1F4NA

C2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
b'GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARFGDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP ALA2ILE2-6
publication title Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 27
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f4nA00
1RPRA 2IJKA 1B6QA 1GTOA 1GMGA 1NKDA 1RPOA 2IJHA 2IJJA 3K79A 4DO2A 1ROPA 2IJIA 2GHYA 1F4NA 1PD3A 1F4MA
chains in the Genus database with same CATH superfamily
4EB6A 1AJPA 3MHHC 1WAZA 4O4HB 4QNHB 2BE3A 5CA0A 3STLC 1WB7A 2WSSG 4PJ0Z 4X62O 1N32B 1K3EA 1L8DA 2Y69B 4O4LB 2P5OA 3KCXA 2E75B 2DN9A 2YXYA 4ZOLA 2A7WA 3K04A 2EBOA 1K34A 4XBFA 1ENVA 2A79B 2EULA 3T1YO 4YJ2B 1ORQC 3I55V 2YIDA 3AK1A 4JAUA 3AG4B 1A32A 3E22A 1I7FA 1YIJV 4B7KA 1Q3EA 3JAKA 3W7UA 1WJZA 1OCCC 3UO3A 5LOVA 3E8BA 4DYLA 2Z0AA 1VQLV 3NXSA 4ZOLB 2ZR3A 4X20A 5LP6B 2FKXA 1ZWIC 5JH7B 1H2KA 2ZDIC 1LR1A 2LO1A 3CXHF 2IJIA 1MNGA 4DV2B 5B1OA 2ARHA 2QM4A 3C3SA 4DR2O 2DJVA 3WB2A 3ZRWB 2F4VB 3JAKB 2XOKG 2KB1A 1R6NA 1U96A 2JK5C 3G80A 1F51A 3CX5F 5LYJA 5LMNO 2D3OW 4HBNA 3RWRD 2UUCO 2F23A 1OCRB 4XDJA 1L0NH 2R72A 3JD0A 2RN9A 1M5IA 1DTOA 2WLLB 3LSSA 3GB7C 1BL8A 1ZX3A 4JI8B 3OAAG 4DR6O 4TSFG 5JVDB 3JAWA 1US6A 4QGPA 3LSUA 2FMLA 5GTHZ 3ETQA 2V1DA 2CH7B 2OTLV 4I50B 1FYJA 4MTFA 4WFFA 3SPCA 3CMEV 2HR3A 1O9HA 1BHAA 5A2QN 1EFRG 2CK3G 2ZIMA 3RGBA 3HKBA 2Y4TA 4AI8A 3VQWA 2IJHA 2JJ2G 4AILC 1NR7A 1YDXA 2OCCC 1S76D 3RYCB 3SJCC 2JGDB 3CRMA 4DXWA 4X65B 3ZIAG 4MVQA 3J80N 3DSQA 4NXNB 1J5EO 3OD4A 1NTKH 4L8JA 1MOFA 4K3AA 5CB4B 2Q68A 3SYQA 3HKBB 4JI0B 1K4CC 3ABUA 4TV9B 1FXKC 5IY5B 2EIKC 2AHYA 4K8ZA 1VF6C 4MVZA 4JI0O 2LGWA 1FFTB 2WLKA 2DWEC 2JS5A 2YIBD 4JASA 3CRAA 4QPKA 5IJ0A 3SYAA 1M1KW 3JARA 2ZE5A 4I55A 3ZMSA 2YEVB 4LFAB 4G27B 4JI2O 3F7VC 4DV6B 4IYIA 4R50A 3IAYA 4IT5A 2MW2B 3PN1A 4NVPA 1R6KA 3ZRXA 3WB0A 4ZI7A 1H38A 4U3FH 1NJIW 3M7MX 1KD1W 4DV0O 2W6IG 4UVBA 2UU9B 1SC5B 3JATB 4EKWA 2VQEO 4I55B 1N33O 4K0KO 2Y48A 2Z5UA 1XI1A 5CA3A 5KHKA 2UU9O 2FB5A 3H1IH 2ZXWC 4N21A 1FXHA 1RPRA 2ZE7A 1YITV 2GUZB 4RUEA 1HNWB 4XDKA 5GONA 3VQYA 3CCQV 4JI6B 4GZRB 2GV9A 2HHHB 2IM9A 2H8PC 4FLTA 2UXCO 1WPXA 4YY3O 5CBHA 2HHHO 3OTOB 3HKDB 4WFHA 3CXCU 3AG1C 2A9HA 2DMXA 1Q6IA 3JASA 3ETGA 4YHHB 5KX5A 1WNSA 1F4MA 2GTAA 4DV1O 4CH4A 1IBMO 4I9WA 3JAMN 3AG3C 5H6QA 5AG2A 3RFRA 1SQQH 2XASA 4JTCB 2ZM6B 1G1XB 3ZHRA 3GWKC 3K5MA 3ZRVA 2HEPA 4O4JB 4UB6Z 3JASB 3CRCA 1YEWA 1JPXA 2X0LA 4B3RB 1F23A 3AG7A 4JI3B 2EINC 3L72H 1OCCB 3OGIB 4JV5B 1W2BU 1GK9A 2DYRC 1O9GA 1K73W 4RQFA 1K5QA 4JI3O 4E2LA 4X1IB 1Q5OA 1PM9A 3M99B 3JSNA 2M7WA 1S5LZ 2HP8A 1BGYH 4CH6A 3T4ZA 4U3JA 2DE0X 4DV7O 1BMFG 1N4CA 3F5WC 4DK1A 4X64B 3C90A 3SPIA 1R3JC 4LWSA 1SZXA 2WLNA 3HR0A 5IJ9A 5GTIZ 4O2AB 3CCMV 1VQMV 1WA8A 3BFRA 2Q0AA 2Q7HA 4FZ1A 5JJNB 5BR8O 1AI5A 2ZT9B 4GX2A 1ZTEA 4F6RB 4EEQA 1JJOA 4J7KA 3OMAB 2YXLA 4IYHA 3JALB 3B8NA 1ZL8B 4PA9A 1S72V 1DLBA 2XHBA 3RYFA 3ZS8C 3FYIB 2O57A 2EJRA 4UV8A 2VRZA 2QR4A 3VQVA 1LNQA 1I94O 5EZYA 1R1BA 1FAFA 1YVWA 4OX9O 1WB8A 4LFCO 2CGNA 4TUYB 4B3MB 5KAIZ 2BTOA 4JPRA 3K03A 4F4LA 4J9ZB 1DF5A 4CS2A 2QSAA 4DV4B 1H8HG 2YDEA 1JJ2U 1FJGB 2GTSA 4B3MO 3QO7A 5K1XA 4UCOA 3BA8A 5LXTA 4JI7O 2ITDC 3HKCA 1MA1A 3N2KA 2JEXA 4L87A 1Q43A 1MZEA 1CP9A 2IH3C 4BIOA 4QE9A 1GAXA 4JI1B 2HKOA 5D5PA 4DR1B 2OCCB 1RSOA 2EX3A 5KHJA 5GW7A 2VWJA 3APQA 4KUMA 1K33A 2LFRA 5KA5A 4DR5B 1RP3B 3L74H 4FFBA 3WB1A 4UB8Z 2LFSA 1XILA 4GKKO 5LXTB 4J7ZA 2WA4A 3HKCB 4DRXA 1SS3A 5H9CA 4CH3A 2OIGA 1GKFA 1FXKB 1YJ9V 3JCUZ 1OCOC 3AK2A 2XAQA 2EIKB 4LF7B 4KHPO 5CA1B 1MSWD 5JQGB 4PDLA 5E79Z 4O4IB 4PA6A 4AQYB 3E8GA 4NTYA 5H2FZ 4LFBB 3B09A 3LDDA 1QR8A 2ZE6A 3HKEB 4MVMA 2WLIA 1IDSA 3MD0A 4LF6O 3G67A 1F7YA 1E1RG 5B1NA 4FLVA 1NKDA 4LFBO 1NI8A 4UVAA 1W0JG 3OTFA 2KKWA 2AW9A 2EILC 3B2EE 1K9MW 1M57C 2ODMA 5LL6Y 4J41A 4J7JA 4I4TA 3FB7C 1R6TA 1CPYA 2V7QG 1I08A 4YIOA 3K08A 4FZ0A 1R3LC 3J81N 3CCEV 1OJHA 3ABKC 1GM8A 2IU3A 4YIPA 4RAIA 4MT8A 4IIJA 2ZXWB 4YJ3A 4DR7B 2XNDG 2ZNJA 3B4SA 4WFGA 3BY6A 4O4HA 2HJFC 2QGNA 4WFEA 3B8MA 4I4TB 3K0DA 1NH2B 1AVMA 2GDSA 4PHZA 1BQZA 4KP4A 1KB9F 1S5HC 1AR1B 1QCEA 2QM7A 3J7AU 3AG1B 4NTXA 4B7EA 1M56C 3UCSC 2FTKA 2XUMA 3EXAA 4YJ3B 1VMGA 2L6LA 4O4LA 1XL6A 1SETA 1EZJA 1SRYA 1TAEA 2JJ1G 1VQ9V 1HWYA 3RVZA 3SR2C 2ETNA 1X4TA 4X66B 2A06H 2HVKC 3AG3B 4JYAB 4NXMB 3FAVA 3H1JH 1PNMA 3KKYA 2N04A 2W6JG 4PI0A 4YJ2A 1KECA 1ZLZA 4X9QA 5JCOA 2XTAA 1KMIZ 3N2GB 2ZNIA 3S3XA 1XL4A 3FKSG 3JSLA 1N32O 2CUGA 2HJDA 2CTRA 2EINB 3E8HA 4RQEA 4WCEV 4C7UA 5LP6A 2WAMA 2DYRB 2RNBA 3ETEA 1MZFA 3FAVB 4JF3A 5JH7A 3OEHG 1XMQB 3K57A 1SQVH 3OMNB 3WFVA 2UXXA 5B1AC 2LGQA 1NTZH 3G4SV 1N36B 1YSCA 4P9PA 3ZRWA 1XEQA 4X1KA 2P6JA 1SF9A 5KHGA 1B3QA 1BE3H 2QWQB 3ASOC 4ABMA 1I5YA 1K97A 2Q8VA 1R3KC 2V4DA 2WLMA 5DN6G 5FNVB 2RJZA 4PA3A 1KC8W 1HR0B 2WLLA 1DK1A 4OXSA 4RUFA 4B3SB 2R9RB 2NN4A 2LQTA 1NVPD 4LF4B 5B3SC 1BZKA 4X1KB 1AI4A 5JVDA 1MG1A 4JZ2A 4DV2O 4DK0A 1H2LA 4BWAA 2ZQMA 3GWOA 4LF4O 2F4VO 2CH7A 3QF7A 1OV9A 4JI5B 2B1GA 1Z2GA 1PV0A 4WF9V 4I50A 1H2SB 5A9GA 2PI4A 5JJEB 3EVKA 2BTQA 4HZ3A 1D5AA 4K35A 2ILMA 4FM2A 4MSWC 1M4UA 2D2CB 1PP9H 2CGOA 1SKVA 4U7NA 1EM1A 5B66Z 1XMOB 5B1BC 4JI8O 1KKCA 4PV1B 3U10A 2AXTZ 1QR9A 1H2NA 5E1AC 1Q90D 5KUMA 1Q8IA 3T1CA 4X1YA 5LGUA 1S5JA 3RYCA 2YSUB 2JGDA 4JAAA 3WG7C 2BTQB 1ZAUA 3JYCA 1V55C 2Q5ZA 5J2UB 4I9QA 3UT5B 5CB4A 4B3TB 4FIPC 4UVCA 3VBBA 4TV9A 2WPDG 4F6EA 4BIUA 3ZMTA 1RPOA 2F95B 3UO2A 2QKAA 2EJ7A 3E89A 4B3TO 5FL7G 1OCOB 4P2ZA 4P9OA 3OEEG 4X1YB 4FLUA 1FD9A 3TK1A 5EC1C 4X8AA 1COWG 3NR7A 2ITCC 3WU2Z 5H6RA 5KLVH 2N05A 2YEVA 3FFQA 4X65O 3TXQA 4NXNO 2YC0A 4GKJB 4FM0A 2DQ0A 5LA6B 4K8XA 2H94A 4CS3A 4GCZA 1WPBA 4G2KA 4GKJO 4KFMA 2EILB 2YS8A 3BPZA 5EIBD 1LUVA 2E5LB 1M57B 1K4DC 3JATA 5F2VO 1Y67A 5L3EA 1YCIA 1AB3A 4JYBA 3B77A 4ASUG 5K1PA 5LHHA 1P4RA 4BW5A 4OPAA 2EZPA 1T5EA 2E74B 3ABKB 2AGAA 2GUZA 4CH5A 4FLYA 4LFAO 3F7YC 4DV6O 1SQPH 1UFIA 1VQOV 3E83A 3DC5A 2ZE8A 1GO3F 2IJJA 3DGEA 3HKDA 5L3BA 1KP3A 2XT9A 2Z3YA 5KHIA 3MAQA 2PUSA 4KL1A 3ZRSA 1GTOA 3K79A 1M56B 4J9YB 1PL0A 1W0KG 3KCYA 3K9AA 1K5SA 3N27A 2ZINA 1Q81W 1V54C 3JD2A 1N34B 2PZSA 3O9OA 1RM1C 1HNWO 3RYIB 2OWOA 1PPJH 1AI7A 3CRQA 4JI6O 5HFLA 2UUBB 1SQGA 4LCUC 4N23A 1GM7A 1OHHG 3JCZA 4O4JA 3D3IA 1HP8A 4HYOA 3OTOO 4FFKA 1XQ8A 4DUZB 3QNEA 4PI2A 2RCVA 4YHHO 1AROP 1AILA 4J11A 2PF4E 4XDLA 3L70H 2IU0A 2WA3A 3IJ4A 3BCCH 1AR4A 3E35A 4PDRA 4X1IA 1MABG 3CCUV 2ZDIA 3BHPA 3UM7A 1QLNA 5B1AB 4JGSA 2IW5A 3D36C 2ZM6O 1D5NA 2A0LA 5FLXN 2ADQB 3ASOB 4O2AA 5DECA 3P3NA 3H1LH 4B3RO 2ADPA 2QWNB 1AJNA 1XUQA 2R70A 1KYOF 4D7SA 4JV5O 2YIBA 4TOIA 1NU1H 2PYJA 1EZVH 5EYPB 4DR4B 4F6RA 2Y4UA 5L3GA 3E2EA 2QA4V 1B06A 3DXRB 1G4YB 2DOSA 3JALA 1ZL8A 4JTAB 1AR5A 1SQXH 3RN4A 4CBCA 5B3SB 4DUYB 4LF5B 5D5QA 1Q6UA 1TA8A 1B6QA 2Q7GA 1Q82W 2F93B 4GX0A 2GSMB 3VOUA 1AI6A 4LF5O 4X64O 4TUYA 5CBGA 4LBEC 3CC2V 2LW1A 3RYHB 3B40A 2X7RB 4J10A 1VQ7V 1QLEC 2KG7B 3OT7A 4GX5A 1ZUQA 1HNZB 4DV5B 1SA0A 3SPJA 3SPGA 5IYCO 1S77D 2Q67A 2GBOA 1TGOA 4Q20A 5J2TB 2NLJC 4DO2A 1VQ8V 3SJAC 3G71V 3I56V 5B1BB 4FLZA 5CBFA 2IH1C 4MW8A 4JAVA 2EIJC 5LGNA 4W4LA 4ZHQB 4EFEA 2RDCA 1QU7A 1Q86W 1SA0B 3WG7B 1FFXA 1H2MA 3H01A 3JD4A 4HNAB 1V55B 1CEZA 1BSMA 3IC9A 4UCTA 1P7GA 2YI9A 3CEIA 5BXZA 3W7WA 4DV4O 4MS2A 1FKAO 2MK3A 3FYEB 1FXKA 1FJGO 2A3QA 1JR9A 3CP1A 4O2BA 1G8MA 1AP6A 1DGSA 4FK5C 5CA1A 3W7XA 1VF6A 2P90A 1NS1A 5JQGA 3P3PA 2UXBB 1VQNV 4LR3A 4O4IA 5ITZA 2X6BA 2UUAB 1FFXB 3ABMC 1BT8A 1TUBA 4JI1O 4MVSA 2HVJC 2Q73A 4DR1O 3HKEA 5EBLC 2UXDB 2UXBO 1XHZA 5EC2C 1JCHA 1SZTA 1XNRB 1HDJA 2QTSA 4DR5O 3SDLA 4CS4A 3E8FA 1QHTA 4O2BB 5BMVA 1VQ6V 4UCVA 3ZJZA 3OR7C 2DWDC 3RVYA 5DEDA 3ZMUA 5ITZB 3CMAV 5KMGB 1TUBB 3FX7A 5JJJB 4LH7A 4LF7O 2R9AA 4NR1A 2BOBC 3SYPA 3ZHQA 3A8TA 2OYQA 2BOCC 4AQYO 1YZBA 4PA4A 1K92A 3FB5C 1I0HA 2JVDA 5BMVB 1IZ3A 5H5NA 3ZMVA 2Y0IA 1JFFA 2EIMC 1WP7A 4I5SA 1K8AW 3CD6V 5IWAB 2HFEC 3DC6A 3ETDA 3LSQA 3OM3B 3OR6C 1FS0G 1U97A 3FB6C 1N0NA 1KUQA 1Y4MA 2WLJA 1QVGU 4A5UB 4MVUA 2P67A 3ASNC 4PDMA 3T1HB 1WLEA 1JQ0A 2K1EA 3K59A 4R6ZA 2P22C 1Y74B 1VIBA 3SJBC 3CYOA 1JFFB 4DW1A 3TGUH 2PYLA 4MTXA 4LNUB 5BY1A 3KG2A 3AG2C 1V54B 2ZR2A 4UCRA 2CTWA 3SPHA 3T2MA 1GN2A 4DR7O 1RM1B 3OMIB 2CTQA 3K58A 2JIZG 4CC6A 1EBOA 4IHJB 1CXZB 4YXWG 5C93A 1EN6A 4CC5A 2PI5A 4DW0A 1SERA 3N2GA 4EFBA 4UFZA 3OGCC 1UPGA 4H0LB 2LP7A 4PELA 5LMUB 4LF8B 4OPHA 2Q9LA 4PDVA 3E86A 1OCZC 4GYCB 3A2FA 4H33A 1PD3A 2DYSC 4LF8O 4X66O 1M90W 1ROPA 2X6CA 3CC7V 3BAAA 3CJHB 3LNMB 4JYAO 2YIAA 4NXMO 1KQSU 3S3WA 1Y76B 3F5TA 1GN3A 4X62B 3MDSA 4FM1A 1AP5A 3ZHVA 4Z2WA 4ICGA 3ICXA 3D8CA 1R3IC 2QE7G 5FNVA 5JWPA 1JA8A 1JMKC 1KU9A 1NT2B 4UCUA 3D3QA 4UV9A 1EN5A 1NR1A 4EB6B 1VF5B 1SQFA 2B1IA 1XMQO 1FXVA 2Q4PA 3BVOA 3T1YB 4OGQB 5CA0B 1N36O 4QIWF 2DW4A 3ML0A 1IX9A 4D6TH 4RO2A 2Q6AA 1NQTA 3C3TA 5IT9N 3BEHA 4BAYA 5KUKA 2YICA 5EK0A 4ZBMA 1VEWA 1GH6A 3BA9A 2NR5A 1YTFD 3ABTA 1G6UA 1QLEB 3L9DA 3K3WA 1XOUA 4H13B 3ZCCA 1HR0O 1XNQB 1E1QG 1DF4A 4DR2B 2QEXV 3CCLV 1N0JA 4B3SO 3K9SA 4LF9B 2H3OA 4UCSA 4FPPA 3ZX6A 1XNQO 5LMNB 4WFBV 4TQDA 5EIBC 5IYBO 1J95A 3E22B 2OCHA 3ZMZA 2EIJB 2UUCB 4LF9O 2QM8A 2VQFB 5LOVB 5J2UA 4JI5O 2PY5A 1GN4A 3UT5A 3LDCA 1XBLA 1ZSPA 4X20B 4TV8A 2VQFO 3JD1A 3QO5A 1M9NA 3TJTA 3R65A 3G6BA 4DR6B 1KP2A 4WBNA 1P7BA 2P4VA 1TVKA 5LBQA 1XMOO 3UQ8A 5L3CA 1GMGA 3UKMA 1VQKV 2IJKA 5L3DA 3A0BZ 5LYJB 1THZA 3SGIA 3ABMB 2QKCA 1WN7A 4MTOA 1YJWV 2ATKC 2YI8A 4TV8B 2OTJV 1GM9A 1Q7YW 2Q7EA 4MW3A 2YUAA 5LA6A 4WBNB 4BR6A 1TVKB 2XAGA 4HAMA 1VF7A 2L35A 1H2GA 1JOYA 3JAWB 3CWBH 5TISZ 1KKDA 3ZHUA 3ZN0A 1V9PA 3H1KH 3TXSA 4R8CA 4JI4B 4LH6A 3ABLC 1J5EB 4BW9A 4KXRA 1Y6XA 2BSKA 1GN6A 2CE4A 4JYYA 4H44B 3CHXA 3CB2A 3CPWU 2M6YA 2G38A 4JI4O 1BCCH 3OUSA 3K5LA 3OUFA 2Q0OC 4GX1A 2QTOA 1QQCA 2RMKB 1EN4A 1IBLB 5BZBA 3CC4V 2EIMB 5J9PC 2FYUH 1VQ5V 5KAFZ 2B9ZA 2JS3A 4QPJA 4D7TA 1IBLO 4NTWA 4I0XA 1M93A 2P7TC 2E5LO 3W7TA 2BSKB 3A0HZ 5LGTA 5KHHA 1W59A 2OIEA 3ASNB 3FB8C 1L1FA 4JI2B 2PTMA 5DM6V 4TQFA 4RWUA 4J80A 4IGGA 3RYIA 4E4EA 1R73A 3AG2B 1NBMG 4MTGA 4FMTA 4DV0B 1I5XA 4I0XB 4Z1VA 1YTFB 3JD3A 1AJQA 1NVPB 2VQEB 4K0KB 1N33B 5IYZA 1WP8A 2UXNA 5IJ0B 4UXNA 2K9PA 5IYDO 1LUWA 1GRJA 3JARB 3L75H 4AHCA 4CZZA 3EHBB 4U7OA 1VARA 3U11A 3P30A 3L73H 1OCZB 4FLWA 1IXBA 2WLHA 2UXCB 2QJ1A 2JDIG 1YXBA 3O65A 4ZKIA 4YY3B 1N34O 2DYSB 4H37A 3X2QC 4ZI7B 4FLXA 3ZHSA 1XREA 5IYZB 2CTPA 2QWPB 3HPLC 3RW0A 2UUBO 3FD9A 4X89A 1BS3A 3CS5A 2IBZH 4BIZA 2QKSA 2ZKOA 1RFYA 4DV1B 1VQPV 2VWKA 2XAJA 4DUZO 1IBMB 1YF2A 2W0FC 1UJWB 3SYOA 5GONB 4ZIBA 2KQXA 5EYPA 3Q4HA 1IURA 3MHSC 2HG5C 3I5DA 3HB3B 4R7CA 3DXRA 1PNLA 2LW7A 3K5OA 2QDOA 2ZD9A 3RBZA 5L3FA 1YHQV 4GT1A 2P06A 3BABA 3CSXA 3DTUB 2F66C 1PNKA 3QTCA 1N8RW 2Y69C 2F43G 3RYHA 3OFNG 5KX5B 4Q6GA 2KG7A 3Q4HB 3SYCA 2C2AA 4PD4F 1OZ0A 5J2TA 4JTDB 1PL4A 3ZHTA 4DR4O 2GHYA 3R66A 4DV7B 4NKGB 2E76B 4JYCA 5JCOC 3AG4C 4DUYO 4ZHQA 5IDJA 4QJFB 1VQ4V 3ZEDA 4WFAV 5IE9A 3IC7A 5BR8B 1P84F 5KA6A 3U0ZA 3STZC 4HNAA 3OE7G 3CE2A 2B5UA 5LP6C 4MVOA 3EFFK 1HNZO 4DV5O 1MSDA 2X6AA 1PKXA 1NH2D 5FPRA 5CMUA 2HLDG 1QBZA 3QVNA 3K06A 1SESA 2PGGA 3W7SA 4I7ZB 1XDCA 1NZ6A 4U3JB 1I94B 4LP8A 1Y66A 3IGAC 3OW2U 1P49A 2NNUA 4OX9B 4UUJC 4LFCB 5LHGA 4LWSB 4Z1MG 5IJ9B 1OCRC 5EBWC 3CCRV 1WA8B 3IFXA 1Q6HA 2W0XA 4FJCC 4JI7B 1JVMA 3CCVV 3M8AA 3QG5A 1E79G 1S0VA 5B5EZ 3LUTB 1IVSA 2AZ2A 3APOA 2JEUA 4QE7A 1KBHA 1URFA 5KMGA 2OT5A 3RYFB 2BCCH 4IL6Z 1HNXB 5EZYB 2P4KA 5CN0A 2ZCEA 2CDYA 1HW7A 2UUAO 3ABLB 2LJ2A 4GKKB 3CCJV 1FPOA 2UXDO 4GLXA 1NTMH 1HNXO 4GUNA 1XNRO 3A0RA 3THOA 1L0LH 1IXMA 1SQBH 3K0GA 2Q69A 5LHIA 4KHPB 1TUEB 4NYKA 2YXHA 2E3CA 3N2KB 2F1MA 1X59A 5C8YA 3H1HH 3KZIZ 4B08A 4MVRA 3T4DA 3H9VA 1XHXA 4TWKA 1RSOB 1Y74A 4LF6B 2QWRB 1YJNV 2JRIA 1Z5WA 4FFBB 1F4NA 4FVMA 3P32A 3TCUA 4LNUA 1Z5VA 2R9IA 2DQ3A 4DRXB 2XAHA 5IY5C 4G28B 3G6EV 2VS0A 4W4KA 5C8YB 4IHJA 1D2DA 4NB5A 3GVMA 5IWAO 4TT3G 3ZN1A 3LDEA 1K7DA 2AHZA 2JGUA 4PA7A 3AEIA 4DR3B 1QNMA 5EBMC 3T1HO 2EZOA 5FPOA 1B04A 2QWOB 3BRCA 2WLIB 3CRRA 3PJSK 4DR3O 1BHBA 3RT3C 5HFMA 2RQ6A 1VP7A 3CJHA 3VQXA 2KSDA 1QVFU 3X2QB 3LNNA 1Y76A 4LC1A 3D36A 2AZ0A 2WWWA 1YI2V 2XAFA 1BQ0A 2ZIOA 1MMMA 4DV3B 1H8EG 3ZBHA 1JX9A 3L71H 1IBKB 2N74A 2Y0PA 3K5NA 3AK3A 2FL4A 3TETA 4JZGA 5LMUO 4X88A 2CAZC 4IIJB 3QO8A 4J42A 4DV3O 1IBKO 3SJQC 3CCSV 1S3JA 4P30A
chains in the Genus database with same CATH topology
1AJPA 1GM9A 1CP9A 2IH3C 4QE9A 3MHHC 1Q7YW 3QNEA 4MW3A 2HKOA 2XAGA 4QNHB 2OCCB 1AROP 5GW7A 4HAMA 4XDLA 3STLC 4KUMA 1K33A 2WSSG 2LFRA 2IU0A 5KA5A 3E35A 4PDRA 1H2GA 1JOYA 1KKDA 2LFSA 1MABG 3ZN0A 2ZDIA 1K3EA 3CCUV 3UM7A 1QLNA 4R8CA 5B1AB 2Y69B 4JGSA 2IW5A 5H9CA 3ABLC 1GKFA 1FXKB 2A0LA 1YJ9V 1OCOC 2XAQA 2EIKB 3CPWU 1MSWD 3K04A 2EBOA 3ASOB 3OUSA 4PDLA 3OUFA 1K34A 4GX1A 2QTOA 4PA6A 3E8GA 1AJNA 4XBFA 1ENVA 5BZBA 2A79B 3CC4V 2EIMB 4P30A 5J9PC 1ORQC 3LDDA 3I55V 1QR8A 4JAUA 3AG4B 4MVMA 2WLIA 3MD0A 1YIJV 1VQ5V 5L3GA 3W7UA 3E2EA 2QA4V 1E1RG 1G4YB 4QPJA 5B1NA 1OCCC 1NKDA 3E8BA 4JTAB 2P7TC 1VQLV 4UVAA 4CBCA 5B3SB 3NXSA 3W7TA 5LGTA 1W0JG 1B6QA 2ZR3A 3ASNB 1Q82W 4GX0A 2EILC 1K9MW 1ZWIC 3FB8C 2GSMB 1M57C 1L1FA 3VOUA 2ZDIC 2IJIA 5DM6V 1AI6A 5CBGA 4LBEC 5B1OA 3FB7C 3CC2V 1CPYA 2V7QG 1VQ7V 2X7RB 1QLEC 4GX5A 3K08A 3ZRWB 1R73A 3AG2B 3SPJA 3SPGA 1NBMG 1R3LC 2XOKG 4MTGA 2KB1A 4FMTA 5IYCO 1S77D 2Q67A 1R6NA 4Q20A 2JK5C 3CCEV 1I5XA 3ABKC 1GM8A 2IU3A 1F51A 2NLJC 1YTFB 3JD3A 2D3OW 1AJQA 4DO2A 4RAIA 1NVPB 4MT8A 1VQ8V 2ZXWB 3G71V 1OCRB 4XDJA 2UXNA 3I56V 5B1BB 2XNDG 5IYDO 4UXNA 5CBFA 4WFGA 3JD0A 3BY6A 2HJFC 2IH1C 4MW8A 4JAVA 1DTOA 2WLLB 2EIJC 3LSSA 3GB7C 1BL8A 3B8MA 4WFEA 5LGNA 3K0DA 4CZZA 3EHBB 4U7OA 1NH2B 3OAAG 1Q86W 3WG7B 4KP4A 4TSFG 3P30A 3H01A 1OCZB 2WLHA 3JD4A 1S5HC 2JDIG 1QCEA 1AR1B 2QM7A 1V55B 3AG1B 4ZKIA 1CEZA 1M56C 2DYSB 4H37A 2FTKA 3X2QC 2V1DA 3W7WA 1XL6A 3HPLC 4MS2A 2MK3A 3RW0A 1SETA 3FYEB 1EZJA 1FXKA 1SRYA 2OTLV 4X89A 2JJ1G 1VQ9V 1HWYA 3CP1A 4MTFA 1G8MA 4WFFA 3SPCA 3RVZA 4FK5C 3CMEV 4BIZA 2HR3A 3W7XA 2HVKC 3AG3B 2P90A 2QKSA 1BHAA 1VQPV 1VQNV 1PNMA 2X6BA 2XAJA 1EFRG 3ABMC 2CK3G 4MVSA 2HVJC 2W0FC 2W6JG 1KECA 1UJWB 5EBLC 3SYOA 3MHSC 5EC2C 1JCHA 1SZTA 2HG5C 3HB3B 2IJHA 2JJ2G 4R7CA 1XL4A 1PNLA 3E8FA 1NR7A 3FKSG 2OCCC 2ZD9A 3RBZA 1S76D 2EINB 1VQ6V 4DXWA 5L3FA 1YHQV 4GT1A 3ZIAG 3E8HA 4MVQA 4RQEA 4WCEV 3ZJZA 2WAMA 2DYRB 3ETEA 3OR7C 2DWDC 4JF3A 1MOFA 3DTUB 3RVYA 3ZMUA 3OEHG 3CMAV 1PNKA 1N8RW 3OMNB 3WFVA 2Q68A 2UXXA 5B1AC 2Y69C 3SYQA 2F43G 3OFNG 2BOBC 1K4CC 3SYPA 3G4SV 1YSCA 3ABUA 4P9PA 1FXKC 3SYCA 3ZRWA 2BOCC 2C2AA 5IY5B 2P6JA 1OZ0A 2EIKC 2AHYA 4PA4A 1K92A 4JTDB 3ASOC 3FB5C 4MVZA 1I5YA 1K97A 1FFTB 1R3KC 2WLKA 2DWEC 2GHYA 3ZMVA 2WLMA 4JASA 4QPKA 2EIMC 3SYAA 5DN6G 1M1KW 4PA3A 1KC8W 4JYCA 4I5SA 3AG4C 1K8AW 2WLLA 3CD6V 2HFEC 4OXSA 3ETDA 3ZMSA 2YEVB 5IDJA 3LSQA 3OM3B 4RUFA 4QJFB 3OR6C 1FS0G 2R9RB 3FB6C 1VQ4V 1NVPD 4G27B 4WFAV 5B3SC 1Y4MA 2WLJA 3IC7A 3F7VC 5KA6A 1QVGU 4R50A 3STZC 1AI4A 1MG1A 4MVUA 2P67A 3ASNC 3OE7G 4PDMA 1WLEA 1R6KA 2B5UA 1JQ0A 3ZRXA 2K1EA 4MVOA 3EFFK 4R6ZA 2ZQMA 3GWOA 1H38A 3CYOA 1NJIW 2X6AA 1PKXA 1NH2D 1KD1W 5CMUA 2B1GA 2W6IG 2HLDG 4UVBA 4WF9V 1QBZA 4EKWA 3K06A 1SESA 4MTXA 3KG2A 2PI4A 3W7SA 3AG2C 1V54B 2ZR2A 3SPHA 2Y48A 4HZ3A 3T2MA 2Z5UA 1RM1B 3OMIB 4LP8A 1Y66A 3IGAC 3OW2U 5CA3A 2NNUA 2JIZG 4UUJC 1EBOA 4MSWC 4YXWG 2ZXWC 4N21A 5LHGA 1FXHA 4Z1MG 4U7NA 5C93A 1RPRA 1OCRC 1YITV 5EBWC 4RUEA 3CCRV 4XDKA 5B1BC 2PI5A 1SERA 3CCQV 3OGCC 3IFXA 2H8PC 1QR9A 5E1AC 5KUMA 1WPXA 2LP7A 4FJCC 4PELA 3T1CA 1JVMA 5LGUA 3CCVV 2YSUB 1E79G 1S0VA 3LUTB 5CBHA 4PDVA 2JEUA 3WG7C 3E86A 1OCZC 4WFHA 3JYCA 4H33A 4QE7A 3CXCU 1V55C 3AG1C 2A9HA 1PD3A 2DYSC 2OT5A 3ETGA 1M90W 1ROPA 2X6CA 3CC7V 3LNMB 4FIPC 4UVCA 3VBBA 1F4MA 2WPDG 1KQSU 5CN0A 4BIUA 3ZMTA 1RPOA 3ABLB 4I9WA 3E89A 3AG3C 5FL7G 1OCOB 4P2ZA 4P9OA 5H6QA 3CCJV 3OEEG 3TK1A 5EC1C 4X8AA 2XASA 1COWG 3A0RA 4JTCB 2ITCC 1R3IC 2QE7G 1IXMA 3ZRVA 3K0GA 2Q69A 5H6RA 5LHIA 2YEVA 1TUEB 4UV9A 1NR1A 1JPXA 2X0LA 1F23A 2B1IA 2DQ0A 4MVRA 3T4DA 1FXVA 2EINC 1OCCB 2H94A 1W2BU 4TWKA 1GK9A 4GCZA 2DYRC 4QIWF 4G2KA 2DW4A 3ML0A 1YJNV 1K73W 4RQFA 4KFMA 2EILB 1K5QA 4E2LA 4RO2A 2Q6AA 3M99B 1M57B 1K4DC 1NQTA 2M7WA 1F4NA 3P32A 3TCUA 5L3EA 3BEHA 4BAYA 5KUKA 2R9IA 5EK0A 4ZBMA 4JYBA 2DQ3A 2XAHA 3T4ZA 5IY5C 3B77A 4ASUG 5LHHA 3ABTA 4G28B 3G6EV 1YTFD 1QLEB 1BMFG 1P4RA 3K3WA 4BW5A 3ZCCA 3F5WC 1E1QG 3SPIA 1DF4A 1R3JC 2EZPA 4TT3G 3ZN1A 2WLNA 3ABKB 2QEXV 3CCLV 3LDEA 3CCMV 1VQMV 1K7DA 2AHZA 4PA7A 4FPPA 3F7YC 3AEIA 1AI5A 5EBMC 1VQOV 3E83A 4WFBV 2EZOA 5IYBO 1J95A 4GX2A 3ZMZA 2EIJB 2QM8A 2WLIB 1GO3F 3OMAB 2IJJA 3DGEA 3PJSK 3B8NA 1BHBA 4PA9A 5L3BA 1KP3A 1S72V 3LDCA 2Z3YA 1DLBA 5HFMA 3FYIB 3ZRSA 2EJRA 3JD1A 4UV8A 3QO5A 1LNQA 1GTOA 1M9NA 1M56B 3K79A 1QVFU 3X2QB 3R65A 4LC1A 1PL0A 1KP2A 1W0KG 3D36A 4J9YB 3K9AA 1P7BA 1K5SA 2WWWA 5LBQA 1V54C 3JD2A 1YI2V 1Q81W 4JPRA 2XAFA 3K03A 1RM1C 4F4LA 5L3CA 1GMGA 1DF5A 4J9ZB 1AI7A 1H8EG 1JX9A 5HFLA 3UKMA 1H8HG 1VQKV 2IJKA 1JJ2U 3QO7A 5L3DA 4LCUC 4N23A 1GM7A 3TETA 1OHHG 3JCZA 1THZA 4X88A 3ABMB 2ITDC 3D3IA 3QO8A 4MTOA 1YJWV 2ATKC 4HYOA 2JEXA 3SJQC 2OTJV 3CCSV 1S3JA 4L87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPR A;  2IJK A;  1B6Q A;  1GTO A;  1GMG A;  1NKD A;  1RPO A;  2IJH A;  2IJJ A;  3K79 A;  4DO2 A;  1ROP A;  2IJI A;  2GHY A;  1F4N A;  1PD3 A;  1F4M A; 
#chains in the Genus database with same CATH topology
 4EB6 A;  1AJP A;  3MHH C;  1WAZ A;  4O4H B;  4QNH B;  2BE3 A;  5CA0 A;  3STL C;  1WB7 A;  2WSS G;  4PJ0 Z;  4X62 O;  1N32 B;  1K3E A;  1L8D A;  2Y69 B;  4O4L B;  2P5O A;  3KCX A;  2E75 B;  2DN9 A;  2YXY A;  4ZOL A;  2A7W A;  3K04 A;  2EBO A;  1K34 A;  4XBF A;  1ENV A;  2A79 B;  2EUL A;  3T1Y O;  4YJ2 B;  1ORQ C;  3I55 V;  2YID A;  3AK1 A;  4JAU A;  3AG4 B;  1A32 A;  3E22 A;  1I7F A;  1YIJ V;  4B7K A;  1Q3E A;  3JAK A;  3W7U A;  1WJZ A;  1OCC C;  3UO3 A;  5LOV A;  3E8B A;  4DYL A;  2Z0A A;  1VQL V;  3NXS A;  4ZOL B;  2ZR3 A;  4X20 A;  5LP6 B;  2FKX A;  1ZWI C;  5JH7 B;  1H2K A;  2ZDI C;  1LR1 A;  2LO1 A;  3CXH F;  2IJI A;  1MNG A;  4DV2 B;  5B1O A;  2ARH A;  2QM4 A;  3C3S A;  4DR2 O;  2DJV A;  3WB2 A;  3ZRW B;  2F4V B;  3JAK B;  2XOK G;  2KB1 A;  1R6N A;  1U96 A;  2JK5 C;  3G80 A;  1F51 A;  3CX5 F;  5LYJ A;  5LMN O;  2D3O W;  4HBN A;  3RWR D;  2UUC O;  2F23 A;  1OCR B;  4XDJ A;  1L0N H;  2R72 A;  3JD0 A;  2RN9 A;  1M5I A;  1DTO A;  2WLL B;  3LSS A;  3GB7 C;  1BL8 A;  1ZX3 A;  4JI8 B;  3OAA G;  4DR6 O;  4TSF G;  5JVD B;  3JAW A;  1US6 A;  4QGP A;  3LSU A;  2FML A;  5GTH Z;  3ETQ A;  2V1D A;  2CH7 B;  2OTL V;  4I50 B;  1FYJ A;  4MTF A;  4WFF A;  3SPC A;  3CME V;  2HR3 A;  1O9H A;  1BHA A;  5A2Q N;  1EFR G;  2CK3 G;  2ZIM A;  3RGB A;  3HKB A;  2Y4T A;  4AI8 A;  3VQW A;  2IJH A;  2JJ2 G;  4AIL C;  1NR7 A;  1YDX A;  2OCC C;  1S76 D;  3RYC B;  3SJC C;  2JGD B;  3CRM A;  4DXW A;  4X65 B;  3ZIA G;  4MVQ A;  3J80 N;  3DSQ A;  4NXN B;  1J5E O;  3OD4 A;  1NTK H;  4L8J A;  1MOF A;  4K3A A;  5CB4 B;  2Q68 A;  3SYQ A;  3HKB B;  4JI0 B;  1K4C C;  3ABU A;  4TV9 B;  1FXK C;  5IY5 B;  2EIK C;  2AHY A;  4K8Z A;  1VF6 C;  4MVZ A;  4JI0 O;  2LGW A;  1FFT B;  2WLK A;  2DWE C;  2JS5 A;  2YIB D;  4JAS A;  3CRA A;  4QPK A;  5IJ0 A;  3SYA A;  1M1K W;  3JAR A;  2ZE5 A;  4I55 A;  3ZMS A;  2YEV B;  4LFA B;  4G27 B;  4JI2 O;  3F7V C;  4DV6 B;  4IYI A;  4R50 A;  3IAY A;  4IT5 A;  2MW2 B;  3PN1 A;  4NVP A;  1R6K A;  3ZRX A;  3WB0 A;  4ZI7 A;  1H38 A;  4U3F H;  1NJI W;  3M7M X;  1KD1 W;  4DV0 O;  2W6I G;  4UVB A;  2UU9 B;  1SC5 B;  3JAT B;  4EKW A;  2VQE O;  4I55 B;  1N33 O;  4K0K O;  2Y48 A;  2Z5U A;  1XI1 A;  5CA3 A;  5KHK A;  2UU9 O;  2FB5 A;  3H1I H;  2ZXW C;  4N21 A;  1FXH A;  1RPR A;  2ZE7 A;  1YIT V;  2GUZ B;  4RUE A;  1HNW B;  4XDK A;  5GON A;  3VQY A;  3CCQ V;  4JI6 B;  4GZR B;  2GV9 A;  2HHH B;  2IM9 A;  2H8P C;  4FLT A;  2UXC O;  1WPX A;  4YY3 O;  5CBH A;  2HHH O;  3OTO B;  3HKD B;  4WFH A;  3CXC U;  3AG1 C;  2A9H A;  2DMX A;  1Q6I A;  3JAS A;  3ETG A;  4YHH B;  5KX5 A;  1WNS A;  1F4M A;  2GTA A;  4DV1 O;  4CH4 A;  1IBM O;  4I9W A;  3JAM N;  3AG3 C;  5H6Q A;  5AG2 A;  3RFR A;  1SQQ H;  2XAS A;  4JTC B;  2ZM6 B;  1G1X B;  3ZHR A;  3GWK C;  3K5M A;  3ZRV A;  2HEP A;  4O4J B;  4UB6 Z;  3JAS B;  3CRC A;  1YEW A;  1JPX A;  2X0L A;  4B3R B;  1F23 A;  3AG7 A;  4JI3 B;  2EIN C;  3L72 H;  1OCC B;  3OGI B;  4JV5 B;  1W2B U;  1GK9 A;  2DYR C;  1O9G A;  1K73 W;  4RQF A;  1K5Q A;  4JI3 O;  4E2L A;  4X1I B;  1Q5O A;  1PM9 A;  3M99 B;  3JSN A;  2M7W A;  1S5L Z;  2HP8 A;  1BGY H;  4CH6 A;  3T4Z A;  4U3J A;  2DE0 X;  4DV7 O;  1BMF G;  1N4C A;  3F5W C;  4DK1 A;  4X64 B;  3C90 A;  3SPI A;  1R3J C;  4LWS A;  1SZX A;  2WLN A;  3HR0 A;  5IJ9 A;  5GTI Z;  4O2A B;  3CCM V;  1VQM V;  1WA8 A;  3BFR A;  2Q0A A;  2Q7H A;  4FZ1 A;  5JJN B;  5BR8 O;  1AI5 A;  2ZT9 B;  4GX2 A;  1ZTE A;  4F6R B;  4EEQ A;  1JJO A;  4J7K A;  3OMA B;  2YXL A;  4IYH A;  3JAL B;  3B8N A;  1ZL8 B;  4PA9 A;  1S72 V;  1DLB A;  2XHB A;  3RYF A;  3ZS8 C;  3FYI B;  2O57 A;  2EJR A;  4UV8 A;  2VRZ A;  2QR4 A;  3VQV A;  1LNQ A;  1I94 O;  5EZY A;  1R1B A;  1FAF A;  1YVW A;  4OX9 O;  1WB8 A;  4LFC O;  2CGN A;  4TUY B;  4B3M B;  5KAI Z;  2BTO A;  4JPR A;  3K03 A;  4F4L A;  4J9Z B;  1DF5 A;  4CS2 A;  2QSA A;  4DV4 B;  1H8H G;  2YDE A;  1JJ2 U;  1FJG B;  2GTS A;  4B3M O;  3QO7 A;  5K1X A;  4UCO A;  3BA8 A;  5LXT A;  4JI7 O;  2ITD C;  3HKC A;  1MA1 A;  3N2K A;  2JEX A;  4L87 A;  1Q43 A;  1MZE A;  1CP9 A;  2IH3 C;  4BIO A;  4QE9 A;  1GAX A;  4JI1 B;  2HKO A;  5D5P A;  4DR1 B;  2OCC B;  1RSO A;  2EX3 A;  5KHJ A;  5GW7 A;  2VWJ A;  3APQ A;  4KUM A;  1K33 A;  2LFR A;  5KA5 A;  4DR5 B;  1RP3 B;  3L74 H;  4FFB A;  3WB1 A;  4UB8 Z;  2LFS A;  1XIL A;  4GKK O;  5LXT B;  4J7Z A;  2WA4 A;  3HKC B;  4DRX A;  1SS3 A;  5H9C A;  4CH3 A;  2OIG A;  1GKF A;  1FXK B;  1YJ9 V;  3JCU Z;  1OCO C;  3AK2 A;  2XAQ A;  2EIK B;  4LF7 B;  4KHP O;  5CA1 B;  1MSW D;  5JQG B;  4PDL A;  5E79 Z;  4O4I B;  4PA6 A;  4AQY B;  3E8G A;  4NTY A;  5H2F Z;  4LFB B;  3B09 A;  3LDD A;  1QR8 A;  2ZE6 A;  3HKE B;  4MVM A;  2WLI A;  1IDS A;  3MD0 A;  4LF6 O;  3G67 A;  1F7Y A;  1E1R G;  5B1N A;  4FLV A;  1NKD A;  4LFB O;  1NI8 A;  4UVA A;  1W0J G;  3OTF A;  2KKW A;  2AW9 A;  2EIL C;  3B2E E;  1K9M W;  1M57 C;  2ODM A;  5LL6 Y;  4J41 A;  4J7J A;  4I4T A;  3FB7 C;  1R6T A;  1CPY A;  2V7Q G;  1I08 A;  4YIO A;  3K08 A;  4FZ0 A;  1R3L C;  3J81 N;  3CCE V;  1OJH A;  3ABK C;  1GM8 A;  2IU3 A;  4YIP A;  4RAI A;  4MT8 A;  4IIJ A;  2ZXW B;  4YJ3 A;  4DR7 B;  2XND G;  2ZNJ A;  3B4S A;  4WFG A;  3BY6 A;  4O4H A;  2HJF C;  2QGN A;  4WFE A;  3B8M A;  4I4T B;  3K0D A;  1NH2 B;  1AVM A;  2GDS A;  4PHZ A;  1BQZ A;  4KP4 A;  1KB9 F;  1S5H C;  1AR1 B;  1QCE A;  2QM7 A;  3J7A U;  3AG1 B;  4NTX A;  4B7E A;  1M56 C;  3UCS C;  2FTK A;  2XUM A;  3EXA A;  4YJ3 B;  1VMG A;  2L6L A;  4O4L A;  1XL6 A;  1SET A;  1EZJ A;  1SRY A;  1TAE A;  2JJ1 G;  1VQ9 V;  1HWY A;  3RVZ A;  3SR2 C;  2ETN A;  1X4T A;  4X66 B;  2A06 H;  2HVK C;  3AG3 B;  4JYA B;  4NXM B;  3FAV A;  3H1J H;  1PNM A;  3KKY A;  2N04 A;  2W6J G;  4PI0 A;  4YJ2 A;  1KEC A;  1ZLZ A;  4X9Q A;  5JCO A;  2XTA A;  1KMI Z;  3N2G B;  2ZNI A;  3S3X A;  1XL4 A;  3FKS G;  3JSL A;  1N32 O;  2CUG A;  2HJD A;  2CTR A;  2EIN B;  3E8H A;  4RQE A;  4WCE V;  4C7U A;  5LP6 A;  2WAM A;  2DYR B;  2RNB A;  3ETE A;  1MZF A;  3FAV B;  4JF3 A;  5JH7 A;  3OEH G;  1XMQ B;  3K57 A;  1SQV H;  3OMN B;  3WFV A;  2UXX A;  5B1A C;  2LGQ A;  1NTZ H;  3G4S V;  1N36 B;  1YSC A;  4P9P A;  3ZRW A;  1XEQ A;  4X1K A;  2P6J A;  1SF9 A;  5KHG A;  1B3Q A;  1BE3 H;  2QWQ B;  3ASO C;  4ABM A;  1I5Y A;  1K97 A;  2Q8V A;  1R3K C;  2V4D A;  2WLM A;  5DN6 G;  5FNV B;  2RJZ A;  4PA3 A;  1KC8 W;  1HR0 B;  2WLL A;  1DK1 A;  4OXS A;  4RUF A;  4B3S B;  2R9R B;  2NN4 A;  2LQT A;  1NVP D;  4LF4 B;  5B3S C;  1BZK A;  4X1K B;  1AI4 A;  5JVD A;  1MG1 A;  4JZ2 A;  4DV2 O;  4DK0 A;  1H2L A;  4BWA A;  2ZQM A;  3GWO A;  4LF4 O;  2F4V O;  2CH7 A;  3QF7 A;  1OV9 A;  4JI5 B;  2B1G A;  1Z2G A;  1PV0 A;  4WF9 V;  4I50 A;  1H2S B;  5A9G A;  2PI4 A;  5JJE B;  3EVK A;  2BTQ A;  4HZ3 A;  1D5A A;  4K35 A;  2ILM A;  4FM2 A;  4MSW C;  1M4U A;  2D2C B;  1PP9 H;  2CGO A;  1SKV A;  4U7N A;  1EM1 A;  5B66 Z;  1XMO B;  5B1B C;  4JI8 O;  1KKC A;  4PV1 B;  3U10 A;  2AXT Z;  1QR9 A;  1H2N A;  5E1A C;  1Q90 D;  5KUM A;  1Q8I A;  3T1C A;  4X1Y A;  5LGU A;  1S5J A;  3RYC A;  2YSU B;  2JGD A;  4JAA A;  3WG7 C;  2BTQ B;  1ZAU A;  3JYC A;  1V55 C;  2Q5Z A;  5J2U B;  4I9Q A;  3UT5 B;  5CB4 A;  4B3T B;  4FIP C;  4UVC A;  3VBB A;  4TV9 A;  2WPD G;  4F6E A;  4BIU A;  3ZMT A;  1RPO A;  2F95 B;  3UO2 A;  2QKA A;  2EJ7 A;  3E89 A;  4B3T O;  5FL7 G;  1OCO B;  4P2Z A;  4P9O A;  3OEE G;  4X1Y B;  4FLU A;  1FD9 A;  3TK1 A;  5EC1 C;  4X8A A;  1COW G;  3NR7 A;  2ITC C;  3WU2 Z;  5H6R A;  5KLV H;  2N05 A;  2YEV A;  3FFQ A;  4X65 O;  3TXQ A;  4NXN O;  2YC0 A;  4GKJ B;  4FM0 A;  2DQ0 A;  5LA6 B;  4K8X A;  2H94 A;  4CS3 A;  4GCZ A;  1WPB A;  4G2K A;  4GKJ O;  4KFM A;  2EIL B;  2YS8 A;  3BPZ A;  5EIB D;  1LUV A;  2E5L B;  1M57 B;  1K4D C;  3JAT A;  5F2V O;  1Y67 A;  5L3E A;  1YCI A;  1AB3 A;  4JYB A;  3B77 A;  4ASU G;  5K1P A;  5LHH A;  1P4R A;  4BW5 A;  4OPA A;  2EZP A;  1T5E A;  2E74 B;  3ABK B;  2AGA A;  2GUZ A;  4CH5 A;  4FLY A;  4LFA O;  3F7Y C;  4DV6 O;  1SQP H;  1UFI A;  1VQO V;  3E83 A;  3DC5 A;  2ZE8 A;  1GO3 F;  2IJJ A;  3DGE A;  3HKD A;  5L3B A;  1KP3 A;  2XT9 A;  2Z3Y A;  5KHI A;  3MAQ A;  2PUS A;  4KL1 A;  3ZRS A;  1GTO A;  3K79 A;  1M56 B;  4J9Y B;  1PL0 A;  1W0K G;  3KCY A;  3K9A A;  1K5S A;  3N27 A;  2ZIN A;  1Q81 W;  1V54 C;  3JD2 A;  1N34 B;  2PZS A;  3O9O A;  1RM1 C;  1HNW O;  3RYI B;  2OWO A;  1PPJ H;  1AI7 A;  3CRQ A;  4JI6 O;  5HFL A;  2UUB B;  1SQG A;  4LCU C;  4N23 A;  1GM7 A;  1OHH G;  3JCZ A;  4O4J A;  3D3I A;  1HP8 A;  4HYO A;  3OTO O;  4FFK A;  1XQ8 A;  4DUZ B;  3QNE A;  4PI2 A;  2RCV A;  4YHH O;  1ARO P;  1AIL A;  4J11 A;  2PF4 E;  4XDL A;  3L70 H;  2IU0 A;  2WA3 A;  3IJ4 A;  3BCC H;  1AR4 A;  3E35 A;  4PDR A;  4X1I A;  1MAB G;  3CCU V;  2ZDI A;  3BHP A;  3UM7 A;  1QLN A;  5B1A B;  4JGS A;  2IW5 A;  3D36 C;  2ZM6 O;  1D5N A;  2A0L A;  5FLX N;  2ADQ B;  3ASO B;  4O2A A;  5DEC A;  3P3N A;  3H1L H;  4B3R O;  2ADP A;  2QWN B;  1AJN A;  1XUQ A;  2R70 A;  1KYO F;  4D7S A;  4JV5 O;  2YIB A;  4TOI A;  1NU1 H;  2PYJ A;  1EZV H;  5EYP B;  4DR4 B;  4F6R A;  2Y4U A;  5L3G A;  3E2E A;  2QA4 V;  1B06 A;  3DXR B;  1G4Y B;  2DOS A;  3JAL A;  1ZL8 A;  4JTA B;  1AR5 A;  1SQX H;  3RN4 A;  4CBC A;  5B3S B;  4DUY B;  4LF5 B;  5D5Q A;  1Q6U A;  1TA8 A;  1B6Q A;  2Q7G A;  1Q82 W;  2F93 B;  4GX0 A;  2GSM B;  3VOU A;  1AI6 A;  4LF5 O;  4X64 O;  4TUY A;  5CBG A;  4LBE C;  3CC2 V;  2LW1 A;  3RYH B;  3B40 A;  2X7R B;  4J10 A;  1VQ7 V;  1QLE C;  2KG7 B;  3OT7 A;  4GX5 A;  1ZUQ A;  1HNZ B;  4DV5 B;  1SA0 A;  3SPJ A;  3SPG A;  5IYC O;  1S77 D;  2Q67 A;  2GBO A;  1TGO A;  4Q20 A;  5J2T B;  2NLJ C;  4DO2 A;  1VQ8 V;  3SJA C;  3G71 V;  3I56 V;  5B1B B;  4FLZ A;  5CBF A;  2IH1 C;  4MW8 A;  4JAV A;  2EIJ C;  5LGN A;  4W4L A;  4ZHQ B;  4EFE A;  2RDC A;  1QU7 A;  1Q86 W;  1SA0 B;  3WG7 B;  1FFX A;  1H2M A;  3H01 A;  3JD4 A;  4HNA B;  1V55 B;  1CEZ A;  1BSM A;  3IC9 A;  4UCT A;  1P7G A;  2YI9 A;  3CEI A;  5BXZ A;  3W7W A;  4DV4 O;  4MS2 A;  1FKA O;  2MK3 A;  3FYE B;  1FXK A;  1FJG O;  2A3Q A;  1JR9 A;  3CP1 A;  4O2B A;  1G8M A;  1AP6 A;  1DGS A;  4FK5 C;  5CA1 A;  3W7X A;  1VF6 A;  2P90 A;  1NS1 A;  5JQG A;  3P3P A;  2UXB B;  1VQN V;  4LR3 A;  4O4I A;  5ITZ A;  2X6B A;  2UUA B;  1FFX B;  3ABM C;  1BT8 A;  1TUB A;  4JI1 O;  4MVS A;  2HVJ C;  2Q73 A;  4DR1 O;  3HKE A;  5EBL C;  2UXD B;  2UXB O;  1XHZ A;  5EC2 C;  1JCH A;  1SZT A;  1XNR B;  1HDJ A;  2QTS A;  4DR5 O;  3SDL A;  4CS4 A;  3E8F A;  1QHT A;  4O2B B;  5BMV A;  1VQ6 V;  4UCV A;  3ZJZ A;  3OR7 C;  2DWD C;  3RVY A;  5DED A;  3ZMU A;  5ITZ B;  3CMA V;  5KMG B;  1TUB B;  3FX7 A;  5JJJ B;  4LH7 A;  4LF7 O;  2R9A A;  4NR1 A;  2BOB C;  3SYP A;  3ZHQ A;  3A8T A;  2OYQ A;  2BOC C;  4AQY O;  1YZB A;  4PA4 A;  1K92 A;  3FB5 C;  1I0H A;  2JVD A;  5BMV B;  1IZ3 A;  5H5N A;  3ZMV A;  2Y0I A;  1JFF A;  2EIM C;  1WP7 A;  4I5S A;  1K8A W;  3CD6 V;  5IWA B;  2HFE C;  3DC6 A;  3ETD A;  3LSQ A;  3OM3 B;  3OR6 C;  1FS0 G;  1U97 A;  3FB6 C;  1N0N A;  1KUQ A;  1Y4M A;  2WLJ A;  1QVG U;  4A5U B;  4MVU A;  2P67 A;  3ASN C;  4PDM A;  3T1H B;  1WLE A;  1JQ0 A;  2K1E A;  3K59 A;  4R6Z A;  2P22 C;  1Y74 B;  1VIB A;  3SJB C;  3CYO A;  1JFF B;  4DW1 A;  3TGU H;  2PYL A;  4MTX A;  4LNU B;  5BY1 A;  3KG2 A;  3AG2 C;  1V54 B;  2ZR2 A;  4UCR A;  2CTW A;  3SPH A;  3T2M A;  1GN2 A;  4DR7 O;  1RM1 B;  3OMI B;  2CTQ A;  3K58 A;  2JIZ G;  4CC6 A;  1EBO A;  4IHJ B;  1CXZ B;  4YXW G;  5C93 A;  1EN6 A;  4CC5 A;  2PI5 A;  4DW0 A;  1SER A;  3N2G A;  4EFB A;  4UFZ A;  3OGC C;  1UPG A;  4H0L B;  2LP7 A;  4PEL A;  5LMU B;  4LF8 B;  4OPH A;  2Q9L A;  4PDV A;  3E86 A;  1OCZ C;  4GYC B;  3A2F A;  4H33 A;  1PD3 A;  2DYS C;  4LF8 O;  4X66 O;  1M90 W;  1ROP A;  2X6C A;  3CC7 V;  3BAA A;  3CJH B;  3LNM B;  4JYA O;  2YIA A;  4NXM O;  1KQS U;  3S3W A;  1Y76 B;  3F5T A;  1GN3 A;  4X62 B;  3MDS A;  4FM1 A;  1AP5 A;  3ZHV A;  4Z2W A;  4ICG A;  3ICX A;  3D8C A;  1R3I C;  2QE7 G;  5FNV A;  5JWP A;  1JA8 A;  1JMK C;  1KU9 A;  1NT2 B;  4UCU A;  3D3Q A;  4UV9 A;  1EN5 A;  1NR1 A;  4EB6 B;  1VF5 B;  1SQF A;  2B1I A;  1XMQ O;  1FXV A;  2Q4P A;  3BVO A;  3T1Y B;  4OGQ B;  5CA0 B;  1N36 O;  4QIW F;  2DW4 A;  3ML0 A;  1IX9 A;  4D6T H;  4RO2 A;  2Q6A A;  1NQT A;  3C3T A;  5IT9 N;  3BEH A;  4BAY A;  5KUK A;  2YIC A;  5EK0 A;  4ZBM A;  1VEW A;  1GH6 A;  3BA9 A;  2NR5 A;  1YTF D;  3ABT A;  1G6U A;  1QLE B;  3L9D A;  3K3W A;  1XOU A;  4H13 B;  3ZCC A;  1HR0 O;  1XNQ B;  1E1Q G;  1DF4 A;  4DR2 B;  2QEX V;  3CCL V;  1N0J A;  4B3S O;  3K9S A;  4LF9 B;  2H3O A;  4UCS A;  4FPP A;  3ZX6 A;  1XNQ O;  5LMN B;  4WFB V;  4TQD A;  5EIB C;  5IYB O;  1J95 A;  3E22 B;  2OCH A;  3ZMZ A;  2EIJ B;  2UUC B;  4LF9 O;  2QM8 A;  2VQF B;  5LOV B;  5J2U A;  4JI5 O;  2PY5 A;  1GN4 A;  3UT5 A;  3LDC A;  1XBL A;  1ZSP A;  4X20 B;  4TV8 A;  2VQF O;  3JD1 A;  3QO5 A;  1M9N A;  3TJT A;  3R65 A;  3G6B A;  4DR6 B;  1KP2 A;  4WBN A;  1P7B A;  2P4V A;  1TVK A;  5LBQ A;  1XMO O;  3UQ8 A;  5L3C A;  1GMG A;  3UKM A;  1VQK V;  2IJK A;  5L3D A;  3A0B Z;  5LYJ B;  1THZ A;  3SGI A;  3ABM B;  2QKC A;  1WN7 A;  4MTO A;  1YJW V;  2ATK C;  2YI8 A;  4TV8 B;  2OTJ V;  1GM9 A;  1Q7Y W;  2Q7E A;  4MW3 A;  2YUA A;  5LA6 A;  4WBN B;  4BR6 A;  1TVK B;  2XAG A;  4HAM A;  1VF7 A;  2L35 A;  1H2G A;  1JOY A;  3JAW B;  3CWB H;  5TIS Z;  1KKD A;  3ZHU A;  3ZN0 A;  1V9P A;  3H1K H;  3TXS A;  4R8C A;  4JI4 B;  4LH6 A;  3ABL C;  1J5E B;  4BW9 A;  4KXR A;  1Y6X A;  2BSK A;  1GN6 A;  2CE4 A;  4JYY A;  4H44 B;  3CHX A;  3CB2 A;  3CPW U;  2M6Y A;  2G38 A;  4JI4 O;  1BCC H;  3OUS A;  3K5L A;  3OUF A;  2Q0O C;  4GX1 A;  2QTO A;  1QQC A;  2RMK B;  1EN4 A;  1IBL B;  5BZB A;  3CC4 V;  2EIM B;  5J9P C;  2FYU H;  1VQ5 V;  5KAF Z;  2B9Z A;  2JS3 A;  4QPJ A;  4D7T A;  1IBL O;  4NTW A;  4I0X A;  1M93 A;  2P7T C;  2E5L O;  3W7T A;  2BSK B;  3A0H Z;  5LGT A;  5KHH A;  1W59 A;  2OIE A;  3ASN B;  3FB8 C;  1L1F A;  4JI2 B;  2PTM A;  5DM6 V;  4TQF A;  4RWU A;  4J80 A;  4IGG A;  3RYI A;  4E4E A;  1R73 A;  3AG2 B;  1NBM G;  4MTG A;  4FMT A;  4DV0 B;  1I5X A;  4I0X B;  4Z1V A;  1YTF B;  3JD3 A;  1AJQ A;  1NVP B;  2VQE B;  4K0K B;  1N33 B;  5IYZ A;  1WP8 A;  2UXN A;  5IJ0 B;  4UXN A;  2K9P A;  5IYD O;  1LUW A;  1GRJ A;  3JAR B;  3L75 H;  4AHC A;  4CZZ A;  3EHB B;  4U7O A;  1VAR A;  3U11 A;  3P30 A;  3L73 H;  1OCZ B;  4FLW A;  1IXB A;  2WLH A;  2UXC B;  2QJ1 A;  2JDI G;  1YXB A;  3O65 A;  4ZKI A;  4YY3 B;  1N34 O;  2DYS B;  4H37 A;  3X2Q C;  4ZI7 B;  4FLX A;  3ZHS A;  1XRE A;  5IYZ B;  2CTP A;  2QWP B;  3HPL C;  3RW0 A;  2UUB O;  3FD9 A;  4X89 A;  1BS3 A;  3CS5 A;  2IBZ H;  4BIZ A;  2QKS A;  2ZKO A;  1RFY A;  4DV1 B;  1VQP V;  2VWK A;  2XAJ A;  4DUZ O;  1IBM B;  1YF2 A;  2W0F C;  1UJW B;  3SYO A;  5GON B;  4ZIB A;  2KQX A;  5EYP A;  3Q4H A;  1IUR A;  3MHS C;  2HG5 C;  3I5D A;  3HB3 B;  4R7C A;  3DXR A;  1PNL A;  2LW7 A;  3K5O A;  2QDO A;  2ZD9 A;  3RBZ A;  5L3F A;  1YHQ V;  4GT1 A;  2P06 A;  3BAB A;  3CSX A;  3DTU B;  2F66 C;  1PNK A;  3QTC A;  1N8R W;  2Y69 C;  2F43 G;  3RYH A;  3OFN G;  5KX5 B;  4Q6G A;  2KG7 A;  3Q4H B;  3SYC A;  2C2A A;  4PD4 F;  1OZ0 A;  5J2T A;  4JTD B;  1PL4 A;  3ZHT A;  4DR4 O;  2GHY A;  3R66 A;  4DV7 B;  4NKG B;  2E76 B;  4JYC A;  5JCO C;  3AG4 C;  4DUY O;  4ZHQ A;  5IDJ A;  4QJF B;  1VQ4 V;  3ZED A;  4WFA V;  5IE9 A;  3IC7 A;  5BR8 B;  1P84 F;  5KA6 A;  3U0Z A;  3STZ C;  4HNA A;  3OE7 G;  3CE2 A;  2B5U A;  5LP6 C;  4MVO A;  3EFF K;  1HNZ O;  4DV5 O;  1MSD A;  2X6A A;  1PKX A;  1NH2 D;  5FPR A;  5CMU A;  2HLD G;  1QBZ A;  3QVN A;  3K06 A;  1SES A;  2PGG A;  3W7S A;  4I7Z B;  1XDC A;  1NZ6 A;  4U3J B;  1I94 B;  4LP8 A;  1Y66 A;  3IGA C;  3OW2 U;  1P49 A;  2NNU A;  4OX9 B;  4UUJ C;  4LFC B;  5LHG A;  4LWS B;  4Z1M G;  5IJ9 B;  1OCR C;  5EBW C;  3CCR V;  1WA8 B;  3IFX A;  1Q6H A;  2W0X A;  4FJC C;  4JI7 B;  1JVM A;  3CCV V;  3M8A A;  3QG5 A;  1E79 G;  1S0V A;  5B5E Z;  3LUT B;  1IVS A;  2AZ2 A;  3APO A;  2JEU A;  4QE7 A;  1KBH A;  1URF A;  5KMG A;  2OT5 A;  3RYF B;  2BCC H;  4IL6 Z;  1HNX B;  5EZY B;  2P4K A;  5CN0 A;  2ZCE A;  2CDY A;  1HW7 A;  2UUA O;  3ABL B;  2LJ2 A;  4GKK B;  3CCJ V;  1FPO A;  2UXD O;  4GLX A;  1NTM H;  1HNX O;  4GUN A;  1XNR O;  3A0R A;  3THO A;  1L0L H;  1IXM A;  1SQB H;  3K0G A;  2Q69 A;  5LHI A;  4KHP B;  1TUE B;  4NYK A;  2YXH A;  2E3C A;  3N2K B;  2F1M A;  1X59 A;  5C8Y A;  3H1H H;  3KZI Z;  4B08 A;  4MVR A;  3T4D A;  3H9V A;  1XHX A;  4TWK A;  1RSO B;  1Y74 A;  4LF6 B;  2QWR B;  1YJN V;  2JRI A;  1Z5W A;  4FFB B;  1F4N A;  4FVM A;  3P32 A;  3TCU A;  4LNU A;  1Z5V A;  2R9I A;  2DQ3 A;  4DRX B;  2XAH A;  5IY5 C;  4G28 B;  3G6E V;  2VS0 A;  4W4K A;  5C8Y B;  4IHJ A;  1D2D A;  4NB5 A;  3GVM A;  5IWA O;  4TT3 G;  3ZN1 A;  3LDE A;  1K7D A;  2AHZ A;  2JGU A;  4PA7 A;  3AEI A;  4DR3 B;  1QNM A;  5EBM C;  3T1H O;  2EZO A;  5FPO A;  1B04 A;  2QWO B;  3BRC A;  2WLI B;  3CRR A;  3PJS K;  4DR3 O;  1BHB A;  3RT3 C;  5HFM A;  2RQ6 A;  1VP7 A;  3CJH A;  3VQX A;  2KSD A;  1QVF U;  3X2Q B;  3LNN A;  1Y76 A;  4LC1 A;  3D36 A;  2AZ0 A;  2WWW A;  1YI2 V;  2XAF A;  1BQ0 A;  2ZIO A;  1MMM A;  4DV3 B;  1H8E G;  3ZBH A;  1JX9 A;  3L71 H;  1IBK B;  2N74 A;  2Y0P A;  3K5N A;  3AK3 A;  2FL4 A;  3TET A;  4JZG A;  5LMU O;  4X88 A;  2CAZ C;  4IIJ B;  3QO8 A;  4J42 A;  4DV3 O;  1IBK O;  3SJQ C;  3CCS V;  1S3J A;  4P30 A; 
#chains in the Genus database with same CATH homology
 1AJP A;  1GM9 A;  1CP9 A;  2IH3 C;  4QE9 A;  3MHH C;  1Q7Y W;  3QNE A;  4MW3 A;  2HKO A;  2XAG A;  4QNH B;  2OCC B;  1ARO P;  5GW7 A;  4HAM A;  4XDL A;  3STL C;  4KUM A;  1K33 A;  2WSS G;  2LFR A;  2IU0 A;  5KA5 A;  3E35 A;  4PDR A;  1H2G A;  1JOY A;  1KKD A;  2LFS A;  1MAB G;  3ZN0 A;  2ZDI A;  1K3E A;  3CCU V;  3UM7 A;  1QLN A;  4R8C A;  5B1A B;  2Y69 B;  4JGS A;  2IW5 A;  5H9C A;  3ABL C;  1GKF A;  1FXK B;  2A0L A;  1YJ9 V;  1OCO C;  2XAQ A;  2EIK B;  3CPW U;  1MSW D;  3K04 A;  2EBO A;  3ASO B;  3OUS A;  4PDL A;  3OUF A;  1K34 A;  4GX1 A;  2QTO A;  4PA6 A;  3E8G A;  1AJN A;  4XBF A;  1ENV A;  5BZB A;  2A79 B;  3CC4 V;  2EIM B;  4P30 A;  5J9P C;  1ORQ C;  3LDD A;  3I55 V;  1QR8 A;  4JAU A;  3AG4 B;  4MVM A;  2WLI A;  3MD0 A;  1YIJ V;  1VQ5 V;  5L3G A;  3W7U A;  3E2E A;  2QA4 V;  1E1R G;  1G4Y B;  4QPJ A;  5B1N A;  1OCC C;  1NKD A;  3E8B A;  4JTA B;  2P7T C;  1VQL V;  4UVA A;  4CBC A;  5B3S B;  3NXS A;  3W7T A;  5LGT A;  1W0J G;  1B6Q A;  2ZR3 A;  3ASN B;  1Q82 W;  4GX0 A;  2EIL C;  1K9M W;  1ZWI C;  3FB8 C;  2GSM B;  1M57 C;  1L1F A;  3VOU A;  2ZDI C;  2IJI A;  5DM6 V;  1AI6 A;  5CBG A;  4LBE C;  5B1O A;  3FB7 C;  3CC2 V;  1CPY A;  2V7Q G;  1VQ7 V;  2X7R B;  1QLE C;  4GX5 A;  3K08 A;  3ZRW B;  1R73 A;  3AG2 B;  3SPJ A;  3SPG A;  1NBM G;  1R3L C;  2XOK G;  4MTG A;  2KB1 A;  4FMT A;  5IYC O;  1S77 D;  2Q67 A;  1R6N A;  4Q20 A;  2JK5 C;  3CCE V;  1I5X A;  3ABK C;  1GM8 A;  2IU3 A;  1F51 A;  2NLJ C;  1YTF B;  3JD3 A;  2D3O W;  1AJQ A;  4DO2 A;  4RAI A;  1NVP B;  4MT8 A;  1VQ8 V;  2ZXW B;  3G71 V;  1OCR B;  4XDJ A;  2UXN A;  3I56 V;  5B1B B;  2XND G;  5IYD O;  4UXN A;  5CBF A;  4WFG A;  3JD0 A;  3BY6 A;  2HJF C;  2IH1 C;  4MW8 A;  4JAV A;  1DTO A;  2WLL B;  2EIJ C;  3LSS A;  3GB7 C;  1BL8 A;  3B8M A;  4WFE A;  5LGN A;  3K0D A;  4CZZ A;  3EHB B;  4U7O A;  1NH2 B;  3OAA G;  1Q86 W;  3WG7 B;  4KP4 A;  4TSF G;  3P30 A;  3H01 A;  1OCZ B;  2WLH A;  3JD4 A;  1S5H C;  2JDI G;  1QCE A;  1AR1 B;  2QM7 A;  1V55 B;  3AG1 B;  4ZKI A;  1CEZ A;  1M56 C;  2DYS B;  4H37 A;  2FTK A;  3X2Q C;  2V1D A;  3W7W A;  1XL6 A;  3HPL C;  4MS2 A;  2MK3 A;  3RW0 A;  1SET A;  3FYE B;  1EZJ A;  1FXK A;  1SRY A;  2OTL V;  4X89 A;  2JJ1 G;  1VQ9 V;  1HWY A;  3CP1 A;  4MTF A;  1G8M A;  4WFF A;  3SPC A;  3RVZ A;  4FK5 C;  3CME V;  4BIZ A;  2HR3 A;  3W7X A;  2HVK C;  3AG3 B;  2P90 A;  2QKS A;  1BHA A;  1VQP V;  1VQN V;  1PNM A;  2X6B A;  2XAJ A;  1EFR G;  3ABM C;  2CK3 G;  4MVS A;  2HVJ C;  2W0F C;  2W6J G;  1KEC A;  1UJW B;  5EBL C;  3SYO A;  3MHS C;  5EC2 C;  1JCH A;  1SZT A;  2HG5 C;  3HB3 B;  2IJH A;  2JJ2 G;  4R7C A;  1XL4 A;  1PNL A;  3E8F A;  1NR7 A;  3FKS G;  2OCC C;  2ZD9 A;  3RBZ A;  1S76 D;  2EIN B;  1VQ6 V;  4DXW A;  5L3F A;  1YHQ V;  4GT1 A;  3ZIA G;  3E8H A;  4MVQ A;  4RQE A;  4WCE V;  3ZJZ A;  2WAM A;  2DYR B;  3ETE A;  3OR7 C;  2DWD C;  4JF3 A;  1MOF A;  3DTU B;  3RVY A;  3ZMU A;  3OEH G;  3CMA V;  1PNK A;  1N8R W;  3OMN B;  3WFV A;  2Q68 A;  2UXX A;  5B1A C;  2Y69 C;  3SYQ A;  2F43 G;  3OFN G;  2BOB C;  1K4C C;  3SYP A;  3G4S V;  1YSC A;  3ABU A;  4P9P A;  1FXK C;  3SYC A;  3ZRW A;  2BOC C;  2C2A A;  5IY5 B;  2P6J A;  1OZ0 A;  2EIK C;  2AHY A;  4PA4 A;  1K92 A;  4JTD B;  3ASO C;  3FB5 C;  4MVZ A;  1I5Y A;  1K97 A;  1FFT B;  1R3K C;  2WLK A;  2DWE C;  2GHY A;  3ZMV A;  2WLM A;  4JAS A;  4QPK A;  2EIM C;  3SYA A;  5DN6 G;  1M1K W;  4PA3 A;  1KC8 W;  4JYC A;  4I5S A;  3AG4 C;  1K8A W;  2WLL A;  3CD6 V;  2HFE C;  4OXS A;  3ETD A;  3ZMS A;  2YEV B;  5IDJ A;  3LSQ A;  3OM3 B;  4RUF A;  4QJF B;  3OR6 C;  1FS0 G;  2R9R B;  3FB6 C;  1VQ4 V;  1NVP D;  4G27 B;  4WFA V;  5B3S C;  1Y4M A;  2WLJ A;  3IC7 A;  3F7V C;  5KA6 A;  1QVG U;  4R50 A;  3STZ C;  1AI4 A;  1MG1 A;  4MVU A;  2P67 A;  3ASN C;  3OE7 G;  4PDM A;  1WLE A;  1R6K A;  2B5U A;  1JQ0 A;  3ZRX A;  2K1E A;  4MVO A;  3EFF K;  4R6Z A;  2ZQM A;  3GWO A;  1H38 A;  3CYO A;  1NJI W;  2X6A A;  1PKX A;  1NH2 D;  1KD1 W;  5CMU A;  2B1G A;  2W6I G;  2HLD G;  4UVB A;  4WF9 V;  1QBZ A;  4EKW A;  3K06 A;  1SES A;  4MTX A;  3KG2 A;  2PI4 A;  3W7S A;  3AG2 C;  1V54 B;  2ZR2 A;  3SPH A;  2Y48 A;  4HZ3 A;  3T2M A;  2Z5U A;  1RM1 B;  3OMI B;  4LP8 A;  1Y66 A;  3IGA C;  3OW2 U;  5CA3 A;  2NNU A;  2JIZ G;  4UUJ C;  1EBO A;  4MSW C;  4YXW G;  2ZXW C;  4N21 A;  5LHG A;  1FXH A;  4Z1M G;  4U7N A;  5C93 A;  1RPR A;  1OCR C;  1YIT V;  5EBW C;  4RUE A;  3CCR V;  4XDK A;  5B1B C;  2PI5 A;  1SER A;  3CCQ V;  3OGC C;  3IFX A;  2H8P C;  1QR9 A;  5E1A C;  5KUM A;  1WPX A;  2LP7 A;  4FJC C;  4PEL A;  3T1C A;  1JVM A;  5LGU A;  3CCV V;  2YSU B;  1E79 G;  1S0V A;  3LUT B;  5CBH A;  4PDV A;  2JEU A;  3WG7 C;  3E86 A;  1OCZ C;  4WFH A;  3JYC A;  4H33 A;  4QE7 A;  3CXC U;  1V55 C;  3AG1 C;  2A9H A;  1PD3 A;  2DYS C;  2OT5 A;  3ETG A;  1M90 W;  1ROP A;  2X6C A;  3CC7 V;  3LNM B;  4FIP C;  4UVC A;  3VBB A;  1F4M A;  2WPD G;  1KQS U;  5CN0 A;  4BIU A;  3ZMT A;  1RPO A;  3ABL B;  4I9W A;  3E89 A;  3AG3 C;  5FL7 G;  1OCO B;  4P2Z A;  4P9O A;  5H6Q A;  3CCJ V;  3OEE G;  3TK1 A;  5EC1 C;  4X8A A;  2XAS A;  1COW G;  3A0R A;  4JTC B;  2ITC C;  1R3I C;  2QE7 G;  1IXM A;  3ZRV A;  3K0G A;  2Q69 A;  5H6R A;  5LHI A;  2YEV A;  1TUE B;  4UV9 A;  1NR1 A;  1JPX A;  2X0L A;  1F23 A;  2B1I A;  2DQ0 A;  4MVR A;  3T4D A;  1FXV A;  2EIN C;  1OCC B;  2H94 A;  1W2B U;  4TWK A;  1GK9 A;  4GCZ A;  2DYR C;  4QIW F;  4G2K A;  2DW4 A;  3ML0 A;  1YJN V;  1K73 W;  4RQF A;  4KFM A;  2EIL B;  1K5Q A;  4E2L A;  4RO2 A;  2Q6A A;  3M99 B;  1M57 B;  1K4D C;  1NQT A;  2M7W A;  1F4N A;  3P32 A;  3TCU A;  5L3E A;  3BEH A;  4BAY A;  5KUK A;  2R9I A;  5EK0 A;  4ZBM A;  4JYB A;  2DQ3 A;  2XAH A;  3T4Z A;  5IY5 C;  3B77 A;  4ASU G;  5LHH A;  3ABT A;  4G28 B;  3G6E V;  1YTF D;  1QLE B;  1BMF G;  1P4R A;  3K3W A;  4BW5 A;  3ZCC A;  3F5W C;  1E1Q G;  3SPI A;  1DF4 A;  1R3J C;  2EZP A;  4TT3 G;  3ZN1 A;  2WLN A;  3ABK B;  2QEX V;  3CCL V;  3LDE A;  3CCM V;  1VQM V;  1K7D A;  2AHZ A;  4PA7 A;  4FPP A;  3F7Y C;  3AEI A;  1AI5 A;  5EBM C;  1VQO V;  3E83 A;  4WFB V;  2EZO A;  5IYB O;  1J95 A;  4GX2 A;  3ZMZ A;  2EIJ B;  2QM8 A;  2WLI B;  1GO3 F;  3OMA B;  2IJJ A;  3DGE A;  3PJS K;  3B8N A;  1BHB A;  4PA9 A;  5L3B A;  1KP3 A;  1S72 V;  3LDC A;  2Z3Y A;  1DLB A;  5HFM A;  3FYI B;  3ZRS A;  2EJR A;  3JD1 A;  4UV8 A;  3QO5 A;  1LNQ A;  1GTO A;  1M9N A;  1M56 B;  3K79 A;  1QVF U;  3X2Q B;  3R65 A;  4LC1 A;  1PL0 A;  1KP2 A;  1W0K G;  3D36 A;  4J9Y B;  3K9A A;  1P7B A;  1K5S A;  2WWW A;  5LBQ A;  1V54 C;  3JD2 A;  1YI2 V;  1Q81 W;  4JPR A;  2XAF A;  3K03 A;  1RM1 C;  4F4L A;  5L3C A;  1GMG A;  1DF5 A;  4J9Z B;  1AI7 A;  1H8E G;  1JX9 A;  5HFL A;  3UKM A;  1H8H G;  1VQK V;  2IJK A;  1JJ2 U;  3QO7 A;  5L3D A;  4LCU C;  4N23 A;  1GM7 A;  3TET A;  1OHH G;  3JCZ A;  1THZ A;  4X88 A;  3ABM B;  2ITD C;  3D3I A;  3QO8 A;  4MTO A;  1YJW V;  2ATK C;  4HYO A;  2JEX A;  3SJQ C;  2OTJ V;  3CCS V;  1S3J A;  4L87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...