1F4NA

C2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARFGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords ROP ALA2ILE2-6
total genus 27
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f4nA00
2IJKA 1ROPA 1RPOA 1F4MA 2GHYA 1NKDA 1F4NA 1PD3A 1GMGA 1RPRA 2IJIA 2IJHA 4DO2A 1GTOA 2IJJA 3K79A 1B6QA
chains in the Genus database with same CATH superfamily
4HYOA 3JCUZ 4OPAA 4DV7B 1S72V 4YJ3A 2E76B 2AZ0A 1NT2B 4QJFB 1YF2A 3BY6A 1TUBB 5EYPB 4FLVA 2PGGA 3K03A 2N04A 2WAMA 3MD0A 2YI8A 4DV7O 4CC5A 5ITZA 2BTQA 3RYCA 5BMVA 4FVMA 5LMUB 3LNMB 1XHXA 2CGOA 4X62O 4FLWA 4GKKO 2F95B 2HHHO 2EIMC 2QM7A 4X65O 3JAMN 4AHCA 4DV1O 3AK1A 3OTOO 1SA0A 3T1HB 1Y66A 2QEXV 1QU7A 2CTPA 3B2EE 1VQNV 5A2QN 2WLHA 1HNZO 3KKYA 1N33O 4TT3G 3T2MA 1EN6A 3OFNG 4KL1A 3ETQA 3JAKA 2RQ6A 2Y69B 1OCZC 2VQFB 4J7ZA 5KHGA 3CCRV 4U7NA 1Q6IA 3SPJA 4KFMA 4DR4O 1Z5VA 4TV9A 4YY3B 1SRYA 1HNZB 3LSSA 1RM1C 3LDEA 3I56V 1GN2A 2OTJV 4NTXA 4DYLA 2CUGA 2LJ2A 5JH7B 5LGNA 3HKDB 2BSKB 1AILA 4EKWA 4LFAB 4LH7A 5BY1A 3R66A 2PTMA 2PUSA 3ZRVA 3AG4C 1NZ6A 1P49A 2LFRA 2L6LA 3BA9A 4JYBA 2CGNA 1ZLZA 2XAFA 2Y0IA 5KMGA 3AK3A 4K8ZA 5DM6V 1U97A 3P32A 4JI3B 2WLNA 4RQFA 1WAZA 3JD2A 2ZE7A 3T4DA 3SJCC 3ZJZA 3E22B 3L72H 2DYSC 1P84F 2YUAA 4DV2O 5B1AC 1K73W 2YXYA 3DXRA 1AB3A 2CH7B 2LFSA 3B40A 1UPGA 4CS3A 1Y74A 1N33B 5J9PC 3G6BA 2DQ3A 5B1BB 3I5DA 4U3JA 1OCRC 2H8PC 2B9ZA 1M93A 4X1KA 2N05A 3ZHUA 3RYHB 1OCZB 1V9PA 2IU3A 1TUBA 1S77D 1QR9A 4DK0A 3TJTA 4U3FH 4B7EA 4JV5O 4CS4A 1YJNV 3K0DA 3ZCCA 1ZX3A 3RBZA 4J7JA 1H2MA 2KB1A 3E22A 4HBNA 2QKAA 4BIOA 1MA1A 2Z3YA 2IJJA 1SQBH 3JD0A 1N8RW 3T4ZA 5KHJA 3BA8A 3TETA 2EULA 3C3TA 1FYJA 5CBFA 1JR9A 1J5EO 2YIAA 4EFEA 4F6EA 1K8AW 4E4EA 1YVWA 4DR7B 5D5PA 4XDLA 4MSWC 2BSKA 3FB6C 3CYOA 1NVPB 4JI8B 2ZR2A 1QHTA 1V54B 3HKCB 1BHAA 3WG7B 1J5EB 1XL4A 3TCUA 2UXCB 2VS0A 4DV6O 3H1KH 4MW8A 1VIBA 1XMQO 1ZTEA 4FJCC 2XT9A 4HNAB 5JJNB 1QBZA 3UT5B 1BS3A 1FPOA 1H2SB 3M7MX 3OMAB 2L35A 5CB4B 1OCOB 3K3WA 2GDSA 1R3KC 1JOYA 5LMNB 2ADQB 3JD3A 4IL6Z 4N21A 2YIBA 4MT8A 3RVZA 4GZRB 3CRAA 5B1BC 4JI5O 3IFXA 2UU9O 3ZIAG 3L9DA 2WA4A 1VQ9V 5EYPA 4FZ1A 3RGBA 3QO8A 4UB6Z 1JJ2U 1OJHA 5A9GA 4O4LA 1I08A 4PDLA 3TXQA 4DR5O 1K4CC 2HHHB 4UVBA 1AP5A 2R70A 3ZHSA 4P9OA 1OV9A 2KKWA 3ZMVA 2FB5A 1VEWA 1VF6C 3ZHRA 4DV0B 4IYIA 4MVQA 2OWOA 4PA7A 3EXAA 1SA0B 5FNVA 4DR6B 4LF5B 2UXBO 1YJWV 1Q82W 2HLDG 2DE0X 1DF4A 5FPOA 1DLBA 3AG2B 4U3JB 3G71V 1JFFA 2VQFO 2YI9A 2PYLA 4B7KA 2ZM6B 1ZWIC 1YTFB 4DV4B 2HVJC 4UFZA 2BCCH 4NXNB 5JWPA 1R3IC 3TK1A 2E5LB 4P2ZA 1DGSA 1QR8A 3GB7C 4D6TH 2JEXA 3OEEG 2RNBA 1COWG 2VQEB 5B1AB 5H6QA 5FPRA 4ICGA 1HR0B 2F23A 4TSFG 2ZQMA 5LBQA 3CSXA 3RW0A 3CS5A 3U0ZA 4GKKB 1TGOA 2EIKC 3SPIA 3CJHA 4WBNB 1XOUA 3UT5A 4X65B 4HAMA 2A9HA 1FAFA 2OYQA 4LF7O 3UM7A 4D7TA 1EN4A 1HWYA 1H2NA 1XBLA 3HKBB 2WLJA 3CP1A 3HPLC 4QE9A 2K1EA 3W7SA 1KP2A 2JGDA 3F7VC 5KUMA 4H13B 2JS5A 5DN6G 5L3GA 1IBMO 1SS3A 1Y76B 4JI3O 2FYUH 1MNGA 4OX9O 4FFBA 1K4DC 1XNRB 1I5XA 2JJ1G 2HVKC 4JI0B 4GUNA 2P90A 2Q7GA 3K0GA 2ZM6O 1GM9A 3OGCC 1Y6XA 2QM4A 5C8YB 2ZE8A 4X8AA 5KHIA 2GBOA 4I55A 3ICXA 2XASA 4FPPA 2W0XA 4WFAV 2QR4A 2E5LO 3CRRA 3WB0A 1RSOB 3FKSG 2FMLA 3H01A 1GN6A 3ZMUA 1M5IA 1JVMA 3IGAC 1DF5A 4PA3A 1AJNA 2V4DA 1G1XB 2AGAA 1Y76A 5FLXN 1GTOA 4FLZA 1W0KG 1B06A 3APOA 1IXMA 1SERA 2YIDA 5EBWC 2FTKA 3RYIB 3FX7A 2K9PA 1M57B 1EN5A 5HFLA 5CA1B 2NNUA 1QCEA 1JCHA 2RDCA 1I94O 1S5HC 1K5QA 1AJPA 1N36B 1IDSA 1IBLO 5H2FZ 1Q3EA 4D7SA 2JGUA 1YDXA 1Z2GA 1YJ9V 3OTFA 2HP8A 1R6TA 1MG1A 1UJWB 2UXDB 1W0JG 4H37A 1M56C 3LDCA 3LDDA 4FIPC 3ML0A 1US6A 4JI8O 2WWWA 3ABLC 3RT3C 4LF8B 4PDVA 5JVDA 3CRCA 1IBLB 3OAAG 5JJEB 2B1GA 4RQEA 1NBMG 2XNDG 4TQFA 4H0LB 3SPCA 2UXDO 2DWDC 1XMOO 5CBHA 1HNWB 4JI6O 2CK3G 5B1OA 3WU2Z 1ROPA 5EK0A 4PA9A 4QIWF 2HEPA 3TGUH 1VQOV 3N27A 2RJZA 4CH6A 4UXNA 2EIMB 3F5TA 3KZIZ 5L3BA 4B3MB 1SQVH 3SYAA 2AW9A 3A0RA 1PL4A 1M90W 1Y67A 4MTOA 1O9HA 3SDLA 3SPHA 1WLEA 1DK1A 1ZSPA 5KA6A 2R9AA 2V7QG 2GTSA 1IBKO 4FFBB 4NXNO 3CC4V 4AILC 4TUYA 1P7BA 4UUJC 4WF9V 1JQ0A 3HKDA 1YHQV 5L3FA 1NR7A 4I9WA 1E79G 5LGTA 2YXLA 3BCCH 4JYYA 5JQGB 2XAJA 2CE4A 1H2LA 3ABMB 5IJ9B 3CC2V 4O4JB 4PDRA 1EM1A 1NJIW 2QKSA 5CB4A 2YSUB 4J7KA 4R50A 3SGIA 3A2FA 1I7FA 5KX5B 2H3OA 3K08A 1WNSA 4ZHQA 1UFIA 1QLEC 1YEWA 4B3RB 4LBEC 1B3QA 1QVFU 4JI7B 2ATKC 2Y4TA 2P22C 3MHSC 4BW9A 2P6JA 3ZMSA 4DV5O 1PNLA 4MTGA 1NS1A 2Q0AA 1MZFA 1L8DA 3PN1A 3K5MA 2EZOA 2RN9A 3MDSA 1R6NA 4YXWG 3CMAV 4FLYA 4P9PA 1TAEA 1ZAUA 4W4KA 2DYRC 4DR6O 4Z1MG 3CCQV 1VQLV 1SQGA 1CP9A 3K57A 4LFAO 5LP6C 4JAAA 3F5WC 1N4CA 2HR3A 5LGUA 4QPJA 5LHHA 1KYOF 2E3CA 2CDYA 5CN0A 2X6AA 1AR4A 3JYCA 2D2CB 3LSQA 4DV3O 2KQXA 1FFXA 1HR0O 2OIEA 4FFKA 1U96A 1ZL8B 1N34O 2JGDB 3ABTA 1D5NA 1PNKA 4UCRA 1OZ0A 4IT5A 4X66B 4LF4O 4LF6B 1BSMA 2A7WA 5KX5A 3IJ4A 1S76D 2MW2B 3DXRB 4UCUA 1BQZA 4LF9O 4UVCA 4GX5A 1IURA 2JK5C 5IYZA 1IZ3A 3FYEB 3KCXA 2EILC 4JI6B 3ASOB 4FLTA 1H8HG 2VWKA 2GUZA 2X6CA 2UUAO 2YXHA 1XREA 3JD1A 5FL7G 4G2KA 1N36O 5GW7A 4LR3A 4JTCB 2HJDA 2DOSA 3P30A 1G4YB 4YJ2A 5JCOC 3AG4B 1M56B 1NI8A 1QVGU 1K34A 2MK3A 3Q4HA 4PJ0Z 3ZS8C 3J81N 3RWRD 1VQ5V 2F66C 2IJIA 5LXTA 3CMEV 4K8XA 3U10A 3RFRA 1KP3A 5LYJA 3L75H 1NQTA 1XNQB 5L3EA 3OT7A 3SYCA 4Q6GA 3ABKB 1F4NA 3EHBB 2FKXA 3D36A 4DV1B 1WP7A 5C93A 1IVSA 1ENVA 5IT9N 1NTMH 2GV9A 4LNUB 3WB2A 3MHHC 4AQYB 3E8BA 2QSAA 2Z0AA 4R7CA 2DMXA 4DUZO 1OHHG 1CXZB 1GN4A 2EBOA 4LNUA 4O4IB 1KKDA 4J41A 3KCYA 1F23A 1AJQA 1VQ8V 4WCEV 1R1BA 3ZMZA 1MSWD 2GTAA 1WN7A 3FB7C 3JAKB 4X1YB 4RUEA 3E8FA 3C90A 2ZR3A 1N32O 4QGPA 1BGYH 3CEIA 3VQXA 3IC7A 2OIGA 5IDJA 4I0XB 5BR8O 4B3SO 4FLUA 1V55C 4ZOLB 5JCOA 2PI4A 5IJ0A 1IX9A 5IYBO 4J80A 2UXNA 2W6JG 3CD6V 4R6ZA 1X4TA 3TXSA 5K1PA 3AG1C 4EB6A 3RYFA 4O4HB 3FAVB 5EBLC 4DR5B 3DC5A 2AZ2A 2XTAA 3ZRWB 1BQ0A 3JD4A 2D3OW 4F6RB 2ITDC 2R72A 3CCLV 1SF9A 3D36C 2WLKA 5K1XA 4IIJA 3D3IA 3AEIA 4DV2B 4NTYA 5GONB 4LF7B 1R6KA 2QWQB 5J2TB 1KB9F 4DV3B 4GLXA 4ABMA 3LUTB 3K9SA 3E86A 3CJHB 4GCZA 1N34B 3OD4A 2Q7EA 5B5EZ 5KA5A 1SZTA 1K33A 4Q20A 4NR1A 1WP8A 3QO7A 1Q6UA 4X9QA 4DW1A 2GSMB 1NKDA 3JAWB 2WLLA 4I50A 1Y74B 4WFBV 1RPOA 4JZGA 4DR2O 3ZHTA 3CRMA 1P4RA 3RVYA 4AI8A 1S3JA 4B3RO 3K04A 4J11A 1CPYA 3SJBC 2XHBA 4O2AB 4O2BA 4DR1B 1KQSU 1HNXB 2XAGA 2IBZH 4G28B 4EEQA 1K7DA 4NXMO 2AHYA 3H1JH 4OX9B 1WA8B 3SYPA 4GYCB 2PZSA 2B1IA 5EIBC 1OCCB 4YJ2B 2F1MA 4LF4B 1RFYA 2XAQA 3THOA 1FXHA 1OCRB 3W7TA 4FM2A 4GX0A 1Y4MA 2P7TC 1WB7A 2QTOA 4LFCO 1TVKB 3DSQA 1BHBA 2M6YA 3N2GB 4O2AA 3DC6A 1KECA 2WLIB 5IWAB 4CZZA 1A32A 3CWBH 4I4TA 2KG7B 2P67A 4WFGA 4BWAA 2KG7A 4MVMA 1XHZA 1Q5OA 4DR7O 1VP7A 5LYJB 2P4KA 5J2TA 1X59A 1PV0A 1HW7A 2WLLB 4LFBO 3N2GA 3FB5C 5JH7A 4NVPA 3K79A 3G6EV 5H9CA 5BXZA 1M1KW 4BW5A 4WFEA 1M4UA 4L8JA 4X1IB 3QO5A 1PM9A 3OM3B 4NXMB 2IM9A 2HJFC 3VBBA 1R3JC 5B66Z 3B8MA 2YDEA 3G80A 4DV0O 4LP8A 4AQYO 3D8CA 1KD1W 3ZRSA 4DR3O 1XUQA 2UUCB 4FK5C 4IHJB 1Q43A 1Q8IA 3ZN0A 2ZXWC 2CTQA 4DUYB 1L1FA 1H2GA 2HKOA 3A8TA 2E75B 2JS3A 4DK1A 2ODMA 3OMNB 1KC8W 4CC6A 4UV8A 2UUCO 5IY5B 3ASNB 5GONA 4UCSA 4JI1B 1YI2V 1FD9A 4NKGB 2QWNB 4MVSA 5H5NA 4DUYO 1CEZA 2BTQB 3ZMTA 1AROP 1AR1B 4L87A 2HG5C 4ASUG 2NR5A 5KAFZ 1H8EG 1XI1A 2ZD9A 4MW3A 4KXRA 2Y48A 1J95A 2LQTA 4TV8B 5BR8B 3ZHQA 4JI1O 1VQ6V 3RYCB 1XL6A 4X1YA 3DGEA 4WBNA 1LUWA 1H2KA 1BE3H 3CCJV 4RAIA 4LF5O 2AXTZ 3O65A 4I5SA 1AR5A 1QLNA 2EX3A 4O4LB 5LOVB 1WPXA 2NLJC 4QPKA 2QKCA 3BAAA 1FKAO 5IJ9A 1GK9A 1H38A 1YIJV 2PF4E 3SJAC 1GM7A 2EJRA 2LW7A 3RYIA 2W0FC 2ZCEA 3M99B 4PI2A 3CCSV 4IGGA 3H1IH 2ADPA 2WPDG 1Q90D 2XAHA 4JGSA 4G27B 1Z5WA 1M57C 4TV8A 3BPZA 1SZXA 1TUEB 2AHZA 3HB3B 4DR1O 5LMUO 4MVUA 4F4LA 2E74B 4JI7O 2Y4UA 5EC1C 4I55B 5LOVA 2V1DA 1M9NA 1FXVA 2RMKB 3ABMC 5B3SB 2DQ0A 3JATB 3K5LA 1BZKA 3I55V 1YSCA 2PY5A 4DV4O 4X88A 1K92A 3BRCA 1THZA 3OTOB 3HKCA 2X6BA 3U11A 1FXKB 2WLMA 2YEVB 2F4VO 2JIZG 4DRXA 2EZPA 4ZI7A 2A0LA 3N2KA 1PNMA 2IH1C 4FLXA 4PI0A 1HP8A 3WG7C 3SYQA 3S3XA 2GHYA 4PA6A 1VF5B 4JI4O 5IWAO 4B3TB 1XILA 3H1HH 1MMMA 1ZL8A 1P7GA 2Q9LA 3CC7V 3HKEA 4ZI7B 4E2LA 2ILMA 1V55B 4H33A 1VQ7V 4X1IA 4JTAB 4UCOA 4TWKA 1VF6A 4DR2B 1YCIA 2DYRB 3G67A 1GH6A 1WA8A 3HR0A 1GAXA 1FJGO 4MS2A 1O9GA 4LF6O 1PD3A 2EINB 4JYCA 2F43G 4UV9A 4ZBMA 5IE9A 2VQEO 4JZ2A 3CXCU 2CAZC 2EIJB 1XNRO 4LF9B 3CCEV 4K35A 3W7XA 2XUMA 3W7UA 1Q86W 1WB8A 4O4IA 5LP6A 1B04A 3OUSA 3K06A 1TVKA 1I94B 2F4VB 1GMGA 1GKFA 4XDJA 1Q6HA 4CBCA 1B6QA 1K3EA 3E89A 3ETDA 4RUFA 5E79Z 5LMNO 1SQXH 1F51A 2IJHA 1YTFD 3OEHG 4B08A 1NVPD 3JATA 2YICA 3OGIB 4MVOA 1MSDA 4C7UA 1EBOA 2QDOA 1F7YA 1HDJA 3AK2A 5KMGB 2IW5A 5CA1A 4ZKIA 1K5SA 4BIUA 4LCUC 1K97A 5CA0B 4B3MO 3ZHVA 1S5LZ 5JQGA 2RCVA 2ZNJA 1XNQO 2UXCO 1JX9A 1AI4A 4J42A 4J9YB 3S3WA 1FFXB 3SPGA 2WA3A 2LW1A 1PL0A 4GX2A 3QF7A 1D2DA 4YHHO 3J7AU 4DO2A 2UUAB 3P3NA 3FD9A 5IJ0B 1BL8A 1V54C 5J2UA 3QNEA 1S0VA 3PJSK 3QTCA 3OR6C 1XDCA 1IBKB 3K59A 3A0BZ 5AG2A 3APQA 4DV6B 2OCCC 2ZIOA 4X62B 5JJJB 2Q0OC 3DTUB 4YHHB 4F6RA 2EIJC 2Q73A 1I0HA 4FZ0A 1RPRA 3UO2A 3ETGA 2ZDIC 5TISZ 1VQKV 3OW2U 3C3SA 4EB6B 1XMQB 2P5OA 4IIJB 5DEDA 3OR7C 2BOBC 4MTFA 3F7YC 3HKBA 4UVAA 4Z1VA 1TA8A 3VQYA 3CPWU 4K0KO 4PD4F 1FXKA 5ITZB 2LGWA 1JPXA 2HFEC 2ZE5A 1LNQA 4YIPA 4MTXA 3GVMA 5H6RA 4ZOLA 3ZBHA 5IYDO 3QG5A 3JALA 3JARA 3E8HA 4JI4B 3KG2A 3IAYA 2P4VA 3AG3C 3ZN1A 4MVZA 2X0LA 1N0JA 2QJ1A 1AVMA 3L70H 3STLC 2O57A 5CMUA 5B3SC 3LSUA 2Q69A 4U7OA 2NN4A 3X2QB 2UXBB 5LHGA 3JAWA 5KAIZ 4KHPB 4TUYB 1QLEB 3FB8C 2EILB 4X89A 2LO1A 1PPJH 3A0HZ 5L3DA 2GUZB 3QVNA 2C2AA 5JVDB 2ZINA 1NH2D 4JAVA 3SYOA 2ZDIA 4I0XA 3UO3A 1OCCC 3CRQA 2A79B 3X2QC 4O2BB 5IYZB 3MAQA 1E1QG 4KHPO 1N0NA 3CCUV 4I4TB 2CTWA 2M7WA 2ITCC 2Q8VA 3NR7A 1VQMV 4PDMA 2EINC 4A5UB 4OXSA 3FYIB 3RN4A 1AI5A 4J10A 2H94A 4J9ZB 3Q4HB 1NH2B 5KUKA 4ZIBA 4JV5B 3ETEA 5LP6B 4DR4B 1YZBA 1NR1A 3LNNA 4UB8Z 3BEHA 1KUQA 4X64B 2ZNIA 2ETNA 1R3LC 1NTKH 2QA4V 3VOUA 4GKJO 1ZUQA 4I7ZB 1KBHA 2DJVA 1VQPV 1K9MW 4BIZA 2W6IG 5KHKA 4DUZB 1G6UA 1SC5B 2VRZA 4IHJA 1VARA 2EJ7A 1FXKC 3L71H 4QNHB 4WFHA 4JI0O 1WJZA 2JRIA 3AG2C 1S5JA 3ZX6A 2ARHA 2QGNA 1MOFA 1JFFB 2ZXWB 4BR6A 1EZVH 2QWOB 2A3QA 3AG1B 2QWRB 5CA3A 3E83A 4LWSA 1VMGA 3B4SA 5C8YA 4LF8O 4RWUA 3K5NA 3JALB 3JARB 2Y0PA 3CCVV 5HFMA 4K3AA 4W4LA 2UUBO 3ASOC 2QWPB 4TOIA 4UCTA 4CH5A 2QTSA 5LHIA 3B77A 3OMIB 4N23A 1DTOA 1RP3B 3B09A 1AI6A 5LXTB 3JCZA 1MZEA 2FL4A 3GWOA 3RYHA 4KP4A 3CHXA 3IC9A 5LA6B 3UCSC 1OCOC 5LA6A 3JASA 4O4HA 4UCVA 2Q6AA 1GN3A 2KSDA 4I50B 3G4SV 3OE7G 3STZC 2Q4PA 2BTOA 4DRXB 5KLVH 3J80N 2ZE6A 2N74A 1EFRG 4JI5B 1HNWO 2Q7HA 5FNVB 2Q5ZA 4JYAO 1WPBA 4IYHA 3E2EA 1LR1A 1AP6A 3W7WA 3M8AA 4LWSB 1QNMA 2R9RB 3O9OA 4NTWA 5IY5C 3WFVA 4CS2A 3CB2A 2QE7G 3T1YO 4JYAB 1GO3F 2A06H 1SETA 3BHPA 3RYFB 1BMFG 2ZT9B 3HKEB 4DW0A 1SQPH 1G8MA 3GWKC 4B3SB 3VQWA 3EFFK 1XQ8A 3CE2A 2JVDA 1VQ4V 2JEUA 1QQCA 1W2BU 1RSOA 4TV9B 4MVRA 1EZJA 4ZHQB 1D5AA 3VQVA 1ORQC 4JTDB 1SQFA 1YXBA 5IYCO 1URFA 3BABA 4OPHA 2UXXA 2YEVA 3FFQA 5J2UB 4DV5B 5D5QA 1E1RG 1VF7A 4XBFA 2ZIMA 4I9QA 4K0KB 2PYJA 3ABUA 3BFRA 1BCCH 2IJKA 2WLIA 3K5OA 3ZRXA 2PI5A 1NU1H 1XEQA 4R8CA 2IU0A 1IBMB 4DXWA 3EVKA 4X1KB 2LGQA 2ZKOA 3OUFA 2DYSB 3T1HO 2YS8A 3B8NA 2YIBD 3ZRWA 2R9IA 2X7RB 2Z5UA 1HNXO 4PHZA 2P06A 1PKXA 5BMVB 3JASB 1FJGB 5DECA 2JDIG 4B3TO 3L74H 5CA0A 3UQ8A 3AG7A 4LC1A 4JPRA 1AI7A 4QE7A 4OGQB 1FS0G 5EIBD 2DW4A 4YY3O 5EBMC 1Q81W 5EZYA 4P30A 1R73A 4GKJB 3SR2C 1KU9A 1KMIZ 3K58A 1W59A 1BT8A 1GRJA 4CH3A 3P3PA 4PELA 4X64O 2VWJA 1RM1B 4Z2WA 3K9AA 4YIOA 1YITV 3NXSA 5F2VO 5L3CA 3T1CA 2B5UA 4KUMA 4X20A 4BAYA 4FM0A 4WFFA 1SESA 1SKVA 2EIKB 3UKMA 4TQDA 2CH7A 1NTZH 4RO2A 3CX5F 4JI2B 1KKCA 3ABLB 4CH4A 2DN9A 2YC0A 4NB5A 1I5YA 1Q7YW 1IXBA 3E35A 4NYKA 3AG3B 5EZYB 1F4MA 5KHHA 1GM8A 3SJQC 3ABKC 3H1LH 4O4JA 3D3QA 4X66O 3R65A 4PV1B 3ASNC 5E1AC 3WB1A 2QM8A 1FFTB 4DR3B 4JASA 1JMKC 1JA8A 2DWEC 3FAVA 2LP7A 3N2KB 5BZBA 1L0LH 2OTLV 2XOKG 1N32B 2F93B 2OT5A 4LFBB 1L0NH 2UUBB 1MABG 1PP9H 2CTRA 4HNAA 5GTHZ 2Q67A 3JSNA 4JF3A 2WSSG 3T1YB 2OCCB 2UU9B 4LFCB 2IH3C 2Q68A 3JSLA 1JJOA 2BE3A 4YJ3B 4XDKA 4PA4A 4LH6A 3ZEDA 3BVOA 5LL6Y 1SQQH 1XMOB 4JI2O 1LUVA 5CBGA 1T5EA 4H44B 3E8GA 2JJ2G 5B1NA 3L73H 2Y69C 3CCMV 4X20B 5EC2C 2G38A 2OCHA 4GT1A 2BOCC 4HZ3A 4GX1A 3CXHF 4FMTA 4EFBA 4JAUA 5GTIZ 3H9VA 4FM1A
chains in the Genus database with same CATH topology
4HYOA 1YJ9V 2Q69A 4U7OA 3X2QB 5LHGA 1MG1A 1UJWB 2XAQA 1S72V 1FXHA 1OCRB 3W7TA 1QLEB 3FB8C 1W0JG 2EILB 4GX0A 4H37A 1M56C 3LDCA 3LDDA 1Y4MA 4X89A 2P7TC 4FIPC 3ML0A 5L3DA 2WWWA 2C2AA 4QJFB 2QTOA 3ABLC 1NH2D 4JAVA 3SYOA 2ZDIA 4PDVA 1OCCC 3OAAG 1BHBA 2B1GA 3BY6A 2A79B 4RQEA 1NBMG 2XNDG 3K03A 3X2QC 2WAMA 3MD0A 1E1QG 3SPCA 2DWDC 1KECA 2WLIB 5CBHA 3CCUV 4CZZA 2CK3G 5B1OA 3LNMB 1ROPA 5EK0A 4PA9A 2M7WA 2P67A 2ITCC 4QIWF 4WFGA 4MVMA 1VQOV 1VQMV 4UXNA 2EIMB 4PDMA 2EINC 5L3BA 4OXSA 3FYIB 2EIMC 1AI5A 2QM7A 3SYAA 2H94A 3A0RA 1M90W 2WLLB 4MTOA 4J9ZB 3FB5C 1Y66A 2QEXV 1NH2B 3K79A 5KUKA 3SPHA 3G6EV 1WLEA 5H9CA 3ETEA 1M1KW 5KA6A 4BW5A 1VQNV 4WFEA 2WLHA 3QO5A 3OM3B 1NR1A 3BEHA 2V7QG 4TT3G 3T2MA 3OFNG 1R3LC 3CC4V 2HJFC 2QA4V 3VOUA 3VBBA 1R3JC 1P7BA 3B8MA 2Y69B 4UUJC 4WF9V 1JQ0A 1YHQV 1OCZC 5L3FA 4LP8A 1KD1W 3ZRSA 3CCRV 1NR7A 1VQPV 1K9MW 4I9WA 1E79G 4U7NA 4BIZA 2W6IG 4FK5C 3SPJA 4KFMA 5LGTA 3ZN0A 2ZXWC 1SRYA 2XAJA 3LSSA 1RM1C 3LDEA 3I56V 3ABMB 1FXKC 2OTJV 3CC2V 4PDRA 1L1FA 4QNHB 1H2GA 4WFHA 2HKOA 5LGNA 1NJIW 4EKWA 2QKSA 3OMNB 3AG2C 1KC8W 4UV8A 5IY5B 2YSUB 1MOFA 3ASNB 3ZRVA 3AG4C 2ZXWB 4R50A 1YI2V 2LFRA 4MVSA 4JYBA 1CEZA 3AG1B 3ZMTA 2XAFA 1AROP 3K08A 1AR1B 4L87A 2HG5C 4ASUG 5DM6V 1H8EG 1QLEC 2ZD9A 4MW3A 4LBEC 5CA3A 3P32A 2Y48A 3E83A 2WLNA 1QVFU 4RQFA 1J95A 2ATKC 3JD2A 3MHSC 3ZMSA 2P6JA 3T4DA 3ZJZA 1PNLA 4MTGA 2DYSC 3CCVV 5B1AC 5HFMA 1K73W 1VQ6V 3ASOC 2EZOA 1XL6A 2LFSA 1R6NA 4YXWG 3DGEA 3CMAV 5LHIA 3B77A 3OMIB 4N23A 4P9PA 1DTOA 1AI6A 5J9PC 3CCJV 2DYRC 5B1BB 2DQ3A 4RAIA 3JCZA 1OCRC 2H8PC 4Z1MG 3CCQV 1VQLV 4I5SA 1QLNA 3GWOA 1WPXA 4KP4A 2NLJC 4QPKA 1OCZB 2IU3A 1GK9A 1CP9A 1S77D 1OCOC 1QR9A 1H38A 1YIJV 1GM7A 2EJRA 2W0FC 3M99B 2Q6AA 3CCSV 3F5WC 3G4SV 2HR3A 2WPDG 3K0DA 3OE7G 2XAHA 4QPJA 3ZCCA 3STZC 5LGUA 4JGSA 5LHHA 4G27B 3RBZA 5CN0A 1M57C 2KB1A 2X6AA 1EFRG 3JYCA 1TUEB 3LSQA 2AHZA 3HB3B 4MVUA 2Z3YA 4F4LA 2IJJA 3JD0A 1N8RW 3E2EA 3T4ZA 3TETA 3ABTA 3W7WA 5CBFA 1PNKA 5EC1C 2V1DA 1M9NA 1FXVA 2R9RB 1K8AW 5IY5C 3ABMC 1OZ0A 3WFVA 5B3SB 2DQ0A 1S76D 2QE7G 4XDLA 3I55V 1YSCA 4MSWC 4X88A 1K92A 1GO3F 3FB6C 3CYOA 1THZA 1NVPB 2X6BA 1FXKB 1SETA 4UVCA 2ZR2A 2WLMA 2YEVB 1BMFG 1V54B 2JIZG 1BHAA 2EZPA 1G8MA 4GX5A 2A0LA 3EFFK 3WG7B 1VQ4V 1XL4A 2JK5C 3TCUA 1PNMA 2IH1C 2JEUA 3WG7C 1W2BU 4MW8A 3SYQA 3FYEB 4MVRA 2GHYA 4PA6A 1EZJA 2EILC 3ASOB 1ORQC 1H8HG 4FJCC 4JTDB 3CC7V 2X6CA 5IYCO 1QBZA 2UXXA 2YEVA 3OMAB 1OCOB 5FL7G 3JD1A 4E2LA 4G2KA 3K3WA 1E1RG 1R3KC 1V55B 4H33A 1JOYA 1VQ7V 5GW7A 4JTAB 4JTCB 3JD3A 4XBFA 4N21A 4TWKA 3P30A 1G4YB 3ABUA 4MT8A 2IJKA 2WLIA 3ZRXA 3RVZA 3AG4B 2DYRB 2PI5A 1M56B 5B1BC 1K34A 2MK3A 4R8CA 3IFXA 1QVGU 3ZIAG 4MS2A 2IU0A 1PD3A 1VQ5V 2IJIA 2EINB 4DXWA 1VQ9V 4JYCA 2F43G 4UV9A 3OUFA 4ZBMA 2DYSB 3QO8A 3B8NA 3CMEV 1JJ2U 3ZRWA 3CXCU 2EIJB 2R9IA 1KP3A 2X7RB 1NQTA 4PDLA 5L3EA 2Z5UA 3CCEV 3W7XA 3SYCA 1K4CC 3ABKB 3W7UA 1F4NA 1PKXA 3EHBB 4UVBA 3D36A 1Q86W 5C93A 1ENVA 4P9OA 3OUSA 3K06A 2JDIG 3ZMVA 3MHHC 1GMGA 3E8BA 4MVQA 1GKFA 4LC1A 4JPRA 1AI7A 4XDJA 4PA7A 4QE7A 4CBCA 1FS0G 1B6QA 4R7CA 1K3EA 1OHHG 2DW4A 3E89A 1YJWV 3ETDA 4RUFA 2HLDG 1Q82W 5EBMC 2EBOA 1DF4A 1Q81W 4P30A 1R73A 1DLBA 1KKDA 3AG2B 3G71V 1F51A 1F23A 2IJHA 1AJQA 1VQ8V 1YTFD 4WCEV 3ZMZA 3OEHG 1NVPD 4PELA 1MSWD 1ZWIC 3FB7C 1YTFB 1RM1B 2HVJC 3K9AA 4MVOA 4RUEA 1YITV 3E8FA 3NXSA 1EBOA 2ZR3A 1R3IC 5L3CA 3T1CA 2B5UA 4KUMA 3TK1A 2IW5A 4P2ZA 1QR8A 3GB7C 4BAYA 1K5SA 2JEXA 3OEEG 4ZKIA 1COWG 4BIUA 3IC7A 1K97A 4LCUC 4WFFA 5B1AB 5H6QA 5IDJA 1V55C 1SESA 4TSFG 2ZQMA 1JX9A 5LBQA 2EIKB 3UKMA 1AI4A 2PI4A 4J9YB 3RW0A 2EIKC 3SPIA 5IYBO 4RO2A 2UXNA 2W6JG 3CD6V 3ABLB 4R6ZA 3SPGA 4HAMA 2A9HA 3AG1C 1PL0A 1I5YA 3UM7A 1Q7YW 3E35A 3AG3B 4GX2A 1F4MA 5EBLC 1HWYA 4DO2A 1GM8A 3ZRWB 3SJQC 3JD4A 1BL8A 1V54C 3ABKC 1YJNV 2D3OW 2ITDC 2WLJA 3CP1A 3HPLC 3CCLV 4QE9A 3R65A 2K1EA 3QNEA 3ASNC 5E1AC 2WLKA 3W7SA 3PJSK 1S0VA 3D3IA 1KP2A 1FFTB 2QM8A 3OR6C 4JASA 3F7VC 3AEIA 5KUMA 1R6KA 5DN6G 5L3GA 2OCCC 3DTUB 2DWEC 2EIJC 2LP7A 5BZBA 1RPRA 3ETGA 3LUTB 2ZDIC 1VQKV 3E86A 1K4DC 4GCZA 2OTLV 2XOKG 1I5XA 2JJ1G 3OW2U 2HVKC 2OT5A 2P90A 3K0GA 5KA5A 1SZTA 1MABG 1GM9A 3OGCC 1K33A 3OR7C 2BOBC 4Q20A 2Q67A 4MTFA 4X8AA 4JF3A 2XASA 3F7YC 4FPPA 4WFAV 2WSSG 3QO7A 4UVAA 3FKSG 3H01A 2OCCB 3ZMUA 2IH3C 2GSMB 1NKDA 2Q68A 1JVMA 3IGAC 1DF5A 4PA3A 3CPWU 2WLLA 1AJNA 1FXKA 4PA4A 4XDKA 4WFBV 1RPOA 1JPXA 2HFEC 1GTOA 1P4RA 1LNQA 1W0KG 4MTXA 5H6RA 3RVYA 5IYDO 1S3JA 1IXMA 1SERA 3E8HA 5CBGA 5EBWC 2FTKA 3KG2A 3E8GA 3K04A 2JJ2G 5B1NA 1CPYA 3AG3C 3ZN1A 1M57B 2Y69C 4MVZA 3CCMV 5HFLA 1KQSU 2XAGA 5EC2C 4G28B 2X0LA 2NNUA 4GT1A 2BOCC 1K7DA 4GX1A 1QCEA 4HZ3A 2AHYA 1JCHA 1S5HC 3SYPA 1K5QA 1AJPA 4FMTA 3STLC 4JAUA 5CMUA 5B3SC 2B1IA 1OCCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJK A;  1ROP A;  1RPO A;  1F4M A;  2GHY A;  1NKD A;  1F4N A;  1PD3 A;  1GMG A;  1RPR A;  2IJI A;  2IJH A;  4DO2 A;  1GTO A;  2IJJ A;  3K79 A;  1B6Q A; 
#chains in the Genus database with same CATH topology
 4HYO A;  3JCU Z;  4OPA A;  4DV7 B;  1S72 V;  4YJ3 A;  2E76 B;  2AZ0 A;  1NT2 B;  4QJF B;  1YF2 A;  3BY6 A;  1TUB B;  5EYP B;  4FLV A;  2PGG A;  3K03 A;  2N04 A;  2WAM A;  3MD0 A;  2YI8 A;  4DV7 O;  4CC5 A;  5ITZ A;  2BTQ A;  3RYC A;  5BMV A;  4FVM A;  5LMU B;  3LNM B;  1XHX A;  2CGO A;  4X62 O;  4FLW A;  4GKK O;  2F95 B;  2HHH O;  2EIM C;  2QM7 A;  4X65 O;  3JAM N;  4AHC A;  4DV1 O;  3AK1 A;  3OTO O;  1SA0 A;  3T1H B;  1Y66 A;  2QEX V;  1QU7 A;  2CTP A;  3B2E E;  1VQN V;  5A2Q N;  2WLH A;  1HNZ O;  3KKY A;  1N33 O;  4TT3 G;  3T2M A;  1EN6 A;  3OFN G;  4KL1 A;  3ETQ A;  3JAK A;  2RQ6 A;  2Y69 B;  1OCZ C;  2VQF B;  4J7Z A;  5KHG A;  3CCR V;  4U7N A;  1Q6I A;  3SPJ A;  4KFM A;  4DR4 O;  1Z5V A;  4TV9 A;  4YY3 B;  1SRY A;  1HNZ B;  3LSS A;  1RM1 C;  3LDE A;  3I56 V;  1GN2 A;  2OTJ V;  4NTX A;  4DYL A;  2CUG A;  2LJ2 A;  5JH7 B;  5LGN A;  3HKD B;  2BSK B;  1AIL A;  4EKW A;  4LFA B;  4LH7 A;  5BY1 A;  3R66 A;  2PTM A;  2PUS A;  3ZRV A;  3AG4 C;  1NZ6 A;  1P49 A;  2LFR A;  2L6L A;  3BA9 A;  4JYB A;  2CGN A;  1ZLZ A;  2XAF A;  2Y0I A;  5KMG A;  3AK3 A;  4K8Z A;  5DM6 V;  1U97 A;  3P32 A;  4JI3 B;  2WLN A;  4RQF A;  1WAZ A;  3JD2 A;  2ZE7 A;  3T4D A;  3SJC C;  3ZJZ A;  3E22 B;  3L72 H;  2DYS C;  1P84 F;  2YUA A;  4DV2 O;  5B1A C;  1K73 W;  2YXY A;  3DXR A;  1AB3 A;  2CH7 B;  2LFS A;  3B40 A;  1UPG A;  4CS3 A;  1Y74 A;  1N33 B;  5J9P C;  3G6B A;  2DQ3 A;  5B1B B;  3I5D A;  4U3J A;  1OCR C;  2H8P C;  2B9Z A;  1M93 A;  4X1K A;  2N05 A;  3ZHU A;  3RYH B;  1OCZ B;  1V9P A;  2IU3 A;  1TUB A;  1S77 D;  1QR9 A;  4DK0 A;  3TJT A;  4U3F H;  4B7E A;  4JV5 O;  4CS4 A;  1YJN V;  3K0D A;  3ZCC A;  1ZX3 A;  3RBZ A;  4J7J A;  1H2M A;  2KB1 A;  3E22 A;  4HBN A;  2QKA A;  4BIO A;  1MA1 A;  2Z3Y A;  2IJJ A;  1SQB H;  3JD0 A;  1N8R W;  3T4Z A;  5KHJ A;  3BA8 A;  3TET A;  2EUL A;  3C3T A;  1FYJ A;  5CBF A;  1JR9 A;  1J5E O;  2YIA A;  4EFE A;  4F6E A;  1K8A W;  4E4E A;  1YVW A;  4DR7 B;  5D5P A;  4XDL A;  4MSW C;  2BSK A;  3FB6 C;  3CYO A;  1NVP B;  4JI8 B;  2ZR2 A;  1QHT A;  1V54 B;  3HKC B;  1BHA A;  3WG7 B;  1J5E B;  1XL4 A;  3TCU A;  2UXC B;  2VS0 A;  4DV6 O;  3H1K H;  4MW8 A;  1VIB A;  1XMQ O;  1ZTE A;  4FJC C;  2XT9 A;  4HNA B;  5JJN B;  1QBZ A;  3UT5 B;  1BS3 A;  1FPO A;  1H2S B;  3M7M X;  3OMA B;  2L35 A;  5CB4 B;  1OCO B;  3K3W A;  2GDS A;  1R3K C;  1JOY A;  5LMN B;  2ADQ B;  3JD3 A;  4IL6 Z;  4N21 A;  2YIB A;  4MT8 A;  3RVZ A;  4GZR B;  3CRA A;  5B1B C;  4JI5 O;  3IFX A;  2UU9 O;  3ZIA G;  3L9D A;  2WA4 A;  1VQ9 V;  5EYP A;  4FZ1 A;  3RGB A;  3QO8 A;  4UB6 Z;  1JJ2 U;  1OJH A;  5A9G A;  4O4L A;  1I08 A;  4PDL A;  3TXQ A;  4DR5 O;  1K4C C;  2HHH B;  4UVB A;  1AP5 A;  2R70 A;  3ZHS A;  4P9O A;  1OV9 A;  2KKW A;  3ZMV A;  2FB5 A;  1VEW A;  1VF6 C;  3ZHR A;  4DV0 B;  4IYI A;  4MVQ A;  2OWO A;  4PA7 A;  3EXA A;  1SA0 B;  5FNV A;  4DR6 B;  4LF5 B;  2UXB O;  1YJW V;  1Q82 W;  2HLD G;  2DE0 X;  1DF4 A;  5FPO A;  1DLB A;  3AG2 B;  4U3J B;  3G71 V;  1JFF A;  2VQF O;  2YI9 A;  2PYL A;  4B7K A;  2ZM6 B;  1ZWI C;  1YTF B;  4DV4 B;  2HVJ C;  4UFZ A;  2BCC H;  4NXN B;  5JWP A;  1R3I C;  3TK1 A;  2E5L B;  4P2Z A;  1DGS A;  1QR8 A;  3GB7 C;  4D6T H;  2JEX A;  3OEE G;  2RNB A;  1COW G;  2VQE B;  5B1A B;  5H6Q A;  5FPR A;  4ICG A;  1HR0 B;  2F23 A;  4TSF G;  2ZQM A;  5LBQ A;  3CSX A;  3RW0 A;  3CS5 A;  3U0Z A;  4GKK B;  1TGO A;  2EIK C;  3SPI A;  3CJH A;  4WBN B;  1XOU A;  3UT5 A;  4X65 B;  4HAM A;  2A9H A;  1FAF A;  2OYQ A;  4LF7 O;  3UM7 A;  4D7T A;  1EN4 A;  1HWY A;  1H2N A;  1XBL A;  3HKB B;  2WLJ A;  3CP1 A;  3HPL C;  4QE9 A;  2K1E A;  3W7S A;  1KP2 A;  2JGD A;  3F7V C;  5KUM A;  4H13 B;  2JS5 A;  5DN6 G;  5L3G A;  1IBM O;  1SS3 A;  1Y76 B;  4JI3 O;  2FYU H;  1MNG A;  4OX9 O;  4FFB A;  1K4D C;  1XNR B;  1I5X A;  2JJ1 G;  2HVK C;  4JI0 B;  4GUN A;  2P90 A;  2Q7G A;  3K0G A;  2ZM6 O;  1GM9 A;  3OGC C;  1Y6X A;  2QM4 A;  5C8Y B;  2ZE8 A;  4X8A A;  5KHI A;  2GBO A;  4I55 A;  3ICX A;  2XAS A;  4FPP A;  2W0X A;  4WFA V;  2QR4 A;  2E5L O;  3CRR A;  3WB0 A;  1RSO B;  3FKS G;  2FML A;  3H01 A;  1GN6 A;  3ZMU A;  1M5I A;  1JVM A;  3IGA C;  1DF5 A;  4PA3 A;  1AJN A;  2V4D A;  1G1X B;  2AGA A;  1Y76 A;  5FLX N;  1GTO A;  4FLZ A;  1W0K G;  1B06 A;  3APO A;  1IXM A;  1SER A;  2YID A;  5EBW C;  2FTK A;  3RYI B;  3FX7 A;  2K9P A;  1M57 B;  1EN5 A;  5HFL A;  5CA1 B;  2NNU A;  1QCE A;  1JCH A;  2RDC A;  1I94 O;  1S5H C;  1K5Q A;  1AJP A;  1N36 B;  1IDS A;  1IBL O;  5H2F Z;  1Q3E A;  4D7S A;  2JGU A;  1YDX A;  1Z2G A;  1YJ9 V;  3OTF A;  2HP8 A;  1R6T A;  1MG1 A;  1UJW B;  2UXD B;  1W0J G;  4H37 A;  1M56 C;  3LDC A;  3LDD A;  4FIP C;  3ML0 A;  1US6 A;  4JI8 O;  2WWW A;  3ABL C;  3RT3 C;  4LF8 B;  4PDV A;  5JVD A;  3CRC A;  1IBL B;  3OAA G;  5JJE B;  2B1G A;  4RQE A;  1NBM G;  2XND G;  4TQF A;  4H0L B;  3SPC A;  2UXD O;  2DWD C;  1XMO O;  5CBH A;  1HNW B;  4JI6 O;  2CK3 G;  5B1O A;  3WU2 Z;  1ROP A;  5EK0 A;  4PA9 A;  4QIW F;  2HEP A;  3TGU H;  1VQO V;  3N27 A;  2RJZ A;  4CH6 A;  4UXN A;  2EIM B;  3F5T A;  3KZI Z;  5L3B A;  4B3M B;  1SQV H;  3SYA A;  2AW9 A;  3A0R A;  1PL4 A;  1M90 W;  1Y67 A;  4MTO A;  1O9H A;  3SDL A;  3SPH A;  1WLE A;  1DK1 A;  1ZSP A;  5KA6 A;  2R9A A;  2V7Q G;  2GTS A;  1IBK O;  4FFB B;  4NXN O;  3CC4 V;  4AIL C;  4TUY A;  1P7B A;  4UUJ C;  4WF9 V;  1JQ0 A;  3HKD A;  1YHQ V;  5L3F A;  1NR7 A;  4I9W A;  1E79 G;  5LGT A;  2YXL A;  3BCC H;  4JYY A;  5JQG B;  2XAJ A;  2CE4 A;  1H2L A;  3ABM B;  5IJ9 B;  3CC2 V;  4O4J B;  4PDR A;  1EM1 A;  1NJI W;  2QKS A;  5CB4 A;  2YSU B;  4J7K A;  4R50 A;  3SGI A;  3A2F A;  1I7F A;  5KX5 B;  2H3O A;  3K08 A;  1WNS A;  4ZHQ A;  1UFI A;  1QLE C;  1YEW A;  4B3R B;  4LBE C;  1B3Q A;  1QVF U;  4JI7 B;  2ATK C;  2Y4T A;  2P22 C;  3MHS C;  4BW9 A;  2P6J A;  3ZMS A;  4DV5 O;  1PNL A;  4MTG A;  1NS1 A;  2Q0A A;  1MZF A;  1L8D A;  3PN1 A;  3K5M A;  2EZO A;  2RN9 A;  3MDS A;  1R6N A;  4YXW G;  3CMA V;  4FLY A;  4P9P A;  1TAE A;  1ZAU A;  4W4K A;  2DYR C;  4DR6 O;  4Z1M G;  3CCQ V;  1VQL V;  1SQG A;  1CP9 A;  3K57 A;  4LFA O;  5LP6 C;  4JAA A;  3F5W C;  1N4C A;  2HR3 A;  5LGU A;  4QPJ A;  5LHH A;  1KYO F;  2E3C A;  2CDY A;  5CN0 A;  2X6A A;  1AR4 A;  3JYC A;  2D2C B;  3LSQ A;  4DV3 O;  2KQX A;  1FFX A;  1HR0 O;  2OIE A;  4FFK A;  1U96 A;  1ZL8 B;  1N34 O;  2JGD B;  3ABT A;  1D5N A;  1PNK A;  4UCR A;  1OZ0 A;  4IT5 A;  4X66 B;  4LF4 O;  4LF6 B;  1BSM A;  2A7W A;  5KX5 A;  3IJ4 A;  1S76 D;  2MW2 B;  3DXR B;  4UCU A;  1BQZ A;  4LF9 O;  4UVC A;  4GX5 A;  1IUR A;  2JK5 C;  5IYZ A;  1IZ3 A;  3FYE B;  3KCX A;  2EIL C;  4JI6 B;  3ASO B;  4FLT A;  1H8H G;  2VWK A;  2GUZ A;  2X6C A;  2UUA O;  2YXH A;  1XRE A;  3JD1 A;  5FL7 G;  4G2K A;  1N36 O;  5GW7 A;  4LR3 A;  4JTC B;  2HJD A;  2DOS A;  3P30 A;  1G4Y B;  4YJ2 A;  5JCO C;  3AG4 B;  1M56 B;  1NI8 A;  1QVG U;  1K34 A;  2MK3 A;  3Q4H A;  4PJ0 Z;  3ZS8 C;  3J81 N;  3RWR D;  1VQ5 V;  2F66 C;  2IJI A;  5LXT A;  3CME V;  4K8X A;  3U10 A;  3RFR A;  1KP3 A;  5LYJ A;  3L75 H;  1NQT A;  1XNQ B;  5L3E A;  3OT7 A;  3SYC A;  4Q6G A;  3ABK B;  1F4N A;  3EHB B;  2FKX A;  3D36 A;  4DV1 B;  1WP7 A;  5C93 A;  1IVS A;  1ENV A;  5IT9 N;  1NTM H;  2GV9 A;  4LNU B;  3WB2 A;  3MHH C;  4AQY B;  3E8B A;  2QSA A;  2Z0A A;  4R7C A;  2DMX A;  4DUZ O;  1OHH G;  1CXZ B;  1GN4 A;  2EBO A;  4LNU A;  4O4I B;  1KKD A;  4J41 A;  3KCY A;  1F23 A;  1AJQ A;  1VQ8 V;  4WCE V;  1R1B A;  3ZMZ A;  1MSW D;  2GTA A;  1WN7 A;  3FB7 C;  3JAK B;  4X1Y B;  4RUE A;  3E8F A;  3C90 A;  2ZR3 A;  1N32 O;  4QGP A;  1BGY H;  3CEI A;  3VQX A;  3IC7 A;  2OIG A;  5IDJ A;  4I0X B;  5BR8 O;  4B3S O;  4FLU A;  1V55 C;  4ZOL B;  5JCO A;  2PI4 A;  5IJ0 A;  1IX9 A;  5IYB O;  4J80 A;  2UXN A;  2W6J G;  3CD6 V;  4R6Z A;  1X4T A;  3TXS A;  5K1P A;  3AG1 C;  4EB6 A;  3RYF A;  4O4H B;  3FAV B;  5EBL C;  4DR5 B;  3DC5 A;  2AZ2 A;  2XTA A;  3ZRW B;  1BQ0 A;  3JD4 A;  2D3O W;  4F6R B;  2ITD C;  2R72 A;  3CCL V;  1SF9 A;  3D36 C;  2WLK A;  5K1X A;  4IIJ A;  3D3I A;  3AEI A;  4DV2 B;  4NTY A;  5GON B;  4LF7 B;  1R6K A;  2QWQ B;  5J2T B;  1KB9 F;  4DV3 B;  4GLX A;  4ABM A;  3LUT B;  3K9S A;  3E86 A;  3CJH B;  4GCZ A;  1N34 B;  3OD4 A;  2Q7E A;  5B5E Z;  5KA5 A;  1SZT A;  1K33 A;  4Q20 A;  4NR1 A;  1WP8 A;  3QO7 A;  1Q6U A;  4X9Q A;  4DW1 A;  2GSM B;  1NKD A;  3JAW B;  2WLL A;  4I50 A;  1Y74 B;  4WFB V;  1RPO A;  4JZG A;  4DR2 O;  3ZHT A;  3CRM A;  1P4R A;  3RVY A;  4AI8 A;  1S3J A;  4B3R O;  3K04 A;  4J11 A;  1CPY A;  3SJB C;  2XHB A;  4O2A B;  4O2B A;  4DR1 B;  1KQS U;  1HNX B;  2XAG A;  2IBZ H;  4G28 B;  4EEQ A;  1K7D A;  4NXM O;  2AHY A;  3H1J H;  4OX9 B;  1WA8 B;  3SYP A;  4GYC B;  2PZS A;  2B1I A;  5EIB C;  1OCC B;  4YJ2 B;  2F1M A;  4LF4 B;  1RFY A;  2XAQ A;  3THO A;  1FXH A;  1OCR B;  3W7T A;  4FM2 A;  4GX0 A;  1Y4M A;  2P7T C;  1WB7 A;  2QTO A;  4LFC O;  1TVK B;  3DSQ A;  1BHB A;  2M6Y A;  3N2G B;  4O2A A;  3DC6 A;  1KEC A;  2WLI B;  5IWA B;  4CZZ A;  1A32 A;  3CWB H;  4I4T A;  2KG7 B;  2P67 A;  4WFG A;  4BWA A;  2KG7 A;  4MVM A;  1XHZ A;  1Q5O A;  4DR7 O;  1VP7 A;  5LYJ B;  2P4K A;  5J2T A;  1X59 A;  1PV0 A;  1HW7 A;  2WLL B;  4LFB O;  3N2G A;  3FB5 C;  5JH7 A;  4NVP A;  3K79 A;  3G6E V;  5H9C A;  5BXZ A;  1M1K W;  4BW5 A;  4WFE A;  1M4U A;  4L8J A;  4X1I B;  3QO5 A;  1PM9 A;  3OM3 B;  4NXM B;  2IM9 A;  2HJF C;  3VBB A;  1R3J C;  5B66 Z;  3B8M A;  2YDE A;  3G80 A;  4DV0 O;  4LP8 A;  4AQY O;  3D8C A;  1KD1 W;  3ZRS A;  4DR3 O;  1XUQ A;  2UUC B;  4FK5 C;  4IHJ B;  1Q43 A;  1Q8I A;  3ZN0 A;  2ZXW C;  2CTQ A;  4DUY B;  1L1F A;  1H2G A;  2HKO A;  3A8T A;  2E75 B;  2JS3 A;  4DK1 A;  2ODM A;  3OMN B;  1KC8 W;  4CC6 A;  4UV8 A;  2UUC O;  5IY5 B;  3ASN B;  5GON A;  4UCS A;  4JI1 B;  1YI2 V;  1FD9 A;  4NKG B;  2QWN B;  4MVS A;  5H5N A;  4DUY O;  1CEZ A;  2BTQ B;  3ZMT A;  1ARO P;  1AR1 B;  4L87 A;  2HG5 C;  4ASU G;  2NR5 A;  5KAF Z;  1H8E G;  1XI1 A;  2ZD9 A;  4MW3 A;  4KXR A;  2Y48 A;  1J95 A;  2LQT A;  4TV8 B;  5BR8 B;  3ZHQ A;  4JI1 O;  1VQ6 V;  3RYC B;  1XL6 A;  4X1Y A;  3DGE A;  4WBN A;  1LUW A;  1H2K A;  1BE3 H;  3CCJ V;  4RAI A;  4LF5 O;  2AXT Z;  3O65 A;  4I5S A;  1AR5 A;  1QLN A;  2EX3 A;  4O4L B;  5LOV B;  1WPX A;  2NLJ C;  4QPK A;  2QKC A;  3BAA A;  1FKA O;  5IJ9 A;  1GK9 A;  1H38 A;  1YIJ V;  2PF4 E;  3SJA C;  1GM7 A;  2EJR A;  2LW7 A;  3RYI A;  2W0F C;  2ZCE A;  3M99 B;  4PI2 A;  3CCS V;  4IGG A;  3H1I H;  2ADP A;  2WPD G;  1Q90 D;  2XAH A;  4JGS A;  4G27 B;  1Z5W A;  1M57 C;  4TV8 A;  3BPZ A;  1SZX A;  1TUE B;  2AHZ A;  3HB3 B;  4DR1 O;  5LMU O;  4MVU A;  4F4L A;  2E74 B;  4JI7 O;  2Y4U A;  5EC1 C;  4I55 B;  5LOV A;  2V1D A;  1M9N A;  1FXV A;  2RMK B;  3ABM C;  5B3S B;  2DQ0 A;  3JAT B;  3K5L A;  1BZK A;  3I55 V;  1YSC A;  2PY5 A;  4DV4 O;  4X88 A;  1K92 A;  3BRC A;  1THZ A;  3OTO B;  3HKC A;  2X6B A;  3U11 A;  1FXK B;  2WLM A;  2YEV B;  2F4V O;  2JIZ G;  4DRX A;  2EZP A;  4ZI7 A;  2A0L A;  3N2K A;  1PNM A;  2IH1 C;  4FLX A;  4PI0 A;  1HP8 A;  3WG7 C;  3SYQ A;  3S3X A;  2GHY A;  4PA6 A;  1VF5 B;  4JI4 O;  5IWA O;  4B3T B;  1XIL A;  3H1H H;  1MMM A;  1ZL8 A;  1P7G A;  2Q9L A;  3CC7 V;  3HKE A;  4ZI7 B;  4E2L A;  2ILM A;  1V55 B;  4H33 A;  1VQ7 V;  4X1I A;  4JTA B;  4UCO A;  4TWK A;  1VF6 A;  4DR2 B;  1YCI A;  2DYR B;  3G67 A;  1GH6 A;  1WA8 A;  3HR0 A;  1GAX A;  1FJG O;  4MS2 A;  1O9G A;  4LF6 O;  1PD3 A;  2EIN B;  4JYC A;  2F43 G;  4UV9 A;  4ZBM A;  5IE9 A;  2VQE O;  4JZ2 A;  3CXC U;  2CAZ C;  2EIJ B;  1XNR O;  4LF9 B;  3CCE V;  4K35 A;  3W7X A;  2XUM A;  3W7U A;  1Q86 W;  1WB8 A;  4O4I A;  5LP6 A;  1B04 A;  3OUS A;  3K06 A;  1TVK A;  1I94 B;  2F4V B;  1GMG A;  1GKF A;  4XDJ A;  1Q6H A;  4CBC A;  1B6Q A;  1K3E A;  3E89 A;  3ETD A;  4RUF A;  5E79 Z;  5LMN O;  1SQX H;  1F51 A;  2IJH A;  1YTF D;  3OEH G;  4B08 A;  1NVP D;  3JAT A;  2YIC A;  3OGI B;  4MVO A;  1MSD A;  4C7U A;  1EBO A;  2QDO A;  1F7Y A;  1HDJ A;  3AK2 A;  5KMG B;  2IW5 A;  5CA1 A;  4ZKI A;  1K5S A;  4BIU A;  4LCU C;  1K97 A;  5CA0 B;  4B3M O;  3ZHV A;  1S5L Z;  5JQG A;  2RCV A;  2ZNJ A;  1XNQ O;  2UXC O;  1JX9 A;  1AI4 A;  4J42 A;  4J9Y B;  3S3W A;  1FFX B;  3SPG A;  2WA3 A;  2LW1 A;  1PL0 A;  4GX2 A;  3QF7 A;  1D2D A;  4YHH O;  3J7A U;  4DO2 A;  2UUA B;  3P3N A;  3FD9 A;  5IJ0 B;  1BL8 A;  1V54 C;  5J2U A;  3QNE A;  1S0V A;  3PJS K;  3QTC A;  3OR6 C;  1XDC A;  1IBK B;  3K59 A;  3A0B Z;  5AG2 A;  3APQ A;  4DV6 B;  2OCC C;  2ZIO A;  4X62 B;  5JJJ B;  2Q0O C;  3DTU B;  4YHH B;  4F6R A;  2EIJ C;  2Q73 A;  1I0H A;  4FZ0 A;  1RPR A;  3UO2 A;  3ETG A;  2ZDI C;  5TIS Z;  1VQK V;  3OW2 U;  3C3S A;  4EB6 B;  1XMQ B;  2P5O A;  4IIJ B;  5DED A;  3OR7 C;  2BOB C;  4MTF A;  3F7Y C;  3HKB A;  4UVA A;  4Z1V A;  1TA8 A;  3VQY A;  3CPW U;  4K0K O;  4PD4 F;  1FXK A;  5ITZ B;  2LGW A;  1JPX A;  2HFE C;  2ZE5 A;  1LNQ A;  4YIP A;  4MTX A;  3GVM A;  5H6R A;  4ZOL A;  3ZBH A;  5IYD O;  3QG5 A;  3JAL A;  3JAR A;  3E8H A;  4JI4 B;  3KG2 A;  3IAY A;  2P4V A;  3AG3 C;  3ZN1 A;  4MVZ A;  2X0L A;  1N0J A;  2QJ1 A;  1AVM A;  3L70 H;  3STL C;  2O57 A;  5CMU A;  5B3S C;  3LSU A;  2Q69 A;  4U7O A;  2NN4 A;  3X2Q B;  2UXB B;  5LHG A;  3JAW A;  5KAI Z;  4KHP B;  4TUY B;  1QLE B;  3FB8 C;  2EIL B;  4X89 A;  2LO1 A;  1PPJ H;  3A0H Z;  5L3D A;  2GUZ B;  3QVN A;  2C2A A;  5JVD B;  2ZIN A;  1NH2 D;  4JAV A;  3SYO A;  2ZDI A;  4I0X A;  3UO3 A;  1OCC C;  3CRQ A;  2A79 B;  3X2Q C;  4O2B B;  5IYZ B;  3MAQ A;  1E1Q G;  4KHP O;  1N0N A;  3CCU V;  4I4T B;  2CTW A;  2M7W A;  2ITC C;  2Q8V A;  3NR7 A;  1VQM V;  4PDM A;  2EIN C;  4A5U B;  4OXS A;  3FYI B;  3RN4 A;  1AI5 A;  4J10 A;  2H94 A;  4J9Z B;  3Q4H B;  1NH2 B;  5KUK A;  4ZIB A;  4JV5 B;  3ETE A;  5LP6 B;  4DR4 B;  1YZB A;  1NR1 A;  3LNN A;  4UB8 Z;  3BEH A;  1KUQ A;  4X64 B;  2ZNI A;  2ETN A;  1R3L C;  1NTK H;  2QA4 V;  3VOU A;  4GKJ O;  1ZUQ A;  4I7Z B;  1KBH A;  2DJV A;  1VQP V;  1K9M W;  4BIZ A;  2W6I G;  5KHK A;  4DUZ B;  1G6U A;  1SC5 B;  2VRZ A;  4IHJ A;  1VAR A;  2EJ7 A;  1FXK C;  3L71 H;  4QNH B;  4WFH A;  4JI0 O;  1WJZ A;  2JRI A;  3AG2 C;  1S5J A;  3ZX6 A;  2ARH A;  2QGN A;  1MOF A;  1JFF B;  2ZXW B;  4BR6 A;  1EZV H;  2QWO B;  2A3Q A;  3AG1 B;  2QWR B;  5CA3 A;  3E83 A;  4LWS A;  1VMG A;  3B4S A;  5C8Y A;  4LF8 O;  4RWU A;  3K5N A;  3JAL B;  3JAR B;  2Y0P A;  3CCV V;  5HFM A;  4K3A A;  4W4L A;  2UUB O;  3ASO C;  2QWP B;  4TOI A;  4UCT A;  4CH5 A;  2QTS A;  5LHI A;  3B77 A;  3OMI B;  4N23 A;  1DTO A;  1RP3 B;  3B09 A;  1AI6 A;  5LXT B;  3JCZ A;  1MZE A;  2FL4 A;  3GWO A;  3RYH A;  4KP4 A;  3CHX A;  3IC9 A;  5LA6 B;  3UCS C;  1OCO C;  5LA6 A;  3JAS A;  4O4H A;  4UCV A;  2Q6A A;  1GN3 A;  2KSD A;  4I50 B;  3G4S V;  3OE7 G;  3STZ C;  2Q4P A;  2BTO A;  4DRX B;  5KLV H;  3J80 N;  2ZE6 A;  2N74 A;  1EFR G;  4JI5 B;  1HNW O;  2Q7H A;  5FNV B;  2Q5Z A;  4JYA O;  1WPB A;  4IYH A;  3E2E A;  1LR1 A;  1AP6 A;  3W7W A;  3M8A A;  4LWS B;  1QNM A;  2R9R B;  3O9O A;  4NTW A;  5IY5 C;  3WFV A;  4CS2 A;  3CB2 A;  2QE7 G;  3T1Y O;  4JYA B;  1GO3 F;  2A06 H;  1SET A;  3BHP A;  3RYF B;  1BMF G;  2ZT9 B;  3HKE B;  4DW0 A;  1SQP H;  1G8M A;  3GWK C;  4B3S B;  3VQW A;  3EFF K;  1XQ8 A;  3CE2 A;  2JVD A;  1VQ4 V;  2JEU A;  1QQC A;  1W2B U;  1RSO A;  4TV9 B;  4MVR A;  1EZJ A;  4ZHQ B;  1D5A A;  3VQV A;  1ORQ C;  4JTD B;  1SQF A;  1YXB A;  5IYC O;  1URF A;  3BAB A;  4OPH A;  2UXX A;  2YEV A;  3FFQ A;  5J2U B;  4DV5 B;  5D5Q A;  1E1R G;  1VF7 A;  4XBF A;  2ZIM A;  4I9Q A;  4K0K B;  2PYJ A;  3ABU A;  3BFR A;  1BCC H;  2IJK A;  2WLI A;  3K5O A;  3ZRX A;  2PI5 A;  1NU1 H;  1XEQ A;  4R8C A;  2IU0 A;  1IBM B;  4DXW A;  3EVK A;  4X1K B;  2LGQ A;  2ZKO A;  3OUF A;  2DYS B;  3T1H O;  2YS8 A;  3B8N A;  2YIB D;  3ZRW A;  2R9I A;  2X7R B;  2Z5U A;  1HNX O;  4PHZ A;  2P06 A;  1PKX A;  5BMV B;  3JAS B;  1FJG B;  5DEC A;  2JDI G;  4B3T O;  3L74 H;  5CA0 A;  3UQ8 A;  3AG7 A;  4LC1 A;  4JPR A;  1AI7 A;  4QE7 A;  4OGQ B;  1FS0 G;  5EIB D;  2DW4 A;  4YY3 O;  5EBM C;  1Q81 W;  5EZY A;  4P30 A;  1R73 A;  4GKJ B;  3SR2 C;  1KU9 A;  1KMI Z;  3K58 A;  1W59 A;  1BT8 A;  1GRJ A;  4CH3 A;  3P3P A;  4PEL A;  4X64 O;  2VWJ A;  1RM1 B;  4Z2W A;  3K9A A;  4YIO A;  1YIT V;  3NXS A;  5F2V O;  5L3C A;  3T1C A;  2B5U A;  4KUM A;  4X20 A;  4BAY A;  4FM0 A;  4WFF A;  1SES A;  1SKV A;  2EIK B;  3UKM A;  4TQD A;  2CH7 A;  1NTZ H;  4RO2 A;  3CX5 F;  4JI2 B;  1KKC A;  3ABL B;  4CH4 A;  2DN9 A;  2YC0 A;  4NB5 A;  1I5Y A;  1Q7Y W;  1IXB A;  3E35 A;  4NYK A;  3AG3 B;  5EZY B;  1F4M A;  5KHH A;  1GM8 A;  3SJQ C;  3ABK C;  3H1L H;  4O4J A;  3D3Q A;  4X66 O;  3R65 A;  4PV1 B;  3ASN C;  5E1A C;  3WB1 A;  2QM8 A;  1FFT B;  4DR3 B;  4JAS A;  1JMK C;  1JA8 A;  2DWE C;  3FAV A;  2LP7 A;  3N2K B;  5BZB A;  1L0L H;  2OTL V;  2XOK G;  1N32 B;  2F93 B;  2OT5 A;  4LFB B;  1L0N H;  2UUB B;  1MAB G;  1PP9 H;  2CTR A;  4HNA A;  5GTH Z;  2Q67 A;  3JSN A;  4JF3 A;  2WSS G;  3T1Y B;  2OCC B;  2UU9 B;  4LFC B;  2IH3 C;  2Q68 A;  3JSL A;  1JJO A;  2BE3 A;  4YJ3 B;  4XDK A;  4PA4 A;  4LH6 A;  3ZED A;  3BVO A;  5LL6 Y;  1SQQ H;  1XMO B;  4JI2 O;  1LUV A;  5CBG A;  1T5E A;  4H44 B;  3E8G A;  2JJ2 G;  5B1N A;  3L73 H;  2Y69 C;  3CCM V;  4X20 B;  5EC2 C;  2G38 A;  2OCH A;  4GT1 A;  2BOC C;  4HZ3 A;  4GX1 A;  3CXH F;  4FMT A;  4EFB A;  4JAU A;  5GTI Z;  3H9V A;  4FM1 A; 
#chains in the Genus database with same CATH homology
 4HYO A;  1YJ9 V;  2Q69 A;  4U7O A;  3X2Q B;  5LHG A;  1MG1 A;  1UJW B;  2XAQ A;  1S72 V;  1FXH A;  1OCR B;  3W7T A;  1QLE B;  3FB8 C;  1W0J G;  2EIL B;  4GX0 A;  4H37 A;  1M56 C;  3LDC A;  3LDD A;  1Y4M A;  4X89 A;  2P7T C;  4FIP C;  3ML0 A;  5L3D A;  2WWW A;  2C2A A;  4QJF B;  2QTO A;  3ABL C;  1NH2 D;  4JAV A;  3SYO A;  2ZDI A;  4PDV A;  1OCC C;  3OAA G;  1BHB A;  2B1G A;  3BY6 A;  2A79 B;  4RQE A;  1NBM G;  2XND G;  3K03 A;  3X2Q C;  2WAM A;  3MD0 A;  1E1Q G;  3SPC A;  2DWD C;  1KEC A;  2WLI B;  5CBH A;  3CCU V;  4CZZ A;  2CK3 G;  5B1O A;  3LNM B;  1ROP A;  5EK0 A;  4PA9 A;  2M7W A;  2P67 A;  2ITC C;  4QIW F;  4WFG A;  4MVM A;  1VQO V;  1VQM V;  4UXN A;  2EIM B;  4PDM A;  2EIN C;  5L3B A;  4OXS A;  3FYI B;  2EIM C;  1AI5 A;  2QM7 A;  3SYA A;  2H94 A;  3A0R A;  1M90 W;  2WLL B;  4MTO A;  4J9Z B;  3FB5 C;  1Y66 A;  2QEX V;  1NH2 B;  3K79 A;  5KUK A;  3SPH A;  3G6E V;  1WLE A;  5H9C A;  3ETE A;  1M1K W;  5KA6 A;  4BW5 A;  1VQN V;  4WFE A;  2WLH A;  3QO5 A;  3OM3 B;  1NR1 A;  3BEH A;  2V7Q G;  4TT3 G;  3T2M A;  3OFN G;  1R3L C;  3CC4 V;  2HJF C;  2QA4 V;  3VOU A;  3VBB A;  1R3J C;  1P7B A;  3B8M A;  2Y69 B;  4UUJ C;  4WF9 V;  1JQ0 A;  1YHQ V;  1OCZ C;  5L3F A;  4LP8 A;  1KD1 W;  3ZRS A;  3CCR V;  1NR7 A;  1VQP V;  1K9M W;  4I9W A;  1E79 G;  4U7N A;  4BIZ A;  2W6I G;  4FK5 C;  3SPJ A;  4KFM A;  5LGT A;  3ZN0 A;  2ZXW C;  1SRY A;  2XAJ A;  3LSS A;  1RM1 C;  3LDE A;  3I56 V;  3ABM B;  1FXK C;  2OTJ V;  3CC2 V;  4PDR A;  1L1F A;  4QNH B;  1H2G A;  4WFH A;  2HKO A;  5LGN A;  1NJI W;  4EKW A;  2QKS A;  3OMN B;  3AG2 C;  1KC8 W;  4UV8 A;  5IY5 B;  2YSU B;  1MOF A;  3ASN B;  3ZRV A;  3AG4 C;  2ZXW B;  4R50 A;  1YI2 V;  2LFR A;  4MVS A;  4JYB A;  1CEZ A;  3AG1 B;  3ZMT A;  2XAF A;  1ARO P;  3K08 A;  1AR1 B;  4L87 A;  2HG5 C;  4ASU G;  5DM6 V;  1H8E G;  1QLE C;  2ZD9 A;  4MW3 A;  4LBE C;  5CA3 A;  3P32 A;  2Y48 A;  3E83 A;  2WLN A;  1QVF U;  4RQF A;  1J95 A;  2ATK C;  3JD2 A;  3MHS C;  3ZMS A;  2P6J A;  3T4D A;  3ZJZ A;  1PNL A;  4MTG A;  2DYS C;  3CCV V;  5B1A C;  5HFM A;  1K73 W;  1VQ6 V;  3ASO C;  2EZO A;  1XL6 A;  2LFS A;  1R6N A;  4YXW G;  3DGE A;  3CMA V;  5LHI A;  3B77 A;  3OMI B;  4N23 A;  4P9P A;  1DTO A;  1AI6 A;  5J9P C;  3CCJ V;  2DYR C;  5B1B B;  2DQ3 A;  4RAI A;  3JCZ A;  1OCR C;  2H8P C;  4Z1M G;  3CCQ V;  1VQL V;  4I5S A;  1QLN A;  3GWO A;  1WPX A;  4KP4 A;  2NLJ C;  4QPK A;  1OCZ B;  2IU3 A;  1GK9 A;  1CP9 A;  1S77 D;  1OCO C;  1QR9 A;  1H38 A;  1YIJ V;  1GM7 A;  2EJR A;  2W0F C;  3M99 B;  2Q6A A;  3CCS V;  3F5W C;  3G4S V;  2HR3 A;  2WPD G;  3K0D A;  3OE7 G;  2XAH A;  4QPJ A;  3ZCC A;  3STZ C;  5LGU A;  4JGS A;  5LHH A;  4G27 B;  3RBZ A;  5CN0 A;  1M57 C;  2KB1 A;  2X6A A;  1EFR G;  3JYC A;  1TUE B;  3LSQ A;  2AHZ A;  3HB3 B;  4MVU A;  2Z3Y A;  4F4L A;  2IJJ A;  3JD0 A;  1N8R W;  3E2E A;  3T4Z A;  3TET A;  3ABT A;  3W7W A;  5CBF A;  1PNK A;  5EC1 C;  2V1D A;  1M9N A;  1FXV A;  2R9R B;  1K8A W;  5IY5 C;  3ABM C;  1OZ0 A;  3WFV A;  5B3S B;  2DQ0 A;  1S76 D;  2QE7 G;  4XDL A;  3I55 V;  1YSC A;  4MSW C;  4X88 A;  1K92 A;  1GO3 F;  3FB6 C;  3CYO A;  1THZ A;  1NVP B;  2X6B A;  1FXK B;  1SET A;  4UVC A;  2ZR2 A;  2WLM A;  2YEV B;  1BMF G;  1V54 B;  2JIZ G;  1BHA A;  2EZP A;  1G8M A;  4GX5 A;  2A0L A;  3EFF K;  3WG7 B;  1VQ4 V;  1XL4 A;  2JK5 C;  3TCU A;  1PNM A;  2IH1 C;  2JEU A;  3WG7 C;  1W2B U;  4MW8 A;  3SYQ A;  3FYE B;  4MVR A;  2GHY A;  4PA6 A;  1EZJ A;  2EIL C;  3ASO B;  1ORQ C;  1H8H G;  4FJC C;  4JTD B;  3CC7 V;  2X6C A;  5IYC O;  1QBZ A;  2UXX A;  2YEV A;  3OMA B;  1OCO B;  5FL7 G;  3JD1 A;  4E2L A;  4G2K A;  3K3W A;  1E1R G;  1R3K C;  1V55 B;  4H33 A;  1JOY A;  1VQ7 V;  5GW7 A;  4JTA B;  4JTC B;  3JD3 A;  4XBF A;  4N21 A;  4TWK A;  3P30 A;  1G4Y B;  3ABU A;  4MT8 A;  2IJK A;  2WLI A;  3ZRX A;  3RVZ A;  3AG4 B;  2DYR B;  2PI5 A;  1M56 B;  5B1B C;  1K34 A;  2MK3 A;  4R8C A;  3IFX A;  1QVG U;  3ZIA G;  4MS2 A;  2IU0 A;  1PD3 A;  1VQ5 V;  2IJI A;  2EIN B;  4DXW A;  1VQ9 V;  4JYC A;  2F43 G;  4UV9 A;  3OUF A;  4ZBM A;  2DYS B;  3QO8 A;  3B8N A;  3CME V;  1JJ2 U;  3ZRW A;  3CXC U;  2EIJ B;  2R9I A;  1KP3 A;  2X7R B;  1NQT A;  4PDL A;  5L3E A;  2Z5U A;  3CCE V;  3W7X A;  3SYC A;  1K4C C;  3ABK B;  3W7U A;  1F4N A;  1PKX A;  3EHB B;  4UVB A;  3D36 A;  1Q86 W;  5C93 A;  1ENV A;  4P9O A;  3OUS A;  3K06 A;  2JDI G;  3ZMV A;  3MHH C;  1GMG A;  3E8B A;  4MVQ A;  1GKF A;  4LC1 A;  4JPR A;  1AI7 A;  4XDJ A;  4PA7 A;  4QE7 A;  4CBC A;  1FS0 G;  1B6Q A;  4R7C A;  1K3E A;  1OHH G;  2DW4 A;  3E89 A;  1YJW V;  3ETD A;  4RUF A;  2HLD G;  1Q82 W;  5EBM C;  2EBO A;  1DF4 A;  1Q81 W;  4P30 A;  1R73 A;  1DLB A;  1KKD A;  3AG2 B;  3G71 V;  1F51 A;  1F23 A;  2IJH A;  1AJQ A;  1VQ8 V;  1YTF D;  4WCE V;  3ZMZ A;  3OEH G;  1NVP D;  4PEL A;  1MSW D;  1ZWI C;  3FB7 C;  1YTF B;  1RM1 B;  2HVJ C;  3K9A A;  4MVO A;  4RUE A;  1YIT V;  3E8F A;  3NXS A;  1EBO A;  2ZR3 A;  1R3I C;  5L3C A;  3T1C A;  2B5U A;  4KUM A;  3TK1 A;  2IW5 A;  4P2Z A;  1QR8 A;  3GB7 C;  4BAY A;  1K5S A;  2JEX A;  3OEE G;  4ZKI A;  1COW G;  4BIU A;  3IC7 A;  1K97 A;  4LCU C;  4WFF A;  5B1A B;  5H6Q A;  5IDJ A;  1V55 C;  1SES A;  4TSF G;  2ZQM A;  1JX9 A;  5LBQ A;  2EIK B;  3UKM A;  1AI4 A;  2PI4 A;  4J9Y B;  3RW0 A;  2EIK C;  3SPI A;  5IYB O;  4RO2 A;  2UXN A;  2W6J G;  3CD6 V;  3ABL B;  4R6Z A;  3SPG A;  4HAM A;  2A9H A;  3AG1 C;  1PL0 A;  1I5Y A;  3UM7 A;  1Q7Y W;  3E35 A;  3AG3 B;  4GX2 A;  1F4M A;  5EBL C;  1HWY A;  4DO2 A;  1GM8 A;  3ZRW B;  3SJQ C;  3JD4 A;  1BL8 A;  1V54 C;  3ABK C;  1YJN V;  2D3O W;  2ITD C;  2WLJ A;  3CP1 A;  3HPL C;  3CCL V;  4QE9 A;  3R65 A;  2K1E A;  3QNE A;  3ASN C;  5E1A C;  2WLK A;  3W7S A;  3PJS K;  1S0V A;  3D3I A;  1KP2 A;  1FFT B;  2QM8 A;  3OR6 C;  4JAS A;  3F7V C;  3AEI A;  5KUM A;  1R6K A;  5DN6 G;  5L3G A;  2OCC C;  3DTU B;  2DWE C;  2EIJ C;  2LP7 A;  5BZB A;  1RPR A;  3ETG A;  3LUT B;  2ZDI C;  1VQK V;  3E86 A;  1K4D C;  4GCZ A;  2OTL V;  2XOK G;  1I5X A;  2JJ1 G;  3OW2 U;  2HVK C;  2OT5 A;  2P90 A;  3K0G A;  5KA5 A;  1SZT A;  1MAB G;  1GM9 A;  3OGC C;  1K33 A;  3OR7 C;  2BOB C;  4Q20 A;  2Q67 A;  4MTF A;  4X8A A;  4JF3 A;  2XAS A;  3F7Y C;  4FPP A;  4WFA V;  2WSS G;  3QO7 A;  4UVA A;  3FKS G;  3H01 A;  2OCC B;  3ZMU A;  2IH3 C;  2GSM B;  1NKD A;  2Q68 A;  1JVM A;  3IGA C;  1DF5 A;  4PA3 A;  3CPW U;  2WLL A;  1AJN A;  1FXK A;  4PA4 A;  4XDK A;  4WFB V;  1RPO A;  1JPX A;  2HFE C;  1GTO A;  1P4R A;  1LNQ A;  1W0K G;  4MTX A;  5H6R A;  3RVY A;  5IYD O;  1S3J A;  1IXM A;  1SER A;  3E8H A;  5CBG A;  5EBW C;  2FTK A;  3KG2 A;  3E8G A;  3K04 A;  2JJ2 G;  5B1N A;  1CPY A;  3AG3 C;  3ZN1 A;  1M57 B;  2Y69 C;  4MVZ A;  3CCM V;  5HFL A;  1KQS U;  2XAG A;  5EC2 C;  4G28 B;  2X0L A;  2NNU A;  4GT1 A;  2BOC C;  1K7D A;  4GX1 A;  1QCE A;  4HZ3 A;  2AHY A;  1JCH A;  1S5H C;  3SYP A;  1K5Q A;  1AJP A;  4FMT A;  3STL C;  4JAU A;  5CMU A;  5B3S C;  2B1I A;  1OCC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...