1M1KW

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m1kW00
1N8RW 3CXCU 3G6EV 3CMEV 3CMAV 1YIJV 1R73A 1YITV 1YHQV 3G4SV 1M1KW 1S72V 1KD1W 2OTJV 3CD6V 3CCRV 1Q86W 3CC4V 4WFAV 3CPWU 1M90W 2OTLV 2QA4V 1JJ2U 1VQ4V 3CC7V 1KC8W 3CC2V 4WF9V 1VQ6V 1VQNV 1VQ9V 3CCUV 1VQLV 3CCJV 1VQOV 1VQPV 1NJIW 5DM6V 4WCEV 1Q82W 3I55V 3CCEV 1VQ7V 1KQSU 3G71V 1YJWV 1VQ5V 3I56V 2D3OW 1Q7YW 1QVGU 1YJ9V 1YI2V 1K9MW 2QEXV 3CCVV 1YJNV 1K8AW 4WFBV 3OW2U 1W2BU 3CCMV 1Q81W 1VQ8V 3CCLV 3CCQV 3CCSV 1VQMV 1QVFU 1K73W 1VQKV
chains in the Genus database with same CATH superfamily
4LF7B 1AR1B 2OIEA 2CGOA 3P3PA 1ZSPA 5LOVA 4DR5O 5H6QA 2QDOA 1JVMA 1H8EG 3K06A 5EYPB 4OXSA 4DR1B 1P4RA 1FKAO 2EULA 4P30A 4KP4A 4GX1A 3RBZA 4O4IB 3OMIB 3JD4A 4JTCB 3JARB 3K58A 4XDLA 4DV2B 2R9IA 1K92A 4IGGA 3G80A 3AG4C 4DR7B 2Q7EA 5A9GA 1XBLA 2LFRA 3M8AA 2CAZC 2YI9A 1P7BA 5LMNO 5H5NA 3T4DA 2B1IA 3UO2A 1SQVH 4FLVA 3QO8A 1P49A 2DW4A 1RM1C 4UVBA 1N4CA 2AXTZ 4JYAO 1ZLZA 2KQXA 1EN6A 4GX2A 5IT9N 5CN0A 5KUMA 4Z1MG 5JJEB 5B1BB 4DV1O 5GONB 1NQTA 4B3MB 1I7FA 3ML0A 4DV5B 5H2FZ 4KL1A 4G27B 5CB4B 3W7TA 4U7NA 1VMGA 4WFAV 2ETNA 2EIMB 3J80N 1VQNV 2YIBD 1W59A 3RVZA 1NVPB 4FIPC 4HZ3A 4I4TA 1EM1A 1B04A 4UCUA 1AP5A 1M57C 4MVSA 2VS0A 3FAVB 4DW1A 3HKBA 2HHHO 5KHIA 3LUTB 3ICXA 2QA4V 2Y0PA 1XNQO 3L72H 3OEHG 3TCUA 3LSUA 1KQSU 3BFRA 2E3CA 1I94B 4QJFB 2B1GA 1OCCB 5L3FA 1Q6UA 1DF4A 4N21A 3OMNB 5CA0A 1KB9F 2YICA 4GCZA 4LC1A 4PA6A 4BIOA 4U3FH 3L9DA 1K5QA 2LQTA 5CA1B 3SGIA 2JK5C 5C8YB 2OCCC 5GW7A 2CTWA 5LYJA 4LFCO 3CCQV 3AG3B 4LH7A 2ZE6A 1XDCA 2XAGA 3BAAA 1G1XB 3H1JH 1VP7A 4KXRA 3RYFB 5J2TB 3B4SA 3F5TA 2EBOA 3I55V 4NTYA 4LFBO 1XREA 4PELA 4ABMA 4U3JA 4JI6O 4DV7O 3LNNA 3BVOA 1FS0G 4PA9A 1HNWO 1NTKH 5FPOA 2GUZA 1D5AA 4RUFA 3TJTA 2Y69B 3SPHA 4ZBMA 3B8NA 4H37A 1HNXB 4MVZA 2NR5A 1ZX3A 1L1FA 3ZMSA 4DV4O 4GX0A 2F23A 5C93A 4PA4A 2QE7G 4MSWC 2DYSC 3PN1A 5BMVA 3DSQA 5L3GA 3AEIA 4TV9B 4ZOLA 1FXKC 1H2NA 3ZJZA 1EN4A 1OCRB 4CS4A 4K8XA 1E79G 3E2EA 5IJ0B 4R50A 2IW5A 3RYCA 1JFFA 4WCEV 4TUYB 4EFEA 3K0DA 4DRXB 2UUCB 4JI3O 1Q8IA 5F2VO 1PNLA 1XMOB 5KX5A 1N34O 1QVFU 1ZL8A 2HLDG 4JF3A 4F6EA 3ABKB 1AI6A 1K4DC 1GAXA 5KAFZ 2H94A 2N74A 3TXQA 4MTXA 4X66B 2YUAA 1COWG 3IAYA 3WB2A 1VARA 2IJIA 5AG2A 4X62B 2ITCC 2D2CB 3GWKC 2DYSB 4B7EA 3VQYA 4UB8Z 1N33O 2JEXA 1JA8A 1H2GA 5LHHA 2WA3A 1GN6A 1S76D 4DYLA 3STZC 2EJRA 1M4UA 1S5HC 3SYCA 4LF7O 1FFXA 3IFXA 3CC4V 4JI7B 2RCVA 3K03A 2WLNA 2AZ0A 1I08A 3OEEG 4ZHQB 5CBGA 1TVKB 2XAJA 2ZM6B 3TK1A 3JCUZ 2ADPA 4DK0A 2PF4E 3CMAV 1AP6A 4MT8A 2QJ1A 1Y66A 1VF5B 3RYIA 1YDXA 3MHSC 1VQ7V 3JD1A 1B3QA 5JQGB 2F4VB 1NR7A 4UXNA 2UU9O 2UXDO 4IYIA 5B5EZ 1NR1A 2WWWA 1SETA 3CRQA 4RQEA 4FLXA 4FK5C 3ETEA 1M57B 4BR6A 4UCTA 1AR4A 4DV3B 3OT7A 1PL0A 3EVKA 2QM7A 4JAVA 4FLUA 1M90W 2P06A 3CC7V 1KMIZ 1R6NA 1K5SA 3HKEB 2BTOA 1GK9A 2ZIMA 4O2AB 2Q67A 1NH2D 2V4DA 2QWPB 4MTGA 1LNQA 1WB8A 1OCZB 4DUZB 2FL4A 3OD4A 4KFMA 5LMUO 2VQFO 5IJ9B 3KG2A 1DLBA 1FD9A 1XHZA 5J2UB 3SPIA 2QKAA 2VQEO 1FXKA 3SJCC 1DGSA 1A32A 2LJ2A 3NXSA 3EHBB 5KMGB 3C90A 3QNEA 2ITDC 2JGDB 5EZYA 1AI4A 2YS8A 3ABUA 4WBNA 3E89A 2ZCEA 2UUBO 3G6BA 1N33B 3APOA 3G4SV 1J5EB 1L0LH 4UCRA 3RN4A 3CPWU 4MVRA 4LF8O 2JRIA 1BQZA 4YXWG 2ZINA 3U0ZA 1WPBA 5LP6C 2EIJB 4H13B 4JI7O 5LA6B 1VQ8V 1Q90D 3B09A 4CC6A 1X59A 3E83A 3D3IA 4B3SO 1V54B 3K08A 1R3LC 1RSOA 1IBKB 3ZN1A 1KBHA 2AZ2A 4I0XB 5LA6A 2KG7A 1SZXA 4DR7O 2YXHA 1EFRG 1SERA 3RT3C 4O4IA 1D5NA 1XL6A 4EEQA 2YXYA 3CX5F 4IL6Z 4PD4F 4AI8A 1BMFG 1JCHA 2QTSA 2HVJC 1F23A 2ZNIA 3J81N 3X2QC 2Q68A 4DV3O 2XAFA 3FB5C 4TV8A 3HPLC 1BHAA 4L87A 3K5OA 1QR9A 1AVMA 1M9NA 1TA8A 4CC5A 1WA8B 4UVAA 4W4KA 1K3EA 3JAWB 3TXSA 4H0LB 2Y4TA 3KCYA 4DR5B 4E2LA 2F93B 3JD0A 4AHCA 4JYYA 3ZMTA 4OPAA 2UUAO 3G6EV 1OCOB 2ZD9A 2MK3A 5CA0B 1S72V 3ABTA 4J11A 3UQ8A 4YHHO 4GKJB 1SA0A 1XILA 2QWOB 2Z5UA 4LFAO 4FJCC 2F66C 5LHIA 4WFEA 4B7KA 5LYJB 3K5MA 1DTOA 3OW2U 1W2BU 1W0KG 2E75B 3CCLV 2DWDC 1V55B 2X7RB 1LUVA 1LR1A 1CPYA 5JWPA 5BR8B 1M1KW 1ZUQA 1J5EO 1PNMA 1AI7A 5KHGA 2UXBO 4I55A 1JFFB 1H2LA 5J2TA 4CH6A 5E79Z 4TQDA 1Y6XA 2QEXV 5KX5B 4WFFA 4UV9A 1VF7A 2XT9A 3IC9A 4K0KO 1CP9A 1WA8A 5CA3A 1E1RG 3RWRD 1F7YA 4FPPA 2QTOA 4DR6O 2ODMA 3D36A 4PA3A 4QPKA 5IYDO 1XHXA 1Y67A 1B6QA 1QVGU 5EK0A 1KP3A 5JJJB 1OCZC 5BXZA 4P9OA 3GWOA 3NR7A 5IE9A 4PDLA 5LP6A 5B1AB 4DK1A 4QGPA 5KAIZ 3A2FA 4O4LA 4PI0A 4DV6O 2GDSA 4X20B 3H1IH 1VQ4V 4NXNB 3HKCA 1JOYA 1NS1A 5IJ9A 1FFXB 4DO2A 2CGNA 3BCCH 4QNHB 4YJ3B 4KHPB 4I9WA 4IT5A 3CRAA 2EILC 1OV9A 4IIJA 2CK3G 4Z1VA 4LCUC 3ZCCA 4XDKA 4GZRB 1TGOA 3CHXA 4L8JA 2BSKA 1HNWB 1VQ6V 1WLEA 3WU2Z 1NT2B 5LBQA 4HAMA 3F7VC 3RW0A 1ZTEA 1O9HA 1I5YA 3FKSG 3WG7C 2GBOA 1UPGA 2IU0A 1AB3A 2DWEC 5LGNA 3JALB 4JAAA 1NKDA 1S5LZ 2CTPA 1JMKC 1FJGB 2X0LA 1THZA 5JQGA 2DOSA 3ZS8C 2JS5A 3CRCA 3DTUB 2KB1A 5GONA 2CTRA 1I5XA 3OE7G 4LFCB 4JI0B 1RM1B 4NXMB 4X88A 2YEVA 1D2DA 1WN7A 4LP8A 3ABMC 1YJNV 3W7SA 3CCMV 3JSLA 4DXWA 3E8FA 4BW9A 2ZE5A 3ZMVA 5JH7B 1IBKO 3ASOC 1Q86W 2Z0AA 4IHJB 3UT5A 4DR6B 4LFBB 3ZHQA 1SQXH 3MHHC 1VIBA 1UJWB 3B40A 1BL8A 1EZVH 1HW7A 4LWSB 4P9PA 5L3CA 4DV7B 2VQEB 3P32A 1SKVA 4I50B 2IJJA 2BOCC 5D5PA 5GTHZ 1Q7YW 4I7ZB 2ZDIA 1NTZH 3JCZA 2RNBA 4BIUA 4DV6B 1QU7A 4DUYO 3ABLB 3ZRVA 3CC2V 4MTOA 1JQ0A 4NVPA 3H1HH 2WLMA 3I56V 5EBLC 4KHPO 1H2KA 3T1YO 1Q81W 5KLVH 1MSWD 3E22A 4J7ZA 1IBLO 1R73A 4J7KA 3K57A 2GHYA 4JV5O 2QKCA 4TWKA 3GB7C 1XMOO 3BRCA 3APQA 1WB7A 2XNDG 3RYIB 5IYZA 4JPRA 5CBFA 4LFAB 2QWQB 1BE3H 3N2GA 2WLKA 2AW9A 1MNGA 4FZ0A 4WBNB 3OGIB 4LWSA 3B2EE 2ZQMA 1H38A 1XMQB 4FMTA 5BR8O 4YIPA 3HKDA 4X62O 3JSNA 4BAYA 3JATA 2W0XA 2LP7A 3L70H 1SQGA 3H01A 1VQ9V 4OX9O 1NVPD 1GKFA 1PP9H 2CDYA 2ZE8A 1OHHG 2HJDA 3CCVV 5B3SB 1NZ6A 4A5UB 4KUMA 1NH2B 4UCVA 5K1XA 1XNQB 1VQMV 1GRJA 1FXHA 3LNMB 3ABMB 1Q6IA 3H1KH 4FM2A 2JS3A 4H33A 1QBZA 3SDLA 1GM9A 3SJAC 4HNAB 1OJHA 1WP8A 4PDRA 1URFA 1SF9A 3SJQC 1ENVA 4F6RA 1N8RW 1HR0O 2PZSA 3WB0A 1JPXA 4DR4B 2Y48A 1IVSA 1BQ0A 3LDDA 2IJKA 4FFBB 3CYOA 1S3JA 2Q69A 4FLWA 5EBWC 2PTMA 3UT5B 1YI2V 5E1AC 3JAWA 2E74B 3IGAC 5D5QA 1XI1A 4BWAA 1IBLB 5FNVA 5BMVB 4K0KB 4J9ZB 2JEUA 2MW2B 1Z5WA 3BPZA 4WFGA 3DC6A 1QLEB 3ABKC 1NI8A 4DUZO 3VBBA 3ETQA 3R65A 5LMUB 2DE0X 2A0LA 4FVMA 3WG7B 5ITZB 3AK1A 1MZFA 3ZRXA 2E5LO 4DV4B 1PM9A 4W4LA 5C8YA 4UCSA 4JI1B 2WPDG 2HKOA 5LMNB 4F6RB 4GLXA 2BSKB 3FB6C 4X64O 3CCUV 1X4TA 3HKEA 2K1EA 3ZIAG 3CP1A 3JD3A 4NTWA 1SS3A 1K9MW 3AG3C 1GH6A 1O9GA 4I9QA 3K59A 1ZL8B 2VWKA 1MA1A 5DEDA 3BHPA 4YIOA 3CXCU 2YXLA 3SPJA 1YHQV 1VEWA 5LXTB 2VWJA 4G2KA 4WF9V 2HJFC 3ZHSA 3L75H 4YJ2A 4PHZA 4OPHA 3OTOB 1G8MA 1OCRC 3KZIZ 3OGCC 3ZMZA 2EX3A 3CJHB 3K9SA 3UCSC 4X1IB 4UFZA 1N36O 2EIKB 1U97A 3E8HA 4O4LB 3DXRB 1SQPH 1IXBA 5HFMA 3CWBH 1NTMH 1JJ2U 2HFEC 1I0HA 4FZ1A 2ZE7A 3CJHA 2F43G 1YSCA 4TOIA 1SZTA 4J41A 3M7MX 1AROP 4LF4B 1OZ0A 1R1BA 1YF2A 3SYPA 1YITV 3CS5A 4R7CA 4X9QA 2P4VA 5LHGA 1YEWA 4NR1A 2RDCA 1B06A 5DM6V 4RQFA 2ZNJA 3FYIB 1WNSA 1UFIA 3CSXA 1SESA 1ORQC 3IJ4A 4DV1B 4FLTA 3F7YC 2BOBC 4PJ0Z 4CS2A 3JASB 3JALA 2UXCO 1Y74B 1YTFD 2E5LB 2H8PC 2FTKA 4GKJO 5B3SC 3OMAB 5EC2C 1IURA 2XAQA 5B1OA 4LF6O 3FFQA 2UU9B 1QNMA 2QM8A 4JTAB 4X1YA 2XUMA 4ZOLB 1RPOA 4K8ZA 3VQWA 4DR2B 1BGYH 4NTXA 1N32B 3LDCA 2G38A 3D36C 4MTFA 3G67A 3SR2C 4JYAB 5EIBD 5JH7A 4JZGA 3T1YB 2P22C 1ZWIC 3BA9A 3HKCB 2X6BA 4DR1O 3QVNA 1VF6A 3K79A 5JCOC 4DV5O 4C7UA 1H2SB 2BTQB 1YTFB 3T1CA 1HNZB 3RYFA 4RAIA 4JGSA 4B3TB 2A79B 3N2GB 1GN4A 1GM7A 3SPGA 1N0NA 2JGUA 3GVMA 1YJWV 1KKCA 2RQ6A 1GO3F 2KG7B 4RO2A 2R9AA 3E22B 4MVQA 2L6LA 5L3BA 1EBOA 4G28B 1M56B 3ZRWA 4D7SA 1PV0A 4O2AA 4X65B 2EILB 4JI2B 4FFKA 4ZIBA 3JAKB 3S3WA 2OIGA 1DK1A 3E8BA 3U11A 2GV9A 1TVKA 3E86A 3W7XA 5IYZB 3SYQA 2YEVB 1P7GA 4YJ3A 3ASOB 2YIBA 1CXZB 2Z3YA 1KKDA 2NN4A 3K5LA 1WP7A 2GSMB 1K97A 3VQXA 2DJVA 1MSDA 3CD6V 2JGDA 4IHJA 5EZYB 2CH7A 3OM3B 1EN5A 2BTQA 1WPXA 2V1DA 3FAVA 3OAAG 2ZR3A 1VQPV 3HR0A 4P2ZA 1H2MA 2K9PA 4DR2O 5BZBA 4BIZA 3B77A 4R6ZA 4LBEC 1N32O 4UV8A 2E76B 2YSUB 2QGNA 1Y76B 4JI4O 2WLJA 4HBNA 4UVCA 3L73H 5J9PC 2KSDA 3CE2A 4FM0A 2WA4A 4QPJA 1MG1A 2FKXA 5L3DA 3SYAA 1WAZA 2OT5A 4RWUA 4O4JA 2QKSA 3K04A 5FL7G 3RYHB 4LF9B 4Z2WA 2LW1A 2OYQA 4GT1A 4QIWF 2NLJC 5CA1A 3S3XA 5IJ0A 1IDSA 3MD0A 5KA6A 4GX5A 1GMGA 2EIMC 2Q7HA 4JYBA 1PPJH 4EB6B 1EZJA 3RFRA 3BEHA 2UXDB 1OCCC 1QR8A 3OUFA 1LUWA 3DC5A 2Q8VA 4X64B 3ASNB 2DQ0A 4O2BB 4LNUB 2R72A 3VQVA 2LGQA 4Q6GA 1SRYA 4DRXA 4GKKO 5EBMC 1Y76A 2UUCO 3THOA 4ASUG 3J7AU 1MMMA 2EINC 5LXTA 1AJNA 1Q6HA 3K9AA 2Q4PA 2UXCB 3RYHA 4B3RO 2IBZH 4JASA 3CB2A 2CE4A 4MVOA 1KC8W 1Z5VA 1WJZA 3T2MA 5J2UA 4O4HB 2ZT9B 3SPCA 4NKGB 4NXNO 4I55B 4X1KA 1GN2A 4BW5A 3CMEV 3SJBC 3STLC 3SYOA 3CXHF 2XAHA 5KHKA 1Q82W 2ZIOA 2D3OW 5LGTA 1H8HG 2HG5C 3D8CA 3ZHVA 3OTFA 2A3QA 1U96A 1PD3A 1HNZO 1OCOC 3H1LH 2LO1A 3CCRV 2IH1C 2WLIB 2OTLV 1R3JC 1HWYA 1HDJA 2F4VO 1BSMA 2IM9A 5IDJA 2DYRB 1M93A 1XUQA 4GYCB 1K8AW 1AJPA 1S0VA 1F51A 1KYOF 4MW3A 2PI4A 1AILA 5K1PA 4X65O 4NXMO 3IC7A 3HKBB 2X6CA 2P4KA 4PDVA 4LH6A 2P6JA 1VQOV 5B1NA 4EFBA 5BY1A 3CCEV 4GUNA 4CH3A 1PKXA 1IZ3A 4EKWA 1G6UA 3RYCB 5DN6G 4DR3B 2W6IG 2ZDIC 1V55C 4MVUA 4J9YB 2YDEA 1MZEA 1Q5OA 3EFFK 2ZXWC 2OTJV 1MABG 1G4YB 3ZBHA 1KU9A 3AK2A 1N36B 2GTSA 3WFVA 4JTDB 2V7QG 4I50A 3LSSA 2ARHA 2CTQA 1BZKA 2WLIA 5DECA 1IXMA 5IYCO 2P90A 4UCOA 4DUYB 4WFBV 1DF5A 1YXBA 1KECA 1K73W 4X1IA 4DW0A 2Q9LA 5FNVB 3ETDA 4QE7A 3AG4B 2ZKOA 5B1AC 1K4CC 4UB6Z 1BHBA 2B5UA 5CBHA 4B3SB 3PJSK 4LNUA 1Q43A 4J80A 1GTOA 4TQFA 5KMGA 3K0GA 4UUJC 1XL4A 3ABLC 4R8CA 2Q5ZA 2W0FC 3OTOO 4LF5B 2YC0A 3UO3A 3A0HZ 3N27A 3U10A 3G71V 5B1BC 1IBMB 4U3JB 2RMKB 2Q0AA 2KKWA 3JD2A 2DQ3A 2JVDA 3CRRA 3ZHTA 1JX9A 3OUSA 3T1HB 3CCSV 3VOUA 2OCHA 3ZRWB 4FLYA 2P67A 4ICGA 1V54C 4GKKB 5LOVB 1FPOA 4IYHA 5H9CA 1MOFA 2EJ7A 1AR5A 4LF8B 4LF4O 3QF7A 3RVYA 4CBCA 1YZBA 1QCEA 1XQ8A 4DV0O 4LR3A 2OWOA 4OGQB 1SQFA 1TUBA 3W7UA 1Z2GA 4B3TO 1QLNA 1PL4A 3AK3A 5JVDA 1CEZA 2HEPA 4JI8B 4I4TB 1GM8A 3O65A 4ZI7B 3TETA 4D7TA 2WLLA 2JJ1G 2WLHA 2GUZB 3L71H 3K5NA 4PI2A 4EB6A 5B66Z 5IWAO 1BT8A 2XASA 3ZN0A 1YVWA 2WSSG 1AJQA 3FX7A 2JIZG 4F4LA 4FLZA 4JZ2A 3L74H 4JI0O 1R6TA 2ZXWB 2XHBA 3FB7C 1JR9A 2UXXA 3E8GA 1R3IC 5KA5A 2YI8A 1VQKV 1RP3B 2X6AA 3R66A 1QHTA 2XTAA 2UUAB 2HVKC 4MS2A 4PV1B 2A06H 1KUQA 2ZM6O 5KHJA 3Q4HA 2W6JG 5JJNB 4YHHB 4I0XA 4JI5B 5LL6Y 5EC1C 1L8DA 3AG2C 4Q20A 3N2KA 1M56C 1S77D 4CH4A 5IYBO 1VF6C 2YIAA 2Q6AA 1V9PA 4FFBA 4TSFG 3HKDB 2GTAA 3OR6C 1P84F 2EIKC 2R9RB 5JVDB 3WB1A 4B08A 2IJHA 1ROPA 3N2KB 3JYCA 4ZI7A 1FJGO 1VQ5V 4YJ2B 1SQBH 2A9HA 4E4EA 4TV8B 2N05A 3CRMA 1FFTB 3FD9A 2QSAA 4JAUA 1K34A 4FM1A 3D3QA 1RSOB 2M6YA 4NYKA 4CH5A 4AQYO 3ZEDA 1KD1W 1N0JA 2DN9A 1I94O 4DV2O 2VQFB 3ZRSA 4O4JB 1RFYA 1XEQA 3O9OA 1ZAUA 2M7WA 2EZOA 3JARA 2ZR2A 1R3KC 2PUSA 4PA7A 3RGBA 2ATKC 4O4HA 1XMQO 3Q4HB 2UXNA 1IX9A 4RUEA 5TISZ 5CB4A 2C2AA 5A2QN 2OCCB 2QWRB 2DMXA 3EXAA 2CH7B 3KKYA 2UUBB 4X89A 1M5IA 3C3SA 4YY3B 3UKMA 1E1QG 2XOKG 1XNRO 5HFLA 1XOUA 1YJ9V 4D6TH 1TAEA 1T5EA 1FXKB 1R6KA 5H6RA 2F1MA 3F5WC 1VQLV 1QLEC 1J95A 3M99B 4JYCA 3C3TA 1Q3EA 2EINB 3QG5A 3ZMUA 4DR3O 5ITZA 4B3RB 4CZZA 2PGGA 4LF5O 3ETGA 1RPRA 2ADQB 5KHHA 4J10A 1IBMO 3KCXA 4ZHQA 2ILMA 5L3EA 1BS3A 1QQCA 4DR4O 1NBMG 3ASNC 2PYJA 4X8AA 3FB8C 1TUBB 4AILC 1GN3A 1KP2A 5CMUA 1F4MA 4I5SA 3B8MA 1NJIW 3MDSA 4TT3G 2AHYA 2F95B 4OX9B 2L35A 2FYUH 3A0BZ 1K7DA 4QE9A 2QWNB 3QTCA 1F4NA 4JV5B 4DV0B 5IY5C 2Q7GA 4CS3A 3ZX6A 1JJOA 4IIJB 4XBFA 2Y69C 2Q0OC 3CCJV 1HP8A 2HP8A 2Y0IA 1N34B 4J7JA 2O57A 2BE3A 4JI8O 4B3MO 2LFSA 2IU3A 3W7WA 3JATB 2PI5A 4HYOA 4JI1O 3OFNG 5LGUA 3I5DA 2NNUA 5GTIZ 3ZHUA 1HR0B 2DYRC 3X2QB 4X1YB 2EIJC 5LP6B 2VRZA 3MAQA 3UM7A 3BA8A 3AG7A 4YY3O 4JI2O 3DGEA 4TV9A 3LDEA 2UXBB 2H3OA 3QO7A 5EIBC 2AGAA 3T4ZA 1S5JA 4HNAA 1BCCH 1YIJV 2HHHB 2FB5A 5FLXN 1FAFA 4NB5A 4U7OA 4XDJA 5IY5B 4JI6B 3AG1B 2AHZA 4TUYA 4MW8A 4JI5O 3H9VA 2QR4A 3BABA 2JJ2G 2BCCH 2HR3A 4ZKIA 1HNXO 2A7WA 4X1KB 2P5OA 2LGWA 2CUGA 3AG2B 3AG1C 2JDIG 2B9ZA 5KUKA 3P3NA 1YCIA 2P7TC 4X20A 3FYEB 5FPRA 4JI4B 5IWAB 4H44B 1SA0B 1US6A 1L0NH 2QM4A 1AI5A 3DXRA 4K35A 1Y4MA 3JAMN 4J42A 2YIDA 3TGUH 2R70A 2IH3C 4N23A 4WFHA 4AQYB 1SQQH 4LF9O 4JI3B 2Y4UA 2RJZA 3K3WA 1TUEB 4O2BA 1PNKA 3A8TA 1FYJA 2N04A 2PYLA 3BY6A 3HB3B 4MVMA 4X66O 1K33A 1SC5B 2WLLB 3E35A 2PY5A 3LSQA 4LF6B 2EZPA 3T1HO 5JCOA 3JASA 2RN9A 2WAMA 4PDMA 1FXVA 1Y74A 3P30A 3OR7C 4K3AA 1W0JG 2LW7A 3ZHRA 1XNRB 3JAKA 2FMLA 3QO5A 3CEIA 3A0RA 5EYPA 2Q73A 1NU1H
chains in the Genus database with same CATH topology
1GTOA 1AR1B 3X2QC 2EIKB 2Q68A 3K0GA 4UUJC 3E8HA 1XL4A 3ABLC 2XAFA 5H6QA 4R8CA 3FB5C 5HFMA 1JVMA 1H8EG 1JJ2U 2HFEC 3K06A 3HPLC 1BHAA 4L87A 2W0FC 4OXSA 1P4RA 1QR9A 4P30A 4KP4A 4GX1A 2F43G 3RBZA 1M9NA 1YSCA 3G71V 5B1BC 4UVAA 1SZTA 1K3EA 3OMIB 3JD4A 4JTCB 4XDLA 2R9IA 2DQ3A 1K92A 3JD2A 1AROP 1JX9A 3AG4C 3OUSA 4E2LA 3CCSV 3VOUA 3JD0A 1OZ0A 3ZMTA 3G6EV 1OCOB 2ZD9A 3SYPA 2MK3A 1YITV 2LFRA 4R7CA 3ZRWB 1S72V 2P67A 3ABTA 1V54C 5H9CA 1MOFA 5LHGA 1P7BA 2Z5UA 5DM6V 4RQFA 3FYIB 4FJCC 5LHIA 1SESA 3RVYA 1ORQC 4WFEA 3T4DA 2B1IA 3F7YC 3QO8A 2BOBC 4CBCA 2DW4A 1DTOA 3OW2U 1RM1C 1W0KG 1W2BU 3CCLV 2DWDC 1V55B 2X7RB 1QCEA 1YTFD 4UVBA 2H8PC 2FTKA 1CPYA 5B3SC 3OMAB 5EC2C 1M1KW 4GX2A 2XAQA 5B1OA 2QM8A 3W7UA 4JTAB 1PNMA 5CN0A 1AI7A 5KUMA 4Z1MG 1RPOA 1QLNA 5B1BB 1CEZA 1GM8A 2QEXV 3LDCA 4WFFA 4UV9A 1NQTA 3TETA 2WLLA 3ML0A 4MTFA 2JJ1G 2WLHA 1CP9A 4G27B 5CA3A 1E1RG 3W7TA 4U7NA 4FPPA 2QTOA 2XASA 3ZN0A 2WSSG 4WFAV 1AJQA 1ZWIC 2JIZG 4F4LA 3D36A 2EIMB 4PA3A 4QPKA 1VQNV 5IYDO 2X6BA 3RVZA 1NVPB 1B6QA 2ZXWB 3K79A 1QVGU 5EK0A 1KP3A 4FIPC 4HZ3A 1OCZC 4P9OA 3GWOA 3FB7C 4PDLA 5B1AB 1YTFB 2UXXA 3T1CA 3E8GA 1R3IC 1M57C 5KA5A 4MVSA 2X6AA 1VQKV 4RAIA 4JGSA 2A79B 3LUTB 2HVKC 4MS2A 2QA4V 1VQ4V 1JOYA 1GM7A 3SPGA 3OEHG 3TCUA 2W6JG 4DO2A 1KQSU 1YJWV 5EC1C 3AG2C 4QJFB 4Q20A 4QNHB 1GO3F 4I9WA 2B1GA 1OCCB 5L3FA 1M56C 4RO2A 1S77D 5IYBO 2EILC 1DF4A 2Q6AA 4TSFG 4N21A 4MVQA 2CK3G 3OR6C 2EIKC 4LCUC 5L3BA 1EBOA 4G28B 1M56B 3OMNB 2R9RB 3ZCCA 3ZRWA 4XDKA 2EILB 4GCZA 2IJHA 1ROPA 3JYCA 4LC1A 4PA6A 1VQ6V 1WLEA 3E8BA 1K5QA 5LBQA 4HAMA 3F7VC 3RW0A 3E86A 1I5YA 3W7XA 1VQ5V 2A9HA 3FKSG 3WG7C 3SYQA 2YEVB 2JK5C 2IU0A 3ASOB 2DWEC 2OCCC 5LGNA 5GW7A 2Z3YA 1KKDA 3CCQV 1NKDA 1FFTB 2GSMB 4JAUA 1K97A 1K34A 2X0LA 3AG3B 1THZA 1KD1W 2XAGA 3CD6V 3OM3B 3DTUB 1WPXA 2V1DA 2KB1A 3ZRSA 3OAAG 2ZR3A 1VQPV 4P2ZA 1I5XA 3OE7G 2EBOA 3I55V 5BZBA 4BIZA 1RM1B 4PELA 4X88A 2M7WA 2YEVA 3B77A 4R6ZA 2EZOA 4LBEC 2ZR2A 1R3KC 3ABMC 4LP8A 4PA7A 1YJNV 4UV8A 2YSUB 3W7SA 3CCMV 4DXWA 2ATKC 2WLJA 1FS0G 4PA9A 4UVCA 3E8FA 2UXNA 4RUEA 4RUFA 3ZMVA 5J9PC 2Y69B 3ASOC 3SPHA 2C2AA 4ZBMA 3B8NA 4H37A 1MG1A 4QPJA 4MVZA 1Q86W 2OCCB 5L3DA 1L1FA 3SYAA 3ZMSA 4GX0A 2OT5A 3MHHC 4X89A 1UJWB 1BL8A 2QKSA 3UKMA 4P9PA 1E1QG 3K04A 4PA4A 2QE7G 2XOKG 4MSWC 5FL7G 5HFLA 5C93A 5L3CA 3P32A 1YJ9V 2DYSC 5L3GA 2IJJA 1FXKB 1R6KA 2BOCC 4GT1A 5H6RA 4QIWF 2NLJC 3AEIA 1VQLV 3F5WC 1QLEC 1J95A 1Q7YW 3M99B 4JYCA 2ZDIA 3MD0A 1FXKC 3JCZA 4BIUA 3ZJZA 1OCRB 5KA6A 1E79G 2EINB 4GX5A 3ABLB 3ZRVA 3E2EA 3ZMUA 3CC2V 4MTOA 1JQ0A 1GMGA 2EIMC 4R50A 2IW5A 4JYBA 4CZZA 1EZJA 3ETGA 1RPRA 4WCEV 3BEHA 2WLMA 3K0DA 3I56V 1OCCC 1QR8A 3OUFA 1PNLA 5EBLC 3ASNB 1Q81W 1MSWD 5L3EA 2DQ0A 1QVFU 2HLDG 4JF3A 3ABKB 1AI6A 1K4DC 1NBMG 1R73A 1SRYA 3ASNC 2H94A 4X8AA 2GHYA 3FB8C 4MTXA 1COWG 1KP2A 5EBMC 4TWKA 5CMUA 3GB7C 1F4MA 4I5SA 3B8MA 1NJIW 2IJIA 2XNDG 4TT3G 4JPRA 5CBFA 2AHYA 4ASUG 2ITCC 2EINC 2WLKA 1AJNA 1K7DA 2DYSB 3K9AA 4QE9A 2JEXA 1F4NA 2ZQMA 1H38A 4FMTA 4JASA 5IY5C 1H2GA 5LHHA 1S76D 4BAYA 4MVOA 3STZC 2EJRA 1KC8W 2LP7A 1S5HC 3SYCA 3H01A 2Y69C 4XBFA 1VQ9V 3CCJV 1NVPD 3T2MA 1GKFA 3IFXA 3CC4V 1OHHG 3K03A 2WLNA 3CCVV 2LFSA 3OEEG 2IU3A 5B3SB 3W7WA 5CBGA 3SPCA 2XAJA 4KUMA 1NH2B 3TK1A 1VQMV 1FXHA 2PI5A 3LNMB 3ABMB 4HYOA 4BW5A 3OFNG 3STLC 5LGUA 3CMAV 3CMEV 2NNUA 3SYOA 4MT8A 2DYRC 3X2QB 1Y66A 2EIJC 4H33A 1QBZA 1GM9A 3UM7A 2XAHA 1Q82W 3MHSC 1VQ7V 3JD1A 2D3OW 5LGTA 1H8HG 2HG5C 1NR7A 4UXNA 4PDRA 1NR1A 3DGEA 2WWWA 3LDEA 1SETA 4RQEA 3QO7A 3SJQC 1PD3A 1ENVA 4FK5C 1OCOC 3T4ZA 3ETEA 1N8RW 1M57B 1YIJV 1PL0A 2QM7A 1JPXA 4JAVA 2IH1C 2WLIB 3CCRV 1M90W 2Y48A 2OTLV 4U7OA 4XDJA 5IY5B 3LDDA 1R3JC 2IJKA 3CYOA 3CC7V 3AG1B 1HWYA 1S3JA 1R6NA 2AHZA 2Q69A 5EBWC 1K5SA 1GK9A 2Q67A 1NH2D 4MW8A 4MTGA 1YI2V 5IDJA 2DYRB 5E1AC 1LNQA 1K8AW 1OCZB 2JJ2G 2HR3A 3IGAC 1AJPA 4KFMA 4ZKIA 1S0VA 1F51A 4MW3A 2PI4A 3KG2A 1DLBA 3AG2B 3SPIA 3AG1C 2JDIG 3IC7A 5KUKA 4J9ZB 2JEUA 2X6CA 1FXKA 2P7TC 4WFGA 3FYEB 1QLEB 4PDVA 2P6JA 1VQOV 3ABKC 5B1NA 3VBBA 3CCEV 3NXSA 3EHBB 3R65A 1AI5A 1PKXA 2A0LA 2ITDC 3QNEA 3WG7B 1Y4MA 1AI4A 3ABUA 4EKWA 3ZRXA 5DN6G 3E89A 2IH3C 2W6IG 2ZDIC 4N23A 1V55C 4MVUA 4J9YB 4WFHA 3EFFK 3G4SV 2ZXWC 2OTJV 1MABG 1G4YB 2WPDG 3CPWU 3K3WA 4MVRA 2HKOA 4YXWG 3FB6C 3WFVA 3CCUV 1TUEB 4JTDB 1PNKA 2K1EA 3ZIAG 2V7QG 2EIJB 3CP1A 3JD3A 3LSSA 1K9MW 3BY6A 3HB3B 4MVMA 2WLIA 1IXMA 5IYCO 3AG3C 2P90A 4WFBV 1VQ8V 1K33A 1DF5A 1KECA 2WLLB 1K73W 3E35A 3E83A 3LSQA 3D3IA 3CXCU 1V54B 3K08A 1R3LC 3SPJA 3ZN1A 1YHQV 2EZPA 3ETDA 2WAMA 4QE7A 4G2KA 4WF9V 4PDMA 3AG4B 1EFRG 1FXVA 1SERA 3P30A 3OR7C 2HJFC 5B1AC 1W0JG 1XL6A 1K4CC 1G8MA 1BHBA 1OCRC 2B5UA 5CBHA 3QO5A 3A0RA 1BMFG 1JCHA 3OGCC 2HVJC 3ZMZA 1F23A 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  3CXC U;  3G6E V;  3CME V;  3CMA V;  1YIJ V;  1R73 A;  1YIT V;  1YHQ V;  3G4S V;  1M1K W;  1S72 V;  1KD1 W;  2OTJ V;  3CD6 V;  3CCR V;  1Q86 W;  3CC4 V;  4WFA V;  3CPW U;  1M90 W;  2OTL V;  2QA4 V;  1JJ2 U;  1VQ4 V;  3CC7 V;  1KC8 W;  3CC2 V;  4WF9 V;  1VQ6 V;  1VQN V;  1VQ9 V;  3CCU V;  1VQL V;  3CCJ V;  1VQO V;  1VQP V;  1NJI W;  5DM6 V;  4WCE V;  1Q82 W;  3I55 V;  3CCE V;  1VQ7 V;  1KQS U;  3G71 V;  1YJW V;  1VQ5 V;  3I56 V;  2D3O W;  1Q7Y W;  1QVG U;  1YJ9 V;  1YI2 V;  1K9M W;  2QEX V;  3CCV V;  1YJN V;  1K8A W;  4WFB V;  3OW2 U;  1W2B U;  3CCM V;  1Q81 W;  1VQ8 V;  3CCL V;  3CCQ V;  3CCS V;  1VQM V;  1QVF U;  1K73 W;  1VQK V; 
#chains in the Genus database with same CATH topology
 4LF7 B;  1AR1 B;  2OIE A;  2CGO A;  3P3P A;  1ZSP A;  5LOV A;  4DR5 O;  5H6Q A;  2QDO A;  1JVM A;  1H8E G;  3K06 A;  5EYP B;  4OXS A;  4DR1 B;  1P4R A;  1FKA O;  2EUL A;  4P30 A;  4KP4 A;  4GX1 A;  3RBZ A;  4O4I B;  3OMI B;  3JD4 A;  4JTC B;  3JAR B;  3K58 A;  4XDL A;  4DV2 B;  2R9I A;  1K92 A;  4IGG A;  3G80 A;  3AG4 C;  4DR7 B;  2Q7E A;  5A9G A;  1XBL A;  2LFR A;  3M8A A;  2CAZ C;  2YI9 A;  1P7B A;  5LMN O;  5H5N A;  3T4D A;  2B1I A;  3UO2 A;  1SQV H;  4FLV A;  3QO8 A;  1P49 A;  2DW4 A;  1RM1 C;  4UVB A;  1N4C A;  2AXT Z;  4JYA O;  1ZLZ A;  2KQX A;  1EN6 A;  4GX2 A;  5IT9 N;  5CN0 A;  5KUM A;  4Z1M G;  5JJE B;  5B1B B;  4DV1 O;  5GON B;  1NQT A;  4B3M B;  1I7F A;  3ML0 A;  4DV5 B;  5H2F Z;  4KL1 A;  4G27 B;  5CB4 B;  3W7T A;  4U7N A;  1VMG A;  4WFA V;  2ETN A;  2EIM B;  3J80 N;  1VQN V;  2YIB D;  1W59 A;  3RVZ A;  1NVP B;  4FIP C;  4HZ3 A;  4I4T A;  1EM1 A;  1B04 A;  4UCU A;  1AP5 A;  1M57 C;  4MVS A;  2VS0 A;  3FAV B;  4DW1 A;  3HKB A;  2HHH O;  5KHI A;  3LUT B;  3ICX A;  2QA4 V;  2Y0P A;  1XNQ O;  3L72 H;  3OEH G;  3TCU A;  3LSU A;  1KQS U;  3BFR A;  2E3C A;  1I94 B;  4QJF B;  2B1G A;  1OCC B;  5L3F A;  1Q6U A;  1DF4 A;  4N21 A;  3OMN B;  5CA0 A;  1KB9 F;  2YIC A;  4GCZ A;  4LC1 A;  4PA6 A;  4BIO A;  4U3F H;  3L9D A;  1K5Q A;  2LQT A;  5CA1 B;  3SGI A;  2JK5 C;  5C8Y B;  2OCC C;  5GW7 A;  2CTW A;  5LYJ A;  4LFC O;  3CCQ V;  3AG3 B;  4LH7 A;  2ZE6 A;  1XDC A;  2XAG A;  3BAA A;  1G1X B;  3H1J H;  1VP7 A;  4KXR A;  3RYF B;  5J2T B;  3B4S A;  3F5T A;  2EBO A;  3I55 V;  4NTY A;  4LFB O;  1XRE A;  4PEL A;  4ABM A;  4U3J A;  4JI6 O;  4DV7 O;  3LNN A;  3BVO A;  1FS0 G;  4PA9 A;  1HNW O;  1NTK H;  5FPO A;  2GUZ A;  1D5A A;  4RUF A;  3TJT A;  2Y69 B;  3SPH A;  4ZBM A;  3B8N A;  4H37 A;  1HNX B;  4MVZ A;  2NR5 A;  1ZX3 A;  1L1F A;  3ZMS A;  4DV4 O;  4GX0 A;  2F23 A;  5C93 A;  4PA4 A;  2QE7 G;  4MSW C;  2DYS C;  3PN1 A;  5BMV A;  3DSQ A;  5L3G A;  3AEI A;  4TV9 B;  4ZOL A;  1FXK C;  1H2N A;  3ZJZ A;  1EN4 A;  1OCR B;  4CS4 A;  4K8X A;  1E79 G;  3E2E A;  5IJ0 B;  4R50 A;  2IW5 A;  3RYC A;  1JFF A;  4WCE V;  4TUY B;  4EFE A;  3K0D A;  4DRX B;  2UUC B;  4JI3 O;  1Q8I A;  5F2V O;  1PNL A;  1XMO B;  5KX5 A;  1N34 O;  1QVF U;  1ZL8 A;  2HLD G;  4JF3 A;  4F6E A;  3ABK B;  1AI6 A;  1K4D C;  1GAX A;  5KAF Z;  2H94 A;  2N74 A;  3TXQ A;  4MTX A;  4X66 B;  2YUA A;  1COW G;  3IAY A;  3WB2 A;  1VAR A;  2IJI A;  5AG2 A;  4X62 B;  2ITC C;  2D2C B;  3GWK C;  2DYS B;  4B7E A;  3VQY A;  4UB8 Z;  1N33 O;  2JEX A;  1JA8 A;  1H2G A;  5LHH A;  2WA3 A;  1GN6 A;  1S76 D;  4DYL A;  3STZ C;  2EJR A;  1M4U A;  1S5H C;  3SYC A;  4LF7 O;  1FFX A;  3IFX A;  3CC4 V;  4JI7 B;  2RCV A;  3K03 A;  2WLN A;  2AZ0 A;  1I08 A;  3OEE G;  4ZHQ B;  5CBG A;  1TVK B;  2XAJ A;  2ZM6 B;  3TK1 A;  3JCU Z;  2ADP A;  4DK0 A;  2PF4 E;  3CMA V;  1AP6 A;  4MT8 A;  2QJ1 A;  1Y66 A;  1VF5 B;  3RYI A;  1YDX A;  3MHS C;  1VQ7 V;  3JD1 A;  1B3Q A;  5JQG B;  2F4V B;  1NR7 A;  4UXN A;  2UU9 O;  2UXD O;  4IYI A;  5B5E Z;  1NR1 A;  2WWW A;  1SET A;  3CRQ A;  4RQE A;  4FLX A;  4FK5 C;  3ETE A;  1M57 B;  4BR6 A;  4UCT A;  1AR4 A;  4DV3 B;  3OT7 A;  1PL0 A;  3EVK A;  2QM7 A;  4JAV A;  4FLU A;  1M90 W;  2P06 A;  3CC7 V;  1KMI Z;  1R6N A;  1K5S A;  3HKE B;  2BTO A;  1GK9 A;  2ZIM A;  4O2A B;  2Q67 A;  1NH2 D;  2V4D A;  2QWP B;  4MTG A;  1LNQ A;  1WB8 A;  1OCZ B;  4DUZ B;  2FL4 A;  3OD4 A;  4KFM A;  5LMU O;  2VQF O;  5IJ9 B;  3KG2 A;  1DLB A;  1FD9 A;  1XHZ A;  5J2U B;  3SPI A;  2QKA A;  2VQE O;  1FXK A;  3SJC C;  1DGS A;  1A32 A;  2LJ2 A;  3NXS A;  3EHB B;  5KMG B;  3C90 A;  3QNE A;  2ITD C;  2JGD B;  5EZY A;  1AI4 A;  2YS8 A;  3ABU A;  4WBN A;  3E89 A;  2ZCE A;  2UUB O;  3G6B A;  1N33 B;  3APO A;  3G4S V;  1J5E B;  1L0L H;  4UCR A;  3RN4 A;  3CPW U;  4MVR A;  4LF8 O;  2JRI A;  1BQZ A;  4YXW G;  2ZIN A;  3U0Z A;  1WPB A;  5LP6 C;  2EIJ B;  4H13 B;  4JI7 O;  5LA6 B;  1VQ8 V;  1Q90 D;  3B09 A;  4CC6 A;  1X59 A;  3E83 A;  3D3I A;  4B3S O;  1V54 B;  3K08 A;  1R3L C;  1RSO A;  1IBK B;  3ZN1 A;  1KBH A;  2AZ2 A;  4I0X B;  5LA6 A;  2KG7 A;  1SZX A;  4DR7 O;  2YXH A;  1EFR G;  1SER A;  3RT3 C;  4O4I A;  1D5N A;  1XL6 A;  4EEQ A;  2YXY A;  3CX5 F;  4IL6 Z;  4PD4 F;  4AI8 A;  1BMF G;  1JCH A;  2QTS A;  2HVJ C;  1F23 A;  2ZNI A;  3J81 N;  3X2Q C;  2Q68 A;  4DV3 O;  2XAF A;  3FB5 C;  4TV8 A;  3HPL C;  1BHA A;  4L87 A;  3K5O A;  1QR9 A;  1AVM A;  1M9N A;  1TA8 A;  4CC5 A;  1WA8 B;  4UVA A;  4W4K A;  1K3E A;  3JAW B;  3TXS A;  4H0L B;  2Y4T A;  3KCY A;  4DR5 B;  4E2L A;  2F93 B;  3JD0 A;  4AHC A;  4JYY A;  3ZMT A;  4OPA A;  2UUA O;  3G6E V;  1OCO B;  2ZD9 A;  2MK3 A;  5CA0 B;  1S72 V;  3ABT A;  4J11 A;  3UQ8 A;  4YHH O;  4GKJ B;  1SA0 A;  1XIL A;  2QWO B;  2Z5U A;  4LFA O;  4FJC C;  2F66 C;  5LHI A;  4WFE A;  4B7K A;  5LYJ B;  3K5M A;  1DTO A;  3OW2 U;  1W2B U;  1W0K G;  2E75 B;  3CCL V;  2DWD C;  1V55 B;  2X7R B;  1LUV A;  1LR1 A;  1CPY A;  5JWP A;  5BR8 B;  1M1K W;  1ZUQ A;  1J5E O;  1PNM A;  1AI7 A;  5KHG A;  2UXB O;  4I55 A;  1JFF B;  1H2L A;  5J2T A;  4CH6 A;  5E79 Z;  4TQD A;  1Y6X A;  2QEX V;  5KX5 B;  4WFF A;  4UV9 A;  1VF7 A;  2XT9 A;  3IC9 A;  4K0K O;  1CP9 A;  1WA8 A;  5CA3 A;  1E1R G;  3RWR D;  1F7Y A;  4FPP A;  2QTO A;  4DR6 O;  2ODM A;  3D36 A;  4PA3 A;  4QPK A;  5IYD O;  1XHX A;  1Y67 A;  1B6Q A;  1QVG U;  5EK0 A;  1KP3 A;  5JJJ B;  1OCZ C;  5BXZ A;  4P9O A;  3GWO A;  3NR7 A;  5IE9 A;  4PDL A;  5LP6 A;  5B1A B;  4DK1 A;  4QGP A;  5KAI Z;  3A2F A;  4O4L A;  4PI0 A;  4DV6 O;  2GDS A;  4X20 B;  3H1I H;  1VQ4 V;  4NXN B;  3HKC A;  1JOY A;  1NS1 A;  5IJ9 A;  1FFX B;  4DO2 A;  2CGN A;  3BCC H;  4QNH B;  4YJ3 B;  4KHP B;  4I9W A;  4IT5 A;  3CRA A;  2EIL C;  1OV9 A;  4IIJ A;  2CK3 G;  4Z1V A;  4LCU C;  3ZCC A;  4XDK A;  4GZR B;  1TGO A;  3CHX A;  4L8J A;  2BSK A;  1HNW B;  1VQ6 V;  1WLE A;  3WU2 Z;  1NT2 B;  5LBQ A;  4HAM A;  3F7V C;  3RW0 A;  1ZTE A;  1O9H A;  1I5Y A;  3FKS G;  3WG7 C;  2GBO A;  1UPG A;  2IU0 A;  1AB3 A;  2DWE C;  5LGN A;  3JAL B;  4JAA A;  1NKD A;  1S5L Z;  2CTP A;  1JMK C;  1FJG B;  2X0L A;  1THZ A;  5JQG A;  2DOS A;  3ZS8 C;  2JS5 A;  3CRC A;  3DTU B;  2KB1 A;  5GON A;  2CTR A;  1I5X A;  3OE7 G;  4LFC B;  4JI0 B;  1RM1 B;  4NXM B;  4X88 A;  2YEV A;  1D2D A;  1WN7 A;  4LP8 A;  3ABM C;  1YJN V;  3W7S A;  3CCM V;  3JSL A;  4DXW A;  3E8F A;  4BW9 A;  2ZE5 A;  3ZMV A;  5JH7 B;  1IBK O;  3ASO C;  1Q86 W;  2Z0A A;  4IHJ B;  3UT5 A;  4DR6 B;  4LFB B;  3ZHQ A;  1SQX H;  3MHH C;  1VIB A;  1UJW B;  3B40 A;  1BL8 A;  1EZV H;  1HW7 A;  4LWS B;  4P9P A;  5L3C A;  4DV7 B;  2VQE B;  3P32 A;  1SKV A;  4I50 B;  2IJJ A;  2BOC C;  5D5P A;  5GTH Z;  1Q7Y W;  4I7Z B;  2ZDI A;  1NTZ H;  3JCZ A;  2RNB A;  4BIU A;  4DV6 B;  1QU7 A;  4DUY O;  3ABL B;  3ZRV A;  3CC2 V;  4MTO A;  1JQ0 A;  4NVP A;  3H1H H;  2WLM A;  3I56 V;  5EBL C;  4KHP O;  1H2K A;  3T1Y O;  1Q81 W;  5KLV H;  1MSW D;  3E22 A;  4J7Z A;  1IBL O;  1R73 A;  4J7K A;  3K57 A;  2GHY A;  4JV5 O;  2QKC A;  4TWK A;  3GB7 C;  1XMO O;  3BRC A;  3APQ A;  1WB7 A;  2XND G;  3RYI B;  5IYZ A;  4JPR A;  5CBF A;  4LFA B;  2QWQ B;  1BE3 H;  3N2G A;  2WLK A;  2AW9 A;  1MNG A;  4FZ0 A;  4WBN B;  3OGI B;  4LWS A;  3B2E E;  2ZQM A;  1H38 A;  1XMQ B;  4FMT A;  5BR8 O;  4YIP A;  3HKD A;  4X62 O;  3JSN A;  4BAY A;  3JAT A;  2W0X A;  2LP7 A;  3L70 H;  1SQG A;  3H01 A;  1VQ9 V;  4OX9 O;  1NVP D;  1GKF A;  1PP9 H;  2CDY A;  2ZE8 A;  1OHH G;  2HJD A;  3CCV V;  5B3S B;  1NZ6 A;  4A5U B;  4KUM A;  1NH2 B;  4UCV A;  5K1X A;  1XNQ B;  1VQM V;  1GRJ A;  1FXH A;  3LNM B;  3ABM B;  1Q6I A;  3H1K H;  4FM2 A;  2JS3 A;  4H33 A;  1QBZ A;  3SDL A;  1GM9 A;  3SJA C;  4HNA B;  1OJH A;  1WP8 A;  4PDR A;  1URF A;  1SF9 A;  3SJQ C;  1ENV A;  4F6R A;  1N8R W;  1HR0 O;  2PZS A;  3WB0 A;  1JPX A;  4DR4 B;  2Y48 A;  1IVS A;  1BQ0 A;  3LDD A;  2IJK A;  4FFB B;  3CYO A;  1S3J A;  2Q69 A;  4FLW A;  5EBW C;  2PTM A;  3UT5 B;  1YI2 V;  5E1A C;  3JAW A;  2E74 B;  3IGA C;  5D5Q A;  1XI1 A;  4BWA A;  1IBL B;  5FNV A;  5BMV B;  4K0K B;  4J9Z B;  2JEU A;  2MW2 B;  1Z5W A;  3BPZ A;  4WFG A;  3DC6 A;  1QLE B;  3ABK C;  1NI8 A;  4DUZ O;  3VBB A;  3ETQ A;  3R65 A;  5LMU B;  2DE0 X;  2A0L A;  4FVM A;  3WG7 B;  5ITZ B;  3AK1 A;  1MZF A;  3ZRX A;  2E5L O;  4DV4 B;  1PM9 A;  4W4L A;  5C8Y A;  4UCS A;  4JI1 B;  2WPD G;  2HKO A;  5LMN B;  4F6R B;  4GLX A;  2BSK B;  3FB6 C;  4X64 O;  3CCU V;  1X4T A;  3HKE A;  2K1E A;  3ZIA G;  3CP1 A;  3JD3 A;  4NTW A;  1SS3 A;  1K9M W;  3AG3 C;  1GH6 A;  1O9G A;  4I9Q A;  3K59 A;  1ZL8 B;  2VWK A;  1MA1 A;  5DED A;  3BHP A;  4YIO A;  3CXC U;  2YXL A;  3SPJ A;  1YHQ V;  1VEW A;  5LXT B;  2VWJ A;  4G2K A;  4WF9 V;  2HJF C;  3ZHS A;  3L75 H;  4YJ2 A;  4PHZ A;  4OPH A;  3OTO B;  1G8M A;  1OCR C;  3KZI Z;  3OGC C;  3ZMZ A;  2EX3 A;  3CJH B;  3K9S A;  3UCS C;  4X1I B;  4UFZ A;  1N36 O;  2EIK B;  1U97 A;  3E8H A;  4O4L B;  3DXR B;  1SQP H;  1IXB A;  5HFM A;  3CWB H;  1NTM H;  1JJ2 U;  2HFE C;  1I0H A;  4FZ1 A;  2ZE7 A;  3CJH A;  2F43 G;  1YSC A;  4TOI A;  1SZT A;  4J41 A;  3M7M X;  1ARO P;  4LF4 B;  1OZ0 A;  1R1B A;  1YF2 A;  3SYP A;  1YIT V;  3CS5 A;  4R7C A;  4X9Q A;  2P4V A;  5LHG A;  1YEW A;  4NR1 A;  2RDC A;  1B06 A;  5DM6 V;  4RQF A;  2ZNJ A;  3FYI B;  1WNS A;  1UFI A;  3CSX A;  1SES A;  1ORQ C;  3IJ4 A;  4DV1 B;  4FLT A;  3F7Y C;  2BOB C;  4PJ0 Z;  4CS2 A;  3JAS B;  3JAL A;  2UXC O;  1Y74 B;  1YTF D;  2E5L B;  2H8P C;  2FTK A;  4GKJ O;  5B3S C;  3OMA B;  5EC2 C;  1IUR A;  2XAQ A;  5B1O A;  4LF6 O;  3FFQ A;  2UU9 B;  1QNM A;  2QM8 A;  4JTA B;  4X1Y A;  2XUM A;  4ZOL B;  1RPO A;  4K8Z A;  3VQW A;  4DR2 B;  1BGY H;  4NTX A;  1N32 B;  3LDC A;  2G38 A;  3D36 C;  4MTF A;  3G67 A;  3SR2 C;  4JYA B;  5EIB D;  5JH7 A;  4JZG A;  3T1Y B;  2P22 C;  1ZWI C;  3BA9 A;  3HKC B;  2X6B A;  4DR1 O;  3QVN A;  1VF6 A;  3K79 A;  5JCO C;  4DV5 O;  4C7U A;  1H2S B;  2BTQ B;  1YTF B;  3T1C A;  1HNZ B;  3RYF A;  4RAI A;  4JGS A;  4B3T B;  2A79 B;  3N2G B;  1GN4 A;  1GM7 A;  3SPG A;  1N0N A;  2JGU A;  3GVM A;  1YJW V;  1KKC A;  2RQ6 A;  1GO3 F;  2KG7 B;  4RO2 A;  2R9A A;  3E22 B;  4MVQ A;  2L6L A;  5L3B A;  1EBO A;  4G28 B;  1M56 B;  3ZRW A;  4D7S A;  1PV0 A;  4O2A A;  4X65 B;  2EIL B;  4JI2 B;  4FFK A;  4ZIB A;  3JAK B;  3S3W A;  2OIG A;  1DK1 A;  3E8B A;  3U11 A;  2GV9 A;  1TVK A;  3E86 A;  3W7X A;  5IYZ B;  3SYQ A;  2YEV B;  1P7G A;  4YJ3 A;  3ASO B;  2YIB A;  1CXZ B;  2Z3Y A;  1KKD A;  2NN4 A;  3K5L A;  1WP7 A;  2GSM B;  1K97 A;  3VQX A;  2DJV A;  1MSD A;  3CD6 V;  2JGD A;  4IHJ A;  5EZY B;  2CH7 A;  3OM3 B;  1EN5 A;  2BTQ A;  1WPX A;  2V1D A;  3FAV A;  3OAA G;  2ZR3 A;  1VQP V;  3HR0 A;  4P2Z A;  1H2M A;  2K9P A;  4DR2 O;  5BZB A;  4BIZ A;  3B77 A;  4R6Z A;  4LBE C;  1N32 O;  4UV8 A;  2E76 B;  2YSU B;  2QGN A;  1Y76 B;  4JI4 O;  2WLJ A;  4HBN A;  4UVC A;  3L73 H;  5J9P C;  2KSD A;  3CE2 A;  4FM0 A;  2WA4 A;  4QPJ A;  1MG1 A;  2FKX A;  5L3D A;  3SYA A;  1WAZ A;  2OT5 A;  4RWU A;  4O4J A;  2QKS A;  3K04 A;  5FL7 G;  3RYH B;  4LF9 B;  4Z2W A;  2LW1 A;  2OYQ A;  4GT1 A;  4QIW F;  2NLJ C;  5CA1 A;  3S3X A;  5IJ0 A;  1IDS A;  3MD0 A;  5KA6 A;  4GX5 A;  1GMG A;  2EIM C;  2Q7H A;  4JYB A;  1PPJ H;  4EB6 B;  1EZJ A;  3RFR A;  3BEH A;  2UXD B;  1OCC C;  1QR8 A;  3OUF A;  1LUW A;  3DC5 A;  2Q8V A;  4X64 B;  3ASN B;  2DQ0 A;  4O2B B;  4LNU B;  2R72 A;  3VQV A;  2LGQ A;  4Q6G A;  1SRY A;  4DRX A;  4GKK O;  5EBM C;  1Y76 A;  2UUC O;  3THO A;  4ASU G;  3J7A U;  1MMM A;  2EIN C;  5LXT A;  1AJN A;  1Q6H A;  3K9A A;  2Q4P A;  2UXC B;  3RYH A;  4B3R O;  2IBZ H;  4JAS A;  3CB2 A;  2CE4 A;  4MVO A;  1KC8 W;  1Z5V A;  1WJZ A;  3T2M A;  5J2U A;  4O4H B;  2ZT9 B;  3SPC A;  4NKG B;  4NXN O;  4I55 B;  4X1K A;  1GN2 A;  4BW5 A;  3CME V;  3SJB C;  3STL C;  3SYO A;  3CXH F;  2XAH A;  5KHK A;  1Q82 W;  2ZIO A;  2D3O W;  5LGT A;  1H8H G;  2HG5 C;  3D8C A;  3ZHV A;  3OTF A;  2A3Q A;  1U96 A;  1PD3 A;  1HNZ O;  1OCO C;  3H1L H;  2LO1 A;  3CCR V;  2IH1 C;  2WLI B;  2OTL V;  1R3J C;  1HWY A;  1HDJ A;  2F4V O;  1BSM A;  2IM9 A;  5IDJ A;  2DYR B;  1M93 A;  1XUQ A;  4GYC B;  1K8A W;  1AJP A;  1S0V A;  1F51 A;  1KYO F;  4MW3 A;  2PI4 A;  1AIL A;  5K1P A;  4X65 O;  4NXM O;  3IC7 A;  3HKB B;  2X6C A;  2P4K A;  4PDV A;  4LH6 A;  2P6J A;  1VQO V;  5B1N A;  4EFB A;  5BY1 A;  3CCE V;  4GUN A;  4CH3 A;  1PKX A;  1IZ3 A;  4EKW A;  1G6U A;  3RYC B;  5DN6 G;  4DR3 B;  2W6I G;  2ZDI C;  1V55 C;  4MVU A;  4J9Y B;  2YDE A;  1MZE A;  1Q5O A;  3EFF K;  2ZXW C;  2OTJ V;  1MAB G;  1G4Y B;  3ZBH A;  1KU9 A;  3AK2 A;  1N36 B;  2GTS A;  3WFV A;  4JTD B;  2V7Q G;  4I50 A;  3LSS A;  2ARH A;  2CTQ A;  1BZK A;  2WLI A;  5DEC A;  1IXM A;  5IYC O;  2P90 A;  4UCO A;  4DUY B;  4WFB V;  1DF5 A;  1YXB A;  1KEC A;  1K73 W;  4X1I A;  4DW0 A;  2Q9L A;  5FNV B;  3ETD A;  4QE7 A;  3AG4 B;  2ZKO A;  5B1A C;  1K4C C;  4UB6 Z;  1BHB A;  2B5U A;  5CBH A;  4B3S B;  3PJS K;  4LNU A;  1Q43 A;  4J80 A;  1GTO A;  4TQF A;  5KMG A;  3K0G A;  4UUJ C;  1XL4 A;  3ABL C;  4R8C A;  2Q5Z A;  2W0F C;  3OTO O;  4LF5 B;  2YC0 A;  3UO3 A;  3A0H Z;  3N27 A;  3U10 A;  3G71 V;  5B1B C;  1IBM B;  4U3J B;  2RMK B;  2Q0A A;  2KKW A;  3JD2 A;  2DQ3 A;  2JVD A;  3CRR A;  3ZHT A;  1JX9 A;  3OUS A;  3T1H B;  3CCS V;  3VOU A;  2OCH A;  3ZRW B;  4FLY A;  2P67 A;  4ICG A;  1V54 C;  4GKK B;  5LOV B;  1FPO A;  4IYH A;  5H9C A;  1MOF A;  2EJ7 A;  1AR5 A;  4LF8 B;  4LF4 O;  3QF7 A;  3RVY A;  4CBC A;  1YZB A;  1QCE A;  1XQ8 A;  4DV0 O;  4LR3 A;  2OWO A;  4OGQ B;  1SQF A;  1TUB A;  3W7U A;  1Z2G A;  4B3T O;  1QLN A;  1PL4 A;  3AK3 A;  5JVD A;  1CEZ A;  2HEP A;  4JI8 B;  4I4T B;  1GM8 A;  3O65 A;  4ZI7 B;  3TET A;  4D7T A;  2WLL A;  2JJ1 G;  2WLH A;  2GUZ B;  3L71 H;  3K5N A;  4PI2 A;  4EB6 A;  5B66 Z;  5IWA O;  1BT8 A;  2XAS A;  3ZN0 A;  1YVW A;  2WSS G;  1AJQ A;  3FX7 A;  2JIZ G;  4F4L A;  4FLZ A;  4JZ2 A;  3L74 H;  4JI0 O;  1R6T A;  2ZXW B;  2XHB A;  3FB7 C;  1JR9 A;  2UXX A;  3E8G A;  1R3I C;  5KA5 A;  2YI8 A;  1VQK V;  1RP3 B;  2X6A A;  3R66 A;  1QHT A;  2XTA A;  2UUA B;  2HVK C;  4MS2 A;  4PV1 B;  2A06 H;  1KUQ A;  2ZM6 O;  5KHJ A;  3Q4H A;  2W6J G;  5JJN B;  4YHH B;  4I0X A;  4JI5 B;  5LL6 Y;  5EC1 C;  1L8D A;  3AG2 C;  4Q20 A;  3N2K A;  1M56 C;  1S77 D;  4CH4 A;  5IYB O;  1VF6 C;  2YIA A;  2Q6A A;  1V9P A;  4FFB A;  4TSF G;  3HKD B;  2GTA A;  3OR6 C;  1P84 F;  2EIK C;  2R9R B;  5JVD B;  3WB1 A;  4B08 A;  2IJH A;  1ROP A;  3N2K B;  3JYC A;  4ZI7 A;  1FJG O;  1VQ5 V;  4YJ2 B;  1SQB H;  2A9H A;  4E4E A;  4TV8 B;  2N05 A;  3CRM A;  1FFT B;  3FD9 A;  2QSA A;  4JAU A;  1K34 A;  4FM1 A;  3D3Q A;  1RSO B;  2M6Y A;  4NYK A;  4CH5 A;  4AQY O;  3ZED A;  1KD1 W;  1N0J A;  2DN9 A;  1I94 O;  4DV2 O;  2VQF B;  3ZRS A;  4O4J B;  1RFY A;  1XEQ A;  3O9O A;  1ZAU A;  2M7W A;  2EZO A;  3JAR A;  2ZR2 A;  1R3K C;  2PUS A;  4PA7 A;  3RGB A;  2ATK C;  4O4H A;  1XMQ O;  3Q4H B;  2UXN A;  1IX9 A;  4RUE A;  5TIS Z;  5CB4 A;  2C2A A;  5A2Q N;  2OCC B;  2QWR B;  2DMX A;  3EXA A;  2CH7 B;  3KKY A;  2UUB B;  4X89 A;  1M5I A;  3C3S A;  4YY3 B;  3UKM A;  1E1Q G;  2XOK G;  1XNR O;  5HFL A;  1XOU A;  1YJ9 V;  4D6T H;  1TAE A;  1T5E A;  1FXK B;  1R6K A;  5H6R A;  2F1M A;  3F5W C;  1VQL V;  1QLE C;  1J95 A;  3M99 B;  4JYC A;  3C3T A;  1Q3E A;  2EIN B;  3QG5 A;  3ZMU A;  4DR3 O;  5ITZ A;  4B3R B;  4CZZ A;  2PGG A;  4LF5 O;  3ETG A;  1RPR A;  2ADQ B;  5KHH A;  4J10 A;  1IBM O;  3KCX A;  4ZHQ A;  2ILM A;  5L3E A;  1BS3 A;  1QQC A;  4DR4 O;  1NBM G;  3ASN C;  2PYJ A;  4X8A A;  3FB8 C;  1TUB B;  4AIL C;  1GN3 A;  1KP2 A;  5CMU A;  1F4M A;  4I5S A;  3B8M A;  1NJI W;  3MDS A;  4TT3 G;  2AHY A;  2F95 B;  4OX9 B;  2L35 A;  2FYU H;  3A0B Z;  1K7D A;  4QE9 A;  2QWN B;  3QTC A;  1F4N A;  4JV5 B;  4DV0 B;  5IY5 C;  2Q7G A;  4CS3 A;  3ZX6 A;  1JJO A;  4IIJ B;  4XBF A;  2Y69 C;  2Q0O C;  3CCJ V;  1HP8 A;  2HP8 A;  2Y0I A;  1N34 B;  4J7J A;  2O57 A;  2BE3 A;  4JI8 O;  4B3M O;  2LFS A;  2IU3 A;  3W7W A;  3JAT B;  2PI5 A;  4HYO A;  4JI1 O;  3OFN G;  5LGU A;  3I5D A;  2NNU A;  5GTI Z;  3ZHU A;  1HR0 B;  2DYR C;  3X2Q B;  4X1Y B;  2EIJ C;  5LP6 B;  2VRZ A;  3MAQ A;  3UM7 A;  3BA8 A;  3AG7 A;  4YY3 O;  4JI2 O;  3DGE A;  4TV9 A;  3LDE A;  2UXB B;  2H3O A;  3QO7 A;  5EIB C;  2AGA A;  3T4Z A;  1S5J A;  4HNA A;  1BCC H;  1YIJ V;  2HHH B;  2FB5 A;  5FLX N;  1FAF A;  4NB5 A;  4U7O A;  4XDJ A;  5IY5 B;  4JI6 B;  3AG1 B;  2AHZ A;  4TUY A;  4MW8 A;  4JI5 O;  3H9V A;  2QR4 A;  3BAB A;  2JJ2 G;  2BCC H;  2HR3 A;  4ZKI A;  1HNX O;  2A7W A;  4X1K B;  2P5O A;  2LGW A;  2CUG A;  3AG2 B;  3AG1 C;  2JDI G;  2B9Z A;  5KUK A;  3P3N A;  1YCI A;  2P7T C;  4X20 A;  3FYE B;  5FPR A;  4JI4 B;  5IWA B;  4H44 B;  1SA0 B;  1US6 A;  1L0N H;  2QM4 A;  1AI5 A;  3DXR A;  4K35 A;  1Y4M A;  3JAM N;  4J42 A;  2YID A;  3TGU H;  2R70 A;  2IH3 C;  4N23 A;  4WFH A;  4AQY B;  1SQQ H;  4LF9 O;  4JI3 B;  2Y4U A;  2RJZ A;  3K3W A;  1TUE B;  4O2B A;  1PNK A;  3A8T A;  1FYJ A;  2N04 A;  2PYL A;  3BY6 A;  3HB3 B;  4MVM A;  4X66 O;  1K33 A;  1SC5 B;  2WLL B;  3E35 A;  2PY5 A;  3LSQ A;  4LF6 B;  2EZP A;  3T1H O;  5JCO A;  3JAS A;  2RN9 A;  2WAM A;  4PDM A;  1FXV A;  1Y74 A;  3P30 A;  3OR7 C;  4K3A A;  1W0J G;  2LW7 A;  3ZHR A;  1XNR B;  3JAK A;  2FML A;  3QO5 A;  3CEI A;  3A0R A;  5EYP A;  2Q73 A;  1NU1 H; 
#chains in the Genus database with same CATH homology
 1GTO A;  1AR1 B;  3X2Q C;  2EIK B;  2Q68 A;  3K0G A;  4UUJ C;  3E8H A;  1XL4 A;  3ABL C;  2XAF A;  5H6Q A;  4R8C A;  3FB5 C;  5HFM A;  1JVM A;  1H8E G;  1JJ2 U;  2HFE C;  3K06 A;  3HPL C;  1BHA A;  4L87 A;  2W0F C;  4OXS A;  1P4R A;  1QR9 A;  4P30 A;  4KP4 A;  4GX1 A;  2F43 G;  3RBZ A;  1M9N A;  1YSC A;  3G71 V;  5B1B C;  4UVA A;  1SZT A;  1K3E A;  3OMI B;  3JD4 A;  4JTC B;  4XDL A;  2R9I A;  2DQ3 A;  1K92 A;  3JD2 A;  1ARO P;  1JX9 A;  3AG4 C;  3OUS A;  4E2L A;  3CCS V;  3VOU A;  3JD0 A;  1OZ0 A;  3ZMT A;  3G6E V;  1OCO B;  2ZD9 A;  3SYP A;  2MK3 A;  1YIT V;  2LFR A;  4R7C A;  3ZRW B;  1S72 V;  2P67 A;  3ABT A;  1V54 C;  5H9C A;  1MOF A;  5LHG A;  1P7B A;  2Z5U A;  5DM6 V;  4RQF A;  3FYI B;  4FJC C;  5LHI A;  1SES A;  3RVY A;  1ORQ C;  4WFE A;  3T4D A;  2B1I A;  3F7Y C;  3QO8 A;  2BOB C;  4CBC A;  2DW4 A;  1DTO A;  3OW2 U;  1RM1 C;  1W0K G;  1W2B U;  3CCL V;  2DWD C;  1V55 B;  2X7R B;  1QCE A;  1YTF D;  4UVB A;  2H8P C;  2FTK A;  1CPY A;  5B3S C;  3OMA B;  5EC2 C;  1M1K W;  4GX2 A;  2XAQ A;  5B1O A;  2QM8 A;  3W7U A;  4JTA B;  1PNM A;  5CN0 A;  1AI7 A;  5KUM A;  4Z1M G;  1RPO A;  1QLN A;  5B1B B;  1CEZ A;  1GM8 A;  2QEX V;  3LDC A;  4WFF A;  4UV9 A;  1NQT A;  3TET A;  2WLL A;  3ML0 A;  4MTF A;  2JJ1 G;  2WLH A;  1CP9 A;  4G27 B;  5CA3 A;  1E1R G;  3W7T A;  4U7N A;  4FPP A;  2QTO A;  2XAS A;  3ZN0 A;  2WSS G;  4WFA V;  1AJQ A;  1ZWI C;  2JIZ G;  4F4L A;  3D36 A;  2EIM B;  4PA3 A;  4QPK A;  1VQN V;  5IYD O;  2X6B A;  3RVZ A;  1NVP B;  1B6Q A;  2ZXW B;  3K79 A;  1QVG U;  5EK0 A;  1KP3 A;  4FIP C;  4HZ3 A;  1OCZ C;  4P9O A;  3GWO A;  3FB7 C;  4PDL A;  5B1A B;  1YTF B;  2UXX A;  3T1C A;  3E8G A;  1R3I C;  1M57 C;  5KA5 A;  4MVS A;  2X6A A;  1VQK V;  4RAI A;  4JGS A;  2A79 B;  3LUT B;  2HVK C;  4MS2 A;  2QA4 V;  1VQ4 V;  1JOY A;  1GM7 A;  3SPG A;  3OEH G;  3TCU A;  2W6J G;  4DO2 A;  1KQS U;  1YJW V;  5EC1 C;  3AG2 C;  4QJF B;  4Q20 A;  4QNH B;  1GO3 F;  4I9W A;  2B1G A;  1OCC B;  5L3F A;  1M56 C;  4RO2 A;  1S77 D;  5IYB O;  2EIL C;  1DF4 A;  2Q6A A;  4TSF G;  4N21 A;  4MVQ A;  2CK3 G;  3OR6 C;  2EIK C;  4LCU C;  5L3B A;  1EBO A;  4G28 B;  1M56 B;  3OMN B;  2R9R B;  3ZCC A;  3ZRW A;  4XDK A;  2EIL B;  4GCZ A;  2IJH A;  1ROP A;  3JYC A;  4LC1 A;  4PA6 A;  1VQ6 V;  1WLE A;  3E8B A;  1K5Q A;  5LBQ A;  4HAM A;  3F7V C;  3RW0 A;  3E86 A;  1I5Y A;  3W7X A;  1VQ5 V;  2A9H A;  3FKS G;  3WG7 C;  3SYQ A;  2YEV B;  2JK5 C;  2IU0 A;  3ASO B;  2DWE C;  2OCC C;  5LGN A;  5GW7 A;  2Z3Y A;  1KKD A;  3CCQ V;  1NKD A;  1FFT B;  2GSM B;  4JAU A;  1K97 A;  1K34 A;  2X0L A;  3AG3 B;  1THZ A;  1KD1 W;  2XAG A;  3CD6 V;  3OM3 B;  3DTU B;  1WPX A;  2V1D A;  2KB1 A;  3ZRS A;  3OAA G;  2ZR3 A;  1VQP V;  4P2Z A;  1I5X A;  3OE7 G;  2EBO A;  3I55 V;  5BZB A;  4BIZ A;  1RM1 B;  4PEL A;  4X88 A;  2M7W A;  2YEV A;  3B77 A;  4R6Z A;  2EZO A;  4LBE C;  2ZR2 A;  1R3K C;  3ABM C;  4LP8 A;  4PA7 A;  1YJN V;  4UV8 A;  2YSU B;  3W7S A;  3CCM V;  4DXW A;  2ATK C;  2WLJ A;  1FS0 G;  4PA9 A;  4UVC A;  3E8F A;  2UXN A;  4RUE A;  4RUF A;  3ZMV A;  5J9P C;  2Y69 B;  3ASO C;  3SPH A;  2C2A A;  4ZBM A;  3B8N A;  4H37 A;  1MG1 A;  4QPJ A;  4MVZ A;  1Q86 W;  2OCC B;  5L3D A;  1L1F A;  3SYA A;  3ZMS A;  4GX0 A;  2OT5 A;  3MHH C;  4X89 A;  1UJW B;  1BL8 A;  2QKS A;  3UKM A;  4P9P A;  1E1Q G;  3K04 A;  4PA4 A;  2QE7 G;  2XOK G;  4MSW C;  5FL7 G;  5HFL A;  5C93 A;  5L3C A;  3P32 A;  1YJ9 V;  2DYS C;  5L3G A;  2IJJ A;  1FXK B;  1R6K A;  2BOC C;  4GT1 A;  5H6R A;  4QIW F;  2NLJ C;  3AEI A;  1VQL V;  3F5W C;  1QLE C;  1J95 A;  1Q7Y W;  3M99 B;  4JYC A;  2ZDI A;  3MD0 A;  1FXK C;  3JCZ A;  4BIU A;  3ZJZ A;  1OCR B;  5KA6 A;  1E79 G;  2EIN B;  4GX5 A;  3ABL B;  3ZRV A;  3E2E A;  3ZMU A;  3CC2 V;  4MTO A;  1JQ0 A;  1GMG A;  2EIM C;  4R50 A;  2IW5 A;  4JYB A;  4CZZ A;  1EZJ A;  3ETG A;  1RPR A;  4WCE V;  3BEH A;  2WLM A;  3K0D A;  3I56 V;  1OCC C;  1QR8 A;  3OUF A;  1PNL A;  5EBL C;  3ASN B;  1Q81 W;  1MSW D;  5L3E A;  2DQ0 A;  1QVF U;  2HLD G;  4JF3 A;  3ABK B;  1AI6 A;  1K4D C;  1NBM G;  1R73 A;  1SRY A;  3ASN C;  2H94 A;  4X8A A;  2GHY A;  3FB8 C;  4MTX A;  1COW G;  1KP2 A;  5EBM C;  4TWK A;  5CMU A;  3GB7 C;  1F4M A;  4I5S A;  3B8M A;  1NJI W;  2IJI A;  2XND G;  4TT3 G;  4JPR A;  5CBF A;  2AHY A;  4ASU G;  2ITC C;  2EIN C;  2WLK A;  1AJN A;  1K7D A;  2DYS B;  3K9A A;  4QE9 A;  2JEX A;  1F4N A;  2ZQM A;  1H38 A;  4FMT A;  4JAS A;  5IY5 C;  1H2G A;  5LHH A;  1S76 D;  4BAY A;  4MVO A;  3STZ C;  2EJR A;  1KC8 W;  2LP7 A;  1S5H C;  3SYC A;  3H01 A;  2Y69 C;  4XBF A;  1VQ9 V;  3CCJ V;  1NVP D;  3T2M A;  1GKF A;  3IFX A;  3CC4 V;  1OHH G;  3K03 A;  2WLN A;  3CCV V;  2LFS A;  3OEE G;  2IU3 A;  5B3S B;  3W7W A;  5CBG A;  3SPC A;  2XAJ A;  4KUM A;  1NH2 B;  3TK1 A;  1VQM V;  1FXH A;  2PI5 A;  3LNM B;  3ABM B;  4HYO A;  4BW5 A;  3OFN G;  3STL C;  5LGU A;  3CMA V;  3CME V;  2NNU A;  3SYO A;  4MT8 A;  2DYR C;  3X2Q B;  1Y66 A;  2EIJ C;  4H33 A;  1QBZ A;  1GM9 A;  3UM7 A;  2XAH A;  1Q82 W;  3MHS C;  1VQ7 V;  3JD1 A;  2D3O W;  5LGT A;  1H8H G;  2HG5 C;  1NR7 A;  4UXN A;  4PDR A;  1NR1 A;  3DGE A;  2WWW A;  3LDE A;  1SET A;  4RQE A;  3QO7 A;  3SJQ C;  1PD3 A;  1ENV A;  4FK5 C;  1OCO C;  3T4Z A;  3ETE A;  1N8R W;  1M57 B;  1YIJ V;  1PL0 A;  2QM7 A;  1JPX A;  4JAV A;  2IH1 C;  2WLI B;  3CCR V;  1M90 W;  2Y48 A;  2OTL V;  4U7O A;  4XDJ A;  5IY5 B;  3LDD A;  1R3J C;  2IJK A;  3CYO A;  3CC7 V;  3AG1 B;  1HWY A;  1S3J A;  1R6N A;  2AHZ A;  2Q69 A;  5EBW C;  1K5S A;  1GK9 A;  2Q67 A;  1NH2 D;  4MW8 A;  4MTG A;  1YI2 V;  5IDJ A;  2DYR B;  5E1A C;  1LNQ A;  1K8A W;  1OCZ B;  2JJ2 G;  2HR3 A;  3IGA C;  1AJP A;  4KFM A;  4ZKI A;  1S0V A;  1F51 A;  4MW3 A;  2PI4 A;  3KG2 A;  1DLB A;  3AG2 B;  3SPI A;  3AG1 C;  2JDI G;  3IC7 A;  5KUK A;  4J9Z B;  2JEU A;  2X6C A;  1FXK A;  2P7T C;  4WFG A;  3FYE B;  1QLE B;  4PDV A;  2P6J A;  1VQO V;  3ABK C;  5B1N A;  3VBB A;  3CCE V;  3NXS A;  3EHB B;  3R65 A;  1AI5 A;  1PKX A;  2A0L A;  2ITD C;  3QNE A;  3WG7 B;  1Y4M A;  1AI4 A;  3ABU A;  4EKW A;  3ZRX A;  5DN6 G;  3E89 A;  2IH3 C;  2W6I G;  2ZDI C;  4N23 A;  1V55 C;  4MVU A;  4J9Y B;  4WFH A;  3EFF K;  3G4S V;  2ZXW C;  2OTJ V;  1MAB G;  1G4Y B;  2WPD G;  3CPW U;  3K3W A;  4MVR A;  2HKO A;  4YXW G;  3FB6 C;  3WFV A;  3CCU V;  1TUE B;  4JTD B;  1PNK A;  2K1E A;  3ZIA G;  2V7Q G;  2EIJ B;  3CP1 A;  3JD3 A;  3LSS A;  1K9M W;  3BY6 A;  3HB3 B;  4MVM A;  2WLI A;  1IXM A;  5IYC O;  3AG3 C;  2P90 A;  4WFB V;  1VQ8 V;  1K33 A;  1DF5 A;  1KEC A;  2WLL B;  1K73 W;  3E35 A;  3E83 A;  3LSQ A;  3D3I A;  3CXC U;  1V54 B;  3K08 A;  1R3L C;  3SPJ A;  3ZN1 A;  1YHQ V;  2EZP A;  3ETD A;  2WAM A;  4QE7 A;  4G2K A;  4WF9 V;  4PDM A;  3AG4 B;  1EFR G;  1FXV A;  1SER A;  3P30 A;  3OR7 C;  2HJF C;  5B1A C;  1W0J G;  1XL6 A;  1K4C C;  1G8M A;  1BHB A;  1OCR C;  2B5U A;  5CBH A;  3QO5 A;  3A0R A;  1BMF G;  1JCH A;  3OGC C;  2HVJ C;  3ZMZ A;  1F23 A;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...