1M1KW

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m1kW00
1VQ6V 1QVFU 1VQLV 1K9MW 3CMEV 1YI2V 3CC2V 3CD6V 1JJ2U 3I55V 4WF9V 1YJ9V 3CMAV 1M1KW 3CCUV 1VQPV 2D3OW 1K8AW 3OW2U 1NJIW 1M90W 1VQ5V 3CCLV 3CCEV 3CCQV 1VQOV 4WCEV 1VQMV 2QA4V 1S72V 1W2BU 1Q7YW 1KD1W 3CPWU 2QEXV 3CCSV 4WFAV 5DM6V 3CXCU 1YJWV 1YIJV 1VQ4V 3G6EV 1VQ7V 1N8RW 1VQ8V 1VQ9V 1Q86W 1YHQV 1KC8W 1QVGU 3G71V 1VQNV 1R73A 3I56V 3CC4V 3CCRV 3CC7V 1YJNV 3CCVV 1K73W 1KQSU 4WFBV 1VQKV 1YITV 3CCMV 1Q82W 2OTLV 2OTJV 3G4SV 1Q81W 3CCJV
chains in the Genus database with same CATH superfamily
1XUQA 5IJ9A 3D36A 2WLKA 2WLNA 5CBGA 2XNDG 1FKAO 3ETGA 3JARB 1R3IC 2IJHA 1GH6A 2P90A 1Q6IA 5C8YA 2FL4A 2BTQA 1BT8A 2P67A 1SQXH 1H2LA 1QR9A 4LFBO 1N4CA 1Y74B 1XNRO 1OCRB 3ZS8C 3ABLB 2XTAA 1KP2A 4IGGA 3VBBA 2W6JG 4BIUA 3S3XA 1KMIZ 3ZCCA 2XASA 2MW2B 3I55V 4DR7B 1Q43A 1KUQA 1Q5OA 1Z2GA 4X66O 2PZSA 4GCZA 2X6CA 2XHBA 5H5NA 2QM7A 1DK1A 4ZI7B 2BSKB 4YXWG 3J81N 3ICXA 1YXBA 4U3JA 3GWKC 3RYCB 4X1KB 1MSDA 4R7CA 3DC6A 1CEZA 1NU1H 3S3WA 1B04A 2XAQA 2Q67A 2ZR3A 3W7SA 3ZMTA 4UFZA 3EFFK 1MOFA 4X1YA 1PPJH 3H1KH 4JF3A 3UT5B 1GN2A 1SF9A 2QWRB 4RWUA 3VQXA 5BMVB 4Q6GA 1YJNV 2OTJV 1AR5A 4I0XA 1EZJA 3ZMSA 3CMEV 5LYJA 2DYSB 1O9HA 3FB5C 1EZVH 3CCLV 4JI4B 4JI3B 1AI4A 4B7KA 1THZA 2Y0PA 3ETDA 3HKEB 5J2UB 3JAWB 2EILB 2A0LA 1JA8A 4TUYA 4TV9B 5L3CA 4DW1A 2K1EA 3BFRA 4JYBA 5E79Z 1NJIW 2QE7G 1M56B 1HNZB 5BXZA 3K9SA 4R8CA 1VIBA 4X64B 1I08A 2WLLB 2IU3A 1XMOB 4X89A 1NI8A 3IJ4A 1LNQA 3JD2A 1RP3B 1VF7A 4WBNB 1K4DC 3T2MA 3ABKC 1YJ9V 2ITDC 3CSXA 3ZBHA 1N36B 2BCCH 4IHJA 1VF5B 2R9IA 4G27B 1W2BU 2Q6AA 1HNWB 1WNSA 3FKSG 1UFIA 1Z5WA 5KHKA 3HKBB 1GMGA 1GO3F 2YEVB 3QO7A 2AHYA 3AG4B 4K8XA 4MVUA 4TQDA 2R70A 4UXNA 1A32A 1EN5A 3HB3B 4OPHA 5A9GA 3VQYA 3C3SA 2VWJA 2A79B 3E8HA 4UCTA 2X7RB 2E76B 5D5PA 2Q9LA 1E1RG 5LA6B 1QLNA 1PM9A 2EULA 4MTXA 1UJWB 4DV5B 3CD6V 1SQQH 1JJ2U 3HKCA 2VS0A 4K8ZA 5CA1B 3ASOC 4PDRA 1P7BA 1SS3A 4O4HB 1COWG 3QTCA 4LNUB 3MAQA 1Q82W 1QU7A 2W0FC 5IYZB 1SC5B 4J42A 3O9OA 3C3TA 2N04A 5JVDB 2XAFA 4ASUG 1JJOA 1SQPH 2ZM6O 4DV2B 3R66A 4JI2O 3L70H 4GX2A 5H6RA 1PNLA 2EINC 3NXSA 1Q86W 5FLXN 1MNGA 4JGSA 4JI6B 1XI1A 1BCCH 4JASA 1DF5A 2YS8A 1QCEA 4HNAB 3E8FA 5EIBC 1HW7A 2QR4A 4NTWA 4K0KO 4YHHO 2CTRA 1SESA 2R9RB 3OGIB 4C7UA 1JOYA 2Q7GA 2ZCEA 1OCRC 1US6A 4MTFA 2CH7A 3ABLC 5FL7G 5CMUA 1D5AA 2LQTA 4FLXA 1I5YA 4DV3O 2H94A 2F93B 4U7OA 4UUJC 2F23A 1GTOA 4QJFB 3BEHA 2B1IA 3A2FA 1TVKB 4HAMA 1V54B 1XEQA 3SJAC 4ZKIA 4I5SA 4J9YB 3QO8A 4YIPA 2GTSA 4B3TO 4JI7O 1U97A 1AVMA 2D2CB 3ZMVA 4DV4B 4FIPC 3OGCC 3ETEA 3E22A 3JASB 4DR2O 2GTAA 1KBHA 1ZWIC 1XL6A 4H0LB 3ZHSA 4LFAB 4JYAB 3OEHG 3TCUA 2H3OA 2XAHA 4ZHQB 3SGIA 5LMUO 2IJIA 1DF4A 4LWSA 4FFBA 2UXNA 2UUCO 3OMIB 2DYSC 1SERA 2AXTZ 1QVFU 3L9DA 2OWOA 1WA8A 4PD4F 1GM8A 4PA4A 2YIBA 3HKDA 4O2AA 4DV0O 4PDVA 1SZTA 2QA4V 3AG7A 2EILC 3A0BZ 2WAMA 2NR5A 1ROPA 5DEDA 4F6RB 3OUFA 4CS4A 1Z5VA 1FXHA 1M56C 4JI2B 4B7EA 1P49A 1L8DA 1OCOB 1FD9A 3CWBH 1KKDA 3OR7C 2ZD9A 4ZOLA 5JQGB 3CC4V 1XNQB 4UCOA 4IT5A 1D2DA 2DE0X 4FM2A 1RPRA 2YC0A 4O4LB 2E3CA 1F51A 2KKWA 4I0XB 1TUBA 2AGAA 3IC7A 1K8AW 1IVSA 4I55A 2FTKA 1LR1A 4FMTA 4GT1A 1ZL8A 3H1IH 3ZHVA 3N2GA 2HFEC 4DR1O 2QKCA 2E74B 3AG4C 4NXNO 4O4JA 1J5EB 1IBKO 2RQ6A 3ML0A 1XMQB 3CE2A 2QM8A 3K57A 1M4UA 3JSNA 3E8GA 4WFGA 1ORQC 5LP6B 3KG2A 2XT9A 4JZ2A 3U0ZA 3A8TA 4W4KA 1GKFA 1KYOF 1VARA 2K9PA 4WFAV 4JYCA 1AP6A 1BQZA 1QBZA 3ZN1A 1SKVA 3JAKA 5KA5A 4OXSA 4OGQB 1NVPB 2LO1A 1M57B 1GRJA 4JTDB 2WA4A 2A7WA 2F4VB 2UXCB 3CC2V 4P2ZA 2UU9O 3FX7A 1SA0A 3OFNG 1G8MA 4J11A 5LMUB 3BPZA 2NN4A 5LHGA 1JCHA 3DGEA 4PA9A 2N74A 2UUCB 4BAYA 4DXWA 2ZT9B 4PELA 4LR3A 2JS3A 3APQA 4DV0B 1YDXA 3L75H 2ZNJA 5KHGA 1Q3EA 3PJSK 1SRYA 2CUGA 3M7MX 1GM7A 3T1YB 5B66Z 3CCEV 4O4IB 4CH3A 3JATA 4GZRB 4N23A 4BW5A 4DR7O 3CJHA 1N33B 2KSDA 5AG2A 2ATKC 2P22C 1YVWA 4OX9O 4FLYA 3RVYA 3FAVA 2RCVA 3AK3A 3JD4A 1FXKB 5B1BB 3OW2U 4Z1VA 4DR5B 4YJ3A 3TGUH 3RYIB 3FFQA 4I50A 3CRAA 4X1IB 5B1AB 4X20B 1K7DA 1FFXB 3LSQA 3DTUB 4DUYB 3HKCB 3RT3C 2E5LB 2YDEA 1K5QA 1R6TA 2W0XA 5GTIZ 5H6QA 1NT2B 2M6YA 1PP9H 5KX5B 4RQFA 3RVZA 1N32B 4F6EA 5E1AC 4DR4B 5KMGA 2VQFB 5L3GA 3JALA 2HJFC 4GLXA 1WB7A 2UXBB 2P6JA 1V54C 3F7VC 5KHIA 2R9AA 3CPWU 3IGAC 1S3JA 2PUSA 5J2TA 4QE9A 3X2QB 2Y48A 5LHHA 3NR7A 4IIJA 4QIWF 1VQ6V 5KHHA 3OR6C 2Q0AA 4UVAA 2DWDC 4TV8B 1VQPV 2Z3YA 4UCVA 1VQ4V 1V55B 5LOVA 1ZX3A 3GB7C 2QWOB 1OZ0A 1FAFA 3LSSA 1F4NA 4X64O 1FXVA 1XHXA 5FPRA 3LDDA 1XMOO 3E8BA 1KU9A 4I4TB 3RFRA 5EK0A 2EZOA 5CB4A 4JV5B 4TWKA 4JZGA 5IJ0A 4QPKA 2YIAA 1OHHG 4DYLA 4UV9A 1N36O 4EB6A 3JYCA 1HNWO 5TISZ 1OCOC 4LH7A 5H2FZ 4J7KA 4LF4B 2ZDIC 2OIGA 1MG1A 4Z1MG 3RYHB 4OX9B 1S72V 4DRXA 4JTAB 2ZQMA 3MHSC 3SYQA 1S0VA 4FJCC 1YJWV 4NYKA 1RFYA 3TK1A 5JJEB 2XAGA 4UVCA 1PNMA 3BA8A 2YXHA 5IYBO 4LC1A 1IBMB 2FMLA 5JCOC 2JGUA 5C93A 3LDEA 2CDYA 1R3LC 4G28B 3RGBA 4ABMA 2L6LA 3TETA 1WA8B 4DV5O 4I9QA 3RWRD 1TA8A 4B3SB 2PI4A 4GYCB 5JH7A 1XILA 4D7TA 2OCHA 2YUAA 4H13B 4GKKB 4L8JA 5K1PA 2C2AA 4DK0A 5ITZB 5LP6C 2IU0A 1MSWD 5HFMA 1FS0G 3STZC 1WB8A 4DV1O 4DO2A 4CH4A 3OD4A 4LF5B 4RUEA 1M57C 2IW5A 1JVMA 4JI0B 4DV2O 4ZOLB 1F23A 1RSOA 3PN1A 5LGUA 4DR6B 1GK9A 4JI6O 4NXMB 1KP3A 5EZYA 2Q73A 5EYPB 4FFKA 1M90W 4D7SA 4FK5C 1WP8A 4TOIA 3N27A 4D6TH 1TUBB 4I7ZB 3UM7A 2ILMA 1ZAUA 3OTOO 3DC5A 3DXRA 4LCUC 5A2QN 5BR8B 3BRCA 4K35A 1ZL8B 5KUMA 3K5MA 2CGOA 4LF9B 1SETA 1B06A 1WLEA 1WN7A 2RDCA 2YIBD 1Y76A 1R3JC 3H1HH 2CTPA 5B1OA 1G6UA 3KKYA 3ZHRA 4KHPO 2QTOA 3K08A 3CXCU 1VQ7V 3B40A 4QPJA 1FXKC 5B1BC 1E1QG 1GN6A 3AG3B 1IURA 2LFRA 3DSQA 3AG1B 2H8PC 3ZRWA 5IY5B 1XOUA 2HP8A 3P32A 5B1AC 1HR0O 4HZ3A 2XAJA 5B3SB 1NTZH 1MA1A 4DV4O 1EBOA 1YCIA 1VQ9V 2QKAA 2XOKG 2GUZB 1PL4A 3RW0A 3HR0A 1NS1A 2BTOA 1Q6HA 5LXTA 4LFAO 4JYAO 1K92A 1IDSA 2ZE8A 3T1CA 3WU2Z 3WB1A 2RMKB 2QGNA 1JFFB 5CA0B 2ZE5A 5F2VO 2W6IG 3AG2B 1WPXA 3LDCA 2EX3A 3BY6A 2UUBB 4WFHA 2QJ1A 4MVZA 4E4EA 4KL1A 2YIDA 1VQ8V 1R6NA 4A5UB 3X2QC 3N2KA 2QKSA 4KUMA 1IXBA 4FM0A 2CGNA 2ZKOA 2Q68A 2LGWA 4X62B 3OTFA 3BAAA 1BHAA 3LNMB 4BWAA 2Q0OC 4DV1B 3CCUV 2KG7A 1AB3A 3K79A 1V55C 3UKMA 1PL0A 4I50B 3T1HO 3RYFA 5DM6V 1K5SA 3P3NA 3Q4HB 5FNVB 4RO2A 2DN9A 4GX1A 1ZUQA 1XHZA 4DR3B 5CBHA 2CTQA 3ZHQA 3W7TA 1XNQO 1H2SB 3LSUA 1M1KW 4EEQA 4TQFA 1S5HC 3OTOB 4LFCB 4O2BA 1K4CC 1JPXA 3SDLA 3IAYA 1FYJA 4H33A 1H2GA 3UO3A 3G71V 5IDJA 4X65O 3BABA 2JGDB 3EHBB 3ETQA 5J2TB 4KHPB 4MS2A 4FLVA 2Q8VA 3U10A 1J5EO 1AJQA 4B3RB 1AI7A 2P06A 3B2EE 1XQ8A 1XMQO 3JCZA 2AZ0A 1MZEA 1ZLZA 3QVNA 3SPIA 3P30A 2Q5ZA 3A0HZ 4MVRA 2PGGA 1HR0B 1B6QA 3JARA 1HWYA 1KB9F 3T4ZA 4DV6B 4CC6A 1OV9A 2Y4TA 2B9ZA 1Y74A 3B77A 1NH2D 1M93A 5IJ9B 3UO2A 2F4VO 2ZXWB 2UXCO 2QWQB 5C8YB 1R73A 4JI1B 2BTQB 2NLJC 4MW8A 5IJ0B 1NR1A 3H01A 5JWPA 4CH6A 2QM4A 1VQLV 1MMMA 1UPGA 2PY5A 4PA7A 5GTHZ 1O9GA 4ZI7A 3BCCH 2PYJA 5LBQA 2ZNIA 3ASNB 3RYCA 3ABMB 4X1KA 2HKOA 5BZBA 4CS3A 3T1YO 3J80N 3GWOA 2A3QA 1G1XB 3G6BA 5DN6G 4L87A 3CRQA 1N33O 4YY3B 3JD3A 3T1HB 4MSWC 2A06H 4U3JB 3SPHA 2HJDA 3SPGA 3CCQV 4DR5O 1KD1W 3M8AA 4ZIBA 5BMVA 4YJ2A 2KB1A 4X1YB 4JAAA 3F5TA 4DUYO 2E5LO 1KQSU 5GONA 1YTFD 1N32O 4I9WA 3G67A 1LUWA 4EKWA 3L72H 3W7UA 4EFBA 1VQ5V 1QLEB 1HDJA 3K5NA 4DR4O 1HP8A 2VQFO 3ZJZA 3E2EA 4X65B 1YSCA 5LYJB 3AG3C 3HKEA 3JAWA 4U7NA 2UXBO 4JYYA 3AG1C 2RJZA 5IY5C 1XL4A 4TV9A 2N05A 1VP7A 3K0DA 2VWKA 3E89A 4TSFG 4XDJA 5B3SC 5CA3A 4X8AA 5B1NA 2DJVA 3CMAV 1RSOB 1EN6A 2WLLA 2P4KA 1M5IA 1I94B 4TUYB 1SQBH 5EZYB 4ZBMA 1AR4A 2CAZC 2IJJA 4WBNA 4U3FH 1W59A 1X59A 2YI8A 1MABG 3C90A 3AG2C 4ICGA 5JJJB 1SQGA 4EFEA 3MHHC 2IM9A 2WLJA 3B8MA 2BOCC 1G4YB 3H1LH 2DOSA 1BHBA 1N34B 3HKBA 2Q7EA 4CC5A 3U11A 3FYIB 1SQFA 4JAUA 3G6EV 2UXDB 1IBLB 2DWEC 2LW1A 4IHJB 5EC2C 3SYCA 1P7GA 5L3DA 3BHPA 2EIMB 3JAMN 3MDSA 1BMFG 4JV5O 1BL8A 3VQWA 1B3QA 4CZZA 1JMKC 2OCCB 3VOUA 2QDOA 2JS5A 4CS2A 4Z2WA 1S5JA 1H2KA 4MVOA 4B3MB 4LF4O 1JR9A 1D5NA 1K97A 4GX5A 2JEXA 4LF6O 2DQ0A 4NTXA 5EBLC 4PHZA 4K3AA 2B1GA 5EBWC 1Q81W 5CA1A 1CPYA 2F95B 1T5EA 1BZKA 3IC9A 2F1MA 3UQ8A 4FLWA 4O4HA 3B8NA 4MTOA 1IBMO 2ZR2A 4LNUA 4X9QA 3L74H 4LBEC 1VF6C 4NKGB 1QR8A 4F4LA 4WFBV 2KQXA 5EBMC 5JVDA 4CBCA 3CHXA 2LJ2A 5KUKA 1DGSA 4B3SO 3F7YC 4P30A 2ARHA 1HNXB 2WLHA 2VQEB 4PDLA 3CX5F 1RM1B 2L35A 4KP4A 4GKKO 1EFRG 3SPCA 4UCSA 4HNAA 4LF7O 3BVOA 1BQ0A 1N0NA 3OMAB 1YZBA 2JJ2G 1I0HA 2ADQB 4NR1A 1TGOA 1SZXA 4LF5O 4G2KA 2HHHB 3D36C 2M7WA 4JI0O 2ODMA 2ZXWC 2ITCC 2Q69A 1R1BA 4HBNA 4AILC 2AW9A 4DR6O 4O2BB 4NXMO 2WPDG 1WJZA 1PKXA 3OM3B 4MVMA 2CH7B 4FVMA 1IX9A 3CCJV 1KECA 2LP7A 5BR8O 4NB5A 1QHTA 1DLBA 3CRCA 2IH3C 3ASNC 1PNKA 3ABMC 3SJBC 4LF9O 4BIZA 3WB0A 1W0KG 4AQYB 5L3FA 4UB6Z 2V1DA 3FD9A 1AJNA 1FJGB 1OCCB 3JASA 3VQVA 5IWAB 3O65A 3JD0A 1XBLA 1JX9A 2HEPA 5L3EA 4YIOA 3ZRSA 1RPOA 3ZHTA 4LF6B 1EN4A 4ZHQA 3ZX6A 2E75B 3QO5A 4PA3A 3TXSA 4AI8A 3E22B 5J9PC 3ZIAG 1YHQV 2HVJC 1V9PA 1AI5A 2X0LA 1NTKH 2GHYA 1VQKV 1YF2A 4LWSB 4XBFA 1QLEC 4FFBB 4IYHA 3SR2C 2YICA 2Z5UA 2EBOA 3K58A 4DUZB 2R72A 3K5OA 3HKDB 3FYEB 4JI5B 3QG5A 4O2AB 4F6RA 2UUBO 2CK3G 2HG5C 3CCRV 3H9VA 2F43G 3JCUZ 2ZDIA 2CE4A 3ABTA 2JIZG 4PI2A 1AP5A 4LF7B 4X62O 5LMNO 4RUFA 2YSUB 5JQGA 2WLIA 3E86A 4J7ZA 2GV9A 1S5LZ 1KC8W 4PA6A 5B5EZ 5EIBD 4O4LA 4YJ2B 5KAIZ 4PJ0Z 5JCOA 4RAIA 4UVBA 4R6ZA 2ADPA 5GONB 3KCXA 4PI0A 2JDIG 1EM1A 4DR3O 1H8EG 1BE3H 3CCSV 1BGYH 2RNBA 2EIMC 4JI8B 3LUTB 4XDLA 3AK1A 4I55B 3ZMUA 1CXZB 1I5XA 1DTOA 4LFCO 2PTMA 1Q90D 1Y6XA 3K0GA 4B08A 3N2GB 2OCCC 1H2NA 4GKJB 3ZRXA 5LP6A 1YI2V 2QWNB 4NVPA 4O4JB 2UUAB 4W4LA 2Y0IA 3FB6C 1Q7YW 1OCZB 1R6KA 4LH6A 3E83A 2JJ1G 3I56V 2JK5C 3WG7B 4B3RO 3K03A 1WPBA 2FKXA 4TT3G 1E79G 3JAKB 4XDKA 5L3BA 1K9MW 3SYOA 4FLUA 4LFBB 4H37A 1XNRB 1N0JA 5FPOA 2EIKC 5KAFZ 2WWWA 4DV6O 1SA0B 1Q8IA 1Y67A 2ZIOA 3CXHF 2Y69B 2HR3A 3K04A 3RN4A 5BY1A 4X66B 1KKCA 4O4IA 4JI1O 1RM1C 3K3WA 3EVKA 3J7AU 3CEIA 2QTSA 3B4SA 1L1FA 1FXKA 1IXMA 3D8CA 2EIJB 3JATB 3RYIA 3CJHB 3LNNA 4GX0A 1L0LH 3ZHUA 5LMNB 4X1IA 4X20A 3FAVB 1FFXA 2EZPA 2F66C 1XREA 3TJTA 5H9CA 4YJ3B 5KX5A 2JVDA 3ZEDA 2DQ3A 2ETNA 4YY3O 2PI5A 2BE3A 1OJHA 3JSLA 3K06A 1NH2B 1ENVA 2RN9A 3THOA 4J10A 2LW7A 5KMGB 2QWPB 3JALB 1J95A 2JEUA 3IFXA 2FB5A 3ZMZA 2YXYA 1YEWA 1PV0A 1F7YA 1OCCC 4MVQA 4J41A 3L73H 3JD1A 4TV8A 1NZ6A 5DECA 1NBMG 3OMNB 4IIJB 4MVSA 4Q20A 5IYCO 5CBFA 2HVKC 3RBZA 1P4RA 3MD0A 3CC7V 1I94O 1NTMH 5LOVB 4FM1A 4WFFA 4I4TA 3AEIA 4LF8O 1U96A 3E35A 5KLVH 1TUEB 2A9HA 2D3OW 4UB8Z 1BS3A 2JRIA 1WP7A 1FFTB 2QSAA 5K1XA 2ZINA 3BA9A 1S76D 1YTFB 1QVGU 3KZIZ 5CB4B 4JPRA 5IYDO 1TAEA 1N34O 1P84F 4IL6Z 2AZ2A 3RYHA 4CH5A 2UXDO 1IBLO 4EB6B 3K9AA 3I5DA 2ZE7A 3QF7A 1WAZA 2DYRB 3D3IA 2BSKA 1H8HG 3SYAA 4BR6A 3AK2A 3ABUA 1URFA 5KA6A 4DRXB 3SJCC 3P3PA 3CRMA 4B3MO 1GN4A 2G38A 3CB2A 4DV7O 3M99B 3UT5A 3R65A 1VQOV 2QEXV 2FYUH 4KXRA 5JJNB 1N8RW 3OUSA 2B5UA 2Y4UA 5D5QA 1XDCA 4N21A 2X6BA 2GSMB 3CYOA 1Y4MA 5ITZA 3CCMV 2ZM6B 3EXAA 1SQVH 5JH7B 4R50A 4BW9A 1OCZC 1VQMV 3CP1A 3WG7C 1GM9A 5CN0A 1LUVA 5J2UA 1AJPA 2Q4PA 2V7QG 4FZ1A 4GUNA 2WLIB 2VQEO 1HNXO 3ZN0A 3SPJA 4RQEA 4YHHB 4K0KB 5GW7A 3UCSC 1AROP 4UV8A 5EYPA 4BIOA 4FLTA 3OT7A 4WFEA 3A0RA 3OEEG 2IH1C 2YXLA 3L71H 2XUMA 4JAVA 4HYOA 3QNEA 1AILA 3STLC 1R3KC 1FPOA 4DV3B 1NKDA 4LP8A 2HHHO 4QGPA 2Y69C 4OPAA 2EJRA 4PV1B 1H38A 4LF8B 4UCRA 2BOBC 1F4MA 3G4SV 3DXRB 2ZE6A 2OIEA 2P5OA 4B3TB 2OYQA 4JI7B 2PYLA 1Y76B 2EIJC 5IT9N 1YIJV 2YEVA 3F5WC 4P9OA 2DMXA 4H44B 3T4DA 3D3QA 2PF4E 4J80A 4DR2B 2OTLV 1AI6A 2YI9A 2HLDG 2AHZA 4AQYO 1K34A 3ZRWB 3K59A 1FJGO 2GUZA 4AHCA 1ZSPA 5IWAO 1Q6UA 2OT5A 4MTGA 1S77D 2WA3A 3CS5A 5LA6A 1BSMA 3GVMA 1K3EA 1JFFA 1K33A 5CA0A 1QNMA 1K73W 4DV7B 2ZIMA 3SJQC 2Q7HA 2X6AA 5LXTB 3WB2A 4MW3A 3CRRA 1GAXA 3ABKB 2P7TC 3B09A 4KFMA 4FPPA 1ZTEA 2EIKB 1QQCA 5LGTA 2V4DA 5IYZA 4FLZA 4IYIA 4PDMA 4DUZO 4P9PA 2MK3A 3H1JH 1VMGA 4JI5O 3N2KB 1W0JG 5IE9A 4J7JA 3Q4HA 5FNVA 1NVPD 3HPLC 3G80A 2WLMA 2IJKA 3K5LA 2KG7B 1M9NA 3WFVA 1JQ0A 2WSSG 2DW4A 1CP9A 3RYFB 1NQTA 2GDSA 3APOA 5LGNA 1X4TA 2LGQA 3CCVV 5LHIA 4WF9V 4JTCB 2GBOA 3ZRVA 2O57A 4DR1B 3SYPA 2P4VA 1VQNV 4NXNB 1IZ3A 1PD3A 4WCEV 5EC1C 3FB7C 1IBKB 2JGDA 3OAAG 3ASOB 1VF6A 5HFLA 4E2LA 4JI4O 3W7WA 2IBZH 4JI3O 4QE7A 2EJ7A 3W7XA 4X88A 1I7FA 4JI8O 1VEWA 2DYRC 1L0NH 1MZFA 4UCUA 1TVKA 5LL6Y 3FB8C 1AR1B 4QNHB 4J9ZB 1NR7A 2LFSA 4GKJO 4DK1A 3TXQA 3OE7G 1H2MA 3KCYA 4MT8A 2NNUA 2UUAO 1GN3A 4DW0A 2VRZA 1HNZO 2UU9B 2Z0AA 2UXXA 2EINB 4FZ0A 2CTWA 1YITV 1Y66A 4NTYA 5KHJA
chains in the Genus database with same CATH topology
4TT3G 4JTDB 3T4ZA 3D36A 1E79G 4XDKA 5L3BA 1K9MW 3SYOA 3CC2V 2WLKA 4P2ZA 4H37A 2WLNA 5CBGA 2EIKC 2XNDG 3OFNG 1G8MA 3B77A 3ETGA 1R3IC 1NH2D 2IJHA 2P90A 5LHGA 2WWWA 1JCHA 2P67A 3DGEA 1QR9A 2ZXWB 4PA9A 4BAYA 4DXWA 1OCRB 1R73A 3ABLB 2NLJC 4MW8A 1KP2A 2HR3A 2Y69B 1NR1A 3K04A 4PELA 3H01A 3VBBA 2W6JG 4BIUA 3ZCCA 1VQLV 2XASA 1RM1C 3I55V 3K3WA 3PJSK 1SRYA 4PA7A 1GM7A 4GCZA 3CCEV 2X6CA 2QM7A 4N23A 5LBQA 1L1FA 4BW5A 3ASNB 1FXKA 1IXMA 2ATKC 3ABMB 2HKOA 4YXWG 2EIJB 5BZBA 3RVYA 3GWOA 4GX0A 3JD4A 1FXKB 5DN6G 5B1BB 4L87A 3OW2U 4R7CA 1CEZA 3JD3A 2EZPA 4MSWC 2XAQA 2Q67A 3SPHA 2ZR3A 3W7SA 3ZMTA 3EFFK 5H9CA 1MOFA 5B1AB 1K7DA 3SPGA 3LSQA 3DTUB 3CCQV 1KD1W 2DQ3A 4JF3A 1K5QA 2KB1A 2PI5A 5H6QA 4RQFA 3RVZA 3K06A 1NH2B 5E1AC 1YJNV 1KQSU 1ENVA 2OTJV 5L3GA 1EZJA 3ZMSA 2HJFC 1YTFD 3CMEV 4I9WA 4EKWA 3W7UA 2DYSB 1VQ5V 1QLEB 2P6JA 1V54C 3FB5C 3F7VC 1J95A 2JEUA 3CCLV 3IFXA 3ZJZA 3E2EA 3CPWU 3ZMZA 1YSCA 3AG3C 1AI4A 3IGAC 4U7NA 1S3JA 3AG1C 1OCCC 5IY5C 4MVQA 1XL4A 1THZA 4QE9A 3ETDA 3X2QB 2Y48A 3JD1A 5LHHA 2EILB 4QIWF 3K0DA 3E89A 1VQ6V 4TSFG 4XDJA 2A0LA 5B3SC 5CA3A 4X8AA 1NBMG 3OMNB 3OR6C 5B1NA 4MVSA 4UVAA 2DWDC 4Q20A 2K1EA 5L3CA 4JYBA 3CMAV 1VQPV 1NJIW 2QE7G 2WLLA 1M56B 5IYCO 5CBFA 2Z3YA 4R8CA 4ZBMA 2HVKC 1VQ4V 1V55B 3RBZA 2WLLB 3GB7C 2IJJA 2IU3A 1P4RA 3MD0A 4X89A 3CC7V 1OZ0A 3LSSA 1F4NA 1LNQA 3JD2A 1FXVA 1MABG 4WFFA 1K4DC 3AG2C 3AEIA 3T2MA 3MHHC 3ABKC 3LDDA 2WLJA 3B8MA 3E35A 2BOCC 1TUEB 2A9HA 3E8BA 1G4YB 2ITDC 1YJ9V 2D3OW 1BHBA 1FFTB 2R9IA 4G27B 5EK0A 2EZOA 1W2BU 2Q6AA 4TWKA 3FYIB 1S76D 4JAUA 3G6EV 4QPKA 2DWEC 1YTFB 3FKSG 5EC2C 1QVGU 1OHHG 3SYCA 1GMGA 4UV9A 4JPRA 5L3DA 5IYDO 2EIMB 1GO3F 2YEVB 3QO7A 1BMFG 3JYCA 2AHYA 3AG4B 1BL8A 1OCOC 3K9AA 4CZZA 4MVUA 2ZDIC 2OCCB 4UXNA 1MG1A 3VOUA 4Z1MG 3HB3B 2DYRB 3D3IA 4MVOA 1S72V 4JTAB 1H8HG 2ZQMA 3MHSC 3SYAA 3SYQA 4FJCC 1S0VA 1YJWV 3ABUA 3TK1A 2A79B 2XAGA 4GX5A 1K97A 3E8HA 2JEXA 4UVCA 2X7RB 5KA6A 1PNMA 2DQ0A 5IYBO 5EBLC 4LC1A 1E1RG 1QLNA 5EBWC 2B1GA 1Q81W 4MTXA 1UJWB 1CPYA 5C93A 3LDEA 3CD6V 1JJ2U 1R3LC 4G28B 3M99B 3B8NA 4MTOA 3TETA 2ZR2A 3R65A 3ASOC 1VQOV 4PDRA 2QEXV 1P7BA 1N8RW 3OUSA 4LBEC 2B5UA 1COWG 4N21A 2X6BA 2PI4A 2GSMB 3CYOA 1Y4MA 1QR8A 4F4LA 4WFBV 5EBMC 1Q82W 3CCMV 4CBCA 2W0FC 5KUKA 2C2AA 3F7YC 4P30A 4R50A 2IU0A 1MSWD 2XAFA 5HFMA 1FS0G 1OCZC 2WLHA 4ASUG 4PDLA 3STZC 1RM1B 4KP4A 1VQMV 3CP1A 4GX2A 3WG7C 1EFRG 1GM9A 5H6RA 5CN0A 4DO2A 1PNLA 3SPCA 2EINC 3NXSA 1Q86W 1AJPA 2V7QG 2WLIB 4RUEA 4JGSA 1M57C 2IW5A 3SPJA 3ZN0A 3OMAB 4JASA 1JVMA 4RQEA 1DF5A 2JJ2G 5GW7A 1QCEA 1AROP 4UV8A 3E8FA 1F23A 4G2KA 4WFEA 3A0RA 5LGUA 1GK9A 3OEEG 1KP3A 2M7WA 2IH1C 2ZXWC 1M90W 2ITCC 1SESA 2Q69A 2R9RB 4HYOA 4FK5C 3QNEA 4JAVA 1JOYA 3STLC 1OCRC 1R3KC 1NKDA 4LP8A 4MTFA 3ABLC 5FL7G 3UM7A 2Y69C 5CMUA 2WPDG 1PKXA 3OM3B 2EJRA 4MVMA 4LCUC 1H38A 1I5YA 5KUMA 2BOBC 1F4MA 2H94A 3G4SV 3CCJV 1SETA 1WLEA 4UUJC 1KECA 4U7OA 1GTOA 1R3JC 2LP7A 5B1OA 4QJFB 1DLBA 2IH3C 3ASNC 1PNKA 3ABMC 3BEHA 4BIZA 2B1IA 2QTOA 2EIJC 3K08A 4HAMA 3CXCU 1YIJV 1V54B 1W0KG 2YEVA 1VQ7V 4ZKIA 3F5WC 4I5SA 3QO8A 4J9YB 4P9OA 1FXKC 4QPJA 5B1BC 1E1QG 5L3FA 3T4DA 3AG3B 2V1DA 2LFRA 1AJNA 3AG1B 1OCCB 1AI6A 2H8PC 3ZRWA 2OTLV 5IY5B 2HLDG 3ZMVA 4FIPC 2AHZA 3P32A 3OGCC 5B1AC 3ETEA 3JD0A 1K34A 5L3EA 1JX9A 3ZRWB 3ZRSA 1RPOA 4HZ3A 2XAJA 5B3SB 3QO5A 1ZWIC 1XL6A 4PA3A 3OEHG 3TCUA 2XAHA 2OT5A 1EBOA 3ZIAG 5J9PC 4MTGA 1VQ9V 1S77D 1YHQV 2XOKG 2IJIA 1DF4A 3RW0A 1K3EA 2HVJC 1K33A 1AI5A 2X0LA 1K73W 1K92A 2GHYA 2UXNA 1VQKV 3OMIB 3T1CA 3SJQC 4XBFA 2DYSC 1SERA 1QVFU 1QLEC 2X6AA 4MW3A 2W6IG 1GM8A 3AG2B 1WPXA 3LDCA 3BY6A 4PA4A 4WFHA 4PDVA 1SZTA 2Z5UA 3ABKB 4MVZA 2EBOA 2P7TC 2QA4V 4KFMA 4FPPA 2EIKB 1VQ8V 1R6NA 3FYEB 3X2QC 2EILC 5LGTA 2QKSA 2CK3G 2WAMA 4KUMA 2HG5C 2Q68A 3CCRV 2F43G 4PDMA 1ROPA 4P9PA 2MK3A 3OUFA 1BHAA 3LNMB 1W0JG 1FXHA 2ZDIA 1M56C 3ABTA 2JIZG 1OCOB 3CCUV 4RUFA 1NVPD 3K79A 1V55C 2YSUB 3UKMA 1PL0A 3HPLC 2WLIA 3E86A 2WLMA 2IJKA 1K5SA 5DM6V 1KKDA 1M9NA 3OR7C 3WFVA 1JQ0A 2ZD9A 2WSSG 1KC8W 4PA6A 4RO2A 2DW4A 4GX1A 3CC4V 1CP9A 1NQTA 5LGNA 3CCVV 1RPRA 5LHIA 4RAIA 5CBHA 4UVBA 1F51A 4R6ZA 3W7TA 4WF9V 4JTCB 1M1KW 3ZRVA 3IC7A 1K8AW 2JDIG 1S5HC 2FTKA 1H8EG 3SYPA 1VQNV 1PD3A 4WCEV 1K4CC 5EC1C 3FB7C 4FMTA 1JPXA 3CCSV 3OAAG 4GT1A 2EIMC 3LUTB 4H33A 4XDLA 1H2GA 3ASOB 5HFLA 2HFEC 3ZMUA 4E2LA 3G71V 1I5XA 1DTOA 5IDJA 3AG4C 3W7WA 3K0GA 4QE7A 3EHBB 2OCCC 3W7XA 4X88A 3ML0A 3ZRXA 2DYRC 4MS2A 1YI2V 2QM8A 3FB8C 1AR1B 4QNHB 4J9ZB 1AJQA 3E8GA 1NR7A 1AI7A 1ORQC 2LFSA 3FB6C 3KG2A 4WFGA 1Q7YW 3OE7G 1GKFA 4WFAV 1OCZB 1R6KA 3JCZA 4JYCA 3E83A 4MT8A 1QBZA 2JJ1G 2NNUA 3SPIA 3ZN1A 3P30A 3I56V 2JK5C 3WG7B 5KA5A 2UXXA 3K03A 4MVRA 2EINB 4OXSA 1NVPB 1YITV 1Y66A 1B6QA 1M57B 1HWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 V;  1QVF U;  1VQL V;  1K9M W;  3CME V;  1YI2 V;  3CC2 V;  3CD6 V;  1JJ2 U;  3I55 V;  4WF9 V;  1YJ9 V;  3CMA V;  1M1K W;  3CCU V;  1VQP V;  2D3O W;  1K8A W;  3OW2 U;  1NJI W;  1M90 W;  1VQ5 V;  3CCL V;  3CCE V;  3CCQ V;  1VQO V;  4WCE V;  1VQM V;  2QA4 V;  1S72 V;  1W2B U;  1Q7Y W;  1KD1 W;  3CPW U;  2QEX V;  3CCS V;  4WFA V;  5DM6 V;  3CXC U;  1YJW V;  1YIJ V;  1VQ4 V;  3G6E V;  1VQ7 V;  1N8R W;  1VQ8 V;  1VQ9 V;  1Q86 W;  1YHQ V;  1KC8 W;  1QVG U;  3G71 V;  1VQN V;  1R73 A;  3I56 V;  3CC4 V;  3CCR V;  3CC7 V;  1YJN V;  3CCV V;  1K73 W;  1KQS U;  4WFB V;  1VQK V;  1YIT V;  3CCM V;  1Q82 W;  2OTL V;  2OTJ V;  3G4S V;  1Q81 W;  3CCJ V; 
#chains in the Genus database with same CATH topology
 1XUQ A;  5IJ9 A;  3D36 A;  2WLK A;  2WLN A;  5CBG A;  2XND G;  1FKA O;  3ETG A;  3JAR B;  1R3I C;  2IJH A;  1GH6 A;  2P90 A;  1Q6I A;  5C8Y A;  2FL4 A;  2BTQ A;  1BT8 A;  2P67 A;  1SQX H;  1H2L A;  1QR9 A;  4LFB O;  1N4C A;  1Y74 B;  1XNR O;  1OCR B;  3ZS8 C;  3ABL B;  2XTA A;  1KP2 A;  4IGG A;  3VBB A;  2W6J G;  4BIU A;  3S3X A;  1KMI Z;  3ZCC A;  2XAS A;  2MW2 B;  3I55 V;  4DR7 B;  1Q43 A;  1KUQ A;  1Q5O A;  1Z2G A;  4X66 O;  2PZS A;  4GCZ A;  2X6C A;  2XHB A;  5H5N A;  2QM7 A;  1DK1 A;  4ZI7 B;  2BSK B;  4YXW G;  3J81 N;  3ICX A;  1YXB A;  4U3J A;  3GWK C;  3RYC B;  4X1K B;  1MSD A;  4R7C A;  3DC6 A;  1CEZ A;  1NU1 H;  3S3W A;  1B04 A;  2XAQ A;  2Q67 A;  2ZR3 A;  3W7S A;  3ZMT A;  4UFZ A;  3EFF K;  1MOF A;  4X1Y A;  1PPJ H;  3H1K H;  4JF3 A;  3UT5 B;  1GN2 A;  1SF9 A;  2QWR B;  4RWU A;  3VQX A;  5BMV B;  4Q6G A;  1YJN V;  2OTJ V;  1AR5 A;  4I0X A;  1EZJ A;  3ZMS A;  3CME V;  5LYJ A;  2DYS B;  1O9H A;  3FB5 C;  1EZV H;  3CCL V;  4JI4 B;  4JI3 B;  1AI4 A;  4B7K A;  1THZ A;  2Y0P A;  3ETD A;  3HKE B;  5J2U B;  3JAW B;  2EIL B;  2A0L A;  1JA8 A;  4TUY A;  4TV9 B;  5L3C A;  4DW1 A;  2K1E A;  3BFR A;  4JYB A;  5E79 Z;  1NJI W;  2QE7 G;  1M56 B;  1HNZ B;  5BXZ A;  3K9S A;  4R8C A;  1VIB A;  4X64 B;  1I08 A;  2WLL B;  2IU3 A;  1XMO B;  4X89 A;  1NI8 A;  3IJ4 A;  1LNQ A;  3JD2 A;  1RP3 B;  1VF7 A;  4WBN B;  1K4D C;  3T2M A;  3ABK C;  1YJ9 V;  2ITD C;  3CSX A;  3ZBH A;  1N36 B;  2BCC H;  4IHJ A;  1VF5 B;  2R9I A;  4G27 B;  1W2B U;  2Q6A A;  1HNW B;  1WNS A;  3FKS G;  1UFI A;  1Z5W A;  5KHK A;  3HKB B;  1GMG A;  1GO3 F;  2YEV B;  3QO7 A;  2AHY A;  3AG4 B;  4K8X A;  4MVU A;  4TQD A;  2R70 A;  4UXN A;  1A32 A;  1EN5 A;  3HB3 B;  4OPH A;  5A9G A;  3VQY A;  3C3S A;  2VWJ A;  2A79 B;  3E8H A;  4UCT A;  2X7R B;  2E76 B;  5D5P A;  2Q9L A;  1E1R G;  5LA6 B;  1QLN A;  1PM9 A;  2EUL A;  4MTX A;  1UJW B;  4DV5 B;  3CD6 V;  1SQQ H;  1JJ2 U;  3HKC A;  2VS0 A;  4K8Z A;  5CA1 B;  3ASO C;  4PDR A;  1P7B A;  1SS3 A;  4O4H B;  1COW G;  3QTC A;  4LNU B;  3MAQ A;  1Q82 W;  1QU7 A;  2W0F C;  5IYZ B;  1SC5 B;  4J42 A;  3O9O A;  3C3T A;  2N04 A;  5JVD B;  2XAF A;  4ASU G;  1JJO A;  1SQP H;  2ZM6 O;  4DV2 B;  3R66 A;  4JI2 O;  3L70 H;  4GX2 A;  5H6R A;  1PNL A;  2EIN C;  3NXS A;  1Q86 W;  5FLX N;  1MNG A;  4JGS A;  4JI6 B;  1XI1 A;  1BCC H;  4JAS A;  1DF5 A;  2YS8 A;  1QCE A;  4HNA B;  3E8F A;  5EIB C;  1HW7 A;  2QR4 A;  4NTW A;  4K0K O;  4YHH O;  2CTR A;  1SES A;  2R9R B;  3OGI B;  4C7U A;  1JOY A;  2Q7G A;  2ZCE A;  1OCR C;  1US6 A;  4MTF A;  2CH7 A;  3ABL C;  5FL7 G;  5CMU A;  1D5A A;  2LQT A;  4FLX A;  1I5Y A;  4DV3 O;  2H94 A;  2F93 B;  4U7O A;  4UUJ C;  2F23 A;  1GTO A;  4QJF B;  3BEH A;  2B1I A;  3A2F A;  1TVK B;  4HAM A;  1V54 B;  1XEQ A;  3SJA C;  4ZKI A;  4I5S A;  4J9Y B;  3QO8 A;  4YIP A;  2GTS A;  4B3T O;  4JI7 O;  1U97 A;  1AVM A;  2D2C B;  3ZMV A;  4DV4 B;  4FIP C;  3OGC C;  3ETE A;  3E22 A;  3JAS B;  4DR2 O;  2GTA A;  1KBH A;  1ZWI C;  1XL6 A;  4H0L B;  3ZHS A;  4LFA B;  4JYA B;  3OEH G;  3TCU A;  2H3O A;  2XAH A;  4ZHQ B;  3SGI A;  5LMU O;  2IJI A;  1DF4 A;  4LWS A;  4FFB A;  2UXN A;  2UUC O;  3OMI B;  2DYS C;  1SER A;  2AXT Z;  1QVF U;  3L9D A;  2OWO A;  1WA8 A;  4PD4 F;  1GM8 A;  4PA4 A;  2YIB A;  3HKD A;  4O2A A;  4DV0 O;  4PDV A;  1SZT A;  2QA4 V;  3AG7 A;  2EIL C;  3A0B Z;  2WAM A;  2NR5 A;  1ROP A;  5DED A;  4F6R B;  3OUF A;  4CS4 A;  1Z5V A;  1FXH A;  1M56 C;  4JI2 B;  4B7E A;  1P49 A;  1L8D A;  1OCO B;  1FD9 A;  3CWB H;  1KKD A;  3OR7 C;  2ZD9 A;  4ZOL A;  5JQG B;  3CC4 V;  1XNQ B;  4UCO A;  4IT5 A;  1D2D A;  2DE0 X;  4FM2 A;  1RPR A;  2YC0 A;  4O4L B;  2E3C A;  1F51 A;  2KKW A;  4I0X B;  1TUB A;  2AGA A;  3IC7 A;  1K8A W;  1IVS A;  4I55 A;  2FTK A;  1LR1 A;  4FMT A;  4GT1 A;  1ZL8 A;  3H1I H;  3ZHV A;  3N2G A;  2HFE C;  4DR1 O;  2QKC A;  2E74 B;  3AG4 C;  4NXN O;  4O4J A;  1J5E B;  1IBK O;  2RQ6 A;  3ML0 A;  1XMQ B;  3CE2 A;  2QM8 A;  3K57 A;  1M4U A;  3JSN A;  3E8G A;  4WFG A;  1ORQ C;  5LP6 B;  3KG2 A;  2XT9 A;  4JZ2 A;  3U0Z A;  3A8T A;  4W4K A;  1GKF A;  1KYO F;  1VAR A;  2K9P A;  4WFA V;  4JYC A;  1AP6 A;  1BQZ A;  1QBZ A;  3ZN1 A;  1SKV A;  3JAK A;  5KA5 A;  4OXS A;  4OGQ B;  1NVP B;  2LO1 A;  1M57 B;  1GRJ A;  4JTD B;  2WA4 A;  2A7W A;  2F4V B;  2UXC B;  3CC2 V;  4P2Z A;  2UU9 O;  3FX7 A;  1SA0 A;  3OFN G;  1G8M A;  4J11 A;  5LMU B;  3BPZ A;  2NN4 A;  5LHG A;  1JCH A;  3DGE A;  4PA9 A;  2N74 A;  2UUC B;  4BAY A;  4DXW A;  2ZT9 B;  4PEL A;  4LR3 A;  2JS3 A;  3APQ A;  4DV0 B;  1YDX A;  3L75 H;  2ZNJ A;  5KHG A;  1Q3E A;  3PJS K;  1SRY A;  2CUG A;  3M7M X;  1GM7 A;  3T1Y B;  5B66 Z;  3CCE V;  4O4I B;  4CH3 A;  3JAT A;  4GZR B;  4N23 A;  4BW5 A;  4DR7 O;  3CJH A;  1N33 B;  2KSD A;  5AG2 A;  2ATK C;  2P22 C;  1YVW A;  4OX9 O;  4FLY A;  3RVY A;  3FAV A;  2RCV A;  3AK3 A;  3JD4 A;  1FXK B;  5B1B B;  3OW2 U;  4Z1V A;  4DR5 B;  4YJ3 A;  3TGU H;  3RYI B;  3FFQ A;  4I50 A;  3CRA A;  4X1I B;  5B1A B;  4X20 B;  1K7D A;  1FFX B;  3LSQ A;  3DTU B;  4DUY B;  3HKC B;  3RT3 C;  2E5L B;  2YDE A;  1K5Q A;  1R6T A;  2W0X A;  5GTI Z;  5H6Q A;  1NT2 B;  2M6Y A;  1PP9 H;  5KX5 B;  4RQF A;  3RVZ A;  1N32 B;  4F6E A;  5E1A C;  4DR4 B;  5KMG A;  2VQF B;  5L3G A;  3JAL A;  2HJF C;  4GLX A;  1WB7 A;  2UXB B;  2P6J A;  1V54 C;  3F7V C;  5KHI A;  2R9A A;  3CPW U;  3IGA C;  1S3J A;  2PUS A;  5J2T A;  4QE9 A;  3X2Q B;  2Y48 A;  5LHH A;  3NR7 A;  4IIJ A;  4QIW F;  1VQ6 V;  5KHH A;  3OR6 C;  2Q0A A;  4UVA A;  2DWD C;  4TV8 B;  1VQP V;  2Z3Y A;  4UCV A;  1VQ4 V;  1V55 B;  5LOV A;  1ZX3 A;  3GB7 C;  2QWO B;  1OZ0 A;  1FAF A;  3LSS A;  1F4N A;  4X64 O;  1FXV A;  1XHX A;  5FPR A;  3LDD A;  1XMO O;  3E8B A;  1KU9 A;  4I4T B;  3RFR A;  5EK0 A;  2EZO A;  5CB4 A;  4JV5 B;  4TWK A;  4JZG A;  5IJ0 A;  4QPK A;  2YIA A;  1OHH G;  4DYL A;  4UV9 A;  1N36 O;  4EB6 A;  3JYC A;  1HNW O;  5TIS Z;  1OCO C;  4LH7 A;  5H2F Z;  4J7K A;  4LF4 B;  2ZDI C;  2OIG A;  1MG1 A;  4Z1M G;  3RYH B;  4OX9 B;  1S72 V;  4DRX A;  4JTA B;  2ZQM A;  3MHS C;  3SYQ A;  1S0V A;  4FJC C;  1YJW V;  4NYK A;  1RFY A;  3TK1 A;  5JJE B;  2XAG A;  4UVC A;  1PNM A;  3BA8 A;  2YXH A;  5IYB O;  4LC1 A;  1IBM B;  2FML A;  5JCO C;  2JGU A;  5C93 A;  3LDE A;  2CDY A;  1R3L C;  4G28 B;  3RGB A;  4ABM A;  2L6L A;  3TET A;  1WA8 B;  4DV5 O;  4I9Q A;  3RWR D;  1TA8 A;  4B3S B;  2PI4 A;  4GYC B;  5JH7 A;  1XIL A;  4D7T A;  2OCH A;  2YUA A;  4H13 B;  4GKK B;  4L8J A;  5K1P A;  2C2A A;  4DK0 A;  5ITZ B;  5LP6 C;  2IU0 A;  1MSW D;  5HFM A;  1FS0 G;  3STZ C;  1WB8 A;  4DV1 O;  4DO2 A;  4CH4 A;  3OD4 A;  4LF5 B;  4RUE A;  1M57 C;  2IW5 A;  1JVM A;  4JI0 B;  4DV2 O;  4ZOL B;  1F23 A;  1RSO A;  3PN1 A;  5LGU A;  4DR6 B;  1GK9 A;  4JI6 O;  4NXM B;  1KP3 A;  5EZY A;  2Q73 A;  5EYP B;  4FFK A;  1M90 W;  4D7S A;  4FK5 C;  1WP8 A;  4TOI A;  3N27 A;  4D6T H;  1TUB B;  4I7Z B;  3UM7 A;  2ILM A;  1ZAU A;  3OTO O;  3DC5 A;  3DXR A;  4LCU C;  5A2Q N;  5BR8 B;  3BRC A;  4K35 A;  1ZL8 B;  5KUM A;  3K5M A;  2CGO A;  4LF9 B;  1SET A;  1B06 A;  1WLE A;  1WN7 A;  2RDC A;  2YIB D;  1Y76 A;  1R3J C;  3H1H H;  2CTP A;  5B1O A;  1G6U A;  3KKY A;  3ZHR A;  4KHP O;  2QTO A;  3K08 A;  3CXC U;  1VQ7 V;  3B40 A;  4QPJ A;  1FXK C;  5B1B C;  1E1Q G;  1GN6 A;  3AG3 B;  1IUR A;  2LFR A;  3DSQ A;  3AG1 B;  2H8P C;  3ZRW A;  5IY5 B;  1XOU A;  2HP8 A;  3P32 A;  5B1A C;  1HR0 O;  4HZ3 A;  2XAJ A;  5B3S B;  1NTZ H;  1MA1 A;  4DV4 O;  1EBO A;  1YCI A;  1VQ9 V;  2QKA A;  2XOK G;  2GUZ B;  1PL4 A;  3RW0 A;  3HR0 A;  1NS1 A;  2BTO A;  1Q6H A;  5LXT A;  4LFA O;  4JYA O;  1K92 A;  1IDS A;  2ZE8 A;  3T1C A;  3WU2 Z;  3WB1 A;  2RMK B;  2QGN A;  1JFF B;  5CA0 B;  2ZE5 A;  5F2V O;  2W6I G;  3AG2 B;  1WPX A;  3LDC A;  2EX3 A;  3BY6 A;  2UUB B;  4WFH A;  2QJ1 A;  4MVZ A;  4E4E A;  4KL1 A;  2YID A;  1VQ8 V;  1R6N A;  4A5U B;  3X2Q C;  3N2K A;  2QKS A;  4KUM A;  1IXB A;  4FM0 A;  2CGN A;  2ZKO A;  2Q68 A;  2LGW A;  4X62 B;  3OTF A;  3BAA A;  1BHA A;  3LNM B;  4BWA A;  2Q0O C;  4DV1 B;  3CCU V;  2KG7 A;  1AB3 A;  3K79 A;  1V55 C;  3UKM A;  1PL0 A;  4I50 B;  3T1H O;  3RYF A;  5DM6 V;  1K5S A;  3P3N A;  3Q4H B;  5FNV B;  4RO2 A;  2DN9 A;  4GX1 A;  1ZUQ A;  1XHZ A;  4DR3 B;  5CBH A;  2CTQ A;  3ZHQ A;  3W7T A;  1XNQ O;  1H2S B;  3LSU A;  1M1K W;  4EEQ A;  4TQF A;  1S5H C;  3OTO B;  4LFC B;  4O2B A;  1K4C C;  1JPX A;  3SDL A;  3IAY A;  1FYJ A;  4H33 A;  1H2G A;  3UO3 A;  3G71 V;  5IDJ A;  4X65 O;  3BAB A;  2JGD B;  3EHB B;  3ETQ A;  5J2T B;  4KHP B;  4MS2 A;  4FLV A;  2Q8V A;  3U10 A;  1J5E O;  1AJQ A;  4B3R B;  1AI7 A;  2P06 A;  3B2E E;  1XQ8 A;  1XMQ O;  3JCZ A;  2AZ0 A;  1MZE A;  1ZLZ A;  3QVN A;  3SPI A;  3P30 A;  2Q5Z A;  3A0H Z;  4MVR A;  2PGG A;  1HR0 B;  1B6Q A;  3JAR A;  1HWY A;  1KB9 F;  3T4Z A;  4DV6 B;  4CC6 A;  1OV9 A;  2Y4T A;  2B9Z A;  1Y74 A;  3B77 A;  1NH2 D;  1M93 A;  5IJ9 B;  3UO2 A;  2F4V O;  2ZXW B;  2UXC O;  2QWQ B;  5C8Y B;  1R73 A;  4JI1 B;  2BTQ B;  2NLJ C;  4MW8 A;  5IJ0 B;  1NR1 A;  3H01 A;  5JWP A;  4CH6 A;  2QM4 A;  1VQL V;  1MMM A;  1UPG A;  2PY5 A;  4PA7 A;  5GTH Z;  1O9G A;  4ZI7 A;  3BCC H;  2PYJ A;  5LBQ A;  2ZNI A;  3ASN B;  3RYC A;  3ABM B;  4X1K A;  2HKO A;  5BZB A;  4CS3 A;  3T1Y O;  3J80 N;  3GWO A;  2A3Q A;  1G1X B;  3G6B A;  5DN6 G;  4L87 A;  3CRQ A;  1N33 O;  4YY3 B;  3JD3 A;  3T1H B;  4MSW C;  2A06 H;  4U3J B;  3SPH A;  2HJD A;  3SPG A;  3CCQ V;  4DR5 O;  1KD1 W;  3M8A A;  4ZIB A;  5BMV A;  4YJ2 A;  2KB1 A;  4X1Y B;  4JAA A;  3F5T A;  4DUY O;  2E5L O;  1KQS U;  5GON A;  1YTF D;  1N32 O;  4I9W A;  3G67 A;  1LUW A;  4EKW A;  3L72 H;  3W7U A;  4EFB A;  1VQ5 V;  1QLE B;  1HDJ A;  3K5N A;  4DR4 O;  1HP8 A;  2VQF O;  3ZJZ A;  3E2E A;  4X65 B;  1YSC A;  5LYJ B;  3AG3 C;  3HKE A;  3JAW A;  4U7N A;  2UXB O;  4JYY A;  3AG1 C;  2RJZ A;  5IY5 C;  1XL4 A;  4TV9 A;  2N05 A;  1VP7 A;  3K0D A;  2VWK A;  3E89 A;  4TSF G;  4XDJ A;  5B3S C;  5CA3 A;  4X8A A;  5B1N A;  2DJV A;  3CMA V;  1RSO B;  1EN6 A;  2WLL A;  2P4K A;  1M5I A;  1I94 B;  4TUY B;  1SQB H;  5EZY B;  4ZBM A;  1AR4 A;  2CAZ C;  2IJJ A;  4WBN A;  4U3F H;  1W59 A;  1X59 A;  2YI8 A;  1MAB G;  3C90 A;  3AG2 C;  4ICG A;  5JJJ B;  1SQG A;  4EFE A;  3MHH C;  2IM9 A;  2WLJ A;  3B8M A;  2BOC C;  1G4Y B;  3H1L H;  2DOS A;  1BHB A;  1N34 B;  3HKB A;  2Q7E A;  4CC5 A;  3U11 A;  3FYI B;  1SQF A;  4JAU A;  3G6E V;  2UXD B;  1IBL B;  2DWE C;  2LW1 A;  4IHJ B;  5EC2 C;  3SYC A;  1P7G A;  5L3D A;  3BHP A;  2EIM B;  3JAM N;  3MDS A;  1BMF G;  4JV5 O;  1BL8 A;  3VQW A;  1B3Q A;  4CZZ A;  1JMK C;  2OCC B;  3VOU A;  2QDO A;  2JS5 A;  4CS2 A;  4Z2W A;  1S5J A;  1H2K A;  4MVO A;  4B3M B;  4LF4 O;  1JR9 A;  1D5N A;  1K97 A;  4GX5 A;  2JEX A;  4LF6 O;  2DQ0 A;  4NTX A;  5EBL C;  4PHZ A;  4K3A A;  2B1G A;  5EBW C;  1Q81 W;  5CA1 A;  1CPY A;  2F95 B;  1T5E A;  1BZK A;  3IC9 A;  2F1M A;  3UQ8 A;  4FLW A;  4O4H A;  3B8N A;  4MTO A;  1IBM O;  2ZR2 A;  4LNU A;  4X9Q A;  3L74 H;  4LBE C;  1VF6 C;  4NKG B;  1QR8 A;  4F4L A;  4WFB V;  2KQX A;  5EBM C;  5JVD A;  4CBC A;  3CHX A;  2LJ2 A;  5KUK A;  1DGS A;  4B3S O;  3F7Y C;  4P30 A;  2ARH A;  1HNX B;  2WLH A;  2VQE B;  4PDL A;  3CX5 F;  1RM1 B;  2L35 A;  4KP4 A;  4GKK O;  1EFR G;  3SPC A;  4UCS A;  4HNA A;  4LF7 O;  3BVO A;  1BQ0 A;  1N0N A;  3OMA B;  1YZB A;  2JJ2 G;  1I0H A;  2ADQ B;  4NR1 A;  1TGO A;  1SZX A;  4LF5 O;  4G2K A;  2HHH B;  3D36 C;  2M7W A;  4JI0 O;  2ODM A;  2ZXW C;  2ITC C;  2Q69 A;  1R1B A;  4HBN A;  4AIL C;  2AW9 A;  4DR6 O;  4O2B B;  4NXM O;  2WPD G;  1WJZ A;  1PKX A;  3OM3 B;  4MVM A;  2CH7 B;  4FVM A;  1IX9 A;  3CCJ V;  1KEC A;  2LP7 A;  5BR8 O;  4NB5 A;  1QHT A;  1DLB A;  3CRC A;  2IH3 C;  3ASN C;  1PNK A;  3ABM C;  3SJB C;  4LF9 O;  4BIZ A;  3WB0 A;  1W0K G;  4AQY B;  5L3F A;  4UB6 Z;  2V1D A;  3FD9 A;  1AJN A;  1FJG B;  1OCC B;  3JAS A;  3VQV A;  5IWA B;  3O65 A;  3JD0 A;  1XBL A;  1JX9 A;  2HEP A;  5L3E A;  4YIO A;  3ZRS A;  1RPO A;  3ZHT A;  4LF6 B;  1EN4 A;  4ZHQ A;  3ZX6 A;  2E75 B;  3QO5 A;  4PA3 A;  3TXS A;  4AI8 A;  3E22 B;  5J9P C;  3ZIA G;  1YHQ V;  2HVJ C;  1V9P A;  1AI5 A;  2X0L A;  1NTK H;  2GHY A;  1VQK V;  1YF2 A;  4LWS B;  4XBF A;  1QLE C;  4FFB B;  4IYH A;  3SR2 C;  2YIC A;  2Z5U A;  2EBO A;  3K58 A;  4DUZ B;  2R72 A;  3K5O A;  3HKD B;  3FYE B;  4JI5 B;  3QG5 A;  4O2A B;  4F6R A;  2UUB O;  2CK3 G;  2HG5 C;  3CCR V;  3H9V A;  2F43 G;  3JCU Z;  2ZDI A;  2CE4 A;  3ABT A;  2JIZ G;  4PI2 A;  1AP5 A;  4LF7 B;  4X62 O;  5LMN O;  4RUF A;  2YSU B;  5JQG A;  2WLI A;  3E86 A;  4J7Z A;  2GV9 A;  1S5L Z;  1KC8 W;  4PA6 A;  5B5E Z;  5EIB D;  4O4L A;  4YJ2 B;  5KAI Z;  4PJ0 Z;  5JCO A;  4RAI A;  4UVB A;  4R6Z A;  2ADP A;  5GON B;  3KCX A;  4PI0 A;  2JDI G;  1EM1 A;  4DR3 O;  1H8E G;  1BE3 H;  3CCS V;  1BGY H;  2RNB A;  2EIM C;  4JI8 B;  3LUT B;  4XDL A;  3AK1 A;  4I55 B;  3ZMU A;  1CXZ B;  1I5X A;  1DTO A;  4LFC O;  2PTM A;  1Q90 D;  1Y6X A;  3K0G A;  4B08 A;  3N2G B;  2OCC C;  1H2N A;  4GKJ B;  3ZRX A;  5LP6 A;  1YI2 V;  2QWN B;  4NVP A;  4O4J B;  2UUA B;  4W4L A;  2Y0I A;  3FB6 C;  1Q7Y W;  1OCZ B;  1R6K A;  4LH6 A;  3E83 A;  2JJ1 G;  3I56 V;  2JK5 C;  3WG7 B;  4B3R O;  3K03 A;  1WPB A;  2FKX A;  4TT3 G;  1E79 G;  3JAK B;  4XDK A;  5L3B A;  1K9M W;  3SYO A;  4FLU A;  4LFB B;  4H37 A;  1XNR B;  1N0J A;  5FPO A;  2EIK C;  5KAF Z;  2WWW A;  4DV6 O;  1SA0 B;  1Q8I A;  1Y67 A;  2ZIO A;  3CXH F;  2Y69 B;  2HR3 A;  3K04 A;  3RN4 A;  5BY1 A;  4X66 B;  1KKC A;  4O4I A;  4JI1 O;  1RM1 C;  3K3W A;  3EVK A;  3J7A U;  3CEI A;  2QTS A;  3B4S A;  1L1F A;  1FXK A;  1IXM A;  3D8C A;  2EIJ B;  3JAT B;  3RYI A;  3CJH B;  3LNN A;  4GX0 A;  1L0L H;  3ZHU A;  5LMN B;  4X1I A;  4X20 A;  3FAV B;  1FFX A;  2EZP A;  2F66 C;  1XRE A;  3TJT A;  5H9C A;  4YJ3 B;  5KX5 A;  2JVD A;  3ZED A;  2DQ3 A;  2ETN A;  4YY3 O;  2PI5 A;  2BE3 A;  1OJH A;  3JSL A;  3K06 A;  1NH2 B;  1ENV A;  2RN9 A;  3THO A;  4J10 A;  2LW7 A;  5KMG B;  2QWP B;  3JAL B;  1J95 A;  2JEU A;  3IFX A;  2FB5 A;  3ZMZ A;  2YXY A;  1YEW A;  1PV0 A;  1F7Y A;  1OCC C;  4MVQ A;  4J41 A;  3L73 H;  3JD1 A;  4TV8 A;  1NZ6 A;  5DEC A;  1NBM G;  3OMN B;  4IIJ B;  4MVS A;  4Q20 A;  5IYC O;  5CBF A;  2HVK C;  3RBZ A;  1P4R A;  3MD0 A;  3CC7 V;  1I94 O;  1NTM H;  5LOV B;  4FM1 A;  4WFF A;  4I4T A;  3AEI A;  4LF8 O;  1U96 A;  3E35 A;  5KLV H;  1TUE B;  2A9H A;  2D3O W;  4UB8 Z;  1BS3 A;  2JRI A;  1WP7 A;  1FFT B;  2QSA A;  5K1X A;  2ZIN A;  3BA9 A;  1S76 D;  1YTF B;  1QVG U;  3KZI Z;  5CB4 B;  4JPR A;  5IYD O;  1TAE A;  1N34 O;  1P84 F;  4IL6 Z;  2AZ2 A;  3RYH A;  4CH5 A;  2UXD O;  1IBL O;  4EB6 B;  3K9A A;  3I5D A;  2ZE7 A;  3QF7 A;  1WAZ A;  2DYR B;  3D3I A;  2BSK A;  1H8H G;  3SYA A;  4BR6 A;  3AK2 A;  3ABU A;  1URF A;  5KA6 A;  4DRX B;  3SJC C;  3P3P A;  3CRM A;  4B3M O;  1GN4 A;  2G38 A;  3CB2 A;  4DV7 O;  3M99 B;  3UT5 A;  3R65 A;  1VQO V;  2QEX V;  2FYU H;  4KXR A;  5JJN B;  1N8R W;  3OUS A;  2B5U A;  2Y4U A;  5D5Q A;  1XDC A;  4N21 A;  2X6B A;  2GSM B;  3CYO A;  1Y4M A;  5ITZ A;  3CCM V;  2ZM6 B;  3EXA A;  1SQV H;  5JH7 B;  4R50 A;  4BW9 A;  1OCZ C;  1VQM V;  3CP1 A;  3WG7 C;  1GM9 A;  5CN0 A;  1LUV A;  5J2U A;  1AJP A;  2Q4P A;  2V7Q G;  4FZ1 A;  4GUN A;  2WLI B;  2VQE O;  1HNX O;  3ZN0 A;  3SPJ A;  4RQE A;  4YHH B;  4K0K B;  5GW7 A;  3UCS C;  1ARO P;  4UV8 A;  5EYP A;  4BIO A;  4FLT A;  3OT7 A;  4WFE A;  3A0R A;  3OEE G;  2IH1 C;  2YXL A;  3L71 H;  2XUM A;  4JAV A;  4HYO A;  3QNE A;  1AIL A;  3STL C;  1R3K C;  1FPO A;  4DV3 B;  1NKD A;  4LP8 A;  2HHH O;  4QGP A;  2Y69 C;  4OPA A;  2EJR A;  4PV1 B;  1H38 A;  4LF8 B;  4UCR A;  2BOB C;  1F4M A;  3G4S V;  3DXR B;  2ZE6 A;  2OIE A;  2P5O A;  4B3T B;  2OYQ A;  4JI7 B;  2PYL A;  1Y76 B;  2EIJ C;  5IT9 N;  1YIJ V;  2YEV A;  3F5W C;  4P9O A;  2DMX A;  4H44 B;  3T4D A;  3D3Q A;  2PF4 E;  4J80 A;  4DR2 B;  2OTL V;  1AI6 A;  2YI9 A;  2HLD G;  2AHZ A;  4AQY O;  1K34 A;  3ZRW B;  3K59 A;  1FJG O;  2GUZ A;  4AHC A;  1ZSP A;  5IWA O;  1Q6U A;  2OT5 A;  4MTG A;  1S77 D;  2WA3 A;  3CS5 A;  5LA6 A;  1BSM A;  3GVM A;  1K3E A;  1JFF A;  1K33 A;  5CA0 A;  1QNM A;  1K73 W;  4DV7 B;  2ZIM A;  3SJQ C;  2Q7H A;  2X6A A;  5LXT B;  3WB2 A;  4MW3 A;  3CRR A;  1GAX A;  3ABK B;  2P7T C;  3B09 A;  4KFM A;  4FPP A;  1ZTE A;  2EIK B;  1QQC A;  5LGT A;  2V4D A;  5IYZ A;  4FLZ A;  4IYI A;  4PDM A;  4DUZ O;  4P9P A;  2MK3 A;  3H1J H;  1VMG A;  4JI5 O;  3N2K B;  1W0J G;  5IE9 A;  4J7J A;  3Q4H A;  5FNV A;  1NVP D;  3HPL C;  3G80 A;  2WLM A;  2IJK A;  3K5L A;  2KG7 B;  1M9N A;  3WFV A;  1JQ0 A;  2WSS G;  2DW4 A;  1CP9 A;  3RYF B;  1NQT A;  2GDS A;  3APO A;  5LGN A;  1X4T A;  2LGQ A;  3CCV V;  5LHI A;  4WF9 V;  4JTC B;  2GBO A;  3ZRV A;  2O57 A;  4DR1 B;  3SYP A;  2P4V A;  1VQN V;  4NXN B;  1IZ3 A;  1PD3 A;  4WCE V;  5EC1 C;  3FB7 C;  1IBK B;  2JGD A;  3OAA G;  3ASO B;  1VF6 A;  5HFL A;  4E2L A;  4JI4 O;  3W7W A;  2IBZ H;  4JI3 O;  4QE7 A;  2EJ7 A;  3W7X A;  4X88 A;  1I7F A;  4JI8 O;  1VEW A;  2DYR C;  1L0N H;  1MZF A;  4UCU A;  1TVK A;  5LL6 Y;  3FB8 C;  1AR1 B;  4QNH B;  4J9Z B;  1NR7 A;  2LFS A;  4GKJ O;  4DK1 A;  3TXQ A;  3OE7 G;  1H2M A;  3KCY A;  4MT8 A;  2NNU A;  2UUA O;  1GN3 A;  4DW0 A;  2VRZ A;  1HNZ O;  2UU9 B;  2Z0A A;  2UXX A;  2EIN B;  4FZ0 A;  2CTW A;  1YIT V;  1Y66 A;  4NTY A;  5KHJ A; 
#chains in the Genus database with same CATH homology
 4TT3 G;  4JTD B;  3T4Z A;  3D36 A;  1E79 G;  4XDK A;  5L3B A;  1K9M W;  3SYO A;  3CC2 V;  2WLK A;  4P2Z A;  4H37 A;  2WLN A;  5CBG A;  2EIK C;  2XND G;  3OFN G;  1G8M A;  3B77 A;  3ETG A;  1R3I C;  1NH2 D;  2IJH A;  2P90 A;  5LHG A;  2WWW A;  1JCH A;  2P67 A;  3DGE A;  1QR9 A;  2ZXW B;  4PA9 A;  4BAY A;  4DXW A;  1OCR B;  1R73 A;  3ABL B;  2NLJ C;  4MW8 A;  1KP2 A;  2HR3 A;  2Y69 B;  1NR1 A;  3K04 A;  4PEL A;  3H01 A;  3VBB A;  2W6J G;  4BIU A;  3ZCC A;  1VQL V;  2XAS A;  1RM1 C;  3I55 V;  3K3W A;  3PJS K;  1SRY A;  4PA7 A;  1GM7 A;  4GCZ A;  3CCE V;  2X6C A;  2QM7 A;  4N23 A;  5LBQ A;  1L1F A;  4BW5 A;  3ASN B;  1FXK A;  1IXM A;  2ATK C;  3ABM B;  2HKO A;  4YXW G;  2EIJ B;  5BZB A;  3RVY A;  3GWO A;  4GX0 A;  3JD4 A;  1FXK B;  5DN6 G;  5B1B B;  4L87 A;  3OW2 U;  4R7C A;  1CEZ A;  3JD3 A;  2EZP A;  4MSW C;  2XAQ A;  2Q67 A;  3SPH A;  2ZR3 A;  3W7S A;  3ZMT A;  3EFF K;  5H9C A;  1MOF A;  5B1A B;  1K7D A;  3SPG A;  3LSQ A;  3DTU B;  3CCQ V;  1KD1 W;  2DQ3 A;  4JF3 A;  1K5Q A;  2KB1 A;  2PI5 A;  5H6Q A;  4RQF A;  3RVZ A;  3K06 A;  1NH2 B;  5E1A C;  1YJN V;  1KQS U;  1ENV A;  2OTJ V;  5L3G A;  1EZJ A;  3ZMS A;  2HJF C;  1YTF D;  3CME V;  4I9W A;  4EKW A;  3W7U A;  2DYS B;  1VQ5 V;  1QLE B;  2P6J A;  1V54 C;  3FB5 C;  3F7V C;  1J95 A;  2JEU A;  3CCL V;  3IFX A;  3ZJZ A;  3E2E A;  3CPW U;  3ZMZ A;  1YSC A;  3AG3 C;  1AI4 A;  3IGA C;  4U7N A;  1S3J A;  3AG1 C;  1OCC C;  5IY5 C;  4MVQ A;  1XL4 A;  1THZ A;  4QE9 A;  3ETD A;  3X2Q B;  2Y48 A;  3JD1 A;  5LHH A;  2EIL B;  4QIW F;  3K0D A;  3E89 A;  1VQ6 V;  4TSF G;  4XDJ A;  2A0L A;  5B3S C;  5CA3 A;  4X8A A;  1NBM G;  3OMN B;  3OR6 C;  5B1N A;  4MVS A;  4UVA A;  2DWD C;  4Q20 A;  2K1E A;  5L3C A;  4JYB A;  3CMA V;  1VQP V;  1NJI W;  2QE7 G;  2WLL A;  1M56 B;  5IYC O;  5CBF A;  2Z3Y A;  4R8C A;  4ZBM A;  2HVK C;  1VQ4 V;  1V55 B;  3RBZ A;  2WLL B;  3GB7 C;  2IJJ A;  2IU3 A;  1P4R A;  3MD0 A;  4X89 A;  3CC7 V;  1OZ0 A;  3LSS A;  1F4N A;  1LNQ A;  3JD2 A;  1FXV A;  1MAB G;  4WFF A;  1K4D C;  3AG2 C;  3AEI A;  3T2M A;  3MHH C;  3ABK C;  3LDD A;  2WLJ A;  3B8M A;  3E35 A;  2BOC C;  1TUE B;  2A9H A;  3E8B A;  1G4Y B;  2ITD C;  1YJ9 V;  2D3O W;  1BHB A;  1FFT B;  2R9I A;  4G27 B;  5EK0 A;  2EZO A;  1W2B U;  2Q6A A;  4TWK A;  3FYI B;  1S76 D;  4JAU A;  3G6E V;  4QPK A;  2DWE C;  1YTF B;  3FKS G;  5EC2 C;  1QVG U;  1OHH G;  3SYC A;  1GMG A;  4UV9 A;  4JPR A;  5L3D A;  5IYD O;  2EIM B;  1GO3 F;  2YEV B;  3QO7 A;  1BMF G;  3JYC A;  2AHY A;  3AG4 B;  1BL8 A;  1OCO C;  3K9A A;  4CZZ A;  4MVU A;  2ZDI C;  2OCC B;  4UXN A;  1MG1 A;  3VOU A;  4Z1M G;  3HB3 B;  2DYR B;  3D3I A;  4MVO A;  1S72 V;  4JTA B;  1H8H G;  2ZQM A;  3MHS C;  3SYA A;  3SYQ A;  4FJC C;  1S0V A;  1YJW V;  3ABU A;  3TK1 A;  2A79 B;  2XAG A;  4GX5 A;  1K97 A;  3E8H A;  2JEX A;  4UVC A;  2X7R B;  5KA6 A;  1PNM A;  2DQ0 A;  5IYB O;  5EBL C;  4LC1 A;  1E1R G;  1QLN A;  5EBW C;  2B1G A;  1Q81 W;  4MTX A;  1UJW B;  1CPY A;  5C93 A;  3LDE A;  3CD6 V;  1JJ2 U;  1R3L C;  4G28 B;  3M99 B;  3B8N A;  4MTO A;  3TET A;  2ZR2 A;  3R65 A;  3ASO C;  1VQO V;  4PDR A;  2QEX V;  1P7B A;  1N8R W;  3OUS A;  4LBE C;  2B5U A;  1COW G;  4N21 A;  2X6B A;  2PI4 A;  2GSM B;  3CYO A;  1Y4M A;  1QR8 A;  4F4L A;  4WFB V;  5EBM C;  1Q82 W;  3CCM V;  4CBC A;  2W0F C;  5KUK A;  2C2A A;  3F7Y C;  4P30 A;  4R50 A;  2IU0 A;  1MSW D;  2XAF A;  5HFM A;  1FS0 G;  1OCZ C;  2WLH A;  4ASU G;  4PDL A;  3STZ C;  1RM1 B;  4KP4 A;  1VQM V;  3CP1 A;  4GX2 A;  3WG7 C;  1EFR G;  1GM9 A;  5H6R A;  5CN0 A;  4DO2 A;  1PNL A;  3SPC A;  2EIN C;  3NXS A;  1Q86 W;  1AJP A;  2V7Q G;  2WLI B;  4RUE A;  4JGS A;  1M57 C;  2IW5 A;  3SPJ A;  3ZN0 A;  3OMA B;  4JAS A;  1JVM A;  4RQE A;  1DF5 A;  2JJ2 G;  5GW7 A;  1QCE A;  1ARO P;  4UV8 A;  3E8F A;  1F23 A;  4G2K A;  4WFE A;  3A0R A;  5LGU A;  1GK9 A;  3OEE G;  1KP3 A;  2M7W A;  2IH1 C;  2ZXW C;  1M90 W;  2ITC C;  1SES A;  2Q69 A;  2R9R B;  4HYO A;  4FK5 C;  3QNE A;  4JAV A;  1JOY A;  3STL C;  1OCR C;  1R3K C;  1NKD A;  4LP8 A;  4MTF A;  3ABL C;  5FL7 G;  3UM7 A;  2Y69 C;  5CMU A;  2WPD G;  1PKX A;  3OM3 B;  2EJR A;  4MVM A;  4LCU C;  1H38 A;  1I5Y A;  5KUM A;  2BOB C;  1F4M A;  2H94 A;  3G4S V;  3CCJ V;  1SET A;  1WLE A;  4UUJ C;  1KEC A;  4U7O A;  1GTO A;  1R3J C;  2LP7 A;  5B1O A;  4QJF B;  1DLB A;  2IH3 C;  3ASN C;  1PNK A;  3ABM C;  3BEH A;  4BIZ A;  2B1I A;  2QTO A;  2EIJ C;  3K08 A;  4HAM A;  3CXC U;  1YIJ V;  1V54 B;  1W0K G;  2YEV A;  1VQ7 V;  4ZKI A;  3F5W C;  4I5S A;  3QO8 A;  4J9Y B;  4P9O A;  1FXK C;  4QPJ A;  5B1B C;  1E1Q G;  5L3F A;  3T4D A;  3AG3 B;  2V1D A;  2LFR A;  1AJN A;  3AG1 B;  1OCC B;  1AI6 A;  2H8P C;  3ZRW A;  2OTL V;  5IY5 B;  2HLD G;  3ZMV A;  4FIP C;  2AHZ A;  3P32 A;  3OGC C;  5B1A C;  3ETE A;  3JD0 A;  1K34 A;  5L3E A;  1JX9 A;  3ZRW B;  3ZRS A;  1RPO A;  4HZ3 A;  2XAJ A;  5B3S B;  3QO5 A;  1ZWI C;  1XL6 A;  4PA3 A;  3OEH G;  3TCU A;  2XAH A;  2OT5 A;  1EBO A;  3ZIA G;  5J9P C;  4MTG A;  1VQ9 V;  1S77 D;  1YHQ V;  2XOK G;  2IJI A;  1DF4 A;  3RW0 A;  1K3E A;  2HVJ C;  1K33 A;  1AI5 A;  2X0L A;  1K73 W;  1K92 A;  2GHY A;  2UXN A;  1VQK V;  3OMI B;  3T1C A;  3SJQ C;  4XBF A;  2DYS C;  1SER A;  1QVF U;  1QLE C;  2X6A A;  4MW3 A;  2W6I G;  1GM8 A;  3AG2 B;  1WPX A;  3LDC A;  3BY6 A;  4PA4 A;  4WFH A;  4PDV A;  1SZT A;  2Z5U A;  3ABK B;  4MVZ A;  2EBO A;  2P7T C;  2QA4 V;  4KFM A;  4FPP A;  2EIK B;  1VQ8 V;  1R6N A;  3FYE B;  3X2Q C;  2EIL C;  5LGT A;  2QKS A;  2CK3 G;  2WAM A;  4KUM A;  2HG5 C;  2Q68 A;  3CCR V;  2F43 G;  4PDM A;  1ROP A;  4P9P A;  2MK3 A;  3OUF A;  1BHA A;  3LNM B;  1W0J G;  1FXH A;  2ZDI A;  1M56 C;  3ABT A;  2JIZ G;  1OCO B;  3CCU V;  4RUF A;  1NVP D;  3K79 A;  1V55 C;  2YSU B;  3UKM A;  1PL0 A;  3HPL C;  2WLI A;  3E86 A;  2WLM A;  2IJK A;  1K5S A;  5DM6 V;  1KKD A;  1M9N A;  3OR7 C;  3WFV A;  1JQ0 A;  2ZD9 A;  2WSS G;  1KC8 W;  4PA6 A;  4RO2 A;  2DW4 A;  4GX1 A;  3CC4 V;  1CP9 A;  1NQT A;  5LGN A;  3CCV V;  1RPR A;  5LHI A;  4RAI A;  5CBH A;  4UVB A;  1F51 A;  4R6Z A;  3W7T A;  4WF9 V;  4JTC B;  1M1K W;  3ZRV A;  3IC7 A;  1K8A W;  2JDI G;  1S5H C;  2FTK A;  1H8E G;  3SYP A;  1VQN V;  1PD3 A;  4WCE V;  1K4C C;  5EC1 C;  3FB7 C;  4FMT A;  1JPX A;  3CCS V;  3OAA G;  4GT1 A;  2EIM C;  3LUT B;  4H33 A;  4XDL A;  1H2G A;  3ASO B;  5HFL A;  2HFE C;  3ZMU A;  4E2L A;  3G71 V;  1I5X A;  1DTO A;  5IDJ A;  3AG4 C;  3W7W A;  3K0G A;  4QE7 A;  3EHB B;  2OCC C;  3W7X A;  4X88 A;  3ML0 A;  3ZRX A;  2DYR C;  4MS2 A;  1YI2 V;  2QM8 A;  3FB8 C;  1AR1 B;  4QNH B;  4J9Z B;  1AJQ A;  3E8G A;  1NR7 A;  1AI7 A;  1ORQ C;  2LFS A;  3FB6 C;  3KG2 A;  4WFG A;  1Q7Y W;  3OE7 G;  1GKF A;  4WFA V;  1OCZ B;  1R6K A;  3JCZ A;  4JYC A;  3E83 A;  4MT8 A;  1QBZ A;  2JJ1 G;  2NNU A;  3SPI A;  3ZN1 A;  3P30 A;  3I56 V;  2JK5 C;  3WG7 B;  5KA5 A;  2UXX A;  3K03 A;  4MVR A;  2EIN B;  4OXS A;  1NVP B;  1YIT V;  1Y66 A;  1B6Q A;  1M57 B;  1HWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...