1F4NA

C2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARFGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
pubmed doi rcsb
molecule keywords ROP ALA2ILE2-6
molecule tags Transcription
source organism Escherichia coli
total genus 27
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f4nA00
1NKDA 1F4MA 1GTOA 2IJIA 1ROPA 2IJJA 1B6QA 1F4NA 3K79A 2GHYA 1GMGA 1RPOA 2IJKA 2IJHA 4DO2A 1RPRA 1PD3A
chains in the Genus database with same CATH superfamily
1K3EA 3FD9A 3JD2A 4BIUA 4IHJB 4LFCB 3AK1A 5BZBA 5JJJB 3CMAV 4PA7A 5LGUA 4GLXA 4NR1A 1GO3F 4EFBA 5LMUB 1BQZA 1QCEA 1PNKA 2IH3C 2P06A 3RWRD 4FK5C 4DR2B 1PNMA 1VQLV 3H1KH 3G6BA 1N34B 4EKWA 1VF7A 3O9OA 1Y66A 4TOIA 2CH7A 5IE9A 2QM8A 4UVAA 3QVNA 4QGPA 5KHGA 4FVMA 2R72A 3F7YC 1OCOC 3CRMA 1AVMA 2X6BA 2WLLB 3ZIAG 5LGTA 3SJCC 4QNHB 4PA9A 3IGAC 1K4DC 1SA0A 4X62O 4CH4A 2X7RB 2HJDA 1B6QA 3NXSA 4QPJA 1JX9A 3MHSC 3T2MA 4O2BA 2A3QA 4N21A 4DYLA 1ZWIC 1OCRB 2LJ2A 1YDXA 4LP8A 2AW9A 2VRZA 1SERA 3D3IA 5CN0A 4PDRA 5J2UB 2UUCO 1N32O 1R3JC 2BTQB 4DV4O 1VQ5V 3D3QA 3CX5F 2N05A 3MD0A 3SYPA 3ASOB 2QGNA 4TUYB 4X66B 2JJ2G 3JD3A 3CPWU 2F66C 1GK9A 4AQYB 4JAVA 4KP4A 4LF8B 3LSQA 2K1EA 4LC1A 1VQMV 3GWKC 3SDLA 3RYCA 2E5LB 1L8DA 1QNMA 4XBFA 1HNXB 1MZFA 2IU0A 4H37A 5LBQA 4U7OA 4GKKO 4EB6B 5LMNB 2ADPA 3SYOA 1I08A 5CBGA 3QF7A 1GM9A 1YJWV 4EFEA 4P9OA 1M56B 4U3JB 5BR8O 1YCIA 3NR7A 2AHYA 2ZM6O 2HVKC 4JI2B 4JYAO 3OT7A 1NH2B 3H9VA 1M4UA 2KQXA 4PD4F 1TUEB 5KMGB 1OCRC 5AG2A 4UB8Z 1XILA 4X88A 2Y69B 4LF5B 3HKCA 5DECA 4DUYO 2HHHB 4GX2A 1HDJA 4LFAO 2PGGA 1XUQA 4LF4B 3IAYA 2Y0IA 3WB0A 5JVDB 3WFVA 3ASOC 1BQ0A 3ZBHA 2IJJA 4UVBA 1JJ2U 3U0ZA 3M8AA 2RNBA 2D3OW 4JF3A 5L3EA 1PKXA 3ASNB 4D7SA 1GN6A 2LQTA 4AILC 1FXVA 4F6RB 3K5LA 4JI8O 3DC5A 2QA4V 3ABKC 4EEQA 5C8YB 4JASA 3RYFB 3OE7G 1IBLO 3WG7B 5D5QA 1Z5WA 3CJHB 4DR6B 2WLLA 1VEWA 5L3CA 4GX0A 4TSFG 4UUJC 5FL7G 1N36O 4NXNO 2A9HA 1M56C 5JWPA 3ZHQA 2OT5A 4RQEA 3TJTA 1MOFA 3T4DA 1SESA 3E83A 2KSDA 1BL8A 4H13B 4O4IB 3UQ8A 4MW3A 2PTMA 5H6QA 2Y69C 3VQWA 1WLEA 1AP5A 4B3RB 2YXLA 1H38A 3JYCA 2X6CA 4MVOA 2P5OA 1S76D 2F43G 2AHZA 3OR6C 5BY1A 4JI4B 2FTKA 2UXBB 1WP8A 1NTMH 3RGBA 2YXHA 3P3PA 4LFBB 4IGGA 3I55V 2FMLA 2GTSA 3CXCU 1L0NH 5CB4B 1GH6A 3B77A 1BMFG 3ASNC 4YY3B 1XMOO 3WB1A 2EIKB 1KP2A 1ROPA 2NLJC 5L3FA 1SQPH 4O4JB 4FMTA 2EJRA 4JI5B 3VBBA 3BCCH 5K1XA 1PPJH 3WG7C 1XOUA 4JI7B 3K5MA 1F51A 4GKJB 4H0LB 4MVMA 3W7WA 1KP3A 4UCOA 1W2BU 3BABA 4WFAV 4UXNA 1E1QG 1FPOA 1OV9A 1IXMA 3ETDA 4U3JA 2WPDG 1Y76A 2ZIOA 1PL0A 4JAUA 1K9MW 1GM8A 5K1PA 3CC2V 4DV6O 4TV8B 3CYOA 3CCUV 4RO2A 2FB5A 4YJ2B 2CUGA 3A2FA 3SJBC 2F1MA 1N33B 3CC7V 1AJQA 1FXKB 1NZ6A 3CRQA 3TK1A 5FLXN 4HZ3A 2GHYA 3UT5B 3OGIB 5CA1A 5IYZA 4KFMA 1KC8W 3A0RA 2QM7A 3THOA 3VQYA 1DK1A 2GSMB 4OPAA 2EULA 1P7BA 1MSDA 2OIEA 4MVQA 4B7KA 4PDLA 1NH2D 1I5XA 2WA3A 2IH1C 5CBHA 4PDVA 4YXWG 4WBNA 3BA8A 1OCZB 3GVMA 4FZ0A 1HR0O 2EIKC 3TETA 2OWOA 1SQXH 4LF7O 5C8YA 2WLKA 3RYFA 4FFKA 3OW2U 1ORQC 3ABTA 3B09A 3PJSK 1AROP 2R9RB 4PI0A 4YIOA 5JCOC 2UU9O 4JYCA 2B1IA 5H2FZ 2VWJA 2LW1A 5FPRA 1F7YA 1M5IA 1OHHG 5LP6B 1N4CA 3UO3A 4DW0A 2HG5C 3SJQC 4KHPB 2O57A 1SZTA 2XUMA 3D36C 1JFFB 3AG7A 5IYDO 5EC2C 2UUBO 2UXXA 4J9ZB 3SPJA 2LFSA 1P7GA 1X4TA 3K03A 2WLMA 2YIBA 4NTWA 3MHHC 2AZ0A 1SQVH 1AJPA 1XQ8A 4X20B 4B3SB 2WSSG 3FX7A 1FXKC 2Q6AA 1KKDA 4NYKA 2A79B 4CH5A 2ZE6A 2F4VO 2RCVA 3OEEG 4P30A 4LF9B 4YHHB 4O4HB 4BW5A 1IBKB 1EZJA 3TCUA 3T1YB 1D5NA 5EZYA 2ZE5A 5GW7A 2DE0X 1O9GA 3PN1A 3X2QB 3E86A 1GN3A 3FB5C 3CD6V 3MAQA 1PP9H 4NKGB 2H8PC 3RYHB 1XNRB 2AGAA 5B1BB 2VQEB 1OCZC 1SQFA 1VIBA 4CC5A 3DTUB 5JCOA 3RN4A 5JJNB 3OGCC 3UO2A 4DV7O 2BCCH 1R3LC 1VQOV 4U3FH 1H2NA 3T1HO 4JTAB 5LP6C 3QO5A 3GWOA 4Q20A 3CWBH 1SQGA 5B3SC 4GZRB 2XTAA 3ZHUA 3DC6A 4N23A 2UXCO 4YJ2A 4UCVA 1MZEA 2ETNA 4ASUG 4CH6A 4X8AA 4KL1A 1E79G 4DR4O 4I4TB 1BHAA 1D2DA 4FM1A 5EYPA 3K06A 4X65B 1FXKA 3WU2Z 5IDJA 3L71H 4FLVA 4TT3G 3ZHSA 2E3CA 2LO1A 3RVZA 1AJNA 1M93A 2D2CB 2JVDA 1OJHA 1SRYA 1EN5A 4OXSA 3OD4A 4XDLA 5KAFZ 4X64B 4DV2O 3CCVV 3K08A 3ZHRA 2VQFB 3ZS8C 3B4SA 3X2QC 3H1JH 2R9IA 1NKDA 1EN6A 4FLYA 5A9GA 1RPOA 2Z3YA 1WN7A 3N2GA 1JJOA 4R7CA 2W6JG 5B1BC 3OUFA 2DMXA 1HP8A 4DR7O 1WA8B 1Q90D 1AILA 3L74H 4JI6B 3AG2C 5LP6A 3RFRA 3TXSA 2M6YA 1WB8A 3AK3A 4LWSA 1URFA 2ZKOA 5CBFA 3W7TA 4HNAB 1NT2B 3AG1C 2X0LA 4B3TB 1JFFA 5LXTA 2Q0AA 2V1DA 1AP6A 3G80A 4DR1O 4FLTA 4AI8A 4D6TH 1MMMA 3P30A 2OCCB 1PD3A 1TUBB 2JGUA 3K3WA 1O9HA 3JAMN 1THZA 1W0JG 3U10A 2QJ1A 2EBOA 4X20A 2X6AA 2UXDB 3JASB 1ZL8B 2WLNA 2Q9LA 3SYAA 4ZHQB 3AG4B 1BT8A 4MTOA 4MVZA 4TQDA 2JEXA 1CP9A 1LR1A 2YDEA 3HKDB 1F4NA 4O4HA 1A32A 2F93B 2HEPA 4X1IB 4PJ0Z 2P4KA 2G38A 2QSAA 1JMKC 3ZJZA 4O4LB 1V9PA 2QWNB 3ZRWB 4Z1VA 4XDKA 1S5HC 3A0HZ 2HP8A 2JIZG 1Q43A 1WJZA 4FLXA 4B3MO 1U97A 2W0XA 1G6UA 4I50A 4X66O 4MTFA 3L9DA 2LP7A 3KKYA 4DV1B 3JALB 2Y0PA 3FYIB 2DWEC 4A5UB 4LF8O 3HPLC 3SYQA 1E1RG 3BA9A 1QQCA 5B1NA 1YF2A 3A8TA 3UM7A 1XBLA 3N2KB 3QO8A 1V55B 2OCCC 1AI7A 3RW0A 4FFBB 1R6TA 1ZX3A 3CCLV 4I4TA 1Y4MA 4NB5A 4PELA 2YEVB 2QWQB 2XNDG 4G2KA 1IBMO 4LR3A 2JRIA 3E8HA 3AG4C 2ZIMA 1Y74B 4RWUA 2BOCC 1AB3A 3IJ4A 2YS8A 3I56V 4NTXA 1GM7A 3SPIA 4BW9A 4JYBA 1QVFU 2DYRB 1MABG 2DQ0A 4FLZA 5BMVB 1S77D 2Q7HA 4H44B 3ZCCA 4JI0O 1BHBA 2P22C 1AI5A 1SKVA 3ZX6A 3H1HH 5KUKA 2PYLA 5ITZB 4QPKA 5EBWC 3ABMB 2ILMA 4X62B 1R1BA 1UJWB 1G8MA 1US6A 1IURA 2Z0AA 2ZDIC 4K35A 1G4YB 4HNAA 5JH7B 4P9PA 3G6EV 5KAIZ 1ZLZA 4UCTA 4DK0A 5J2TB 4IIJB 2P4VA 4K8XA 5KA5A 1Q3EA 2QWOB 1V55C 4IHJA 2HR3A 2UUCB 1N32B 1MG1A 4RUFA 4HYOA 5CA0B 4DV4B 1B04A 4DR6O 2JS3A 3ZRXA 3CEIA 4NXMB 3JASA 1ZL8A 3K57A 4ZHQA 3HKDA 1AI4A 1N0JA 2Q7EA 2WLIB 1CEZA 2QKAA 3H1LH 1RFYA 3ETEA 2W0FC 2PY5A 2DYRC 2KB1A 4GX5A 1LUWA 1GMGA 1M90W 2HKOA 4O4LA 4QIWF 1L0LH 4GKKB 2EX3A 3OMNB 1S72V 2EJ7A 3FYEB 3D8CA 4B7EA 3OAAG 3K04A 5LOVB 1XMQO 4U7NA 4F6EA 3EFFK 4UV8A 3J81N 5BR8B 5IWAO 3JAKB 4DRXB 2ZDIA 1TA8A 2ZM6B 1JQ0A 4JYAB 3JALA 1LUVA 2Q68A 2EINB 3OTFA 1QHTA 4JI1O 4QJFB 2NR5A 3QTCA 4UCSA 5IJ0B 1CXZB 3ICXA 2DQ3A 5FNVB 4DUYB 3FKSG 4R8CA 3DSQA 2ZNIA 4FFBA 4UFZA 4LFAB 4DV0O 5DM6V 4I9QA 2GDSA 2EILB 2QM4A 3JCUZ 2YEVA 5J2UA 3TGUH 4TQFA 3OTOO 3FAVB 2BTQA 4DR5O 1SF9A 4MTXA 1Y67A 4PDMA 2IBZH 4TUYA 1OZ0A 2NNUA 4I55B 4JZ2A 5KHKA 1VMGA 1UFIA 4JI8B 2Y48A 3EXAA 4Q6GA 1HNZO 4JTCB 1HWYA 1IBLB 3HKBB 4PI2A 3S3XA 2PUSA 1XI1A 2K9PA 4F4LA 1NJIW 4LF6O 4YIPA 1RPRA 4K8ZA 2Q73A 2OTJV 1JOYA 1N36B 4MS2A 4EB6A 3SJAC 2A06H 3ABLB 5A2QN 1H2LA 4NXNB 2ADQB 3B8NA 3B8MA 2GTAA 4J7JA 1JVMA 2PZSA 4ZI7B 3CCSV 1AR4A 1YTFD 2ZR2A 2PI4A 2CAZC 1FJGO 1SQBH 5JH7A 3LSSA 4L87A 4ICGA 5LHHA 3M99B 3G71V 4JI3B 2F23A 2IM9A 3JAWB 4CS3A 5H9CA 4IIJA 1GN2A 5DN6G 5KMGA 4PA6A 5CA0A 1YHQV 3OFNG 1RSOB 4O2AB 2IU3A 3APQA 5BXZA 2Z5UA 3K0GA 2QWRB 4J11A 1K8AW 3ZMTA 5IYBO 4IL6Z 3JARB 4K0KO 5JVDA 2WLIA 5C93A 1P4RA 2ARHA 1XMOB 3EHBB 4DV5O 5KHHA 4OPHA 1K73W 4J9YB 2QE7G 5HFLA 5EBLC 1BZKA 2CTRA 1SC5B 3K9SA 4F6RA 2DW4A 1UPGA 5LOVA 1N8RW 1W0KG 1BCCH 4LF9O 3CCJV 1IBKO 3ABLC 3CJHA 1FXHA 4DV3O 3JAKA 4BAYA 5EC1C 3K5NA 1H2SB 1Q6UA 1FFXB 4DV6B 4FZ1A 3N27A 1R6KA 1BS3A 1KECA 4J10A 1NVPB 1R3IC 3HKEB 5B1OA 5IJ0A 5CA3A 4OX9O 4MW8A 4O4IA 4MT8A 4RQFA 1HNWO 4D7TA 2CGOA 1VQPV 2B1GA 1SS3A 2Y4TA 2F95B 4DR3O 5FPOA 3FB7C 2YC0A 1FFTB 4BWAA 4I55A 1IDSA 5B1AB 1GTOA 1RM1B 3CXHF 5CB4A 5D5PA 3LNMB 4CC6A 1XNQO 2UXNA 1DGSA 2EIMB 3C3SA 4MSWC 4DUZO 2KKWA 4CBCA 3HKBA 3RVYA 1NTZH 1I94O 4GYCB 4DO2A 4O4JA 1GRJA 1NU1H 2LFRA 3L70H 4HBNA 1QLEB 4WCEV 3DXRB 4ZI7A 2NN4A 4BR6A 2UUBB 1KU9A 4E4EA 2CH7B 4LH6A 1JCHA 1DTOA 3D36A 1IZ3A 1KQSU 4NVPA 1VQNV 1KMIZ 4TV8A 3JAWA 2UUAO 2DYSB 2Q7GA 4KUMA 1TVKB 1YSCA 2CTQA 2F4VB 2HLDG 1VF5B 1SA0B 1K33A 4J41A 4DK1A 2YSUB 4JV5O 1RSOA 3LSUA 4O2AA 2BE3A 1QR8A 1VQ6V 2IJHA 3UT5A 3H01A 5L3BA 1BGYH 3JARA 4KXRA 4WFBV 4UV9A 3K5OA 1J5EO 5JQGB 2OIGA 5B1AC 1RM1C 3STLC 2Q0OC 4LFCO 2WWWA 4DV7B 2PI5A 4LBEC 4QE9A 4FPPA 2ZE8A 3ZN1A 2H94A 4PV1B 5L3GA 3T1HB 2BSKB 1NI8A 5IT9N 5LMUO 3IC9A 4C7UA 4WFFA 2QEXV 3CE2A 3B2EE 2XASA 3SYCA 4BIOA 1FFXA 1QLEC 1XDCA 1VQKV 1YJNV 2LW7A 4J7ZA 1M1KW 4BIZA 5GONB 2UXCB 4DR2O 1K34A 4W4LA 1N34O 5B5EZ 4DR4B 4ZOLB 2ZXWB 4TWKA 2Q4PA 4X1KB 2AZ2A 1JR9A 1G1XB 1EBOA 1M57B 2E76B 1V54B 4UCRA 1AR1B 2B9ZA 2KG7B 2WAMA 5H6RA 5TISZ 1NS1A 2DYSC 1P84F 3CRRA 4FLWA 1GAXA 1Q82W 3ML0A 2C2AA 4GUNA 4DV2B 3LNNA 2QTOA 1K97A 4JGSA 5LHGA 2L6LA 1VQ9V 1NVPD 4X1YB 4K3AA 3HKCB 4DXWA 2AXTZ 4RUEA 1FAFA 1GN4A 3VQXA 2Y4UA 2A0LA 4DR7B 3RYHA 3CSXA 4B08A 1W59A 2ZNJA 1D5AA 1DLBA 2CTPA 4JZGA 1NBMG 3ZHVA 1VF6C 4E2LA 3K59A 2WLHA 1I7FA 4AHCA 4WFEA 2M7WA 4ZKIA 1NR7A 1R3KC 1VQ4V 3DXRA 4JTDB 3ZHTA 1H2KA 5LA6B 4IT5A 3W7SA 1YJ9V 2R70A 4XDJA 4DR1B 3CCMV 3VOUA 4AQYO 3OMAB 3G4SV 1YI2V 4WFGA 4CZZA 3ZMSA 1EM1A 2BOBC 2ZXWC 2YIDA 4J80A 2DOSA 2E5LO 1COWG 1M57C 1V54C 1HNXO 5E79Z 1VARA 1TVKA 5LMNO 2CDYA 2ODMA 3KCYA 2XAQA 2YUAA 3W7XA 3SR2C 4Z2WA 2LGQA 5IJ9B 3R66A 1P49A 4YJ3B 5IY5B 3CC4V 1JPXA 5EK0A 4CS4A 2R9AA 1YTFB 4JI2O 3SGIA 3ZMZA 2Q5ZA 5JQGA 1Q6HA 1TAEA 3QO7A 2MW2B 4LF5O 3LDCA 3UKMA 3IFXA 2HHHO 4B3MB 4NXMO 2QDOA 1VF6A 2ZR3A 4RAIA 2N04A 2BSKA 2BTOA 2PYJA 4LF4O 2GUZB 5EBMC 1WA8A 5KA6A 5HFMA 2Q69A 1GKFA 4GT1A 1K4CC 1X59A 3LDEA 1QBZA 3ABKB 3MDSA 1YEWA 1XEQA 2XHBA 3EVKA 5GONA 3J7AU 4I9WA 3L72H 5LYJB 1VP7A 2RN9A 2EZOA 1XREA 2QKSA 4ZOLA 1YIJV 4X1KA 4QE7A 3SPHA 3CCEV 4NTYA 1TUBA 1ZTEA 3K58A 1LNQA 2XAFA 2OTLV 1XL6A 2P6JA 2KG7A 1VQ8V 3JSLA 1QLNA 1IBMB 3T4ZA 2HVJC 2E75B 4L8JA 1Y76B 3S3WA 3ZMUA 3W7UA 3HB3B 4R50A 2DJVA 3FB8C 3F5TA 1YITV 1Q5OA 2V4DA 3C90A 4J7KA 1EN4A 3SPGA 1I5YA 3OR7C 5IY5C 4X1YA 4UVCA 1MNGA 4X1IA 4I0XB 4JI0B 3E35A 3J80N 2ZQMA 2EIJB 1BSMA 1PM9A 2YICA 5CA1B 5IYZB 1XL4A 3ZRWA 4LH7A 3B40A 4B3RO 3OEHG 3CRAA 3E2EA 2ITCC 4MVUA 3P3NA 4JI4O 3UCSC 2RDCA 2UXBO 3ABMC 1TGOA 2GV9A 5DEDA 2ZE7A 3KZIZ 3BRCA 1H2GA 4LFBO 5LA6A 4WBNB 2W6IG 4FJCC 1Q7YW 3K9AA 2FKXA 2CGNA 2OYQA 4YY3O 2GBOA 1KUQA 1K5QA 3OUSA 4G27B 1YXBA 3N2KA 2JJ1G 1Q86W 4ABMA 3ETQA 2QWPB 2CK3G 4JI5O 1H8EG 3CS5A 5IYCO 1NTKH 1ENVA 1AI6A 2XAHA 3AEIA 3WB2A 4JI7O 1T5EA 1S5JA 2ZD9A 4CS2A 4GKJO 1Q81W 2ZT9B 3C3TA 4JPRA 4FM0A 5IJ9A 1FS0G 3STZC 4FM2A 4PA3A 4Z1MG 2WA4A 1SZXA 4ZIBA 4YJ3A 2N74A 2QKCA 2YIAA 1IXBA 1Y74A 1OCCB 2JK5C 4JI3O 3LUTB 3E8GA 2ITDC 4MTGA 3JD1A 5B66Z 2EIJC 2IJKA 5BMVA 1R6NA 5L3DA 3QNEA 1XMQB 1N33O 1QVGU 3E22B 3TXQA 3RYIB 1PNLA 3OM3B 5EIBC 1U96A 5IWAB 3CCRV 4W4KA 5ITZA 3ZRVA 1Z2GA 2VS0A 5EZYB 2ZCEA 5LL6Y 2ZINA 5KX5B 2GUZA 3JSNA 4JYYA 3L73H 2JS5A 2LGWA 2XAJA 4JI1B 2L35A 2EZPA 3IC7A 2DN9A 4LCUC 3SPCA 3ABUA 5LYJA 1F23A 1N0NA 2EINC 2Q67A 4DV0B 1FD9A 5J2TA 4I7ZB 3DGEA 1CPYA 4IYIA 3M7MX 3OTOB 4IYHA 4DR5B 2EILC 3JATB 1QR9A 3QG5A 2HJFC 2P67A 4KHPO 1AR5A 1ZSPA 1EZVH 1WP7A 1M9NA 4GX1A 1HNZB 2JGDB 4R6ZA 2P7TC 1OCCC 3R65A 4I0XA 5KHIA 5EYPB 4LF6B 3CRCA 2XOKG 3OMIB 1S0VA 2YXYA 2XT9A 1SETA 4B3SO 4X89A 1VQ7V 1QU7A 1K92A 5E1AC 1DF5A 5KLVH 3AG3B 2QTSA 4GCZA 4YHHO 3CCQV 1FJGB 3Q4HB 3T1YO 3JCZA 4DRXA 1DF4A 4TV9B 3CMEV 3E8FA 3FB6C 1SQQH 1F4MA 3E8BA 5J9PC 4LNUB 4WFHA 3T1CA 3N2GB 1PL4A 4CH3A 2OCHA 2DWDC 2HFEC 3HR0A 1XNRO 1K7DA 2Q8VA 2VQEO 5EIBD 5FNVA 2IW5A 1Q8IA 4PHZA 1WNSA 4LWSB 2MK3A 1NQTA 5B3SB 4K0KB 5F2VO 5LXTB 3FAVA 5GTHZ 1Y6XA 4DV5B 4G28B 3ZN0A 1MA1A 3ZRSA 3F7VC 4X9QA 3CHXA 3AK2A 1HR0B 3E89A 4LF7B 1S3JA 4I5SA 3ZMVA 2XAGA 3BAAA 1JA8A 3E22A 1MSWD 4X65O 2B5UA 3RT3C 3RYIA 5CMUA 1Z5VA 2FL4A 2UU9B 4DV3B 4ZBMA 1FYJA 3FFQA 1HW7A 3AG3C 5KX5A 1KB9F 4OGQB 2ATKC 5KHJA 1BE3H 3LDDA 2YIBD 4X64O 2RMKB 4DW1A 1ZUQA 1ZAUA 2A7WA 2VQFO 2YI9A 4UCUA 2PF4E 4OX9B 3K79A 5H5NA 1HNWB 3AG2B 3I5DA 4I50B 3VQVA 3BFRA 3CB2A 1WPXA 4DR3B 1H8HG 1B06A 4JAAA 3AG1B 3ETGA 3CP1A 3JATA 4JI6O 3A0BZ 3GB7C 1IX9A 3H1IH 5LGNA 3APOA 4WF9V 2V7QG 1FKAO 1WPBA 4O2BB 1WB7A 3F5WC 5JJEB 2JGDA 1XNQB 4B3TO 1NR1A 3BPZA 4DUZB 1WAZA 1Q6IA 1I94B 4PA4A 3P32A 3G67A 1R73A 3BEHA 1KBHA 3KG2A 1L1FA 2CTWA 3RBZA 2EIMC 2YI8A 2RQ6A 2UXDO 1XHZA 2QR4A 3BHPA 2FYUH 2JDIG 3BVOA 5LHIA 1K5SA 4FLUA 2RJZA 5GTIZ 1YZBA 3L75H 3Q4HA 3BY6A 1KYOF 1PV0A 4TV9A 4J42A 2JEUA 4UB6Z 4LNUA 3JD0A 3RYCB 4FIPC 2UUAB 4MVRA 2WLJA 1S5LZ 3O65A 3HKEA 1OCOB 4H33A 1B3QA 3KCXA 1KD1W 4MVSA 1EFRG 1I0HA 4JV5B 2E74B 1YVWA 1H2MA 2VWKA 3U11A 1RP3B 3ZEDA 4HAMA 2H3OA 2IJIA 3K0DA 1KKCA 2P90A 4DV1O 1IVSA 5KUMA 4P2ZA 3JD4A 1J5EB 1J95A 2CE4A 1XHXA
chains in the Genus database with same CATH topology
3CCEV 1K3EA 3ABLB 3JD2A 4BIUA 5GW7A 3B8NA 1LNQA 2XAFA 3B8MA 2OTLV 1XL6A 2P6JA 1JVMA 3X2QB 1VQ8V 1QLNA 3E86A 3CCSV 3T4ZA 5BZBA 2HVJC 1YTFD 2ZR2A 3FB5C 4PA7A 5LGUA 3CMAV 3CD6V 2PI4A 2H8PC 3ZMUA 3HB3B 3W7UA 1GO3F 4R50A 3FB8C 5B1BB 3LSSA 1OCZC 1YITV 4L87A 5LHHA 3M99B 3G71V 1QCEA 1PNKA 3DTUB 2IH3C 3SPGA 1I5YA 3OR7C 3OGCC 4FK5C 5H9CA 5IY5C 1R3LC 5DN6G 4UVCA 1VQOV 3E35A 4PA6A 2ZQMA 2EIJB 1PNMA 4JTAB 1VQLV 1YHQV 3OFNG 3QO5A 3GWOA 4EKWA 2IU3A 1Y66A 4Q20A 1XL4A 3ZRWA 2QM8A 2Z5UA 3K0GA 4UVAA 5B3SC 1K8AW 3ZMTA 3OEHG 5IYBO 4N23A 2WLIA 3E2EA 2ITCC 4MVUA 3F7YC 1OCOC 5C93A 1P4RA 4ASUG 2X6BA 3EHBB 4X8AA 2WLLB 3ABMC 1E79G 3ZIAG 1BHAA 1K73W 5LGTA 4J9YB 2QE7G 4QNHB 3K06A 5HFLA 4PA9A 1H2GA 1FXKA 3IGAC 1K4DC 5IDJA 4TT3G 5EBLC 2W6IG 2X7RB 4FJCC 1Q7YW 1B6QA 3RVZA 1AJNA 3K9AA 3NXSA 2DW4A 4QPJA 1JX9A 3MHSC 3T2MA 1SRYA 1K5QA 3OUSA 1N8RW 1W0KG 4N21A 4OXSA 4G27B 1ZWIC 1OCRB 4XDLA 2JJ1G 1Q86W 4LP8A 3CCJV 2CK3G 3ABLC 1H8EG 3K08A 3CCVV 1FXHA 5IYCO 1ENVA 4BAYA 5EC1C 1SERA 3D3IA 5CN0A 4PDRA 3X2QC 1AI6A 2XAHA 3AEIA 2R9IA 1NKDA 1R6KA 2ZD9A 1KECA 1R3JC 1Q81W 1RPOA 1NVPB 4JPRA 1VQ5V 1R3IC 2Z3YA 1FS0G 4R7CA 3STZC 2W6JG 4PA3A 5B1BC 3MD0A 3OUFA 3SYPA 3ASOB 5B1OA 4Z1MG 5CA3A 2JJ2G 3JD3A 1OCCB 2JK5C 3CPWU 1GK9A 3LUTB 4MW8A 4MT8A 3E8GA 4RQFA 2ITDC 3AG2C 4MTGA 4JAVA 4KP4A 1VQPV 3JD1A 3LSQA 2EIJC 2IJKA 2B1GA 1R6NA 2K1EA 5L3DA 3QNEA 4LC1A 1VQMV 5CBFA 1QVGU 3W7TA 3AG1C 2X0LA 1PNLA 3FB7C 3OM3B 2V1DA 1FFTB 3CCRV 4XBFA 2IU0A 4H37A 3P30A 4U7OA 3ZRVA 5LBQA 2OCCB 3SYOA 1PD3A 3K3WA 5CBGA 1GM9A 1THZA 1W0JG 1YJWV 4P9OA 1GTOA 5B1AB 1RM1B 2EBOA 1M56B 2X6AA 3LNMB 2XAJA 2UXNA 2EIMB 4MSWC 4CBCA 3RVYA 2WLNA 2EZPA 3IC7A 4LCUC 3SPCA 2AHYA 3SYAA 3AG4B 4MTOA 4MVZA 2HVKC 4DO2A 3ABUA 1F23A 1CP9A 2JEXA 1NH2B 1F4NA 2EINC 2Q67A 1TUEB 2LFRA 1OCRC 3DGEA 4X88A 2Y69B 1CPYA 1QLEB 4WCEV 3ZJZA 4GX2A 2EILC 3ZRWB 4XDKA 1S5HC 1JCHA 1DTOA 3D36A 1KQSU 1QR9A 2HJFC 1VQNV 2P67A 1M9NA 2JIZG 4GX1A 3WFVA 3ASOC 2IJJA 4R6ZA 4UVBA 1JJ2U 2P7TC 1OCCC 2DYSB 3R65A 4JF3A 4KUMA 2D3OW 1YSCA 5L3EA 1PKXA 2HLDG 3ASNB 4MTFA 2XOKG 2LP7A 1K33A 3OMIB 2YSUB 1S0VA 1FXVA 1QR8A 2QA4V 3FYIB 1SETA 2DWEC 3ABKC 3HPLC 1VQ6V 2IJHA 3SYQA 1E1RG 4JASA 4X89A 3H01A 1VQ7V 5B1NA 3OE7G 1K92A 5E1AC 3UM7A 1DF5A 3WG7B 5L3BA 3AG3B 3QO8A 1V55B 2OCCC 1AI7A 4GCZA 3RW0A 4WFBV 4UV9A 2WLLA 3CCLV 3CCQV 5L3CA 4GX0A 4TSFG 4UUJC 5FL7G 1Y4MA 3JCZA 4PELA 1DF4A 2YEVB 5B1AC 3CMEV 1RM1C 3E8FA 2A9HA 1M56C 3FB6C 3STLC 3E8BA 1F4MA 2WWWA 2XNDG 4G2KA 5J9PC 4WFHA 3T1CA 2OT5A 4RQEA 1MOFA 3E8HA 2PI5A 4LBEC 4QE9A 3AG4C 3T4DA 2DWDC 1SESA 3E83A 4FPPA 3ZN1A 2HFEC 2H94A 5L3GA 2BOCC 1K7DA 1BL8A 3I56V 3SPIA 1GM7A 2IW5A 4JYBA 1QVFU 2DYRB 1MABG 4WFFA 2QEXV 2DQ0A 4MW3A 5H6QA 2XASA 3SYCA 2Y69C 2MK3A 1S77D 1WLEA 1NQTA 1QLEC 1H38A 3JYCA 3ZCCA 1VQKV 1YJNV 2X6CA 4MVOA 5B3SB 1S76D 1BHBA 1AI5A 1M1KW 4BIZA 2F43G 2AHZA 3OR6C 5KUKA 1K34A 2FTKA 4QPKA 5EBWC 2ZXWB 4G28B 4TWKA 3ZN0A 3ABMB 1M57B 1EBOA 1V54B 3ZRSA 3I55V 3F7VC 1UJWB 1G8MA 1AR1B 3CXCU 2WAMA 5H6RA 2DYSC 3B77A 3E89A 1BMFG 1S3JA 2ZDIC 3ASNC 4I5SA 3ZMVA 2XAGA 1G4YB 2EIKB 1KP2A 1ROPA 2NLJC 5L3FA 1Q82W 1MSWD 3ML0A 2C2AA 2B5UA 4P9PA 5CMUA 3G6EV 4FMTA 2EJRA 3VBBA 4ZBMA 2QTOA 1K97A 4JGSA 5LHGA 3WG7C 1VQ9V 1NVPD 5KA5A 3AG3C 1V55C 2HR3A 1F51A 2ATKC 4MVMA 1MG1A 4DXWA 3W7WA 4RUFA 1KP3A 4HYOA 1W2BU 4RUEA 3LDDA 4WFAV 3ZRXA 4UXNA 1E1QG 1IXMA 3ETDA 2WPDG 2A0LA 1K9MW 1PL0A 4JAUA 1GM8A 3CC2V 1DLBA 3CYOA 3K79A 1AI4A 4RO2A 3CCUV 1NBMG 2WLIB 4E2LA 1CEZA 2WLHA 3AG2B 3ETEA 4WFEA 2M7WA 4ZKIA 2W0FC 3TCUA 1NR7A 1R3KC 2DYRC 2KB1A 1VQ4V 1WPXA 3CC7V 4GX5A 1AJQA 1FXKB 4JTDB 1GMGA 1H8HG 3W7SA 1YJ9V 4XDJA 2HKOA 3TK1A 1M90W 4QIWF 3CCMV 3AG1B 3ETGA 4HZ3A 3VOUA 3CP1A 3OMNB 3OMAB 2GHYA 3GB7C 1S72V 3G4SV 1YI2V 3FYEB 5LGNA 4KFMA 4WF9V 4WFGA 2V7QG 1KC8W 3OAAG 3A0RA 2QM7A 3K04A 2GSMB 4CZZA 4U7NA 3ZMSA 3F5WC 3EFFK 4UV8A 2BOBC 1P7BA 2ZXWC 1NR1A 1COWG 1M57C 4MVQA 1V54C 4PDLA 1NH2D 1I5XA 4PA4A 2ZDIA 2IH1C 3P32A 5CBHA 1R73A 3BEHA 1JQ0A 2XAQA 3KG2A 4PDVA 4YXWG 1L1FA 3RBZA 1OCZB 2Q68A 3W7XA 2EIMC 2EINB 2EIKC 3TETA 2WLKA 4QJFB 3OW2U 1ORQC 3ABTA 5IY5B 2DQ3A 3PJSK 1AROP 2R9RB 1JPXA 3CC4V 5EK0A 1YTFB 3FKSG 4R8CA 2JDIG 4JYCA 2B1IA 5LHIA 1OHHG 1K5SA 5DM6V 3ZMZA 2EILB 3BY6A 2HG5C 2YEVA 3SJQC 1SZTA 2JEUA 3QO7A 3LDCA 3JD0A 3UKMA 3IFXA 4FIPC 5IYDO 5EC2C 4MVRA 2WLJA 2UXXA 4J9ZB 3SPJA 2LFSA 1OCOB 2ZR3A 4MTXA 4PDMA 4H33A 4RAIA 1KD1W 4MVSA 1EFRG 1OZ0A 3K03A 2NNUA 2WLMA 5EBMC 5KA6A 5HFMA 2Q69A 1GKFA 3MHHC 4GT1A 1K4CC 2Y48A 1AJPA 3LDEA 2WSSG 1QBZA 4HAMA 3ABKB 4JTCB 1HWYA 1FXKC 2Q6AA 1KKDA 2A79B 2IJIA 3K0DA 4F4LA 3OEEG 1NJIW 4P30A 2P90A 4I9WA 1RPRA 5KUMA 2EZOA 4BW5A 2QKSA 2OTJV 1JOYA 1EZJA 4P2ZA 3JD4A 1J95A 1YIJV 4QE7A 4MS2A 3SPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKD A;  1F4M A;  1GTO A;  2IJI A;  1ROP A;  2IJJ A;  1B6Q A;  1F4N A;  3K79 A;  2GHY A;  1GMG A;  1RPO A;  2IJK A;  2IJH A;  4DO2 A;  1RPR A;  1PD3 A; 
#chains in the Genus database with same CATH topology
 1K3E A;  3FD9 A;  3JD2 A;  4BIU A;  4IHJ B;  4LFC B;  3AK1 A;  5BZB A;  5JJJ B;  3CMA V;  4PA7 A;  5LGU A;  4GLX A;  4NR1 A;  1GO3 F;  4EFB A;  5LMU B;  1BQZ A;  1QCE A;  1PNK A;  2IH3 C;  2P06 A;  3RWR D;  4FK5 C;  4DR2 B;  1PNM A;  1VQL V;  3H1K H;  3G6B A;  1N34 B;  4EKW A;  1VF7 A;  3O9O A;  1Y66 A;  4TOI A;  2CH7 A;  5IE9 A;  2QM8 A;  4UVA A;  3QVN A;  4QGP A;  5KHG A;  4FVM A;  2R72 A;  3F7Y C;  1OCO C;  3CRM A;  1AVM A;  2X6B A;  2WLL B;  3ZIA G;  5LGT A;  3SJC C;  4QNH B;  4PA9 A;  3IGA C;  1K4D C;  1SA0 A;  4X62 O;  4CH4 A;  2X7R B;  2HJD A;  1B6Q A;  3NXS A;  4QPJ A;  1JX9 A;  3MHS C;  3T2M A;  4O2B A;  2A3Q A;  4N21 A;  4DYL A;  1ZWI C;  1OCR B;  2LJ2 A;  1YDX A;  4LP8 A;  2AW9 A;  2VRZ A;  1SER A;  3D3I A;  5CN0 A;  4PDR A;  5J2U B;  2UUC O;  1N32 O;  1R3J C;  2BTQ B;  4DV4 O;  1VQ5 V;  3D3Q A;  3CX5 F;  2N05 A;  3MD0 A;  3SYP A;  3ASO B;  2QGN A;  4TUY B;  4X66 B;  2JJ2 G;  3JD3 A;  3CPW U;  2F66 C;  1GK9 A;  4AQY B;  4JAV A;  4KP4 A;  4LF8 B;  3LSQ A;  2K1E A;  4LC1 A;  1VQM V;  3GWK C;  3SDL A;  3RYC A;  2E5L B;  1L8D A;  1QNM A;  4XBF A;  1HNX B;  1MZF A;  2IU0 A;  4H37 A;  5LBQ A;  4U7O A;  4GKK O;  4EB6 B;  5LMN B;  2ADP A;  3SYO A;  1I08 A;  5CBG A;  3QF7 A;  1GM9 A;  1YJW V;  4EFE A;  4P9O A;  1M56 B;  4U3J B;  5BR8 O;  1YCI A;  3NR7 A;  2AHY A;  2ZM6 O;  2HVK C;  4JI2 B;  4JYA O;  3OT7 A;  1NH2 B;  3H9V A;  1M4U A;  2KQX A;  4PD4 F;  1TUE B;  5KMG B;  1OCR C;  5AG2 A;  4UB8 Z;  1XIL A;  4X88 A;  2Y69 B;  4LF5 B;  3HKC A;  5DEC A;  4DUY O;  2HHH B;  4GX2 A;  1HDJ A;  4LFA O;  2PGG A;  1XUQ A;  4LF4 B;  3IAY A;  2Y0I A;  3WB0 A;  5JVD B;  3WFV A;  3ASO C;  1BQ0 A;  3ZBH A;  2IJJ A;  4UVB A;  1JJ2 U;  3U0Z A;  3M8A A;  2RNB A;  2D3O W;  4JF3 A;  5L3E A;  1PKX A;  3ASN B;  4D7S A;  1GN6 A;  2LQT A;  4AIL C;  1FXV A;  4F6R B;  3K5L A;  4JI8 O;  3DC5 A;  2QA4 V;  3ABK C;  4EEQ A;  5C8Y B;  4JAS A;  3RYF B;  3OE7 G;  1IBL O;  3WG7 B;  5D5Q A;  1Z5W A;  3CJH B;  4DR6 B;  2WLL A;  1VEW A;  5L3C A;  4GX0 A;  4TSF G;  4UUJ C;  5FL7 G;  1N36 O;  4NXN O;  2A9H A;  1M56 C;  5JWP A;  3ZHQ A;  2OT5 A;  4RQE A;  3TJT A;  1MOF A;  3T4D A;  1SES A;  3E83 A;  2KSD A;  1BL8 A;  4H13 B;  4O4I B;  3UQ8 A;  4MW3 A;  2PTM A;  5H6Q A;  2Y69 C;  3VQW A;  1WLE A;  1AP5 A;  4B3R B;  2YXL A;  1H38 A;  3JYC A;  2X6C A;  4MVO A;  2P5O A;  1S76 D;  2F43 G;  2AHZ A;  3OR6 C;  5BY1 A;  4JI4 B;  2FTK A;  2UXB B;  1WP8 A;  1NTM H;  3RGB A;  2YXH A;  3P3P A;  4LFB B;  4IGG A;  3I55 V;  2FML A;  2GTS A;  3CXC U;  1L0N H;  5CB4 B;  1GH6 A;  3B77 A;  1BMF G;  3ASN C;  4YY3 B;  1XMO O;  3WB1 A;  2EIK B;  1KP2 A;  1ROP A;  2NLJ C;  5L3F A;  1SQP H;  4O4J B;  4FMT A;  2EJR A;  4JI5 B;  3VBB A;  3BCC H;  5K1X A;  1PPJ H;  3WG7 C;  1XOU A;  4JI7 B;  3K5M A;  1F51 A;  4GKJ B;  4H0L B;  4MVM A;  3W7W A;  1KP3 A;  4UCO A;  1W2B U;  3BAB A;  4WFA V;  4UXN A;  1E1Q G;  1FPO A;  1OV9 A;  1IXM A;  3ETD A;  4U3J A;  2WPD G;  1Y76 A;  2ZIO A;  1PL0 A;  4JAU A;  1K9M W;  1GM8 A;  5K1P A;  3CC2 V;  4DV6 O;  4TV8 B;  3CYO A;  3CCU V;  4RO2 A;  2FB5 A;  4YJ2 B;  2CUG A;  3A2F A;  3SJB C;  2F1M A;  1N33 B;  3CC7 V;  1AJQ A;  1FXK B;  1NZ6 A;  3CRQ A;  3TK1 A;  5FLX N;  4HZ3 A;  2GHY A;  3UT5 B;  3OGI B;  5CA1 A;  5IYZ A;  4KFM A;  1KC8 W;  3A0R A;  2QM7 A;  3THO A;  3VQY A;  1DK1 A;  2GSM B;  4OPA A;  2EUL A;  1P7B A;  1MSD A;  2OIE A;  4MVQ A;  4B7K A;  4PDL A;  1NH2 D;  1I5X A;  2WA3 A;  2IH1 C;  5CBH A;  4PDV A;  4YXW G;  4WBN A;  3BA8 A;  1OCZ B;  3GVM A;  4FZ0 A;  1HR0 O;  2EIK C;  3TET A;  2OWO A;  1SQX H;  4LF7 O;  5C8Y A;  2WLK A;  3RYF A;  4FFK A;  3OW2 U;  1ORQ C;  3ABT A;  3B09 A;  3PJS K;  1ARO P;  2R9R B;  4PI0 A;  4YIO A;  5JCO C;  2UU9 O;  4JYC A;  2B1I A;  5H2F Z;  2VWJ A;  2LW1 A;  5FPR A;  1F7Y A;  1M5I A;  1OHH G;  5LP6 B;  1N4C A;  3UO3 A;  4DW0 A;  2HG5 C;  3SJQ C;  4KHP B;  2O57 A;  1SZT A;  2XUM A;  3D36 C;  1JFF B;  3AG7 A;  5IYD O;  5EC2 C;  2UUB O;  2UXX A;  4J9Z B;  3SPJ A;  2LFS A;  1P7G A;  1X4T A;  3K03 A;  2WLM A;  2YIB A;  4NTW A;  3MHH C;  2AZ0 A;  1SQV H;  1AJP A;  1XQ8 A;  4X20 B;  4B3S B;  2WSS G;  3FX7 A;  1FXK C;  2Q6A A;  1KKD A;  4NYK A;  2A79 B;  4CH5 A;  2ZE6 A;  2F4V O;  2RCV A;  3OEE G;  4P30 A;  4LF9 B;  4YHH B;  4O4H B;  4BW5 A;  1IBK B;  1EZJ A;  3TCU A;  3T1Y B;  1D5N A;  5EZY A;  2ZE5 A;  5GW7 A;  2DE0 X;  1O9G A;  3PN1 A;  3X2Q B;  3E86 A;  1GN3 A;  3FB5 C;  3CD6 V;  3MAQ A;  1PP9 H;  4NKG B;  2H8P C;  3RYH B;  1XNR B;  2AGA A;  5B1B B;  2VQE B;  1OCZ C;  1SQF A;  1VIB A;  4CC5 A;  3DTU B;  5JCO A;  3RN4 A;  5JJN B;  3OGC C;  3UO2 A;  4DV7 O;  2BCC H;  1R3L C;  1VQO V;  4U3F H;  1H2N A;  3T1H O;  4JTA B;  5LP6 C;  3QO5 A;  3GWO A;  4Q20 A;  3CWB H;  1SQG A;  5B3S C;  4GZR B;  2XTA A;  3ZHU A;  3DC6 A;  4N23 A;  2UXC O;  4YJ2 A;  4UCV A;  1MZE A;  2ETN A;  4ASU G;  4CH6 A;  4X8A A;  4KL1 A;  1E79 G;  4DR4 O;  4I4T B;  1BHA A;  1D2D A;  4FM1 A;  5EYP A;  3K06 A;  4X65 B;  1FXK A;  3WU2 Z;  5IDJ A;  3L71 H;  4FLV A;  4TT3 G;  3ZHS A;  2E3C A;  2LO1 A;  3RVZ A;  1AJN A;  1M93 A;  2D2C B;  2JVD A;  1OJH A;  1SRY A;  1EN5 A;  4OXS A;  3OD4 A;  4XDL A;  5KAF Z;  4X64 B;  4DV2 O;  3CCV V;  3K08 A;  3ZHR A;  2VQF B;  3ZS8 C;  3B4S A;  3X2Q C;  3H1J H;  2R9I A;  1NKD A;  1EN6 A;  4FLY A;  5A9G A;  1RPO A;  2Z3Y A;  1WN7 A;  3N2G A;  1JJO A;  4R7C A;  2W6J G;  5B1B C;  3OUF A;  2DMX A;  1HP8 A;  4DR7 O;  1WA8 B;  1Q90 D;  1AIL A;  3L74 H;  4JI6 B;  3AG2 C;  5LP6 A;  3RFR A;  3TXS A;  2M6Y A;  1WB8 A;  3AK3 A;  4LWS A;  1URF A;  2ZKO A;  5CBF A;  3W7T A;  4HNA B;  1NT2 B;  3AG1 C;  2X0L A;  4B3T B;  1JFF A;  5LXT A;  2Q0A A;  2V1D A;  1AP6 A;  3G80 A;  4DR1 O;  4FLT A;  4AI8 A;  4D6T H;  1MMM A;  3P30 A;  2OCC B;  1PD3 A;  1TUB B;  2JGU A;  3K3W A;  1O9H A;  3JAM N;  1THZ A;  1W0J G;  3U10 A;  2QJ1 A;  2EBO A;  4X20 A;  2X6A A;  2UXD B;  3JAS B;  1ZL8 B;  2WLN A;  2Q9L A;  3SYA A;  4ZHQ B;  3AG4 B;  1BT8 A;  4MTO A;  4MVZ A;  4TQD A;  2JEX A;  1CP9 A;  1LR1 A;  2YDE A;  3HKD B;  1F4N A;  4O4H A;  1A32 A;  2F93 B;  2HEP A;  4X1I B;  4PJ0 Z;  2P4K A;  2G38 A;  2QSA A;  1JMK C;  3ZJZ A;  4O4L B;  1V9P A;  2QWN B;  3ZRW B;  4Z1V A;  4XDK A;  1S5H C;  3A0H Z;  2HP8 A;  2JIZ G;  1Q43 A;  1WJZ A;  4FLX A;  4B3M O;  1U97 A;  2W0X A;  1G6U A;  4I50 A;  4X66 O;  4MTF A;  3L9D A;  2LP7 A;  3KKY A;  4DV1 B;  3JAL B;  2Y0P A;  3FYI B;  2DWE C;  4A5U B;  4LF8 O;  3HPL C;  3SYQ A;  1E1R G;  3BA9 A;  1QQC A;  5B1N A;  1YF2 A;  3A8T A;  3UM7 A;  1XBL A;  3N2K B;  3QO8 A;  1V55 B;  2OCC C;  1AI7 A;  3RW0 A;  4FFB B;  1R6T A;  1ZX3 A;  3CCL V;  4I4T A;  1Y4M A;  4NB5 A;  4PEL A;  2YEV B;  2QWQ B;  2XND G;  4G2K A;  1IBM O;  4LR3 A;  2JRI A;  3E8H A;  3AG4 C;  2ZIM A;  1Y74 B;  4RWU A;  2BOC C;  1AB3 A;  3IJ4 A;  2YS8 A;  3I56 V;  4NTX A;  1GM7 A;  3SPI A;  4BW9 A;  4JYB A;  1QVF U;  2DYR B;  1MAB G;  2DQ0 A;  4FLZ A;  5BMV B;  1S77 D;  2Q7H A;  4H44 B;  3ZCC A;  4JI0 O;  1BHB A;  2P22 C;  1AI5 A;  1SKV A;  3ZX6 A;  3H1H H;  5KUK A;  2PYL A;  5ITZ B;  4QPK A;  5EBW C;  3ABM B;  2ILM A;  4X62 B;  1R1B A;  1UJW B;  1G8M A;  1US6 A;  1IUR A;  2Z0A A;  2ZDI C;  4K35 A;  1G4Y B;  4HNA A;  5JH7 B;  4P9P A;  3G6E V;  5KAI Z;  1ZLZ A;  4UCT A;  4DK0 A;  5J2T B;  4IIJ B;  2P4V A;  4K8X A;  5KA5 A;  1Q3E A;  2QWO B;  1V55 C;  4IHJ A;  2HR3 A;  2UUC B;  1N32 B;  1MG1 A;  4RUF A;  4HYO A;  5CA0 B;  4DV4 B;  1B04 A;  4DR6 O;  2JS3 A;  3ZRX A;  3CEI A;  4NXM B;  3JAS A;  1ZL8 A;  3K57 A;  4ZHQ A;  3HKD A;  1AI4 A;  1N0J A;  2Q7E A;  2WLI B;  1CEZ A;  2QKA A;  3H1L H;  1RFY A;  3ETE A;  2W0F C;  2PY5 A;  2DYR C;  2KB1 A;  4GX5 A;  1LUW A;  1GMG A;  1M90 W;  2HKO A;  4O4L A;  4QIW F;  1L0L H;  4GKK B;  2EX3 A;  3OMN B;  1S72 V;  2EJ7 A;  3FYE B;  3D8C A;  4B7E A;  3OAA G;  3K04 A;  5LOV B;  1XMQ O;  4U7N A;  4F6E A;  3EFF K;  4UV8 A;  3J81 N;  5BR8 B;  5IWA O;  3JAK B;  4DRX B;  2ZDI A;  1TA8 A;  2ZM6 B;  1JQ0 A;  4JYA B;  3JAL A;  1LUV A;  2Q68 A;  2EIN B;  3OTF A;  1QHT A;  4JI1 O;  4QJF B;  2NR5 A;  3QTC A;  4UCS A;  5IJ0 B;  1CXZ B;  3ICX A;  2DQ3 A;  5FNV B;  4DUY B;  3FKS G;  4R8C A;  3DSQ A;  2ZNI A;  4FFB A;  4UFZ A;  4LFA B;  4DV0 O;  5DM6 V;  4I9Q A;  2GDS A;  2EIL B;  2QM4 A;  3JCU Z;  2YEV A;  5J2U A;  3TGU H;  4TQF A;  3OTO O;  3FAV B;  2BTQ A;  4DR5 O;  1SF9 A;  4MTX A;  1Y67 A;  4PDM A;  2IBZ H;  4TUY A;  1OZ0 A;  2NNU A;  4I55 B;  4JZ2 A;  5KHK A;  1VMG A;  1UFI A;  4JI8 B;  2Y48 A;  3EXA A;  4Q6G A;  1HNZ O;  4JTC B;  1HWY A;  1IBL B;  3HKB B;  4PI2 A;  3S3X A;  2PUS A;  1XI1 A;  2K9P A;  4F4L A;  1NJI W;  4LF6 O;  4YIP A;  1RPR A;  4K8Z A;  2Q73 A;  2OTJ V;  1JOY A;  1N36 B;  4MS2 A;  4EB6 A;  3SJA C;  2A06 H;  3ABL B;  5A2Q N;  1H2L A;  4NXN B;  2ADQ B;  3B8N A;  3B8M A;  2GTA A;  4J7J A;  1JVM A;  2PZS A;  4ZI7 B;  3CCS V;  1AR4 A;  1YTF D;  2ZR2 A;  2PI4 A;  2CAZ C;  1FJG O;  1SQB H;  5JH7 A;  3LSS A;  4L87 A;  4ICG A;  5LHH A;  3M99 B;  3G71 V;  4JI3 B;  2F23 A;  2IM9 A;  3JAW B;  4CS3 A;  5H9C A;  4IIJ A;  1GN2 A;  5DN6 G;  5KMG A;  4PA6 A;  5CA0 A;  1YHQ V;  3OFN G;  1RSO B;  4O2A B;  2IU3 A;  3APQ A;  5BXZ A;  2Z5U A;  3K0G A;  2QWR B;  4J11 A;  1K8A W;  3ZMT A;  5IYB O;  4IL6 Z;  3JAR B;  4K0K O;  5JVD A;  2WLI A;  5C93 A;  1P4R A;  2ARH A;  1XMO B;  3EHB B;  4DV5 O;  5KHH A;  4OPH A;  1K73 W;  4J9Y B;  2QE7 G;  5HFL A;  5EBL C;  1BZK A;  2CTR A;  1SC5 B;  3K9S A;  4F6R A;  2DW4 A;  1UPG A;  5LOV A;  1N8R W;  1W0K G;  1BCC H;  4LF9 O;  3CCJ V;  1IBK O;  3ABL C;  3CJH A;  1FXH A;  4DV3 O;  3JAK A;  4BAY A;  5EC1 C;  3K5N A;  1H2S B;  1Q6U A;  1FFX B;  4DV6 B;  4FZ1 A;  3N27 A;  1R6K A;  1BS3 A;  1KEC A;  4J10 A;  1NVP B;  1R3I C;  3HKE B;  5B1O A;  5IJ0 A;  5CA3 A;  4OX9 O;  4MW8 A;  4O4I A;  4MT8 A;  4RQF A;  1HNW O;  4D7T A;  2CGO A;  1VQP V;  2B1G A;  1SS3 A;  2Y4T A;  2F95 B;  4DR3 O;  5FPO A;  3FB7 C;  2YC0 A;  1FFT B;  4BWA A;  4I55 A;  1IDS A;  5B1A B;  1GTO A;  1RM1 B;  3CXH F;  5CB4 A;  5D5P A;  3LNM B;  4CC6 A;  1XNQ O;  2UXN A;  1DGS A;  2EIM B;  3C3S A;  4MSW C;  4DUZ O;  2KKW A;  4CBC A;  3HKB A;  3RVY A;  1NTZ H;  1I94 O;  4GYC B;  4DO2 A;  4O4J A;  1GRJ A;  1NU1 H;  2LFR A;  3L70 H;  4HBN A;  1QLE B;  4WCE V;  3DXR B;  4ZI7 A;  2NN4 A;  4BR6 A;  2UUB B;  1KU9 A;  4E4E A;  2CH7 B;  4LH6 A;  1JCH A;  1DTO A;  3D36 A;  1IZ3 A;  1KQS U;  4NVP A;  1VQN V;  1KMI Z;  4TV8 A;  3JAW A;  2UUA O;  2DYS B;  2Q7G A;  4KUM A;  1TVK B;  1YSC A;  2CTQ A;  2F4V B;  2HLD G;  1VF5 B;  1SA0 B;  1K33 A;  4J41 A;  4DK1 A;  2YSU B;  4JV5 O;  1RSO A;  3LSU A;  4O2A A;  2BE3 A;  1QR8 A;  1VQ6 V;  2IJH A;  3UT5 A;  3H01 A;  5L3B A;  1BGY H;  3JAR A;  4KXR A;  4WFB V;  4UV9 A;  3K5O A;  1J5E O;  5JQG B;  2OIG A;  5B1A C;  1RM1 C;  3STL C;  2Q0O C;  4LFC O;  2WWW A;  4DV7 B;  2PI5 A;  4LBE C;  4QE9 A;  4FPP A;  2ZE8 A;  3ZN1 A;  2H94 A;  4PV1 B;  5L3G A;  3T1H B;  2BSK B;  1NI8 A;  5IT9 N;  5LMU O;  3IC9 A;  4C7U A;  4WFF A;  2QEX V;  3CE2 A;  3B2E E;  2XAS A;  3SYC A;  4BIO A;  1FFX A;  1QLE C;  1XDC A;  1VQK V;  1YJN V;  2LW7 A;  4J7Z A;  1M1K W;  4BIZ A;  5GON B;  2UXC B;  4DR2 O;  1K34 A;  4W4L A;  1N34 O;  5B5E Z;  4DR4 B;  4ZOL B;  2ZXW B;  4TWK A;  2Q4P A;  4X1K B;  2AZ2 A;  1JR9 A;  1G1X B;  1EBO A;  1M57 B;  2E76 B;  1V54 B;  4UCR A;  1AR1 B;  2B9Z A;  2KG7 B;  2WAM A;  5H6R A;  5TIS Z;  1NS1 A;  2DYS C;  1P84 F;  3CRR A;  4FLW A;  1GAX A;  1Q82 W;  3ML0 A;  2C2A A;  4GUN A;  4DV2 B;  3LNN A;  2QTO A;  1K97 A;  4JGS A;  5LHG A;  2L6L A;  1VQ9 V;  1NVP D;  4X1Y B;  4K3A A;  3HKC B;  4DXW A;  2AXT Z;  4RUE A;  1FAF A;  1GN4 A;  3VQX A;  2Y4U A;  2A0L A;  4DR7 B;  3RYH A;  3CSX A;  4B08 A;  1W59 A;  2ZNJ A;  1D5A A;  1DLB A;  2CTP A;  4JZG A;  1NBM G;  3ZHV A;  1VF6 C;  4E2L A;  3K59 A;  2WLH A;  1I7F A;  4AHC A;  4WFE A;  2M7W A;  4ZKI A;  1NR7 A;  1R3K C;  1VQ4 V;  3DXR A;  4JTD B;  3ZHT A;  1H2K A;  5LA6 B;  4IT5 A;  3W7S A;  1YJ9 V;  2R70 A;  4XDJ A;  4DR1 B;  3CCM V;  3VOU A;  4AQY O;  3OMA B;  3G4S V;  1YI2 V;  4WFG A;  4CZZ A;  3ZMS A;  1EM1 A;  2BOB C;  2ZXW C;  2YID A;  4J80 A;  2DOS A;  2E5L O;  1COW G;  1M57 C;  1V54 C;  1HNX O;  5E79 Z;  1VAR A;  1TVK A;  5LMN O;  2CDY A;  2ODM A;  3KCY A;  2XAQ A;  2YUA A;  3W7X A;  3SR2 C;  4Z2W A;  2LGQ A;  5IJ9 B;  3R66 A;  1P49 A;  4YJ3 B;  5IY5 B;  3CC4 V;  1JPX A;  5EK0 A;  4CS4 A;  2R9A A;  1YTF B;  4JI2 O;  3SGI A;  3ZMZ A;  2Q5Z A;  5JQG A;  1Q6H A;  1TAE A;  3QO7 A;  2MW2 B;  4LF5 O;  3LDC A;  3UKM A;  3IFX A;  2HHH O;  4B3M B;  4NXM O;  2QDO A;  1VF6 A;  2ZR3 A;  4RAI A;  2N04 A;  2BSK A;  2BTO A;  2PYJ A;  4LF4 O;  2GUZ B;  5EBM C;  1WA8 A;  5KA6 A;  5HFM A;  2Q69 A;  1GKF A;  4GT1 A;  1K4C C;  1X59 A;  3LDE A;  1QBZ A;  3ABK B;  3MDS A;  1YEW A;  1XEQ A;  2XHB A;  3EVK A;  5GON A;  3J7A U;  4I9W A;  3L72 H;  5LYJ B;  1VP7 A;  2RN9 A;  2EZO A;  1XRE A;  2QKS A;  4ZOL A;  1YIJ V;  4X1K A;  4QE7 A;  3SPH A;  3CCE V;  4NTY A;  1TUB A;  1ZTE A;  3K58 A;  1LNQ A;  2XAF A;  2OTL V;  1XL6 A;  2P6J A;  2KG7 A;  1VQ8 V;  3JSL A;  1QLN A;  1IBM B;  3T4Z A;  2HVJ C;  2E75 B;  4L8J A;  1Y76 B;  3S3W A;  3ZMU A;  3W7U A;  3HB3 B;  4R50 A;  2DJV A;  3FB8 C;  3F5T A;  1YIT V;  1Q5O A;  2V4D A;  3C90 A;  4J7K A;  1EN4 A;  3SPG A;  1I5Y A;  3OR7 C;  5IY5 C;  4X1Y A;  4UVC A;  1MNG A;  4X1I A;  4I0X B;  4JI0 B;  3E35 A;  3J80 N;  2ZQM A;  2EIJ B;  1BSM A;  1PM9 A;  2YIC A;  5CA1 B;  5IYZ B;  1XL4 A;  3ZRW A;  4LH7 A;  3B40 A;  4B3R O;  3OEH G;  3CRA A;  3E2E A;  2ITC C;  4MVU A;  3P3N A;  4JI4 O;  3UCS C;  2RDC A;  2UXB O;  3ABM C;  1TGO A;  2GV9 A;  5DED A;  2ZE7 A;  3KZI Z;  3BRC A;  1H2G A;  4LFB O;  5LA6 A;  4WBN B;  2W6I G;  4FJC C;  1Q7Y W;  3K9A A;  2FKX A;  2CGN A;  2OYQ A;  4YY3 O;  2GBO A;  1KUQ A;  1K5Q A;  3OUS A;  4G27 B;  1YXB A;  3N2K A;  2JJ1 G;  1Q86 W;  4ABM A;  3ETQ A;  2QWP B;  2CK3 G;  4JI5 O;  1H8E G;  3CS5 A;  5IYC O;  1NTK H;  1ENV A;  1AI6 A;  2XAH A;  3AEI A;  3WB2 A;  4JI7 O;  1T5E A;  1S5J A;  2ZD9 A;  4CS2 A;  4GKJ O;  1Q81 W;  2ZT9 B;  3C3T A;  4JPR A;  4FM0 A;  5IJ9 A;  1FS0 G;  3STZ C;  4FM2 A;  4PA3 A;  4Z1M G;  2WA4 A;  1SZX A;  4ZIB A;  4YJ3 A;  2N74 A;  2QKC A;  2YIA A;  1IXB A;  1Y74 A;  1OCC B;  2JK5 C;  4JI3 O;  3LUT B;  3E8G A;  2ITD C;  4MTG A;  3JD1 A;  5B66 Z;  2EIJ C;  2IJK A;  5BMV A;  1R6N A;  5L3D A;  3QNE A;  1XMQ B;  1N33 O;  1QVG U;  3E22 B;  3TXQ A;  3RYI B;  1PNL A;  3OM3 B;  5EIB C;  1U96 A;  5IWA B;  3CCR V;  4W4K A;  5ITZ A;  3ZRV A;  1Z2G A;  2VS0 A;  5EZY B;  2ZCE A;  5LL6 Y;  2ZIN A;  5KX5 B;  2GUZ A;  3JSN A;  4JYY A;  3L73 H;  2JS5 A;  2LGW A;  2XAJ A;  4JI1 B;  2L35 A;  2EZP A;  3IC7 A;  2DN9 A;  4LCU C;  3SPC A;  3ABU A;  5LYJ A;  1F23 A;  1N0N A;  2EIN C;  2Q67 A;  4DV0 B;  1FD9 A;  5J2T A;  4I7Z B;  3DGE A;  1CPY A;  4IYI A;  3M7M X;  3OTO B;  4IYH A;  4DR5 B;  2EIL C;  3JAT B;  1QR9 A;  3QG5 A;  2HJF C;  2P67 A;  4KHP O;  1AR5 A;  1ZSP A;  1EZV H;  1WP7 A;  1M9N A;  4GX1 A;  1HNZ B;  2JGD B;  4R6Z A;  2P7T C;  1OCC C;  3R65 A;  4I0X A;  5KHI A;  5EYP B;  4LF6 B;  3CRC A;  2XOK G;  3OMI B;  1S0V A;  2YXY A;  2XT9 A;  1SET A;  4B3S O;  4X89 A;  1VQ7 V;  1QU7 A;  1K92 A;  5E1A C;  1DF5 A;  5KLV H;  3AG3 B;  2QTS A;  4GCZ A;  4YHH O;  3CCQ V;  1FJG B;  3Q4H B;  3T1Y O;  3JCZ A;  4DRX A;  1DF4 A;  4TV9 B;  3CME V;  3E8F A;  3FB6 C;  1SQQ H;  1F4M A;  3E8B A;  5J9P C;  4LNU B;  4WFH A;  3T1C A;  3N2G B;  1PL4 A;  4CH3 A;  2OCH A;  2DWD C;  2HFE C;  3HR0 A;  1XNR O;  1K7D A;  2Q8V A;  2VQE O;  5EIB D;  5FNV A;  2IW5 A;  1Q8I A;  4PHZ A;  1WNS A;  4LWS B;  2MK3 A;  1NQT A;  5B3S B;  4K0K B;  5F2V O;  5LXT B;  3FAV A;  5GTH Z;  1Y6X A;  4DV5 B;  4G28 B;  3ZN0 A;  1MA1 A;  3ZRS A;  3F7V C;  4X9Q A;  3CHX A;  3AK2 A;  1HR0 B;  3E89 A;  4LF7 B;  1S3J A;  4I5S A;  3ZMV A;  2XAG A;  3BAA A;  1JA8 A;  3E22 A;  1MSW D;  4X65 O;  2B5U A;  3RT3 C;  3RYI A;  5CMU A;  1Z5V A;  2FL4 A;  2UU9 B;  4DV3 B;  4ZBM A;  1FYJ A;  3FFQ A;  1HW7 A;  3AG3 C;  5KX5 A;  1KB9 F;  4OGQ B;  2ATK C;  5KHJ A;  1BE3 H;  3LDD A;  2YIB D;  4X64 O;  2RMK B;  4DW1 A;  1ZUQ A;  1ZAU A;  2A7W A;  2VQF O;  2YI9 A;  4UCU A;  2PF4 E;  4OX9 B;  3K79 A;  5H5N A;  1HNW B;  3AG2 B;  3I5D A;  4I50 B;  3VQV A;  3BFR A;  3CB2 A;  1WPX A;  4DR3 B;  1H8H G;  1B06 A;  4JAA A;  3AG1 B;  3ETG A;  3CP1 A;  3JAT A;  4JI6 O;  3A0B Z;  3GB7 C;  1IX9 A;  3H1I H;  5LGN A;  3APO A;  4WF9 V;  2V7Q G;  1FKA O;  1WPB A;  4O2B B;  1WB7 A;  3F5W C;  5JJE B;  2JGD A;  1XNQ B;  4B3T O;  1NR1 A;  3BPZ A;  4DUZ B;  1WAZ A;  1Q6I A;  1I94 B;  4PA4 A;  3P32 A;  3G67 A;  1R73 A;  3BEH A;  1KBH A;  3KG2 A;  1L1F A;  2CTW A;  3RBZ A;  2EIM C;  2YI8 A;  2RQ6 A;  2UXD O;  1XHZ A;  2QR4 A;  3BHP A;  2FYU H;  2JDI G;  3BVO A;  5LHI A;  1K5S A;  4FLU A;  2RJZ A;  5GTI Z;  1YZB A;  3L75 H;  3Q4H A;  3BY6 A;  1KYO F;  1PV0 A;  4TV9 A;  4J42 A;  2JEU A;  4UB6 Z;  4LNU A;  3JD0 A;  3RYC B;  4FIP C;  2UUA B;  4MVR A;  2WLJ A;  1S5L Z;  3O65 A;  3HKE A;  1OCO B;  4H33 A;  1B3Q A;  3KCX A;  1KD1 W;  4MVS A;  1EFR G;  1I0H A;  4JV5 B;  2E74 B;  1YVW A;  1H2M A;  2VWK A;  3U11 A;  1RP3 B;  3ZED A;  4HAM A;  2H3O A;  2IJI A;  3K0D A;  1KKC A;  2P90 A;  4DV1 O;  1IVS A;  5KUM A;  4P2Z A;  3JD4 A;  1J5E B;  1J95 A;  2CE4 A;  1XHX A; 
#chains in the Genus database with same CATH homology
 3CCE V;  1K3E A;  3ABL B;  3JD2 A;  4BIU A;  5GW7 A;  3B8N A;  1LNQ A;  2XAF A;  3B8M A;  2OTL V;  1XL6 A;  2P6J A;  1JVM A;  3X2Q B;  1VQ8 V;  1QLN A;  3E86 A;  3CCS V;  3T4Z A;  5BZB A;  2HVJ C;  1YTF D;  2ZR2 A;  3FB5 C;  4PA7 A;  5LGU A;  3CMA V;  3CD6 V;  2PI4 A;  2H8P C;  3ZMU A;  3HB3 B;  3W7U A;  1GO3 F;  4R50 A;  3FB8 C;  5B1B B;  3LSS A;  1OCZ C;  1YIT V;  4L87 A;  5LHH A;  3M99 B;  3G71 V;  1QCE A;  1PNK A;  3DTU B;  2IH3 C;  3SPG A;  1I5Y A;  3OR7 C;  3OGC C;  4FK5 C;  5H9C A;  5IY5 C;  1R3L C;  5DN6 G;  4UVC A;  1VQO V;  3E35 A;  4PA6 A;  2ZQM A;  2EIJ B;  1PNM A;  4JTA B;  1VQL V;  1YHQ V;  3OFN G;  3QO5 A;  3GWO A;  4EKW A;  2IU3 A;  1Y66 A;  4Q20 A;  1XL4 A;  3ZRW A;  2QM8 A;  2Z5U A;  3K0G A;  4UVA A;  5B3S C;  1K8A W;  3ZMT A;  3OEH G;  5IYB O;  4N23 A;  2WLI A;  3E2E A;  2ITC C;  4MVU A;  3F7Y C;  1OCO C;  5C93 A;  1P4R A;  4ASU G;  2X6B A;  3EHB B;  4X8A A;  2WLL B;  3ABM C;  1E79 G;  3ZIA G;  1BHA A;  1K73 W;  5LGT A;  4J9Y B;  2QE7 G;  4QNH B;  3K06 A;  5HFL A;  4PA9 A;  1H2G A;  1FXK A;  3IGA C;  1K4D C;  5IDJ A;  4TT3 G;  5EBL C;  2W6I G;  2X7R B;  4FJC C;  1Q7Y W;  1B6Q A;  3RVZ A;  1AJN A;  3K9A A;  3NXS A;  2DW4 A;  4QPJ A;  1JX9 A;  3MHS C;  3T2M A;  1SRY A;  1K5Q A;  3OUS A;  1N8R W;  1W0K G;  4N21 A;  4OXS A;  4G27 B;  1ZWI C;  1OCR B;  4XDL A;  2JJ1 G;  1Q86 W;  4LP8 A;  3CCJ V;  2CK3 G;  3ABL C;  1H8E G;  3K08 A;  3CCV V;  1FXH A;  5IYC O;  1ENV A;  4BAY A;  5EC1 C;  1SER A;  3D3I A;  5CN0 A;  4PDR A;  3X2Q C;  1AI6 A;  2XAH A;  3AEI A;  2R9I A;  1NKD A;  1R6K A;  2ZD9 A;  1KEC A;  1R3J C;  1Q81 W;  1RPO A;  1NVP B;  4JPR A;  1VQ5 V;  1R3I C;  2Z3Y A;  1FS0 G;  4R7C A;  3STZ C;  2W6J G;  4PA3 A;  5B1B C;  3MD0 A;  3OUF A;  3SYP A;  3ASO B;  5B1O A;  4Z1M G;  5CA3 A;  2JJ2 G;  3JD3 A;  1OCC B;  2JK5 C;  3CPW U;  1GK9 A;  3LUT B;  4MW8 A;  4MT8 A;  3E8G A;  4RQF A;  2ITD C;  3AG2 C;  4MTG A;  4JAV A;  4KP4 A;  1VQP V;  3JD1 A;  3LSQ A;  2EIJ C;  2IJK A;  2B1G A;  1R6N A;  2K1E A;  5L3D A;  3QNE A;  4LC1 A;  1VQM V;  5CBF A;  1QVG U;  3W7T A;  3AG1 C;  2X0L A;  1PNL A;  3FB7 C;  3OM3 B;  2V1D A;  1FFT B;  3CCR V;  4XBF A;  2IU0 A;  4H37 A;  3P30 A;  4U7O A;  3ZRV A;  5LBQ A;  2OCC B;  3SYO A;  1PD3 A;  3K3W A;  5CBG A;  1GM9 A;  1THZ A;  1W0J G;  1YJW V;  4P9O A;  1GTO A;  5B1A B;  1RM1 B;  2EBO A;  1M56 B;  2X6A A;  3LNM B;  2XAJ A;  2UXN A;  2EIM B;  4MSW C;  4CBC A;  3RVY A;  2WLN A;  2EZP A;  3IC7 A;  4LCU C;  3SPC A;  2AHY A;  3SYA A;  3AG4 B;  4MTO A;  4MVZ A;  2HVK C;  4DO2 A;  3ABU A;  1F23 A;  1CP9 A;  2JEX A;  1NH2 B;  1F4N A;  2EIN C;  2Q67 A;  1TUE B;  2LFR A;  1OCR C;  3DGE A;  4X88 A;  2Y69 B;  1CPY A;  1QLE B;  4WCE V;  3ZJZ A;  4GX2 A;  2EIL C;  3ZRW B;  4XDK A;  1S5H C;  1JCH A;  1DTO A;  3D36 A;  1KQS U;  1QR9 A;  2HJF C;  1VQN V;  2P67 A;  1M9N A;  2JIZ G;  4GX1 A;  3WFV A;  3ASO C;  2IJJ A;  4R6Z A;  4UVB A;  1JJ2 U;  2P7T C;  1OCC C;  2DYS B;  3R65 A;  4JF3 A;  4KUM A;  2D3O W;  1YSC A;  5L3E A;  1PKX A;  2HLD G;  3ASN B;  4MTF A;  2XOK G;  2LP7 A;  1K33 A;  3OMI B;  2YSU B;  1S0V A;  1FXV A;  1QR8 A;  2QA4 V;  3FYI B;  1SET A;  2DWE C;  3ABK C;  3HPL C;  1VQ6 V;  2IJH A;  3SYQ A;  1E1R G;  4JAS A;  4X89 A;  3H01 A;  1VQ7 V;  5B1N A;  3OE7 G;  1K92 A;  5E1A C;  3UM7 A;  1DF5 A;  3WG7 B;  5L3B A;  3AG3 B;  3QO8 A;  1V55 B;  2OCC C;  1AI7 A;  4GCZ A;  3RW0 A;  4WFB V;  4UV9 A;  2WLL A;  3CCL V;  3CCQ V;  5L3C A;  4GX0 A;  4TSF G;  4UUJ C;  5FL7 G;  1Y4M A;  3JCZ A;  4PEL A;  1DF4 A;  2YEV B;  5B1A C;  3CME V;  1RM1 C;  3E8F A;  2A9H A;  1M56 C;  3FB6 C;  3STL C;  3E8B A;  1F4M A;  2WWW A;  2XND G;  4G2K A;  5J9P C;  4WFH A;  3T1C A;  2OT5 A;  4RQE A;  1MOF A;  3E8H A;  2PI5 A;  4LBE C;  4QE9 A;  3AG4 C;  3T4D A;  2DWD C;  1SES A;  3E83 A;  4FPP A;  3ZN1 A;  2HFE C;  2H94 A;  5L3G A;  2BOC C;  1K7D A;  1BL8 A;  3I56 V;  3SPI A;  1GM7 A;  2IW5 A;  4JYB A;  1QVF U;  2DYR B;  1MAB G;  4WFF A;  2QEX V;  2DQ0 A;  4MW3 A;  5H6Q A;  2XAS A;  3SYC A;  2Y69 C;  2MK3 A;  1S77 D;  1WLE A;  1NQT A;  1QLE C;  1H38 A;  3JYC A;  3ZCC A;  1VQK V;  1YJN V;  2X6C A;  4MVO A;  5B3S B;  1S76 D;  1BHB A;  1AI5 A;  1M1K W;  4BIZ A;  2F43 G;  2AHZ A;  3OR6 C;  5KUK A;  1K34 A;  2FTK A;  4QPK A;  5EBW C;  2ZXW B;  4G28 B;  4TWK A;  3ZN0 A;  3ABM B;  1M57 B;  1EBO A;  1V54 B;  3ZRS A;  3I55 V;  3F7V C;  1UJW B;  1G8M A;  1AR1 B;  3CXC U;  2WAM A;  5H6R A;  2DYS C;  3B77 A;  3E89 A;  1BMF G;  1S3J A;  2ZDI C;  3ASN C;  4I5S A;  3ZMV A;  2XAG A;  1G4Y B;  2EIK B;  1KP2 A;  1ROP A;  2NLJ C;  5L3F A;  1Q82 W;  1MSW D;  3ML0 A;  2C2A A;  2B5U A;  4P9P A;  5CMU A;  3G6E V;  4FMT A;  2EJR A;  3VBB A;  4ZBM A;  2QTO A;  1K97 A;  4JGS A;  5LHG A;  3WG7 C;  1VQ9 V;  1NVP D;  5KA5 A;  3AG3 C;  1V55 C;  2HR3 A;  1F51 A;  2ATK C;  4MVM A;  1MG1 A;  4DXW A;  3W7W A;  4RUF A;  1KP3 A;  4HYO A;  1W2B U;  4RUE A;  3LDD A;  4WFA V;  3ZRX A;  4UXN A;  1E1Q G;  1IXM A;  3ETD A;  2WPD G;  2A0L A;  1K9M W;  1PL0 A;  4JAU A;  1GM8 A;  3CC2 V;  1DLB A;  3CYO A;  3K79 A;  1AI4 A;  4RO2 A;  3CCU V;  1NBM G;  2WLI B;  4E2L A;  1CEZ A;  2WLH A;  3AG2 B;  3ETE A;  4WFE A;  2M7W A;  4ZKI A;  2W0F C;  3TCU A;  1NR7 A;  1R3K C;  2DYR C;  2KB1 A;  1VQ4 V;  1WPX A;  3CC7 V;  4GX5 A;  1AJQ A;  1FXK B;  4JTD B;  1GMG A;  1H8H G;  3W7S A;  1YJ9 V;  4XDJ A;  2HKO A;  3TK1 A;  1M90 W;  4QIW F;  3CCM V;  3AG1 B;  3ETG A;  4HZ3 A;  3VOU A;  3CP1 A;  3OMN B;  3OMA B;  2GHY A;  3GB7 C;  1S72 V;  3G4S V;  1YI2 V;  3FYE B;  5LGN A;  4KFM A;  4WF9 V;  4WFG A;  2V7Q G;  1KC8 W;  3OAA G;  3A0R A;  2QM7 A;  3K04 A;  2GSM B;  4CZZ A;  4U7N A;  3ZMS A;  3F5W C;  3EFF K;  4UV8 A;  2BOB C;  1P7B A;  2ZXW C;  1NR1 A;  1COW G;  1M57 C;  4MVQ A;  1V54 C;  4PDL A;  1NH2 D;  1I5X A;  4PA4 A;  2ZDI A;  2IH1 C;  3P32 A;  5CBH A;  1R73 A;  3BEH A;  1JQ0 A;  2XAQ A;  3KG2 A;  4PDV A;  4YXW G;  1L1F A;  3RBZ A;  1OCZ B;  2Q68 A;  3W7X A;  2EIM C;  2EIN B;  2EIK C;  3TET A;  2WLK A;  4QJF B;  3OW2 U;  1ORQ C;  3ABT A;  5IY5 B;  2DQ3 A;  3PJS K;  1ARO P;  2R9R B;  1JPX A;  3CC4 V;  5EK0 A;  1YTF B;  3FKS G;  4R8C A;  2JDI G;  4JYC A;  2B1I A;  5LHI A;  1OHH G;  1K5S A;  5DM6 V;  3ZMZ A;  2EIL B;  3BY6 A;  2HG5 C;  2YEV A;  3SJQ C;  1SZT A;  2JEU A;  3QO7 A;  3LDC A;  3JD0 A;  3UKM A;  3IFX A;  4FIP C;  5IYD O;  5EC2 C;  4MVR A;  2WLJ A;  2UXX A;  4J9Z B;  3SPJ A;  2LFS A;  1OCO B;  2ZR3 A;  4MTX A;  4PDM A;  4H33 A;  4RAI A;  1KD1 W;  4MVS A;  1EFR G;  1OZ0 A;  3K03 A;  2NNU A;  2WLM A;  5EBM C;  5KA6 A;  5HFM A;  2Q69 A;  1GKF A;  3MHH C;  4GT1 A;  1K4C C;  2Y48 A;  1AJP A;  3LDE A;  2WSS G;  1QBZ A;  4HAM A;  3ABK B;  4JTC B;  1HWY A;  1FXK C;  2Q6A A;  1KKD A;  2A79 B;  2IJI A;  3K0D A;  4F4L A;  3OEE G;  1NJI W;  4P30 A;  2P90 A;  4I9W A;  1RPR A;  5KUM A;  2EZO A;  4BW5 A;  2QKS A;  2OTJ V;  1JOY A;  1EZJ A;  4P2Z A;  3JD4 A;  1J95 A;  1YIJ V;  4QE7 A;  4MS2 A;  3SPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...