3P3PA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1997-2016) peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3pA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3pA01
1H2MA 2CGOA 4Z1VA 1H2KA 2CGNA 1H2LA 4JAAA 2WA4A 4B7KA 3P3NA 2XUMA 4NR1A 4BIOA 5JWPA 1YCIA 3P3PA 1MZEA 2ILMA 4AI8A 1IZ3A 4Z2WA 1H2NA 1MZFA 2YDEA 2W0XA 2Y0IA 2YC0A 3D8CA 3KCXA 2WA3A 3OD4A 4QU2A 3KCYA 4B7EA
chains in the Genus database with same CATH superfamily
1SC5B 3LOIA 1XNBA 3POWA 1T5EA 3THDA 4YVWA 1REFA 5LA6B 3LQCA 4GMP1 1CJPA 3GGLA 1AL21 4EWDA 4URAA 4TUYA 3POEA 1ZWIC 5GKAC 1V9U2 1JCHA 1RITA 2EIKC 3NNLA 5JOXA 4MYEA 2W1UA 4MH0E 1RSOB 3ZFEC 1AILA 1QOSA 1JMUB 5TSWA 3ZFGB 1LR1A 5CA0A 1N1SA 3RS6A 1V6IA 1XE8A 3POJA 1AR63 1UAIA 3B8NA 3WG7C 1WBFA 1Q8IA 2C9KA 2GDFA 1ZBA2 3L9DA 4MTXA 2GMMA 4PDWB 3ZYIB 5J7MA 4QPGB 2J1AA 4LNVA 4LWSA 3K3NA 3C90A 3M8AA 4COZA 4LQRA 1RUF1 3E97A 3AKSA 4HZFA 3RYIA 1PO21 4AOCA 1PO12 2A6YA 2PAMA 4Q4W2 4KXRA 5HV4A 1YCIA 5L3EA 1S5HC 3PVNA 4P9IA 3MFCA 5C5UA 3KB5A 3GCWA 2B9VA 1GFF2 2WSSG 5FYHA 4U2AA 2OCCC 1W28A 4Z07A 4KFMA 5LA9A 4N9HA 1EN4A 3N36A 1BMV2 1OLQA 2R7EB 3OTFA 2C24A 1RUJ3 1P84F 3S3WA 1HDKA 3GNEA 3ZIWA 5C5TA 3NVCA 4UCTA 2MW2B 3UGGA 1Q8QA 4W6WA 1YITV 5C3PA 3I2KA 2Q7HA 3VN4A 5A6YA 5JCOC 3LEGA 3FYIB 2RM22 3N9LA 5EJ1B 3L9JT 4HT1T 2YXLA 5H5NA 2G9GA 3HT1A 2VU9A 1XJAA 1VQ4V 3WNKA 2WPDG 5LXTB 3UJOA 1LECA 4PLOA 5C8CB 4F6RA 5L73A 4MVQA 4S2GA 5KXDA 1W6PA 4Q2FA 4LO6B 3MD0A 2E7QA 1ONAA 1VBD2 4PT6A 3GWKC 4UV8A 4NPLA 3FB7C 4NXMO 1WP7A 1URFA 1EV12 1QU7A 4JI7O 3INAA 3L74H 4QQ2A 1BJQA 4FI9A 2CU5A 4DV0B 3VBHA 1XU2A 4DR6O 2NN8A 4UBHA 1MR5A 3Q4HB 2E9QA 5CFCC 3GHMA 2N74A 5JSPA 4CU7A 1EZVH 3AZXA 4FOQA 3RYCB 1U5XA 2K9ZA 4V2WA 3MPBA 2LALA 1XBLA 3OE7G 4F6RB 4KGQA 2DUOA 4YIPA 2R32A 1W6NA 5LZ6A 1PGW2 1R081 5A3LA 1ZLZA 2LW1A 4LF6O 1OVPA 4HKLA 1AX2A 4TTGA 3T0BA 4LF6B 3VBBA 5C8YA 3R4UA 4IEPA 1QBZA 1VAMA 1XYOA 3DSQA 3KWVA 3WW1A 4Q1RA 3AG4C 5CNAA 1ZUQA 4CDUC 3JCZA 5JOYA 1HNZO 2WZR3 5CMUA 3HQUA 3AFKA 2YU1A 3K75B 3R05A 1RUI1 1SQ4A 2GMPA 3HR0A 4ZI7B 1BYHA 2FBEA 1DGWA 1MG1A 3OBRA 5BR8B 1GWMA 3WT3A 4NYKA 2WAMA 1IG3A 3CJIC 5HCFA 5A1LA 4HK8A 3FB8C 5BR8O 4MGQA 1DFQA 4UCVA 1BGYH 4XDPA 4FMTA 3MFAA 3IDBB 4QQHA 1UYXA 1VQ6V 3RYFB 4QE9A 3CHXA 5KMGA 2VG9A 3JD71 2VQUA 3AM2A 1IBKO 5CFDA 3GXUA 5BPXA 4JRAA 5LW9A 1ULPA 4I0BA 3KF5A 4MADA 1PHMA 4Q0VA 2UXBB 2VZOA 2EXKA 1H2MA 1QF3A 4LC1A 1IBKB 2W68A 3MDSA 1OQEA 3MYXA 3T1HB 4M4PA 3BIEA 1KU9A 1WPXA 2W6IG 1Q81W 3HMYA 1WP8A 2HJDA 4LBQD 1MZFA 1PVXA 4GB32 1D7PM 2UWCA 2QKSA 5KAFZ 4CS3A 3T1HO 2XAGA 4LO7A 4TV9A 4AQSA 1IURA 1SCRA 2A06H 2EIDA 2ZGTA 2RVAA 3I2OA 4AI9A 3NNGA 4N7IA 3OF1A 5E1RA 4WVVA 5I8SA 1PL4A 5JQGB 4DXZA 2P37A 1TE1B 1ZZ8A 1VBC3 1G7YA 1RHI1 1W6OB 1R1A2 5A9GA 2N7GA 3ACHA 2GC3A 4CC5A 3ABZA 2GZWA 2AREA 3L75H 5D8AC 3J8F2 1GSLA 4DY3A 4O7XA 3D3AA 2G38A 5CA0B 2HWF2 3T30A 4R9AA 1TQ5A 3K03A 4JZGA 1V6JA 5BY5A 4FFKA 2FDIA 4AAXA 5CAZA 4DRVA 3WUCA 1N3PA 1O5UA 1ENSA 1JHNA 2LO1A 1AR72 1U12A 2F17A 1Y9QA 1ND3C 3UL2A 5IYZB 1W8NA 1GQGA 2GTAA 5C93A 5LHGA 1NKDA 2D44A 3H42B 1BT8A 3HBKA 2PAEA 3W5NA 5A1AA 1AZDA 4JQRA 1POV1 1AR62 2OPKA 2AW9A 4LA3A 4QX7A 1LR5A 1UMZA 1UY2A 3NV3A 1WW4A 4U3JA 4DV1B 3ZN4A 1AI4A 2CDPA 2WT2A 3TN92 3ELNA 1UFIA 3ACIA 1FYUA 4UW6A 1VRH3 4FPHA 2RDSA 1O9HA 3QTCA 2BGPA 2GALA 1W9FA 5CBHA 3H8OA 2VZUA 3RWNA 2CYFA 3ROUA 3VHPA 1UYPA 4A42A 2ZKNA 1RUC2 4AFCA 2O0OA 2KXLA 2WC2A 2ZX1A 4WM8C 4PD4F 3E8GA 4L0PA 5IFTA 5J2TB 3QO8A 2P3JA 1UW8A 5H9PA 3N4MA 5C8CA 3ZIAG 4OUSA 1B35B 2HWD3 3VHRA 2W87A 5LEKA 5IATA 4MGSA 1OCOC 4OLLA 1NH2D 1OPMA 2BGOA 4GH4C 1ZZBA 4MXWA 5SV8A 4I50B 4PV1B 3HVDA 3UKTA 2WLKA 2ZABA 3A8TA 2Z2SB 2OPWA 3BVCA 1G9BA 5ANQA 2ZE7A 2P7TC 2X0LA 5FZ7A 1MS0A 1RJ7A 4JHZA 2YICA 1W9TA 4GUNA 1GZCA 1JUHA 2GH2A 4FLVA 4XJ9A 4LIVA 3C7EA 1HRI2 3OUSA 1DZTA 4LOSA 4Q20A 5T5PA 3WU2Z 1UPSA 2YMZA 4DEQA 1K8AW 3KMHA 3BGAA 3POIA 2C6SA 2GC2A 1R083 5BNPC 3WB0A 5CFDC 1KS4A 1GP5A 2GC1A 2P2KA 4IHJB 4ZOLB 4CSWA 3RVHA 4ZBMA 3AC0A 1CQ9A 2F6BA 2E63A 1O3QA 5LBQA 1HLCA 2QM4A 4BQ5A 4LWSB 2DUPA 1UX7A 2JIJA 1JZ8A 3LPGA 2QFEA 3VQVA 1RVF1 1PZ8A 1YFXA 3OPWA 4CCEA 4PDWA 5DN2A 4LF8B 4NRMA 2WNUB 5LMUO 4NHXA 4Z1VA 4XJ8A 1DLBA 4CDQC 4FFFA 3AZWA 3AG2B 3AFGA 2WO7A 1M56B 1SPPA 5FYMA 4AFAA 4BQ1A 1RHI2 2WA3A 4XFCA 2IH1C 5GZGA 4AYUA 4PA4A 4LITA 1XOYA 2CGNA 2X5IB 4NIAA 1A6CA 4Y24A 3LKJA 3M2MA 2PQQA 3EBRA 5KA6A 3CXHF 3ZHUA 3ECQA 4M4RA 3PU3A 2YPJA 2LP7A 1HB3A 5KC6A 1MSWD 2WQZC 3G6JB 2YYOA 2D2CB 4CCOA 5LHHA 4XQDA 4YG3A 4MTOA 2RDQA 5IYYA 3UGFA 3D0JA 5DXDA 2W1WA 2W91A 4FTBA 2V5YA 1GU3A 4NHLA 3APQA 5GONA 2V4AA 1JZ4A 3EQEA 3ZXJA 2UYBA 5FPOA 1OCZC 4DW0A 3PIGA 5FXWA 5LYJB 3JCIA 4UXNA 3BU0A 4M3CA 3POSA 1H1MA 3BUCA 3WV6A 4ASLA 3ASOC 1P49A 2E75B 5IFPA 1NA1C 4JV4A 3TBDA 4BLIA 4LE3A 1XNQO 4R50A 5JPMB 1AJKA 4PA7A 1MQTB 3GALA 4UXAA 2ORXA 1HNZB 1A8MA 1HIXA 3MHHC 1GWKA 4MGYE 5IDJA 4K6BA 2VS0A 3UYJA 3IPVB 4H14A 3RMYA 1JOJA 2NZ9A 5A70A 1VBA3 1X7NA 4IE4A 5FUPA 1HN1A 1D4M3 5FNVA 2JJ1G 4FLYA 1W90A 1YTFB 2VOWA 2VZSA 3CNAA 1US3A 4Q0UA 1LOEA 2CWMA 2VCBA 2WZEA 3ZDSA 1MNGA 4BIOA 5FY8A 1GNZA 1N3OA 4AQ6A 5L7OA 1ZBE2 2XXZA 3VBFB 1MQTA 3T4VA 3IBMA 1KQRA 4QXCA 3E6DA 1TUBB 4CXWA 1RL3A 1N8RW 3L73H 2RG4A 2RS11 4ZI7A 3JASA 1SS3A 1RUG1 1YSCA 1W99A 3ZHRA 1E5SA 3QVNA 2AGSA 3RYPA 2KSDA 1WAZA 3VBOC 3VBRA 5KXEA 1Z78A 4J41A 5EHDA 2AACA 4R4ZA 5LRRA 2B5HA 1X50A 1I9RA 5JSOA 1IZ3A 1BCXA 2OT5A 4IV1C 3WDWA 2AZ0A 2NN4A 2JG8B 4COVA 2Y60A 5K0UB 5CBLA 5GZCA 3JATA 4AILC 1B3QA 4GMP0 1VMFA 3VDDC 4N90A 4CS2A 1NLQA 3ACGA 3JD0A 4GB33 3MBWA 3TN93 5IWAO 1JYNA 3RSJA 3V64A 2QWNB 3HPNA 3K4ZA 2VUAA 3G4SV 3KT7A 3POFA 1KD7A 2BVVA 1ZL8B 1PMJX 1G9AA 4XCAA 2BYVE 1HRV1 2P06A 1URXA 2VMFA 5DZEA 3S0MA 4MVMA 4M00A 5DZGA 3OGRA 2WLPA 3IC9A 4WVMA 5A32A 3RZMA 4Q4V1 2PTMA 1N32B 4X8NA 5EP9A 2Y6KA 3B40A 4CRQA 1NA1B 3P6BA 1ZZCA 3NNJA 2VM9A 2OQ7A 5JMOA 4RR3C 2VMIA 1N32O 4A3XA 4J10A 4HVOA 3W7TA 5A7WA 4Z82A 4CH5A 5FO8B 4KWUA 2TUNA 5AVPA 5B1AC 3M1HA 4YIOA 1XQ8A 1HRV2 5FTTC 3LSUA 4NPRA 3VQXA 3MW3A 1VP7A 4YM0A 2A5ZA 4B7EA 2N04A 3ZHVA 5D21A 2RV9A 4CVUA 4PJ0Z 4XW3A 5A7OA 2O57A 2PLV2 4LF4B 2WS91 3OUIA 2AUYA 3S7EA 3JALB 5FLHA 1POV3 3IGAC 1AP5A 2VQEB 2BSKA 4XTPA 2DCYA 3TOJA 1PGW1 1R082 4QWNA 1EN5A 4OQ8A 1NY72 5T5JA 2PN5A 4U7NA 4QDSA 4JI6O 3E1F1 3B02A 4QQPA 1APNA 4Z8BA 1Y4WA 3WCSA 3OMNB 3WF3A 4BJ0A 4Q26A 4YFZA 5FL7G 4D6SA 4YZ1A 3U07A 3OY8A 4RQPB 1ND2A 4TLFA 5FZIA 4UW5A 2B45X 4XDQA 4EFBA 3R0RA 3E89A 4JI1O 4Q4Y3 2IXKA 1OOPC 1Q90D 3J8F3 1IDSA 3AG3C 3K77A 2AR6A 1IXBA 2VQ0A 1CGPA 3JAKA 5F5CA 1Q6UA 1GK9A 1VRH1 4XJUA 2EAAA 5EZYA 3GZEA 3CRAA 3ZN6A 4XAEA 3O1SA 4X9QA 3RRDA 1QJU2 1C8M2 3AK3A 3ENRA 2AXTZ 4XUQA 4I01A 3MIDA 1C5IA 1UCXA 3WSOA 2Y69B 1I5XA 1A78A 1EBOA 1EAH2 3ST7A 2DWEC 5IE9A 1B04A 2ATKC 4L92A 4GZ9A 4JAUA 2FQPA 4IUGA 1UD1A 2GN7A 4JGZA 3NW4A 1HKDA 4RL7A 3ZBHA 3TEYA 5J98B 4PQ9A 4B3MB 1JJ2U 1PNKA 4ZOLA 4JAAA 1O3TA 1BK0A 5FBJA 2PYLA 4QDQA 2A7WA 2WLMA 3CCQV 1EAH1 2F4PA 2X6AA 3D4KA 1BKZA 4PA6A 2B1GA 1Y6XA 5DDJ3 5FZ3A 3CP1A 3AKRA 1NXMA 3AEIA 1LHVA 1WB7A 2VZ3A 1UZWA 4LT5A 4AAPA 1PK6A 3TGUH 2WBKA 1C28A 3AZVA 4NR1A 2IWGB 2NMNA 3WNLA 1ENXA 3BFRA 3A22A 5HXVA 3JASB 1YFUA 2NQYA 2Y34A 3CQOA 4X8PA 4FP2A 4RGAA 4AEDC 4TYSA 2VUCA 1LODA 5FYYA 5F3EA 1ZX3A 5FY9A 2HYXA 4MVOA 4WM8B 1A34A 2W52A 3SKJE 2RR12 3DYOA 5E16A 3USUB 1M57C 3LUTB 3IDAA 1LB2A 2XWJB 1COV2 2Q30A 4DR5O 1X8EA 1C1FA 2Y64A 1KDMA 1VMHA 1JYIA 4BMEA 2B8MA 2EAKA 2CTQA 4CCLA 3ASIA 1DCSA 3QO7A 2CAZC 1KBHA 2H94A 4M01A 1ND3B 4R9BA 5FJHA 3FL7A 3JD73 1JYCA 1AP6A 4WCEV 5FV3A 4Q27A 2Q67A 4DZGA 1Z7S1 4ORFA 4W6XA 1MS3A 4X1KB 2WLJA 1R1ZA 2LFRA 3WR0A 3MIHA 3MLLA 2XBO2 1LCLA 2IXLA 1S0EA 4RHV3 3I2IA 3VZNA 5FY5A 1WPBA 4A6OA 1UOFA 4QX5A 2A3QA 3FUQA 4CEYB 1R092 1POQA 1XC6A 1D2DA 4Z2WA 4Q4X3 1AR92 2P34A 5FZLA 2WZR1 3O12A 2N05A 4TQDA 4LLOA 4NIDA 3M3EA 3WF2A 2ZBJA 5F2SA 4YZ3A 1ZA7A 4RQEA 1K5MA 3BTAA 5KR7A 4LUMA 1Y3TA 4R9DA 2VOXA 4EN0A 4JZ2A 4DY5A 1S2EA 1TNRA 4MUVA 1LOAA 2YY1A 3NJXA 2ZJCA 3N9QA 3M3CA 4KMQA 4MTFA 3BHPA 2YGMA 4E9KA 2VO5A 4EN6B 1ULOA 4HN1A 2VTFA 1K42A 3C7HA 2WSVA 2FDHA 1RUD3 4AQYB 4YLZA 5GW7A 3ZIXA 1YEWA 4LNUB 4A7YA 2HG5C 3I7DA 2Y6JA 3I59A 2YUAA 4MG2A 4AGVA 2WLQA 4AVAA 2F4VB 1PP9H 1K5SA 1WN7A 3H1YA 1W3XA 4XJWA 5F5QA 2D6NA 1FV3A 5AC91 2DWDC 5L19A 1O7FA 4HL0A 3RWRD 5DAWA 1H0BA 1B35A 2ODMA 3CZUA 5AVAA 2GTSA 3POBA 3F5WC 3R66A 1QQP2 5LA2A 4D8MA 4B08A 1JJOA 4I50A 4OUEA 4J42A 1NVPD 4I9QA 2UUAB 5ACA3 2ZM6B 5FXXA 1QJZA 4A44A 2L9LA 3PVOA 5ISLA 1KITA 1P4RA 1N36B 2W9XA 3W7XA 1ZRRA 2ZM6O 2AC1A 4IV3A 5LBBA 1SBEA 3THOA 4WZFA 3NV4A 4XPVA 4O4JA 2XQXA 3ABLC 1J3QA 3AG2C 3STZC 2DCKA 1FFTB 3KGLA 3MIFA 2L35A 1E1QG 4UCRA 2WABA 2ZTNA 1LOBA 2BERA 4OPAA 3ZMTA 1CXZB 1SBFA 3PN1A 1UF2C 4F3JA 2LGQA 1IS6A 1XEQA 5IVCA 2ZE8A 1AXYA 4YVSA 4QPWA 2WFPA 2XTAA 3W7UA 4JGZC 3MO4A 4ZY9A 3EJKA 4FQ4A 2HBTA 4XF1A 4KQ7A 1AF9A 1MS9A 3D36C 2Q8DA 1D0GA 2R0FA 1NA1A 2YBSA 1SLAA 4DW1A 2VZVA 5IAXA 4YNIA 5I0UA 4YRDA 2CV6A 2DTWA 3N2GB 2XLFA 1RMU3 3EVKA 1XILA 2GHYA 4WVZA 3CMGA 4FK5C 2WSUA 3I2JA 2VZPA 1R6TA 4NROA 2EIGA 3PMEA 4QHBA 4BAYA 1L0NH 4XF3A 1FFXA 1YFYA 5FP3A 5FZAA 1D0HA 3A7QA 4A4AA 5BY1A 2BOJA 3DXRA 1N33B 1J1LA 4G27B 1YF2A 4O65A 4X6RB 3VBOB 2H3OA 5FZ8A 4QKDA 2R6QA 3OFNG 1FXKC 1W2UA 4YG0A 5FYUA 1BCCH 3VKLA 1OA4A 4H2AA 1LU1A 1E5HA 1AR81 4WBNB 3SKVA 1NLRA 2BNMA 3LD8A 4TZDA 2ZGPA 4I3GA 3WLUA 3RZLA 5BXZA 4BW5A 3GVMA 3AVSA 2GNDA 2KR2A 1I5PA 2CTVA 1LHOA 5KA5A 3R65A 3RT3C 2OS2A 2BE3A 4JTDB 2IFWA 2WLLA 1XUQA 3I3BA 4WFGA 4CDUB 4LEJA 1ZAUA 3HIFA 3CCLV 4QGLA 2XONA 5FPAA 4UFKA 5EBLC 3R6SA 3AMQA 4IIJA 1UKGA 3UESA 4UVBA 2J1RA 2YBKA 1HJGA 3SEEA 4QDRA 4XC9A 2V73A 3I97A 3AB0A 3OG2A 1COWG 4IGPA 1TME1 5A3OA 2R071 4NIIA 2BWAA 1LOFA 3ZRXA 3ZYFA 1SQGA 3QBQA 4B3TO 1Y74A 1H1AA 4RR3B 1COV3 2FDJA 1RUD1 1K3IA 3JAKB 2ZE5A 3B01A 1W2OA 4LF9B 1UY0A 4MW3A 4TV8B 2WO3A 4NUBA 2GV9A 1RXGA 2EXIA 3OEEG 4CEYA 1UZ0A 3Q8AA 3O0XA 4JYYA 4LF9O 4LFAO 3MW4A 2R061 1HB2A 2LFSA 1NXD1 4DV7O 5IYBO 2R072 3W58A 2VW2A 3J26N 3TYJA 1X33A 3JXSA 3EXUA 5FY7A 3KG2A 5JWPA 2VZTA 3ZN5A 3VBRB 3C3TA 4LBEC 1OJHA 1NCRA 5F3CA 1JQ0A 5LGNA 5EC1C 4WM7C 1OPOA 4I0AA 3WEZA 3WNXA 4Q4X1 3OGIB 2VY0A 2VNGA 5K7PA 3DKQA 3K06A 4DV3B 2PHFA 4P08A 3LFIA 5GLTA 2E6VA 5FBZA 4I9WA 4CH4A 3LA3A 4Y20A 2ZEYA 2DF7A 4Q1PA 5B1BC 5HPOA 2R70A 5JAXA 4RYDA 1I1EA 3K57A 5IJ9B 3S6PA 2OX0A 4FPFA 3CCRV 4KNCA 3CEIA 4BMBA 1FJGB 3MF9A 1PX4A 5FZKA 2VULA 4PF1A 1TMF3 1GZ9A 1RUG3 4HBNA 4CEWA 1UJWB 3SGIA 5B4NA 4XHXA 4Y1VA 3ZYRA 2QJVA 5C3QA 1A8DA 5EYPA 3AMPA 2Y6HA 2QZ2A 2D6LX 3QF7A 5B1AB 4RA0A 5F2VO 3OAAG 1GQHA 1W3VA 4ES8A 4E2SA 2XJSA 3BCWA 2FB5A 3N2KB 4AG4A 5LMNO 1HW7A 1B09A 3IAQA 3CCMV 1C57A 3D3IA 3RDIA 3FJSA 4CDQA 4K1YA 5FY0A 5B3SC 4Y1UA 3ZRWB 2HWC3 3RJRA 1I7FA 1ND3A 2ZXQA 4YW2A 2G19A 3ZXEA 2VOKA 2JS3A 4D0QA 2B1IA 3LDCA 1R3IC 3ZXGA 4QM9A 2JB4A 4DUYB 3FX7A 3W5MA 5CKMA 1QXPA 2CNAA 4JGYC 4UF0A 2P17A 3BPZA 3OUJA 4FJCC 4BQWA 3ILNA 2P5OA 2A79B 4B3NA 4HFSA 2CTWA 2WLIA 4QHOA 5LWBA 3KT1A 2D5HA 1ZBE1 1D2QA 1NTMH 2ITDC 3O14A 2E74B 4N53C 3VBFA 3WP5A 2RS31 3ZX6A 4HVQA 5FPLA 5DG2A 3U75A 3THCA 3G71V 3ITQA 2ZGQA 3FN9A 5FLXN 2BSKB 2KG7B 4EQVA 3ZMUA 3U10A 3UCSC 2F4VO 2YFZA 3WP3A 1BEV2 3AG3B 1FI2A 2WYFA 1AR71 3P1IA 4JC1A 2X6CA 4DFSA 2E5LB 3ZFFA 3H01A 3DXRB 3DPRB 1ZRCA 3NV1A 2RS33 1NG0A 3CC7V 4OZXA 4AGGA 5C4WB 1K34A 2BBVA 1S0VA 4O4IB 2D6OX 3WFVA 1VBE2 2WFF3 1YTFD 1JN2P 2PFWA 4Y4YA 1THZA 2A6WA 1VBB1 3H7JA 4D7SA 3LIHA 5I8TA 2KG7A 4FZ1A 3HKCA 2A3YA 3SYAA 2WYSA 1N36O 4HN0A 3JB8A 1S3JA 2P4EA 2UY8A 3S5QA 3AXEA 1AJQA 3N27A 1IBMB 1HRI3 5K9YA 4JKMA 2MEV2 2P1BA 3F7VC 4XOGA 3VKNA 1NLSA 1KJLA 2OKXA 3Q8CA 4DS0A 1K73W 1UWWA 1IBMO 2XNDG 1UY4A 1WA4A 5F2WA 3URFA 1RPRA 3UGHA 2GNBA 2WNVB 4RUFA 3QACA 4O4LA 2NM1A 4EB6A 1VQ8V 3CS5A 1QJY2 4LULA 4YY3B 1SQXH 3CLPA 1HXS2 3PNAA 1L1FA 2PI5A 5H9CA 2XVGA 4WF9V 3HKCB 4V1PA 4FM2A 2X10A 3ZMNA 1W2TA 1XNCA 4O4JB 1QJFA 4YY3O 4DXTA 3JBG2 5FQ0A 2XPJA 1GN2A 2AHYA 3TRSB 3AJZA 3U0ZA 2VMDA 2VQFO 4DR7O 4HAMA 3KVBA 2J7MA 4UVAA 4FLZA 5T54A 5JIAA 2ZEXA 2O1QA 3IJ4A 4MHUA 2WKKA 2WS93 4Q8LA 3OGJA 2R043 3B4SA 3ZRVA 1Q6IA 3D82A 5KAIZ 4DMIA 3BPSA 4AVCA 2OCHA 2EIMB 2XUEA 5FZ1A 3HEIA 3RZJA 4O9EA 4DR1B 1W0KG 2VMCA 1JMKC 3ZFGC 2DV9A 1N1YA 1JODA 1OF4A 2VBBA 4DR1O 4D7TA 2P6JA 1NCRB 1FPN1 3NAPC 4FVVA 4AEMA 4ZHNA 3DKWA 1RUC1 5FZ4A 3FX3A 1X82A 4LE4A 3N2GA 4UW4A 3ZXLA 4FT8A 4RGKA 3FAVA 1XL6A 5J2UB 4DR2B 4BQYA 2R9RB 2NPIA 3DPRC 5J96B 4AF9A 1OBNA 2X05A 4OYUA 3FHAA 5L3GA 5I0SA 1DLLA 1QLEC 5IJ9A 1CVNA 4QPIC 4L9BA 2FCTA 1Y9MA 3CJHA 2GSYA 2RJ2A 2XGXA 4AI8A 1ODNA 3SC7X 4BW9A 2R041 2CSGA 4LH6A 2HEPA 1VB4A 3RYHB 1K7DA 2GDSA 4ZZ5A 1TVGA 1QU0A 3AKPA 2KM2A 5FZHA 4QPJA 4Y3OA 4XBFA 1K5QA 3N35A 1DU3D 2YB7A 2QQKA 2GN3A 3VBFC 3NQHA 1YQ2A 4P9LA 2H6CA 4O4HA 5AG2A 3K9AA 3KQ4B 3HQXA 4R9CA 2WNOA 3CMAV 2PELA 4IGOA 2WLLB 4NTYA 2IU3A 1HW5A 1G4YB 2EIJB 4N7UA 4XABA 2HWD2 2ZIMA 1SERA 2JKXA 5DECA 4LFAB 3FFZA 2JJ6A 3OD0A 1H38A 4WFAV 3GZUC 2OXBA 3WVJA 4XBQA 3WHTA 2QWRB 2CDYA 5IT9N 3ZMVA 4QU1A 5FMOL 2CY6A 1GO3F 1OD5A 1ZBE3 3H1IH 4IQPA 3RZZA 2DN9A 4IV1B 4JGZB 1LESA 1DQ4A 2VBPA 4LA2A 5FP9A 3LOBA 1V54B 1M9NA 5J37A 1GP6A 2OVUA 3DC6A 5JVDB 5CG9A 3S7IA 4PDLA 5L9RA 1WUVA 4GX2A 1V6KA 2LM3A 2A6VA 4K9SA 4OMDA 3BKZA 2XUMA 4DV3O 3NNFA 1N3QA 1MEC1 3OPTA 4QX0A 5FZ0A 1QR9A 3U37A 2HWB2 2BZDA 2HKXA 2ZT9B 3CB2A 3K3WA 1GM8A 4L97A 1I5ZA 2CTRA 2BUKA 3SH5A 4QXHA 4YARA 2UXDO 3I8TA 2QWQB 1KD1W 4JYAB 1YYNA 3CYOA 1PNGA 1XHZA 4LCUC 4HOOA 1VR3A 2DCTA 1Q8VA 2A3WA 2ZIOA 5FYIA 4G2KA 4JDNA 2PI4A 4GXLA 1DYPA 3ABLB 2W0XA 1Y76A 4HKWA 3CXCU 3Q8EA 4FO9A 1H30A 4OI2A 1SKVA 2QTWB 5AFEA 2YSUB 4BIUA 4ITCA 1KB9F 4G9SB 1UZVA 4CZZA 3H0OA 4Q4V2 2JICA 2Z69A 1QY4A 3KV6A 3RYKA 4EZ4A 2OWOA 1VF6A 4BB3A 4AI1A 5FMCA 1NTKH 3GYDA 4AQ2A 5K1PA 1UU5A 4K3UA 1BHBA 1SQBH 1HNWO 1VMGA 4CXYA 3BTZA 3IB3A 2VC9A 3BALA 2WLNA 3PL0A 4BDVB 1DQ6A 5IVBA 4LBJA 3VZOA 5FJKA 2YXHA 3MV11 3WF4A 2VW0A 4KH9A 4I55A 3VD4A 1FD9A 2FL4A 5I93A 5F6LB 4G4FA 1RUJ2 1R1BA 1Z0HA 3NAPA 1LHWA 4S2HA 1VQPV 4MXVA 4IE5A 5JQGA 1C8M3 1W9YA 2XHBA 1JS9A 4JTCB 2VMHA 3EO6A 3M7AA 2ZMKA 5JOZA 2FKXA 1RYYA 2YFUA 1UYYA 4RUEA 2JE8A 3K5OA 1QJX3 1GMGA 4FIPC 4P9OA 5C70A 1RM1B 1YVWA 3HKBB 4AEDA 1STMA 3KCCA 2XJPA 1NKGA 4CYDA 4OI1A 1JU3A 2DYRC 2FTKA 1IBLB 4AQTA 4GX1A 4LO8A 1YIFA 4PLNA 2OTJV 1JU4A 3QH7A 1YFWA 4XACA 1SLBA 4P9WA 1WZXA 4QIWF 5FP4A 1XE0A 3WB2A 1W8WA 3D6EA 3KT4A 4WBNA 2P3KA 1JTZX 1HR0O 1CN1A 1I3HA 3X2QC 2OYZA 2JE9A 1AVMA 5JCOA 1DGRA 2JD4A 5SV5A 1XNKA 1PK6C 2JDHA 2QM7A 2NNUA 1RUE2 4UBGA 1AR82 2WJSA 1P8JA 2WWJA 1I08A 3T1LA 3ZHQA 3DPRA 3VBUC 1LU2A 2Y69C 2BFUL 3IFXA 3O1RA 1ULCA 5J2UA 3K5LA 1PM4A 4RN5A 1CONA 2BWCA 1OA2A 1YJWV 1D4VB 3VUOA 2PHWA 5IJ0B 3WY6A 2QQLA 1NJIW 5DUUA 3H1WA 1VBD1 2Y33A 1WWYA 1QLNA 4AHYA 1KRIA 1JXNA 1MABG 1CIWA 2YHJA 5CA3A 1D2SA 3JARB 1ZRIA 1MA1A 1K5MC 3IMNA 4JZRA 4I0XB 3RZKA 3M4FA 2Q4SA 1DHKB 5FY4A 1DDLA 1V00A 2JGDA 1R6NA 2D6PA 2PLV3 2R1BA 2Y0OA 4LKSA 5CB4B 3SLIA 4AK3A 3K46A 5H9QA 1Z7S3 1G6UA 1UPGA 1PGL1 3KF3A 1VQOV 5FAXA 1SZBA 1MS8A 1NQTA 1SQPH 3J7HA 4JPRA 1GM9A 4QKNA 4MVTA 1LEMA 1OA3A 1S0GA 5K8SA 4X66O 4H13B 1HWYA 1V6OA 2PMWB 5DM6V 1YDXA 2ATFA 5FOBB 4J7JA 4EB6B 3MI8A 3GF6A 3P30A 1VIBA 3HBZA 2XOMA 4RS5B 1KFUL 3RYIB 2OTLV 4GJYA 4F4LA 3NJZA 3MV01 1PGL2 1L7LA 2BP6A 1R3KC 4N43A 3J4UH 4ATFA 1DK1A 3E8HA 2RJZA 4M3CE 3AZYA 4E4ZA 2QGNA 5FZCA 3RW0A 2BRTA 4AL9A 4CCNA 1X4TA 4JI4B 4CP2A 3V0BB 2XBO1 1AYM2 1RUNA 3M3OA 3USUA 2IW5A 4ZXEA 2B4KA 4OHXA 3I2GA 4UYBA 4DUWA 1OCCB 5IK5A 1VBE3 5T52A 4BH9A 2WFF2 4L8QA 4OULA 4RSUA 2RR13 5KX5A 2G4IA 2Y4TA 3H3LA 1NVPB 5BNPB 2RQ6A 2ZR2A 5KHHA 3UT5A 3QD6A 2Y48A 1HP8A 3AG1B 1U5YA 5FLIA 4LLFA 3VBSC 1WD3A 2RJKA 4B4QA 1RUD2 1G8MA 4TLGA 4E8CA 1OH4A 1M06G 4QX2A 4XFIA 3VZJA 2C2AA 2OUJA 3BOWA 4D3WA 2YDEA 3JAWA 3H1JH 5FZGA 4UCUA 2P6CA 1GYKA 4LHNA 4PCRA 2ZR3A 5T50A 5KX5B 3RYHA 1PIV1 1F4AA 4PJYA 2Q9LA 2JDZA 3JCUZ 3E5XA 3HD8B 5J1XA 5LCWL 3GBGA 2WN2A 2JDMA 3DN7A 3HB3B 5FK7A 1OQ1A 3UETA 3OTOB 1PPJH 5E89A 3ZYJB 4D7YA 3I2HA 4UF0B 3ASNC 1KP2A 1XMQB 4P9XA 4UCSA 4XHBA 3JAWB 4KBBA 2HEWF 4BLJA 2JDNA 1J84A 3HT2A 2P5BA 3TB0A 2D93A 3APOA 3CCJV 1KDKA 1J95A 1H2KA 1QOTA 2ZMNA 4ASMB 2QBXA 2ERFA 1CPMA 5LL6Y 2EJRA 4J1XA 2JVDA 4CZSA 5K1XA 2CDOA 5E8AA 4AFBA 2KA3A 2WUHA 3AKQA 3T0AA 4FLXA 1QEXA 1M90W 1EV11 1CX4A 5EYXA 5CA1A 2UXDB 3HKBA 4WBBA 5FMDA 3S30A 2VRZA 1COV1 5A3WA 3ETGA 3AP7A 2YU2A 4A2UA 4NHMA 2P4KA 3ASOB 1BEV1 3NSTA 3O65A 3JYCA 4P9YA 1JZ6A 3FUOA 4IEOA 3WNPA 4NWWA 3HQRA 4RFT0 3DUIA 1BK1A 3GBWA 3KHBA 2ZOEB 4D6TH 4ET7A 1PD3A 5L36A 2J42A 1WA8B 1DBNA 4JTNA 3V65A 2WT0A 1D5NA 1VBC2 2JDKA 1V6NA 1I94B 4FAHA 5F3IA 3LEKA 3SHRA 1ST8A 4P30A 5I8YA 4CU6A 2QWOB 3LDEA 2GUZA 1BE3H 2QCSB 4TN7A 5KXCA 1WNSA 3VKFC 1LGNA 3WDTA 4GKKO 2DOSA 1X8MA 2Q6AA 3RN4A 1C8M1 3RZGA 3CJXA 4ASKA 1CWPA 3SPIA 1VF5B 2CHHA 2RCVA 5CVRA 3ZKYA 4BK5A 1IS4A 5FZOA 4HLTA 1UQXA 5DAQA 2XOKG 1DF4A 3JUUA 2UUBO 5GTHZ 1DP0A 3ABMB 2CAVA 3HKEB 3ES4A 2UU9B 1OLRA 4MS2A 4DV4O 5C3OA 2WFF1 4JASA 1OKOA 5A7PA 2Z3YA 1V6LA 3RBZA 4QU2A 1J59A 1QQP1 4QM8A 5ERLA 2JDIG 4LO4B 1PMHX 3ETQA 1DQ1A 3J81N 3GJAA 3LSDA 5A80A 5A2QN 1WMFA 2Q5TA 3MIEA 5F7UA 5EFUA 3M3QA 4ZS3A 4C8DA 3ZR5A 1PKXA 2QEXV 2IH3C 4FAGA 2RS53 5A32B 5A1FA 3LWCA 1N1TA 4YVWC 2I07B 2GU9A 3I3QA 3FKSG 1K4CC 4GULA 3CO2A 2BU9A 4ZHQB 5IVJA 2VW1A 3UKNA 3PVBB 5D8AB 1QKQA 2Q5ZA 2EILC 5FR3A 4Q0PA 1RUF3 1ZZ9A 2RHPA 3NKGA 4PBOA 5KHIA 1SQFA 4NWVA 1WJZA 1RPOA 1AR93 3N7KA 1D5AA 2UXNA 5H6RA 2VZ1A 1EPZA 2F66C 2HR3A 4QE7A 3J7NA 1QOOA 5B1OA 2DU1A 4XUNA 2DVBA 5GZEA 3AL6A 1JX9A 4QPKA 2JG9B 3B9IA 2Y6GA 1LNSA 2WWSA 2BJSA 4YGEA 1S1AA 2PZSA 1FATA 3LEMA 3UKVA 1RUE3 5L3FA 1X36A 4META 1UY3A 1M1KW 4I09A 4XQWA 4F8AA 5C8WA 1BQ0A 3B7MA 3N9PA 2J1SA 2IJJA 1AYM3 2LS6A 4RHV1 4LF5B 4Y1ZA 2ZZJA 4QQOA 1V54C 4XF4A 3RYCA 5B5EZ 4JV5O 1RVF3 2ZX3A 1GAXA 4AI3A 2HWE1 5GZFA 5BYNA 2X53S 3M3IA 1NI8A 5D2AA 1EPWA 2QQNA 2VVEA 3IDCB 5B66Z 5EV7A 4LBOA 2D5FA 1RMU1 3C2UA 4K1ZA 3TEXA 2EINB 2I2SA 2B5UA 3EXAA 2ZDIC 4XUOA 3TXQA 4P2ZA 3GCXA 1QQP3 2V5DA 2DQ0A 1OFSA 2ARCA 1QJX1 4EFEA 5DAVA 2AGAA 4FXKB 1W2BU 4AXOA 2EXHA 3MGUA 4RQPC 4CUBA 3ZFFC 3K48A 5E6HA 2JXAA 5FKCA 2DBNA 4P9GA 2HWE2 4JI0O 2ZGMA 2EXJA 2W46A 2JEMA 3RYFA 4LHKA 1XB9A 5K4LA 2OIGA 5CFCA 2Q69A 3MIGA 5DABA 1ZX5A 2D6MA 3ZR6A 1IXMA 1YHFA 1JZ5A 1MS5A 3IIAA 1S0BA 4C0BA 2QA4V 1PVC2 4UFLA 4MVZA 5A3TA 3X2QB 3L2YA 2FYUH 1IVSA 5CFDB 2VE1A 4N21A 1NZIA 4QAWA 4KWKA 2IBZH 4HANA 4TV9B 4KHPB 3IC7A 5EYPB 2XDVA 2W39A 3WDUA 3ZSKA 2B42B 4NHYA 3DGEA 2JKBA 5B3SB 2E32A 1BBT1 1K33A 4DK0A 5D5PA 2QNKA 3CL1A 3T4DA 3SJAC 1GN3A 4BQ2A 4YM1A 2BGCA 2WR9A 5H6QA 1LEDA 1FAFA 3BODA 3VDDA 1BMV1 2QDOA 1VQ7V 3DL3A 3GWOA 5K0UA 5L3CA 1WLCA 4CDQB 1JBCA 5BMVA 5BNNA 1UOGA 4DO2A 2BNOA 1OCOB 3WF1A 4BOWA 3SQOA 5JI9A 2X5IC 3D5OA 1W6NB 4WM8A 3ZM8A 3B94A 3M70A 4QGMA 3VLBB 4DV5O 5LASA 3ZLIA 4HSLA 4N9IA 1S0FA 2WT1A 3WP6A 3H8RA 3U11A 2SBAA 3G7DA 5L9VA 2YC4A 5BXXA 5I0RA 4P9PA 4UUJC 3MW2A 4IGQA 1XSQA 1CAXB 4QPGC 5CN0A 2GSMB 5EK0A 3IPVA 2YI8A 4OGQB 2B7YA 4IV3C 4FPYA 5C4WC 1MVQA 1FPN3 2LJ2A 1HV0A 2ES3A 2IVJA 4K35A 1H6YA 1XBFA 2AEZA 4WV8A 3SYPA 4L99A 4M0NA 5C9AB 4GQ7A 3EB7A 3ILFA 4YZ5A 4I3PA 2YEVA 1UPIA 5LP6A 4J7KA 5IY5B 3J7AU 1YJNV 4K3AA 1ZA4A 1BQPA 4QHZA 3PU8A 4PA9A 4DRRA 5CA1B 1PO13 1AR5A 5CKQA 4Q4W3 4TQFA 1NBMG 2JDPA 4ZHQA 2EBOA 3OGVA 5LOVA 4ZU7A 1RB8G 5FKBA 2ZX4A 1JOBA 1LGBA 4ZU5A 3QO5A 2WIIB 2XH6A 5EJ3A 5FZ6A 4PI0A 3MZHA 4AHZA 2JX9A 4NAOA 1K5MB 4JGSA 1DIWA 4HNAA 1S0DA 4AVVA 1FMD3 4CDXA 4FP3A 1W0OA 4GKKB 2RN9A 1OMIA 4YW7A 1CZSA 3BTYA 4I30A 3IAYA 2ZACA 1UMIA 5FMBA 4AFMA 1WA8A 4XMAA 2A7AA 5J2TA 1WMDA 4X64B 3FWEA 1VF7A 4NN0A 4I4TB 4ISQA 2LQTA 3BA9A 4RQPA 4F7ZA 2A70A 1GH6A 5HCHA 1C1LA 1VIWB 4CE8A 2JB8A 1TME2 3L2HA 3VV1A 5FUNA 3DYMA 4XUTA 3JBG1 2UU9O 1OCRB 4UAPA 1UZZA 2AZ2A 3QH6A 3T4ZA 3CPWU 3RG0A 1F51A 1RC6A 2DMXA 2XJVA 3UKMA 2ZX0A 4BXSV 1UXZA 1N0NA 2IXHA 3L72H 1VQNV 2UUCO 5EZYB 5F5AA 2Q1FA 1IGOA 1ULEA 2YC2A 1WBLA 3VOUA 3T1MA 4OI4A 2F23A 1OUSA 1PO22 2ETEA 4JHTA 2VJXA 5DN6G 3DECA 5FOJB 1ZL8A 3FHIB 2CH7A 4JI3O 4FPPA 3PMSA 4LOTA 3VQWA 2MEV3 1H2GA 1XL4A 2WO1A 3OT7A 3AG4B 3CCUV 1B06A 3LF7A 4JI3B 2WO2A 2FHRA 4UOJA 2R49A 5KC5A 4G3YC 2VBDA 4IV3B 2XAFA 2ZPXA 1NQDA 4UVCA 2UYAA 3SPGA 4XDJA 3T1YO 5A6XA 5BNOB 1GZTA 1UX6A 3RMXA 3HNMA 2HEVF 3UQ8A 2HKOA 5AFBA 4TWKA 4YM3A 1LTEA 1W6PB 1SPPB 1BSMA 5D1IA 4LR4A 3ZXDA 1Y67A 1OKQA 3AP4A 5LA1A 2W1SA 1JYVA 1FXHA 3CMEV 5DUXA 4BQ4A 2C26A 1KKDA 1S5JA 4DEVA 4J11A 4LF7O 1SQQH 4XURA 1W0JG 4LF8O 5APAA 4XILA 4YPJA 5FP8A 5BNPA 1AHSA 1UMHA 2JJ2G 4XZUG 5LEJA 4ES9A 2ZGRA 1LOFC 3THPA 1K12A 1IG0A 5IUQA 4LF5O 1H8EG 4I2OA 2Q4PA 2EVXA 4P02B 1O3SA 2DYCA 4C0HA 2G1MA 3N3HA 4ABMA 1R1A3 3QNEA 4KWLA 1MZ6A 1UYZA 2R063 2CWSA 3JBG3 1WCKA 4DV0O 1F5FA 4DOUA 2Q1MA 4P5YA 4RQFA 3E6CC 2Y26A 1V9U3 4E4DX 4LK6A 3H8UA 3SR2C 4QX1A 3N7JA 4NTXA 2FMYA 1I0HA 2IU0A 5LYJA 4XJAA 4EN7B 4L8JA 3ZYBA 4BZ4A 1XNAA 4LTAA 2W6JG 1PX3A 1F31A 3B00A 4NXNO 2YC0A 4YW4A 4ASUG 2A1XA 3DF0A 3U14A 3BVOA 4RAIA 4PQQA 4PDRA 1W03A 4O2BA 3DC5A 2EJ7A 2MHFA 1OVSA 3O1TA 4CDUA 4E8DA 4BE3A 5C33A 4JI0B 5EC2C 2RS52 5EQUA 2Q8VA 3WG7B 3SCFA 4PIXA 2K2SA 4K8ZA 2UU8A 1MMMA 4Y4RA 1H8VA 2WQ4A 3TNPB 4URTA 5KMGB 3LSEA 2OYQA 4I02A 4DUZO 2W92A 1NX9A 4QGNA 2Q0AA 2VZRA 4NVPA 5DDJ1 3WG2A 2VMGA 1N0JA 2CE4A 4K21A 2QKDA 2L6LA 4CU9A 2YEVB 1ALYA 2QJ1A 1GTOA 2W1QA 2YXYA 2BOBC 3ZO0B 2Y0IA 1RINA 4B1MA 4UFHA 5KHKA 2QDRA 2XAHA 4AHWA 1YJLA 4DIQA 1RUJ1 2UXBO 3SPCA 3UO3A 3CZJA 4J9ZB 1KECA 4JRLA 4K8FA 4KUMA 1FX5A 2WAOA 2WZ8A 1S2KA 3E6BA 3X29B 1NS1A 4Y5TA 3T4HB 5DAPA 1J3RA 5JH7B 2VNOA 1GBGA 5FPZA 3U4XA 3E8FA 2ZGKA 3I54A 1AYN3 3NL1A 3VZMA 1JW6A 3MF6A 1FXVA 3A0HZ 3SMHA 5L3BA 4XMIA 2HWB1 4MSVA 4BQ3A 4BYYA 4GJZA 2R16A 2BW8A 2K9PA 4JYCA 4GH4B 2OQ6A 4MX3A 3JAMN 3VD5A 5ANNA 2FDFA 3AL5A 4IL7A 4AFDA 5F6KA 5CBGA 3KHCA 4E2GA 2Q7EA 4MHRA 4GWIA 5FPBA 3SYOA 1YXBA 2P67A 5CU1A 1Q5OA 3FHQA 2EULA 1YNAA 4YVWB 5FMOS 4WFBV 3PUIA 5C7GA 2IXJA 2LUWA 3ALQA 1BBT3 3KD4A 3NO8A 4MZUA 5BMVB 5BNNB 4AEDB 4LO5B 3TCUA 4Q4V3 4QQLA 1LHUA 1X9TA 4CDWA 2UWBA 1RSOA 1BVVA 3I2DA 1WLWA 1FT9A 4QPIA 1CAXA 1H2NA 1CAVA 4U3JB 1YJ9V 3DGTA 3PLQA 3A0RA 2TNFA 4DR3O 5FNVB 3AK1A 5EBMC 2GP3A 1S2BA 1UL9A 2EZPA 3TN91 4CUAA 3MLKA 4DR3B 4XBNA 2WLHA 1CZTA 2Z5WA 1QHTA 5JZGA 3VBSA 1GNYA 2PQSA 2ORZA 2XMLA 4DPNA 2JK5C 4CA9A 3KM5A 3E22B 1HX6A 2B39A 1QNWA 3HN1A 4I7ZB 1GOHA 2QUOA 1K92A 1GWLA 4FM0A 2J22A 2VOVA 2ZAHA 4P14A 3CJIB 4XDOA 4R6ZA 5JMCA 4H7LA 1ZZ6A 3SDLA 5JXHA 1OZ0A 4DV1O 3CRCA 4LORA 3LIGA 3OBTA 4AHXA 4AEJA 4NIGA 1ZTEA 4Q4Y1 2VQEO 5HI0A 1O9GA 1U5IA 1XSRA 5IVYA 4X1YA 4I0XA 3OBAA 1RTVA 3K59A 4KU7A 3WX5A 1R091 3DXTA 1UNBA 1RUH1 3ILRA 3DTUB 4COYA 1Q56A 3RQ0A 1VRH2 4CP0A 4TSVA 3ABKC 2V7QG 2BQPA 3A0NA 3EMRA 3BEHA 4RS5C 2ZGLA 1SBDA 3H3ZA 4E4HA 5FIXA 1W8TA 4N8MA 1VQLV 5EXOA 1U0AA 4CCKA 5FY1A 1HB4A 1L7RA 4QD2A 4HPKA 4CPBA 4LMFA 4NB5A 3BTXA 4AW7A 3RJ2X 4CP1A 2EF6A 1H6XA 4W50A 2WQ8A 4ONUA 4JYBA 4XAAA 1MOFA 2VCMA 5IYDO 3EYPA 2DJVA 4AGRA 3ML0A 5DUVA 1JFFB 3LB9A 1CEZA 4OQ9A 4LK7A 3VD9A 5BNNC 2NP0A 2WRAA 1PZ9A 2RJLA 3E35A 3ZYHA 2BTOA 1I6XA 3ABUA 1XRUA 3DEMA 2C0ZA 4W8JA 1F5JA 3MPPG 5F37A 2X5IA 3FZ3A 1CAWA 4R7CA 1AJNA 2J1EA 5IY5C 4Z92B 1K9MW 4MT8A 5LBEA 1EZJA 4QB2A 2NYYA 4KG0A 4LF7B 4GCZA 3FYEB 5A3MA 3C7FA 3E2EA 2EZOA 4TOIA 3NKTA 1DGLA 1JZ2A 4U36A 2JS5A 3VQYA 2WNVC 5C3SA 2Y6FA 4F83A 3FBYA 4FQZA 4WFEA 1VEWA 1N1VA 1FNZA 5IVVA 4B3MO 2QDNA 3VBOA 3LFMA 3LA2A 3ASNB 3KZIZ 1IQAA 4OHWA 1TEIA 3AK0A 5KWRA 2GNTA 1CESA 4JI7B 5LP6C 4GMP3 4Y20B 3JZVA 3LNNA 3OD4A 3MICA 3FMGA 4FPJA 3VDDB 1FOD2 4QXBA 3IAPA 2YIBA 3DXUA 3ZFEA 2J1TA 3MAQA 3W20A 1AUYA 4XBLA 5JR2A 5LGTA 5FWJA 2OIIA 5FPXA 3WQBA 4MGKE 1PO23 2VECA 2ILMA 1NE6A 1WMEA 3I56V 3TK1A 3T2QA 2RMU1 3G67A 2P22C 3LEIA 4XEZA 1N34B 1JH5A 1KQSU 2BTQB 4BIFA 4FPCA 1SFNA 3ZYGA 1RP3B 1AX0A 2BOIA 3N9NA 4FOVA 1TMF2 4LBKA 1LGCA 2XAQA 1YI7A 1QVFU 5GM0A 3B69A 1KGYA 3ZDVA 4PDMA 1H8TC 2ZMLA 3L71H 1BEV3 1AR61 4PF5A 1XNQB 1TAEA 2NLRA 1HXS1 2HP8A 2W2IA 3AMHA 5GONB 2HWF1 1VJ2A 3U1XA 4GWNA 2W94A 3IIIA 3UJQA 5CBFA 1UZYA 2XJQA 3K0DA 4MLOA 1U96A 2V4VA 5FZEA 5A3UA 2PHLA 1QJU1 2VMEA 1OD3A 4D94A 3HPLC 5F8PA 4RGGA 1Z7S2 2D98A 3B8MA 4X89A 2GH8A 4ZKIA 3T2OA 4GZRB 4XFGA 4B4RA 1YLLA 3HWJA 3RGBA 2WN3A 4CUCA 5FZMA 3KCYA 3MDPA 3NRUA 4YGBA 4Q8KA 1J3PA 1ZRFA 2ZNJA 1XDCA 1POV0 4B7KA 2DE0X 1QQCA 2EIJC 1YZBA 3PVEA 1BHGA 1M56C 3Q8BA 4MV2A 3JD4A 2HLDG 1UU4A 1WCSA 4PIYA 3G6EV 4D6QA 1PM9A 2X7RB 1OSGA 2AHZA 5BZBA 3E8BA 4FPOB 3VDBA 4FM1A 4Y1XA 3O0WA 5J3UA 2RDNA 5JI7A 3PJQA 1YQCA 2XB6C 1SG3A 1V9U1 5J9PC 3O0VA 1BHAA 3CF6E 5IWAB 4KL1A 1PO11 3BY6A 5GLZA 1OOPB 4K7JA 3QLQA 1GP4A 4PA3A 2JE7A 5FYSA 1AYN2 2C5DA 4ZZ8A 3O1MA 1VMJA 3CE2A 3GM8A 4XQ4A 1NQJA 1PNFA 2E7TA 1EAH3 3K2OA 2AZ5A 4X1KA 1QXJA 3LSQA 1SZTA 1RUOA 2RS32 2EILB 1IOAA 3MHSC 5LK7B 3RFRA 3EHBB 3UT0A 2PF4E 2XL9A 1L8DA 4RFRB 4JI2O 4A6SA 1OV9A 2JENA 1HRV3 5AC92 2WNVA 1O4YA 4ICGA 2PHTA 3K4AA 4SBVA 2X8KA 1BS3A 4EV0A 2ZGSA 1OLME 2RDRA 4JI2B 2KD7A 4LUKA 1SA0A 2Q8OA 2KB1A 4H55A 1Q82W 3K4DA 3ZMOA 3BA8A 2XHKA 1UO9A 1QCEA 2QWPB 1UOBA 3WDVA 3NR7A 4IEQA 1B6QA 1GN6A 2PHUA 2Q68A 1AB3A 5BNOA 5C8CC 3O9OA 2E51A 3IM0A 3RI9A 4I55B 4NO4A 4XFHA 2YS8A 5JZGB 4C1XA 1ZBA3 1EN6A 4UW3A 2D7FA 5L7OC 3CCSV 2OZ6A 1FXZA 3ZCCA 1SA0B 2A3XA 4IGGA 2XJTA 4I0WB 3AVRA 3G80A 1H9PA 4B3SB 4JI6B 2JD9A 1W8UA 5FZDA 1CJDA 4YGDA 2ZEZA 3T1CA 4E2LA 1T2XA 2YZ4A 5T5LA 3ZVXA 3I49A 3V0AA 1XMOO 2A73B 4B3SO 4N43C 4CDXB 5CADA 4I5SA 3KS7A 4IE0A 2PLV1 2WS92 1GANA 1J58A 4BK4A 4OMCA 1XMOB 3E83A 4LBMA 1KMIZ 5BUVA 4X88A 5LXTA 1F4NA 1IS3A 2XQRA 4QX3A 5IVFA 3JD72 4JX0A 4WM7A 2ZGNA 1O5LA 1A32A 4CBCA 2DFCA 1D4M1 3ZFFB 4JI1B 3K79A 2JG8C 1RUI3 1QH7A 5G05L 2XBO3 3R4DB 3ZN0A 5CEHA 4YWAA 3LE0A 3RVYA 1LHNA 3O7OA 4Y5Z0 4UB6Z 4IIJB 1G86A 2HWC2 3JSLA 4M0HA 4TUYB 2BEOA 4XDKA 1ND2C 2SLIA 5A7NA 2QQIA 4IETA 4IXLA 5C8YB 1VE0A 5DAXA 4O4HB 5FXZA 3A4UA 3KVAA 2VD7A 2X6BA 3SYCA 5IJ0A 3NNMA 1SLIA 1YQ6A 3U78A 4KWJA 3W7WA 2QKAA 3F5TA 5IWFA 3N9OA 1TG7A 4YVSB 3BI3A 1A3KA 2YIDA 2HEYF 4H44B 4A3ZA 3ZXKA 1BQZA 1AI7A 3OUFA 3CX5F 4DO0A 5C71A 1ZREA 4DUVA 1NCQC 3K08A 5LMUB 4RD7A 4QXKA 2OUHA 3NJVA 1GLHA 2XG3A 3J7LA 1PNLA 2K1EA 4OVEA 2ZCWA 3P5BA 3BB6A 2E3CA 3CDZB 4BM8A 4DB5A 2GP5A 2VNVA 3WG4A 3CKHA 4DV2O 2ETNA 4OX9O 1NOVA 1DF5A 1AVBA 4IHJA 5FO9B 4YZ4A 4BPZA 5M0TA 5FYBA 1LOCA 1VBD3 3KLSA 5IHRA 5L7OB 1MACA 1OUXA 2DVDA 1RVF2 1DF0A 4XFAA 2BPA2 1PMIA 4N53A 2E7AA 1R6KA 2WNUA 4GH4A 2Q0OC 2ZINA 1G9FA 1KP3A 5JDBA 2CAUA 3S57A 4O9GA 1JZ7A 1YWKA 5HXMA 4J6GA 2MNGA 1K45A 4DR5B 1N47A 3N2KA 4JDOA 1PVC3 2HWB3 3AYDA 5TISZ 1S4CA 1N34O 1E5RA 3WW3A 2A0LA 1TA8A 4UCOA 3WNMA 5CIRA 3Q4HA 5DG1A 1CP9A 1FOD3 5C3RA 1QJY1 2FZ2A 3NMBA 5HCBA 2A6ZA 1QGLA 2QQWA 4E4SA 2QQUA 4FFGA 2WZR2 1TVKA 2Q1ZB 3SJBC 1PM7A 1REEA 3KKYA 1PL0A 3JQWA 4AZZA 3KV5A 4QKBA 5IK8A 4B3RO 4DK1A 3K0GA 2ZAAA 2DQ3A 4PELA 3AG1C 2LW8A 2AEYA 3W21A 4FFHA 4QPIB 5JCTA 1XXNA 3W7SA 4UT5A 4R4XA 1FS0G 1EV13 5LOVB 2E76B 3LZZA 4A41A 1MEC3 4GKXA 4ARXA 2ET1A 4FCAA 5ABJB 2DCJA 2OZJA 2X09A 3VKMA 4NRPA 2YIAA 3D36A 4MVSA 3TAYA 3A0KA 3P3PA 2HFEC 3I3EA 4K8RB 2WDBA 1WGPA 1JHJA 2ARBA 2Y8KA 3E22A 1S5LZ 3GZTB 2YUEA 1AR91 3SH3A 4AEKA 3Q8FA 3VDAA 1WLEA 5GLVA 2RMU3 1DYKA 3OEBA 1IKQA 1KKCA 2VVFA 4AQYO 1QXRA 3PUAA 3JALA 2LTNA 4EJRA 4YFWA 1VBB2 4YJ2A 1ZNPA 1FXKA 3DV8A 2LGWA 3WF0A 2UURA 5BNQA 1S0CA 3JD2A 2DCZA 1JUIA 4LIUA 4ZXKA 1PIV3 1XNRB 2GC0A 1SCSA 3H1KH 2A6XA 4IW3A 1TME3 1NUKA 1TUBA 5DPNA 3H1LH 2MEV1 4FLWA 3OM3B 1M4WA 3KZ4C 1QNMA 3PTYA 3SNMA 3H1MA 3SXWA 1XNRO 4HPKB 4XFBA 2ZE6A 1IPKA 3OGGA 5FPRA 2Q73A 2PAKA 3P32A 1GOGA 3MIBA 4XUPA 1S0JA 3NV2A 4FVMA 2MPFA 2R72A 1H4GA 1QH6A 3OY8B 1UIKA 2CH7B 4LHSA 2IXIA 1FKAO 1QWRA 4RWUA 1ROPA 5I0TA 1GNHA 4B29A 3I59B 3FLTA 1E5IA 4HONA 4JKKA 2JEUA 3GJBA 4PBPA 4YJ3A 4RHV2 3ZRWA 4HSJA 4YSFA 3VD3A 1QVGU 1CIYA 2CUGA 2OIEA 3SYQA 3OMIB 2IVIB 5FZBA 2VUJA 2QQOA 3ZN6B 4Y26A 2UY9A 4WVMB 1RJ8A 4FSJA 1W6QA 1HN0A 1MPXA 5FZOB 1FMD2 2C9AA 1MVEA 3K9SA 3V56A 3H7YA 4LF4O 2E31A 3UV9A 2PHDA 2VPVA 2D40A 5FK8A 1J83A 3WXPA 4YGCA 3OEAA 1QIQA 2EX3A 1O4ZA 3TNQA 2VQFB 3OYWB 2J1UA 1G1XB 4N23A 2ZKLA 3PTRB 5CZKA 4JI8B 4INDA 2ZA9A 4XE9A 4D6RA 2BBAA 2W08A 4YW1A 4IL6Z 1UKRA 5I91A 5CYYA 2VNRA 2FDKA 3B5LB 3ZPYA 1G6NA 2ENRA 4H37A 3S5AA 1H2SB 3FAVB 5JJJB 5EBWC 3ZKUA 1XI1A 3L70H 5JJNB 2RMKB 4L11A 3DYPA 4J9YB 1F2NA 3PJYA 1OC1A 1GMMA 3C7GA 1N33O 1W04A 2XL7A 5H9RA 4CXXA 1VBE1 4V2VA 5LB6A 2ZHMA 4CCDA 4OHZA 5LY2A 2DYRB 3ICXA 2VCCA 4NTWA 3PUQA 2P6HA 1TZOA 4U7OA 2ADPA 4BHPA 1O3RA 1O6UA 1ENRA 1RHI3 2AYHA 3RYRA 1Z5VA 1YHQV 1HQLA 1VBC1 1E57A 4MTGA 3CCVV 3FE5A 3LAGA 5LHIA 2QVSB 1BVP1 1VP6A 4GWMA 4EWEA 4PDVA 1F35A 3JD3A 5HFLA 3ES1A 5EIBC 1JVMA 1SESA 1ZBA1 3ON7A 4M3CB 1VB2A 1K3EA 1UOJA 4XF9A 2YG0A 4K0KB 4B3TB 5A6ZA 4LFCB 4EN8B 5D5QA 2QE3A 2ZS6B 4X62B 1U97A 2DVAA 4X6QB 4LFCO 4Q29A 1S0IA 4EKWA 2IJIA 2XWBB 4R52A 4GT1A 4IDZA 1XYNA 5JVVA 4DV2B 4OX9B 4ZONA 2VTXA 2PYTA 2Y6LA 4LHLA 3VBHC 3LDRA 1SHWB 4BCUA 3O1VA 4W4LA 4XYXA 2MK3A 4IYHA 2YBPA 3M8LA 1CX1A 1SMVA 4AVBA 2ZHNA 5JZGC 4EZHA 2RS12 4EWAA 2ITCC 5T3NA 3RZHA 5K0UC 4R8HA 2ZHLA 2YIBD 5LGUA 4DV7B 4BXFA 3W59A 3U4SA 1Y74B 2ET7A 1GM7A 2ADEA 3WD5A 4O2AA 4NAMA 2FCUA 4DXRA 1UN1A 3V0BA 4RS5A 4KU8A 4AI0A 3K3OA 1AI6A 2CGOA 3OOXA 3WZ1A 3WW2A 3M99B 2DURA 4N43B 3E5QA 1TUEB 2RNBA 1WW5A 3JATB 1PK6B 3K58A 1WLTA 1Q6HA 4FPLA 4QMAA 1W2NA 1M93A 1AR4A 2YI9A 2HBUA 2XKPA 1FXKB 3J9SA 3H9VA 1NY71 1UIJA 4GA9A 1WLDA 4LXLA 1MZEA 4TT3G 1BZKA 1CZVA 2RS51 2XVLA 5EWSA 2GMEA 1BLZA 3WQ0A 4FPEA 1GZWA 1K5JA 1KS5A 3QCWA 4B3RB 3ETDA 3VBUA 4OI0A 3WCRA 3TEZA 3VGIA 1W2AX 3FB5C 3AZZA 2BTQA 1RUG2 3POGA 4B4PA 2PYJA 2XAJA 2Q8CA 5KUMA 5A7WB 1AYM1 5KLVH 4KP4A 2VGDA 1R64A 4BQXA 4HKOA 3OR7C 3KCXA 3VBSB 5KUKA 1ASJ2 1H8HG 5LMNB 5GLWA 2BOCC 4J7ZA 1WD4A 3AMNA 2JRIA 4NJ4A 2R042 2GBOA 1ASJ1 4IEXA 1VBA1 4QKFA 5FUIA 2PY5A 1HXS3 1GZWB 4AVTA 2R1DA 1Q43A 5DUWA 1HNXO 4GYCB 4GAZA 1TVKB 1W6QB 4CDXC 1GUIA 4BWOA 3I2FA 3CJIA 1M4UA 4F6EA 3VD7A 1BBT2 1PZ7A 1NR1A 1VPHA 4FZ0A 4DUYO 1ODMA 5ITZB 3OUHA 2TBVA 4UB8Z 1HQNA 1B35C 3BIWE 5A3PA 3ZPOA 3MLJA 3A21A 3FFQA 3OCPA 5T5OA 2WAAA 5LA0A 1LNQA 4XIOA 2C4XA 2WWUA 1ZM1A 2O14A 2R9AA 5GTIZ 1RUH2 2QKCA 3HAGA 1NCRC 3OBZA 4OHYA 3POYA 3O5SA 4M3CF 3H1HH 1KYOF 2WNEA 5A7SA 4LKDA 3PUHA 4LBQB 1R3LC 4NIHA 3ABTA 2WA4A 1SLTA 2R073 1ND2B 4C90A 4MXWB 4TWTA 5T55A 4P00B 5ITZA 4CH3A 1SZXA 4HMZA 1ENQA 1LUWA 1OLMA 2E5LO 5FPVA 1IKPA 4NKGB 1QLEB 2JEXA 2XJRA 5KHGA 1W8FA 2F4LA 3WQ7A 4IEYA 4XVHA 2UUAO 1W8ZA 2LRPA 2YXSA 1M57B 3UNPA 4G28B 1O4TA 5EIBD 1SFPA 1PIV2 2GUZB 4YVSC 3BYWA 1L0LH 4DINB 4YM2A 2JGDB 3SITA 2QZ3A 2Z42A 5JJEB 4P5HA 4CEWC 4H0LB 2PGGA 1PNMA 4LNUA 2FMDA 1YJKA 2P3IA 1AI5A 4JVAA 4GD4A 5FYTA 3P3NA 4JTOA 2WNUC 3B2EE 1OT5A 2PXJA 1SLCA 3RPQA 3SEPA 3ZSMA 1SDWA 4FFBA 3SH4A 1CAWB 4BU2A 4KG8A 3J7MA 1Q7YW 3GDBA 3SPHA 1IS5A 2FD8A 2QE7G 5EPAA 1R73A 3USSA 2Q7GA 3GHNA 3G6BA 1H9WA 3C3SA 1NZ6A 3AYCA 1G9DA 1RIRA 5A33B 1XPWA 1F4HA 5H2FZ 1WW7A 1IHMA 1V55B 3CU7A 4S2FA 4IEVA 5FWEA 3NJYA 4LBNA 3IMMA 4YJ3B 2VCAA 2OW4A 4RR3A 1VQKV 3RI8A 2FDGA 4JI8O 3A23A 2F95B 5FP7A 3ZN1A 3ZFGA 5FDBA 2EALA 3TJTA 4FFBB 3CCEV 1W9WA 2RDCA 1XNTA 5JUVA 4COUA 2ADQB 1HDJA 1YQ8A 4FBFA 4PIZA 3LA7A 3PJSK 5A33A 4B1LA 2UWAA 1P7GA 3E86A 2DWRA 4NRQA 1DTOA 5HV0A 4AHCA 3GBFA 2QTOA 4HK9A 5JSRA 2RR11 4Q4Y2 2KKWA 2DDUA 2VAUA 4NHKA 4XTMA 3MEPA 3ZOIA 4DR2O 4CP9B 3K5NA 3T2MA 4JF3A 1FAYA 3VHOA 3K04A 1C5HA 3SJQC 1LRHA 1NTZH 1W59A 2VXRA 2BVBA 5DEDA 4W65A 5IK4A 1IQDC 2PHXA 2R30A 5FZ9A 4XXPA 1F9KA 2DVGA 3F2ZA 2O8QA 1RGSA 2CK3G 2RM23 4CEYC 1ULGA 1NU1H 1AJOA 4QNHB 4BA6A 2Y0PA 4K0KO 4J25A 5IK7A 3CIHA 1DZRA 3VL9A 4CTEA 4CEWB 1TNFA 5ABJC 2E33A 5C6CA 3ZJZA 4X62O 3VZLA 5JXGA 5I0DA 3D0SA 4DXSA 1NE4A 5F1RA 3APBA 4IESA 1GV9A 1KC8W 3LDKA 4EN9B 2Z4FA 3R4SA 3MUZ1 2WWWA 4BWAA 4J1WA 2JECA 2XLGA 5LRSA 1REDA 1JA8A 4A7KA 1SETA 1SRYA 4MVRA 1PV0A 1JYXA 4FTSA 5FYZA 1MS4A 4JI5O 3PIJA 4YHHO 4YW3A 3ATGA 1OQDA 4ISRA 1V6MA 5EIYB 4H7MA 2F93B 3VKOA 3ORJA 3STLC 4YHHB 4QX8A 1V9PA 2HHHB 4XFFA 3LDBA 3AXDA 5DZFA 1XU1A 4HVRA 2V4DA 5H9SA 3O1OA 4CCCA 3ETEA 3LSSA 1C3HA 2EIEA 1AR83 2B46X 3HNYM 2HHHO 4YJ2B 5E88A 1W06A 4Q0SA 5EYYA 4FTEA 4H3WA 1QJU3 2JIGA 3ACLA 4PLMA 1GKFA 1ASJ3 5JXJA 3C7OA 2NR5A 2IJKA 4JYAO 5IAVA 2IC1A 4XCBA 3N7LA 2ARHA 5E79Z 4GKJO 1YIJV 5J48A 2HWF3 1ENVA 3CEWA 4UWDA 1FJGO 5F5IA 3B77A 2ZKOA 1GQPA 3D3QA 1YI9A 4XZPA 5HFMA 1UXXX 2QQMA 4Q0QA 1RMU2 3Q9OA 2JG9C 4HNAB 4LBQA 3ZHTA 2FZ1A 5CG8A 4WZCA 1IX9A 5F32A 5B1NA 5L3DA 1JOYA 1Q86W 3I4IA 1EFRG 1Z2GA 3PURA 4Y22B 3FBMA 1YI2V 1SDDB 4IE7A 4IEUA 1L7QA 1NYWA 1SQVH 4HG6B 4C91A 1GRJA 2XJUA 4X1IA 2QM8A 2DUQA 2ZEWA 1VALA 2ID4A 4E27A 4Y33A 5LY1A 1EUTA 1SACA 4MGTA 4IERA 5LA6A 2VQTA 5L9BA 1WA6X 1QR8A 1HNXB 1Y76B 4FFIA 3LNMB 1FYJA 1LJ7A 1VF6C 2R0HA 5F39A 2DW4A 1J5EB 1LULA 1OHFA 2VL4A 3UM7A 2EINC 4XJZA 4AE2A 1J5EO 5LK5A 2ZNIA 2Z79A 2OT7A 2QQJA 2FCVA 2IUWA 3OYWA 4OHVA 5B2GB 1O8SA 4UFIA 3OGSA 2HYKA 3V0AB 2VWKA 5AC93 4OPHA 1N4CA 3KGZA 3S3XA 2WLIB 2D43A 2JG9A 1AR73 3ZEDA 3KV4A 1HR0B 2R9IA 3IT8A 1XREA 1YXWA 4B8EA 3RVZA 3LDDA 1QHDA 4WM7B 1JI6A 1H8TA 4ZIBA 1VQMV 1FFXB 1DYOA 1BMFG 1E1RG 2HVJC 4NPMA 3H8XA 1P7BA 3OR6C 5IYZA 1ZZ7A 4TXWA 1CAUA 1WKYA 2UXCB 1LOGA 2A75A 3JARA 4L2NA 1M5IA 2ADDA 5B1BB 1ZVFA 4LJHA 3JQXA 4YW5A 5FLJA 4KBZA 4CP9A 2RM21 3SPJA 4SLIA 5KBFA 1SFYA 5CB4A 1HRI1 1ORQC 4FOWA 2BDRA 2WZPP 1AROP 2DYSB 4Q6GA 1Q8SA 1W6MA 4JQTA 5HCAA 3IKWA 3T2PA 1VAVA 4CH6A 4W4ZA 2Z5UA 1FPOA 3A0BZ 4QB6A 2A9HA 4Z1MG 1WCQA 4R8CA 1S55A 5JPNB 2VQAA 4UFJA 2QSAA 1O59A 5FFOC 2BNNA 3WG1A 4DV6O 1NR7A 4MOAA 3ZHSA 3IWZA 2F1MA 4LFBB 5FPUA 4Y5SA 1E79G 4DR7B 4TV8A 1XQNA 4AR2A 3CBNA 2BV4A 3AJYA 4NOTA 3OGCC 4O2BB 1G9CA 4Y1YA 2NLJC 1FNYA 4UV9A 4FPGA 1UU6A 3AK2A 4DNYA 4JGYB 1F7YA 3FLPA 1Q3EA 4IEZA 1F15A 3QG5A 5IW0A 4L87A 1XOUA 4O2AB 2G9ZA 4XIKA 1WB8A 1O91A 3OSDA 5C9AC 1PVC1 1JFFA 2QQPA 5F9TA 2EIKB 3BCCH 2DFBA 3E5UA 4N53B 2HJFC 4GIQA 1IPSA 1JYTA 4QPGA 4XXAA 4JI4O 3I3MA 4X20B 3C8XA 4E2QA 5J09A 5FQ0B 1RUI2 3CC4V 1GICA 2TEPA 2W3JA 1AL22 1KJRA 1NT0A 2ZXWC 5JLVA 1W05A 1QJX2 1HJFA 2BFUS 2CGPA 2W5FA 1VQ9V 4AVSA 4DYLA 1RUC3 1XNDA 4FPKA 3ZS8C 4PI2A 1TGOA 4OFGA 3WQ1A 4C7UA 4DQAA 2CL2A 3RNSA 1DQ5A 3B09A 5JIUA 1IPJA 1SF9A 3OW2U 2IJHA 1D4M2 3ETPA 1BXHA 2F43G 1YQ5A 4NE9A 4P9JA 3O1UA 1VBB3 3UK9A 1CR7A 2VR4A 3CRQA 4O61A 5JH7A 3TXSA 1S76D 3T09A 4KHPO 2EA7A 3MHZA 4LKEA 3VBUB 2V09A 2VOTA 3HJRA 1NAEA 2VZQA 3SCGA 2D3RA 4GB31 2OCCB 5FYCA 1EYBA 2JDUA 5JR7B 1WW6A 5G04L 3CJHB 1DQ0A 2XKOA 1CD3G 1CPYA 1HV1A 5DQ0A 1VQ5V 1DLCA 4GLXA 3K5MA 1HQWA 4Q4W1 1L3JA 4CCMA 1US2A 1Q8PA 3UT5B 1VLNA 4GX5A 5E1AC 1K4DC 4QJFB 4HXCA 1BZWA 2G9FA 4CPBD 1XMQO 4JI5B 2I74A 3WOGA 4U3FH 1AYN1 1ULDA 3I5DA 3OMAB 3AYEA 4XF0A 3OB8A 2PUSA 1OF3A 1EM1A 2ZGOA 5C9AA 1T6GC 2IXCA 4KGGA 1MEC2 2Y4UA 1Y7BA 4W4KA 3OTOO 4TSFG 1F8VA 1SLLA 2PA7A 1NH2B 4FXGB 3T08A 1OHHG 2E53A 3F7YC 3OPZA 5IYCO 1DQ2A 2QR4A 2AH2A 3WUDA 4ARYA 1VAKA 3VZKA 1XHXA 2XVKA 4KI5M 1QMJA 5CFCB 2EICA 2Z0AA 4OXSA 4GKJB 4DRXA 4IE6A 3ZSEA 5JVDA 3H9AA 3KQRA 5GZDA 2ZQMA 4X65O 4WVWA 1OCZB 3ZXAC 5EJZB 4LPLA 3LPFA 1T6BX 4LBLA 4YG6A 3VB9A 4DR4O 1NT2B 2IZWA 4HYOA 3CWBH 5FYVA 2H8PC 4BISA 1K97A 3N9MA 2JWPA 4I4TA 4CC6A 4DR4B 1GR3A 1OFNA 4QB1A 1MQTC 2J1VA 4E4EA 1MZ5A 1NCQA 4S2DA 4OCTA 1J1TA 1SEFA 3PHMA 2B9UA 4ZKTB 4COWA 3F95A 2ZX2A 1QJEA 3H3UA 3HKDB 3BN6A 1O8PA 3AMMA 5C4WA 4UI9L 2XT9A 4O4IA 3WW4A 3TWIA 3GB7C 2XLAA 3ZX7A 1AXKA 2EIBA 4J80A 4Y22A 1HNWB 2VH9A 2GNMA 3T0DA 3HOBA 3CC2V 3D8CA 1VRBA 3CRRA 1F4MA 3LGRA 4UFMA 2D3SA 3A2FA 2XR4A 3PUSA 2VXJA 4IEWA 3VDCA 5CISA 1OI6A 3WG3A 4QPYA 3ZMZA 4X8AA 3C3VA 1WCUA 2RE9A 1RXFA 2JG8A 1JR9A 1R1A1 1X9PA 4JTAB 2HWC1 4O4LB 2EIMC 1KEXA 2W95A 2YV8A 1VARA 2GAUA 1VBA2 2RMU2 3MUY1 3BAAA 5FO7B 4Q5OA 4ZS2A 3SCHA 4FLUA 2K0GA 2ZGUA 1CAVB 1IBLO 1W0PA 3NAPB 1ZYBA 2UUCB 4DV4B 3AKTA 3WNOA 2D6KA 3WP4A 1LUVA 1RUF2 2XHNA 4CDWB 4JGYA 4GALA 5FRAA 1QJY3 4K8XA 1YO8A 3B9CA 1OURA 1GOFA 1OXCA 2PHRA 5GLUA 2HWE3 1DGWX 2AENA 5IVEA 2P90A 1LKNA 3BABA 2DTYA 2VTXJ 2UXCO 1Y66A 3PDQA 4WFFA 1WCDJ 1W8HA 3T1YB 3VL8A 4MSWC 4AWDA 3HNBM 3IZOA 2HH9A 1CPNA 4WFHA 4JDMA 2IM9A 2XASA 1S77D 1JPXA 4QGPA 5GJ6A 5JXIA 2HVKC 1RUE1 3RWKX 4CUGA 2QTSA 5CA6A 1Y9GA 4H33A 2P3YA 3I55V 4JAVA 4JKLA 2BCCH 4CU8A 1LAJA 1R3JC 3W9AA 2C1FA 5FREA 2JDAA 5D8AA 3AX4A 3BOPA 3TETA 4YW6A 3ZYPA 4BR6A 1YC61 3VBHB 4DV6B 1UY1A 2IFRA 1I5YA 5A3NA 1AL23 4HETA 4LP8A 4NMIA 4LFBO 4JV5B 4X1YB 3AG7A 1DG6A 2WL1A 2YGLA 3NWKA 3J80N 2JIZG 2DBIA 3EFFK 3HN3A 3IDEA 3K51A 3DCQA 2V72A 3VBRC 2ZCEA 2B9ZA 4NXMB 4HZ3A 4A45A 4X66B 4D69A 4LR3A 1QDCA 2K46A 3SISA 2ZZQA 4GWJA 4ZU4A 4DR6B 4IV1A 1QNYA 2YROA 3ABMC 1X59A 1KXGA 2D3OW 1FMD1 1TMF1 2HLEA 2X29A 3JD1A 2BTVC 3ABKB 3WNNA 4NXNB 5BV6A 1GN4A 4ZPIA 1ULFA 3HR9A 4A7ZA 1QDOA 4YXWG 1RM1C 5F3GA 4CDWC 4QT6A 5FZFA 5EZWA 2VUDA 2UXXA 3B93A 1Y4MA 2LW7A 3ME2A 1YUDA 5LATA 3EHKA 2ARAA 5GALA 1H2LA 4LH7A 4DUXA 4K40A 1AR1B 4X20A 1DZQA 2H6BA 3H50A 4DUZB 4CCJA 3CSXA 4OUMA 3CRMA 3T2TA 2OA2A 2KQXA 4GKYA 3IN9A 2NMOA 5B4XA 1G8WA 2HWD1 2HJIA 1MS1A 1AX1A 3NXSA 4PHZA 1FV2A 3AYAA 5ACA1 1XYPA 1R093 4JCKA 1U5ZA 4CS4A 3JU9A 2YPDA 4AI2A 2VWJA 4FLTA 3QOPA 5ACA2 5A7QA 2JDYA 1NCQB 5DDJ2 2WINB 3FLRA 3BU7A 1WMXA 1JOPA 3JSNA 1HB1A 3FC0A 1W39A 3ZMSA 3OJBA 3HKDA 2ARXA 5LBCA 3VHNA 2DU0A 4IYIA 2DVFA 1W6OA 2E26A 2M6YA 1JYWA 5FXVA 1BL8A 3WHUA 5FCCA 1LENA 2Q8EA 4MVUA 3WDYA 1OH3A 1OCRC 4X1IB 1Q8OA 4EROA 5DMYA 1OOPA 3FD9A 4EYUA 1DGRN 3CD6V 1C8NA 3LCPA 3I3DA 5HBAA 4UFZA 5A6QA 1Z5WA 3ZFEB 3KSCA 3AP5A 3JB4C 5KXBA 5LBFA 3TEWA 5CKNA 2CTPA 1US6A 5LP6B 4C1WA 1F23A 1ACCA 3KV9A 3J8F1 3WINE 4BIZA 1Y43B 1C4RA 4PDWC 3ZRSA 2O8OA 4RO2A 2A71A 4DV5B 1GKBA 3HKEA 3ZSLA 5IJRA 1MSDA 2FMLA 4XDLA 3UO2A 1YRZA 2ZDIA 3BRCA 4DXWA 4K20A 5IT6A 1V70A 4X65B 3M7MX 1JZ3A 3B3QE 1XE7A 1EY2A 5BNOC 5JOWA 1EUUA 3T3YA 2H0BA 1KUQA 2D97A 2JGUA 4W6YA 4LKFA 1RUH3 1YIPA 3GZAA 3ZXFA 2W0FC 1W0NA 2Y38A 4MGZE 3OEHG 4FOYA 4Q4X2 1ZRDA 2VVDA 5J36A 3ACFA 2DYSC 2W47A 4MW8A 1FPN2 4GX0A 3WDXA 2ZHKA 1RFYA 2ZXWB 1ZSPA 1EP0A 1H1IA 4XETA 2P4VA 4EEQA 1H8TB 2R062 1OCCC 5ABJA 1H4HA 1I94O 2D3PA 2M7WA 5KHJA 3AP6A 4DRXB 3SJCC 1PGSA 3AP9A 1CAUB 1DGSA 1V0AA 1FOD1 3FB6C 1AL0G 1W6MB 4X64O 1AXZA 2H0VA 2QQVA 2RS13 4IT5A 4OZOA 1W9SA 4MO3M 2ZD9A 2V1DA 4YZ2A 3THTA 5CB7A 1AJPA 1V55C 1S72V 4EE2A 2LROA 1W8OA 1NZCA 4Z2AA 4ATEA 4MGIE 1KFXL 2I45A 4A5UB 3N7MA 3WB1A 4YYOA 3ZSJA 3O1PA 2UUBB
chains in the Genus database with same CATH topology
1TME2 3L2HA 5JZGC 3LOIA 1XNBA 3VV1A 2RS12 3POWA 2VW2A 4M27A 3J26N 4YVWA 1REFA 3TYJA 1X33A 4EWAA 5T3NA 3EXUA 3JBG1 5K0UC 4GMP1 4R8HA 1CJPA 2ZHLA 1UZZA 3QH6A 1AL21 4EWDA 5JWPA 3W59A 3ZN5A 3VBRB 3RG0A 2ET7A 5GKAC 1V9U2 3WD5A 1RC6A 1RITA 1UN1A 2XJVA 3N6WA 1NCRA 3V0BA 4RS5A 4KU8A 5JOXA 2ZX0A 4AI0A 4WM7C 1OPOA 2IXHA 4I0AA 4MYEA 2CGOA 3WZ1A 4MH0E 3ZFEC 3WW2A 3WNXA 4Q4X1 1QOSA 5TSWA 2DURA 2VY0A 3ZFGB 1N1SA 3RS6A 1V6IA 2VNGA 5K7PA 1IGOA 1ULEA 1XE8A 2PHFA 4N43B 1WBLA 1AR63 3T1MA 1UAIA 4OI4A 3E5QA 1PO22 2ETEA 1WW5A 5GLTA 2E6VA 5FBZA 1WBFA 2GDFA 1PK6B 1ZBA2 5FOJB 3FHIB 3LA3A 4Y20A 2GMMA 1WLTA 4QMAA 3PMSA 4FPLA 4PDWB 2DF7A 2MEV3 4Q1PA 5JAXA 3ZYIB 1I1EA 2XKPA 3R1JA 5J7MA 3J9SA 4QPGB 3S6PA 4FPFA 1NY71 1UIJA 4KNCA 4GA9A 4BMBA 1WLDA 3MF9A 1MZEA 3V15A 2FHRA 2VULA 4LNVA 2R49A 1TMF3 5KC5A 4G3YC 1GZ9A 4IV3B 1RUG3 4COZA 1RUF1 2ZPXA 1NQDA 4HBNA 3E97A 3AKSA 4CEWA 4HZFA 2UYAA 4XHXA 2RS51 4Y1VA 2XVLA 5BNOB 5EWSA 1PO21 4M23A 1PO12 2A6YA 3ZYRA 2GMEA 2PAMA 2QJVA 4Q4W2 1A8DA 3WQ0A 3AMPA 4FPEA 1UX6A 2QZ2A 1YCIA 1GZWA 3RMXA 2D6LX 4RA0A 2HEVF 3PVNA 1KS5A 3QCWA 4P9IA 3MFCA 1GQHA 3KB5A 5AFBA 4YM3A 1GFF2 1LTEA 1NX8A 1W6PB 3VBUA 4U2AA 5D1IA 4E2SA 4ES8A 4Z07A 4OI0A 2XJSA 4LR4A 3WCRA 3ZXDA 1OKQA 4N9HA 3BCWA 3AP4A 3VGIA 3N36A 3AZZA 1BMV2 1RUG2 1OLQA 4AG4A 5DUXA 4B4PA 3OTFA 1RUJ3 1HDKA 3GNEA 1B09A 3ZIWA 1C57A 3NVCA 1AYM1 2VGDA 4HKOA 1Q8QA 4W6WA 3KCXA 3RDIA 3VBSB 3FJSA 1ASJ2 4CDQA 4K1YA 4XILA 5GLWA 4Y1UA 2HWC3 3VN4A 1WD4A 3AMNA 5BNPA 1AHSA 3RJRA 2R042 2RM22 3L9JT 1ND3A 4HT1T 1ASJ1 4IEXA 1VBA1 4YW2A 5LEJA 3ZXEA 4ES9A 2ZGRA 2WBQA 1LOFC 3THPA 2VOKA 2G9GA 5IUQA 3HT1A 2VU9A 1HXS3 1GZWB 4AVTA 2R1DA 3UJOA 1LECA 4I2OA 4PLOA 1Q43A 3ZXGA 4QM9A 5DUWA 5C8CB 2EVXA 5L73A 1W6QB 2DYCA 1O3SA 4CDXC 4C0HA 1QXPA 4S2GA 4BWOA 2CNAA 5KXDA 1W6PA 3N3HA 4JGYC 4Q2FA 4LO6B 1R1A3 4KWLA 3CJIA 1MZ6A 2R063 2P17A 3BPZA 2CWSA 2E7QA 3JBG3 1WCKA 1BBT2 1F5FA 3ILNA 1ONAA 1PZ7A 1VBD2 4DOUA 4B3NA 1OIJB 2Q1MA 4C5WA 4HFSA 3E6CC 1DS1A 3KT1A 2D5HA 1EV12 2TBVA 3INAA 1HQNA 1ZBE1 4QQ2A 1D2QA 1B35C 1BJQA 2Y26A 3BIWE 1V9U3 4E4DX 3O14A 3VBHA 4N53C 3VBFA 3WP5A 3MLJA 1XU2A 3FFQA 3H8UA 2RS31 4HVQA 3OCPA 4BGMA 5T5OA 3N7JA 2NN8A 4UBHA 1MR5A 5DG2A 4XIOA 2FMYA 4XJAA 2E9QA 4EN7B 2ZGQA 5CFCC 3GHMA 1ZM1A 5JSPA 3AZXA 4FOQA 4BZ4A 4LTAA 1RUH2 1F31A 1U5XA 2K9ZA 3HAGA 3MPBA 1NCRC 4OHYA 3B00A 2LALA 3POYA 2YC0A 1OIHA 4YW4A