1M1KW

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m1kW00
1JJ2U 3CC7V 3I55V 1YI2V 3CCVV 1VQPV 4WF9V 1VQ7V 1Q81W 3CC4V 1K8AW 3OW2U 1R73A 1YIJV 4WFBV 1W2BU 3CCMV 3CD6V 2OTJV 1VQ6V 3CCQV 3G4SV 3CCJV 1VQOV 1S72V 1Q7YW 4WFAV 1QVGU 2OTLV 1NJIW 3CPWU 3CCEV 1KD1W 1VQ8V 1YHQV 3CMAV 1Q86W 3G6EV 1VQMV 5DM6V 3G71V 1VQNV 3CC2V 3CMEV 3I56V 1N8RW 1KQSU 1VQLV 3CCSV 1YITV 1VQKV 1K73W 2QEXV 1KC8W 1VQ5V 2QA4V 1K9MW 1Q82W 1M1KW 1M90W 4WCEV 3CXCU 1YJ9V 1YJNV 1YJWV 2D3OW 1VQ4V 1VQ9V 1QVFU 3CCRV 3CCUV 3CCLV
chains in the Genus database with same CATH superfamily
2XHBA 2HEPA 1N32B 1P7BA 2R9IA 2LGWA 2QSAA 2UUAB 3JATA 4F4LA 4I50A 5IT9N 2YXYA 3K5NA 4JI2O 1NQTA 2GUZB 3BCCH 4LNUB 3OR6C 4DO2A 5B1NA 3JALB 3TGUH 3R65A 5BXZA 1IBKB 4MTXA 2IJHA 4PDMA 3F5WC 1MA1A 3CC7V 4BR6A 1RM1C 3OTOO 5BMVA 1DF4A 4MW3A 1EZVH 4DR4B 1NR7A 1QU7A 5IYCO 4PDRA 1XQ8A 1VQLV 5LYJB 2HJFC 3X2QB 3MD0A 1WAZA 3CXCU 2VQFO 4DR3O 1K3EA 3TK1A 4PA9A 3K0GA 3OR7C 5CA0B 4R7CA 4JAAA 2IU3A 1FXKC 1ENVA 3ABTA 2DQ3A 2FTKA 2Q9LA 2BTOA 4I4TA 2OTLV 2JGDA 4K3AA 2OIGA 1RP3B 3AG3B 4X8AA 5LA6A 5E79Z 1PD3A 2WLLB 2UXBO 1GTOA 1GN3A 5FL7G 3I55V 1AI6A 5J2TB 3IJ4A 3B8NA 3FB7C 2P4VA 1AJPA 3CCQV 5KUMA 5LOVB 4LF5O 2UXDO 4AQYO 5B66Z 1OCRB 3BABA 2EJ7A 4Q20A 5IJ0B 3RYHB 5EYPA 3EVKA 4B7KA 3OEHG 5C93A 4MVUA 1RPOA 2JK5C 1HWYA 4MVOA 2ZDIA 4X62O 2HJDA 4O2BA 3RYIA 3ABKB 2DOSA 4I50B 3ZS8C 1VEWA 2DWEC 2YXHA 2ZXWB 2F4VB 2HLDG 2DW4A 3HKCA 1I5YA 5FNVA 1FD9A 3K5MA 5IYDO 3O9OA 1SETA 2HG5C 3A0BZ 1GM8A 4X1YA 4GT1A 2ZNJA 1J5EO 1XBLA 1JVMA 2Z0AA 2HVKC 1TVKA 2B1GA 5BZBA 4DV1B 2NLJC 1BQZA 1GAXA 2P4KA 4CBCA 1MNGA 2O57A 4BAYA 1K7DA 1VF5B 4EEQA 4B3TO 2RN9A 1XNRB 1F4NA 4HZ3A 4U7NA 1JFFA 3IC7A 3K79A 4RUEA 4I4TB 1E79G 2JGDB 4J9YB 5IY5C 1JOYA 1PM9A 3BHPA 5LA6B 1MZFA 5A2QN 2ZE7A 1HNXO 2Q8VA 3ZMTA 4UB8Z 3I5DA 2KB1A 1VARA 5LMNB 3DGEA 1R73A 4XDKA 2W0XA 3ZHUA 2OCCC 2Q69A 3M8AA 3SYQA 1PL4A 4DR5B 1N8RW 1KP2A 1L0NH 3JAWA 3N2KB 3U0ZA 4FFBA 2VQEB 3JD2A 2QA4V 1YTFB 4HYOA 4BIUA 3OTFA 1V9PA 4LFCO 4LF8B 4CS2A 1FXKA 4PA6A 4X1KB 1FXVA 3K5LA 4O2BB 3L73H 1JR9A 2F93B 1DK1A 4IIJA 4MVQA 2WLKA 5LHIA 1S5LZ 3L74H 3LNNA 2Q73A 2WLIA 3HKCB 5FNVB 3FAVA 2Q0OC 1ZSPA 4UXNA 2Q6AA 4WFEA 3UQ8A 2L35A 4U3JA 5D5PA 4WFBV 3CCMV 2YIAA 4IHJA 3CCJV 1Z2GA 1Y4MA 1Y6XA 3P3PA 4JZ2A 1FFTB 2BSKA 1EN5A 3WU2Z 2NN4A 5CA3A 4EB6B 2CTRA 2JJ1G 5KA5A 2Y0PA 3SJCC 2A06H 3ZHVA 4GX2A 4I55A 4OGQB 4DUYB 2HVJC 1KECA 3JD1A 3MDSA 3T2MA 4MTFA 3CMAV 4DR7O 3OGIB 5EBWC 1YITV 3T1YO 5B3SC 1XUQA 2LW1A 3OMNB 5ITZA 1ZLZA 2Q0AA 2YUAA 1B3QA 4JYBA 5IWAO 1I5XA 1PL0A 2F95B 2JDIG 1BE3H 3EHBB 1IBMO 2YEVA 4DV0O 3ZRXA 1R3IC 3BY6A 3JAWB 3STLC 1D2DA 4GYCB 4FLUA 1JCHA 1BZKA 3UO3A 3ABLB 1XI1A 2B5UA 1YCIA 4J80A 2FB5A 4B3RO 2IH1C 4DR1O 2ZR2A 3H9VA 1UJWB 2BCCH 3LUTB 1NKDA 4FFKA 3SYAA 4FMTA 2KSDA 3UCSC 3BRCA 3E8BA 4MS2A 1K5SA 2IJJA 2Z5UA 3X2QC 1EN6A 1VMGA 3FAVB 4DW1A 1M93A 4KXRA 1BGYH 4W4KA 1N4CA 4JI8B 3T4ZA 1Q81W 4P9OA 4U3JB 3HKDB 4TWKA 4IHJB 1S72V 1N34B 3BPZA 4QE9A 4G2KA 3AG3C 4MW8A 2YI8A 1LNQA 1Z5WA 2R72A 1Q8IA 1U96A 3JASA 2DYSB 5KUKA 4MVSA 3E8HA 3ZN1A 1FJGO 5C8YB 1NR1A 1QQCA 1SQVH 4YIOA 4X66B 1KYOF 4UVAA 2BOCC 1H2MA 3KCYA 4I55B 2G38A 2CE4A 2UXCO 3DTUB 4J11A 3S3WA 1OCRC 3QF7A 2C2AA 2ATKC 3ZJZA 5CBFA 4XDLA 3F7YC 3LDEA 1K4CC 2P06A 4GX1A 3CJHB 4YHHO 1FKAO 3OMAB 4B3SO 4PV1B 2OTJV 1VF6A 3ABKC 2QM4A 3WG7B 1PNKA 4LF6O 1AI5A 1XDCA 4JPRA 1YJ9V 1OHHG 2WLNA 4GX5A 1VP7A 3OAAG 3OE7G 2ZIOA 1PNLA 1H2SB 4DR6B 4DV2O 4LF4B 1RSOA 2ZE6A 3B8MA 1XILA 3JD4A 1AI7A 4DR2O 3J7AU 1ZL8A 3GVMA 3L9DA 1XMQO 5KAIZ 3ABMB 2PYLA 4X65O 3ASOB 5KHIA 5H9CA 1YVWA 3E8FA 1P49A 1AVMA 2P6JA 4PDLA 2RJZA 1KD1W 1VQ8V 4JI7B 4U3FH 3W7TA 2PY5A 1XNQO 4K8ZA 2YC0A 4LNUA 4DUZO 3MAQA 2QWNB 5DN6G 1VQ5V 3LSSA 2CUGA 3SPCA 3JASB 4QPJA 3B2EE 2YIBA 3ZRWB 1SQPH 1Y76A 3OUFA 3Q4HA 4YY3B 3K03A 3SYPA 2UUCB 1NTKH 5D5QA 2N74A 4MT8A 1KUQA 3UM7A 3SJAC 3FX7A 1VIBA 3A8TA 5IE9A 3ZHQA 1N32O 1US6A 2ZDIC 3RBZA 4NKGB 1CXZB 2EIJB 1WB7A 4ABMA 2DQ0A 4IT5A 3GWKC 4DV6B 1QR8A 2QKCA 2JEXA 2KKWA 4G27B 3QNEA 2HHHO 5L3EA 1NI8A 2JS5A 1NBMG 2YIDA 5EC1C 2D3OW 2WLLA 3B09A 3CEIA 2QE7G 1X4TA 5J2TA 3STZC 2Y69B 1H8EG 1YTFD 2B9ZA 1RSOB 1SZTA 4JAVA 3AG2B 1EZJA 4LFAB 2A9HA 1WPXA 3QO7A 1K34A 2YDEA 3CC2V 1ZL8B 5CB4B 4BW9A 4LC1A 3HR0A 1W0JG 1TUBB 2UU9B 3OFNG 4FLWA 4YXWG 4UB6Z 4JV5B 4J9ZB 2ZM6B 5EC2C 4GX0A 1ZWIC 5BR8B 3DC6A 1S5JA 4TUYB 1HNZO 2E3CA 1Q82W 1VQ9V 1W59A 4GCZA 4TSFG 4QPKA 3CCLV 3N27A 3S3XA 4JYAO 1Y76B 4X9QA 4WFHA 5CBGA 3Q4HB 3CXHF 1VQOV 1OCCB 5H6RA 5GTHZ 3B40A 2A0LA 1RPRA 2Z3YA 2JIZG 2ZINA 4DK0A 1M9NA 1YJNV 1V55B 3ABLC 2P5OA 2FMLA 2X7RB 1K5QA 3RW0A 4CC5A 4B3MB 3ICXA 4KP4A 1Q3EA 2WWWA 4GUNA 1GK9A 1NT2B 3N2GA 1S76D 5H6QA 2Y48A 1IDSA 3P30A 3B4SA 3CMEV 1I7FA 3RT3C 4NXNB 4LF9O 2IW5A 1D5NA 4DV3O 2DN9A 1XHXA 2ZD9A 3ABUA 3H1IH 4RAIA 5LHGA 4DV1O 4PD4F 3CC4V 3P3NA 1W2BU 1GM7A 1ROPA 4I9QA 1NH2B 1SQQH 1KP3A 1S77D 2EIKB 4OXSA 3L71H 4UCVA 3N2KA 1AR1B 2W6JG 4ASUG 2DYSC 3FB8C 2P90A 1BQ0A 5IDJA 2PZSA 2AZ2A 2E5LO 3ASNB 3OTOB 1BHAA 4X1KA 3D3IA 1S0VA 4AHCA 3CPWU 2DYRB 2UXXA 1FAFA 4RO2A 4B08A 1F7YA 4LWSB 4PDVA 1M90W 3SJBC 1OCOB 4CS4A 2B1IA 4DR3B 1JJ2U 2FYUH 1OZ0A 3MHSC 3A2FA 3G80A 4Z2WA 3LSUA 2M6YA 1EM1A 3E86A 3IFXA 4WFAV 4IL6Z 4H44B 2X6BA 3WG7C 3SPJA 4EFBA 4JI1O 1Q6UA 2E76B 4JF3A 3TCUA 2DE0X 4E4EA 4EB6A 1NTZH 5EIBC 4JI4B 4L87A 2LGQA 4X64O 4R6ZA 2UXBB 3DXRA 2HP8A 4PHZA 2JGUA 2NR5A 4IYHA 2M7WA 3A0RA 4EFEA 1IXBA 3N2GB 4NXMO 1Q43A 5CA1A 4RQEA 1ZUQA 4LF5B 2UXDB 1GM9A 3NR7A 4AQYB 1G6UA 3I56V 1N36O 1H38A 3ABMC 4O2AB 3OGCC 2E74B 5KHHA 1CEZA 3PJSK 4GZRB 3C3SA 3ASOC 2LFSA 1H2KA 2HKOA 1K4DC 5EIBD 2QR4A 1YIJV 5F2VO 1LUVA 2DWDC 2XAHA 2EINC 3KKYA 3T1HO 1CPYA 2QKSA 1R3KC 4ZKIA 3RVYA 3H1LH 2DJVA 2BOBC 2N04A 3ZBHA 2AGAA 4QE7A 2F66C 5KMGA 2WAMA 3APQA 3J81N 2CH7B 4UCOA 1I0HA 2V7QG 3QO8A 1W0KG 2WLMA 2WA4A 1XL4A 5B1AC 1J5EB 3ZMSA 1COWG 3VQWA 4Z1MG 4JI6O 1X59A 4ZI7B 4C7UA 1QBZA 1QVGU 5KHGA 4YJ2A 2Q5ZA 2BTQA 3C90A 4LH6A 4B3TB 5B5EZ 3D3QA 2EIJC 2EIMB 3HKDA 2ZCEA 3OT7A 1M57B 2XOKG 1VF6C 4MTOA 2Y4TA 4NTWA 5LHHA 2LQTA 1RFYA 2RDCA 4JGSA 4WFGA 5GW7A 3ZHSA 3H1KH 5C8YA 3DXRB 4MVRA 3ZCCA 1HNXB 1XMOO 2Y69C 1VQPV 1VQ7V 5BY1A 2QDOA 1NU1H 2HFEC 1QHTA 2LO1A 4CC6A 3AG2C 1R1BA 2QTSA 5CA1B 2WA3A 5LXTB 4CZZA 1HNWO 1AB3A 4OX9B 2XAJA 2W0FC 5IYZB 3WFVA 3ETQA 3CJHA 1A32A 4DXWA 1M56B 2XAQA 4LFCB 1WPBA 1BT8A 1WLEA 1UFIA 2ITDC 3TXQA 4QJFB 1XHZA 5CBHA 4LFBO 4DV7O 5LP6B 4JI0O 1G1XB 5GONA 4HBNA 5KMGB 3E89A 1V54C 1GH6A 1GMGA 2UUBB 1KBHA 1WNSA 2QWRB 4R50A 3JAKB 1K97A 2JJ2G 1OCCC 3VOUA 2MK3A 1GN2A 1YHQV 3UKMA 1GN6A 2X6CA 3L75H 5EZYA 4YJ2B 5KAFZ 1NTMH 1IZ3A 1L8DA 2BTQB 1QR9A 1KMIZ 4RUFA 1QVFU 1V55C 4Z1VA 3JCUZ 4NYKA 2ZQMA 4UCUA 2YIBD 3OEEG 1MABG 4P9PA 5L3BA 2IJIA 4DR7B 2OWOA 4TV9B 3B77A 4NTXA 3K06A 3WB2A 4FLVA 1QNMA 1K9MW 4QGPA 4WCEV 3T1YB 1E1RG 2ETNA 1SRYA 4D7TA 4LF4O 4GKKO 3WB0A 3ZRWA 1JPXA 3QG5A 3AEIA 4GKJO 2KG7B 2JS3A 1BSMA 5IWAB 3VQYA 1YDXA 3DSQA 2ADQB 1JMKC 5KHJA 4PI2A 3HKEA 3UO2A 4UCTA 1AJNA 1VQMV 1GO3F 2EIKC 4ZHQB 1IBMB 2GHYA 4DV0B 4JI5O 2QTOA 3APOA 2AXTZ 1F23A 1HR0B 1NS1A 3ASNC 3CCVV 4B3RB 4CH6A 4JI7O 4DR1B 3F5TA 1SKVA 1G8MA 2LJ2A 2DYRC 2WPDG 1IBLO 1ORQC 5IJ9A 1NH2D 3C3TA 2CGNA 1OJHA 2EZOA 1OCOC 5GONB 1XOUA 2UUCO 2ZR3A 3IC9A 4IGGA 4FVMA 2IM9A 2H3OA 1VQ6V 3E8GA 3RWRD 5LGUA 3CCEV 3PN1A 2LW7A 2OYQA 1YZBA 1I08A 1WB8A 3SGIA 1FYJA 3CRAA 4JAUA 5HFLA 5EZYB 2EJRA 4UUJC 5CB4A 3ZIAG 2VWJA 1P84F 1WA8B 3VQXA 4OPAA 1N0JA 1TUBA 4N23A 1BL8A 1QCEA 1FJGB 4J42A 4DW0A 4FM2A 4DV6O 3CRMA 3SYCA 4F6EA 2YICA 2CTQA 2EINB 1QLNA 4DV5O 1B06A 4KHPO 4UCSA 4TUYA 5LMUO 3TETA 3W7UA 4NVPA 2OT5A 1NVPB 4TQFA 4PJ0Z 3K0DA 4J7KA 5B1BB 2IBZH 2XAFA 3ZHRA 5B1AB 3D36A 4LFAO 4B3SB 5L3DA 1XREA 2F23A 5H2FZ 4K0KO 3HKEB 1Q6HA 2Q67A 5B1OA 4LF6B 3JD3A 2UU9O 4P2ZA 2YS8A 3G6BA 1R3JC 2A79B 3JYCA 1Q90D 2ODMA 5HFMA 2XUMA 2JRIA 1PKXA 2UUAO 1AP5A 5JCOA 4DV2B 3MHHC 5J2UA 5H5NA 5KLVH 2VWKA 3OMIB 5KX5A 4DR2B 1HDJA 3OD4A 1WP7A 1P7GA 1IBKO 5IJ9B 4GLXA 1F4MA 4KUMA 3JD0A 4JI3B 3RVZA 1O9HA 4FM1A 4FIPC 4U7OA 2XNDG 4DR4O 1AR4A 3W7SA 1N33B 4X65B 3RYCA 4BIOA 3AK1A 2EIMC 4DV4B 1M57C 1PPJH 4I0XA 3GB7C 2K1EA 2AHYA 2GTAA 1Z5VA 3AK2A 1XNQB 2EILB 1AILA 4UV9A 1SA0A 1MSDA 4DUZB 1IURA 4PA7A 1AROP 2UXNA 5JJJB 3HKBB 2Q68A 4JTDB 3RFRA 4B3MO 4N21A 3U11A 4LF7B 2W6IG 1IX9A 2F1MA 3E83A 1Y66A 1XL6A 2MW2B 2QJ1A 4ZOLA 3UT5A 4O4LA 3ZEDA 3THOA 2CGOA 3G67A 3SR2C 4NXNO 1NZ6A 2H8PC 1HP8A 1SESA 2AW9A 4FK5C 3RYFB 2V1DA 4LWSA 4FJCC 1V54B 2A7WA 2PI5A 1M56C 1M5IA 1IVSA 3BEHA 4TT3G 2IJKA 1L1FA 4JASA 2X6AA 4B7EA 4X1IA 3LNMB 5E1AC 3CCSV 3BA8A 2HHHB 4E2LA 3HB3B 4PA3A 5LP6C 1FFXB 4ICGA 2X0LA 5GTIZ 1BMFG 2P22C 4NR1A 1I94B 3FYIB 4BW5A 5J2UB 3TXSA 2GDSA 3BVOA 2Y0IA 5KX5B 2PI4A 2F4VO 1Q6IA 1KB9F 3LDCA 4HNAB 4O2AA 4J10A 1SERA 4J41A 1SF9A 3CE2A 3RYCB 1K8AW 3D8CA 1DGSA 3BA9A 2AZ0A 4I0XB 3OM3B 4RQFA 5JJNB 3G6EV 1VQNV 5K1PA 4JI2B 2JEUA 4JI4O 1S3JA 3RN4A 1SA0B 1K73W 3O65A 1HNZB 3K57A 1XNRO 5FPOA 2IU0A 2CH7A 2WLJA 1YSCA 4FLTA 1PP9H 4I7ZB 1AR5A 1UPGA 4DRXB 3CD6V 1LR1A 3CP1A 4JYAB 5J9PC 4ZOLB 3H01A 3UT5B 4ZI7A 4O4LB 5DECA 3E2EA 1L0LH 4O4HA 3SPHA 1JQ0A 1VQKV 3ZMUA 1KC8W 2ZE8A 3GWOA 2PYJA 3K59A 3BAAA 1SZXA 5EK0A 5KHKA 2VQFB 5LMNO 2BE3A 5AG2A 4CH5A 3OW2U 1OCZB 1FPOA 2QWPB 4PA4A 4UV8A 3JATB 1OV9A 4O4JA 4DR5O 3ETDA 1Q86W 2Q7HA 4X1IB 1EBOA 2ITCC 5DM6V 2VQEO 1M4UA 2Y4UA 1HW7A 2XTAA 1DLBA 2RQ6A 4LF9B 2ZE5A 1H2NA 4DV3B 4LF8O 1H2GA 4KFMA 4WFFA 5BMVB 3CHXA 2EX3A 1GRJA 3EFFK 4I9WA 5CN0A 4IYIA 1ZTEA 2GBOA 1ZAUA 3A0HZ 5LXTA 3ZX6A 5JJEB 3W7XA 3QTCA 3CWBH 1R6KA 3M99B 1AP6A 1VQ4V 1K33A 3SYOA 5IYZA 1MZEA 5FLXN 4WF9V 2E5LB 1TAEA 2WSSG 3JSNA 5LBQA 1J95A 1BS3A 3F7VC 1H8HG 2Q7EA 4X62B 4I5SA 1H2LA 3AG4B 3K9AA 3JCZA 4NB5A 2K9PA 5L3CA 4RWUA 4BIZA 4JZGA 4NTYA 1IXMA 1TA8A 5LP6A 4BWAA 4WBNA 3IGAC 5A9GA 5B1BC 2AHZA 4D7SA 2R9AA 4DUYO 1SQBH 3AK3A 3JAKA 2QWQB 4R8CA 3CYOA 3VBBA 4PI0A 4FLXA 4FM0A 3ETGA 4O4HB 4UCRA 2XT9A 3VQVA 4OX9O 3SDLA 4HAMA 4H33A 1KKCA 4LBEC 4JI1B 5EYPB 3R66A 4LR3A 4OPHA 3K58A 3FKSG 3QO5A 4X64B 4LH7A 3L70H 1FXHA 4G28B 2GSMB 1U97A 1NVPD 1YEWA 1QLEB 1SQGA 3RYIB 1FS0G 1URFA 4DK1A 1PV0A 5DEDA 3AG1B 4O4JB 4NXMB 2ZT9B 3KZIZ 1O9GA 4O4IA 1WP8A 4K35A 4TV9A 5KA6A 1N36B 1JJOA 2UUBO 2RMKB 3CCUV 1SQXH 4X1YB 1E1QG 1TVKB 3CRRA 2KG7A 3FB5C 2OIEA 2ZKOA 3SJQC 3JSLA 1MMMA 3WB1A 2CTWA 3K08A 2ZNIA 3G71V 3T1HB 1LUWA 2EILC 4FZ1A 4JYCA 1KQSU 1K92A 4ZHQA 4CH3A 3P32A 3W7WA 1TGOA 5IYBO 3AG7A 4LP8A 2ADPA 2NNUA 2EBOA 4JI8O 3U10A 4EKWA 1THZA 4H0LB 1GKFA 2QM7A 1JFFB 2GTSA 1N34O 1MOFA 1TUEB 1B04A 4JI6B 4FLZA 4X89A 4XBFA 3ZRVA 1B6QA 3M7MX 2QEXV 3EXAA 3ZHTA 4WBNB 2L6LA 3L72H 3CCRV 2EZPA 5EBMC 5TISZ 4X66O 1RM1B 1YI2V 3ETEA 1PNMA 2N05A 1KKDA 2Q7GA 3D36C 1EN4A 2YSUB 3CRQA 3OUSA 3JAMN 1GN4A 5EBLC 4Q6GA 4FFBB 1WA8A 1HR0O 3H1HH 2H94A 3KG2A 2IH3C 4FZ0A 4AI8A 1FXKB 3ZRSA 5JCOC 3QVNA 4UVBA 1XMOB 2YI9A 3G4SV 4D6TH 2QGNA 4IIJB 4YIPA 4O4IB 1HNWB 2WLIB 3JARA 4LCUC 4DR6O 3CX5F 2VRZA 4TQDA 5LL6Y 4ZIBA 5FPRA 4J7JA 2KQXA 2PTMA 5JVDA 1Q7YW 1SS3A 3LSQA 2BSKB 2D2CB 3K04A 4LFBB 3CS5A 4F6RA 4DV7B 1WJZA 4JI0B 4H37A 1EFRG 4FLYA 1N0NA 1DTOA 2Q4PA 1YF2A 2EULA 2JVDA 4K8XA 1AI4A 4P30A 1NJIW 4MSWC 3K3WA 5LGNA 2YXLA 4YJ3A 4UVCA 3SPGA 2ARHA 5ITZB 3FD9A 2OCHA 1SQFA 3T1CA 1JX9A 2DMXA 4YY3O 3CSXA 1OCZC 1S5HC 2R70A 3FB6C 4JYYA 4XDJA 1SC5B 4X20A 4MTGA 2ZXWC 2YEVB 2QWOB 2VS0A 1F51A 4ZBMA 4JTCB 2GV9A 3E22A 1Y67A 4A5UB 3HKBA 1T5EA 4J7ZA 4TV8A 3K5OA 1AJQA 2LP7A 4GKKB 4GKJB 4PELA 5IY5B 2PGGA 5L3FA 2UXCB 2CK3G 4QNHB 1Q5OA 4FPPA 2QM8A 4JI3O 3J80N 3ZN0A 5JH7A 3RYFA 1Y74A 1M1KW 5JQGA 3JARB 4JI5B 1BCCH 1N33O 2P7TC 4X88A 1YXBA 4DV4O 2RNBA 4YHHB 3ZMVA 1JA8A 2OCCB 2FKXA 5L3GA 3LDDA 5JVDB 3AG4C 5CMUA 2GUZA 3T4DA 3BFRA 3JALA 2R9RB 1XEQA 5LGTA 2PUSA 1IBLB 3KCXA 4W4LA 1P4RA 4LF7O 3TJTA 4F6RB 1FFXA 4KL1A 1G4YB 4TOIA 2CAZC 4JV5O 2ILMA 5K1XA 2ZM6O 2P67A 5BR8O 2A3QA 2E75B 2XASA 3DC5A 4UFZA 2QKAA 3K9SA 1MG1A 5LYJA 4YJ3B 1VF7A 4HNAA 1XMQB 1YJWV 3H1JH 3SPIA 5CA0A 1ZX3A 2RCVA 4MVMA 3ML0A 2CDYA 5JWPA 2ZIMA 1BHBA 1QLEC 1DF5A 4CS3A 4QIWF 4AILC 3AG1C 4X20B 1WN7A 4H13B 4DV5B 3ZMZA 1R6TA 4KHPB 1D5AA 4CH4A 3RGBA 5LMUB 1CP9A 3E22B 3NXSA 2XAGA 1MSWD 2V4DA 3CB2A 4TV8B 1I94O 2PF4E 1KU9A 2CTPA 3IAYA 4DRXA 1R3LC 2WLHA 3FFQA 3FYEB 5LOVA 3HPLC 2FL4A 4L8JA 4K0KB 2HR3A 4DYLA 5IJ0A 3RYHA 4JTAB 5B3SB 4MVZA 5JH7B 1R6NA 2F43G 3CRCA 1Y74B 5JQGB 3E35A 2LFRA
chains in the Genus database with same CATH topology
3WFVA 1H2GA 4KFMA 4WFFA 4DXWA 1P7BA 1M56B 3EFFK 2XAQA 4I9WA 2R9IA 5CN0A 3B8MA 3JD4A 1AI7A 4F4LA 1WLEA 2ITDC 1NQTA 4QJFB 5CBHA 3OR6C 4DO2A 5B1NA 3W7XA 1R6KA 3ABMB 3R65A 3M99B 1VQ4V 4MTXA 1K33A 2IJHA 3SYOA 3E89A 4PDMA 1V54C 3F5WC 1GMGA 3ASOB 3CC7V 1RM1C 1DF4A 4MW3A 4R50A 5H9CA 3E8FA 4WF9V 2WSSG 5LBQA 1J95A 1K97A 3F7VC 2JJ2G 1H8HG 2P6JA 4I5SA 4PDLA 1OCCC 1NR7A 3VOUA 3AG4B 2MK3A 5IYCO 3K9AA 1KD1W 3W7TA 3JCZA 1YHQV 3UKMA 1VQ8V 2X6CA 4PDRA 5L3CA 4BIZA 1VQLV 2HJFC 5DN6G 1VQ5V 3LSSA 1IXMA 3SPCA 3X2QB 1QR9A 3MD0A 3CXCU 4QPJA 4RUFA 1K3EA 3IGAC 1QVFU 1V55C 3TK1A 4PA9A 3ZRWB 3K0GA 3OR7C 5B1BC 2AHZA 4R7CA 3OUFA 2IU3A 1FXKC 1ENVA 3ABTA 3K03A 2DQ3A 3SYPA 2FTKA 2ZQMA 3OEEG 4R8CA 3CYOA 2OTLV 3VBBA 4MT8A 1MABG 4P9PA 3ETGA 5L3BA 3AG3B 4X8AA 2IJIA 3UM7A 3B77A 3K06A 4HAMA 4H33A 4LBEC 1K9MW 1PD3A 4WCEV 2WLLB 1E1RG 1GTOA 1SRYA 3FKSG 5FL7G 3ZRWA 3QO5A 1JPXA 1AI6A 3I55V 3AEIA 1FXHA 2ZDIC 3RBZA 2EIJB 3B8NA 3FB7C 2DQ0A 4G28B 2GSMB 1NVPD 1AJPA 3CCQV 5KUMA 1QLEB 1FS0G 1QR8A 1OCRB 2JEXA 3AG1B 1AJNA 1VQMV 4G27B 1GO3F 3QNEA 4Q20A 2EIKC 5L3EA 5KA6A 2GHYA 1NBMG 2QTOA 5EC1C 2D3OW 2WLLA 1F23A 3OEHG 5C93A 3CCUV 4MVUA 1RPOA 2JK5C 2QE7G 1HWYA 4MVOA 2ZDIA 3ASNC 1E1QG 2Y69B 3STZC 3CCVV 1H8EG 1YTFD 1SZTA 3FB5C 4JAVA 3AG2B 1EZJA 3OAAG 2A9HA 3ABKB 3SJQC 1G8MA 1WPXA 2DYRC 3QO7A 3K08A 2DWEC 2WPDG 3G71V 1K34A 3CC2V 2ZXWB 2EILC 4JYCA 1ORQC 1KQSU 1K92A 1NH2D 2HLDG 2DW4A 1I5YA 4LC1A 3P32A 5IYDO 1W0JG 2EZOA 1OCOC 5IYBO 3W7WA 1SETA 2HG5C 3OFNG 1GM8A 4LP8A 2NNUA 2EBOA 4GT1A 1JVMA 2HVKC 2ZR3A 4YXWG 4EKWA 1THZA 1GKFA 2B1GA 5BZBA 2QM7A 4J9ZB 1VQ6V 3E8GA 5LGUA 5EC2C 2NLJC 1MOFA 1TUEB 4GX0A 3CCEV 1ZWIC 4X89A 4CBCA 4BAYA 1K7DA 4XBFA 4JAUA 5HFLA 3ZRVA 2EJRA 4UUJC 3ZIAG 1B6QA 1Q82W 2QEXV 4N23A 1VQ9V 4GCZA 4TSFG 3CCRV 1BL8A 1F4NA 4QPKA 3CCLV 2EZPA 5EBMC 1QCEA 4HZ3A 1RM1B 1YI2V 3ETEA 1PNMA 4U7NA 4WFHA 1KKDA 5CBGA 3SYCA 3IC7A 1VQOV 3K79A 1OCCB 4RUEA 5H6RA 2EINB 2YSUB 1E79G 4J9YB 5IY5C 3OUSA 1QLNA 2A0LA 1JOYA 1RPRA 2Z3YA 2JIZG 5EBLC 3TETA 3W7UA 1M9NA 2H94A 1YJNV 1V55B 3ABLC 2OT5A 3KG2A 1NVPB 3K0DA 2X7RB 5B1BB 2IH3C 1K5QA 2XAFA 3RW0A 3ZMTA 2KB1A 5B1AB 3DGEA 1FXKB 1R73A 4KP4A 2WWWA 3D36A 4XDKA 4UVBA 1GK9A 5L3DA 3ZRSA 2OCCC 3G4SV 1S76D 2Q69A 5H6QA 2Y48A 3SYQA 3P30A 3CMEV 1N8RW 2Q67A 1KP2A 5B1OA 3JD3A 2WLIB 4P2ZA 3JD2A 2IW5A 2QA4V 1R3JC 4LCUC 1YTFB 2A79B 3JYCA 2ZD9A 3ABUA 4HYOA 4BIUA 5HFMA 4RAIA 5LHGA 1PKXA 3CC4V 1W2BU 1FXKA 4PA6A 3MHHC 1FXVA 1GM7A 1ROPA 1NH2B 1Q7YW 3OMIB 1KP3A 3LSQA 4MVQA 2WLKA 5LHIA 1S77D 2EIKB 4OXSA 3K04A 1F4MA 2WLIA 4KUMA 1AR1B 2W6JG 3JD0A 4ASUG 3RVZA 2DYSC 3FB8C 2P90A 4FIPC 5IDJA 4U7OA 4H37A 4UXNA 2XNDG 2Q6AA 1EFRG 4WFEA 3W7SA 3ASNB 1DTOA 1BHAA 4WFBV 3CCMV 2EIMC 3D3IA 1S0VA 1M57C 3CCJV 1AI4A 4P30A 1NJIW 3CPWU 3GB7C 4MSWC 2DYRB 1Y4MA 2K1EA 3K3WA 2UXXA 2AHYA 5LGNA 4RO2A 1FFTB 2EILB 4UV9A 4UVCA 5CA3A 3SPGA 4PA7A 4PDVA 2JJ1G 1M90W 1AROP 2UXNA 1OCOB 5KA5A 2Q68A 4JTDB 3T1CA 2B1IA 1JX9A 1JJ2U 4N21A 2W6IG 1OZ0A 3MHSC 4GX2A 1OCZC 1S5HC 3E83A 1Y66A 1XL6A 3E86A 3FB6C 3IFXA 2HVJC 1KECA 3JD1A 3OE7G 3T2MA 4WFAV 4MTFA 4XDJA 2X6BA 3CMAV 4MTGA 3WG7C 3SPJA 2ZXWC 2H8PC 2YEVB 1SESA 1F51A 5EBWC 4ZBMA 1YITV 4JTCB 4JF3A 3TCUA 5B3SC 4FK5C 3OMNB 2V1DA 4L87A 4FJCC 1V54B 4R6ZA 4JYBA 2PI5A 1AJQA 2LP7A 1M56C 1I5XA 1PL0A 3BEHA 2M7WA 3A0RA 4TT3G 2JDIG 4PELA 2IJKA 3EHBB 1L1FA 5IY5B 5L3FA 4RQEA 4JASA 2X6AA 2CK3G 3LNMB 1GM9A 4QNHB 4FPPA 2QM8A 3I56V 2YEVA 3ZRXA 5E1AC 3CCSV 1R3IC 3BY6A 1H38A 3STLC 3HB3B 4E2LA 3ABMC 3ZN0A 4PA3A 1M1KW 3OGCC 1JCHA 1CEZA 3PJSK 3ABLB 2B5UA 2P7TC 4X88A 3ASOC 2X0LA 1BMFG 2LFSA 2HKOA 1K4DC 2IH1C 2ZR2A 1UJWB 1YIJV 3ZMVA 3FYIB 2OCCB 4BW5A 2DWDC 2XAHA 2EINC 5L3GA 3LUTB 1NKDA 3LDDA 3SYAA 3AG4C 5CMUA 2PI4A 1CPYA 4FMTA 3T4DA 2QKSA 2R9RB 1R3KC 4MS2A 3E8BA 4ZKIA 1K5SA 3RVYA 5LGTA 2BOBC 3LDCA 2IJJA 1P4RA 2Z5UA 4QE7A 3X2QC 2WAMA 1SERA 2V7QG 3QO8A 1W0KG 2WLMA 1G4YB 1XL4A 5B1AC 3T4ZA 3ZMSA 2P67A 1Q81W 4P9OA 1COWG 4Z1MG 1K8AW 4TWKA 2XASA 1S72V 1QBZA 1QVGU 3OM3B 4QE9A 4RQFA 3G6EV 4G2KA 1VQNV 1MG1A 3AG3C 4MW8A 2JEUA 1LNQA 1S3JA 1K73W 2DYSB 1YJWV 2IU0A 5KUKA 4MVSA 3E8HA 3ZN1A 2WLJA 1YSCA 3SPIA 1NR1A 4MVMA 3ML0A 4UVAA 2BOCC 2EIJC 3CP1A 3CD6V 2EIMB 1BHBA 1M57B 1QLEC 5J9PC 3H01A 1DF5A 2XOKG 3DTUB 3E2EA 4QIWF 4MTOA 1OCRC 3AG1C 3SPHA 5LHHA 2C2AA 3ZMZA 2ATKC 1JQ0A 1VQKV 3ZJZA 3ZMUA 5CBFA 1KC8W 4JGSA 4WFGA 1CP9A 3NXSA 4XDLA 3F7YC 3GWOA 2XAGA 5GW7A 3LDEA 1K4CC 1MSWD 5EK0A 4GX1A 3OMAB 4MVRA 3ZCCA 2Y69C 1VQPV 1VQ7V 3OW2U 1OCZB 2OTJV 2HFEC 1R3LC 4PA4A 4UV8A 2WLHA 3FYEB 3AG2C 3ABKC 3HPLC 3ETDA 1Q86W 4CZZA 3WG7B 1EBOA 2ITCC 1PNKA 2HR3A 5DM6V 4JTAB 5B3SB 1AI5A 4MVZA 1DLBA 1R6NA 2F43G 4JPRA 1YJ9V 2XAJA 1OHHG 2W0FC 3E35A 2WLNA 4GX5A 1PNLA 2LFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 U;  3CC7 V;  3I55 V;  1YI2 V;  3CCV V;  1VQP V;  4WF9 V;  1VQ7 V;  1Q81 W;  3CC4 V;  1K8A W;  3OW2 U;  1R73 A;  1YIJ V;  4WFB V;  1W2B U;  3CCM V;  3CD6 V;  2OTJ V;  1VQ6 V;  3CCQ V;  3G4S V;  3CCJ V;  1VQO V;  1S72 V;  1Q7Y W;  4WFA V;  1QVG U;  2OTL V;  1NJI W;  3CPW U;  3CCE V;  1KD1 W;  1VQ8 V;  1YHQ V;  3CMA V;  1Q86 W;  3G6E V;  1VQM V;  5DM6 V;  3G71 V;  1VQN V;  3CC2 V;  3CME V;  3I56 V;  1N8R W;  1KQS U;  1VQL V;  3CCS V;  1YIT V;  1VQK V;  1K73 W;  2QEX V;  1KC8 W;  1VQ5 V;  2QA4 V;  1K9M W;  1Q82 W;  1M1K W;  1M90 W;  4WCE V;  3CXC U;  1YJ9 V;  1YJN V;  1YJW V;  2D3O W;  1VQ4 V;  1VQ9 V;  1QVF U;  3CCR V;  3CCU V;  3CCL V; 
#chains in the Genus database with same CATH topology
 2XHB A;  2HEP A;  1N32 B;  1P7B A;  2R9I A;  2LGW A;  2QSA A;  2UUA B;  3JAT A;  4F4L A;  4I50 A;  5IT9 N;  2YXY A;  3K5N A;  4JI2 O;  1NQT A;  2GUZ B;  3BCC H;  4LNU B;  3OR6 C;  4DO2 A;  5B1N A;  3JAL B;  3TGU H;  3R65 A;  5BXZ A;  1IBK B;  4MTX A;  2IJH A;  4PDM A;  3F5W C;  1MA1 A;  3CC7 V;  4BR6 A;  1RM1 C;  3OTO O;  5BMV A;  1DF4 A;  4MW3 A;  1EZV H;  4DR4 B;  1NR7 A;  1QU7 A;  5IYC O;  4PDR A;  1XQ8 A;  1VQL V;  5LYJ B;  2HJF C;  3X2Q B;  3MD0 A;  1WAZ A;  3CXC U;  2VQF O;  4DR3 O;  1K3E A;  3TK1 A;  4PA9 A;  3K0G A;  3OR7 C;  5CA0 B;  4R7C A;  4JAA A;  2IU3 A;  1FXK C;  1ENV A;  3ABT A;  2DQ3 A;  2FTK A;  2Q9L A;  2BTO A;  4I4T A;  2OTL V;  2JGD A;  4K3A A;  2OIG A;  1RP3 B;  3AG3 B;  4X8A A;  5LA6 A;  5E79 Z;  1PD3 A;  2WLL B;  2UXB O;  1GTO A;  1GN3 A;  5FL7 G;  3I55 V;  1AI6 A;  5J2T B;  3IJ4 A;  3B8N A;  3FB7 C;  2P4V A;  1AJP A;  3CCQ V;  5KUM A;  5LOV B;  4LF5 O;  2UXD O;  4AQY O;  5B66 Z;  1OCR B;  3BAB A;  2EJ7 A;  4Q20 A;  5IJ0 B;  3RYH B;  5EYP A;  3EVK A;  4B7K A;  3OEH G;  5C93 A;  4MVU A;  1RPO A;  2JK5 C;  1HWY A;  4MVO A;  2ZDI A;  4X62 O;  2HJD A;  4O2B A;  3RYI A;  3ABK B;  2DOS A;  4I50 B;  3ZS8 C;  1VEW A;  2DWE C;  2YXH A;  2ZXW B;  2F4V B;  2HLD G;  2DW4 A;  3HKC A;  1I5Y A;  5FNV A;  1FD9 A;  3K5M A;  5IYD O;  3O9O A;  1SET A;  2HG5 C;  3A0B Z;  1GM8 A;  4X1Y A;  4GT1 A;  2ZNJ A;  1J5E O;  1XBL A;  1JVM A;  2Z0A A;  2HVK C;  1TVK A;  2B1G A;  5BZB A;  4DV1 B;  2NLJ C;  1BQZ A;  1GAX A;  2P4K A;  4CBC A;  1MNG A;  2O57 A;  4BAY A;  1K7D A;  1VF5 B;  4EEQ A;  4B3T O;  2RN9 A;  1XNR B;  1F4N A;  4HZ3 A;  4U7N A;  1JFF A;  3IC7 A;  3K79 A;  4RUE A;  4I4T B;  1E79 G;  2JGD B;  4J9Y B;  5IY5 C;  1JOY A;  1PM9 A;  3BHP A;  5LA6 B;  1MZF A;  5A2Q N;  2ZE7 A;  1HNX O;  2Q8V A;  3ZMT A;  4UB8 Z;  3I5D A;  2KB1 A;  1VAR A;  5LMN B;  3DGE A;  1R73 A;  4XDK A;  2W0X A;  3ZHU A;  2OCC C;  2Q69 A;  3M8A A;  3SYQ A;  1PL4 A;  4DR5 B;  1N8R W;  1KP2 A;  1L0N H;  3JAW A;  3N2K B;  3U0Z A;  4FFB A;  2VQE B;  3JD2 A;  2QA4 V;  1YTF B;  4HYO A;  4BIU A;  3OTF A;  1V9P A;  4LFC O;  4LF8 B;  4CS2 A;  1FXK A;  4PA6 A;  4X1K B;  1FXV A;  3K5L A;  4O2B B;  3L73 H;  1JR9 A;  2F93 B;  1DK1 A;  4IIJ A;  4MVQ A;  2WLK A;  5LHI A;  1S5L Z;  3L74 H;  3LNN A;  2Q73 A;  2WLI A;  3HKC B;  5FNV B;  3FAV A;  2Q0O C;  1ZSP A;  4UXN A;  2Q6A A;  4WFE A;  3UQ8 A;  2L35 A;  4U3J A;  5D5P A;  4WFB V;  3CCM V;  2YIA A;  4IHJ A;  3CCJ V;  1Z2G A;  1Y4M A;  1Y6X A;  3P3P A;  4JZ2 A;  1FFT B;  2BSK A;  1EN5 A;  3WU2 Z;  2NN4 A;  5CA3 A;  4EB6 B;  2CTR A;  2JJ1 G;  5KA5 A;  2Y0P A;  3SJC C;  2A06 H;  3ZHV A;  4GX2 A;  4I55 A;  4OGQ B;  4DUY B;  2HVJ C;  1KEC A;  3JD1 A;  3MDS A;  3T2M A;  4MTF A;  3CMA V;  4DR7 O;  3OGI B;  5EBW C;  1YIT V;  3T1Y O;  5B3S C;  1XUQ A;  2LW1 A;  3OMN B;  5ITZ A;  1ZLZ A;  2Q0A A;  2YUA A;  1B3Q A;  4JYB A;  5IWA O;  1I5X A;  1PL0 A;  2F95 B;  2JDI G;  1BE3 H;  3EHB B;  1IBM O;  2YEV A;  4DV0 O;  3ZRX A;  1R3I C;  3BY6 A;  3JAW B;  3STL C;  1D2D A;  4GYC B;  4FLU A;  1JCH A;  1BZK A;  3UO3 A;  3ABL B;  1XI1 A;  2B5U A;  1YCI A;  4J80 A;  2FB5 A;  4B3R O;  2IH1 C;  4DR1 O;  2ZR2 A;  3H9V A;  1UJW B;  2BCC H;  3LUT B;  1NKD A;  4FFK A;  3SYA A;  4FMT A;  2KSD A;  3UCS C;  3BRC A;  3E8B A;  4MS2 A;  1K5S A;  2IJJ A;  2Z5U A;  3X2Q C;  1EN6 A;  1VMG A;  3FAV B;  4DW1 A;  1M93 A;  4KXR A;  1BGY H;  4W4K A;  1N4C A;  4JI8 B;  3T4Z A;  1Q81 W;  4P9O A;  4U3J B;  3HKD B;  4TWK A;  4IHJ B;  1S72 V;  1N34 B;  3BPZ A;  4QE9 A;  4G2K A;  3AG3 C;  4MW8 A;  2YI8 A;  1LNQ A;  1Z5W A;  2R72 A;  1Q8I A;  1U96 A;  3JAS A;  2DYS B;  5KUK A;  4MVS A;  3E8H A;  3ZN1 A;  1FJG O;  5C8Y B;  1NR1 A;  1QQC A;  1SQV H;  4YIO A;  4X66 B;  1KYO F;  4UVA A;  2BOC C;  1H2M A;  3KCY A;  4I55 B;  2G38 A;  2CE4 A;  2UXC O;  3DTU B;  4J11 A;  3S3W A;  1OCR C;  3QF7 A;  2C2A A;  2ATK C;  3ZJZ A;  5CBF A;  4XDL A;  3F7Y C;  3LDE A;  1K4C C;  2P06 A;  4GX1 A;  3CJH B;  4YHH O;  1FKA O;  3OMA B;  4B3S O;  4PV1 B;  2OTJ V;  1VF6 A;  3ABK C;  2QM4 A;  3WG7 B;  1PNK A;  4LF6 O;  1AI5 A;  1XDC A;  4JPR A;  1YJ9 V;  1OHH G;  2WLN A;  4GX5 A;  1VP7 A;  3OAA G;  3OE7 G;  2ZIO A;  1PNL A;  1H2S B;  4DR6 B;  4DV2 O;  4LF4 B;  1RSO A;  2ZE6 A;  3B8M A;  1XIL A;  3JD4 A;  1AI7 A;  4DR2 O;  3J7A U;  1ZL8 A;  3GVM A;  3L9D A;  1XMQ O;  5KAI Z;  3ABM B;  2PYL A;  4X65 O;  3ASO B;  5KHI A;  5H9C A;  1YVW A;  3E8F A;  1P49 A;  1AVM A;  2P6J A;  4PDL A;  2RJZ A;  1KD1 W;  1VQ8 V;  4JI7 B;  4U3F H;  3W7T A;  2PY5 A;  1XNQ O;  4K8Z A;  2YC0 A;  4LNU A;  4DUZ O;  3MAQ A;  2QWN B;  5DN6 G;  1VQ5 V;  3LSS A;  2CUG A;  3SPC A;  3JAS B;  4QPJ A;  3B2E E;  2YIB A;  3ZRW B;  1SQP H;  1Y76 A;  3OUF A;  3Q4H A;  4YY3 B;  3K03 A;  3SYP A;  2UUC B;  1NTK H;  5D5Q A;  2N74 A;  4MT8 A;  1KUQ A;  3UM7 A;  3SJA C;  3FX7 A;  1VIB A;  3A8T A;  5IE9 A;  3ZHQ A;  1N32 O;  1US6 A;  2ZDI C;  3RBZ A;  4NKG B;  1CXZ B;  2EIJ B;  1WB7 A;  4ABM A;  2DQ0 A;  4IT5 A;  3GWK C;  4DV6 B;  1QR8 A;  2QKC A;  2JEX A;  2KKW A;  4G27 B;  3QNE A;  2HHH O;  5L3E A;  1NI8 A;  2JS5 A;  1NBM G;  2YID A;  5EC1 C;  2D3O W;  2WLL A;  3B09 A;  3CEI A;  2QE7 G;  1X4T A;  5J2T A;  3STZ C;  2Y69 B;  1H8E G;  1YTF D;  2B9Z A;  1RSO B;  1SZT A;  4JAV A;  3AG2 B;  1EZJ A;  4LFA B;  2A9H A;  1WPX A;  3QO7 A;  1K34 A;  2YDE A;  3CC2 V;  1ZL8 B;  5CB4 B;  4BW9 A;  4LC1 A;  3HR0 A;  1W0J G;  1TUB B;  2UU9 B;  3OFN G;  4FLW A;  4YXW G;  4UB6 Z;  4JV5 B;  4J9Z B;  2ZM6 B;  5EC2 C;  4GX0 A;  1ZWI C;  5BR8 B;  3DC6 A;  1S5J A;  4TUY B;  1HNZ O;  2E3C A;  1Q82 W;  1VQ9 V;  1W59 A;  4GCZ A;  4TSF G;  4QPK A;  3CCL V;  3N27 A;  3S3X A;  4JYA O;  1Y76 B;  4X9Q A;  4WFH A;  5CBG A;  3Q4H B;  3CXH F;  1VQO V;  1OCC B;  5H6R A;  5GTH Z;  3B40 A;  2A0L A;  1RPR A;  2Z3Y A;  2JIZ G;  2ZIN A;  4DK0 A;  1M9N A;  1YJN V;  1V55 B;  3ABL C;  2P5O A;  2FML A;  2X7R B;  1K5Q A;  3RW0 A;  4CC5 A;  4B3M B;  3ICX A;  4KP4 A;  1Q3E A;  2WWW A;  4GUN A;  1GK9 A;  1NT2 B;  3N2G A;  1S76 D;  5H6Q A;  2Y48 A;  1IDS A;  3P30 A;  3B4S A;  3CME V;  1I7F A;  3RT3 C;  4NXN B;  4LF9 O;  2IW5 A;  1D5N A;  4DV3 O;  2DN9 A;  1XHX A;  2ZD9 A;  3ABU A;  3H1I H;  4RAI A;  5LHG A;  4DV1 O;  4PD4 F;  3CC4 V;  3P3N A;  1W2B U;  1GM7 A;  1ROP A;  4I9Q A;  1NH2 B;  1SQQ H;  1KP3 A;  1S77 D;  2EIK B;  4OXS A;  3L71 H;  4UCV A;  3N2K A;  1AR1 B;  2W6J G;  4ASU G;  2DYS C;  3FB8 C;  2P90 A;  1BQ0 A;  5IDJ A;  2PZS A;  2AZ2 A;  2E5L O;  3ASN B;  3OTO B;  1BHA A;  4X1K A;  3D3I A;  1S0V A;  4AHC A;  3CPW U;  2DYR B;  2UXX A;  1FAF A;  4RO2 A;  4B08 A;  1F7Y A;  4LWS B;  4PDV A;  1M90 W;  3SJB C;  1OCO B;  4CS4 A;  2B1I A;  4DR3 B;  1JJ2 U;  2FYU H;  1OZ0 A;  3MHS C;  3A2F A;  3G80 A;  4Z2W A;  3LSU A;  2M6Y A;  1EM1 A;  3E86 A;  3IFX A;  4WFA V;  4IL6 Z;  4H44 B;  2X6B A;  3WG7 C;  3SPJ A;  4EFB A;  4JI1 O;  1Q6U A;  2E76 B;  4JF3 A;  3TCU A;  2DE0 X;  4E4E A;  4EB6 A;  1NTZ H;  5EIB C;  4JI4 B;  4L87 A;  2LGQ A;  4X64 O;  4R6Z A;  2UXB B;  3DXR A;  2HP8 A;  4PHZ A;  2JGU A;  2NR5 A;  4IYH A;  2M7W A;  3A0R A;  4EFE A;  1IXB A;  3N2G B;  4NXM O;  1Q43 A;  5CA1 A;  4RQE A;  1ZUQ A;  4LF5 B;  2UXD B;  1GM9 A;  3NR7 A;  4AQY B;  1G6U A;  3I56 V;  1N36 O;  1H38 A;  3ABM C;  4O2A B;  3OGC C;  2E74 B;  5KHH A;  1CEZ A;  3PJS K;  4GZR B;  3C3S A;  3ASO C;  2LFS A;  1H2K A;  2HKO A;  1K4D C;  5EIB D;  2QR4 A;  1YIJ V;  5F2V O;  1LUV A;  2DWD C;  2XAH A;  2EIN C;  3KKY A;  3T1H O;  1CPY A;  2QKS A;  1R3K C;  4ZKI A;  3RVY A;  3H1L H;  2DJV A;  2BOB C;  2N04 A;  3ZBH A;  2AGA A;  4QE7 A;  2F66 C;  5KMG A;  2WAM A;  3APQ A;  3J81 N;  2CH7 B;  4UCO A;  1I0H A;  2V7Q G;  3QO8 A;  1W0K G;  2WLM A;  2WA4 A;  1XL4 A;  5B1A C;  1J5E B;  3ZMS A;  1COW G;  3VQW A;  4Z1M G;  4JI6 O;  1X59 A;  4ZI7 B;  4C7U A;  1QBZ A;  1QVG U;  5KHG A;  4YJ2 A;  2Q5Z A;  2BTQ A;  3C90 A;  4LH6 A;  4B3T B;  5B5E Z;  3D3Q A;  2EIJ C;  2EIM B;  3HKD A;  2ZCE A;  3OT7 A;  1M57 B;  2XOK G;  1VF6 C;  4MTO A;  2Y4T A;  4NTW A;  5LHH A;  2LQT A;  1RFY A;  2RDC A;  4JGS A;  4WFG A;  5GW7 A;  3ZHS A;  3H1K H;  5C8Y A;  3DXR B;  4MVR A;  3ZCC A;  1HNX B;  1XMO O;  2Y69 C;  1VQP V;  1VQ7 V;  5BY1 A;  2QDO A;  1NU1 H;  2HFE C;  1QHT A;  2LO1 A;  4CC6 A;  3AG2 C;  1R1B A;  2QTS A;  5CA1 B;  2WA3 A;  5LXT B;  4CZZ A;  1HNW O;  1AB3 A;  4OX9 B;  2XAJ A;  2W0F C;  5IYZ B;  3WFV A;  3ETQ A;  3CJH A;  1A32 A;  4DXW A;  1M56 B;  2XAQ A;  4LFC B;  1WPB A;  1BT8 A;  1WLE A;  1UFI A;  2ITD C;  3TXQ A;  4QJF B;  1XHZ A;  5CBH A;  4LFB O;  4DV7 O;  5LP6 B;  4JI0 O;  1G1X B;  5GON A;  4HBN A;  5KMG B;  3E89 A;  1V54 C;  1GH6 A;  1GMG A;  2UUB B;  1KBH A;  1WNS A;  2QWR B;  4R50 A;  3JAK B;  1K97 A;  2JJ2 G;  1OCC C;  3VOU A;  2MK3 A;  1GN2 A;  1YHQ V;  3UKM A;  1GN6 A;  2X6C A;  3L75 H;  5EZY A;  4YJ2 B;  5KAF Z;  1NTM H;  1IZ3 A;  1L8D A;  2BTQ B;  1QR9 A;  1KMI Z;  4RUF A;  1QVF U;  1V55 C;  4Z1V A;  3JCU Z;  4NYK A;  2ZQM A;  4UCU A;  2YIB D;  3OEE G;  1MAB G;  4P9P A;  5L3B A;  2IJI A;  4DR7 B;  2OWO A;  4TV9 B;  3B77 A;  4NTX A;  3K06 A;  3WB2 A;  4FLV A;  1QNM A;  1K9M W;  4QGP A;  4WCE V;  3T1Y B;  1E1R G;  2ETN A;  1SRY A;  4D7T A;  4LF4 O;  4GKK O;  3WB0 A;  3ZRW A;  1JPX A;  3QG5 A;  3AEI A;  4GKJ O;  2KG7 B;  2JS3 A;  1BSM A;  5IWA B;  3VQY A;  1YDX A;  3DSQ A;  2ADQ B;  1JMK C;  5KHJ A;  4PI2 A;  3HKE A;  3UO2 A;  4UCT A;  1AJN A;  1VQM V;  1GO3 F;  2EIK C;  4ZHQ B;  1IBM B;  2GHY A;  4DV0 B;  4JI5 O;  2QTO A;  3APO A;  2AXT Z;  1F23 A;  1HR0 B;  1NS1 A;  3ASN C;  3CCV V;  4B3R B;  4CH6 A;  4JI7 O;  4DR1 B;  3F5T A;  1SKV A;  1G8M A;  2LJ2 A;  2DYR C;  2WPD G;  1IBL O;  1ORQ C;  5IJ9 A;  1NH2 D;  3C3T A;  2CGN A;  1OJH A;  2EZO A;  1OCO C;  5GON B;  1XOU A;  2UUC O;  2ZR3 A;  3IC9 A;  4IGG A;  4FVM A;  2IM9 A;  2H3O A;  1VQ6 V;  3E8G A;  3RWR D;  5LGU A;  3CCE V;  3PN1 A;  2LW7 A;  2OYQ A;  1YZB A;  1I08 A;  1WB8 A;  3SGI A;  1FYJ A;  3CRA A;  4JAU A;  5HFL A;  5EZY B;  2EJR A;  4UUJ C;  5CB4 A;  3ZIA G;  2VWJ A;  1P84 F;  1WA8 B;  3VQX A;  4OPA A;  1N0J A;  1TUB A;  4N23 A;  1BL8 A;  1QCE A;  1FJG B;  4J42 A;  4DW0 A;  4FM2 A;  4DV6 O;  3CRM A;  3SYC A;  4F6E A;  2YIC A;  2CTQ A;  2EIN B;  1QLN A;  4DV5 O;  1B06 A;  4KHP O;  4UCS A;  4TUY A;  5LMU O;  3TET A;  3W7U A;  4NVP A;  2OT5 A;  1NVP B;  4TQF A;  4PJ0 Z;  3K0D A;  4J7K A;  5B1B B;  2IBZ H;  2XAF A;  3ZHR A;  5B1A B;  3D36 A;  4LFA O;  4B3S B;  5L3D A;  1XRE A;  2F23 A;  5H2F Z;  4K0K O;  3HKE B;  1Q6H A;  2Q67 A;  5B1O A;  4LF6 B;  3JD3 A;  2UU9 O;  4P2Z A;  2YS8 A;  3G6B A;  1R3J C;  2A79 B;  3JYC A;  1Q90 D;  2ODM A;  5HFM A;  2XUM A;  2JRI A;  1PKX A;  2UUA O;  1AP5 A;  5JCO A;  4DV2 B;  3MHH C;  5J2U A;  5H5N A;  5KLV H;  2VWK A;  3OMI B;  5KX5 A;  4DR2 B;  1HDJ A;  3OD4 A;  1WP7 A;  1P7G A;  1IBK O;  5IJ9 B;  4GLX A;  1F4M A;  4KUM A;  3JD0 A;  4JI3 B;  3RVZ A;  1O9H A;  4FM1 A;  4FIP C;  4U7O A;  2XND G;  4DR4 O;  1AR4 A;  3W7S A;  1N33 B;  4X65 B;  3RYC A;  4BIO A;  3AK1 A;  2EIM C;  4DV4 B;  1M57 C;  1PPJ H;  4I0X A;  3GB7 C;  2K1E A;  2AHY A;  2GTA A;  1Z5V A;  3AK2 A;  1XNQ B;  2EIL B;  1AIL A;  4UV9 A;  1SA0 A;  1MSD A;  4DUZ B;  1IUR A;  4PA7 A;  1ARO P;  2UXN A;  5JJJ B;  3HKB B;  2Q68 A;  4JTD B;  3RFR A;  4B3M O;  4N21 A;  3U11 A;  4LF7 B;  2W6I G;  1IX9 A;  2F1M A;  3E83 A;  1Y66 A;  1XL6 A;  2MW2 B;  2QJ1 A;  4ZOL A;  3UT5 A;  4O4L A;  3ZED A;  3THO A;  2CGO A;  3G67 A;  3SR2 C;  4NXN O;  1NZ6 A;  2H8P C;  1HP8 A;  1SES A;  2AW9 A;  4FK5 C;  3RYF B;  2V1D A;  4LWS A;  4FJC C;  1V54 B;  2A7W A;  2PI5 A;  1M56 C;  1M5I A;  1IVS A;  3BEH A;  4TT3 G;  2IJK A;  1L1F A;  4JAS A;  2X6A A;  4B7E A;  4X1I A;  3LNM B;  5E1A C;  3CCS V;  3BA8 A;  2HHH B;  4E2L A;  3HB3 B;  4PA3 A;  5LP6 C;  1FFX B;  4ICG A;  2X0L A;  5GTI Z;  1BMF G;  2P22 C;  4NR1 A;  1I94 B;  3FYI B;  4BW5 A;  5J2U B;  3TXS A;  2GDS A;  3BVO A;  2Y0I A;  5KX5 B;  2PI4 A;  2F4V O;  1Q6I A;  1KB9 F;  3LDC A;  4HNA B;  4O2A A;  4J10 A;  1SER A;  4J41 A;  1SF9 A;  3CE2 A;  3RYC B;  1K8A W;  3D8C A;  1DGS A;  3BA9 A;  2AZ0 A;  4I0X B;  3OM3 B;  4RQF A;  5JJN B;  3G6E V;  1VQN V;  5K1P A;  4JI2 B;  2JEU A;  4JI4 O;  1S3J A;  3RN4 A;  1SA0 B;  1K73 W;  3O65 A;  1HNZ B;  3K57 A;  1XNR O;  5FPO A;  2IU0 A;  2CH7 A;  2WLJ A;  1YSC A;  4FLT A;  1PP9 H;  4I7Z B;  1AR5 A;  1UPG A;  4DRX B;  3CD6 V;  1LR1 A;  3CP1 A;  4JYA B;  5J9P C;  4ZOL B;  3H01 A;  3UT5 B;  4ZI7 A;  4O4L B;  5DEC A;  3E2E A;  1L0L H;  4O4H A;  3SPH A;  1JQ0 A;  1VQK V;  3ZMU A;  1KC8 W;  2ZE8 A;  3GWO A;  2PYJ A;  3K59 A;  3BAA A;  1SZX A;  5EK0 A;  5KHK A;  2VQF B;  5LMN O;  2BE3 A;  5AG2 A;  4CH5 A;  3OW2 U;  1OCZ B;  1FPO A;  2QWP B;  4PA4 A;  4UV8 A;  3JAT B;  1OV9 A;  4O4J A;  4DR5 O;  3ETD A;  1Q86 W;  2Q7H A;  4X1I B;  1EBO A;  2ITC C;  5DM6 V;  2VQE O;  1M4U A;  2Y4U A;  1HW7 A;  2XTA A;  1DLB A;  2RQ6 A;  4LF9 B;  2ZE5 A;  1H2N A;  4DV3 B;  4LF8 O;  1H2G A;  4KFM A;  4WFF A;  5BMV B;  3CHX A;  2EX3 A;  1GRJ A;  3EFF K;  4I9W A;  5CN0 A;  4IYI A;  1ZTE A;  2GBO A;  1ZAU A;  3A0H Z;  5LXT A;  3ZX6 A;  5JJE B;  3W7X A;  3QTC A;  3CWB H;  1R6K A;  3M99 B;  1AP6 A;  1VQ4 V;  1K33 A;  3SYO A;  5IYZ A;  1MZE A;  5FLX N;  4WF9 V;  2E5L B;  1TAE A;  2WSS G;  3JSN A;  5LBQ A;  1J95 A;  1BS3 A;  3F7V C;  1H8H G;  2Q7E A;  4X62 B;  4I5S A;  1H2L A;  3AG4 B;  3K9A A;  3JCZ A;  4NB5 A;  2K9P A;  5L3C A;  4RWU A;  4BIZ A;  4JZG A;  4NTY A;  1IXM A;  1TA8 A;  5LP6 A;  4BWA A;  4WBN A;  3IGA C;  5A9G A;  5B1B C;  2AHZ A;  4D7S A;  2R9A A;  4DUY O;  1SQB H;  3AK3 A;  3JAK A;  2QWQ B;  4R8C A;  3CYO A;  3VBB A;  4PI0 A;  4FLX A;  4FM0 A;  3ETG A;  4O4H B;  4UCR A;  2XT9 A;  3VQV A;  4OX9 O;  3SDL A;  4HAM A;  4H33 A;  1KKC A;  4LBE C;  4JI1 B;  5EYP B;  3R66 A;  4LR3 A;  4OPH A;  3K58 A;  3FKS G;  3QO5 A;  4X64 B;  4LH7 A;  3L70 H;  1FXH A;  4G28 B;  2GSM B;  1U97 A;  1NVP D;  1YEW A;  1QLE B;  1SQG A;  3RYI B;  1FS0 G;  1URF A;  4DK1 A;  1PV0 A;  5DED A;  3AG1 B;  4O4J B;  4NXM B;  2ZT9 B;  3KZI Z;  1O9G A;  4O4I A;  1WP8 A;  4K35 A;  4TV9 A;  5KA6 A;  1N36 B;  1JJO A;  2UUB O;  2RMK B;  3CCU V;  1SQX H;  4X1Y B;  1E1Q G;  1TVK B;  3CRR A;  2KG7 A;  3FB5 C;  2OIE A;  2ZKO A;  3SJQ C;  3JSL A;  1MMM A;  3WB1 A;  2CTW A;  3K08 A;  2ZNI A;  3G71 V;  3T1H B;  1LUW A;  2EIL C;  4FZ1 A;  4JYC A;  1KQS U;  1K92 A;  4ZHQ A;  4CH3 A;  3P32 A;  3W7W A;  1TGO A;  5IYB O;  3AG7 A;  4LP8 A;  2ADP A;  2NNU A;  2EBO A;  4JI8 O;  3U10 A;  4EKW A;  1THZ A;  4H0L B;  1GKF A;  2QM7 A;  1JFF B;  2GTS A;  1N34 O;  1MOF A;  1TUE B;  1B04 A;  4JI6 B;  4FLZ A;  4X89 A;  4XBF A;  3ZRV A;  1B6Q A;  3M7M X;  2QEX V;  3EXA A;  3ZHT A;  4WBN B;  2L6L A;  3L72 H;  3CCR V;  2EZP A;  5EBM C;  5TIS Z;  4X66 O;  1RM1 B;  1YI2 V;  3ETE A;  1PNM A;  2N05 A;  1KKD A;  2Q7G A;  3D36 C;  1EN4 A;  2YSU B;  3CRQ A;  3OUS A;  3JAM N;  1GN4 A;  5EBL C;  4Q6G A;  4FFB B;  1WA8 A;  1HR0 O;  3H1H H;  2H94 A;  3KG2 A;  2IH3 C;  4FZ0 A;  4AI8 A;  1FXK B;  3ZRS A;  5JCO C;  3QVN A;  4UVB A;  1XMO B;  2YI9 A;  3G4S V;  4D6T H;  2QGN A;  4IIJ B;  4YIP A;  4O4I B;  1HNW B;  2WLI B;  3JAR A;  4LCU C;  4DR6 O;  3CX5 F;  2VRZ A;  4TQD A;  5LL6 Y;  4ZIB A;  5FPR A;  4J7J A;  2KQX A;  2PTM A;  5JVD A;  1Q7Y W;  1SS3 A;  3LSQ A;  2BSK B;  2D2C B;  3K04 A;  4LFB B;  3CS5 A;  4F6R A;  4DV7 B;  1WJZ A;  4JI0 B;  4H37 A;  1EFR G;  4FLY A;  1N0N A;  1DTO A;  2Q4P A;  1YF2 A;  2EUL A;  2JVD A;  4K8X A;  1AI4 A;  4P30 A;  1NJI W;  4MSW C;  3K3W A;  5LGN A;  2YXL A;  4YJ3 A;  4UVC A;  3SPG A;  2ARH A;  5ITZ B;  3FD9 A;  2OCH A;  1SQF A;  3T1C A;  1JX9 A;  2DMX A;  4YY3 O;  3CSX A;  1OCZ C;  1S5H C;  2R70 A;  3FB6 C;  4JYY A;  4XDJ A;  1SC5 B;  4X20 A;  4MTG A;  2ZXW C;  2YEV B;  2QWO B;  2VS0 A;  1F51 A;  4ZBM A;  4JTC B;  2GV9 A;  3E22 A;  1Y67 A;  4A5U B;  3HKB A;  1T5E A;  4J7Z A;  4TV8 A;  3K5O A;  1AJQ A;  2LP7 A;  4GKK B;  4GKJ B;  4PEL A;  5IY5 B;  2PGG A;  5L3F A;  2UXC B;  2CK3 G;  4QNH B;  1Q5O A;  4FPP A;  2QM8 A;  4JI3 O;  3J80 N;  3ZN0 A;  5JH7 A;  3RYF A;  1Y74 A;  1M1K W;  5JQG A;  3JAR B;  4JI5 B;  1BCC H;  1N33 O;  2P7T C;  4X88 A;  1YXB A;  4DV4 O;  2RNB A;  4YHH B;  3ZMV A;  1JA8 A;  2OCC B;  2FKX A;  5L3G A;  3LDD A;  5JVD B;  3AG4 C;  5CMU A;  2GUZ A;  3T4D A;  3BFR A;  3JAL A;  2R9R B;  1XEQ A;  5LGT A;  2PUS A;  1IBL B;  3KCX A;  4W4L A;  1P4R A;  4LF7 O;  3TJT A;  4F6R B;  1FFX A;  4KL1 A;  1G4Y B;  4TOI A;  2CAZ C;  4JV5 O;  2ILM A;  5K1X A;  2ZM6 O;  2P67 A;  5BR8 O;  2A3Q A;  2E75 B;  2XAS A;  3DC5 A;  4UFZ A;  2QKA A;  3K9S A;  1MG1 A;  5LYJ A;  4YJ3 B;  1VF7 A;  4HNA A;  1XMQ B;  1YJW V;  3H1J H;  3SPI A;  5CA0 A;  1ZX3 A;  2RCV A;  4MVM A;  3ML0 A;  2CDY A;  5JWP A;  2ZIM A;  1BHB A;  1QLE C;  1DF5 A;  4CS3 A;  4QIW F;  4AIL C;  3AG1 C;  4X20 B;  1WN7 A;  4H13 B;  4DV5 B;  3ZMZ A;  1R6T A;  4KHP B;  1D5A A;  4CH4 A;  3RGB A;  5LMU B;  1CP9 A;  3E22 B;  3NXS A;  2XAG A;  1MSW D;  2V4D A;  3CB2 A;  4TV8 B;  1I94 O;  2PF4 E;  1KU9 A;  2CTP A;  3IAY A;  4DRX A;  1R3L C;  2WLH A;  3FFQ A;  3FYE B;  5LOV A;  3HPL C;  2FL4 A;  4L8J A;  4K0K B;  2HR3 A;  4DYL A;  5IJ0 A;  3RYH A;  4JTA B;  5B3S B;  4MVZ A;  5JH7 B;  1R6N A;  2F43 G;  3CRC A;  1Y74 B;  5JQG B;  3E35 A;  2LFR A; 
#chains in the Genus database with same CATH homology
 3WFV A;  1H2G A;  4KFM A;  4WFF A;  4DXW A;  1P7B A;  1M56 B;  3EFF K;  2XAQ A;  4I9W A;  2R9I A;  5CN0 A;  3B8M A;  3JD4 A;  1AI7 A;  4F4L A;  1WLE A;  2ITD C;  1NQT A;  4QJF B;  5CBH A;  3OR6 C;  4DO2 A;  5B1N A;  3W7X A;  1R6K A;  3ABM B;  3R65 A;  3M99 B;  1VQ4 V;  4MTX A;  1K33 A;  2IJH A;  3SYO A;  3E89 A;  4PDM A;  1V54 C;  3F5W C;  1GMG A;  3ASO B;  3CC7 V;  1RM1 C;  1DF4 A;  4MW3 A;  4R50 A;  5H9C A;  3E8F A;  4WF9 V;  2WSS G;  5LBQ A;  1J95 A;  1K97 A;  3F7V C;  2JJ2 G;  1H8H G;  2P6J A;  4I5S A;  4PDL A;  1OCC C;  1NR7 A;  3VOU A;  3AG4 B;  2MK3 A;  5IYC O;  3K9A A;  1KD1 W;  3W7T A;  3JCZ A;  1YHQ V;  3UKM A;  1VQ8 V;  2X6C A;  4PDR A;  5L3C A;  4BIZ A;  1VQL V;  2HJF C;  5DN6 G;  1VQ5 V;  3LSS A;  1IXM A;  3SPC A;  3X2Q B;  1QR9 A;  3MD0 A;  3CXC U;  4QPJ A;  4RUF A;  1K3E A;  3IGA C;  1QVF U;  1V55 C;  3TK1 A;  4PA9 A;  3ZRW B;  3K0G A;  3OR7 C;  5B1B C;  2AHZ A;  4R7C A;  3OUF A;  2IU3 A;  1FXK C;  1ENV A;  3ABT A;  3K03 A;  2DQ3 A;  3SYP A;  2FTK A;  2ZQM A;  3OEE G;  4R8C A;  3CYO A;  2OTL V;  3VBB A;  4MT8 A;  1MAB G;  4P9P A;  3ETG A;  5L3B A;  3AG3 B;  4X8A A;  2IJI A;  3UM7 A;  3B77 A;  3K06 A;  4HAM A;  4H33 A;  4LBE C;  1K9M W;  1PD3 A;  4WCE V;  2WLL B;  1E1R G;  1GTO A;  1SRY A;  3FKS G;  5FL7 G;  3ZRW A;  3QO5 A;  1JPX A;  1AI6 A;  3I55 V;  3AEI A;  1FXH A;  2ZDI C;  3RBZ A;  2EIJ B;  3B8N A;  3FB7 C;  2DQ0 A;  4G28 B;  2GSM B;  1NVP D;  1AJP A;  3CCQ V;  5KUM A;  1QLE B;  1FS0 G;  1QR8 A;  1OCR B;  2JEX A;  3AG1 B;  1AJN A;  1VQM V;  4G27 B;  1GO3 F;  3QNE A;  4Q20 A;  2EIK C;  5L3E A;  5KA6 A;  2GHY A;  1NBM G;  2QTO A;  5EC1 C;  2D3O W;  2WLL A;  1F23 A;  3OEH G;  5C93 A;  3CCU V;  4MVU A;  1RPO A;  2JK5 C;  2QE7 G;  1HWY A;  4MVO A;  2ZDI A;  3ASN C;  1E1Q G;  2Y69 B;  3STZ C;  3CCV V;  1H8E G;  1YTF D;  1SZT A;  3FB5 C;  4JAV A;  3AG2 B;  1EZJ A;  3OAA G;  2A9H A;  3ABK B;  3SJQ C;  1G8M A;  1WPX A;  2DYR C;  3QO7 A;  3K08 A;  2DWE C;  2WPD G;  3G71 V;  1K34 A;  3CC2 V;  2ZXW B;  2EIL C;  4JYC A;  1ORQ C;  1KQS U;  1K92 A;  1NH2 D;  2HLD G;  2DW4 A;  1I5Y A;  4LC1 A;  3P32 A;  5IYD O;  1W0J G;  2EZO A;  1OCO C;  5IYB O;  3W7W A;  1SET A;  2HG5 C;  3OFN G;  1GM8 A;  4LP8 A;  2NNU A;  2EBO A;  4GT1 A;  1JVM A;  2HVK C;  2ZR3 A;  4YXW G;  4EKW A;  1THZ A;  1GKF A;  2B1G A;  5BZB A;  2QM7 A;  4J9Z B;  1VQ6 V;  3E8G A;  5LGU A;  5EC2 C;  2NLJ C;  1MOF A;  1TUE B;  4GX0 A;  3CCE V;  1ZWI C;  4X89 A;  4CBC A;  4BAY A;  1K7D A;  4XBF A;  4JAU A;  5HFL A;  3ZRV A;  2EJR A;  4UUJ C;  3ZIA G;  1B6Q A;  1Q82 W;  2QEX V;  4N23 A;  1VQ9 V;  4GCZ A;  4TSF G;  3CCR V;  1BL8 A;  1F4N A;  4QPK A;  3CCL V;  2EZP A;  5EBM C;  1QCE A;  4HZ3 A;  1RM1 B;  1YI2 V;  3ETE A;  1PNM A;  4U7N A;  4WFH A;  1KKD A;  5CBG A;  3SYC A;  3IC7 A;  1VQO V;  3K79 A;  1OCC B;  4RUE A;  5H6R A;  2EIN B;  2YSU B;  1E79 G;  4J9Y B;  5IY5 C;  3OUS A;  1QLN A;  2A0L A;  1JOY A;  1RPR A;  2Z3Y A;  2JIZ G;  5EBL C;  3TET A;  3W7U A;  1M9N A;  2H94 A;  1YJN V;  1V55 B;  3ABL C;  2OT5 A;  3KG2 A;  1NVP B;  3K0D A;  2X7R B;  5B1B B;  2IH3 C;  1K5Q A;  2XAF A;  3RW0 A;  3ZMT A;  2KB1 A;  5B1A B;  3DGE A;  1FXK B;  1R73 A;  4KP4 A;  2WWW A;  3D36 A;  4XDK A;  4UVB A;  1GK9 A;  5L3D A;  3ZRS A;  2OCC C;  3G4S V;  1S76 D;  2Q69 A;  5H6Q A;  2Y48 A;  3SYQ A;  3P30 A;  3CME V;  1N8R W;  2Q67 A;  1KP2 A;  5B1O A;  3JD3 A;  2WLI B;  4P2Z A;  3JD2 A;  2IW5 A;  2QA4 V;  1R3J C;  4LCU C;  1YTF B;  2A79 B;  3JYC A;  2ZD9 A;  3ABU A;  4HYO A;  4BIU A;  5HFM A;  4RAI A;  5LHG A;  1PKX A;  3CC4 V;  1W2B U;  1FXK A;  4PA6 A;  3MHH C;  1FXV A;  1GM7 A;  1ROP A;  1NH2 B;  1Q7Y W;  3OMI B;  1KP3 A;  3LSQ A;  4MVQ A;  2WLK A;  5LHI A;  1S77 D;  2EIK B;  4OXS A;  3K04 A;  1F4M A;  2WLI A;  4KUM A;  1AR1 B;  2W6J G;  3JD0 A;  4ASU G;  3RVZ A;  2DYS C;  3FB8 C;  2P90 A;  4FIP C;  5IDJ A;  4U7O A;  4H37 A;  4UXN A;  2XND G;  2Q6A A;  1EFR G;  4WFE A;  3W7S A;  3ASN B;  1DTO A;  1BHA A;  4WFB V;  3CCM V;  2EIM C;  3D3I A;  1S0V A;  1M57 C;  3CCJ V;  1AI4 A;  4P30 A;  1NJI W;  3CPW U;  3GB7 C;  4MSW C;  2DYR B;  1Y4M A;  2K1E A;  3K3W A;  2UXX A;  2AHY A;  5LGN A;  4RO2 A;  1FFT B;  2EIL B;  4UV9 A;  4UVC A;  5CA3 A;  3SPG A;  4PA7 A;  4PDV A;  2JJ1 G;  1M90 W;  1ARO P;  2UXN A;  1OCO B;  5KA5 A;  2Q68 A;  4JTD B;  3T1C A;  2B1I A;  1JX9 A;  1JJ2 U;  4N21 A;  2W6I G;  1OZ0 A;  3MHS C;  4GX2 A;  1OCZ C;  1S5H C;  3E83 A;  1Y66 A;  1XL6 A;  3E86 A;  3FB6 C;  3IFX A;  2HVJ C;  1KEC A;  3JD1 A;  3OE7 G;  3T2M A;  4WFA V;  4MTF A;  4XDJ A;  2X6B A;  3CMA V;  4MTG A;  3WG7 C;  3SPJ A;  2ZXW C;  2H8P C;  2YEV B;  1SES A;  1F51 A;  5EBW C;  4ZBM A;  1YIT V;  4JTC B;  4JF3 A;  3TCU A;  5B3S C;  4FK5 C;  3OMN B;  2V1D A;  4L87 A;  4FJC C;  1V54 B;  4R6Z A;  4JYB A;  2PI5 A;  1AJQ A;  2LP7 A;  1M56 C;  1I5X A;  1PL0 A;  3BEH A;  2M7W A;  3A0R A;  4TT3 G;  2JDI G;  4PEL A;  2IJK A;  3EHB B;  1L1F A;  5IY5 B;  5L3F A;  4RQE A;  4JAS A;  2X6A A;  2CK3 G;  3LNM B;  1GM9 A;  4QNH B;  4FPP A;  2QM8 A;  3I56 V;  2YEV A;  3ZRX A;  5E1A C;  3CCS V;  1R3I C;  3BY6 A;  1H38 A;  3STL C;  3HB3 B;  4E2L A;  3ABM C;  3ZN0 A;  4PA3 A;  1M1K W;  3OGC C;  1JCH A;  1CEZ A;  3PJS K;  3ABL B;  2B5U A;  2P7T C;  4X88 A;  3ASO C;  2X0L A;  1BMF G;  2LFS A;  2HKO A;  1K4D C;  2IH1 C;  2ZR2 A;  1UJW B;  1YIJ V;  3ZMV A;  3FYI B;  2OCC B;  4BW5 A;  2DWD C;  2XAH A;  2EIN C;  5L3G A;  3LUT B;  1NKD A;  3LDD A;  3SYA A;  3AG4 C;  5CMU A;  2PI4 A;  1CPY A;  4FMT A;  3T4D A;  2QKS A;  2R9R B;  1R3K C;  4MS2 A;  3E8B A;  4ZKI A;  1K5S A;  3RVY A;  5LGT A;  2BOB C;  3LDC A;  2IJJ A;  1P4R A;  2Z5U A;  4QE7 A;  3X2Q C;  2WAM A;  1SER A;  2V7Q G;  3QO8 A;  1W0K G;  2WLM A;  1G4Y B;  1XL4 A;  5B1A C;  3T4Z A;  3ZMS A;  2P67 A;  1Q81 W;  4P9O A;  1COW G;  4Z1M G;  1K8A W;  4TWK A;  2XAS A;  1S72 V;  1QBZ A;  1QVG U;  3OM3 B;  4QE9 A;  4RQF A;  3G6E V;  4G2K A;  1VQN V;  1MG1 A;  3AG3 C;  4MW8 A;  2JEU A;  1LNQ A;  1S3J A;  1K73 W;  2DYS B;  1YJW V;  2IU0 A;  5KUK A;  4MVS A;  3E8H A;  3ZN1 A;  2WLJ A;  1YSC A;  3SPI A;  1NR1 A;  4MVM A;  3ML0 A;  4UVA A;  2BOC C;  2EIJ C;  3CP1 A;  3CD6 V;  2EIM B;  1BHB A;  1M57 B;  1QLE C;  5J9P C;  3H01 A;  1DF5 A;  2XOK G;  3DTU B;  3E2E A;  4QIW F;  4MTO A;  1OCR C;  3AG1 C;  3SPH A;  5LHH A;  2C2A A;  3ZMZ A;  2ATK C;  1JQ0 A;  1VQK V;  3ZJZ A;  3ZMU A;  5CBF A;  1KC8 W;  4JGS A;  4WFG A;  1CP9 A;  3NXS A;  4XDL A;  3F7Y C;  3GWO A;  2XAG A;  5GW7 A;  3LDE A;  1K4C C;  1MSW D;  5EK0 A;  4GX1 A;  3OMA B;  4MVR A;  3ZCC A;  2Y69 C;  1VQP V;  1VQ7 V;  3OW2 U;  1OCZ B;  2OTJ V;  2HFE C;  1R3L C;  4PA4 A;  4UV8 A;  2WLH A;  3FYE B;  3AG2 C;  3ABK C;  3HPL C;  3ETD A;  1Q86 W;  4CZZ A;  3WG7 B;  1EBO A;  2ITC C;  1PNK A;  2HR3 A;  5DM6 V;  4JTA B;  5B3S B;  1AI5 A;  4MVZ A;  1DLB A;  1R6N A;  2F43 G;  4JPR A;  1YJ9 V;  2XAJ A;  1OHH G;  2W0F C;  3E35 A;  2WLN A;  4GX5 A;  1PNL A;  2LFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...