4LF6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf6O00
4AQYO 3JAMN 1N33O 4LF5O 2AGAA 4OPHA 4B3MO 4KHPO 2ZM6O 1R1BA 2FKXA 2E5LO 2HHHO 1HNZO 5FLXN 4LF4O 4DV3O 1XNQO 1I94O 4GKKO 1N34O 1HR0O 2ZKOA 2UU9O 4B3RO 4LFBO 4YY3O 4JI0O 4LFCO 3J81N 1XEQA 3J7AU 1N32O 4NXNO 1NS1A 2VQFO 4JI2O 1FJGO 2UXCO 1FKAO 4X66O 4DR4O 5H5NA 2UUBO 1FYJA 3RT3C 4JI4O 1KUQA 1IBLO 1IBKO 3F5TA 1J5EO 3SDLA 1IBMO 4JI7O 4LF8O 4JI8O 2JRIA 4DV7O 4X64O 4DV5O 1HNXO 4OX9O 4JI6O 3M8AA 5IWAO 4DV0O 1D2DA 4DV4O 4B3TO 3T1HO 1AB3A 2Z0AA 2N74A 1N36O 4DUYO 2LW7A 2UUAO 4OPAA 1AILA 4X65O 3O65A 2DOSA 4X62O 3J80N 4DV2O 4GKJO 1X59A 1YZBA 4DUZO 2F4VO 4A5UB 4LF6O 4K0KO 4LF9O 4JI1O 1XMQO 4JV5O 5A2QN 1F7YA 4DR3O 4DR2O 5BXZA 2UXBO 5LMNO 3T1YO 1G1XB 4DR5O 1XMOO 5BY1A 4DV1O 4YHHO 5LL6Y 1A32A 5LMUO 4JYAO 5BR8O 1XNRO 4DR7O 2VQEO 4JI3O 2UUCO 2UXDO 5IT9N 4NXMO 4DR6O 4DV6O 3R66A 4DR1O 4JI5O 2DJVA 1HNWO 4LF7O 4B3SO 4LFAO 3OTOO 1DK1A 1R6TA
chains in the Genus database with same CATH superfamily
1FXHA 2Q8VA 1M57B 3RVZA 1PNKA 2WPDG 2FKXA 1DTOA 1IBKB 1QVFU 2EZPA 1Q5OA 3BAAA 1K5QA 3CB2A 2QR4A 1L8DA 4PA9A 4KL1A 4JTAB 1NVPD 1MG1A 5LA6A 1Q7YW 2BCCH 4J42A 1FXKB 4JASA 3O9OA 4I0XB 1PL0A 1H2SB 1QLEC 3GWOA 4NYKA 5C8YA 1TVKB 2RMKB 4YIOA 2ITCC 1KP3A 4OX9O 1RPRA 4JAUA 1NT2B 1WP7A 2ADPA 4HYOA 4B3TO 5CA1B 1SRYA 4K0KB 3JASA 1AR5A 3OFNG 2QA4V 2GBOA 5KMGB 4X1IB 4IT5A 4CH4A 4DUYO 1H2NA 2ZCEA 4OPAA 4ASUG 1AILA 3BABA 4C7UA 1GM7A 4GZRB 4JTCB 2IM9A 4I9QA 4X20A 2R72A 3SJCC 5IYCO 1XMQO 3GB7C 4NTYA 3D36C 4B3SB 4DXWA 3JARA 5LHGA 1NH2D 1VQMV 3JD1A 2K9PA 3X2QB 2ZNIA 1IVSA 2H94A 1K34A 1NH2B 3M7MX 3HKEB 2Y0IA 4LWSA 5KAIZ 4PA3A 2UXDO 5IYZB 2EIMB 4DR1O 1LUVA 1GO3F 4LBEC 1Q6IA 1R3LC 2YI9A 1FXVA 3UT5B 2WAMA 2JS5A 1V9PA 4KHPO 4D7TA 3FD9A 1M56B 2HHHO 1F23A 1SA0B 4DV3O 1VF6C 2CDYA 4JI7B 3WB1A 3ZMUA 4AHCA 1XQ8A 2XASA 3J7AU 1JA8A 4DRXA 4LH6A 1DF5A 4DK0A 2ZNJA 3EVKA 2QWNB 3G80A 1B3QA 3E22A 3H1KH 4DR4B 1IBKO 3CWBH 1VF5B 2OCCC 4ZI7A 5TISZ 2XNDG 1Q81W 4J10A 1NZ6A 2EJ7A 1M9NA 4DV2B 3LDCA 5L3CA 2Q68A 1P7BA 1ZLZA 3ZRXA 1AB3A 2B9ZA 4JI1B 1V54C 2YDEA 2ZXWB 4TQFA 1AJPA 3K57A 4YIPA 4RQEA 3IAYA 4UCTA 4TWKA 1B06A 5IY5C 1MMMA 4UCOA 3WG7C 5LOVB 1IZ3A 3N2KB 1AJQA 1DF4A 2YXHA 4DR7B 3SPIA 4ZBMA 2JK5C 1UPGA 5JJNB 4K0KO 3E8HA 1HNWB 1TUBB 2ZQMA 1OCOB 5BXZA 5J2UB 3ETGA 1LR1A 4DR3B 3K0DA 2JGDA 5IDJA 4BAYA 4DO2A 3FKSG 4O4HB 5KUMA 1M5IA 1K97A 4LF7O 4B3SO 5KHGA 4TV9A 1L1FA 1I08A 4X1YB 3H9VA 2X0LA 2QM4A 3CRRA 2VQFB 1CP9A 3OE7G 4WF9V 2AGAA 5B1AC 3SJBC 3SYPA 1OCZC 4X9QA 4H33A 4J7JA 4RAIA 3JD3A 4KP4A 5EC1C 5J2TA 2ZKOA 3MHSC 1TGOA 1SS3A 5JH7B 2YS8A 3OEEG 3CC7V 4B3RB 1JQ0A 4ZHQA 1SZTA 4NTWA 3OMIB 1Q90D 4TUYB 2Z5UA 1SETA 2N04A 2WA3A 2F93B 2UXXA 4U7OA 5IJ0A 4JI7O 3CE2A 3AG7A 3APOA 5KA6A 3L72H 4K3AA 2V1DA 2WLIA 5DECA 3RYFB 1Z5VA 3K5NA 2Q9LA 2N05A 4TQDA 2NLJC 3ZRVA 4BWAA 4FLTA 1MOFA 3G71V 2IU3A 2V4DA 2QTOA 4NVPA 2LJ2A 5LP6C 2LW7A 2A7WA 3FB8C 2JEXA 4TV8B 3ETQA 3U0ZA 4UCUA 3K03A 1QLEB 5KHHA 2BTOA 3NR7A 5LMUB 2GSMB 4ICGA 4DV2O 4I55A 4GLXA 2CTRA 5KHJA 1VQ9V 1VQKV 4DR6B 4JI1O 4P2ZA 5A2QN 3ZRSA 1WB8A 3CRCA 4I4TA 1OHHG 4R7CA 2P5OA 3E8FA 4FLVA 5L3EA 3EXAA 2KQXA 1HDJA 1XMOB 2EIJB 4DR7O 1MABG 2X6CA 4DV1B 4JZ2A 1N34B 3AG1B 4P30A 4MVRA 1VQNV 1GN3A 1HNWO 1R3KC 1H2KA 3Q4HB 3LSUA 4LF5O 4O2BA 1ZX3A 4J11A 5DN6G 3SYCA 3ZJZA 1J5EB 4U3FH 4Z1MG 4AILC 1O9HA 1FXKC 1I94B 4J7KA 2IU0A 2JVDA 1WLEA 3JD4A 1P49A 2VQFO 2CGNA 1FKAO 4LNUA 1XUQA 3HR0A 1HW7A 4F4LA 1FJGB 3RT3C 4WFAV 2WA4A 2PY5A 2PI4A 4I5SA 5GONA 2DMXA 3G67A 1BT8A 3RBZA 1BMFG 3WB2A 3K5MA 3F5WC 5LYJB 1S72V 2DYSB 1AR1B 4E4EA 2PZSA 3B8MA 4GX1A 3RYCA 5K1XA 1YI2V 2R9AA 2BOCC 2N74A 4D6TH 2BSKB 1EN6A 4P9PA 4MTFA 2XTAA 3LDEA 1GM8A 2ZR3A 1JR9A 1SZXA 3UKMA 3O65A 3QO8A 2OCCB 1FS0G 4FK5C 5CA0B 1YHQV 3X2QC 4RUFA 1EM1A 2IJHA 3ZRWB 4YJ2A 4X1KB 5KHKA 4PDVA 3G6BA 1S5LZ 1V54B 3OT7A 5LXTB 3DC5A 5LL6Y 5LMUO 1HP8A 2KG7A 3UCSC 2EIMC 1L0NH 1VQ8V 2EJRA 4DR6O 3SPHA 5IY5B 3R66A 4JAAA 3ZMVA 1JOYA 5IJ9A 4FM2A 5AG2A 5JWPA 2IH1C 1UJWB 1EZJA 2O57A 4GYCB 2ZE5A 2Y4TA 2QDOA 5CMUA 1N34O 4RUEA 1Z2GA 5DEDA 1CEZA 4RO2A 4WFGA 1WP8A 1X4TA 4LC1A 2AW9A 4KFMA 2YEVA 5LBQA 1DLBA 5GW7A 3AK2A 1J5EO 1KKDA 2HG5C 3LSQA 1Q43A 1F51A 1FFXB 4NR1A 1WA8B 2Q0AA 1BQ0A 2WSSG 4O2AB 4GKJB 1D2DA 2B1IA 5B1BC 2ZXWC 1K73W 2F4VB 2XT9A 1P7GA 1I0HA 4DW1A 1WPBA 2Z0AA 2A0LA 3JCZA 3FX7A 1GTOA 2RDCA 4WBNA 4MTGA 2FL4A 4Q20A 4IHJB 1M93A 1XILA 1AI7A 4JYYA 5EYPB 5L3DA 2FYUH 1WNSA 3H01A 4F6RA 3HKCA 1WAZA 4FFBB 2ZINA 1F4NA 5JQGB 2GUZB 1SQQH 5EIBD 3T4ZA 1NJIW 3OD4A 5LP6B 1VF7A 1MSDA 1TA8A 2VWKA 2WLLB 4LF4B 4JPRA 3SYQA 4F6EA 3JAKB 5IYBO 4XDLA 3HKBB 2UU9B 4YY3B 3A0RA 4QIWF 1Q6HA 2RCVA 3B4SA 2PGGA 1R6TA 4FLWA 3L73H 3QNEA 3K58A 2ZD9A 4FM0A 4OPHA 1W0KG 2JEUA 3OM3B 2HFEC 1CXZB 1RP3B 4JF3A 1VEWA 3CHXA 4JI8B 1OV9A 4DV3B 2P06A 3N2KA 4JI6B 2C2AA 4U7NA 3JATB 3J81N 1W59A 4NXNO 1YSCA 4UV9A 1THZA 4B7KA 1SQBH 5C93A 5B1OA 1P4RA 4LF8O 2Y48A 4H44B 2IW5A 5CB4A 1YJWV 5H6RA 1G4YB 2AHZA 4YXWG 1AP5A 1H8HG 1VQ5V 3OR7C 2R9IA 3CCEV 1PM9A 3P32A 1RSOB 4O4IB 1PKXA 2DQ3A 3DXRA 4HBNA 2DQ0A 1NTZH 3WB0A 3CEIA 4FPPA 1NVPB 3VBBA 1VQPV 2QEXV 3BHPA 5A9GA 3ICXA 2QKAA 3F7YC 3ZX6A 2IJIA 2QGNA 3AG2B 4GKJO 1G6UA 2F4VO 1EZVH 4FZ0A 3JD2A 1K33A 4MVOA 3STZC 5K1PA 1GM9A 2E76B 2HVKC 3H1IH 1SQVH 5LMNO 3T1YO 4IYHA 3E89A 2EIJC 3IC9A 3JAWB 1SERA 3AG1C 4JYCA 1J95A 1Y67A 4OGQB 1NBMG 3RVYA 4FVMA 5CN0A 3ZN1A 4NXMO 4IIJB 2P4VA 2YUAA 3OW2U 3P30A 3RYFA 4MTXA 2FMLA 4LF7B 4CC6A 2M7WA 3CJHA 4X8AA 1IDSA 1Y74A 1R1BA 4EB6A 4LF4O 5B5EZ 3ZMZA 1IBLB 4UVBA 1IBMB 3OMAB 2A06H 4PI2A 4TV8A 1AI6A 1PPJH 3F7VC 4DV7B 2UU9O 4X64B 4DV5B 1GN2A 4YY3O 4GX2A 2HLDG 3T1CA 1XI1A 3CXHF 4UFZA 4BIOA 1K7DA 2EULA 1SQGA 1H2GA 4U3JB 4PA4A 5F2VO 4JI8O 1BZKA 2PUSA 2DYSC 4JI6O 4H13B 3ZHTA 4X62B 1E1RG 2CE4A 3JD0A 4DUZB 4LP8A 3RYIB 3OR6C 4UV8A 2YICA 3QO7A 1XL4A 1W0JG 2LGWA 2ZE7A 1TUEB 3D36A 1JJOA 1NKDA 1OCCB 3KCYA 1AVMA 3L71H 4ZOLB 3RWRD 3D8CA 1BGYH 2Y69B 3K5LA 3EHBB 3R65A 5B1BB 3WFVA 3C3TA 2PTMA 1A32A 2OIEA 5GTHZ 2ZDIC 1XNRO 3FFQA 1HNZB 3FB6C 5IT9N 3TGUH 5KAFZ 3K3WA 2YIBA 3ZHRA 1VF6A 3OUFA 2JJ1G 5LYJA 4O4JA 2YIAA 1SQFA 1QCEA 3JALA 4YJ3B 2UUBB 4MS2A 1XBLA 4FJCC 1ZL8B 3ZBHA 4LF5B 2IBZH 5L3FA 2EX3A 4FM1A 4O4LA 3MD0A 3TCUA 5CA3A 5ITZB 3OEHG 3H1LH 1NS1A 5CA0A 4J41A 3CXCU 1WPXA 1IBLO 3CCMV 4ZKIA 1IBMO 5KA5A 2BTQB 2UUAB 2G38A 4DV7O 4X64O 4DV5O 1YTFD 5LXTA 5LA6B 1OCRB 3BVOA 1QBZA 2XAQA 5J9PC 2W0FC 3MHHC 3TJTA 2Q69A 3CPWU 2AZ2A 4WFBV 4R50A 4LF6B 1N0JA 2BOBC 3BA8A 5C8YB 4JAVA 4GX5A 2ZIOA 4FLUA 2YI8A 1O9GA 1PP9H 2UXBB 5LHIA 2PYLA 1S5HC 4WFEA 4TSFG 2OYQA 4X62O 1X59A 3JASB 1YZBA 5LGNA 4CH5A 4DUZO 3CC2V 2LQTA 2Q6AA 2H3OA 4K8ZA 2CK3G 2E74B 1KQSU 1R3IC 4HNAA 1G1XB 2P22C 1T5EA 4UUJC 1K9MW 5JVDA 5EIBC 2WLMA 1AI5A 3A0BZ 2CH7A 4AI8A 2YXLA 2FTKA 4Q6GA 3JARB 1US6A 2B5UA 4LFCB 4I50A 1B6QA 3OMNB 1N33O 1YIJV 4XBFA 2Q7GA 1QQCA 5EK0A 3HB3B 3FB7C 3MAQA 1HNZO 5FLXN 1Y4MA 3SYAA 4BR6A 1Q6UA 3DSQA 2B1GA 3M99B 1HNXB 3LUTB 2LP7A 3APQA 1BSMA 4MT8A 3FAVA 1GAXA 3AK3A 2RQ6A 4DV4B 3B77A 3BCCH 2UUBO 4K8XA 1IXBA 4KUMA 3CYOA 2F1MA 4NKGB 3CC4V 1N36B 3OGIB 3ASOC 2P6JA 1KYOF 2OWOA 3GWKC 1S76D 2HJFC 2EINB 4X65B 3M8AA 5LP6A 3UO2A 2P7TC 3L75H 4MVMA 5L3GA 3VQXA 3K5OA 3L70H 4BW5A 1KU9A 2QKSA 2UUAO 1OZ0A 4PDRA 1U96A 3AG2C 4RWUA 5EBWC 2P4KA 4MW8A 2L35A 3J80N 2WWWA 2IJKA 2YIDA 4LF6O 4DV6B 2HJDA 2LGQA 3CCUV 1LUWA 3EFFK 3JATA 3OTOB 1UFIA 4KXRA 2UXBO 2LFRA 2YXYA 2ADQB 2ZT9B 4CS4A 4PJ0Z 4CH6A 3U10A 3OTFA 3BY6A 2A3QA 2Q7EA 3S3WA 1VP7A 2QJ1A 3D3QA 3ZN0A 1XNQB 4GKKB 1HR0B 1MZEA 1K8AW 2CTQA 4RQFA 4LFAO 3JSNA 3W7WA 4JI2B 5KLVH 1FXKA 3W7XA 4O4IA 4JYBA 1U97A 3CCQV 1JVMA 1NI8A 4CH3A 4I0XA 3SPCA 1PNLA 2W0XA 1TVKA 4EKWA 4TV9B 1G8MA 4LFCO 1Y6XA 2KSDA 2AXTZ 2UXCO 3RW0A 2F23A 3FYEB 3P3NA 4L87A 2ZE8A 5CA1A 4NXNB 1FYJA 1AR4A 3H1HH 3DC6A 2GHYA 4JI4O 2X6BA 1RM1C 2XHBA 4GX0A 5KMGA 4X1IA 3SDLA 3C90A 1BE3H 4EFEA 3ABLB 1HNXO 4LF8B 3SGIA 3JAWA 1NQTA 1MSWD 1VQ6V 3B09A 1H38A 4ZHQB 1FPOA 1K92A 4DV4O 4IIJA 4PA7A 4DW0A 3KG2A 1QR9A 4JV5B 5IJ0B 1N36O 5FNVB 1ZUQA 2PYJA 4OXSA 1OCCC 1VQOV 1S77D 1M4UA 4X65O 3CCLV 4DR5B 4CC5A 4W4KA 2DW4A 3ZHSA 4PA6A 2L6LA 1AP6A 2Y69C 1BCCH 2HVJC 3W7SA 3HKEA 5IYZA 2QKCA 2JJ2G 2EILC 1BS3A 2Z3YA 4JTDB 1ENVA 3UT5A 4U3JA 5LMNB 3T1YB 5D5PA 4I55B 3P3PA 3B2EE 5BR8O 2VQEO 1SA0A 1WJZA 5FPOA 3ML0A 4DV6O 2HP8A 3BPZA 4CS2A 3K9SA 4I4TB 1JFFB 1S5JA 4NXMB 3OTOO 3UM7A 5JCOC 5IE9A 5EBMC 2CAZC 3D3IA 3ABMB 2ZR2A 3CCRV 4GT1A 5KUKA 3PN1A 1KBHA 3CD6V 1XNQO 1LNQA 4GKKO 3L74H 1FAFA 1HR0O 2X6AA 3BFRA 4G27B 1GKFA 1EN5A 1EBOA 4EFBA 1Y76B 4ZOLA 4JI2O 4WFHA 4GUNA 4O2BB 4WFFA 1ZWIC 2MW2B 1R73A 1SQPH 1KUQA 1QVGU 3N27A 1OCRC 2W6JG 3SPGA 2QWOB 4K35A 2HKOA 3ZEDA 4QE7A 4D7SA 4NTXA 5LOVA 1FFTB 1YEWA 4LNUB 1XDCA 2RNBA 3T1HO 4EEQA 1MA1A 1GN4A 3OGCC 5GONB 4ABMA 2HEPA 1TUBA 4DR2B 1E1QG 1VQ4V 5J2UA 2XOKG 3CMAV 5FPRA 1ZL8A 1M1KW 1PNMA 4BW9A 3ASOB 3ASNB 1WN7A 4JI3B 2JGUA 2P90A 2UUCB 2Q7HA 4O4HA 2DYRB 4JV5O 1JMKC 3CSXA 5ITZA 4PD4F 4X1YA 1EFRG 1H2LA 3KKYA 3ABKC 4DR5O 1PL4A 2KKWA 2BTQA 2LW1A 3W7TA 1XNRB 4FZ1A 4FLXA 4PELA 1COWG 4YJ2B 1DK1A 3I5DA 1N32B 5JH7A 5KHIA 1RPOA 3ETEA 1VARA 2KG7B 1AJNA 4FLYA 2OCHA 1N8RW 4TUYA 3N2GB 4I9WA 3AG4C 3IJ4A 5IJ9B 2ZIMA 3G4SV 1FD9A 5D5QA 1XEQA 3K04A 3RYHB 4LR3A 5CBHA 1MZFA 4UCVA 3CRAA 1ZSPA 3AG3C 2X7RB 2QWPB 1CPYA 5BMVB 2EINC 3U11A 2AZ0A 3IC7A 2YEVB 5EZYB 2CUGA 3ABUA 3TXQA 2Q67A 1ZAUA 4L8JA 4UVCA 2OIGA 2QM7A 3QF7A 5H6QA 1D5AA 4J80A 3CCVV 4B7EA 2WLHA 5L3BA 1YJNV 1URFA 2XAHA 3TXSA 2ODMA 1RM1B 1ZTEA 3UO3A 3ZMTA 2H8PC 1XOUA 3H1JH 2R9RB 4A5UB 4DYLA 3LNNA 3ZHQA 1KP2A 5KX5B 3SR2C 2Q0OC 3HKDB 3SYOA 4DR2O 4WBNB 1K3EA 4QJFB 3Q4HA 4AQYB 3E8BA 3STLC 4Z1VA 3HPLC 4B3MB 3THOA 4Z2WA 2Q73A 4F6RB 3HKCB 2E5LB 4JI3O 2JIZG 3MDSA 4DK1A 3T2MA 2UUCO 2ETNA 1RFYA 2DJVA 4JI0B 1R6NA 1DGSA 3DTUB 3JAMN 2Y0PA 2VWJA 1QR8A 2D3OW 2EILB 1N33B 1GH6A 2DE0X 3ZS8C 1BHAA 2PF4E 2F95B 4N21A 1AROP 3VQYA 1QNMA 4X89A 5LGTA 3VOUA 2E3CA 5IWAB 3S3XA 4NB5A 1N32O 1PV0A 5H5NA 2GTSA 2YC0A 1V55B 3OUSA 2DN9A 3ABLC 2NN4A 3F5TA 4QNHB 3VQWA 4PHZA 2BSKA 3QVNA 4QGPA 4P9OA 2GDSA 1NTMH 4XDJA 4BIUA 4MVSA 1HWYA 3UQ8A 2KB1A 1VQLV 4LF9B 4IGGA 3C3SA 3AK1A 4UVAA 4FFKA 5B66Z 1YCIA 1TAEA 1Y66A 5CB4B 3ZRWA 4X1KA 3FB5C 3CRMA 3RFRA 1YJ9V 5B3SB 3I56V 2XAJA 4CS3A 4UB8Z 3NXSA 3SJAC 3CRQA 3L9DA 3DXRB 4WCEV 2ZDIA 1BQZA 5FL7G 5H9CA 1YTFB 1YVWA 1NU1H 2Q5ZA 5HFMA 2R70A 2NNUA 3IFXA 3E2EA 2WLKA 3E35A 1M90W 3CCSV 4LH7A 4TT3G 4G2KA 4HAMA 2ZM6B 3CMEV 2VS0A 3WU2Z 2QWQB 1W2BU 2A79B 2QSAA 4MSWC 3KZIZ 3ZMSA 4LFBB 1R3JC 2YSUB 2A9HA 1PD3A 3CP1A 3ABMC 2IH3C 2JDIG 4AQYO 4LFAB 5JJEB 1N0NA 4J9YB 4CBCA 4FLZA 1ROPA 4B3MO 2E5LO 5FNVA 2MK3A 1P84F 1F4MA 3ABKB 4B08A 5E1AC 4X20B 4JZGA 4FMTA 2HR3A 1FFXA 2AHYA 4JI0O 2LFSA 2M6YA 3FYIB 1NTKH 3CJHB 1WA8A 1S0VA 3B40A 4O2AA 2CTPA 4UB6Z 5EC2C 3ZHUA 1Y74B 4HZ3A 4DR4O 4EB6B 2WLNA 2UXCB 1KKCA 3PJSK 2XUMA 3A2FA 4J7ZA 5IYDO 4LWSB 1KD1W 4JI4B 3CS5A 4UCRA 2RJZA 3ZIAG 1Q86W 1N4CA 1JJ2U 1GK9A 1Q8IA 5IWAO 2P67A 2OT5A 1QLNA 4IHJA 3BRCA 2EIKC 3AG4B 5EYPA 1JFFA 4FFBA 1I5YA 3LSSA 5JQGA 2GUZA 2ILMA 4R6ZA 2FB5A 3AG3B 1SESA 2BE3A 4W4LA 3ASNC 2UXNA 2DOSA 2JS3A 4JYAB 2DYRC 4DRXB 1SF9A 3TK1A 3K59A 2WLLA 4LF9O 1M57C 3JAKA 2QE7G 4JI5B 4PI0A 1WB7A 3HKBA 4DR3O 1Y76A 3JSLA 3E22B 1R6KA 2ATKC 1VMGA 3RGBA 4ZI7B 1NR1A 2OTJV 2ZE6A 3JCUZ 5H2FZ 5LGUA 4E2LA 1OJHA 5BR8B 1VQ7V 2VQEB 1GRJA 4PDMA 4MVQA 1K4DC 5HFLA 4QE9A 5B1NA 3ETDA 4TOIA 2YIBD 4X66B 2W6IG 3BA9A 3OAAG 2CGOA 2ZM6O 1QU7A 2RN9A 2E75B 1YXBA 2ITDC 1K4CC 3K79A 4B3RO 4LFBO 1Q82W 4R8CA 3IGAC 4X88A 4O4JB 3KCXA 4DV0B 1XL6A 3DGEA 3JALB 3ZCCA 3W7UA 1SKVA 2JGDB 4MW3A 1RSOA 1KMIZ 4MVUA 3LDDA 2NR5A 4H0LB 4O4LB 2JRIA 3T4DA 1GN6A 2Q4PA 3ZHVA 1H8EG 2DWEC 3RN4A 2GV9A 1GMGA 3T1HB 2EBOA 3TETA 1IX9A 4CZZA 5DM6V 1YITV 5EBLC 1D5NA 1MNGA 2PI5A 4BIZA 5J2TB 3I55V 5JJJB 3ABTA 4YHHB 5E79Z 3N2GA 3AEIA 1SQXH 3WG7B 1Z5WA 3QG5A 4LCUC 4QPJA 3SPJA 2GTAA 4UCSA 2LO1A 3RYHA 1QHTA 1BL8A 4GCZA 1M56C 1XHXA 1EN4A 3QO5A 1XMOO 3A8TA 5BY1A 4DV1O 2WLIB 4JYAO 3K9AA 5BMVA 4H37A 3A0HZ 3K0GA 1JCHA 5CBFA 4JI5O 2QM8A 4HNAB 5EZYA 1XREA 1YF2A 4MVZA 1ORQC 1KECA 5JVDB 2F43G 1SC5B 1VIBA 4IYIA 2CH7B 2XAFA 2CTWA 5B1AB 1I94O 3QTCA 1OCZB 2K1EA 4OX9B 3GVMA 4I50B 2DWDC 1S3JA 1V55C 4ZIBA 1FJGO 3E8GA 4G28B 4B3TB 5GTIZ 4X66O 4N23A 5KX5A 4PV1B 4MTOA 3RYIA 3HKDA 2D2CB 4DUYB 2WLJA 4J9ZB 2VRZA 1JPXA 1K5SA 2OTLV 3FAVB 1JX9A 1BHBA 4XDKA 4DV0O 2Y4UA 1Q3EA 1H2MA 4FIPC 1OCOC 4PDLA 3VQVA 4JGSA 1XMQB 2XAGA 1YDXA 2IJJA 3G6EV 2QWRB 5B3SC 3CCJV 4IL6Z 4QPKA 3E83A 5CBGA 1L0LH 2EZOA 5LHHA 5BZBA 3CX5F 2UXDB 1IXMA 2QTSA 3LNMB 1I7FA 4DR1B 1XHZA 2F66C 1F7YA 1IURA 2EIKB 1KB9F 1I5XA 3K08A 1E79G 5JCOA 3K06A 1AI4A 4YHHO 3B8NA 1NR7A 2ARHA 1B04A 4YJ3A 4KHPB 3JYCA 4I7ZB 2HHHB 3BEHA 4UXNA 3SJQC 3RYCB 3E86A 2V7QG 1KC8W
chains in the Genus database with same CATH topology
4AQYO 3JAMN 1N33O 4LF5O 2AGAA 4OPHA 4B3MO 4KHPO 2ZM6O 1R1BA 2FKXA 2E5LO 2HHHO 1HNZO 5FLXN 4LF4O 4DV3O 1XNQO 1I94O 4GKKO 1N34O 1HR0O 2ZKOA 2UU9O 4B3RO 4LFBO 4YY3O 4JI0O 4LFCO 3J81N 1XEQA 3J7AU 1N32O 4NXNO 1NS1A 2VQFO 4JI2O 1FJGO 2UXCO 1FKAO 4X66O 4DR4O 5H5NA 2UUBO 1FYJA 3RT3C 4JI4O 1KUQA 1IBLO 1IBKO 3F5TA 1J5EO 3SDLA 1IBMO 4JI7O 4LF8O 4JI8O 2JRIA 4DV7O 4X64O 4DV5O 1HNXO 4OX9O 4JI6O 3M8AA 5IWAO 4DV0O 1D2DA 4DV4O 4B3TO 3T1HO 1AB3A 2Z0AA 2N74A 1N36O 4DUYO 2LW7A 2UUAO 4OPAA 1AILA 4X65O 3O65A 2DOSA 4X62O 3J80N 4DV2O 4GKJO 1X59A 1YZBA 4DUZO 2F4VO 4A5UB 4LF6O 4K0KO 4LF9O 4JI1O 1XMQO 4JV5O 5A2QN 1F7YA 4DR3O 4DR2O 5BXZA 2UXBO 5LMNO 3T1YO 1G1XB 4DR5O 1XMOO 5BY1A 4DV1O 4YHHO 5LL6Y 1A32A 5LMUO 4JYAO 5BR8O 1XNRO 4DR7O 2VQEO 4JI3O 2UUCO 2UXDO 5IT9N 4NXMO 4DR6O 4DV6O 3R66A 4DR1O 4JI5O 2DJVA 1HNWO 4LF7O 4B3SO 4LFAO 3OTOO 1DK1A 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  3JAM N;  1N33 O;  4LF5 O;  2AGA A;  4OPH A;  4B3M O;  4KHP O;  2ZM6 O;  1R1B A;  2FKX A;  2E5L O;  2HHH O;  1HNZ O;  5FLX N;  4LF4 O;  4DV3 O;  1XNQ O;  1I94 O;  4GKK O;  1N34 O;  1HR0 O;  2ZKO A;  2UU9 O;  4B3R O;  4LFB O;  4YY3 O;  4JI0 O;  4LFC O;  3J81 N;  1XEQ A;  3J7A U;  1N32 O;  4NXN O;  1NS1 A;  2VQF O;  4JI2 O;  1FJG O;  2UXC O;  1FKA O;  4X66 O;  4DR4 O;  5H5N A;  2UUB O;  1FYJ A;  3RT3 C;  4JI4 O;  1KUQ A;  1IBL O;  1IBK O;  3F5T A;  1J5E O;  3SDL A;  1IBM O;  4JI7 O;  4LF8 O;  4JI8 O;  2JRI A;  4DV7 O;  4X64 O;  4DV5 O;  1HNX O;  4OX9 O;  4JI6 O;  3M8A A;  5IWA O;  4DV0 O;  1D2D A;  4DV4 O;  4B3T O;  3T1H O;  1AB3 A;  2Z0A A;  2N74 A;  1N36 O;  4DUY O;  2LW7 A;  2UUA O;  4OPA A;  1AIL A;  4X65 O;  3O65 A;  2DOS A;  4X62 O;  3J80 N;  4DV2 O;  4GKJ O;  1X59 A;  1YZB A;  4DUZ O;  2F4V O;  4A5U B;  4LF6 O;  4K0K O;  4LF9 O;  4JI1 O;  1XMQ O;  4JV5 O;  5A2Q N;  1F7Y A;  4DR3 O;  4DR2 O;  5BXZ A;  2UXB O;  5LMN O;  3T1Y O;  1G1X B;  4DR5 O;  1XMO O;  5BY1 A;  4DV1 O;  4YHH O;  5LL6 Y;  1A32 A;  5LMU O;  4JYA O;  5BR8 O;  1XNR O;  4DR7 O;  2VQE O;  4JI3 O;  2UUC O;  2UXD O;  5IT9 N;  4NXM O;  4DR6 O;  4DV6 O;  3R66 A;  4DR1 O;  4JI5 O;  2DJV A;  1HNW O;  4LF7 O;  4B3S O;  4LFA O;  3OTO O;  1DK1 A;  1R6T A; 
#chains in the Genus database with same CATH topology
 1FXH A;  2Q8V A;  1M57 B;  3RVZ A;  1PNK A;  2WPD G;  2FKX A;  1DTO A;  1IBK B;  1QVF U;  2EZP A;  1Q5O A;  3BAA A;  1K5Q A;  3CB2 A;  2QR4 A;  1L8D A;  4PA9 A;  4KL1 A;  4JTA B;  1NVP D;  1MG1 A;  5LA6 A;  1Q7Y W;  2BCC H;  4J42 A;  1FXK B;  4JAS A;  3O9O A;  4I0X B;  1PL0 A;  1H2S B;  1QLE C;  3GWO A;  4NYK A;  5C8Y A;  1TVK B;  2RMK B;  4YIO A;  2ITC C;  1KP3 A;  4OX9 O;  1RPR A;  4JAU A;  1NT2 B;  1WP7 A;  2ADP A;  4HYO A;  4B3T O;  5CA1 B;  1SRY A;  4K0K B;  3JAS A;  1AR5 A;  3OFN G;  2QA4 V;  2GBO A;  5KMG B;  4X1I B;  4IT5 A;  4CH4 A;  4DUY O;  1H2N A;  2ZCE A;  4OPA A;  4ASU G;  1AIL A;  3BAB A;  4C7U A;  1GM7 A;  4GZR B;  4JTC B;  2IM9 A;  4I9Q A;  4X20 A;  2R72 A;  3SJC C;  5IYC O;  1XMQ O;  3GB7 C;  4NTY A;  3D36 C;  4B3S B;  4DXW A;  3JAR A;  5LHG A;  1NH2 D;  1VQM V;  3JD1 A;  2K9P A;  3X2Q B;  2ZNI A;  1IVS A;  2H94 A;  1K34 A;  1NH2 B;  3M7M X;  3HKE B;  2Y0I A;  4LWS A;  5KAI Z;  4PA3 A;  2UXD O;  5IYZ B;  2EIM B;  4DR1 O;  1LUV A;  1GO3 F;  4LBE C;  1Q6I A;  1R3L C;  2YI9 A;  1FXV A;  3UT5 B;  2WAM A;  2JS5 A;  1V9P A;  4KHP O;  4D7T A;  3FD9 A;  1M56 B;  2HHH O;  1F23 A;  1SA0 B;  4DV3 O;  1VF6 C;  2CDY A;  4JI7 B;  3WB1 A;  3ZMU A;  4AHC A;  1XQ8 A;  2XAS A;  3J7A U;  1JA8 A;  4DRX A;  4LH6 A;  1DF5 A;  4DK0 A;  2ZNJ A;  3EVK A;  2QWN B;  3G80 A;  1B3Q A;  3E22 A;  3H1K H;  4DR4 B;  1IBK O;  3CWB H;  1VF5 B;  2OCC C;  4ZI7 A;  5TIS Z;  2XND G;  1Q81 W;  4J10 A;  1NZ6 A;  2EJ7 A;  1M9N A;  4DV2 B;  3LDC A;  5L3C A;  2Q68 A;  1P7B A;  1ZLZ A;  3ZRX A;  1AB3 A;  2B9Z A;  4JI1 B;  1V54 C;  2YDE A;  2ZXW B;  4TQF A;  1AJP A;  3K57 A;  4YIP A;  4RQE A;  3IAY A;  4UCT A;  4TWK A;  1B06 A;  5IY5 C;  1MMM A;  4UCO A;  3WG7 C;  5LOV B;  1IZ3 A;  3N2K B;  1AJQ A;  1DF4 A;  2YXH A;  4DR7 B;  3SPI A;  4ZBM A;  2JK5 C;  1UPG A;  5JJN B;  4K0K O;  3E8H A;  1HNW B;  1TUB B;  2ZQM A;  1OCO B;  5BXZ A;  5J2U B;  3ETG A;  1LR1 A;  4DR3 B;  3K0D A;  2JGD A;  5IDJ A;  4BAY A;  4DO2 A;  3FKS G;  4O4H B;  5KUM A;  1M5I A;  1K97 A;  4LF7 O;  4B3S O;  5KHG A;  4TV9 A;  1L1F A;  1I08 A;  4X1Y B;  3H9V A;  2X0L A;  2QM4 A;  3CRR A;  2VQF B;  1CP9 A;  3OE7 G;  4WF9 V;  2AGA A;  5B1A C;  3SJB C;  3SYP A;  1OCZ C;  4X9Q A;  4H33 A;  4J7J A;  4RAI A;  3JD3 A;  4KP4 A;  5EC1 C;  5J2T A;  2ZKO A;  3MHS C;  1TGO A;  1SS3 A;  5JH7 B;  2YS8 A;  3OEE G;  3CC7 V;  4B3R B;  1JQ0 A;  4ZHQ A;  1SZT A;  4NTW A;  3OMI B;  1Q90 D;  4TUY B;  2Z5U A;  1SET A;  2N04 A;  2WA3 A;  2F93 B;  2UXX A;  4U7O A;  5IJ0 A;  4JI7 O;  3CE2 A;  3AG7 A;  3APO A;  5KA6 A;  3L72 H;  4K3A A;  2V1D A;  2WLI A;  5DEC A;  3RYF B;  1Z5V A;  3K5N A;  2Q9L A;  2N05 A;  4TQD A;  2NLJ C;  3ZRV A;  4BWA A;  4FLT A;  1MOF A;  3G71 V;  2IU3 A;  2V4D A;  2QTO A;  4NVP A;  2LJ2 A;  5LP6 C;  2LW7 A;  2A7W A;  3FB8 C;  2JEX A;  4TV8 B;  3ETQ A;  3U0Z A;  4UCU A;  3K03 A;  1QLE B;  5KHH A;  2BTO A;  3NR7 A;  5LMU B;  2GSM B;  4ICG A;  4DV2 O;  4I55 A;  4GLX A;  2CTR A;  5KHJ A;  1VQ9 V;  1VQK V;  4DR6 B;  4JI1 O;  4P2Z A;  5A2Q N;  3ZRS A;  1WB8 A;  3CRC A;  4I4T A;  1OHH G;  4R7C A;  2P5O A;  3E8F A;  4FLV A;  5L3E A;  3EXA A;  2KQX A;  1HDJ A;  1XMO B;  2EIJ B;  4DR7 O;  1MAB G;  2X6C A;  4DV1 B;  4JZ2 A;  1N34 B;  3AG1 B;  4P30 A;  4MVR A;  1VQN V;  1GN3 A;  1HNW O;  1R3K C;  1H2K A;  3Q4H B;  3LSU A;  4LF5 O;  4O2B A;  1ZX3 A;  4J11 A;  5DN6 G;  3SYC A;  3ZJZ A;  1J5E B;  4U3F H;  4Z1M G;  4AIL C;  1O9H A;  1FXK C;  1I94 B;  4J7K A;  2IU0 A;  2JVD A;  1WLE A;  3JD4 A;  1P49 A;  2VQF O;  2CGN A;  1FKA O;  4LNU A;  1XUQ A;  3HR0 A;  1HW7 A;  4F4L A;  1FJG B;  3RT3 C;  4WFA V;  2WA4 A;  2PY5 A;  2PI4 A;  4I5S A;  5GON A;  2DMX A;  3G67 A;  1BT8 A;  3RBZ A;  1BMF G;  3WB2 A;  3K5M A;  3F5W C;  5LYJ B;  1S72 V;  2DYS B;  1AR1 B;  4E4E A;  2PZS A;  3B8M A;  4GX1 A;  3RYC A;  5K1X A;  1YI2 V;  2R9A A;  2BOC C;  2N74 A;  4D6T H;  2BSK B;  1EN6 A;  4P9P A;  4MTF A;  2XTA A;  3LDE A;  1GM8 A;  2ZR3 A;  1JR9 A;  1SZX A;  3UKM A;  3O65 A;  3QO8 A;  2OCC B;  1FS0 G;  4FK5 C;  5CA0 B;  1YHQ V;  3X2Q C;  4RUF A;  1EM1 A;  2IJH A;  3ZRW B;  4YJ2 A;  4X1K B;  5KHK A;  4PDV A;  3G6B A;  1S5L Z;  1V54 B;  3OT7 A;  5LXT B;  3DC5 A;  5LL6 Y;  5LMU O;  1HP8 A;  2KG7 A;  3UCS C;  2EIM C;  1L0N H;  1VQ8 V;  2EJR A;  4DR6 O;  3SPH A;  5IY5 B;  3R66 A;  4JAA A;  3ZMV A;  1JOY A;  5IJ9 A;  4FM2 A;  5AG2 A;  5JWP A;  2IH1 C;  1UJW B;  1EZJ A;  2O57 A;  4GYC B;  2ZE5 A;  2Y4T A;  2QDO A;  5CMU A;  1N34 O;  4RUE A;  1Z2G A;  5DED A;  1CEZ A;  4RO2 A;  4WFG A;  1WP8 A;  1X4T A;  4LC1 A;  2AW9 A;  4KFM A;  2YEV A;  5LBQ A;  1DLB A;  5GW7 A;  3AK2 A;  1J5E O;  1KKD A;  2HG5 C;  3LSQ A;  1Q43 A;  1F51 A;  1FFX B;  4NR1 A;  1WA8 B;  2Q0A A;  1BQ0 A;  2WSS G;  4O2A B;  4GKJ B;  1D2D A;  2B1I A;  5B1B C;  2ZXW C;  1K73 W;  2F4V B;  2XT9 A;  1P7G A;  1I0H A;  4DW1 A;  1WPB A;  2Z0A A;  2A0L A;  3JCZ A;  3FX7 A;  1GTO A;  2RDC A;  4WBN A;  4MTG A;  2FL4 A;  4Q20 A;  4IHJ B;  1M93 A;  1XIL A;  1AI7 A;  4JYY A;  5EYP B;  5L3D A;  2FYU H;  1WNS A;  3H01 A;  4F6R A;  3HKC A;  1WAZ A;  4FFB B;  2ZIN A;  1F4N A;  5JQG B;  2GUZ B;  1SQQ H;  5EIB D;  3T4Z A;  1NJI W;  3OD4 A;  5LP6 B;  1VF7 A;  1MSD A;  1TA8 A;  2VWK A;  2WLL B;  4LF4 B;  4JPR A;  3SYQ A;  4F6E A;  3JAK B;  5IYB O;  4XDL A;  3HKB B;  2UU9 B;  4YY3 B;  3A0R A;  4QIW F;  1Q6H A;  2RCV A;  3B4S A;  2PGG A;  1R6T A;  4FLW A;  3L73 H;  3QNE A;  3K58 A;  2ZD9 A;  4FM0 A;  4OPH A;  1W0K G;  2JEU A;  3OM3 B;  2HFE C;  1CXZ B;  1RP3 B;  4JF3 A;  1VEW A;  3CHX A;  4JI8 B;  1OV9 A;  4DV3 B;  2P06 A;  3N2K A;  4JI6 B;  2C2A A;  4U7N A;  3JAT B;  3J81 N;  1W59 A;  4NXN O;  1YSC A;  4UV9 A;  1THZ A;  4B7K A;  1SQB H;  5C93 A;  5B1O A;  1P4R A;  4LF8 O;  2Y48 A;  4H44 B;  2IW5 A;  5CB4 A;  1YJW V;  5H6R A;  1G4Y B;  2AHZ A;  4YXW G;  1AP5 A;  1H8H G;  1VQ5 V;  3OR7 C;  2R9I A;  3CCE V;  1PM9 A;  3P32 A;  1RSO B;  4O4I B;  1PKX A;  2DQ3 A;  3DXR A;  4HBN A;  2DQ0 A;  1NTZ H;  3WB0 A;  3CEI A;  4FPP A;  1NVP B;  3VBB A;  1VQP V;  2QEX V;  3BHP A;  5A9G A;  3ICX A;  2QKA A;  3F7Y C;  3ZX6 A;  2IJI A;  2QGN A;  3AG2 B;  4GKJ O;  1G6U A;  2F4V O;  1EZV H;  4FZ0 A;  3JD2 A;  1K33 A;  4MVO A;  3STZ C;  5K1P A;  1GM9 A;  2E76 B;  2HVK C;  3H1I H;  1SQV H;  5LMN O;  3T1Y O;  4IYH A;  3E89 A;  2EIJ C;  3IC9 A;  3JAW B;  1SER A;  3AG1 C;  4JYC A;  1J95 A;  1Y67 A;  4OGQ B;  1NBM G;  3RVY A;  4FVM A;  5CN0 A;  3ZN1 A;  4NXM O;  4IIJ B;  2P4V A;  2YUA A;  3OW2 U;  3P30 A;  3RYF A;  4MTX A;  2FML A;  4LF7 B;  4CC6 A;  2M7W A;  3CJH A;  4X8A A;  1IDS A;  1Y74 A;  1R1B A;  4EB6 A;  4LF4 O;  5B5E Z;  3ZMZ A;  1IBL B;  4UVB A;  1IBM B;  3OMA B;  2A06 H;  4PI2 A;  4TV8 A;  1AI6 A;  1PPJ H;  3F7V C;  4DV7 B;  2UU9 O;  4X64 B;  4DV5 B;  1GN2 A;  4YY3 O;  4GX2 A;  2HLD G;  3T1C A;  1XI1 A;  3CXH F;  4UFZ A;  4BIO A;  1K7D A;  2EUL A;  1SQG A;  1H2G A;  4U3J B;  4PA4 A;  5F2V O;  4JI8 O;  1BZK A;  2PUS A;  2DYS C;  4JI6 O;  4H13 B;  3ZHT A;  4X62 B;  1E1R G;  2CE4 A;  3JD0 A;  4DUZ B;  4LP8 A;  3RYI B;  3OR6 C;  4UV8 A;  2YIC A;  3QO7 A;  1XL4 A;  1W0J G;  2LGW A;  2ZE7 A;  1TUE B;  3D36 A;  1JJO A;  1NKD A;  1OCC B;  3KCY A;  1AVM A;  3L71 H;  4ZOL B;  3RWR D;  3D8C A;  1BGY H;  2Y69 B;  3K5L A;  3EHB B;  3R65 A;  5B1B B;  3WFV A;  3C3T A;  2PTM A;  1A32 A;  2OIE A;  5GTH Z;  2ZDI C;  1XNR O;  3FFQ A;  1HNZ B;  3FB6 C;  5IT9 N;  3TGU H;  5KAF Z;  3K3W A;  2YIB A;  3ZHR A;  1VF6 A;  3OUF A;  2JJ1 G;  5LYJ A;  4O4J A;  2YIA A;  1SQF A;  1QCE A;  3JAL A;  4YJ3 B;  2UUB B;  4MS2 A;  1XBL A;  4FJC C;  1ZL8 B;  3ZBH A;  4LF5 B;  2IBZ H;  5L3F A;  2EX3 A;  4FM1 A;  4O4L A;  3MD0 A;  3TCU A;  5CA3 A;  5ITZ B;  3OEH G;  3H1L H;  1NS1 A;  5CA0 A;  4J41 A;  3CXC U;  1WPX A;  1IBL O;  3CCM V;  4ZKI A;  1IBM O;  5KA5 A;  2BTQ B;  2UUA B;  2G38 A;  4DV7 O;  4X64 O;  4DV5 O;  1YTF D;  5LXT A;  5LA6 B;  1OCR B;  3BVO A;  1QBZ A;  2XAQ A;  5J9P C;  2W0F C;  3MHH C;  3TJT A;  2Q69 A;  3CPW U;  2AZ2 A;  4WFB V;  4R50 A;  4LF6 B;  1N0J A;  2BOB C;  3BA8 A;  5C8Y B;  4JAV A;  4GX5 A;  2ZIO A;  4FLU A;  2YI8 A;  1O9G A;  1PP9 H;  2UXB B;  5LHI A;  2PYL A;  1S5H C;  4WFE A;  4TSF G;  2OYQ A;  4X62 O;  1X59 A;  3JAS B;  1YZB A;  5LGN A;  4CH5 A;  4DUZ O;  3CC2 V;  2LQT A;  2Q6A A;  2H3O A;  4K8Z A;  2CK3 G;  2E74 B;  1KQS U;  1R3I C;  4HNA A;  1G1X B;  2P22 C;  1T5E A;  4UUJ C;  1K9M W;  5JVD A;  5EIB C;  2WLM A;  1AI5 A;  3A0B Z;  2CH7 A;  4AI8 A;  2YXL A;  2FTK A;  4Q6G A;  3JAR B;  1US6 A;  2B5U A;  4LFC B;  4I50 A;  1B6Q A;  3OMN B;  1N33 O;  1YIJ V;  4XBF A;  2Q7G A;  1QQC A;  5EK0 A;  3HB3 B;  3FB7 C;  3MAQ A;  1HNZ O;  5FLX N;  1Y4M A;  3SYA A;  4BR6 A;  1Q6U A;  3DSQ A;  2B1G A;  3M99 B;  1HNX B;  3LUT B;  2LP7 A;  3APQ A;  1BSM A;  4MT8 A;  3FAV A;  1GAX A;  3AK3 A;  2RQ6 A;  4DV4 B;  3B77 A;  3BCC H;  2UUB O;  4K8X A;  1IXB A;  4KUM A;  3CYO A;  2F1M A;  4NKG B;  3CC4 V;  1N36 B;  3OGI B;  3ASO C;  2P6J A;  1KYO F;  2OWO A;  3GWK C;  1S76 D;  2HJF C;  2EIN B;  4X65 B;  3M8A A;  5LP6 A;  3UO2 A;  2P7T C;  3L75 H;  4MVM A;  5L3G A;  3VQX A;  3K5O A;  3L70 H;  4BW5 A;  1KU9 A;  2QKS A;  2UUA O;  1OZ0 A;  4PDR A;  1U96 A;  3AG2 C;  4RWU A;  5EBW C;  2P4K A;  4MW8 A;  2L35 A;  3J80 N;  2WWW A;  2IJK A;  2YID A;  4LF6 O;  4DV6 B;  2HJD A;  2LGQ A;  3CCU V;  1LUW A;  3EFF K;  3JAT A;  3OTO B;  1UFI A;  4KXR A;  2UXB O;  2LFR A;  2YXY A;  2ADQ B;  2ZT9 B;  4CS4 A;  4PJ0 Z;  4CH6 A;  3U10 A;  3OTF A;  3BY6 A;  2A3Q A;  2Q7E A;  3S3W A;  1VP7 A;  2QJ1 A;  3D3Q A;  3ZN0 A;  1XNQ B;  4GKK B;  1HR0 B;  1MZE A;  1K8A W;  2CTQ A;  4RQF A;  4LFA O;  3JSN A;  3W7W A;  4JI2 B;  5KLV H;  1FXK A;  3W7X A;  4O4I A;  4JYB A;  1U97 A;  3CCQ V;  1JVM A;  1NI8 A;  4CH3 A;  4I0X A;  3SPC A;  1PNL A;  2W0X A;  1TVK A;  4EKW A;  4TV9 B;  1G8M A;  4LFC O;  1Y6X A;  2KSD A;  2AXT Z;  2UXC O;  3RW0 A;  2F23 A;  3FYE B;  3P3N A;  4L87 A;  2ZE8 A;  5CA1 A;  4NXN B;  1FYJ A;  1AR4 A;  3H1H H;  3DC6 A;  2GHY A;  4JI4 O;  2X6B A;  1RM1 C;  2XHB A;  4GX0 A;  5KMG A;  4X1I A;  3SDL A;  3C90 A;  1BE3 H;  4EFE A;  3ABL B;  1HNX O;  4LF8 B;  3SGI A;  3JAW A;  1NQT A;  1MSW D;  1VQ6 V;  3B09 A;  1H38 A;  4ZHQ B;  1FPO A;  1K92 A;  4DV4 O;  4IIJ A;  4PA7 A;  4DW0 A;  3KG2 A;  1QR9 A;  4JV5 B;  5IJ0 B;  1N36 O;  5FNV B;  1ZUQ A;  2PYJ A;  4OXS A;  1OCC C;  1VQO V;  1S77 D;  1M4U A;  4X65 O;  3CCL V;  4DR5 B;  4CC5 A;  4W4K A;  2DW4 A;  3ZHS A;  4PA6 A;  2L6L A;  1AP6 A;  2Y69 C;  1BCC H;  2HVJ C;  3W7S A;  3HKE A;  5IYZ A;  2QKC A;  2JJ2 G;  2EIL C;  1BS3 A;  2Z3Y A;  4JTD B;  1ENV A;  3UT5 A;  4U3J A;  5LMN B;  3T1Y B;  5D5P A;  4I55 B;  3P3P A;  3B2E E;  5BR8 O;  2VQE O;  1SA0 A;  1WJZ A;  5FPO A;  3ML0 A;  4DV6 O;  2HP8 A;  3BPZ A;  4CS2 A;  3K9S A;  4I4T B;  1JFF B;  1S5J A;  4NXM B;  3OTO O;  3UM7 A;  5JCO C;  5IE9 A;  5EBM C;  2CAZ C;  3D3I A;  3ABM B;  2ZR2 A;  3CCR V;  4GT1 A;  5KUK A;  3PN1 A;  1KBH A;  3CD6 V;  1XNQ O;  1LNQ A;  4GKK O;  3L74 H;  1FAF A;  1HR0 O;  2X6A A;  3BFR A;  4G27 B;  1GKF A;  1EN5 A;  1EBO A;  4EFB A;  1Y76 B;  4ZOL A;  4JI2 O;  4WFH A;  4GUN A;  4O2B B;  4WFF A;  1ZWI C;  2MW2 B;  1R73 A;  1SQP H;  1KUQ A;  1QVG U;  3N27 A;  1OCR C;  2W6J G;  3SPG A;  2QWO B;  4K35 A;  2HKO A;  3ZED A;  4QE7 A;  4D7S A;  4NTX A;  5LOV A;  1FFT B;  1YEW A;  4LNU B;  1XDC A;  2RNB A;  3T1H O;  4EEQ A;  1MA1 A;  1GN4 A;  3OGC C;  5GON B;  4ABM A;  2HEP A;  1TUB A;  4DR2 B;  1E1Q G;  1VQ4 V;  5J2U A;  2XOK G;  3CMA V;  5FPR A;  1ZL8 A;  1M1K W;  1PNM A;  4BW9 A;  3ASO B;  3ASN B;  1WN7 A;  4JI3 B;  2JGU A;  2P90 A;  2UUC B;  2Q7H A;  4O4H A;  2DYR B;  4JV5 O;  1JMK C;  3CSX A;  5ITZ A;  4PD4 F;  4X1Y A;  1EFR G;  1H2L A;  3KKY A;  3ABK C;  4DR5 O;  1PL4 A;  2KKW A;  2BTQ A;  2LW1 A;  3W7T A;  1XNR B;  4FZ1 A;  4FLX A;  4PEL A;  1COW G;  4YJ2 B;  1DK1 A;  3I5D A;  1N32 B;  5JH7 A;  5KHI A;  1RPO A;  3ETE A;  1VAR A;  2KG7 B;  1AJN A;  4FLY A;  2OCH A;  1N8R W;  4TUY A;  3N2G B;  4I9W A;  3AG4 C;  3IJ4 A;  5IJ9 B;  2ZIM A;  3G4S V;  1FD9 A;  5D5Q A;  1XEQ A;  3K04 A;  3RYH B;  4LR3 A;  5CBH A;  1MZF A;  4UCV A;  3CRA A;  1ZSP A;  3AG3 C;  2X7R B;  2QWP B;  1CPY A;  5BMV B;  2EIN C;  3U11 A;  2AZ0 A;  3IC7 A;  2YEV B;  5EZY B;  2CUG A;  3ABU A;  3TXQ A;  2Q67 A;  1ZAU A;  4L8J A;  4UVC A;  2OIG A;  2QM7 A;  3QF7 A;  5H6Q A;  1D5A A;  4J80 A;  3CCV V;  4B7E A;  2WLH A;  5L3B A;  1YJN V;  1URF A;  2XAH A;  3TXS A;  2ODM A;  1RM1 B;  1ZTE A;  3UO3 A;  3ZMT A;  2H8P C;  1XOU A;  3H1J H;  2R9R B;  4A5U B;  4DYL A;  3LNN A;  3ZHQ A;  1KP2 A;  5KX5 B;  3SR2 C;  2Q0O C;  3HKD B;  3SYO A;  4DR2 O;  4WBN B;  1K3E A;  4QJF B;  3Q4H A;  4AQY B;  3E8B A;  3STL C;  4Z1V A;  3HPL C;  4B3M B;  3THO A;  4Z2W A;  2Q73 A;  4F6R B;  3HKC B;  2E5L B;  4JI3 O;  2JIZ G;  3MDS A;  4DK1 A;  3T2M A;  2UUC O;  2ETN A;  1RFY A;  2DJV A;  4JI0 B;  1R6N A;  1DGS A;  3DTU B;  3JAM N;  2Y0P A;  2VWJ A;  1QR8 A;  2D3O W;  2EIL B;  1N33 B;  1GH6 A;  2DE0 X;  3ZS8 C;  1BHA A;  2PF4 E;  2F95 B;  4N21 A;  1ARO P;  3VQY A;  1QNM A;  4X89 A;  5LGT A;  3VOU A;  2E3C A;  5IWA B;  3S3X A;  4NB5 A;  1N32 O;  1PV0 A;  5H5N A;  2GTS A;  2YC0 A;  1V55 B;  3OUS A;  2DN9 A;  3ABL C;  2NN4 A;  3F5T A;  4QNH B;  3VQW A;  4PHZ A;  2BSK A;  3QVN A;  4QGP A;  4P9O A;  2GDS A;  1NTM H;  4XDJ A;  4BIU A;  4MVS A;  1HWY A;  3UQ8 A;  2KB1 A;  1VQL V;  4LF9 B;  4IGG A;  3C3S A;  3AK1 A;  4UVA A;  4FFK A;  5B66 Z;  1YCI A;  1TAE A;  1Y66 A;  5CB4 B;  3ZRW A;  4X1K A;  3FB5 C;  3CRM A;  3RFR A;  1YJ9 V;  5B3S B;  3I56 V;  2XAJ A;  4CS3 A;  4UB8 Z;  3NXS A;  3SJA C;  3CRQ A;  3L9D A;  3DXR B;  4WCE V;  2ZDI A;  1BQZ A;  5FL7 G;  5H9C A;  1YTF B;  1YVW A;  1NU1 H;  2Q5Z A;  5HFM A;  2R70 A;  2NNU A;  3IFX A;  3E2E A;  2WLK A;  3E35 A;  1M90 W;  3CCS V;  4LH7 A;  4TT3 G;  4G2K A;  4HAM A;  2ZM6 B;  3CME V;  2VS0 A;  3WU2 Z;  2QWQ B;  1W2B U;  2A79 B;  2QSA A;  4MSW C;  3KZI Z;  3ZMS A;  4LFB B;  1R3J C;  2YSU B;  2A9H A;  1PD3 A;  3CP1 A;  3ABM C;  2IH3 C;  2JDI G;  4AQY O;  4LFA B;  5JJE B;  1N0N A;  4J9Y B;  4CBC A;  4FLZ A;  1ROP A;  4B3M O;  2E5L O;  5FNV A;  2MK3 A;  1P84 F;  1F4M A;  3ABK B;  4B08 A;  5E1A C;  4X20 B;  4JZG A;  4FMT A;  2HR3 A;  1FFX A;  2AHY A;  4JI0 O;  2LFS A;  2M6Y A;  3FYI B;  1NTK H;  3CJH B;  1WA8 A;  1S0V A;  3B40 A;  4O2A A;  2CTP A;  4UB6 Z;  5EC2 C;  3ZHU A;  1Y74 B;  4HZ3 A;  4DR4 O;  4EB6 B;  2WLN A;  2UXC B;  1KKC A;  3PJS K;  2XUM A;  3A2F A;  4J7Z A;  5IYD O;  4LWS B;  1KD1 W;  4JI4 B;  3CS5 A;  4UCR A;  2RJZ A;  3ZIA G;  1Q86 W;  1N4C A;  1JJ2 U;  1GK9 A;  1Q8I A;  5IWA O;  2P67 A;  2OT5 A;  1QLN A;  4IHJ A;  3BRC A;  2EIK C;  3AG4 B;  5EYP A;  1JFF A;  4FFB A;  1I5Y A;  3LSS A;  5JQG A;  2GUZ A;  2ILM A;  4R6Z A;  2FB5 A;  3AG3 B;  1SES A;  2BE3 A;  4W4L A;  3ASN C;  2UXN A;  2DOS A;  2JS3 A;  4JYA B;  2DYR C;  4DRX B;  1SF9 A;  3TK1 A;  3K59 A;  2WLL A;  4LF9 O;  1M57 C;  3JAK A;  2QE7 G;  4JI5 B;  4PI0 A;  1WB7 A;  3HKB A;  4DR3 O;  1Y76 A;  3JSL A;  3E22 B;  1R6K A;  2ATK C;  1VMG A;  3RGB A;  4ZI7 B;  1NR1 A;  2OTJ V;  2ZE6 A;  3JCU Z;  5H2F Z;  5LGU A;  4E2L A;  1OJH A;  5BR8 B;  1VQ7 V;  2VQE B;  1GRJ A;  4PDM A;  4MVQ A;  1K4D C;  5HFL A;  4QE9 A;  5B1N A;  3ETD A;  4TOI A;  2YIB D;  4X66 B;  2W6I G;  3BA9 A;  3OAA G;  2CGO A;  2ZM6 O;  1QU7 A;  2RN9 A;  2E75 B;  1YXB A;  2ITD C;  1K4C C;  3K79 A;  4B3R O;  4LFB O;  1Q82 W;  4R8C A;  3IGA C;  4X88 A;  4O4J B;  3KCX A;  4DV0 B;  1XL6 A;  3DGE A;  3JAL B;  3ZCC A;  3W7U A;  1SKV A;  2JGD B;  4MW3 A;  1RSO A;  1KMI Z;  4MVU A;  3LDD A;  2NR5 A;  4H0L B;  4O4L B;  2JRI A;  3T4D A;  1GN6 A;  2Q4P A;  3ZHV A;  1H8E G;  2DWE C;  3RN4 A;  2GV9 A;  1GMG A;  3T1H B;  2EBO A;  3TET A;  1IX9 A;  4CZZ A;  5DM6 V;  1YIT V;  5EBL C;  1D5N A;  1MNG A;  2PI5 A;  4BIZ A;  5J2T B;  3I55 V;  5JJJ B;  3ABT A;  4YHH B;  5E79 Z;  3N2G A;  3AEI A;  1SQX H;  3WG7 B;  1Z5W A;  3QG5 A;  4LCU C;  4QPJ A;  3SPJ A;  2GTA A;  4UCS A;  2LO1 A;  3RYH A;  1QHT A;  1BL8 A;  4GCZ A;  1M56 C;  1XHX A;  1EN4 A;  3QO5 A;  1XMO O;  3A8T A;  5BY1 A;  4DV1 O;  2WLI B;  4JYA O;  3K9A A;  5BMV A;  4H37 A;  3A0H Z;  3K0G A;  1JCH A;  5CBF A;  4JI5 O;  2QM8 A;  4HNA B;  5EZY A;  1XRE A;  1YF2 A;  4MVZ A;  1ORQ C;  1KEC A;  5JVD B;  2F43 G;  1SC5 B;  1VIB A;  4IYI A;  2CH7 B;  2XAF A;  2CTW A;  5B1A B;  1I94 O;  3QTC A;  1OCZ B;  2K1E A;  4OX9 B;  3GVM A;  4I50 B;  2DWD C;  1S3J A;  1V55 C;  4ZIB A;  1FJG O;  3E8G A;  4G28 B;  4B3T B;  5GTI Z;  4X66 O;  4N23 A;  5KX5 A;  4PV1 B;  4MTO A;  3RYI A;  3HKD A;  2D2C B;  4DUY B;  2WLJ A;  4J9Z B;  2VRZ A;  1JPX A;  1K5S A;  2OTL V;  3FAV B;  1JX9 A;  1BHB A;  4XDK A;  4DV0 O;  2Y4U A;  1Q3E A;  1H2M A;  4FIP C;  1OCO C;  4PDL A;  3VQV A;  4JGS A;  1XMQ B;  2XAG A;  1YDX A;  2IJJ A;  3G6E V;  2QWR B;  5B3S C;  3CCJ V;  4IL6 Z;  4QPK A;  3E83 A;  5CBG A;  1L0L H;  2EZO A;  5LHH A;  5BZB A;  3CX5 F;  2UXD B;  1IXM A;  2QTS A;  3LNM B;  1I7F A;  4DR1 B;  1XHZ A;  2F66 C;  1F7Y A;  1IUR A;  2EIK B;  1KB9 F;  1I5X A;  3K08 A;  1E79 G;  5JCO A;  3K06 A;  1AI4 A;  4YHH O;  3B8N A;  1NR7 A;  2ARH A;  1B04 A;  4YJ3 A;  4KHP B;  3JYC A;  4I7Z B;  2HHH B;  3BEH A;  4UXN A;  3SJQ C;  3RYC B;  3E86 A;  2V7Q G;  1KC8 W; 
#chains in the Genus database with same CATH homology
 4AQY O;  3JAM N;  1N33 O;  4LF5 O;  2AGA A;  4OPH A;  4B3M O;  4KHP O;  2ZM6 O;  1R1B A;  2FKX A;  2E5L O;  2HHH O;  1HNZ O;  5FLX N;  4LF4 O;  4DV3 O;  1XNQ O;  1I94 O;  4GKK O;  1N34 O;  1HR0 O;  2ZKO A;  2UU9 O;  4B3R O;  4LFB O;  4YY3 O;  4JI0 O;  4LFC O;  3J81 N;  1XEQ A;  3J7A U;  1N32 O;  4NXN O;  1NS1 A;  2VQF O;  4JI2 O;  1FJG O;  2UXC O;  1FKA O;  4X66 O;  4DR4 O;  5H5N A;  2UUB O;  1FYJ A;  3RT3 C;  4JI4 O;  1KUQ A;  1IBL O;  1IBK O;  3F5T A;  1J5E O;  3SDL A;  1IBM O;  4JI7 O;  4LF8 O;  4JI8 O;  2JRI A;  4DV7 O;  4X64 O;  4DV5 O;  1HNX O;  4OX9 O;  4JI6 O;  3M8A A;  5IWA O;  4DV0 O;  1D2D A;  4DV4 O;  4B3T O;  3T1H O;  1AB3 A;  2Z0A A;  2N74 A;  1N36 O;  4DUY O;  2LW7 A;  2UUA O;  4OPA A;  1AIL A;  4X65 O;  3O65 A;  2DOS A;  4X62 O;  3J80 N;  4DV2 O;  4GKJ O;  1X59 A;  1YZB A;  4DUZ O;  2F4V O;  4A5U B;  4LF6 O;  4K0K O;  4LF9 O;  4JI1 O;  1XMQ O;  4JV5 O;  5A2Q N;  1F7Y A;  4DR3 O;  4DR2 O;  5BXZ A;  2UXB O;  5LMN O;  3T1Y O;  1G1X B;  4DR5 O;  1XMO O;  5BY1 A;  4DV1 O;  4YHH O;  5LL6 Y;  1A32 A;  5LMU O;  4JYA O;  5BR8 O;  1XNR O;  4DR7 O;  2VQE O;  4JI3 O;  2UUC O;  2UXD O;  5IT9 N;  4NXM O;  4DR6 O;  4DV6 O;  3R66 A;  4DR1 O;  4JI5 O;  2DJV A;  1HNW O;  4LF7 O;  4B3S O;  4LFA O;  3OTO O;  1DK1 A;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...