1M1KW

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m1kW00
3CC2V 1VQ4V 2OTJV 2QEXV 1YJ9V 4WFAV 1YI2V 1KQSU 1VQLV 3I55V 3CCEV 1VQ6V 3I56V 1YHQV 3CXCU 1VQOV 1S72V 1Q86W 3G6EV 3CC4V 3CD6V 1VQ8V 1M1KW 1K8AW 1VQMV 3CPWU 1YITV 1VQ9V 4WCEV 1VQ5V 1K9MW 1VQPV 1M90W 3CMAV 1YJNV 1VQ7V 3CCJV 1YIJV 1VQKV 3CCRV 1VQNV 1Q7YW 3G4SV 3CCUV 1KC8W 3CCLV 2D3OW 1QVGU 1K73W 1YJWV 1NJIW 1JJ2U 1KD1W 1QVFU 3CCSV 1W2BU 3CCVV 4WFBV 2OTLV 2QA4V 1R73A 3G71V 1Q81W 5DM6V 3CMEV 3CCMV 4WF9V 3CCQV 1Q82W 1N8RW 3OW2U 3CC7V
chains in the Genus database with same CATH superfamily
1TA8A 2OWOA 3IJ4A 2QTOA 4DR5B 3E8HA 3ASNC 4O4HA 1R6TA 4DR2O 3W7XA 2ZDIC 4KUMA 3AG3B 1TGOA 4IIJA 4QIWF 3RYFA 5JH7B 4O2BA 2XT9A 4WFGA 2GUZA 1NVPB 3P3PA 1VMGA 2QM4A 2XUMA 3MHSC 1JJOA 4X65B 1T5EA 2XAHA 2YI9A 4NTYA 1Q6IA 1GM7A 1K3EA 1NH2B 1DGSA 5JVDA 1XHZA 4GX5A 4Z1MG 4YJ2B 1EN5A 1RPRA 3EXAA 4MTGA 1NTMH 3ZMZA 1BL8A 2BSKB 4WFFA 3E22A 4EFEA 4B3TO 1P84F 4FLWA 4LFBO 2B5UA 5KAIZ 3VQYA 1Q82W 1Y76B 3AG2B 5JQGB 2OT5A 3U11A 1H2GA 5H6QA 1YJNV 2Q9LA 1YTFB 1VEWA 3CCSV 4O2AA 3JALA 3ETQA 5L3FA 5JWPA 3ZIAG 3ZEDA 4DR4O 3JARB 3SYAA 2BOCC 3L73H 3ZMUA 5BMVA 1SA0A 3RW0A 2IJKA 4O4IA 5IYCO 2LFRA 2EULA 1OHHG 1QVGU 3ZHQA 1RSOB 3FAVA 3G80A 1Z5WA 4DV2O 5B1AB 3OTOO 1AROP 3C3TA 1VQ6V 1WA8A 4I0XA 3OEEG 4X8AA 1K8AW 5IDJA 3UT5A 1BQZA 3E8BA 3SJAC 5CA1B 3JAKA 4ABMA 4JGSA 4KHPB 5BZBA 5KMGA 2AHYA 3ZHTA 2A9HA 3AG3C 5IWAB 3TGUH 5IE9A 2VWKA 1XNRO 3W7SA 1GMGA 1Q86W 2CDYA 4IHJB 1VQ9V 1XNRB 5IYZB 3WU2Z 5A2QN 1VQNV 4UCTA 2ZT9B 4O4JA 4AI8A 3CRQA 1Y6XA 1FFXB 3ZMVA 1Y74A 5C8YB 1PD3A 2ZR2A 5LXTA 4NXNO 1YJ9V 4KP4A 2CTRA 4JI6B 3EHBB 3T1HB 3GB7C 1M90W 4GKJO 4UCRA 3G4SV 4R8CA 2ZXWB 4I50A 3ABUA 1VP7A 1K33A 2D2CB 4LF7O 3SPGA 2R9RB 4J11A 5DECA 4YIOA 4I7ZB 4PJ0Z 3RWRD 1OJHA 4HNAB 3RYCB 5EZYA 3P30A 4A5UB 1HR0B 1PL4A 3CWBH 3UKMA 1V54B 3AK1A 1G8MA 1JCHA 3L70H 4CC5A 1JJ2U 4I4TA 1FAFA 4B7KA 4DV4O 3CCQV 3WG7C 5LMNB 5GONA 4JTAB 1LNQA 1SZTA 3R65A 3DXRB 4TV9B 2HHHO 4YXWG 3AK3A 4JI1B 3JCUZ 1JA8A 2QKCA 2CK3G 1SC5B 3JSLA 3HKCB 4DW1A 3K59A 2JGUA 2HHHB 4DXWA 1NJIW 4DV3O 1M56C 4JI2O 1DTOA 5JVDB 1FXHA 3ZN0A 4KFMA 4PI0A 1JOYA 1XILA 1ZX3A 1Y4MA 2DWEC 5EYPB 4DR1O 2KG7A 2ATKC 3ZHSA 4BR6A 2HFEC 1S77D 2JJ2G 4ASUG 4JYAB 2ETNA 4PDVA 1SETA 4ZHQB 2WPDG 4RQFA 1URFA 1GTOA 4HZ3A 3S3WA 1R3JC 5B3SB 4AQYB 1B6QA 5DM6V 1KU9A 2OCHA 1N34O 1Q3EA 1SRYA 2Q73A 2ZCEA 1WJZA 3HKDB 3RFRA 4FFBA 3N2GA 2UXXA 5CB4A 1OCZB 3PJSK 5CA1A 4O2BB 1F51A 3OE7G 4DK0A 1TUBA 4FLUA 5JJJB 3WFVA 4LNUA 3D8CA 2QM7A 2DE0X 2JGDA 4K0KB 3ABMC 3DXRA 1D5AA 3FAVB 4ZBMA 4JV5O 1NU1H 1Z2GA 2DYRC 3OUSA 4AHCA 3CRCA 1JQ0A 5B1BB 3ZS8C 4B3SB 5LP6A 4DRXB 3M8AA 3UQ8A 1YSCA 3BA9A 1BT8A 4K8ZA 1WNSA 1XBLA 4I0XB 1KC8W 1Q8IA 3ABLC 5L3CA 5GW7A 4RQEA 2YSUB 2O57A 3IGAC 3FB5C 4TUYA 5B1BC 3MAQA 4JYBA 1H8HG 4JTDB 1VQMV 2AZ2A 5IT9N 2QWPB 2A06H 1VARA 4GUNA 3CCUV 1N36B 3B8MA 3SPJA 4MT8A 4JI7O 1YDXA 2IJHA 2JVDA 4IYIA 2JJ1G 2WLHA 1B3QA 4DUZB 4NXMO 3H9VA 1IVSA 2KB1A 1VF5B 2EINB 4LF6B 5KLVH 4I55A 1HR0O 3BY6A 2JRIA 2ZE5A 4LF6O 3A0RA 1IZ3A 4BWAA 4TOIA 4DV7B 3C90A 2HVKC 4N21A 4DRXA 1Q6UA 4GKJB 5LGTA 1N0JA 4K35A 4F4LA 4YJ2A 4X89A 2CGOA 2P4VA 4QE7A 4O4HB 1S3JA 4PD4F 2WLIB 1SESA 1KQSU 2QWNB 4WBNA 3BCCH 3LDEA 4TT3G 1BSMA 4JAVA 3A0BZ 4B7EA 2ZIMA 5D5QA 3RYFB 4FFBB 1GN2A 3W7UA 4UVBA 3TETA 2RN9A 1AI5A 3G6BA 2YIBA 5ITZB 1OCOC 2WA4A 1FPOA 5FL7G 2QA4V 3ETGA 1HP8A 4IT5A 2GSMB 3R66A 4JI4B 3FYIB 1GH6A 3I56V 4C7UA 1HDJA 2UUCO 2BTQA 5IYBO 3JAWB 4KHPO 2XOKG 5KAFZ 4FLYA 1N4CA 3AG7A 3OGIB 2PYLA 4N23A 1XMQO 3OM3B 4Z2WA 4FM1A 1NS1A 2P6JA 2ZM6O 2CTPA 5L3DA 4L8JA 4CS2A 2A0LA 1QU7A 1MOFA 1Y76A 1NI8A 5HFLA 1X4TA 5LMUO 4KL1A 2X0LA 5GONB 1N8RW 3G67A 2B9ZA 3BEHA 3OMAB 1R6KA 4TQFA 3RN4A 3FX7A 3ETDA 1L8DA 1VQ8V 3CEIA 3K9AA 4X20A 2EIKB 2CTWA 2PF4E 4DV3B 5CN0A 4CBCA 3RYIA 1O9HA 4DR6O 3JATB 4BW5A 4WF9V 5LHIA 2BTQB 3CB2A 4GX2A 1SQBH 5JQGA 4I50B 1ZL8A 4P9PA 3H1HH 2MW2B 3FYEB 1VF6A 3CYOA 1WPBA 3K5LA 2IJIA 1S76D 4UB6Z 2ZR3A 4ZI7A 1S0VA 1R1BA 2DW4A 2OIGA 2EBOA 2WA3A 2OYQA 3ZRSA 2QM8A 1R73A 2FMLA 4O4LB 1XQ8A 2QWOB 1UPGA 4FVMA 4DUYO 3I55V 4X62O 2ZQMA 2P7TC 4PI2A 3CXCU 3BA8A 3HKBA 2GUZB 3CPWU 4JAAA 4PDMA 1UFIA 5CB4B 3Q4HA 4TSFG 1AP6A 4CH6A 2ARHA 4LFAO 1G4YB 5EBLC 1AI4A 3K3WA 1K4CC 4JI1O 1I5YA 2ODMA 2UXBB 3OGCC 3E8FA 2JK5C 5LA6A 1M1KW 3OW2U 1F7YA 3TJTA 1JVMA 4LBEC 2FYUH 4LFCB 4UCVA 3THOA 3OAAG 1PNMA 3C3SA 2Q67A 2EX3A 5CBFA 5EIBD 3UT5B 4LF9O 2HJFC 3CRMA 4EKWA 2KG7B 4LF8O 2PZSA 4I5SA 2F4VO 1IBMO 2LQTA 3K03A 3RYCA 5BMVB 3KCYA 1CEZA 1AJPA 2YI8A 2BOBC 1XL6A 2NR5A 1Q6HA 3FB6C 3X2QB 2ZKOA 4LCUC 3ZHVA 4CC6A 1H2KA 4LF5B 5JJEB 4P9OA 1XMQB 2GBOA 3UO2A 2WLLA 3CCMV 1GN4A 2AHZA 1M5IA 1S5HC 2QKSA 1EFRG 4XBFA 2AZ0A 1OCZC 3DC5A 2P06A 1J5EO 1QQCA 4WCEV 3RYHA 2Q4PA 3F7VC 3JYCA 5DEDA 3QO5A 3FD9A 4H0LB 3E22B 1JFFA 2Q8VA 1XUQA 1IBMB 3LNMB 3AEIA 2DJVA 4FIPC 2F4VB 1BE3H 3OFNG 5D5PA 1IDSA 1P4RA 3X2QC 4RO2A 2F95B 4LWSB 4ZOLA 1COWG 5JCOC 1R6NA 4JAUA 3ZMTA 4DV6O 1MG1A 4F6RB 2H3OA 1SQVH 1W0KG 2YXYA 4G28B 2W6JG 3HKBB 1BGYH 1AILA 1XEQA 4PA4A 4QGPA 1P7GA 1KBHA 3TK1A 2E5LO 1JFFB 4JI0O 3ZRXA 4B3RO 4NTXA 3STLC 1BCCH 2QSAA 3JASA 4U3FH 5EC1C 4BIUA 2DWDC 1NH2D 4IL6Z 3B40A 2R9IA 1P7BA 2PTMA 2BE3A 1HNWB 5BY1A 5LMUB 4AQYO 1F23A 3HKEA 3FB7C 1YEWA 2LFSA 4X1KB 2NLJC 3ABLB 2LW7A 4LF8B 3N2KA 1FXKA 2DMXA 5LGNA 1QLEC 3ZRVA 5HFMA 1YTFD 2CTQA 1HNZO 2DN9A 3QF7A 3NXSA 2HG5C 1WLEA 2UXBO 1H2LA 4JI0B 3VQXA 4DR6B 3D3IA 4BW9A 5H5NA 1PNLA 3HR0A 3W7WA 2DYSC 1JX9A 1BHBA 1FJGB 4B3TB 2BSKA 2WAMA 1VIBA 5LHHA 3PN1A 2ZD9A 3CMEV 2LGWA 2YICA 2ITDC 3K06A 3H1JH 4DK1A 4PA6A 1V55B 5CA0B 3WB0A 4BIOA 1N33O 1MABG 1K7DA 2X6BA 5F2VO 4D7TA 4DR2B 5LBQA 3CCVV 4EFBA 2E5LB 2B1IA 3S3XA 5L3EA 3JASB 2OTJV 5KX5B 3K5MA 2XASA 4HNAA 1M9NA 3IFXA 3L74H 1PPJH 2R9AA 4J41A 3VQVA 2YEVB 4QNHB 5J2UA 3DSQA 1E1RG 4CH4A 2F43G 3E8GA 2OTLV 2W0XA 4IIJB 4IHJA 3F5TA 4WBNB 4B3MO 4UUJC 2IU0A 3NR7A 2Q7EA 4JI3O 4FK5C 3QG5A 4JI3B 1FD9A 2BCCH 3HKEB 2JIZG 5KX5A 1Q5OA 1JR9A 3JD3A 1VQPV 4ZI7B 4AILC 3LDCA 3LSUA 4DV0B 4ZHQA 1GN6A 3AK2A 1N36O 3K9SA 1NTZH 4H44B 5K1XA 1FS0G 3O9OA 2L6LA 3LSSA 3DTUB 3ABKB 2Z3YA 3SYCA 4G27B 5FPOA 5L3GA 1U97A 2VQFO 1NBMG 4HAMA 4FLZA 2GTAA 4JTCB 1E1QG 2UU9B 1TVKB 1WP7A 3CX5F 5LYJA 2UUBB 1BHAA 2GDSA 3SJCC 1NT2B 2ZE8A 2EIJB 2QWQB 4DV4B 2NN4A 5EK0A 5EZYB 4WFBV 3TXQA 1N34B 3E89A 3ZMSA 2K1EA 4HBNA 1NZ6A 1VQOV 1SS3A 4DW0A 4X64O 1O9GA 2OIEA 4DV1O 1FYJA 1WPXA 4WFEA 5EBMC 3KG2A 1YJWV 4OPHA 1SERA 1KD1W 3ABMB 2ZDIA 4B3RB 5B1OA 2CE4A 3K0GA 3CCEV 3RGBA 4RWUA 1IXBA 5EBWC 3ZHUA 1A32A 3CD6V 3J7AU 2GHYA 5EC2C 4X66B 1W59A 4CH3A 1YITV 4DYLA 3LUTB 2N74A 3ZRWA 3HB3B 2Q0AA 3JAWA 3LSQA 3RT3C 2PY5A 4MVSA 1QLNA 3BAAA 3RBZA 1M57B 3ZCCA 4D7SA 5IJ0B 4X64B 4B3MB 5LXTB 1TUBB 5ITZA 3ETEA 2C2AA 3N2KB 2FKXA 4UVAA 4GKKO 1YZBA 3WB2A 2Z5UA 5KHJA 1XI1A 4FM2A 2X6AA 2D3OW 4NTWA 4UV8A 5FPRA 3KZIZ 1S5LZ 1YF2A 2B1GA 1VF6C 3RVZA 4E4EA 1G6UA 2CAZC 3QO7A 2JS3A 3CXHF 3L75H 4J9YB 1K4DC 1QBZA 1THZA 4YHHO 2UUAB 2UU9O 3CP1A 4LFCO 2ZINA 5KUMA 1RSOA 4F6RA 5JJNB 4LNUB 2WSSG 1CP9A 1NR1A 2RQ6A 4U7NA 2VQFB 1ORQC 1K9MW 3SPHA 3QO8A 1VQKV 3N27A 4YIPA 1Q7YW 2QDOA 1OCRC 1M93A 1EN4A 1NVPD 2UUCB 1BS3A 3FFQA 3JATA 4MS2A 4CZZA 2EZOA 3IC7A 1YHQV 1AJNA 1R3LC 2JEXA 2ADQB 3AG1C 4FLTA 3F5WC 2OCCB 5AG2A 4FJCC 5KHIA 4J7KA 1OZ0A 2PGGA 1Y66A 4TV9A 1QVFU 2YC0A 1CXZB 4DO2A 3CRAA 3SDLA 3CC7V 4K8XA 2AGAA 3L71H 3J80N 2ZXWC 2LP7A 2JS5A 1AI7A 1PP9H 3JARA 2XTAA 2JDIG 1E79G 1Y67A 2Q7HA 4FPPA 1EZVH 2ZIOA 5LOVA 4FZ0A 2WLLB 4JI8B 1N32B 3CCLV 1P49A 2ZNIA 5KHHA 4F6EA 5H6RA 2N05A 4H37A 3SR2C 3KCXA 5KUKA 1HWYA 1I7FA 2AXTZ 4FMTA 1KP3A 3UM7A 4TV8B 4I4TB 4PV1B 3AG4C 5FNVA 4DR4B 4W4KA 2UXNA 1KECA 5BXZA 1F4NA 4MVZA 1MSDA 3BPZA 4FLXA 2ZM6B 1Z5VA 4JI7B 3EFFK 2V4DA 4WFHA 3SJBC 2UUAO 1FXKB 2VQEO 4YJ3B 3GVMA 3O65A 2FB5A 1CPYA 1SKVA 5IYZA 2LGQA 5J2UB 4IGGA 2Q69A 2HVJC 5EYPA 5JCOA 5GTHZ 1GN3A 1V54C 1SQGA 4WFAV 1YI2V 2EIKC 2E76B 1AR1B 5LP6C 4DUYB 2PI4A 1BZKA 3HKCA 3KKYA 1OCCC 4LH6A 4JI4O 3OMIB 1IXMA 3A8TA 1SQXH 3APOA 2ZE7A 2KQXA 1EN6A 2P67A 5KA6A 1ZAUA 3E86A 1XMOB 3CS5A 4LF7B 2Y0PA 2FTKA 1SZXA 2WLIA 5EIBC 4JI2B 3CHXA 3F7YC 4K0KO 5J2TB 3BFRA 2E3CA 1GAXA 4ZOLB 1RPOA 4H33A 5KMGB 4X66O 3P3NA 2H94A 4O4IB 2M7WA 2Y4TA 1Q90D 4LFBB 4R7CA 3ABTA 3T4ZA 5C93A 4DV2B 3MD0A 5CBHA 1I94B 1AI6A 3HPLC 2WWWA 2KKWA 2EILC 2EIMC 3U10A 1KYOF 4JYYA 4MVUA 4LP8A 3MDSA 3CC4V 2EINC 1V55C 3RYHB 1HW7A 1DK1A 5J2TA 3GWKC 2DOSA 2X6CA 2ZNJA 4DV7O 3ML0A 1VQ5V 2MK3A 4CS3A 4NKGB 1EM1A 2RJZA 5LHGA 1PL0A 4CH5A 3B4SA 3G71V 2Y69B 4E2LA 2ILMA 1X59A 3OR7C 2IU3A 4I9WA 1FFXA 4DUZO 3DGEA 2P22C 1KUQA 3JCZA 3G6EV 2QKAA 2RDCA 3ASOB 4XDLA 4GX0A 2LO1A 1MSWD 5H9CA 4YHHB 2M6YA 1YIJV 1WAZA 5IY5B 3CE2A 1MZFA 1K73W 1RP3B 1QNMA 3OMNB 3L9DA 3BHPA 2R72A 2QR4A 4EEQA 1QHTA 4UCOA 2X7RB 3SYOA 3ZHRA 1R3KC 1SF9A 4OXSA 3H01A 4DV1B 4UVCA 1DF4A 3N2GB 4YJ3A 1H2MA 5LP6B 4X1YB 4FM0A 1AR4A 5FNVB 1WA8B 1EBOA 3BRCA 5IWAO 1ZTEA 3B2EE 2HP8A 1QCEA 4U3JA 4J10A 1GRJA 4DR1B 3JD2A 1ZL8B 1N0NA 1J95A 2HJDA 1K5SA 3OEHG 3OR6C 1QR9A 3E35A 1MNGA 3CCJV 2QJ1A 3RYIB 3SYQA 4I9QA 1PNKA 3VQWA 2XAFA 2QTSA 1LR1A 2KSDA 2Q7GA 3T1HO 2IBZH 5B3SC 3E83A 2XAGA 4RUEA 2R70A 3D36A 4LH7A 4X62B 2DYSB 1VQ7V 5CA3A 5IJ9A 3B77A 1XNQB 2W6IG 1AP5A 2NNUA 4DV5O 5L3BA 3H1KH 2JEUA 4YY3B 5CA0A 4PA9A 2A79B 3JALB 3LNNA 4O2AB 1FJGO 3GWOA 3P32A 3K58A 1N32O 1D2DA 3VBBA 4X20B 2K9PA 2G38A 1NR7A 1TVKA 3VOUA 3JD0A 4TUYB 3AG4B 5IJ9B 2W0FC 3QVNA 4Z1VA 4NXNB 3EVKA 5BR8O 5LMNO 1VQLV 2Y48A 4GLXA 1NQTA 3TCUA 3JAMN 4K3AA 2IJJA 5CMUA 1NTKH 3STZC 1HNXB 3SPIA 1K92A 2V1DA 5B5EZ 5LYJB 1IBKB 2YXLA 5E79Z 1MMMA 3QTCA 4MW8A 1ZWIC 3H1LH 5IY5C 1US6A 4JZ2A 2HEPA 4P2ZA 2QWRB 1K34A 2A7WA 3M99B 1LUWA 1MA1A 2LW1A 2EIJC 2QGNA 3FB8C 2OCCC 4QPJA 5KHGA 5K1PA 3RVYA 4BIZA 1YVWA 2XAQA 2H8PC 4ICGA 5IYDO 1MZEA 1YCIA 2YDEA 1U96A 4NR1A 2N04A 4X1YA 2EJRA 1KKCA 3E2EA 3M7MX 4JI6O 4JI5B 2UXCB 2QEXV 1H2NA 4DV6B 2YUAA 4X88A 2P90A 2Y4UA 2P5OA 2F93B 3T2MA 5H2FZ 1EZJA 4QPKA 2RNBA 4JASA 1TAEA 2WLKA 1OCRB 2ZE6A 4R50A 3TXSA 3OT7A 1K5QA 2E75B 1YXBA 4RAIA 4UB8Z 2LJ2A 4UXNA 3JD1A 4X9QA 2UUBO 1H2SB 5A9GA 3ASNB 1GM8A 4X1IB 5KA5A 1XREA 4CS4A 2F1MA 1W2BU 1KP2A 4Q20A 1TUEB 2GTSA 4PDRA 1FFTB 4DR7O 2F66C 4MTXA 1G1XB 2XHBA 3BABA 1PKXA 2BTOA 4Q6GA 4MTOA 4GT1A 1XMOO 4DR3O 3OTFA 1SA0B 1RFYA 3IAYA 1N33B 3ICXA 1WP8A 2Z0AA 1JPXA 1WN7A 2WLJA 2IH3C 3OD4A 4TWKA 2E74B 2IM9A 4OPAA 1I08A 2IH1C 4JV5B 4QJFB 4LR3A 4FFKA 2F23A 4GX1A 3ZX6A 4LF9B 1XL4A 1ROPA 3JD4A 3IC9A 1FXVA 1SQPH 1J5EB 3K57A 2VQEB 5JH7A 1M56B 2CUGA 2UXDB 3SJQC 1WB7A 2V7QG 4O4LA 3SGIA 4UCUA 1QLEB 1ENVA 4XDKA 1KMIZ 4KXRA 2AW9A 4GZRB 1GKFA 2JGDB 4BAYA 5DN6G 2VWJA 1H38A 1XOUA 4MSWC 3B8NA 4XDJA 3ZN1A 4TV8A 1LUVA 4DR3B 3T4DA 3DC6A 4LWSA 3UCSC 4QE9A 3CSXA 4MVRA 2HKOA 3LDDA 4LF4O 1ZSPA 1H8EG 2PYJA 5IJ0A 2QE7G 2PI5A 1B06A 3AG1B 2ADPA 1OCCB 3ZBHA 3HKDA 3CRRA 2YS8A 4I55B 2FL4A 4JI8O 4RUFA 5B1NA 2HLDG 3ZRWB 1B04A 1S5JA 4PELA 1FKAO 4OX9B 1AR5A 1ZUQA 2UXDO 1ZLZA 2EZPA 1BQ0A 1NKDA 2CH7A 2RCVA 3OUFA 3OTOB 1BMFG 2YXHA 2DQ3A 3CJHB 4FLVA 1GO3F 3BVOA 1JMKC 4NVPA 1XNQO 4JPRA 5E1AC 1DF5A 2ITCC 1IBLO 3CC2V 1QR8A 4R6ZA 4JYCA 4J42A 2HR3A 4JYAO 2PUSA 4NXMB 1PV0A 4H13B 5TISZ 5KHKA 1VF7A 1KKDA 1L0NH 3CCRV 1XHXA 3CJHA 3SYPA 5B1AC 3K79A 4LC1A 5BR8B 1UJWB 3MHHC 4DR5O 5LL6Y 2CGNA 2YIBD 3T1CA 1VQ4V 3SPCA 1AJQA 4U3JB 2Y0IA 1XDCA 2RMKB 4TQDA 4J7ZA 4MVOA 4DV0O 1F4MA 4JF3A 4W4LA 1FXKC 3Q4HB 2A3QA 4HYOA 4FZ1A 1AB3A 3D3QA 1IBKO 2YIDA 1HNXO 2GV9A 2Q68A 1M4UA 4UV9A 2XNDG 2P4KA 3D36C 2VRZA 4X1KA 1IBLB 3T1YO 1SQFA 1I5XA 1HNWO 3J81N 3APQA 5B66Z 3B09A 1RM1B 2YIAA 4DR7B 4PHZA 2VS0A 2EILB 2EIMB 3ABKC 4GYCB 1Q81W 5CBGA 1V9PA 1Y74B 5C8YA 1PM9A 1SQQH 3A2FA 4J9ZB 1S72V 2YEVA 1L0LH 1K97A 4LFAB 4OGQB 4NYKA 4DV5B 1I0HA 3I5DA 4D6TH 5FLXN 1GK9A 1OCOB 4UFZA 2Y69C 3K0DA 3JAKB 4P30A 3A0HZ 4J80A 3T1YB 3K5OA 4MVMA 3ASOC 3CMAV 4X1IA 3U0ZA 4IYHA 1KB9F 4EB6A 2WLNA 3QNEA 1I94O 2WLMA 3WG7B 1AVMA 5J9PC 1DLBA 3L72H 1IX9A 4J7JA 3K04A 1WB8A 2XAJA 4NB5A 4PDLA 5LOVB 3UO3A 4EB6B 3JSNA 4MVQA 1L1FA 4OX9O 3H1IH 3K08A 1W0JG 4UCSA 3WB1A 5LGUA 2CH7B 2L35A 4G2KA 4B08A 1HNZB 1Q43A 4LF5O 2DYRB 2Q6AA 1D5NA 1R3IC 3AG2C 4L87A 4GKKB 1M57C 2Q5ZA 5GTIZ 4YY3O 4LF4B 1RM1C 1GM9A 5LA6B 1IURA 2DQ0A 4U7OA 3FKSG 4MTFA 4X65O 4PA3A 4ZKIA 4ZIBA 2EJ7A 2Q0OC 4B3SO 4GCZA 4JZGA 1OV9A 4O4JB 4PA7A 3K5NA 4JI5O 2UXCO 2IW5A 4MW3A 3W7TA 3ZJZA
chains in the Genus database with same CATH topology
3ZMSA 2K1EA 3FYIB 2QTOA 1VQLV 2Y48A 3I56V 3E8HA 3ASNC 1VQOV 1NQTA 3TCUA 5IYBO 3W7XA 2IJJA 2XOKG 2ZDIC 4KUMA 5CMUA 3AG3B 4QIWF 1WPXA 3STZC 4WFEA 3SPIA 1K92A 2V1DA 5EBMC 3KG2A 4WFGA 1YJWV 1NVPB 1SERA 1KD1W 3ABMB 2ZDIA 4N23A 3OM3B 2P6JA 4MW8A 1ZWIC 5B1OA 3MHSC 5IY5C 2XAHA 3K0GA 5L3DA 4P2ZA 1K34A 3CCEV 3M99B 5EBWC 3CD6V 1GM7A 1K3EA 2EIJC 1NH2B 3FB8C 2OCCC 2GHYA 4GX5A 2A0LA 4QPJA 5EC2C 4Z1MG 1YITV 1MOFA 3RVYA 1RPRA 4BIZA 2XAQA 2H8PC 4MTGA 3LUTB 3ZMZA 5IYDO 1BL8A 5HFLA 4WFFA 3ZRWA 3HB3B 3LSQA 2B5UA 4MVSA 2EJRA 1QLNA 2X0LA 3E2EA 1Q82W 3AG2B 1N8RW 3RBZA 3BEHA 1M57B 2OT5A 3OMAB 2QEXV 3ZCCA 1R6KA 4X88A 2P90A 3ETDA 1VQ8V 1H2GA 3K9AA 3ETEA 2C2AA 3T2MA 2EIKB 5H6QA 1EZJA 1YJNV 4QPKA 4UVAA 2Z5UA 5CN0A 4CBCA 1YTFB 2D3OW 2X6AA 4JASA 4UV8A 3CCSV 2WLKA 1OCRB 4R50A 4BW5A 4WF9V 2B1GA 3RVZA 5LHIA 5L3FA 3ZIAG 3QO7A 1K5QA 4GX2A 3SYAA 4RAIA 2BOCC 4P9PA 4J9YB 1K4DC 1QBZA 1THZA 3FYEB 3JD1A 4UXNA 3ZMUA 3CP1A 3ASNB 3CYOA 5KUMA 1GM8A 2WSSG 1CP9A 1NR1A 4U7NA 3RW0A 2IJKA 1ORQC 2IJIA 3SPHA 1K9MW 3QO8A 1S76D 5KA5A 5IYCO 1VQKV 2LFRA 2ZR3A 1S0VA 1OHHG 2DW4A 1Q7YW 1OCRC 1QVGU 2EBOA 1W2BU 1NVPD 3ZRSA 1KP2A 2QM8A 1TUEB 4Q20A 1R73A 4PDRA 1FFTB 5B1AB 4MS2A 4MTXA 4CZZA 1AROP 2EZOA 3I55V 1VQ6V 3IC7A 2ZQMA 2P7TC 3CXCU 1AJNA 1YHQV 1R3LC 2JEXA 3OEEG 3AG1C 1PKXA 4X8AA 1K8AW 5IDJA 3CPWU 3E8BA 4MTOA 3F5WC 4PDMA 2OCCB 4FJCC 4TSFG 4GT1A 1OZ0A 4JGSA 1Y66A 5BZBA 1G4YB 1AI4A 5EBLC 3K3WA 1JPXA 1K4CC 1QVFU 2WLJA 2IH3C 1I5YA 4TWKA 4DO2A 2AHYA 3OGCC 3E8FA 2JK5C 1M1KW 3OW2U 2A9HA 2IH1C 3AG3C 3CC7V 1JVMA 4LBEC 4QJFB 2ZXWC 2LP7A 1AI7A 3W7SA 1GMGA 1Q86W 3OAAG 4GX1A 2JDIG 1PNMA 1XL4A 1E79G 4FPPA 2Q67A 1ROPA 3JD4A 1VQ9V 5CBFA 1FXVA 2HJFC 2WLLB 4EKWA 1VQNV 3CCLV 3ZJZA 1M56B 4I5SA 3ZMVA 3SJQC 1PD3A 2ZR2A 5H6RA 3K03A 4H37A 1YJ9V 2V7QG 4KP4A 5KUKA 1HWYA 1QLEB 3EHBB 1CEZA 1AJPA 1ENVA 4XDKA 2BOBC 1XL6A 4FMTA 3FB6C 1KP3A 1GKFA 3GB7C 3UM7A 3X2QB 1M90W 4BAYA 4LCUC 5DN6G 3G4SV 4R8CA 1H38A 4MSWC 3AG4C 2ZXWB 3B8NA 4P9OA 4XDJA 3ABUA 3ZN1A 1K33A 3SPGA 2WLLA 3T4DA 2R9RB 3CCMV 2AHZA 2UXNA 1KECA 1F4NA 4MVZA 4QE9A 1S5HC 2QKSA 2HKOA 3LDDA 4MVRA 1EFRG 4XBFA 1H8EG 3EFFK 4WFHA 1FXKB 1OCZC 3P30A 2QE7G 2PI5A 4WCEV 3AG1B 3UKMA 1OCCB 1CPYA 1V54B 1G8MA 1JCHA 3F7VC 3JYCA 4RUFA 3QO5A 5B1NA 1JJ2U 2Q69A 2HLDG 2HVJC 3ZRWB 4PELA 3LNMB 3CCQV 3WG7C 3AEIA 4FIPC 1V54C 3OFNG 2EZPA 4JTAB 4WFAV 1P4RA 1LNQA 3X2QC 4RO2A 1SZTA 2EIKC 1YI2V 1NKDA 1COWG 1AR1B 3OUFA 2PI4A 3R65A 1BMFG 1OCCC 1R6NA 2DQ3A 1IXMA 3OMIB 4JAUA 3ZMTA 1MG1A 4YXWG 1GO3F 1W0KG 2P67A 2CK3G 5KA6A 3E86A 4DXWA 4G28B 4JPRA 1M56C 1NJIW 1DTOA 5E1AC 2W6JG 1FXHA 1DF5A 3ZN0A 2ITCC 4KFMA 1JOYA 4PA4A 2FTKA 3CC2V 1QR8A 1Y4MA 2DWEC 2WLIA 4R6ZA 3TK1A 3F7YC 4JYCA 3ZRXA 3STLC 2HR3A 2ATKC 2HFEC 1S77D 2JJ2G 1RPOA 4H33A 4ASUG 5EC1C 4BIUA 2DWDC 1NH2D 4PDVA 2H94A 1SETA 1P7BA 2R9IA 2WPDG 1KKDA 4RQFA 3CCRV 2M7WA 1GTOA 4HZ3A 4R7CA 3SYPA 5B1AC 1F23A 3K79A 3ABTA 3FB7C 1R3JC 4LC1A 2LFSA 3T4ZA 3MHHC 5B3SB 5C93A 1UJWB 1B6QA 5DM6V 2NLJC 3MD0A 3ABLB 5CBHA 1AI6A 3T1CA 1SRYA 3HPLC 2WWWA 2EILC 2EIMC 1VQ4V 3SPCA 1AJQA 1FXKA 4MVUA 4LP8A 3CC4V 2EINC 5LGNA 1V55C 4MVOA 2X6CA 1F4MA 1QLEC 2UXXA 3ML0A 4JF3A 3ZRVA 1VQ5V 5HFMA 1FXKC 1OCZB 3PJSK 1YTFD 1F51A 3OE7G 4HYOA 2MK3A 5LHGA 1PL0A 3WFVA 3NXSA 3G71V 2HG5C 2QM7A 1WLEA 2Y69B 4E2LA 2Q68A 2IU3A 3OR7C 4I9WA 3ABMC 4UV9A 3DGEA 3D3IA 2XNDG 3JCZA 1PNLA 3W7WA 3G6EV 4ZBMA 3ASOB 4XDLA 2DYRC 2DYSC 3OUSA 1I5XA 4GX0A 1JQ0A 5B1BB 1MSWD 1JX9A 5H9CA 1YIJV 1BHBA 5IY5B 1YSCA 1RM1B 2WAMA 1K73W 3ABKC 2EILB 2EIMB 5LHHA 3OMNB 1KC8W 1Q81W 2ZD9A 3ABLC 5CBGA 5L3CA 5GW7A 4RQEA 3CMEV 2ITDC 2YSUB 3K06A 2X7RB 3IGAC 3SYOA 3FB5C 5B1BC 4J9ZB 4JYBA 1H8HG 4PA6A 1S72V 1R3KC 1V55B 4JTDB 4OXSA 2YEVA 3H01A 1VQMV 1K97A 4UVCA 1DF4A 1MABG 1K7DA 2X6BA 3CCUV 1EBOA 3B8MA 3SPJA 5LBQA 3CCVV 1GK9A 1OCOB 4MT8A 1QCEA 2Y69C 3K0DA 2B1IA 2IJHA 3JD2A 4P30A 5L3EA 2OTJV 1J95A 2JJ1G 4MVMA 2WLHA 3ASOC 1K5SA 2XASA 3OEHG 1M9NA 3IFXA 3OR6C 1QR9A 3E35A 2KB1A 3CMAV 3CCJV 2EINB 3SYQA 2WLNA 2YEVB 3QNEA 4QNHB 2WLMA 3WG7B 1E1RG 1DLBA 1PNKA 5J9PC 3BY6A 2XAFA 2F43G 3E8GA 2XAJA 3A0RA 3K04A 4PDLA 2OTLV 5B3SC 4UUJC 2IU0A 4MVQA 1L1FA 4FK5C 3E83A 2HVKC 3K08A 1W0JG 4N21A 5LGUA 2XAGA 4G2KA 4RUEA 2JIZG 3JD3A 3D36A 1VQPV 2DYSB 2DYRB 2Q6AA 5LGTA 1VQ7V 5CA3A 3LDCA 1R3IC 3AG2C 3B77A 4L87A 4F4LA 4X89A 1M57C 2W6IG 2NNUA 4QE7A 1S3JA 5L3BA 1RM1C 1FS0G 2JEUA 1GM9A 2DQ0A 3LSSA 3DTUB 3ABKB 2Z3YA 2A79B 4PA9A 3SYCA 2WLIB 1SESA 4G27B 5L3GA 1KQSU 4U7OA 1NBMG 3FKSG 4TT3G 3LDEA 4HAMA 4MTFA 4JTCB 3GWOA 3P32A 4PA3A 1E1QG 4ZKIA 4JAVA 4GCZA 1BHAA 3VBBA 2EIJB 3W7UA 4UVBA 3TETA 4PA7A 1AI5A 1NR7A 5EK0A 3VOUA 1OCOC 3JD0A 5FL7G 2IW5A 3AG4B 4WFBV 2QA4V 4MW3A 3ETGA 3W7TA 2W0FC 2GSMB 3E89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  1VQ4 V;  2OTJ V;  2QEX V;  1YJ9 V;  4WFA V;  1YI2 V;  1KQS U;  1VQL V;  3I55 V;  3CCE V;  1VQ6 V;  3I56 V;  1YHQ V;  3CXC U;  1VQO V;  1S72 V;  1Q86 W;  3G6E V;  3CC4 V;  3CD6 V;  1VQ8 V;  1M1K W;  1K8A W;  1VQM V;  3CPW U;  1YIT V;  1VQ9 V;  4WCE V;  1VQ5 V;  1K9M W;  1VQP V;  1M90 W;  3CMA V;  1YJN V;  1VQ7 V;  3CCJ V;  1YIJ V;  1VQK V;  3CCR V;  1VQN V;  1Q7Y W;  3G4S V;  3CCU V;  1KC8 W;  3CCL V;  2D3O W;  1QVG U;  1K73 W;  1YJW V;  1NJI W;  1JJ2 U;  1KD1 W;  1QVF U;  3CCS V;  1W2B U;  3CCV V;  4WFB V;  2OTL V;  2QA4 V;  1R73 A;  3G71 V;  1Q81 W;  5DM6 V;  3CME V;  3CCM V;  4WF9 V;  3CCQ V;  1Q82 W;  1N8R W;  3OW2 U;  3CC7 V; 
#chains in the Genus database with same CATH topology
 1TA8 A;  2OWO A;  3IJ4 A;  2QTO A;  4DR5 B;  3E8H A;  3ASN C;  4O4H A;  1R6T A;  4DR2 O;  3W7X A;  2ZDI C;  4KUM A;  3AG3 B;  1TGO A;  4IIJ A;  4QIW F;  3RYF A;  5JH7 B;  4O2B A;  2XT9 A;  4WFG A;  2GUZ A;  1NVP B;  3P3P A;  1VMG A;  2QM4 A;  2XUM A;  3MHS C;  1JJO A;  4X65 B;  1T5E A;  2XAH A;  2YI9 A;  4NTY A;  1Q6I A;  1GM7 A;  1K3E A;  1NH2 B;  1DGS A;  5JVD A;  1XHZ A;  4GX5 A;  4Z1M G;  4YJ2 B;  1EN5 A;  1RPR A;  3EXA A;  4MTG A;  1NTM H;  3ZMZ A;  1BL8 A;  2BSK B;  4WFF A;  3E22 A;  4EFE A;  4B3T O;  1P84 F;  4FLW A;  4LFB O;  2B5U A;  5KAI Z;  3VQY A;  1Q82 W;  1Y76 B;  3AG2 B;  5JQG B;  2OT5 A;  3U11 A;  1H2G A;  5H6Q A;  1YJN V;  2Q9L A;  1YTF B;  1VEW A;  3CCS V;  4O2A A;  3JAL A;  3ETQ A;  5L3F A;  5JWP A;  3ZIA G;  3ZED A;  4DR4 O;  3JAR B;  3SYA A;  2BOC C;  3L73 H;  3ZMU A;  5BMV A;  1SA0 A;  3RW0 A;  2IJK A;  4O4I A;  5IYC O;  2LFR A;  2EUL A;  1OHH G;  1QVG U;  3ZHQ A;  1RSO B;  3FAV A;  3G80 A;  1Z5W A;  4DV2 O;  5B1A B;  3OTO O;  1ARO P;  3C3T A;  1VQ6 V;  1WA8 A;  4I0X A;  3OEE G;  4X8A A;  1K8A W;  5IDJ A;  3UT5 A;  1BQZ A;  3E8B A;  3SJA C;  5CA1 B;  3JAK A;  4ABM A;  4JGS A;  4KHP B;  5BZB A;  5KMG A;  2AHY A;  3ZHT A;  2A9H A;  3AG3 C;  5IWA B;  3TGU H;  5IE9 A;  2VWK A;  1XNR O;  3W7S A;  1GMG A;  1Q86 W;  2CDY A;  4IHJ B;  1VQ9 V;  1XNR B;  5IYZ B;  3WU2 Z;  5A2Q N;  1VQN V;  4UCT A;  2ZT9 B;  4O4J A;  4AI8 A;  3CRQ A;  1Y6X A;  1FFX B;  3ZMV A;  1Y74 A;  5C8Y B;  1PD3 A;  2ZR2 A;  5LXT A;  4NXN O;  1YJ9 V;  4KP4 A;  2CTR A;  4JI6 B;  3EHB B;  3T1H B;  3GB7 C;  1M90 W;  4GKJ O;  4UCR A;  3G4S V;  4R8C A;  2ZXW B;  4I50 A;  3ABU A;  1VP7 A;  1K33 A;  2D2C B;  4LF7 O;  3SPG A;  2R9R B;  4J11 A;  5DEC A;  4YIO A;  4I7Z B;  4PJ0 Z;  3RWR D;  1OJH A;  4HNA B;  3RYC B;  5EZY A;  3P30 A;  4A5U B;  1HR0 B;  1PL4 A;  3CWB H;  3UKM A;  1V54 B;  3AK1 A;  1G8M A;  1JCH A;  3L70 H;  4CC5 A;  1JJ2 U;  4I4T A;  1FAF A;  4B7K A;  4DV4 O;  3CCQ V;  3WG7 C;  5LMN B;  5GON A;  4JTA B;  1LNQ A;  1SZT A;  3R65 A;  3DXR B;  4TV9 B;  2HHH O;  4YXW G;  3AK3 A;  4JI1 B;  3JCU Z;  1JA8 A;  2QKC A;  2CK3 G;  1SC5 B;  3JSL A;  3HKC B;  4DW1 A;  3K59 A;  2JGU A;  2HHH B;  4DXW A;  1NJI W;  4DV3 O;  1M56 C;  4JI2 O;  1DTO A;  5JVD B;  1FXH A;  3ZN0 A;  4KFM A;  4PI0 A;  1JOY A;  1XIL A;  1ZX3 A;  1Y4M A;  2DWE C;  5EYP B;  4DR1 O;  2KG7 A;  2ATK C;  3ZHS A;  4BR6 A;  2HFE C;  1S77 D;  2JJ2 G;  4ASU G;  4JYA B;  2ETN A;  4PDV A;  1SET A;  4ZHQ B;  2WPD G;  4RQF A;  1URF A;  1GTO A;  4HZ3 A;  3S3W A;  1R3J C;  5B3S B;  4AQY B;  1B6Q A;  5DM6 V;  1KU9 A;  2OCH A;  1N34 O;  1Q3E A;  1SRY A;  2Q73 A;  2ZCE A;  1WJZ A;  3HKD B;  3RFR A;  4FFB A;  3N2G A;  2UXX A;  5CB4 A;  1OCZ B;  3PJS K;  5CA1 A;  4O2B B;  1F51 A;  3OE7 G;  4DK0 A;  1TUB A;  4FLU A;  5JJJ B;  3WFV A;  4LNU A;  3D8C A;  2QM7 A;  2DE0 X;  2JGD A;  4K0K B;  3ABM C;  3DXR A;  1D5A A;  3FAV B;  4ZBM A;  4JV5 O;  1NU1 H;  1Z2G A;  2DYR C;  3OUS A;  4AHC A;  3CRC A;  1JQ0 A;  5B1B B;  3ZS8 C;  4B3S B;  5LP6 A;  4DRX B;  3M8A A;  3UQ8 A;  1YSC A;  3BA9 A;  1BT8 A;  4K8Z A;  1WNS A;  1XBL A;  4I0X B;  1KC8 W;  1Q8I A;  3ABL C;  5L3C A;  5GW7 A;  4RQE A;  2YSU B;  2O57 A;  3IGA C;  3FB5 C;  4TUY A;  5B1B C;  3MAQ A;  4JYB A;  1H8H G;  4JTD B;  1VQM V;  2AZ2 A;  5IT9 N;  2QWP B;  2A06 H;  1VAR A;  4GUN A;  3CCU V;  1N36 B;  3B8M A;  3SPJ A;  4MT8 A;  4JI7 O;  1YDX A;  2IJH A;  2JVD A;  4IYI A;  2JJ1 G;  2WLH A;  1B3Q A;  4DUZ B;  4NXM O;  3H9V A;  1IVS A;  2KB1 A;  1VF5 B;  2EIN B;  4LF6 B;  5KLV H;  4I55 A;  1HR0 O;  3BY6 A;  2JRI A;  2ZE5 A;  4LF6 O;  3A0R A;  1IZ3 A;  4BWA A;  4TOI A;  4DV7 B;  3C90 A;  2HVK C;  4N21 A;  4DRX A;  1Q6U A;  4GKJ B;  5LGT A;  1N0J A;  4K35 A;  4F4L A;  4YJ2 A;  4X89 A;  2CGO A;  2P4V A;  4QE7 A;  4O4H B;  1S3J A;  4PD4 F;  2WLI B;  1SES A;  1KQS U;  2QWN B;  4WBN A;  3BCC H;  3LDE A;  4TT3 G;  1BSM A;  4JAV A;  3A0B Z;  4B7E A;  2ZIM A;  5D5Q A;  3RYF B;  4FFB B;  1GN2 A;  3W7U A;  4UVB A;  3TET A;  2RN9 A;  1AI5 A;  3G6B A;  2YIB A;  5ITZ B;  1OCO C;  2WA4 A;  1FPO A;  5FL7 G;  2QA4 V;  3ETG A;  1HP8 A;  4IT5 A;  2GSM B;  3R66 A;  4JI4 B;  3FYI B;  1GH6 A;  3I56 V;  4C7U A;  1HDJ A;  2UUC O;  2BTQ A;  5IYB O;  3JAW B;  4KHP O;  2XOK G;  5KAF Z;  4FLY A;  1N4C A;  3AG7 A;  3OGI B;  2PYL A;  4N23 A;  1XMQ O;  3OM3 B;  4Z2W A;  4FM1 A;  1NS1 A;  2P6J A;  2ZM6 O;  2CTP A;  5L3D A;  4L8J A;  4CS2 A;  2A0L A;  1QU7 A;  1MOF A;  1Y76 A;  1NI8 A;  5HFL A;  1X4T A;  5LMU O;  4KL1 A;  2X0L A;  5GON B;  1N8R W;  3G67 A;  2B9Z A;  3BEH A;  3OMA B;  1R6K A;  4TQF A;  3RN4 A;  3FX7 A;  3ETD A;  1L8D A;  1VQ8 V;  3CEI A;  3K9A A;  4X20 A;  2EIK B;  2CTW A;  2PF4 E;  4DV3 B;  5CN0 A;  4CBC A;  3RYI A;  1O9H A;  4DR6 O;  3JAT B;  4BW5 A;  4WF9 V;  5LHI A;  2BTQ B;  3CB2 A;  4GX2 A;  1SQB H;  5JQG A;  4I50 B;  1ZL8 A;  4P9P A;  3H1H H;  2MW2 B;  3FYE B;  1VF6 A;  3CYO A;  1WPB A;  3K5L A;  2IJI A;  1S76 D;  4UB6 Z;  2ZR3 A;  4ZI7 A;  1S0V A;  1R1B A;  2DW4 A;  2OIG A;  2EBO A;  2WA3 A;  2OYQ A;  3ZRS A;  2QM8 A;  1R73 A;  2FML A;  4O4L B;  1XQ8 A;  2QWO B;  1UPG A;  4FVM A;  4DUY O;  3I55 V;  4X62 O;  2ZQM A;  2P7T C;  4PI2 A;  3CXC U;  3BA8 A;  3HKB A;  2GUZ B;  3CPW U;  4JAA A;  4PDM A;  1UFI A;  5CB4 B;  3Q4H A;  4TSF G;  1AP6 A;  4CH6 A;  2ARH A;  4LFA O;  1G4Y B;  5EBL C;  1AI4 A;  3K3W A;  1K4C C;  4JI1 O;  1I5Y A;  2ODM A;  2UXB B;  3OGC C;  3E8F A;  2JK5 C;  5LA6 A;  1M1K W;  3OW2 U;  1F7Y A;  3TJT A;  1JVM A;  4LBE C;  2FYU H;  4LFC B;  4UCV A;  3THO A;  3OAA G;  1PNM A;  3C3S A;  2Q67 A;  2EX3 A;  5CBF A;  5EIB D;  3UT5 B;  4LF9 O;  2HJF C;  3CRM A;  4EKW A;  2KG7 B;  4LF8 O;  2PZS A;  4I5S A;  2F4V O;  1IBM O;  2LQT A;  3K03 A;  3RYC A;  5BMV B;  3KCY A;  1CEZ A;  1AJP A;  2YI8 A;  2BOB C;  1XL6 A;  2NR5 A;  1Q6H A;  3FB6 C;  3X2Q B;  2ZKO A;  4LCU C;  3ZHV A;  4CC6 A;  1H2K A;  4LF5 B;  5JJE B;  4P9O A;  1XMQ B;  2GBO A;  3UO2 A;  2WLL A;  3CCM V;  1GN4 A;  2AHZ A;  1M5I A;  1S5H C;  2QKS A;  1EFR G;  4XBF A;  2AZ0 A;  1OCZ C;  3DC5 A;  2P06 A;  1J5E O;  1QQC A;  4WCE V;  3RYH A;  2Q4P A;  3F7V C;  3JYC A;  5DED A;  3QO5 A;  3FD9 A;  4H0L B;  3E22 B;  1JFF A;  2Q8V A;  1XUQ A;  1IBM B;  3LNM B;  3AEI A;  2DJV A;  4FIP C;  2F4V B;  1BE3 H;  3OFN G;  5D5P A;  1IDS A;  1P4R A;  3X2Q C;  4RO2 A;  2F95 B;  4LWS B;  4ZOL A;  1COW G;  5JCO C;  1R6N A;  4JAU A;  3ZMT A;  4DV6 O;  1MG1 A;  4F6R B;  2H3O A;  1SQV H;  1W0K G;  2YXY A;  4G28 B;  2W6J G;  3HKB B;  1BGY H;  1AIL A;  1XEQ A;  4PA4 A;  4QGP A;  1P7G A;  1KBH A;  3TK1 A;  2E5L O;  1JFF B;  4JI0 O;  3ZRX A;  4B3R O;  4NTX A;  3STL C;  1BCC H;  2QSA A;  3JAS A;  4U3F H;  5EC1 C;  4BIU A;  2DWD C;  1NH2 D;  4IL6 Z;  3B40 A;  2R9I A;  1P7B A;  2PTM A;  2BE3 A;  1HNW B;  5BY1 A;  5LMU B;  4AQY O;  1F23 A;  3HKE A;  3FB7 C;  1YEW A;  2LFS A;  4X1K B;  2NLJ C;  3ABL B;  2LW7 A;  4LF8 B;  3N2K A;  1FXK A;  2DMX A;  5LGN A;  1QLE C;  3ZRV A;  5HFM A;  1YTF D;  2CTQ A;  1HNZ O;  2DN9 A;  3QF7 A;  3NXS A;  2HG5 C;  1WLE A;  2UXB O;  1H2L A;  4JI0 B;  3VQX A;  4DR6 B;  3D3I A;  4BW9 A;  5H5N A;  1PNL A;  3HR0 A;  3W7W A;  2DYS C;  1JX9 A;  1BHB A;  1FJG B;  4B3T B;  2BSK A;  2WAM A;  1VIB A;  5LHH A;  3PN1 A;  2ZD9 A;  3CME V;  2LGW A;  2YIC A;  2ITD C;  3K06 A;  3H1J H;  4DK1 A;  4PA6 A;  1V55 B;  5CA0 B;  3WB0 A;  4BIO A;  1N33 O;  1MAB G;  1K7D A;  2X6B A;  5F2V O;  4D7T A;  4DR2 B;  5LBQ A;  3CCV V;  4EFB A;  2E5L B;  2B1I A;  3S3X A;  5L3E A;  3JAS B;  2OTJ V;  5KX5 B;  3K5M A;  2XAS A;  4HNA A;  1M9N A;  3IFX A;  3L74 H;  1PPJ H;  2R9A A;  4J41 A;  3VQV A;  2YEV B;  4QNH B;  5J2U A;  3DSQ A;  1E1R G;  4CH4 A;  2F43 G;  3E8G A;  2OTL V;  2W0X A;  4IIJ B;  4IHJ A;  3F5T A;  4WBN B;  4B3M O;  4UUJ C;  2IU0 A;  3NR7 A;  2Q7E A;  4JI3 O;  4FK5 C;  3QG5 A;  4JI3 B;  1FD9 A;  2BCC H;  3HKE B;  2JIZ G;  5KX5 A;  1Q5O A;  1JR9 A;  3JD3 A;  1VQP V;  4ZI7 B;  4AIL C;  3LDC A;  3LSU A;  4DV0 B;  4ZHQ A;  1GN6 A;  3AK2 A;  1N36 O;  3K9S A;  1NTZ H;  4H44 B;  5K1X A;  1FS0 G;  3O9O A;  2L6L A;  3LSS A;  3DTU B;  3ABK B;  2Z3Y A;  3SYC A;  4G27 B;  5FPO A;  5L3G A;  1U97 A;  2VQF O;  1NBM G;  4HAM A;  4FLZ A;  2GTA A;  4JTC B;  1E1Q G;  2UU9 B;  1TVK B;  1WP7 A;  3CX5 F;  5LYJ A;  2UUB B;  1BHA A;  2GDS A;  3SJC C;  1NT2 B;  2ZE8 A;  2EIJ B;  2QWQ B;  4DV4 B;  2NN4 A;  5EK0 A;  5EZY B;  4WFB V;  3TXQ A;  1N34 B;  3E89 A;  3ZMS A;  2K1E A;  4HBN A;  1NZ6 A;  1VQO V;  1SS3 A;  4DW0 A;  4X64 O;  1O9G A;  2OIE A;  4DV1 O;  1FYJ A;  1WPX A;  4WFE A;  5EBM C;  3KG2 A;  1YJW V;  4OPH A;  1SER A;  1KD1 W;  3ABM B;  2ZDI A;  4B3R B;  5B1O A;  2CE4 A;  3K0G A;  3CCE V;  3RGB A;  4RWU A;  1IXB A;  5EBW C;  3ZHU A;  1A32 A;  3CD6 V;  3J7A U;  2GHY A;  5EC2 C;  4X66 B;  1W59 A;  4CH3 A;  1YIT V;  4DYL A;  3LUT B;  2N74 A;  3ZRW A;  3HB3 B;  2Q0A A;  3JAW A;  3LSQ A;  3RT3 C;  2PY5 A;  4MVS A;  1QLN A;  3BAA A;  3RBZ A;  1M57 B;  3ZCC A;  4D7S A;  5IJ0 B;  4X64 B;  4B3M B;  5LXT B;  1TUB B;  5ITZ A;  3ETE A;  2C2A A;  3N2K B;  2FKX A;  4UVA A;  4GKK O;  1YZB A;  3WB2 A;  2Z5U A;  5KHJ A;  1XI1 A;  4FM2 A;  2X6A A;  2D3O W;  4NTW A;  4UV8 A;  5FPR A;  3KZI Z;  1S5L Z;  1YF2 A;  2B1G A;  1VF6 C;  3RVZ A;  4E4E A;  1G6U A;  2CAZ C;  3QO7 A;  2JS3 A;  3CXH F;  3L75 H;  4J9Y B;  1K4D C;  1QBZ A;  1THZ A;  4YHH O;  2UUA B;  2UU9 O;  3CP1 A;  4LFC O;  2ZIN A;  5KUM A;  1RSO A;  4F6R A;  5JJN B;  4LNU B;  2WSS G;  1CP9 A;  1NR1 A;  2RQ6 A;  4U7N A;  2VQF B;  1ORQ C;  1K9M W;  3SPH A;  3QO8 A;  1VQK V;  3N27 A;  4YIP A;  1Q7Y W;  2QDO A;  1OCR C;  1M93 A;  1EN4 A;  1NVP D;  2UUC B;  1BS3 A;  3FFQ A;  3JAT A;  4MS2 A;  4CZZ A;  2EZO A;  3IC7 A;  1YHQ V;  1AJN A;  1R3L C;  2JEX A;  2ADQ B;  3AG1 C;  4FLT A;  3F5W C;  2OCC B;  5AG2 A;  4FJC C;  5KHI A;  4J7K A;  1OZ0 A;  2PGG A;  1Y66 A;  4TV9 A;  1QVF U;  2YC0 A;  1CXZ B;  4DO2 A;  3CRA A;  3SDL A;  3CC7 V;  4K8X A;  2AGA A;  3L71 H;  3J80 N;  2ZXW C;  2LP7 A;  2JS5 A;  1AI7 A;  1PP9 H;  3JAR A;  2XTA A;  2JDI G;  1E79 G;  1Y67 A;  2Q7H A;  4FPP A;  1EZV H;  2ZIO A;  5LOV A;  4FZ0 A;  2WLL B;  4JI8 B;  1N32 B;  3CCL V;  1P49 A;  2ZNI A;  5KHH A;  4F6E A;  5H6R A;  2N05 A;  4H37 A;  3SR2 C;  3KCX A;  5KUK A;  1HWY A;  1I7F A;  2AXT Z;  4FMT A;  1KP3 A;  3UM7 A;  4TV8 B;  4I4T B;  4PV1 B;  3AG4 C;  5FNV A;  4DR4 B;  4W4K A;  2UXN A;  1KEC A;  5BXZ A;  1F4N A;  4MVZ A;  1MSD A;  3BPZ A;  4FLX A;  2ZM6 B;  1Z5V A;  4JI7 B;  3EFF K;  2V4D A;  4WFH A;  3SJB C;  2UUA O;  1FXK B;  2VQE O;  4YJ3 B;  3GVM A;  3O65 A;  2FB5 A;  1CPY A;  1SKV A;  5IYZ A;  2LGQ A;  5J2U B;  4IGG A;  2Q69 A;  2HVJ C;  5EYP A;  5JCO A;  5GTH Z;  1GN3 A;  1V54 C;  1SQG A;  4WFA V;  1YI2 V;  2EIK C;  2E76 B;  1AR1 B;  5LP6 C;  4DUY B;  2PI4 A;  1BZK A;  3HKC A;  3KKY A;  1OCC C;  4LH6 A;  4JI4 O;  3OMI B;  1IXM A;  3A8T A;  1SQX H;  3APO A;  2ZE7 A;  2KQX A;  1EN6 A;  2P67 A;  5KA6 A;  1ZAU A;  3E86 A;  1XMO B;  3CS5 A;  4LF7 B;  2Y0P A;  2FTK A;  1SZX A;  2WLI A;  5EIB C;  4JI2 B;  3CHX A;  3F7Y C;  4K0K O;  5J2T B;  3BFR A;  2E3C A;  1GAX A;  4ZOL B;  1RPO A;  4H33 A;  5KMG B;  4X66 O;  3P3N A;  2H94 A;  4O4I B;  2M7W A;  2Y4T A;  1Q90 D;  4LFB B;  4R7C A;  3ABT A;  3T4Z A;  5C93 A;  4DV2 B;  3MD0 A;  5CBH A;  1I94 B;  1AI6 A;  3HPL C;  2WWW A;  2KKW A;  2EIL C;  2EIM C;  3U10 A;  1KYO F;  4JYY A;  4MVU A;  4LP8 A;  3MDS A;  3CC4 V;  2EIN C;  1V55 C;  3RYH B;  1HW7 A;  1DK1 A;  5J2T A;  3GWK C;  2DOS A;  2X6C A;  2ZNJ A;  4DV7 O;  3ML0 A;  1VQ5 V;  2MK3 A;  4CS3 A;  4NKG B;  1EM1 A;  2RJZ A;  5LHG A;  1PL0 A;  4CH5 A;  3B4S A;  3G71 V;  2Y69 B;  4E2L A;  2ILM A;  1X59 A;  3OR7 C;  2IU3 A;  4I9W A;  1FFX A;  4DUZ O;  3DGE A;  2P22 C;  1KUQ A;  3JCZ A;  3G6E V;  2QKA A;  2RDC A;  3ASO B;  4XDL A;  4GX0 A;  2LO1 A;  1MSW D;  5H9C A;  4YHH B;  2M6Y A;  1YIJ V;  1WAZ A;  5IY5 B;  3CE2 A;  1MZF A;  1K73 W;  1RP3 B;  1QNM A;  3OMN B;  3L9D A;  3BHP A;  2R72 A;  2QR4 A;  4EEQ A;  1QHT A;  4UCO A;  2X7R B;  3SYO A;  3ZHR A;  1R3K C;  1SF9 A;  4OXS A;  3H01 A;  4DV1 B;  4UVC A;  1DF4 A;  3N2G B;  4YJ3 A;  1H2M A;  5LP6 B;  4X1Y B;  4FM0 A;  1AR4 A;  5FNV B;  1WA8 B;  1EBO A;  3BRC A;  5IWA O;  1ZTE A;  3B2E E;  2HP8 A;  1QCE A;  4U3J A;  4J10 A;  1GRJ A;  4DR1 B;  3JD2 A;  1ZL8 B;  1N0N A;  1J95 A;  2HJD A;  1K5S A;  3OEH G;  3OR6 C;  1QR9 A;  3E35 A;  1MNG A;  3CCJ V;  2QJ1 A;  3RYI B;  3SYQ A;  4I9Q A;  1PNK A;  3VQW A;  2XAF A;  2QTS A;  1LR1 A;  2KSD A;  2Q7G A;  3T1H O;  2IBZ H;  5B3S C;  3E83 A;  2XAG A;  4RUE A;  2R70 A;  3D36 A;  4LH7 A;  4X62 B;  2DYS B;  1VQ7 V;  5CA3 A;  5IJ9 A;  3B77 A;  1XNQ B;  2W6I G;  1AP5 A;  2NNU A;  4DV5 O;  5L3B A;  3H1K H;  2JEU A;  4YY3 B;  5CA0 A;  4PA9 A;  2A79 B;  3JAL B;  3LNN A;  4O2A B;  1FJG O;  3GWO A;  3P32 A;  3K58 A;  1N32 O;  1D2D A;  3VBB A;  4X20 B;  2K9P A;  2G38 A;  1NR7 A;  1TVK A;  3VOU A;  3JD0 A;  4TUY B;  3AG4 B;  5IJ9 B;  2W0F C;  3QVN A;  4Z1V A;  4NXN B;  3EVK A;  5BR8 O;  5LMN O;  1VQL V;  2Y48 A;  4GLX A;  1NQT A;  3TCU A;  3JAM N;  4K3A A;  2IJJ A;  5CMU A;  1NTK H;  3STZ C;  1HNX B;  3SPI A;  1K92 A;  2V1D A;  5B5E Z;  5LYJ B;  1IBK B;  2YXL A;  5E79 Z;  1MMM A;  3QTC A;  4MW8 A;  1ZWI C;  3H1L H;  5IY5 C;  1US6 A;  4JZ2 A;  2HEP A;  4P2Z A;  2QWR B;  1K34 A;  2A7W A;  3M99 B;  1LUW A;  1MA1 A;  2LW1 A;  2EIJ C;  2QGN A;  3FB8 C;  2OCC C;  4QPJ A;  5KHG A;  5K1P A;  3RVY A;  4BIZ A;  1YVW A;  2XAQ A;  2H8P C;  4ICG A;  5IYD O;  1MZE A;  1YCI A;  2YDE A;  1U96 A;  4NR1 A;  2N04 A;  4X1Y A;  2EJR A;  1KKC A;  3E2E A;  3M7M X;  4JI6 O;  4JI5 B;  2UXC B;  2QEX V;  1H2N A;  4DV6 B;  2YUA A;  4X88 A;  2P90 A;  2Y4U A;  2P5O A;  2F93 B;  3T2M A;  5H2F Z;  1EZJ A;  4QPK A;  2RNB A;  4JAS A;  1TAE A;  2WLK A;  1OCR B;  2ZE6 A;  4R50 A;  3TXS A;  3OT7 A;  1K5Q A;  2E75 B;  1YXB A;  4RAI A;  4UB8 Z;  2LJ2 A;  4UXN A;  3JD1 A;  4X9Q A;  2UUB O;  1H2S B;  5A9G A;  3ASN B;  1GM8 A;  4X1I B;  5KA5 A;  1XRE A;  4CS4 A;  2F1M A;  1W2B U;  1KP2 A;  4Q20 A;  1TUE B;  2GTS A;  4PDR A;  1FFT B;  4DR7 O;  2F66 C;  4MTX A;  1G1X B;  2XHB A;  3BAB A;  1PKX A;  2BTO A;  4Q6G A;  4MTO A;  4GT1 A;  1XMO O;  4DR3 O;  3OTF A;  1SA0 B;  1RFY A;  3IAY A;  1N33 B;  3ICX A;  1WP8 A;  2Z0A A;  1JPX A;  1WN7 A;  2WLJ A;  2IH3 C;  3OD4 A;  4TWK A;  2E74 B;  2IM9 A;  4OPA A;  1I08 A;  2IH1 C;  4JV5 B;  4QJF B;  4LR3 A;  4FFK A;  2F23 A;  4GX1 A;  3ZX6 A;  4LF9 B;  1XL4 A;  1ROP A;  3JD4 A;  3IC9 A;  1FXV A;  1SQP H;  1J5E B;  3K57 A;  2VQE B;  5JH7 A;  1M56 B;  2CUG A;  2UXD B;  3SJQ C;  1WB7 A;  2V7Q G;  4O4L A;  3SGI A;  4UCU A;  1QLE B;  1ENV A;  4XDK A;  1KMI Z;  4KXR A;  2AW9 A;  4GZR B;  1GKF A;  2JGD B;  4BAY A;  5DN6 G;  2VWJ A;  1H38 A;  1XOU A;  4MSW C;  3B8N A;  4XDJ A;  3ZN1 A;  4TV8 A;  1LUV A;  4DR3 B;  3T4D A;  3DC6 A;  4LWS A;  3UCS C;  4QE9 A;  3CSX A;  4MVR A;  2HKO A;  3LDD A;  4LF4 O;  1ZSP A;  1H8E G;  2PYJ A;  5IJ0 A;  2QE7 G;  2PI5 A;  1B06 A;  3AG1 B;  2ADP A;  1OCC B;  3ZBH A;  3HKD A;  3CRR A;  2YS8 A;  4I55 B;  2FL4 A;  4JI8 O;  4RUF A;  5B1N A;  2HLD G;  3ZRW B;  1B04 A;  1S5J A;  4PEL A;  1FKA O;  4OX9 B;  1AR5 A;  1ZUQ A;  2UXD O;  1ZLZ A;  2EZP A;  1BQ0 A;  1NKD A;  2CH7 A;  2RCV A;  3OUF A;  3OTO B;  1BMF G;  2YXH A;  2DQ3 A;  3CJH B;  4FLV A;  1GO3 F;  3BVO A;  1JMK C;  4NVP A;  1XNQ O;  4JPR A;  5E1A C;  1DF5 A;  2ITC C;  1IBL O;  3CC2 V;  1QR8 A;  4R6Z A;  4JYC A;  4J42 A;  2HR3 A;  4JYA O;  2PUS A;  4NXM B;  1PV0 A;  4H13 B;  5TIS Z;  5KHK A;  1VF7 A;  1KKD A;  1L0N H;  3CCR V;  1XHX A;  3CJH A;  3SYP A;  5B1A C;  3K79 A;  4LC1 A;  5BR8 B;  1UJW B;  3MHH C;  4DR5 O;  5LL6 Y;  2CGN A;  2YIB D;  3T1C A;  1VQ4 V;  3SPC A;  1AJQ A;  4U3J B;  2Y0I A;  1XDC A;  2RMK B;  4TQD A;  4J7Z A;  4MVO A;  4DV0 O;  1F4M A;  4JF3 A;  4W4L A;  1FXK C;  3Q4H B;  2A3Q A;  4HYO A;  4FZ1 A;  1AB3 A;  3D3Q A;  1IBK O;  2YID A;  1HNX O;  2GV9 A;  2Q68 A;  1M4U A;  4UV9 A;  2XND G;  2P4K A;  3D36 C;  2VRZ A;  4X1K A;  1IBL B;  3T1Y O;  1SQF A;  1I5X A;  1HNW O;  3J81 N;  3APQ A;  5B66 Z;  3B09 A;  1RM1 B;  2YIA A;  4DR7 B;  4PHZ A;  2VS0 A;  2EIL B;  2EIM B;  3ABK C;  4GYC B;  1Q81 W;  5CBG A;  1V9P A;  1Y74 B;  5C8Y A;  1PM9 A;  1SQQ H;  3A2F A;  4J9Z B;  1S72 V;  2YEV A;  1L0L H;  1K97 A;  4LFA B;  4OGQ B;  4NYK A;  4DV5 B;  1I0H A;  3I5D A;  4D6T H;  5FLX N;  1GK9 A;  1OCO B;  4UFZ A;  2Y69 C;  3K0D A;  3JAK B;  4P30 A;  3A0H Z;  4J80 A;  3T1Y B;  3K5O A;  4MVM A;  3ASO C;  3CMA V;  4X1I A;  3U0Z A;  4IYH A;  1KB9 F;  4EB6 A;  2WLN A;  3QNE A;  1I94 O;  2WLM A;  3WG7 B;  1AVM A;  5J9P C;  1DLB A;  3L72 H;  1IX9 A;  4J7J A;  3K04 A;  1WB8 A;  2XAJ A;  4NB5 A;  4PDL A;  5LOV B;  3UO3 A;  4EB6 B;  3JSN A;  4MVQ A;  1L1F A;  4OX9 O;  3H1I H;  3K08 A;  1W0J G;  4UCS A;  3WB1 A;  5LGU A;  2CH7 B;  2L35 A;  4G2K A;  4B08 A;  1HNZ B;  1Q43 A;  4LF5 O;  2DYR B;  2Q6A A;  1D5N A;  1R3I C;  3AG2 C;  4L87 A;  4GKK B;  1M57 C;  2Q5Z A;  5GTI Z;  4YY3 O;  4LF4 B;  1RM1 C;  1GM9 A;  5LA6 B;  1IUR A;  2DQ0 A;  4U7O A;  3FKS G;  4MTF A;  4X65 O;  4PA3 A;  4ZKI A;  4ZIB A;  2EJ7 A;  2Q0O C;  4B3S O;  4GCZ A;  4JZG A;  1OV9 A;  4O4J B;  4PA7 A;  3K5N A;  4JI5 O;  2UXC O;  2IW5 A;  4MW3 A;  3W7T A;  3ZJZ A; 
#chains in the Genus database with same CATH homology
 3ZMS A;  2K1E A;  3FYI B;  2QTO A;  1VQL V;  2Y48 A;  3I56 V;  3E8H A;  3ASN C;  1VQO V;  1NQT A;  3TCU A;  5IYB O;  3W7X A;  2IJJ A;  2XOK G;  2ZDI C;  4KUM A;  5CMU A;  3AG3 B;  4QIW F;  1WPX A;  3STZ C;  4WFE A;  3SPI A;  1K92 A;  2V1D A;  5EBM C;  3KG2 A;  4WFG A;  1YJW V;  1NVP B;  1SER A;  1KD1 W;  3ABM B;  2ZDI A;  4N23 A;  3OM3 B;  2P6J A;  4MW8 A;  1ZWI C;  5B1O A;  3MHS C;  5IY5 C;  2XAH A;  3K0G A;  5L3D A;  4P2Z A;  1K34 A;  3CCE V;  3M99 B;  5EBW C;  3CD6 V;  1GM7 A;  1K3E A;  2EIJ C;  1NH2 B;  3FB8 C;  2OCC C;  2GHY A;  4GX5 A;  2A0L A;  4QPJ A;  5EC2 C;  4Z1M G;  1YIT V;  1MOF A;  3RVY A;  1RPR A;  4BIZ A;  2XAQ A;  2H8P C;  4MTG A;  3LUT B;  3ZMZ A;  5IYD O;  1BL8 A;  5HFL A;  4WFF A;  3ZRW A;  3HB3 B;  3LSQ A;  2B5U A;  4MVS A;  2EJR A;  1QLN A;  2X0L A;  3E2E A;  1Q82 W;  3AG2 B;  1N8R W;  3RBZ A;  3BEH A;  1M57 B;  2OT5 A;  3OMA B;  2QEX V;  3ZCC A;  1R6K A;  4X88 A;  2P90 A;  3ETD A;  1VQ8 V;  1H2G A;  3K9A A;  3ETE A;  2C2A A;  3T2M A;  2EIK B;  5H6Q A;  1EZJ A;  1YJN V;  4QPK A;  4UVA A;  2Z5U A;  5CN0 A;  4CBC A;  1YTF B;  2D3O W;  2X6A A;  4JAS A;  4UV8 A;  3CCS V;  2WLK A;  1OCR B;  4R50 A;  4BW5 A;  4WF9 V;  2B1G A;  3RVZ A;  5LHI A;  5L3F A;  3ZIA G;  3QO7 A;  1K5Q A;  4GX2 A;  3SYA A;  4RAI A;  2BOC C;  4P9P A;  4J9Y B;  1K4D C;  1QBZ A;  1THZ A;  3FYE B;  3JD1 A;  4UXN A;  3ZMU A;  3CP1 A;  3ASN B;  3CYO A;  5KUM A;  1GM8 A;  2WSS G;  1CP9 A;  1NR1 A;  4U7N A;  3RW0 A;  2IJK A;  1ORQ C;  2IJI A;  3SPH A;  1K9M W;  3QO8 A;  1S76 D;  5KA5 A;  5IYC O;  1VQK V;  2LFR A;  2ZR3 A;  1S0V A;  1OHH G;  2DW4 A;  1Q7Y W;  1OCR C;  1QVG U;  2EBO A;  1W2B U;  1NVP D;  3ZRS A;  1KP2 A;  2QM8 A;  1TUE B;  4Q20 A;  1R73 A;  4PDR A;  1FFT B;  5B1A B;  4MS2 A;  4MTX A;  4CZZ A;  1ARO P;  2EZO A;  3I55 V;  1VQ6 V;  3IC7 A;  2ZQM A;  2P7T C;  3CXC U;  1AJN A;  1YHQ V;  1R3L C;  2JEX A;  3OEE G;  3AG1 C;  1PKX A;  4X8A A;  1K8A W;  5IDJ A;  3CPW U;  3E8B A;  4MTO A;  3F5W C;  4PDM A;  2OCC B;  4FJC C;  4TSF G;  4GT1 A;  1OZ0 A;  4JGS A;  1Y66 A;  5BZB A;  1G4Y B;  1AI4 A;  5EBL C;  3K3W A;  1JPX A;  1K4C C;  1QVF U;  2WLJ A;  2IH3 C;  1I5Y A;  4TWK A;  4DO2 A;  2AHY A;  3OGC C;  3E8F A;  2JK5 C;  1M1K W;  3OW2 U;  2A9H A;  2IH1 C;  3AG3 C;  3CC7 V;  1JVM A;  4LBE C;  4QJF B;  2ZXW C;  2LP7 A;  1AI7 A;  3W7S A;  1GMG A;  1Q86 W;  3OAA G;  4GX1 A;  2JDI G;  1PNM A;  1XL4 A;  1E79 G;  4FPP A;  2Q67 A;  1ROP A;  3JD4 A;  1VQ9 V;  5CBF A;  1FXV A;  2HJF C;  2WLL B;  4EKW A;  1VQN V;  3CCL V;  3ZJZ A;  1M56 B;  4I5S A;  3ZMV A;  3SJQ C;  1PD3 A;  2ZR2 A;  5H6R A;  3K03 A;  4H37 A;  1YJ9 V;  2V7Q G;  4KP4 A;  5KUK A;  1HWY A;  1QLE B;  3EHB B;  1CEZ A;  1AJP A;  1ENV A;  4XDK A;  2BOB C;  1XL6 A;  4FMT A;  3FB6 C;  1KP3 A;  1GKF A;  3GB7 C;  3UM7 A;  3X2Q B;  1M90 W;  4BAY A;  4LCU C;  5DN6 G;  3G4S V;  4R8C A;  1H38 A;  4MSW C;  3AG4 C;  2ZXW B;  3B8N A;  4P9O A;  4XDJ A;  3ABU A;  3ZN1 A;  1K33 A;  3SPG A;  2WLL A;  3T4D A;  2R9R B;  3CCM V;  2AHZ A;  2UXN A;  1KEC A;  1F4N A;  4MVZ A;  4QE9 A;  1S5H C;  2QKS A;  2HKO A;  3LDD A;  4MVR A;  1EFR G;  4XBF A;  1H8E G;  3EFF K;  4WFH A;  1FXK B;  1OCZ C;  3P30 A;  2QE7 G;  2PI5 A;  4WCE V;  3AG1 B;  3UKM A;  1OCC B;  1CPY A;  1V54 B;  1G8M A;  1JCH A;  3F7V C;  3JYC A;  4RUF A;  3QO5 A;  5B1N A;  1JJ2 U;  2Q69 A;  2HLD G;  2HVJ C;  3ZRW B;  4PEL A;  3LNM B;  3CCQ V;  3WG7 C;  3AEI A;  4FIP C;  1V54 C;  3OFN G;  2EZP A;  4JTA B;  4WFA V;  1P4R A;  1LNQ A;  3X2Q C;  4RO2 A;  1SZT A;  2EIK C;  1YI2 V;  1NKD A;  1COW G;  1AR1 B;  3OUF A;  2PI4 A;  3R65 A;  1BMF G;  1OCC C;  1R6N A;  2DQ3 A;  1IXM A;  3OMI B;  4JAU A;  3ZMT A;  1MG1 A;  4YXW G;  1GO3 F;  1W0K G;  2P67 A;  2CK3 G;  5KA6 A;  3E86 A;  4DXW A;  4G28 B;  4JPR A;  1M56 C;  1NJI W;  1DTO A;  5E1A C;  2W6J G;  1FXH A;  1DF5 A;  3ZN0 A;  2ITC C;  4KFM A;  1JOY A;  4PA4 A;  2FTK A;  3CC2 V;  1QR8 A;  1Y4M A;  2DWE C;  2WLI A;  4R6Z A;  3TK1 A;  3F7Y C;  4JYC A;  3ZRX A;  3STL C;  2HR3 A;  2ATK C;  2HFE C;  1S77 D;  2JJ2 G;  1RPO A;  4H33 A;  4ASU G;  5EC1 C;  4BIU A;  2DWD C;  1NH2 D;  4PDV A;  2H94 A;  1SET A;  1P7B A;  2R9I A;  2WPD G;  1KKD A;  4RQF A;  3CCR V;  2M7W A;  1GTO A;  4HZ3 A;  4R7C A;  3SYP A;  5B1A C;  1F23 A;  3K79 A;  3ABT A;  3FB7 C;  1R3J C;  4LC1 A;  2LFS A;  3T4Z A;  3MHH C;  5B3S B;  5C93 A;  1UJW B;  1B6Q A;  5DM6 V;  2NLJ C;  3MD0 A;  3ABL B;  5CBH A;  1AI6 A;  3T1C A;  1SRY A;  3HPL C;  2WWW A;  2EIL C;  2EIM C;  1VQ4 V;  3SPC A;  1AJQ A;  1FXK A;  4MVU A;  4LP8 A;  3CC4 V;  2EIN C;  5LGN A;  1V55 C;  4MVO A;  2X6C A;  1F4M A;  1QLE C;  2UXX A;  3ML0 A;  4JF3 A;  3ZRV A;  1VQ5 V;  5HFM A;  1FXK C;  1OCZ B;  3PJS K;  1YTF D;  1F51 A;  3OE7 G;  4HYO A;  2MK3 A;  5LHG A;  1PL0 A;  3WFV A;  3NXS A;  3G71 V;  2HG5 C;  2QM7 A;  1WLE A;  2Y69 B;  4E2L A;  2Q68 A;  2IU3 A;  3OR7 C;  4I9W A;  3ABM C;  4UV9 A;  3DGE A;  3D3I A;  2XND G;  3JCZ A;  1PNL A;  3W7W A;  3G6E V;  4ZBM A;  3ASO B;  4XDL A;  2DYR C;  2DYS C;  3OUS A;  1I5X A;  4GX0 A;  1JQ0 A;  5B1B B;  1MSW D;  1JX9 A;  5H9C A;  1YIJ V;  1BHB A;  5IY5 B;  1YSC A;  1RM1 B;  2WAM A;  1K73 W;  3ABK C;  2EIL B;  2EIM B;  5LHH A;  3OMN B;  1KC8 W;  1Q81 W;  2ZD9 A;  3ABL C;  5CBG A;  5L3C A;  5GW7 A;  4RQE A;  3CME V;  2ITD C;  2YSU B;  3K06 A;  2X7R B;  3IGA C;  3SYO A;  3FB5 C;  5B1B C;  4J9Z B;  4JYB A;  1H8H G;  4PA6 A;  1S72 V;  1R3K C;  1V55 B;  4JTD B;  4OXS A;  2YEV A;  3H01 A;  1VQM V;  1K97 A;  4UVC A;  1DF4 A;  1MAB G;  1K7D A;  2X6B A;  3CCU V;  1EBO A;  3B8M A;  3SPJ A;  5LBQ A;  3CCV V;  1GK9 A;  1OCO B;  4MT8 A;  1QCE A;  2Y69 C;  3K0D A;  2B1I A;  2IJH A;  3JD2 A;  4P30 A;  5L3E A;  2OTJ V;  1J95 A;  2JJ1 G;  4MVM A;  2WLH A;  3ASO C;  1K5S A;  2XAS A;  3OEH G;  1M9N A;  3IFX A;  3OR6 C;  1QR9 A;  3E35 A;  2KB1 A;  3CMA V;  3CCJ V;  2EIN B;  3SYQ A;  2WLN A;  2YEV B;  3QNE A;  4QNH B;  2WLM A;  3WG7 B;  1E1R G;  1DLB A;  1PNK A;  5J9P C;  3BY6 A;  2XAF A;  2F43 G;  3E8G A;  2XAJ A;  3A0R A;  3K04 A;  4PDL A;  2OTL V;  5B3S C;  4UUJ C;  2IU0 A;  4MVQ A;  1L1F A;  4FK5 C;  3E83 A;  2HVK C;  3K08 A;  1W0J G;  4N21 A;  5LGU A;  2XAG A;  4G2K A;  4RUE A;  2JIZ G;  3JD3 A;  3D36 A;  1VQP V;  2DYS B;  2DYR B;  2Q6A A;  5LGT A;  1VQ7 V;  5CA3 A;  3LDC A;  1R3I C;  3AG2 C;  3B77 A;  4L87 A;  4F4L A;  4X89 A;  1M57 C;  2W6I G;  2NNU A;  4QE7 A;  1S3J A;  5L3B A;  1RM1 C;  1FS0 G;  2JEU A;  1GM9 A;  2DQ0 A;  3LSS A;  3DTU B;  3ABK B;  2Z3Y A;  2A79 B;  4PA9 A;  3SYC A;  2WLI B;  1SES A;  4G27 B;  5L3G A;  1KQS U;  4U7O A;  1NBM G;  3FKS G;  4TT3 G;  3LDE A;  4HAM A;  4MTF A;  4JTC B;  3GWO A;  3P32 A;  4PA3 A;  1E1Q G;  4ZKI A;  4JAV A;  4GCZ A;  1BHA A;  3VBB A;  2EIJ B;  3W7U A;  4UVB A;  3TET A;  4PA7 A;  1AI5 A;  1NR7 A;  5EK0 A;  3VOU A;  1OCO C;  3JD0 A;  5FL7 G;  2IW5 A;  3AG4 B;  4WFB V;  2QA4 V;  4MW3 A;  3ETG A;  3W7T A;  2W0F C;  2GSM B;  3E89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...