6BA 2W91A 2DV9A 1GZCA 1VJ2A 2HEYF 5JAXA 5LBQA 1MMMA 2MW2B 4WM7A 2JJ6A 2OX0A 2ZDIA 3OPWA 4BE3A 4JPRA 2D6KA 3G6JB 1N1SA 1KDKA 4RR3A 2PTMA 1T6GC 1H30A 2E32A 3JYCA 2PMWB 1RUC2 2XL9A 3H1KH 1FT9A 1CVNA 2M6YA 2JVDA 4MYEA 4GZ9A 2EXIA 4R8HA 1O7FA 3LEGA 3THDA 4M4PA 1H4HA 3ZXLA 4PA6A 5GONB 5H6QA 4AOCA 4E4DX 3NNGA 4OX9O 2VL4A 5GJ6A 4CPBD 4DY5A 4I55B 4W8JA 2R073 2N74A 4GMP1 3SMHA 2WWSA 2AHZA 3EHKA 2OYQA 3RZZA 3DF0A 3RZGA 4UFHA 4XOGA 2DWEC 2YSUB 3APQA 4JI7B 5LOVA 2ZKOA 3W7SA 2GU9A 1R6KA 4AQYB 2VCCA 5GZFA 3USUB 1G9DA 2CK3G 4G4FA 1VBA2 1HXS2 1QNWA 1HNWO 2OUHA 3ZR5A 2H6CA 1WJZA 4NXNO 3IIAA 2VOVA 4JF3A 1D0HA 2UYBA 1RUOA 3ABLC 5KC5A 4JI5O 2JG8B 5HFLA 1HDJA 1ZZ9A 1JYXA 4FPKA 3JB8A 5D8AA 2EINC 3MFCA 5ABJB 5IWAO 3IJ4A 2W87A 2QQVA 5FZ8A 1I5PA 5BNOA 4M3CE 3KLSA 2PAEA 4C1XA 4FLZA 3O1PA 3V65A 4NYKA 5ACA2 4D3WA 4YGCA 3RI9A 1MQTC 3SPCA 2JKXA 1FXVA 3OY8B 3NJVA 2YV8A 4XFIA 1HV1A 1V9U1 1V6MA 2UU8A 1W9YA 3CQOA 5FZIA 3AG1C 4XAAA 4ZU4A 3VKLA 3A0NA 4QJFB 1K7DA 1S76D 4ZS3A 3TOJA 4O61A 4J7ZA 3Q8CA 3LB9A 1A34A 3RMXA 3JSLA 2W2IA 4EE2A 4NIGA 2DVAA 4WVZA 2XPJA 1XPWA 1CP9A 1FPN2 5FIXA 2A7WA 1RUC3 4UCUA 5E79Z 2Q8OA 4WZFA 3M2MA 2P2KA 3UT5A 4YWAA 1PNGA 3KM5A 4UBHA 1AL0G 4CP0A 5F1RA 4IE0A 4UVCA 4PV1B 4UCRA 1L8DA 1SDWA 5AC92 1ASJ1 4GXLA 1AI7A 5DG1A 1JW6A 4SBVA 4JTCB 2GN7A 3BUCA 4BXFA 2ERFA 4RUEA 4MVQA 2HEWF 1UZWA 1YIPA 3ZHQA 3DV8A 1W6MB 4GQ7A 3W7XA 3UGFA 1FFXB 1XI1A 1OUSA 1RUI1 3K08A 4RD7A 2G9GA 2D40A 4LBNA 1VPHA 4NUBA 1DTOA 3HQRA 4Q4V2 4FOWA 1HV0A 1OOPB 5JDBA 3LDCA 3B00A 1BEV1 2XHBA 4AQ2A 4LF6O 4Q2FA 1V6OA 5EZWA 3A21A 4GZRB 3GF6A 5CG8A 4FPOB 4BW5A 5EBMC 1UL9A 5FMDA 4RYDA 3B02A 3LDBA 1IZ3A 1H8TA 1ZBA3 5JLVA 4QPGA 5T5LA 1AR91 1OCOC 3OUIA 2DCZA 3H0OA 4OHYA 3AYAA 3LEMA 3IPVA 4LH6A 1QQP3 3N2KA 4GLXA 1NCRA 1DHKB 1NCQA 5JPMB 4FFBA 2Q1MA 1WBLA 2WLLA 4AHYA 2CGPA 3WUDA 2A79B 1URXA
chains in the Genus database with same CATH topology
1ZBA2 1UMZA 5GZGA 5JOZA 2NM1A 2VECA 2XG3A 4PQ9A 4CZSA 2P3KA 5GLWA 2VVFA 2DUQA 4L92A 2YC0A 1AVBA 4FPLA 2ARBA 1BJQA 3K48A 3VZJA 4HVOA 2TNFA 1W39A 4AI1A 1UCXA 1RUH3 2GN3A 4ES8A 4RQPC 3ST7A 5B2GB 3AXDA 4WVWA 4W65A 5JMCA 3JD72 3NSTA 5FQ0B 2HWF3 2QZ3A 2R49A 2OYZA 4N7UA 4CYDA 4YM0A 2IZWA 1ASJ3 1J59A 1W6QB 2ZGOA 1ZA4A 1OHFA 3M8LA 4JGZC 4AI3A 1NYWA 2UWCA 2CTVA 2R041 4QXKA 2FZ1A 3OTFA 4LHKA 2E7QA 1CAUA 3HAGA 4FO9A 1QOTA 1UKRA 2B5HA 3ZYGA 3WDVA 2AENA 1NA1A 5CFDC 2ZACA 3DPRB 1ZM1A 4EN6B 1YFXA 1Q43A 4IEVA 4PJYA 1WW5A 2BVVA 1ULGA 4GWMA 1YLLA 2JICA 1I6XA 1U0AA 2R1BA 4AG4A 1OQDA 3O0WA 1ULEA 1D0GA 2LALA 3VBUA 3BOPA 4N53A 2DU1A 2R30A 4Y5Z0 3PJYA 4CEWC 1SLBA 3VBOC 5L19A 4RQPB 1GNHA 2ZGKA 5F9TA 2R16A 3AZYA 1JR7A 4O9GA 1YI7A 1RUC1 3GBGA 3VBRA 1UU6A 4K6BA 2HKXA 2VMIA 4CP1A 2JG8C 4Y1ZA 4ZU7A 1LENA 1JHNA 1XQNA 3GALA 2X5IC 5FTTC 2DCYA 3HR9A 3AMPA 2CGNA 4BA6A 1VBB2 3IN9A 5HSXA 4IESA 4Y22A 3OGJA 1MS1A 1LOFC 5C4WA 4XDQA 3P3PA 3CLPA 3WZ1A 5KXBA 4QU2A 1HW5A 4MXWB 1ZZBA 4YSFA 5KEUA 1DRTA 4Q4Y3 1C8NA 3VZOA 4NWWA 2YYOA 2SBAA 1RB8G 1JYIA 3QCWA 1KQRA 4XQWA 3AXEA 3S30A 1FYUA 5KC6A 4C90A 4IV3C 1ND2C 1YJLA 1X50A 1QJU3 4HK8A 4XILA 1EAH1 4XFHA 1VRH2 4WVVA 3QH7A 3RQ0A 4AF9A 1G6NA 3V0BB 5T5JA 1IPJA 4AQSA 2D5HA 4OJ8A 4KL1A 1HRI1 4URTA 3RWNA 3EQEA 3MIEA 1RUG3 2CWMA 3CF6E 2PHFA 2V09A 3TBDA 1G9FA 1WD3A 1ZRRA 5I0RA 4HZFA 5JCTA 4G3YC 1RUF2 3AP6A 1RUNA 5KBFA 3H1MA 1SLLA 1UW8A 4M2IA 4BM8A 3MZHA 1CPMA 1OLRA 4DFSA 4OVEA 1YFUA 1FNYA 1N3QA 1U5ZA 1H8TB 4YRDA 3OD4A 4DMIA 1F8VA 1Y9QA 3VL9A 4AI2A 4Q1RA 4AVTA 4NE0A 5CFDB 3FFQA 2HWE1 2HYKA 1FAYA 1H1AA 3WR0A 4IL7A 3PJQA 1YUDA 2YY1A 1O3SA 5LRSA 1BEV2 1Q8PA 3ZPYA 4KGQA 4N43C 2VNRA 3RS6A 2WNUC 1NXD1 1FXZA 3BPZA 3VHNA 3WOGA 1R083 1LGBA 3M4FA 4V1PA 1JTZX 4KU7A 5KHGA 4BG1A 1BZWA 1ZNPA 3OGGA 3FFZA 2HWB3 2ZKLA 2ZAHA 1RL3A 2Y0OA 2ES3A 1KJLA 4D7TA 1ASJ2 1AYN3 5A32A 4Q4X3 5FAXA 4AHZA 4TZDA 3ILRA 1WA4A 4UW4A 1AJOA 2CNAA 5FREA 2ZGMA 5GLVA 4HSLA 2BWAA 3A4UA 2Q30A 2HWC3 1XNCA 1FATA 2V5YA 5FO7B 1RUD3 1AZDA 4H3WA 3WG3A 1AR71 4BGKA 1C3HA 1QXRA 1YXWA 1H8TC 2ZGSA 2CYFA 2NLRA 3GNEA 1PIV1 2IXJA 1BCXA 3E6DA 2XVKA 3AJZA 4L2NA 2BW8A 1TNRA 2DVBA 5I0UA 2DFBA 4YFZA 2P3IA 4HFSA 2PHWA 2BFUS 3OYWA 4XJZA 2F6BA 2YXSA 3LZZA 1PM7A 1Q56A 1OIJB 4YW5A 3H8UA 3ZFFC 4QQLA 3AMQA 3DKWA 4OFGA 1OMIA 1Q3EA 3TB0A 1CGPA 2K0GA 5CFCA 4LBQB 1MZFA 2WFF2 3OF1A 2RMU3 4L8QA 1VBE1