1M1KW

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m1kW00
3CCEV 1VQ4V 3CD6V 1VQ8V 1KC8W 1K73W 3CC4V 4WFBV 4WF9V 1VQPV 1S72V 3CCSV 1VQ6V 1Q81W 4WCEV 1N8RW 1Q82W 3CC7V 1KQSU 1YIJV 1W2BU 1YJ9V 3CCVV 1YJWV 1VQLV 1Q86W 1VQNV 1M1KW 1R73A 1YHQV 3CCQV 1YITV 3I55V 1VQ9V 3CC2V 2OTJV 3CCUV 1YJNV 1NJIW 1QVGU 1YI2V 2QEXV 1VQOV 1JJ2U 3CXCU 1K9MW 3CCMV 2QA4V 3I56V 1VQMV 4WFAV 1VQ7V 1K8AW 1VQ5V 2OTLV 1VQKV 1M90W 3CPWU 1KD1W 2D3OW 1Q7YW 3G71V 3CMAV 3CCLV 3CCRV 5DM6V 3CMEV 3G6EV 3G4SV 3CCJV 3OW2U 1QVFU
chains in the Genus database with same CATH superfamily
3A8TA 2ZDIC 4F6RA 1BCCH 2EX3A 3E8HA 2YXHA 3BHPA 2VWJA 3E35A 4U3JB 3SYPA 5EBLC 1FFXB 2DQ0A 2A7WA 1GH6A 2YI8A 4X65O 5J2UA 1VF6C 3FD9A 2Y0IA 4X1YA 1M57C 1HP8A 3FKSG 1K73W 2Q7HA 3QG5A 4JASA 2BOBC 4LBEC 3RYFB 1SZXA 1QR8A 3E89A 1X4TA 4OPHA 5IWAO 2ZNJA 5LMNO 5KA6A 2UXBO 1V55B 4LF8B 2WLLA 1VARA 3OW2U 4PDMA 4PI2A 3SPJA 1DK1A 3TGUH 2AW9A 4B3MO 2OIGA 3VOUA 2HJFC 2LFRA 2AZ0A 2ZQMA 3ETQA 4DV4B 2R72A 5DEDA 2M7WA 3D36A 4H33A 1IBMB 3FX7A 2E5LO 1LNQA 3UM7A 2ETNA 3W7WA 3J81N 3SJQC 4H44B 4DUZB 4NB5A 4I50A 5FNVA 2P7TC 3BRCA 1YDXA 4O4JB 1YZBA 2VS0A 1ZWIC 2ZDIA 4CZZA 3AG4C 1QU7A 1VQ9V 2LW1A 4MVZA 3ML0A 4GX1A 5LA6A 2CAZC 2EJ7A 4I4TA 3ZRSA 3UQ8A 1SQBH 5KX5A 2VQFB 4NR1A 2JEUA 2EZPA 4UVBA 4LFBO 1R3JC 1ZL8A 3ZMTA 2JK5C 3BPZA 1K33A 3JAWA 1FXKA 3ZX6A 2JS3A 4YIPA 3X2QC 2P22C 5IY5C 3IGAC 4TWKA 2IJIA 1Z5VA 4KHPB 3RVYA 4JI2O 3JD1A 4LNUB 4O4HA 2Q7EA 1JQ0A 4JI7B 4X9QA 5B5EZ 2H8PC 2OCHA 3OEEG 2UUAO 4FLZA 3OR7C 1H2MA 1Y74A 2UXXA 1THZA 4X64B 3OUFA 4DW1A 4R8CA 5JCOC 1XMQB 2YXYA 5JQGA 2RQ6A 4JI1B 4MTGA 3BY6A 1H2KA 1P4RA 3JD0A 3CCMV 1FYJA 5KMGA 5LHIA 1WN7A 1TVKA 3AG1B 2WLMA 1KUQA 1FJGB 4WFFA 2IU0A 3JASA 3K57A 4LF6B 3AK1A 4DR3O 2UUCO 4K3AA 3ABLC 1OCZC 4OX9O 1HR0B 4TV9B 1KB9F 4YJ2B 1N4CA 2GV9A 4P2ZA 3HKEA 1YCIA 4LP8A 4YXWG 4IL6Z 2QKAA 4H13B 1Q6IA 3BA8A 1PP9H 2ZR3A 4QGPA 2VQEO 1Q86W 3UT5A 1XDCA 3UCSC 4PJ0Z 4WBNA 3CCUV 3K5OA 4QNHB 3K5LA 3VQWA 4WFAV 2V7QG 1QNMA 1J5EO 3ABUA 2XOKG 4JI5O 4UFZA 4AILC 4KXRA 5CN0A 4ZI7B 1XILA 1FS0G 4X1IB 1IVSA 2EULA 1XMOO 4G28B 5EC2C 3THOA 3CCSV 1Y66A 5IJ0A 1KQSU 1AP5A 3C3TA 4YY3O 5JCOA 1XNQB 3I55V 1NJIW 2Q73A 1QLEC 5L3CA 4I55A 3K04A 5EYPB 3IC7A 1AJQA 1IBLB 5EK0A 2OT5A 3TXQA 3H1KH 1RPRA 1RM1B 1JOYA 1V54C 3GWKC 4FFBB 2OTJV 4FLXA 2QWNB 4U3JA 1AI5A 3T4ZA 1EN6A 5KAFZ 2R9RB 5BMVB 1XNRO 1FFXA 1Q5OA 2ARHA 1E1RG 4DV7B 2XUMA 2QWQB 1N36B 4PDVA 1WP7A 4JTCB 4ABMA 1R6KA 1N34O 4K0KO 4UUJC 3RYFA 1M9NA 3AG2C 3B8NA 4JPRA 1AROP 1WB8A 5JH7B 1R6NA 2LFSA 3DXRB 4B3SB 3RYCB 3VQXA 4GZRB 1SESA 4AQYO 2YS8A 3F7VC 4DXWA 1VF7A 1VQ8V 2FKXA 2ODMA 5LP6B 4DUYB 4QE7A 2B5UA 4Z1VA 1VQPV 2CTWA 3ETDA 1F23A 2MK3A 3CRCA 4PA9A 4IT5A 1AVMA 2WPDG 4MVSA 2IBZH 4FMTA 2CUGA 3OE7G 4WFGA 4XDJA 3OT7A 3BAAA 3T2MA 2A9HA 4PA6A 1S5LZ 2F4VO 4X66O 1EZJA 1P7GA 2PI5A 1D5AA 3JARB 3JALB 4MTOA 5B1NA 1LUVA 4EFBA 2OIEA 1MG1A 4KFMA 1KECA 4DR4B 1YVWA 2DOSA 4RQFA 2HVJC 4O4JA 3WG7B 4DV0O 5CB4A 3RT3C 2V4DA 1O9GA 4XDKA 5BR8O 2Q68A 2Y69B 3QTCA 1OCOB 2ZXWC 3FAVB 2WA4A 1I94O 2IH1C 5KHGA 5LYJB 4A5UB 4DV3B 3H1HH 2Y4UA 2MW2B 3OGIB 3QNEA 4J9ZB 4DV5O 4NTYA 5B3SC 4UCOA 2AZ2A 4CH6A 5CBHA 1GRJA 3IAYA 2B1GA 4LNUA 4DR1B 2CGNA 1K92A 4I0XB 4DV1B 3R65A 3O65A 4YIOA 1TUBB 1F4MA 3CCQV 4DR5B 4K8XA 5IE9A 1OCCB 5EC1C 3WU2Z 4MT8A 4GT1A 1E79G 1Q8IA 5LL6Y 2OWOA 4OXSA 1Y6XA 1XL4A 4P9PA 4RO2A 1AR4A 2F1MA 4R50A 3E83A 5C93A 3D3QA 2YEVB 3B4SA 4IGGA 1RM1C 5HFMA 1VP7A 5HFLA 4LH6A 4X62B 1JJ2U 2ZIOA 2ITDC 3WB0A 1SZTA 3IJ4A 5KUMA 4L87A 3N2GB 4TV9A 2N74A 3CXHF 4MSWC 4DW0A 4YJ2A 1TA8A 4TOIA 2Q67A 2Q0OC 1M57B 4R7CA 3LDEA 4DK1A 3A0HZ 2CGOA 1F4NA 3JAWB 4X88A 2CTQA 3L70H 4WCEV 4DV6O 4JV5B 1W0JG 3J7AU 1Q43A 5D5QA 1Q6UA 3OD4A 1XBLA 3QO8A 4O4HB 3ZMUA 3G67A 1H8EG 4DV2B 1AI6A 1GTOA 3K9SA 4ICGA 3M7MX 2BOCC 1KKDA 1RSOB 5CMUA 5LHHA 3LUTB 2UXDO 2NR5A 4ZI7A 3CHXA 5LP6C 4O2AB 1HNWO 1M4UA 5JQGB 4K35A 1WP8A 4JGSA 5EZYB 4G2KA 1NT2B 2A3QA 1WAZA 4B3RO 1TVKB 4CH4A 2EIMC 3CCRV 1EN5A 5EYPA 4UCUA 1G4YB 3E22B 2B1IA 1KU9A 1ZSPA 1DF4A 2HJDA 1HDJA 2DQ3A 3AG4B 1G6UA 1N0JA 2HFEC 2LGQA 4D7TA 2Y69C 3LNMB 3ZHVA 4UV9A 3HKEB 5ITZA 2A79B 3ICXA 4JAVA 5BMVA 3CMAV 1GAXA 2ADQB 3G80A 1WJZA 4DO2A 4WF9V 1HNZO 3KKYA 3SYCA 3NR7A 4AI8A 2KSDA 1S76D 3N2KB 1MNGA 3X2QB 2IW5A 2N05A 3CB2A 5JH7A 5CBFA 3DXRA 3RYCA 1M56C 4LF4O 3J80N 2GUZB 4WFHA 4MW8A 3CP1A 1NI8A 5LP6A 1Q82W 2ZT9B 4B3TB 3K03A 5EBWC 2UXBB 2QKCA 1OCCC 3K0DA 1SQVH 4F6EA 4B3MB 1U97A 2DJVA 1YF2A 3OEHG 2PF4E 5L3FA 3JARA 3JALA 2E3CA 2QM4A 2GHYA 1CXZB 1B3QA 3ABLB 1OCZB 3H01A 1NKDA 2QEXV 1O9HA 2WSSG 1IBKO 3FAVA 3CCLV 1P84F 2LQTA 2UXNA 3EVKA 4JI8O 1NQTA 1W59A 4DR2O 5FL7G 1KBHA 3RWRD 1OCRB 4UVAA 2FYUH 2Z5UA 4BW5A 5LYJA 3K06A 2B9ZA 3W7TA 1VF5B 1K34A 1SS3A 4DR6O 3JAKB 3ZRXA 1K97A 2E76B 3QO7A 1FXVA 3E2EA 3U0ZA 4J9YB 1GN6A 1ZUQA 5A9GA 2JRIA 3T1HO 5AG2A 2QDOA 3S3XA 4I0XA 2IM9A 1AJPA 1WPXA 3TJTA 3ZHTA 5KHIA 3ZMZA 5KAIZ 4GKKO 1N33B 1TUBA 3MDSA 1ENVA 3RYHA 2CDYA 4JZ2A 3K79A 1I0HA 1QLEB 3KCXA 1JA8A 4JI4B 5L3DA 5DM6V 3APQA 3K9AA 2CE4A 3LSSA 5CB4B 3ABMB 5JJNB 1PNKA 5L3GA 2E75B 2YEVA 1V54B 1OZ0A 3ASNB 1BMFG 4GYCB 1GO3F 2Y4TA 2IJKA 1DGSA 1L8DA 4FLTA 3RYIB 2F66C 1GM9A 4I9WA 1K3EA 3N2GA 2DYSC 1VF6A 1ORQC 4W4LA 4FFKA 3RBZA 1FXHA 4CH3A 1Q81W 5JWPA 3JSLA 2QR4A 2FL4A 2P90A 3DSQA 2DN9A 3AG2B 4O4IB 4PA4A 2X6AA 2XASA 1GM8A 3NXSA 4AHCA 2D3OW 1Q7YW 1OHHG 3W7UA 4JI6O 4MTXA 1RSOA 4NTWA 4FK5C 4JAAA 1I7FA 1COWG 3K5NA 4C7UA 4LF9O 4O2AA 5F2VO 4JI5B 1SRYA 1AI4A 1R6TA 3U10A 1P7BA 1UPGA 1M93A 5EZYA 2WLKA 1GM7A 1XREA 3SPIA 1DLBA 1IBMO 4ZHQB 3CMEV 2LW7A 2K1EA 3HR0A 1PL0A 1PNLA 4HNAB 3E22A 5IT9N 4NXNO 3RGBA 3ZRWA 4LFAO 5GONB 2WA3A 4N23A 2ZXWB 4FLYA 1QR9A 1ROPA 3UO3A 3TETA 3HB3B 4JYBA 3RVZA 3JSNA 4ZOLB 4HZ3A 5EIBC 1WLEA 1KKCA 1JPXA 1OCRC 1MOFA 3RFRA 3JD2A 2VQFO 5DN6G 1XNRB 5KHKA 5D5PA 3N2KA 5B3SB 3B09A 3BA9A 4RUEA 3B8MA 4FM0A 4QPJA 4KHPO 2GUZA 4U3FH 2XTAA 1R3IC 4JI7O 4J7KA 3T1YB 3ZCCA 1W0KG 2CTRA 2H94A 5FPOA 2LJ2A 3FB8C 2XNDG 2P5OA 4X64O 2HR3A 4F4LA 4MVUA 1VQ7V 1NU1H 4JI1O 3CYOA 2BSKB 1X59A 3ABMC 1NTZH 2PUSA 1SERA 2F4VB 3VQVA 4X66B 4FZ1A 3ASNC 1ZAUA 1Q6HA 3B40A 3JAMN 2LO1A 2ZE6A 1JMKC 1B04A 4PV1B 4GX5A 3SPCA 5ITZB 3K58A 2EILC 1WA8B 2Y48A 4DV0B 3G4SV 1AR1B 1SF9A 1OJHA 5JVDB 2VWKA 4EKWA 2YIAA 3OMAB 3BEHA 2Q69A 3L71H 2QE7G 5BY1A 4OGQB 4NVPA 1I94B 3C90A 1SKVA 3CX5F 4IIJB 1J95A 1YTFB 2BTQB 3JAKA 1GMGA 4JTDB 4FPPA 3H1JH 3M99B 4QPKA 4X20B 4FLWA 3CC4V 4DV5B 4DR7B 3LDDA 1EBOA 1JX9A 2XAFA 4FJCC 5FLXN 1ZX3A 2X6CA 2ZE7A 5GTIZ 1G1XB 1XNQO 1CP9A 5B66Z 2EIMB 1JR9A 3HKCA 2JGDA 1JCHA 1MZFA 4LWSA 2GTSA 1A32A 1IZ3A 1SQPH 4GLXA 4JI0B 3DC6A 4D6TH 4JYAO 5IJ9B 4MVMA 1IBLO 3GVMA 3CCVV 1YJWV 1XUQA 2CH7A 4H0LB 4JI3O 3ASOC 1U96A 5KHJA 1RPOA 2AGAA 2EINC 2EIKC 1VQKV 4X8AA 3D3IA 4PA7A 4YJ3A 2JJ1G 3E8BA 1NVPB 3RYIA 2ITCC 3CCJV 3EFFK 2R70A 4Z1MG 3BVOA 3OMNB 2OCCC 4PA3A 4TSFG 4J7JA 3F7YC 4DV7O 2BCCH 1N36O 4JF3A 3RW0A 5IYBO 2UUBB 4O4IA 5CA3A 2HP8A 1US6A 1T5EA 1TAEA 3FB6C 3ZIAG 1FAFA 1M56B 1NR1A 1S5JA 2F43G 3STZC 3LNNA 5LMUO 3CC7V 3OTOB 2M6YA 3D8CA 3RYHB 2ZINA 4DUYO 3S3WA 2R9AA 3ETEA 1Y67A 1N32O 1LR1A 5TISZ 2F23A 1H38A 4O2BB 5H2FZ 4ZHQA 2QKSA 3P3PA 3FYEB 1XI1A 4HNAA 4TQFA 1BHAA 1I5XA 1PM9A 5J2TA 2F93B 1I5YA 1WPBA 2QM7A 5GONA 3ZN0A 2ZM6B 2P67A 4CS4A 3C3SA 3L72H 4HBNA 2DYRB 1KD1W 1XL6A 1Y76B 1R1BA 2RCVA 4ZOLA 4JYYA 1SETA 1K4DC 3FFQA 3ZHQA 2W0XA 5LOVA 3ABTA 3OTFA 5H5NA 2KB1A 3OFNG 4LF5O 3HKDB 4ZBMA 4CH5A 1N0NA 2AHYA 3I5DA 4LCUC 4KUMA 4NXMO 1ZTEA 2RN9A 1HW7A 1K7DA 4DR1O 3H1IH 3ZJZA 4DV1O 4LF4B 2UU9B 5CBGA 2HHHB 3OR6C 4YHHB 1K5SA 3OAAG 4FLUA 1VQMV 2UXCB 1FD9A 1L1FA 2GDSA 1K4CC 3SYQA 1SQQH 3LSUA 2W6JG 4MVQA 3HPLC 3SJAC 4UCTA 2ZNIA 2EIJC 3ETGA 4GX0A 2QGNA 1GK9A 2P06A 4BIOA 4RWUA 3CEIA 1H2NA 2Q9LA 3ZRWB 2BSKA 3WB1A 2A06H 1R3LC 2W0FC 5GW7A 4UCSA 4BAYA 4BR6A 3JD3A 4DK0A 1HNXB 1F7YA 1NH2B 2N04A 2QWPB 3JD4A 5B1BC 3G71V 4X62O 1WA8A 5L3BA 2DYSB 3CCEV 3A2FA 1JJOA 5CA0A 3CSXA 1XQ8A 5IYZB 5JVDA 4U7NA 1AB3A 4X65B 2G38A 3H1LH 4LFCO 1H8HG 4JI8B 4IIJA 1UFIA 3I56V 3JATB 2BTQA 2AHZA 4N21A 1S5HC 1MMMA 4X20A 2LP7A 4GKJO 5IWAB 4DR6B 4DV2O 5LMNB 1NTKH 1VQLV 3VBBA 3AG3C 3APOA 4FLVA 2Z0AA 5A2QN 2QJ1A 1G8MA 4DRXB 1K9MW 4RQEA 3OMIB 2FMLA 2GSMB 5JJJB 4PHZA 1B06A 3P32A 4GKKB 3CRQA 4ASUG 3FYIB 1KP3A 3SGIA 1MABG 4RUFA 3CRRA 4TT3G 3MD0A 2X6BA 2E5LB 1MA1A 5IJ9A 1IXMA 3WB2A 3ZEDA 1QHTA 1YXBA 2PZSA 2K9PA 3CPWU 2DYRC 2YI9A 3CJHB 5C8YB 3Q4HB 5IDJA 3LDCA 4BIUA 4P30A 1KMIZ 2L35A 1VQNV 5FPRA 1CEZA 2WWWA 3SDLA 1BSMA 1MSDA 3F5WC 4LF7O 3ZHUA 4LFBB 1WB7A 2IJJA 1XHZA 1KYOF 1I08A 3QVNA 3T1CA 1UJWB 1H2LA 5B1OA 4I5SA 1FXKC 4XDLA 1E1QG 3CRMA 2Q7GA 4JI2B 1GN4A 3L9DA 2UUAB 1RFYA 1PD3A 4JI6B 2QA4V 4B3TO 2VRZA 1OV9A 3JYCA 3HKCB 4WFEA 2JGDB 5L3EA 1TUEB 4UXNA 1IDSA 2HG5C 4LWSB 4LF9B 4JYCA 4O2BA 1DTOA 3WFVA 1KC8W 1BQ0A 1WNSA 3UO2A 3FB5C 2Q4PA 4L8JA 3MAQA 2IU3A 1Y4MA 2CH7B 3E86A 3GB7C 1NS1A 2HKOA 1BT8A 3TK1A 2JVDA 2D2CB 4MW3A 4YJ3B 2EILB 1CPYA 4PD4F 2Z3YA 4NXNB 4LFAB 4FIPC 4DR3B 2UUCB 1XEQA 1Y76A 3PJSK 1S72V 4OX9B 4G27B 1YIJV 3K3WA 5LHGA 2XAJA 2QTSA 1JVMA 2X7RB 5B1AC 4QE9A 5LGUA 2YUAA 2A0LA 1M5IA 1AR5A 2JJ2G 4JZGA 3L73H 4O4LB 3U11A 1YTFD 3HKDA 4UB8Z 2VQEB 4UCRA 3KCYA 3G6BA 4LF8O 3EXAA 3CS5A 1W2BU 4TV8B 1J5EB 1Z5WA 3MHHC 1QQCA 5J9PC 3CXCU 4DV4O 4Q20A 1N33O 1XMOB 4FVMA 4D7SA 1B6QA 2KG7B 2P4VA 2WLIB 2Q0AA 1PV0A 2E74B 5E1AC 1SA0A 2RDCA 3RN4A 4YY3B 3ABKC 2ZD9A 2PI4A 4Q6GA 4JI4O 4E4EA 3BABA 4DUZO 1TGOA 2Y0PA 5J2TB 1YHQV 1BL8A 2JS5A 2X0LA 4QJFB 4LH7A 1QVGU 3ASOB 3UKMA 3A0BZ 2W6IG 2EZOA 1K5QA 2EINB 2EIKB 1M90W 2ZKOA 2O57A 1Q90D 4NTXA 4CS3A 4B08A 3G6EV 3W7XA 1NVPD 4EEQA 2OCCB 5LOVB 1IXBA 2PYJA 1HWYA 5IYZA 2WAMA 2HVKC 4MS2A 1BQZA 3OGCC 4B7KA 5K1PA 4FZ0A 3JATA 1N34B 2EJRA 1AI7A 1QVFU 4K0KB 2IJHA 1EZVH 1URFA 4MVRA 2ZE5A 3ZRVA 2ADPA 2P6JA 3JCUZ 3R66A 3BFRA 5LXTB 5H6QA 4AQYB 3DGEA 4J41A 5JJEB 4BW9A 1XMQO 4DRXA 1V55C 3DTUB 2V1DA 1P49A 3HKBB 2PYLA 3F5TA 3VQYA 3JCZA 3AK3A 1R73A 1FJGO 1BZKA 1GN2A 2WLHA 3SYOA 1YI2V 2H3OA 4NKGB 4X89A 4LF6O 2QTOA 3CWBH 1NTMH 1PNMA 1Z2GA 4JYAB 3P3NA 2YICA 1JFFB 4EB6B 2YDEA 3N27A 1L0NH 2JGUA 1HR0O 3CJHA 1FPOA 4J10A 5C8YA 4KP4A 3Q4HA 5CA0B 5BR8B 4JI3B 1QBZA 5K1XA 3TXSA 1M1KW 3B77A 1YJNV 1XHXA 2DWEC 1YSCA 4IHJB 1V9PA 2QSAA 2QWRB 4W4KA 2LGWA 4K8ZA 4CS2A 1VEWA 2F95B 2Q8VA 3PN1A 1NZ6A 4UB6Z 4X1KB 5IYCO 1H2GA 3E8FA 4FM1A 2ZIMA 3O9OA 3T1YO 3SJBC 4EFEA 1EFRG 2PGGA 5KLVH 4JAUA 5LMUB 3M8AA 4UCVA 1GKFA 5LBQA 4FM2A 3L74H 1QLNA 2WLNA 2EIJB 1VQ6V 2L6LA 3ZHSA 4GX2A 5CA1B 1YEWA 2XHBA 4P9OA 1N32B 4PDLA 2C2AA 2HEPA 2NLJC 4TUYB 3ZBHA 4E2LA 3BCCH 3DC5A 4CC5A 5LGNA 2FB5A 4NYKA 2YIDA 5B1BB 3AG1C 1NH2D 1LUWA 1VIBA 3SPHA 4F6RB 3H9VA 2Q6AA 1R3KC 4KL1A 2YXLA 2ZE8A 3CRAA 1D5NA 3P30A 5BXZA 5J2UB 2QM8A 2JEXA 4X1YB 2FTKA 4DV6B 4O4LA 4B3SO 5EBMC 1S0VA 3AEIA 1PPJH 4GUNA 2XT9A 4LF5B 4J7ZA 3AG3B 1MSWD 1BGYH 2JDIG 4PELA 4DR7O 4TV8A 4BIZA 4JTAB 2ATKC 2EBOA 2UXDB 3ZHRA 4NXMB 1NR7A 2WLLB 5BZBA 1HNWB 1QCEA 4GCZA 2JIZG 2KG7A 2WLIA 4CBCA 4WFBV 2YSUB 1S77D 1N8RW 3ZMVA 3K5MA 1PKXA 1DF5A 1S3JA 2GTAA 4B3RB 5KA5A 2RNBA 5KUKA 3OM3B 4DR4O 4JI0O 1VMGA 3OUSA 5IYDO 2KQXA 2ZCEA 5DECA 1FKAO 2YIBA 4I50B 5FNVB 1BS3A 4OPAA 4H37A 3A0RA 2Q5ZA 1MZEA 4I7ZB 4I9QA 2DMXA 5EIBD 1H2SB 2CK3G 4DYLA 1BHBA 1D2DA 3MHSC 1YITV 5LA6B 2OTLV 4I4TB 3LSQA 2R9IA 3E8GA 4TQDA 4BWAA 2DWDC 1KP2A 3ZS8C 5KX5B 4IYHA 4DV3O 5LGTA 1HNZB 4MTFA 4Z2WA 1ZL8B 2UUBO 2XAQA 4MVOA 4HYOA 4LFCB 4ZKIA 1FXKB 2YC0A 1EM1A 1RP3B 5H6RA 4R6ZA 4QIWF 2ZR2A 1YJ9V 2RMKB 2PTMA 5LXTA 3OTOO 2ILMA 4CC6A 1PL4A 4PDRA 4GKJB 1IX9A 2AXTZ 1AJNA 3K0GA 4DR5O 1SA0B 2DE0X 1Y74B 4XBFA 3HKBA 1GN3A 4X1IA 2XAHA 3IC9A 2QWOB 1Q3EA 4J42A 1F51A 3KZIZ 3CC2V 4J80A 4B7EA 2WLJA 2HLDG 2CTPA 3STLC 1XOUA 5KMGB 3SPGA 3B2EE 2ZM6O 4PI0A 3T4DA 1JFFA 4EB6A 3JASB 3GWOA 1EN4A 3WG7C 3FB7C 4HAMA 5GTHZ 1IBKB 1NBMG 5B1AB 4FFBA 1OCOC 2XAGA 1VQOV 4JV5O 3EHBB 4IHJA 4DR2B 1AP6A 3ZMSA 1SQXH 1BE3H 3SJCC 1FFTB 1VQ4V 3W7SA 3AK2A 3CD6V 2NN4A 1IURA 3QO5A 1SQGA 2IH3C 3UT5B 2KKWA 5KHHA 4LF7B 4WBNB 4X1KA 3K59A 3L75H 3TCUA 5IY5B 3T1HB 2GBOA 5E79Z 1K8AW 3SR2C 4LR3A 3AG7A 1VQ5V 2PY5A 3ZN1A 2UU9O 4RAIA 2HHHO 3K08A 3SYAA 4YHHO 3QF7A 2UXCO 5IJ0B 3ABKB 2NNUA 1ZLZA 1SQFA 3D36C 2OYQA 5CA1A 3IFXA 4LC1A 2DW4A 4U7OA 4UVCA 5H9CA 4TUYA 4I55B 4ZIBA 3CE2A 2BTOA 4UV8A 4IYIA 1SC5B 1AILA 2P4KA 4J11A 2BE3A 3KG2A 2YIBD 1HNXO 1L0LH 2RJZA
chains in the Genus database with same CATH topology
4R7CA 3CC4V 3LDEA 3ABKC 2ZDIC 2ZD9A 2PI4A 1F4NA 4X88A 3E8HA 4WCEV 3LDDA 1W0JG 1EBOA 3E35A 1YHQV 1BL8A 1JX9A 2X0LA 2XAFA 3SYPA 4FJCC 4QJFB 1QVGU 3ASOB 3UKMA 5EBLC 2W6IG 2DQ0A 2X6CA 2EZOA 1K5QA 2EINB 3QO8A 2EIKB 1M90W 3ZMUA 1CP9A 1H8EG 1AI6A 1GTOA 2EIMB 1JCHA 2BOCC 3G6EV 1KKDA 5CMUA 1M57C 5LHHA 3LUTB 3W7XA 1NVPD 3FKSG 1K73W 2OCCB 4JASA 2BOBC 4LBEC 4MVMA 4JGSA 1HWYA 1QR8A 2WAMA 3CCVV 1YJWV 3E89A 4G2KA 2HVKC 4MS2A 3OGCC 3ASOC 1RPOA 2EINC 5KA6A 2EIKC 1VQKV 1V55B 4X8AA 3D3IA 4PA7A 2JJ1G 2EIMC 3E8BA 3CCRV 1NVPB 2WLLA 3OW2U 2ITCC 4PDMA 3CCJV 1G4YB 1AI7A 2EJRA 3EFFK 3SPJA 1QVFU 2B1IA 4Z1MG 1DF4A 2IJHA 2OCCC 2HJFC 2LFRA 3OMNB 4MVRA 4PA3A 3VOUA 2ZQMA 4TSFG 3ZRVA 2DQ3A 2P6JA 3AG4B 2M7WA 3D36A 4H33A 2HFEC 3F7YC 4JF3A 5H6QA 2Y69C 3LNMB 3RW0A 3DGEA 1LNQA 5IYBO 4UV9A 5CA3A 3UM7A 1V55C 3W7WA 3FB6C 2A79B 3ZIAG 3DTUB 4JAVA 3SJQC 3CMAV 2V1DA 1M56B 1NR1A 2P7TC 4DO2A 2F43G 3STZC 4WF9V 1ZWIC 2ZDIA 4CZZA 3CC7V 3SYCA 3AG4C 3JCZA 1R73A 1S76D 1VQ9V 3X2QB 4MVZA 2IW5A 2WLHA 3ML0A 3ETEA 3SYOA 1YI2V 4X89A 4GX1A 2QTOA 5CBFA 1PNMA 3ZRSA 1H38A 1M56C 2QKSA 4KP4A 2JEUA 2EZPA 4WFHA 4UVBA 4MW8A 1R3JC 3CP1A 3ZMTA 3FYEB 2JK5C 1K33A 1QBZA 1Q82W 1FXKA 1BHAA 3K03A 5EBWC 1I5XA 1M1KW 3B77A 1I5YA 3X2QC 1YJNV 2QM7A 5IY5C 3IGAC 3ZN0A 2DWEC 1OCCC 3K0DA 4TWKA 1YSCA 2P67A 2IJIA 3RVYA 2DYRB 1KD1W 3JD1A 1XL6A 1JQ0A 3OEHG 5L3FA 2H8PC 3OEEG 3OR7C 2UXXA 1THZA 2GHYA 5IYCO 1SETA 1K4DC 3OUFA 1H2GA 3E8FA 4R8CA 3ABTA 4MTGA 3BY6A 2KB1A 1P4RA 3ABLB 1OCZB 3JD0A 3H01A 1NKDA 2QEXV 3OFNG 3CCMV 2WSSG 1EFRG 4JAUA 4ZBMA 5LHIA 3CCLV 3AG1B 1GKFA 2WLMA 5LBQA 2AHYA 2UXNA 4LCUC 1NQTA 4KUMA 1QLNA 2WLNA 5FL7G 2EIJB 1VQ6V 4GX2A 4WFFA 1OCRB 4UVAA 2IU0A 2Z5UA 4BW5A 4P9OA 1K7DA 4PDLA 3K06A 3ZJZA 2C2AA 2NLJC 3W7TA 3ABLC 1OCZC 1K34A 4E2LA 5CBGA 3OR6C 5LGNA 3ZRXA 1K5SA 1K97A 3OAAG 1VQMV 3QO7A 1L1FA 1FXVA 4P2ZA 3E2EA 1K4CC 5B1BB 3AG1C 1NH2D 3SYQA 4J9YB 2W6JG 4LP8A 4MVQA 3HPLC 4YXWG 3SPHA 2EIJC 3ETGA 2Q6AA 4GX0A 2ZR3A 1AJPA 1GK9A 1R3KC 3ZRWB 1WPXA 1Q86W 3ZMZA 1R3LC 2W0FC 1ENVA 5GW7A 4BAYA 3CCUV 3JD3A 4QNHB 1NH2B 3P30A 4WFAV 2V7QG 2QM8A 2JEXA 3JD4A 1QLEB 3K79A 5B1BC 3ABUA 2XOKG 2FTKA 3G71V 5CN0A 5L3DA 5DM6V 1FS0G 5L3BA 2DYSB 3CCEV 5EBMC 3K9AA 1S0VA 3AEIA 4G28B 5EC2C 3CCSV 1Y66A 3LSSA 3ABMB 1PNKA 5L3GA 4U7NA 1KQSU 2YEVA 1V54B 1OZ0A 3AG3B 3ASNB 1MSWD 1BMFG 2JDIG 3I55V 4PELA 1NJIW 1GO3F 4BIZA 1H8HG 4JTAB 2ATKC 2IJKA 2EBOA 3I56V 1NR7A 1QLEC 5L3CA 2AHZA 2WLLB 3K04A 1GM9A 4I9WA 1K3EA 3IC7A 5BZBA 4N21A 1QCEA 4GCZA 1AJQA 1S5HC 2JIZG 2DYSC 2WLIA 1ORQC 4CBCA 5EK0A 3RBZA 2LP7A 1FXHA 4WFBV 2OT5A 2YSUB 1S77D 1Q81W 1N8RW 1RPRA 3ZMVA 1RM1B 1JOYA 2P90A 1PKXA 1V54C 1DF5A 1VQLV 3VBBA 3AG3C 1S3JA 2OTJV 5KA5A 5KUKA 3AG2B 3OM3B 1G8MA 4PA4A 2X6AA 1AI5A 2XASA 3T4ZA 1K9MW 3OUSA 2R9RB 4RQEA 3OMIB 1GM8A 2GSMB 3NXSA 2D3OW 5IYDO 1Q7YW 1OHHG 3W7UA 3P32A 4H37A 1E1RG 3A0RA 4MTXA 3FYIB 1KP3A 4ASUG 1MABG 4RUFA 4FK5C 4TT3G 3MD0A 4PDVA 1COWG 4JTCB 2X6BA 1R6KA 2CK3G 1BHBA 4UUJC 3MHSC 1IXMA 1YITV 1M9NA 1SRYA 1AI4A 1P7BA 3AG2C 3B8NA 4JPRA 1AROP 2WLKA 1R6NA 2LFSA 2OTLV 1GM7A 3LSQA 2R9IA 3E8GA 3SPIA 1DLBA 3CPWU 2DWDC 1KP2A 2DYRC 1SESA 5LGTA 4MTFA 3F7VC 4DXWA 3CMEV 5IDJA 2K1EA 3LDCA 4BIUA 1VQ8V 2XAQA 4MVOA 1PL0A 1PNLA 4HYOA 4P30A 2B5UA 4QE7A 4ZKIA 1FXKB 1VQPV 3ETDA 5H6RA 4R6ZA 1F23A 2MK3A 4PA9A 4QIWF 2WPDG 2ZR2A 1YJ9V 4MVSA 3ZRWA 1VQNV 4FMTA 3OE7G 4WFGA 4XDJA 4N23A 1CEZA 2WWWA 3T2MA 2A9HA 2ZXWB 3F5WC 1QR9A 4PA6A 1ROPA 4PDRA 1AJNA 3TETA 3K0GA 3HB3B 4JYBA 3RVZA 1EZJA 2IJJA 2PI5A 4MTOA 5B1NA 4HZ3A 3T1CA 4XBFA 1MG1A 1UJWB 4I5SA 4KFMA 5B1OA 1WLEA 1KECA 1FXKC 2XAHA 1JPXA 4RQFA 4XDLA 2HVJC 3WG7B 1OCRC 1E1QG 1MOFA 3JD2A 1F51A 5DN6G 4XDKA 3CC2V 2Q68A 2WLJA 2HLDG 2Y69B 3STLC 1OCOB 2ZXWC 5B3SB 1PD3A 2QA4V 3SPGA 3JYCA 2IH1C 4RUEA 4WFEA 5L3EA 3B8MA 1TUEB 4UXNA 2HG5C 3T4DA 4QPJA 4JYCA 1DTOA 3WFVA 1KC8W 3GWOA 3WG7C 1R3IC 3FB5C 3ZCCA 1W0KG 2H94A 2IU3A 3FB7C 4HAMA 1Y4MA 3E86A 3GB7C 1NBMG 2HKOA 5B1AB 3FB8C 2XNDG 3QNEA 4J9ZB 1OCOC 2HR3A 2XAGA 5B3SC 1VQOV 4F4LA 4MVUA 1VQ7V 3EHBB 3TK1A 4MW3A 5CBHA 2EILB 1CPYA 3CYOA 2Z3YA 2B1GA 3ZMSA 1K92A 4FIPC 1VQ4V 3CD6V 1FFTB 3W7SA 3R65A 3PJSK 3QO5A 1S72V 2IH3C 4G27B 3ABMC 1YIJV 1SERA 3K3WA 5LHGA 2XAJA 1JVMA 1F4MA 2X7RB 3ASNC 5B1AC 4QE9A 3TCUA 3CCQV 5IY5B 5LGUA 1OCCB 2A0LA 5EC1C 4MT8A 4GT1A 2JJ2G 1K8AW 4GX5A 3SPCA 1VQ5V 1E79G 2EILC 3ZN1A 1YTFD 2Y48A 4RAIA 3G4SV 4OXSA 3K08A 3SYAA 1XL4A 4P9PA 4RO2A 1AR1B 4R50A 3E83A 5C93A 3ABKB 2NNUA 4EKWA 2YEVB 3OMAB 3BEHA 2Q69A 2QE7G 1RM1C 1W2BU 3IFXA 4LC1A 5HFMA 5HFLA 2DW4A 4U7OA 3MHHC 1J95A 4UVCA 5H9CA 5J9PC 1JJ2U 1YTFB 2ITDC 3CXCU 1SZTA 5KUMA 4L87A 4JTDB 1GMGA 4Q20A 4UV8A 1B6QA 2WLIB 4FPPA 4MSWC 3M99B 4QPKA 3KG2A 2Q67A 5E1AC 1M57B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE V;  1VQ4 V;  3CD6 V;  1VQ8 V;  1KC8 W;  1K73 W;  3CC4 V;  4WFB V;  4WF9 V;  1VQP V;  1S72 V;  3CCS V;  1VQ6 V;  1Q81 W;  4WCE V;  1N8R W;  1Q82 W;  3CC7 V;  1KQS U;  1YIJ V;  1W2B U;  1YJ9 V;  3CCV V;  1YJW V;  1VQL V;  1Q86 W;  1VQN V;  1M1K W;  1R73 A;  1YHQ V;  3CCQ V;  1YIT V;  3I55 V;  1VQ9 V;  3CC2 V;  2OTJ V;  3CCU V;  1YJN V;  1NJI W;  1QVG U;  1YI2 V;  2QEX V;  1VQO V;  1JJ2 U;  3CXC U;  1K9M W;  3CCM V;  2QA4 V;  3I56 V;  1VQM V;  4WFA V;  1VQ7 V;  1K8A W;  1VQ5 V;  2OTL V;  1VQK V;  1M90 W;  3CPW U;  1KD1 W;  2D3O W;  1Q7Y W;  3G71 V;  3CMA V;  3CCL V;  3CCR V;  5DM6 V;  3CME V;  3G6E V;  3G4S V;  3CCJ V;  3OW2 U;  1QVF U; 
#chains in the Genus database with same CATH topology
 3A8T A;  2ZDI C;  4F6R A;  1BCC H;  2EX3 A;  3E8H A;  2YXH A;  3BHP A;  2VWJ A;  3E35 A;  4U3J B;  3SYP A;  5EBL C;  1FFX B;  2DQ0 A;  2A7W A;  1GH6 A;  2YI8 A;  4X65 O;  5J2U A;  1VF6 C;  3FD9 A;  2Y0I A;  4X1Y A;  1M57 C;  1HP8 A;  3FKS G;  1K73 W;  2Q7H A;  3QG5 A;  4JAS A;  2BOB C;  4LBE C;  3RYF B;  1SZX A;  1QR8 A;  3E89 A;  1X4T A;  4OPH A;  5IWA O;  2ZNJ A;  5LMN O;  5KA6 A;  2UXB O;  1V55 B;  4LF8 B;  2WLL A;  1VAR A;  3OW2 U;  4PDM A;  4PI2 A;  3SPJ A;  1DK1 A;  3TGU H;  2AW9 A;  4B3M O;  2OIG A;  3VOU A;  2HJF C;  2LFR A;  2AZ0 A;  2ZQM A;  3ETQ A;  4DV4 B;  2R72 A;  5DED A;  2M7W A;  3D36 A;  4H33 A;  1IBM B;  3FX7 A;  2E5L O;  1LNQ A;  3UM7 A;  2ETN A;  3W7W A;  3J81 N;  3SJQ C;  4H44 B;  4DUZ B;  4NB5 A;  4I50 A;  5FNV A;  2P7T C;  3BRC A;  1YDX A;  4O4J B;  1YZB A;  2VS0 A;  1ZWI C;  2ZDI A;  4CZZ A;  3AG4 C;  1QU7 A;  1VQ9 V;  2LW1 A;  4MVZ A;  3ML0 A;  4GX1 A;  5LA6 A;  2CAZ C;  2EJ7 A;  4I4T A;  3ZRS A;  3UQ8 A;  1SQB H;  5KX5 A;  2VQF B;  4NR1 A;  2JEU A;  2EZP A;  4UVB A;  4LFB O;  1R3J C;  1ZL8 A;  3ZMT A;  2JK5 C;  3BPZ A;  1K33 A;  3JAW A;  1FXK A;  3ZX6 A;  2JS3 A;  4YIP A;  3X2Q C;  2P22 C;  5IY5 C;  3IGA C;  4TWK A;  2IJI A;  1Z5V A;  4KHP B;  3RVY A;  4JI2 O;  3JD1 A;  4LNU B;  4O4H A;  2Q7E A;  1JQ0 A;  4JI7 B;  4X9Q A;  5B5E Z;  2H8P C;  2OCH A;  3OEE G;  2UUA O;  4FLZ A;  3OR7 C;  1H2M A;  1Y74 A;  2UXX A;  1THZ A;  4X64 B;  3OUF A;  4DW1 A;  4R8C A;  5JCO C;  1XMQ B;  2YXY A;  5JQG A;  2RQ6 A;  4JI1 B;  4MTG A;  3BY6 A;  1H2K A;  1P4R A;  3JD0 A;  3CCM V;  1FYJ A;  5KMG A;  5LHI A;  1WN7 A;  1TVK A;  3AG1 B;  2WLM A;  1KUQ A;  1FJG B;  4WFF A;  2IU0 A;  3JAS A;  3K57 A;  4LF6 B;  3AK1 A;  4DR3 O;  2UUC O;  4K3A A;  3ABL C;  1OCZ C;  4OX9 O;  1HR0 B;  4TV9 B;  1KB9 F;  4YJ2 B;  1N4C A;  2GV9 A;  4P2Z A;  3HKE A;  1YCI A;  4LP8 A;  4YXW G;  4IL6 Z;  2QKA A;  4H13 B;  1Q6I A;  3BA8 A;  1PP9 H;  2ZR3 A;  4QGP A;  2VQE O;  1Q86 W;  3UT5 A;  1XDC A;  3UCS C;  4PJ0 Z;  4WBN A;  3CCU V;  3K5O A;  4QNH B;  3K5L A;  3VQW A;  4WFA V;  2V7Q G;  1QNM A;  1J5E O;  3ABU A;  2XOK G;  4JI5 O;  4UFZ A;  4AIL C;  4KXR A;  5CN0 A;  4ZI7 B;  1XIL A;  1FS0 G;  4X1I B;  1IVS A;  2EUL A;  1XMO O;  4G28 B;  5EC2 C;  3THO A;  3CCS V;  1Y66 A;  5IJ0 A;  1KQS U;  1AP5 A;  3C3T A;  4YY3 O;  5JCO A;  1XNQ B;  3I55 V;  1NJI W;  2Q73 A;  1QLE C;  5L3C A;  4I55 A;  3K04 A;  5EYP B;  3IC7 A;  1AJQ A;  1IBL B;  5EK0 A;  2OT5 A;  3TXQ A;  3H1K H;  1RPR A;  1RM1 B;  1JOY A;  1V54 C;  3GWK C;  4FFB B;  2OTJ V;  4FLX A;  2QWN B;  4U3J A;  1AI5 A;  3T4Z A;  1EN6 A;  5KAF Z;  2R9R B;  5BMV B;  1XNR O;  1FFX A;  1Q5O A;  2ARH A;  1E1R G;  4DV7 B;  2XUM A;  2QWQ B;  1N36 B;  4PDV A;  1WP7 A;  4JTC B;  4ABM A;  1R6K A;  1N34 O;  4K0K O;  4UUJ C;  3RYF A;  1M9N A;  3AG2 C;  3B8N A;  4JPR A;  1ARO P;  1WB8 A;  5JH7 B;  1R6N A;  2LFS A;  3DXR B;  4B3S B;  3RYC B;  3VQX A;  4GZR B;  1SES A;  4AQY O;  2YS8 A;  3F7V C;  4DXW A;  1VF7 A;  1VQ8 V;  2FKX A;  2ODM A;  5LP6 B;  4DUY B;  4QE7 A;  2B5U A;  4Z1V A;  1VQP V;  2CTW A;  3ETD A;  1F23 A;  2MK3 A;  3CRC A;  4PA9 A;  4IT5 A;  1AVM A;  2WPD G;  4MVS A;  2IBZ H;  4FMT A;  2CUG A;  3OE7 G;  4WFG A;  4XDJ A;  3OT7 A;  3BAA A;  3T2M A;  2A9H A;  4PA6 A;  1S5L Z;  2F4V O;  4X66 O;  1EZJ A;  1P7G A;  2PI5 A;  1D5A A;  3JAR B;  3JAL B;  4MTO A;  5B1N A;  1LUV A;  4EFB A;  2OIE A;  1MG1 A;  4KFM A;  1KEC A;  4DR4 B;  1YVW A;  2DOS A;  4RQF A;  2HVJ C;  4O4J A;  3WG7 B;  4DV0 O;  5CB4 A;  3RT3 C;  2V4D A;  1O9G A;  4XDK A;  5BR8 O;  2Q68 A;  2Y69 B;  3QTC A;  1OCO B;  2ZXW C;  3FAV B;  2WA4 A;  1I94 O;  2IH1 C;  5KHG A;  5LYJ B;  4A5U B;  4DV3 B;  3H1H H;  2Y4U A;  2MW2 B;  3OGI B;  3QNE A;  4J9Z B;  4DV5 O;  4NTY A;  5B3S C;  4UCO A;  2AZ2 A;  4CH6 A;  5CBH A;  1GRJ A;  3IAY A;  2B1G A;  4LNU A;  4DR1 B;  2CGN A;  1K92 A;  4I0X B;  4DV1 B;  3R65 A;  3O65 A;  4YIO A;  1TUB B;  1F4M A;  3CCQ V;  4DR5 B;  4K8X A;  5IE9 A;  1OCC B;  5EC1 C;  3WU2 Z;  4MT8 A;  4GT1 A;  1E79 G;  1Q8I A;  5LL6 Y;  2OWO A;  4OXS A;  1Y6X A;  1XL4 A;  4P9P A;  4RO2 A;  1AR4 A;  2F1M A;  4R50 A;  3E83 A;  5C93 A;  3D3Q A;  2YEV B;  3B4S A;  4IGG A;  1RM1 C;  5HFM A;  1VP7 A;  5HFL A;  4LH6 A;  4X62 B;  1JJ2 U;  2ZIO A;  2ITD C;  3WB0 A;  1SZT A;  3IJ4 A;  5KUM A;  4L87 A;  3N2G B;  4TV9 A;  2N74 A;  3CXH F;  4MSW C;  4DW0 A;  4YJ2 A;  1TA8 A;  4TOI A;  2Q67 A;  2Q0O C;  1M57 B;  4R7C A;  3LDE A;  4DK1 A;  3A0H Z;  2CGO A;  1F4N A;  3JAW B;  4X88 A;  2CTQ A;  3L70 H;  4WCE V;  4DV6 O;  4JV5 B;  1W0J G;  3J7A U;  1Q43 A;  5D5Q A;  1Q6U A;  3OD4 A;  1XBL A;  3QO8 A;  4O4H B;  3ZMU A;  3G67 A;  1H8E G;  4DV2 B;  1AI6 A;  1GTO A;  3K9S A;  4ICG A;  3M7M X;  2BOC C;  1KKD A;  1RSO B;  5CMU A;  5LHH A;  3LUT B;  2UXD O;  2NR5 A;  4ZI7 A;  3CHX A;  5LP6 C;  4O2A B;  1HNW O;  1M4U A;  5JQG B;  4K35 A;  1WP8 A;  4JGS A;  5EZY B;  4G2K A;  1NT2 B;  2A3Q A;  1WAZ A;  4B3R O;  1TVK B;  4CH4 A;  2EIM C;  3CCR V;  1EN5 A;  5EYP A;  4UCU A;  1G4Y B;  3E22 B;  2B1I A;  1KU9 A;  1ZSP A;  1DF4 A;  2HJD A;  1HDJ A;  2DQ3 A;  3AG4 B;  1G6U A;  1N0J A;  2HFE C;  2LGQ A;  4D7T A;  2Y69 C;  3LNM B;  3ZHV A;  4UV9 A;  3HKE B;  5ITZ A;  2A79 B;  3ICX A;  4JAV A;  5BMV A;  3CMA V;  1GAX A;  2ADQ B;  3G80 A;  1WJZ A;  4DO2 A;  4WF9 V;  1HNZ O;  3KKY A;  3SYC A;  3NR7 A;  4AI8 A;  2KSD A;  1S76 D;  3N2K B;  1MNG A;  3X2Q B;  2IW5 A;  2N05 A;  3CB2 A;  5JH7 A;  5CBF A;  3DXR A;  3RYC A;  1M56 C;  4LF4 O;  3J80 N;  2GUZ B;  4WFH A;  4MW8 A;  3CP1 A;  1NI8 A;  5LP6 A;  1Q82 W;  2ZT9 B;  4B3T B;  3K03 A;  5EBW C;  2UXB B;  2QKC A;  1OCC C;  3K0D A;  1SQV H;  4F6E A;  4B3M B;  1U97 A;  2DJV A;  1YF2 A;  3OEH G;  2PF4 E;  5L3F A;  3JAR A;  3JAL A;  2E3C A;  2QM4 A;  2GHY A;  1CXZ B;  1B3Q A;  3ABL B;  1OCZ B;  3H01 A;  1NKD A;  2QEX V;  1O9H A;  2WSS G;  1IBK O;  3FAV A;  3CCL V;  1P84 F;  2LQT A;  2UXN A;  3EVK A;  4JI8 O;  1NQT A;  1W59 A;  4DR2 O;  5FL7 G;  1KBH A;  3RWR D;  1OCR B;  4UVA A;  2FYU H;  2Z5U A;  4BW5 A;  5LYJ A;  3K06 A;  2B9Z A;  3W7T A;  1VF5 B;  1K34 A;  1SS3 A;  4DR6 O;  3JAK B;  3ZRX A;  1K97 A;  2E76 B;  3QO7 A;  1FXV A;  3E2E A;  3U0Z A;  4J9Y B;  1GN6 A;  1ZUQ A;  5A9G A;  2JRI A;  3T1H O;  5AG2 A;  2QDO A;  3S3X A;  4I0X A;  2IM9 A;  1AJP A;  1WPX A;  3TJT A;  3ZHT A;  5KHI A;  3ZMZ A;  5KAI Z;  4GKK O;  1N33 B;  1TUB A;  3MDS A;  1ENV A;  3RYH A;  2CDY A;  4JZ2 A;  3K79 A;  1I0H A;  1QLE B;  3KCX A;  1JA8 A;  4JI4 B;  5L3D A;  5DM6 V;  3APQ A;  3K9A A;  2CE4 A;  3LSS A;  5CB4 B;  3ABM B;  5JJN B;  1PNK A;  5L3G A;  2E75 B;  2YEV A;  1V54 B;  1OZ0 A;  3ASN B;  1BMF G;  4GYC B;  1GO3 F;  2Y4T A;  2IJK A;  1DGS A;  1L8D A;  4FLT A;  3RYI B;  2F66 C;  1GM9 A;  4I9W A;  1K3E A;  3N2G A;  2DYS C;  1VF6 A;  1ORQ C;  4W4L A;  4FFK A;  3RBZ A;  1FXH A;  4CH3 A;  1Q81 W;  5JWP A;  3JSL A;  2QR4 A;  2FL4 A;  2P90 A;  3DSQ A;  2DN9 A;  3AG2 B;  4O4I B;  4PA4 A;  2X6A A;  2XAS A;  1GM8 A;  3NXS A;  4AHC A;  2D3O W;  1Q7Y W;  1OHH G;  3W7U A;  4JI6 O;  4MTX A;  1RSO A;  4NTW A;  4FK5 C;  4JAA A;  1I7F A;  1COW G;  3K5N A;  4C7U A;  4LF9 O;  4O2A A;  5F2V O;  4JI5 B;  1SRY A;  1AI4 A;  1R6T A;  3U10 A;  1P7B A;  1UPG A;  1M93 A;  5EZY A;  2WLK A;  1GM7 A;  1XRE A;  3SPI A;  1DLB A;  1IBM O;  4ZHQ B;  3CME V;  2LW7 A;  2K1E A;  3HR0 A;  1PL0 A;  1PNL A;  4HNA B;  3E22 A;  5IT9 N;  4NXN O;  3RGB A;  3ZRW A;  4LFA O;  5GON B;  2WA3 A;  4N23 A;  2ZXW B;  4FLY A;  1QR9 A;  1ROP A;  3UO3 A;  3TET A;  3HB3 B;  4JYB A;  3RVZ A;  3JSN A;  4ZOL B;  4HZ3 A;  5EIB C;  1WLE A;  1KKC A;  1JPX A;  1OCR C;  1MOF A;  3RFR A;  3JD2 A;  2VQF O;  5DN6 G;  1XNR B;  5KHK A;  5D5P A;  3N2K A;  5B3S B;  3B09 A;  3BA9 A;  4RUE A;  3B8M A;  4FM0 A;  4QPJ A;  4KHP O;  2GUZ A;  4U3F H;  2XTA A;  1R3I C;  4JI7 O;  4J7K A;  3T1Y B;  3ZCC A;  1W0K G;  2CTR A;  2H94 A;  5FPO A;  2LJ2 A;  3FB8 C;  2XND G;  2P5O A;  4X64 O;  2HR3 A;  4F4L A;  4MVU A;  1VQ7 V;  1NU1 H;  4JI1 O;  3CYO A;  2BSK B;  1X59 A;  3ABM C;  1NTZ H;  2PUS A;  1SER A;  2F4V B;  3VQV A;  4X66 B;  4FZ1 A;  3ASN C;  1ZAU A;  1Q6H A;  3B40 A;  3JAM N;  2LO1 A;  2ZE6 A;  1JMK C;  1B04 A;  4PV1 B;  4GX5 A;  3SPC A;  5ITZ B;  3K58 A;  2EIL C;  1WA8 B;  2Y48 A;  4DV0 B;  3G4S V;  1AR1 B;  1SF9 A;  1OJH A;  5JVD B;  2VWK A;  4EKW A;  2YIA A;  3OMA B;  3BEH A;  2Q69 A;  3L71 H;  2QE7 G;  5BY1 A;  4OGQ B;  4NVP A;  1I94 B;  3C90 A;  1SKV A;  3CX5 F;  4IIJ B;  1J95 A;  1YTF B;  2BTQ B;  3JAK A;  1GMG A;  4JTD B;  4FPP A;  3H1J H;  3M99 B;  4QPK A;  4X20 B;  4FLW A;  3CC4 V;  4DV5 B;  4DR7 B;  3LDD A;  1EBO A;  1JX9 A;  2XAF A;  4FJC C;  5FLX N;  1ZX3 A;  2X6C A;  2ZE7 A;  5GTI Z;  1G1X B;  1XNQ O;  1CP9 A;  5B66 Z;  2EIM B;  1JR9 A;  3HKC A;  2JGD A;  1JCH A;  1MZF A;  4LWS A;  2GTS A;  1A32 A;  1IZ3 A;  1SQP H;  4GLX A;  4JI0 B;  3DC6 A;  4D6T H;  4JYA O;  5IJ9 B;  4MVM A;  1IBL O;  3GVM A;  3CCV V;  1YJW V;  1XUQ A;  2CH7 A;  4H0L B;  4JI3 O;  3ASO C;  1U96 A;  5KHJ A;  1RPO A;  2AGA A;  2EIN C;  2EIK C;  1VQK V;  4X8A A;  3D3I A;  4PA7 A;  4YJ3 A;  2JJ1 G;  3E8B A;  1NVP B;  3RYI A;  2ITC C;  3CCJ V;  3EFF K;  2R70 A;  4Z1M G;  3BVO A;  3OMN B;  2OCC C;  4PA3 A;  4TSF G;  4J7J A;  3F7Y C;  4DV7 O;  2BCC H;  1N36 O;  4JF3 A;  3RW0 A;  5IYB O;  2UUB B;  4O4I A;  5CA3 A;  2HP8 A;  1US6 A;  1T5E A;  1TAE A;  3FB6 C;  3ZIA G;  1FAF A;  1M56 B;  1NR1 A;  1S5J A;  2F43 G;  3STZ C;  3LNN A;  5LMU O;  3CC7 V;  3OTO B;  2M6Y A;  3D8C A;  3RYH B;  2ZIN A;  4DUY O;  3S3W A;  2R9A A;  3ETE A;  1Y67 A;  1N32 O;  1LR1 A;  5TIS Z;  2F23 A;  1H38 A;  4O2B B;  5H2F Z;  4ZHQ A;  2QKS A;  3P3P A;  3FYE B;  1XI1 A;  4HNA A;  4TQF A;  1BHA A;  1I5X A;  1PM9 A;  5J2T A;  2F93 B;  1I5Y A;  1WPB A;  2QM7 A;  5GON A;  3ZN0 A;  2ZM6 B;  2P67 A;  4CS4 A;  3C3S A;  3L72 H;  4HBN A;  2DYR B;  1KD1 W;  1XL6 A;  1Y76 B;  1R1B A;  2RCV A;  4ZOL A;  4JYY A;  1SET A;  1K4D C;  3FFQ A;  3ZHQ A;  2W0X A;  5LOV A;  3ABT A;  3OTF A;  5H5N A;  2KB1 A;  3OFN G;  4LF5 O;  3HKD B;  4ZBM A;  4CH5 A;  1N0N A;  2AHY A;  3I5D A;  4LCU C;  4KUM A;  4NXM O;  1ZTE A;  2RN9 A;  1HW7 A;  1K7D A;  4DR1 O;  3H1I H;  3ZJZ A;  4DV1 O;  4LF4 B;  2UU9 B;  5CBG A;  2HHH B;  3OR6 C;  4YHH B;  1K5S A;  3OAA G;  4FLU A;  1VQM V;  2UXC B;  1FD9 A;  1L1F A;  2GDS A;  1K4C C;  3SYQ A;  1SQQ H;  3LSU A;  2W6J G;  4MVQ A;  3HPL C;  3SJA C;  4UCT A;  2ZNI A;  2EIJ C;  3ETG A;  4GX0 A;  2QGN A;  1GK9 A;  2P06 A;  4BIO A;  4RWU A;  3CEI A;  1H2N A;  2Q9L A;  3ZRW B;  2BSK A;  3WB1 A;  2A06 H;  1R3L C;  2W0F C;  5GW7 A;  4UCS A;  4BAY A;  4BR6 A;  3JD3 A;  4DK0 A;  1HNX B;  1F7Y A;  1NH2 B;  2N04 A;  2QWP B;  3JD4 A;  5B1B C;  3G71 V;  4X62 O;  1WA8 A;  5L3B A;  2DYS B;  3CCE V;  3A2F A;  1JJO A;  5CA0 A;  3CSX A;  1XQ8 A;  5IYZ B;  5JVD A;  4U7N A;  1AB3 A;  4X65 B;  2G38 A;  3H1L H;  4LFC O;  1H8H G;  4JI8 B;  4IIJ A;  1UFI A;  3I56 V;  3JAT B;  2BTQ A;  2AHZ A;  4N21 A;  1S5H C;  1MMM A;  4X20 A;  2LP7 A;  4GKJ O;  5IWA B;  4DR6 B;  4DV2 O;  5LMN B;  1NTK H;  1VQL V;  3VBB A;  3AG3 C;  3APO A;  4FLV A;  2Z0A A;  5A2Q N;  2QJ1 A;  1G8M A;  4DRX B;  1K9M W;  4RQE A;  3OMI B;  2FML A;  2GSM B;  5JJJ B;  4PHZ A;  1B06 A;  3P32 A;  4GKK B;  3CRQ A;  4ASU G;  3FYI B;  1KP3 A;  3SGI A;  1MAB G;  4RUF A;  3CRR A;  4TT3 G;  3MD0 A;  2X6B A;  2E5L B;  1MA1 A;  5IJ9 A;  1IXM A;  3WB2 A;  3ZED A;  1QHT A;  1YXB A;  2PZS A;  2K9P A;  3CPW U;  2DYR C;  2YI9 A;  3CJH B;  5C8Y B;  3Q4H B;  5IDJ A;  3LDC A;  4BIU A;  4P30 A;  1KMI Z;  2L35 A;  1VQN V;  5FPR A;  1CEZ A;  2WWW A;  3SDL A;  1BSM A;  1MSD A;  3F5W C;  4LF7 O;  3ZHU A;  4LFB B;  1WB7 A;  2IJJ A;  1XHZ A;  1KYO F;  1I08 A;  3QVN A;  3T1C A;  1UJW B;  1H2L A;  5B1O A;  4I5S A;  1FXK C;  4XDL A;  1E1Q G;  3CRM A;  2Q7G A;  4JI2 B;  1GN4 A;  3L9D A;  2UUA B;  1RFY A;  1PD3 A;  4JI6 B;  2QA4 V;  4B3T O;  2VRZ A;  1OV9 A;  3JYC A;  3HKC B;  4WFE A;  2JGD B;  5L3E A;  1TUE B;  4UXN A;  1IDS A;  2HG5 C;  4LWS B;  4LF9 B;  4JYC A;  4O2B A;  1DTO A;  3WFV A;  1KC8 W;  1BQ0 A;  1WNS A;  3UO2 A;  3FB5 C;  2Q4P A;  4L8J A;  3MAQ A;  2IU3 A;  1Y4M A;  2CH7 B;  3E86 A;  3GB7 C;  1NS1 A;  2HKO A;  1BT8 A;  3TK1 A;  2JVD A;  2D2C B;  4MW3 A;  4YJ3 B;  2EIL B;  1CPY A;  4PD4 F;  2Z3Y A;  4NXN B;  4LFA B;  4FIP C;  4DR3 B;  2UUC B;  1XEQ A;  1Y76 A;  3PJS K;  1S72 V;  4OX9 B;  4G27 B;  1YIJ V;  3K3W A;  5LHG A;  2XAJ A;  2QTS A;  1JVM A;  2X7R B;  5B1A C;  4QE9 A;  5LGU A;  2YUA A;  2A0L A;  1M5I A;  1AR5 A;  2JJ2 G;  4JZG A;  3L73 H;  4O4L B;  3U11 A;  1YTF D;  3HKD A;  4UB8 Z;  2VQE B;  4UCR A;  3KCY A;  3G6B A;  4LF8 O;  3EXA A;  3CS5 A;  1W2B U;  4TV8 B;  1J5E B;  1Z5W A;  3MHH C;  1QQC A;  5J9P C;  3CXC U;  4DV4 O;  4Q20 A;  1N33 O;  1XMO B;  4FVM A;  4D7S A;  1B6Q A;  2KG7 B;  2P4V A;  2WLI B;  2Q0A A;  1PV0 A;  2E74 B;  5E1A C;  1SA0 A;  2RDC A;  3RN4 A;  4YY3 B;  3ABK C;  2ZD9 A;  2PI4 A;  4Q6G A;  4JI4 O;  4E4E A;  3BAB A;  4DUZ O;  1TGO A;  2Y0P A;  5J2T B;  1YHQ V;  1BL8 A;  2JS5 A;  2X0L A;  4QJF B;  4LH7 A;  1QVG U;  3ASO B;  3UKM A;  3A0B Z;  2W6I G;  2EZO A;  1K5Q A;  2EIN B;  2EIK B;  1M90 W;  2ZKO A;  2O57 A;  1Q90 D;  4NTX A;  4CS3 A;  4B08 A;  3G6E V;  3W7X A;  1NVP D;  4EEQ A;  2OCC B;  5LOV B;  1IXB A;  2PYJ A;  1HWY A;  5IYZ A;  2WAM A;  2HVK C;  4MS2 A;  1BQZ A;  3OGC C;  4B7K A;  5K1P A;  4FZ0 A;  3JAT A;  1N34 B;  2EJR A;  1AI7 A;  1QVF U;  4K0K B;  2IJH A;  1EZV H;  1URF A;  4MVR A;  2ZE5 A;  3ZRV A;  2ADP A;  2P6J A;  3JCU Z;  3R66 A;  3BFR A;  5LXT B;  5H6Q A;  4AQY B;  3DGE A;  4J41 A;  5JJE B;  4BW9 A;  1XMQ O;  4DRX A;  1V55 C;  3DTU B;  2V1D A;  1P49 A;  3HKB B;  2PYL A;  3F5T A;  3VQY A;  3JCZ A;  3AK3 A;  1R73 A;  1FJG O;  1BZK A;  1GN2 A;  2WLH A;  3SYO A;  1YI2 V;  2H3O A;  4NKG B;  4X89 A;  4LF6 O;  2QTO A;  3CWB H;  1NTM H;  1PNM A;  1Z2G A;  4JYA B;  3P3N A;  2YIC A;  1JFF B;  4EB6 B;  2YDE A;  3N27 A;  1L0N H;  2JGU A;  1HR0 O;  3CJH A;  1FPO A;  4J10 A;  5C8Y A;  4KP4 A;  3Q4H A;  5CA0 B;  5BR8 B;  4JI3 B;  1QBZ A;  5K1X A;  3TXS A;  1M1K W;  3B77 A;  1YJN V;  1XHX A;  2DWE C;  1YSC A;  4IHJ B;  1V9P A;  2QSA A;  2QWR B;  4W4K A;  2LGW A;  4K8Z A;  4CS2 A;  1VEW A;  2F95 B;  2Q8V A;  3PN1 A;  1NZ6 A;  4UB6 Z;  4X1K B;  5IYC O;  1H2G A;  3E8F A;  4FM1 A;  2ZIM A;  3O9O A;  3T1Y O;  3SJB C;  4EFE A;  1EFR G;  2PGG A;  5KLV H;  4JAU A;  5LMU B;  3M8A A;  4UCV A;  1GKF A;  5LBQ A;  4FM2 A;  3L74 H;  1QLN A;  2WLN A;  2EIJ B;  1VQ6 V;  2L6L A;  3ZHS A;  4GX2 A;  5CA1 B;  1YEW A;  2XHB A;  4P9O A;  1N32 B;  4PDL A;  2C2A A;  2HEP A;  2NLJ C;  4TUY B;  3ZBH A;  4E2L A;  3BCC H;  3DC5 A;  4CC5 A;  5LGN A;  2FB5 A;  4NYK A;  2YID A;  5B1B B;  3AG1 C;  1NH2 D;  1LUW A;  1VIB A;  3SPH A;  4F6R B;  3H9V A;  2Q6A A;  1R3K C;  4KL1 A;  2YXL A;  2ZE8 A;  3CRA A;  1D5N A;  3P30 A;  5BXZ A;  5J2U B;  2QM8 A;  2JEX A;  4X1Y B;  2FTK A;  4DV6 B;  4O4L A;  4B3S O;  5EBM C;  1S0V A;  3AEI A;  1PPJ H;  4GUN A;  2XT9 A;  4LF5 B;  4J7Z A;  3AG3 B;  1MSW D;  1BGY H;  2JDI G;  4PEL A;  4DR7 O;  4TV8 A;  4BIZ A;  4JTA B;  2ATK C;  2EBO A;  2UXD B;  3ZHR A;  4NXM B;  1NR7 A;  2WLL B;  5BZB A;  1HNW B;  1QCE A;  4GCZ A;  2JIZ G;  2KG7 A;  2WLI A;  4CBC A;  4WFB V;  2YSU B;  1S77 D;  1N8R W;  3ZMV A;  3K5M A;  1PKX A;  1DF5 A;  1S3J A;  2GTA A;  4B3R B;  5KA5 A;  2RNB A;  5KUK A;  3OM3 B;  4DR4 O;  4JI0 O;  1VMG A;  3OUS A;  5IYD O;  2KQX A;  2ZCE A;  5DEC A;  1FKA O;  2YIB A;  4I50 B;  5FNV B;  1BS3 A;  4OPA A;  4H37 A;  3A0R A;  2Q5Z A;  1MZE A;  4I7Z B;  4I9Q A;  2DMX A;  5EIB D;  1H2S B;  2CK3 G;  4DYL A;  1BHB A;  1D2D A;  3MHS C;  1YIT V;  5LA6 B;  2OTL V;  4I4T B;  3LSQ A;  2R9I A;  3E8G A;  4TQD A;  4BWA A;  2DWD C;  1KP2 A;  3ZS8 C;  5KX5 B;  4IYH A;  4DV3 O;  5LGT A;  1HNZ B;  4MTF A;  4Z2W A;  1ZL8 B;  2UUB O;  2XAQ A;  4MVO A;  4HYO A;  4LFC B;  4ZKI A;  1FXK B;  2YC0 A;  1EM1 A;  1RP3 B;  5H6R A;  4R6Z A;  4QIW F;  2ZR2 A;  1YJ9 V;  2RMK B;  2PTM A;  5LXT A;  3OTO O;  2ILM A;  4CC6 A;  1PL4 A;  4PDR A;  4GKJ B;  1IX9 A;  2AXT Z;  1AJN A;  3K0G A;  4DR5 O;  1SA0 B;  2DE0 X;  1Y74 B;  4XBF A;  3HKB A;  1GN3 A;  4X1I A;  2XAH A;  3IC9 A;  2QWO B;  1Q3E A;  4J42 A;  1F51 A;  3KZI Z;  3CC2 V;  4J80 A;  4B7E A;  2WLJ A;  2HLD G;  2CTP A;  3STL C;  1XOU A;  5KMG B;  3SPG A;  3B2E E;  2ZM6 O;  4PI0 A;  3T4D A;  1JFF A;  4EB6 A;  3JAS B;  3GWO A;  1EN4 A;  3WG7 C;  3FB7 C;  4HAM A;  5GTH Z;  1IBK B;  1NBM G;  5B1A B;  4FFB A;  1OCO C;  2XAG A;  1VQO V;  4JV5 O;  3EHB B;  4IHJ A;  4DR2 B;  1AP6 A;  3ZMS A;  1SQX H;  1BE3 H;  3SJC C;  1FFT B;  1VQ4 V;  3W7S A;  3AK2 A;  3CD6 V;  2NN4 A;  1IUR A;  3QO5 A;  1SQG A;  2IH3 C;  3UT5 B;  2KKW A;  5KHH A;  4LF7 B;  4WBN B;  4X1K A;  3K59 A;  3L75 H;  3TCU A;  5IY5 B;  3T1H B;  2GBO A;  5E79 Z;  1K8A W;  3SR2 C;  4LR3 A;  3AG7 A;  1VQ5 V;  2PY5 A;  3ZN1 A;  2UU9 O;  4RAI A;  2HHH O;  3K08 A;  3SYA A;  4YHH O;  3QF7 A;  2UXC O;  5IJ0 B;  3ABK B;  2NNU A;  1ZLZ A;  1SQF A;  3D36 C;  2OYQ A;  5CA1 A;  3IFX A;  4LC1 A;  2DW4 A;  4U7O A;  4UVC A;  5H9C A;  4TUY A;  4I55 B;  4ZIB A;  3CE2 A;  2BTO A;  4UV8 A;  4IYI A;  1SC5 B;  1AIL A;  2P4K A;  4J11 A;  2BE3 A;  3KG2 A;  2YIB D;  1HNX O;  1L0L H;  2RJZ A; 
#chains in the Genus database with same CATH homology
 4R7C A;  3CC4 V;  3LDE A;  3ABK C;  2ZDI C;  2ZD9 A;  2PI4 A;  1F4N A;  4X88 A;  3E8H A;  4WCE V;  3LDD A;  1W0J G;  1EBO A;  3E35 A;  1YHQ V;  1BL8 A;  1JX9 A;  2X0L A;  2XAF A;  3SYP A;  4FJC C;  4QJF B;  1QVG U;  3ASO B;  3UKM A;  5EBL C;  2W6I G;  2DQ0 A;  2X6C A;  2EZO A;  1K5Q A;  2EIN B;  3QO8 A;  2EIK B;  1M90 W;  3ZMU A;  1CP9 A;  1H8E G;  1AI6 A;  1GTO A;  2EIM B;  1JCH A;  2BOC C;  3G6E V;  1KKD A;  5CMU A;  1M57 C;  5LHH A;  3LUT B;  3W7X A;  1NVP D;  3FKS G;  1K73 W;  2OCC B;  4JAS A;  2BOB C;  4LBE C;  4MVM A;  4JGS A;  1HWY A;  1QR8 A;  2WAM A;  3CCV V;  1YJW V;  3E89 A;  4G2K A;  2HVK C;  4MS2 A;  3OGC C;  3ASO C;  1RPO A;  2EIN C;  5KA6 A;  2EIK C;  1VQK V;  1V55 B;  4X8A A;  3D3I A;  4PA7 A;  2JJ1 G;  2EIM C;  3E8B A;  3CCR V;  1NVP B;  2WLL A;  3OW2 U;  2ITC C;  4PDM A;  3CCJ V;  1G4Y B;  1AI7 A;  2EJR A;  3EFF K;  3SPJ A;  1QVF U;  2B1I A;  4Z1M G;  1DF4 A;  2IJH A;  2OCC C;  2HJF C;  2LFR A;  3OMN B;  4MVR A;  4PA3 A;  3VOU A;  2ZQM A;  4TSF G;  3ZRV A;  2DQ3 A;  2P6J A;  3AG4 B;  2M7W A;  3D36 A;  4H33 A;  2HFE C;  3F7Y C;  4JF3 A;  5H6Q A;  2Y69 C;  3LNM B;  3RW0 A;  3DGE A;  1LNQ A;  5IYB O;  4UV9 A;  5CA3 A;  3UM7 A;  1V55 C;  3W7W A;  3FB6 C;  2A79 B;  3ZIA G;  3DTU B;  4JAV A;  3SJQ C;  3CMA V;  2V1D A;  1M56 B;  1NR1 A;  2P7T C;  4DO2 A;  2F43 G;  3STZ C;  4WF9 V;  1ZWI C;  2ZDI A;  4CZZ A;  3CC7 V;  3SYC A;  3AG4 C;  3JCZ A;  1R73 A;  1S76 D;  1VQ9 V;  3X2Q B;  4MVZ A;  2IW5 A;  2WLH A;  3ML0 A;  3ETE A;  3SYO A;  1YI2 V;  4X89 A;  4GX1 A;  2QTO A;  5CBF A;  1PNM A;  3ZRS A;  1H38 A;  1M56 C;  2QKS A;  4KP4 A;  2JEU A;  2EZP A;  4WFH A;  4UVB A;  4MW8 A;  1R3J C;  3CP1 A;  3ZMT A;  3FYE B;  2JK5 C;  1K33 A;  1QBZ A;  1Q82 W;  1FXK A;  1BHA A;  3K03 A;  5EBW C;  1I5X A;  1M1K W;  3B77 A;  1I5Y A;  3X2Q C;  1YJN V;  2QM7 A;  5IY5 C;  3IGA C;  3ZN0 A;  2DWE C;  1OCC C;  3K0D A;  4TWK A;  1YSC A;  2P67 A;  2IJI A;  3RVY A;  2DYR B;  1KD1 W;  3JD1 A;  1XL6 A;  1JQ0 A;  3OEH G;  5L3F A;  2H8P C;  3OEE G;  3OR7 C;  2UXX A;  1THZ A;  2GHY A;  5IYC O;  1SET A;  1K4D C;  3OUF A;  1H2G A;  3E8F A;  4R8C A;  3ABT A;  4MTG A;  3BY6 A;  2KB1 A;  1P4R A;  3ABL B;  1OCZ B;  3JD0 A;  3H01 A;  1NKD A;  2QEX V;  3OFN G;  3CCM V;  2WSS G;  1EFR G;  4JAU A;  4ZBM A;  5LHI A;  3CCL V;  3AG1 B;  1GKF A;  2WLM A;  5LBQ A;  2AHY A;  2UXN A;  4LCU C;  1NQT A;  4KUM A;  1QLN A;  2WLN A;  5FL7 G;  2EIJ B;  1VQ6 V;  4GX2 A;  4WFF A;  1OCR B;  4UVA A;  2IU0 A;  2Z5U A;  4BW5 A;  4P9O A;  1K7D A;  4PDL A;  3K06 A;  3ZJZ A;  2C2A A;  2NLJ C;  3W7T A;  3ABL C;  1OCZ C;  1K34 A;  4E2L A;  5CBG A;  3OR6 C;  5LGN A;  3ZRX A;  1K5S A;  1K97 A;  3OAA G;  1VQM V;  3QO7 A;  1L1F A;  1FXV A;  4P2Z A;  3E2E A;  1K4C C;  5B1B B;  3AG1 C;  1NH2 D;  3SYQ A;  4J9Y B;  2W6J G;  4LP8 A;  4MVQ A;  3HPL C;  4YXW G;  3SPH A;  2EIJ C;  3ETG A;  2Q6A A;  4GX0 A;  2ZR3 A;  1AJP A;  1GK9 A;  1R3K C;  3ZRW B;  1WPX A;  1Q86 W;  3ZMZ A;  1R3L C;  2W0F C;  1ENV A;  5GW7 A;  4BAY A;  3CCU V;  3JD3 A;  4QNH B;  1NH2 B;  3P30 A;  4WFA V;  2V7Q G;  2QM8 A;  2JEX A;  3JD4 A;  1QLE B;  3K79 A;  5B1B C;  3ABU A;  2XOK G;  2FTK A;  3G71 V;  5CN0 A;  5L3D A;  5DM6 V;  1FS0 G;  5L3B A;  2DYS B;  3CCE V;  5EBM C;  3K9A A;  1S0V A;  3AEI A;  4G28 B;  5EC2 C;  3CCS V;  1Y66 A;  3LSS A;  3ABM B;  1PNK A;  5L3G A;  4U7N A;  1KQS U;  2YEV A;  1V54 B;  1OZ0 A;  3AG3 B;  3ASN B;  1MSW D;  1BMF G;  2JDI G;  3I55 V;  4PEL A;  1NJI W;  1GO3 F;  4BIZ A;  1H8H G;  4JTA B;  2ATK C;  2IJK A;  2EBO A;  3I56 V;  1NR7 A;  1QLE C;  5L3C A;  2AHZ A;  2WLL B;  3K04 A;  1GM9 A;  4I9W A;  1K3E A;  3IC7 A;  5BZB A;  4N21 A;  1QCE A;  4GCZ A;  1AJQ A;  1S5H C;  2JIZ G;  2DYS C;  2WLI A;  1ORQ C;  4CBC A;  5EK0 A;  3RBZ A;  2LP7 A;  1FXH A;  4WFB V;  2OT5 A;  2YSU B;  1S77 D;  1Q81 W;  1N8R W;  1RPR A;  3ZMV A;  1RM1 B;  1JOY A;  2P90 A;  1PKX A;  1V54 C;  1DF5 A;  1VQL V;  3VBB A;  3AG3 C;  1S3J A;  2OTJ V;  5KA5 A;  5KUK A;  3AG2 B;  3OM3 B;  1G8M A;  4PA4 A;  2X6A A;  1AI5 A;  2XAS A;  3T4Z A;  1K9M W;  3OUS A;  2R9R B;  4RQE A;  3OMI B;  1GM8 A;  2GSM B;  3NXS A;  2D3O W;  5IYD O;  1Q7Y W;  1OHH G;  3W7U A;  3P32 A;  4H37 A;  1E1R G;  3A0R A;  4MTX A;  3FYI B;  1KP3 A;  4ASU G;  1MAB G;  4RUF A;  4FK5 C;  4TT3 G;  3MD0 A;  4PDV A;  1COW G;  4JTC B;  2X6B A;  1R6K A;  2CK3 G;  1BHB A;  4UUJ C;  3MHS C;  1IXM A;  1YIT V;  1M9N A;  1SRY A;  1AI4 A;  1P7B A;  3AG2 C;  3B8N A;  4JPR A;  1ARO P;  2WLK A;  1R6N A;  2LFS A;  2OTL V;  1GM7 A;  3LSQ A;  2R9I A;  3E8G A;  3SPI A;  1DLB A;  3CPW U;  2DWD C;  1KP2 A;  2DYR C;  1SES A;  5LGT A;  4MTF A;  3F7V C;  4DXW A;  3CME V;  5IDJ A;  2K1E A;  3LDC A;  4BIU A;  1VQ8 V;  2XAQ A;  4MVO A;  1PL0 A;  1PNL A;  4HYO A;  4P30 A;  2B5U A;  4QE7 A;  4ZKI A;  1FXK B;  1VQP V;  3ETD A;  5H6R A;  4R6Z A;  1F23 A;  2MK3 A;  4PA9 A;  4QIW F;  2WPD G;  2ZR2 A;  1YJ9 V;  4MVS A;  3ZRW A;  1VQN V;  4FMT A;  3OE7 G;  4WFG A;  4XDJ A;  4N23 A;  1CEZ A;  2WWW A;  3T2M A;  2A9H A;  2ZXW B;  3F5W C;  1QR9 A;  4PA6 A;  1ROP A;  4PDR A;  1AJN A;  3TET A;  3K0G A;  3HB3 B;  4JYB A;  3RVZ A;  1EZJ A;  2IJJ A;  2PI5 A;  4MTO A;  5B1N A;  4HZ3 A;  3T1C A;  4XBF A;  1MG1 A;  1UJW B;  4I5S A;  4KFM A;  5B1O A;  1WLE A;  1KEC A;  1FXK C;  2XAH A;  1JPX A;  4RQF A;  4XDL A;  2HVJ C;  3WG7 B;  1OCR C;  1E1Q G;  1MOF A;  3JD2 A;  1F51 A;  5DN6 G;  4XDK A;  3CC2 V;  2Q68 A;  2WLJ A;  2HLD G;  2Y69 B;  3STL C;  1OCO B;  2ZXW C;  5B3S B;  1PD3 A;  2QA4 V;  3SPG A;  3JYC A;  2IH1 C;  4RUE A;  4WFE A;  5L3E A;  3B8M A;  1TUE B;  4UXN A;  2HG5 C;  3T4D A;  4QPJ A;  4JYC A;  1DTO A;  3WFV A;  1KC8 W;  3GWO A;  3WG7 C;  1R3I C;  3FB5 C;  3ZCC A;  1W0K G;  2H94 A;  2IU3 A;  3FB7 C;  4HAM A;  1Y4M A;  3E86 A;  3GB7 C;  1NBM G;  2HKO A;  5B1A B;  3FB8 C;  2XND G;  3QNE A;  4J9Z B;  1OCO C;  2HR3 A;  2XAG A;  5B3S C;  1VQO V;  4F4L A;  4MVU A;  1VQ7 V;  3EHB B;  3TK1 A;  4MW3 A;  5CBH A;  2EIL B;  1CPY A;  3CYO A;  2Z3Y A;  2B1G A;  3ZMS A;  1K92 A;  4FIP C;  1VQ4 V;  3CD6 V;  1FFT B;  3W7S A;  3R65 A;  3PJS K;  3QO5 A;  1S72 V;  2IH3 C;  4G27 B;  3ABM C;  1YIJ V;  1SER A;  3K3W A;  5LHG A;  2XAJ A;  1JVM A;  1F4M A;  2X7R B;  3ASN C;  5B1A C;  4QE9 A;  3TCU A;  3CCQ V;  5IY5 B;  5LGU A;  1OCC B;  2A0L A;  5EC1 C;  4MT8 A;  4GT1 A;  2JJ2 G;  1K8A W;  4GX5 A;  3SPC A;  1VQ5 V;  1E79 G;  2EIL C;  3ZN1 A;  1YTF D;  2Y48 A;  4RAI A;  3G4S V;  4OXS A;  3K08 A;  3SYA A;  1XL4 A;  4P9P A;  4RO2 A;  1AR1 B;  4R50 A;  3E83 A;  5C93 A;  3ABK B;  2NNU A;  4EKW A;  2YEV B;  3OMA B;  3BEH A;  2Q69 A;  2QE7 G;  1RM1 C;  1W2B U;  3IFX A;  4LC1 A;  5HFM A;  5HFL A;  2DW4 A;  4U7O A;  3MHH C;  1J95 A;  4UVC A;  5H9C A;  5J9P C;  1JJ2 U;  1YTF B;  2ITD C;  3CXC U;  1SZT A;  5KUM A;  4L87 A;  4JTD B;  1GMG A;  4Q20 A;  4UV8 A;  1B6Q A;  2WLI B;  4FPP A;  4MSW C;  3M99 B;  4QPK A;  3KG2 A;  2Q67 A;  5E1A C;  1M57 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...