4X64O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x64O00
4LF4O 2VQFO 3T1YO 2UUCO 4JI0O 4DUYO 4OPHA 1HNWO 1IBKO 4DV6O 4B3SO 4GKJO 4OPAA 1XMOO 4OX9O 4DR4O 5LL6Y 3J80N 2Z0AA 2HHHO 4B3MO 2N74A 4DR1O 1IBMO 4KHPO 4LF7O 4DV1O 2FKXA 4GKKO 4DR6O 4DV2O 4LFBO 1I94O 4X66O 5LMNO 1XNQO 4LF8O 1XNRO 1D2DA 4DV7O 1N34O 3J7AU 4JYAO 4A5UB 1X59A 1HNXO 3OTOO 4JI2O 4JI4O 2DJVA 4DR5O 1N32O 5IT9N 4K0KO 1G1XB 4X65O 2DOSA 2VQEO 3R66A 4JI5O 1F7YA 4NXNO 1J5EO 5LMUO 4DR7O 2AGAA 4X64O 2JRIA 4JI8O 4JI3O 1R6TA 4JI7O 1XMQO 3J81N 2UXBO 4LF9O 1KUQA 3RT3C 5BY1A 4JI1O 1R1BA 4DR3O 1NS1A 4DUZO 4NXMO 4DV3O 2ZKOA 3M8AA 3O65A 4LFCO 1FYJA 1A32A 4DV0O 4DR2O 4LF6O 2UXCO 4DV5O 5FLXN 1DK1A 2UUBO 5A2QN 3T1HO 4YHHO 4LFAO 4AQYO 1HR0O 5BXZA 4YY3O 3JAMN 4B3RO 2LW7A 4X62O 5BR8O 1FKAO 2ZM6O 1YZBA 1AB3A 5IWAO 1XEQA 3F5TA 1N36O 1N33O 3SDLA 4JI6O 1AILA 2UU9O 2UUAO 2UXDO 1HNZO 5H5NA 1FJGO 2E5LO 4LF5O 4DV4O 4JV5O 4B3TO 1IBLO 2F4VO
chains in the Genus database with same CATH superfamily
2VQFO 1QCEA 2JGUA 4YIPA 1JR9A 3JATA 1Z5WA 3N27A 3SPCA 3RYFB 1R73A 2JIZG 3FB8C 4DRXA 2IBZH 5IY5C 1P84F 3D8CA 4GKKO 3HKEA 4I9WA 4O4JB 1BHAA 1H2LA 2Y0IA 2BOBC 5J9PC 1Y74A 2FYUH 4X1YB 5B1BC 4ASUG 2GSMB 2GTSA 1HNZB 2UXDB 2Z3YA 1FJGB 3CCQV 4MSWC 5IJ9A 4TT3G 3OW2U 3ZRWB 3T1YB 2QKAA 4IYHA 3DTUB 1MMMA 1TUEB 3AK2A 2JRIA 1TUBA 3WU2Z 1GTOA 5DEDA 3H1JH 2PY5A 3QVNA 1CPYA 3ABMC 4TQFA 5LMUB 2IU3A 4D6TH 3DC6A 3CMAV 1GAXA 2XOKG 2XTAA 4WCEV 4K8XA 4G2KA 5JCOA 4F4LA 1XNRB 3SPIA 3ABKC 2JJ1G 3AG4C 1TAEA 1SA0B 3JALA 1H2GA 3CJHA 1QVGU 4KL1A 2OCHA 2DQ0A 4GX1A 4NB5A 4J42A 2W6JG 1QHTA 3T4DA 5EYPB 1VF6C 3K5OA 4UCOA 5B5EZ 4WBNB 5H5NA 2F43G 1GN2A 2HVKC 1NVPD 4X88A 2GUZB 1MZFA 3IGAC 4Z1MG 3LDEA 1WAZA 2UUCO 5FPOA 4ZBMA 3CRMA 3TK1A 3ZN1A 1XDCA 2LW1A 2A0LA 1HP8A 3K9SA 4DR4O 3OEEG 2XNDG 5LL6Y 3ABLB 1V54B 3RYHA 1K33A 3HB3B 3WB2A 2WPDG 5CA0A 2R9RB 1K4DC 5IWAB 4X1IB 4X8AA 4JASA 1XI1A 4LF8O 1Z2GA 4PV1B 1XHZA 4JYAO 2EZPA 3SPGA 1S72V 3STLC 3QO5A 4CS3A 3JATB 3P3PA 4MW8A 2VQFB 3R66A 4F6RA 5JVDB 1GKFA 2FL4A 4CC6A 3VOUA 5B3SC 4X20A 2GV9A 4J7JA 4LF9O 2LO1A 3P32A 3JASA 1JQ0A 4NR1A 3AEIA 1RM1B 1DTOA 2Q9LA 4GKKB 4LWSA 2YS8A 3OD4A 1U96A 1MNGA 3CYOA 4TV8A 5IJ9B 4Q20A 2W0XA 2XAGA 2MK3A 1IURA 3QG5A 3BPZA 5L3EA 4GT1A 1QU7A 1TUBB 4YY3O 3G71V 3SR2C 2ZM6O 3WFVA 4I50A 1NR7A 2V1DA 4TV9A 3SYCA 2CTQA 2BCCH 1YVWA 4U3JB 3RN4A 1Q5OA 1W2BU 1QQCA 1YIJV 1WNSA 4O2BA 2Q0AA 2HP8A 3JALB 1N8RW 3CJHB 3KG2A 5LP6A 2LFSA 3N2GA 1LR1A 1BSMA 3DXRB 5KX5A 2Q68A 5CBGA 2E3CA 5KUMA 1IBMO 3E86A 4LNUA 3JD3A 4DR6O 3KCYA 2ARHA 5LMNO 1K34A 4CBCA 3CXCU 4I9QA 1UFIA 1I5XA 3JAKB 1S3JA 1S0VA 2PTMA 2ETNA 3KKYA 2Q4PA 2H94A 2YEVA 4O4HB 4FLVA 2UUCB 4UCSA 4QPKA 2P5OA 2VRZA 1G8MA 2CTPA 2LJ2A 3CRAA 2GTAA 1F7YA 3ZHQA 3RYHB 2BE3A 1OCZC 3ZHTA 1TVKA 4MVOA 5CA0B 4DR4B 4UXNA 2WLIB 2QWNB 5IJ0A 3TXQA 1H2MA 3FKSG 2OTJV 1PV0A 3W7SA 4DV0O 3CX5F 4LF8B 3JD0A 1VQ5V 5B66Z 3CP1A 4I4TA 1BHBA 2QA4V 2YXLA 4JYAB 3AG1B 3ICXA 4AQYO 1DF4A 1VQOV 3JD4A 2Q8VA 4LP8A 1JVMA 4JYYA 2ADQB 3HR0A 3JASB 3K5NA 4EFBA 4IT5A 5L3DA 3H1IH 3IFXA 2Y4TA 3NR7A 4LWSB 4IGGA 2DYSB 4TUYA 2LQTA 1FXKA 4FM0A 1TGOA 3S3WA 3K5MA 1S76D 2ITCC 1W0JG 5GTHZ 1HNWO 1BCCH 1IXBA 2E75B 3U0ZA 4ZHQB 1L0LH 4HNAA 1XMOO 5B1NA 4YY3B 2WAMA 4D7TA 4I50B 1QVFU 4TV9B 3G6BA 2EIMC 3ZN0A 3CD6V 5AG2A 2PF4E 2ZM6B 2VS0A 4KHPO 4JZ2A 1D5AA 1EZJA 5IDJA 4EB6B 1QNMA 4PDRA 4I0XA 4O2BB 4J9YB 4PA6A 3W7XA 1E1RG 5LP6B 3N2GB 1Q82W 5KX5B 4JAUA 1J5EO 5K1PA 3CPWU 4DR7O 1W59A 4RUEA 3FB5C 3AG3C 5FPRA 4J7ZA 1COWG 5EIBC 4FFBA 1IBMB 3ZX6A 5LGUA 4Q6GA 4EEQA 2JS3A 2L6LA 4DR6B 2ZDIA 3CC4V 1D5NA 3VQWA 5LMNB 2YIAA 3ASNC 4J10A 5B1AB 1YHQV 5FLXN 2P4VA 3BVOA 5BXZA 1FS0G 4HYOA 2Q69A 4N21A 1SQGA 1YZBA 4YXWG 2RMKB 2C2AA 5IJ0B 3ZHVA 2UUAO 3W7TA 3OEHG 1VQPV 1L0NH 4Z2WA 3GB7C 2IJJA 4DV0B 4UVAA 3D3QA 4WFBV 1WN7A 2OIEA 3HKBA 4QPJA 4AQYB 1QLEC 4ABMA 3K57A 4DR1O 1S5HC 1NBMG 1SZXA 5CMUA 1OCRB 1AI7A 3VQYA 4TUYB 5C93A 1VQKV 1VQ9V 4TWKA 2P4KA 3GVMA 1B04A 1ZL8A 5EBMC 4DR5O 2KKWA 4DV7B 4HNAB 4GZRB 5CA3A 1HNWB 5LHHA 5LMUO 4O4LB 4JI2B 4X1KA 3QTCA 2UXBO 1XMOB 1S77D 4KXRA 1H2KA 4FLTA 1XL6A 5BY1A 2EULA 1R1BA 4MW3A 4JI1O 2H8PC 1IZ3A 2LGWA 4NXMO 2QWOB 4I0XB 5LYJA 3O65A 3CCSV 4LFCO 2QE7G 4JTAB 2ADPA 1VQMV 3SYPA 3JAWA 5CB4A 4YHHO 3TJTA 3JD2A 2QWQB 3LUTB 1DF5A 1FKAO 1BT8A 2Q7EA 1J5EB 1ROPA 1P7BA 1N0NA 4DR7B 4FFBB 5LOVA 1Q3EA 3ZMZA 3L74H 1ENVA 3F5TA 2CDYA 1MG1A 1M9NA 1AVMA 3FD9A 3ABLC 1V54C 2NR5A 1SQBH 1KBHA 2F4VO 1VQNV 1FFTB 4P30A 4PD4F 1GM7A 1VQ7V 2V4DA 1YF2A 2CTRA 2JS5A 3QF7A 1M1KW 4DV6O 2YSUB 4HBNA 2Z0AA 2HHHO 2UXNA 3CCEV 1BMFG 4PDVA 3H9VA 3ZRVA 3R65A 2B1IA 1LNQA 4UB6Z 3ETQA 4G27B 3PN1A 1W0KG 4DV2O 3G67A 4B3MB 4ZIBA 1T5EA 1BZKA 2UUAB 3A0RA 1NI8A 3HKBB 3L9DA 4X89A 1PL0A 4WF9V 3AG7A 3L73H 4X64O 2B5UA 3DSQA 3WG7C 5ITZA 4DR1B 4R7CA 5TISZ 3K58A 1EN6A 4DK0A 1AR1B 4DR2O 1YXBA 3BFRA 4DV5O 5KLVH 2EIKC 3JYCA 2JEUA 1F4MA 3TCUA 2H3OA 2QEXV 4DR5B 1Z5VA 4FPPA 4X1KB 4OGQB 1BQ0A 3EHBB 1JFFA 1XEQA 2UXBB 4B3RB 1E1QG 1YSCA 4JI1B 1GN4A 2XAQA 1IDSA 1VQ6V 2ZE6A 4NXMB 3JAWB 5CB4B 2DWEC 4LF4O 4LFCB 3WB1A 4CH6A 2PI5A 1K5SA 4OPHA 3CHXA 4O4IA 2XT9A 4UCUA 4BW9A 4YHHB 2K9PA 1YDXA 3J80N 5LOVB 1HDJA 4PJ0Z 2JJ2G 4XDJA 4IIJA 1LUVA 3CSXA 4QE9A 2EIJB 1OCCB 1KMIZ 2HLDG 1AR4A 2OCCB 3HKDB 3ZHUA 3ZS8C 1D2DA 2FMLA 1QR8A 4P9OA 3H1LH 5J2TA 4K35A 3VQVA 2DJVA 4K0KO 2F4VB 2PI4A 3T2MA 4JI5O 3E22A 5FL7G 2CH7A 4PDMA 4DV6B 4FLUA 1R6TA 4JI7O 3BA8A 2HHHB 4UV8A 1WB8A 1VF6A 2X7RB 4IL6Z 2IM9A 4DR3O 2HEPA 1KP3A 3M8AA 4DV2B 3CCRV 2ODMA 2P06A 3RVZA 1E79G 2IH1C 4R50A 2ZT9B 1SRYA 4BW5A 4B7EA 4DRXB 4EFEA 2FB5A 4LFAO 1NVPB 3JD1A 2AHZA 4JTDB 3E2EA 5BR8O 1OZ0A 3HKEB 4X64B 3ZIAG 3ZHRA 1Y74B 5HFLA 3OMNB 4JPRA 4K8ZA 1SC5B 1AR5A 1TA8A 3PJSK 3RYIA 5J2UA 4L87A 4MVUA 3OM3B 4KFMA 1K92A 1KU9A 4DR2B 4JI0O 4DK1A 4AILC 4DV5B 1K9MW 2Q0OC 3SYQA 2Y69B 4IHJA 3BABA 5IY5B 1S5LZ 2EILC 4JYCA 1PP9H 4NYKA 5IYZA 4XDKA 4FIPC 5IYCO 1VIBA 1I94O 4G28B 2E74B 2HR3A 5K1XA 4O4IB 1L1FA 5L3FA 1XUQA 1N32O 1G1XB 1K3EA 2XAFA 1AP5A 1XNQB 4LF4B 4YJ3A 1JOYA 5JJEB 1K8AW 3G80A 3SPJA 4NXNO 1BS3A 1XL4A 2AGAA 5B1AC 1Y76A 4JI8O 2IU0A 4IIJB 3ABMB 2WA3A 5IYBO 4P2ZA 1R3JC 4O2AA 1I7FA 2P22C 3C3TA 1Q6HA 3K5LA 4P9PA 2BTOA 2ZKOA 1NZ6A 1YJWV 1YITV 1SETA 5J2TB 3SGIA 3ABKB 3UCSC 3K0GA 2UUBO 2HKOA 3TGUH 3G6EV 1ZLZA 3ML0A 3T1HO 1VQ8V 2CH7B 1M57C 1ZWIC 1MOFA 5KHGA 2XASA 4K0KB 1NR1A 2ZNIA 1M5IA 1PM9A 4JI5B 3UT5A 1OHHG 3QO7A 2RNBA 5B1OA 3OE7G 4K3AA 3H1KH 1Q6IA 4JI7B 1WLEA 4L8JA 3KCXA 3K0DA 1CP9A 3F7YC 5LGNA 1NKDA 1KECA 1P7GA 3K04A 4DR3B 3OGCC 3CCMV 4F6RB 3BA9A 3E35A 3FB7C 4X20B 3BEHA 2B9ZA 1BGYH 2RJZA 3GWOA 2ZR3A 2EINC 4LFAB 4FM2A 2JGDA 4CC5A 5BR8B 4YJ2A 3RYIB 4TV8B 1XREA 3FAVA 4QJFB 2DWDC 3I56V 3TXSA 2X6CA 1WP8A 2YIDA 2WSSG 1PKXA 4DV7O 5KHKA 2HFEC 1EN4A 3TETA 5H6RA 2XUMA 4JI2O 4JI4O 4Z1VA 2ZXWB 3OMIB 4B7KA 1H38A 2YICA 2QDOA 2X6AA 3MD0A 4MVZA 5B3SB 4JI0B 4D7SA 2DE0X 1UPGA 2DYRB 3T1CA 2XAJA 1NQTA 2BOCC 5E79Z 4E2LA 2CK3G 4DYLA 4UCRA 3B4SA 5GW7A 5CA1A 2HJDA 4JZGA 1R6NA 1FXHA 3ETEA 1YTFD 3APQA 3B2EE 5GONA 1I94B 2PGGA 4YIOA 5LHIA 2QJ1A 2ZDIC 4BIZA 5JWPA 1KB9F 1Y76B 4LNUB 4BWAA 1N32B 2WLJA 1GN3A 2QM7A 2P6JA 4E4EA 3D36C 1Q8IA 4O2AB 4NXNB 4KP4A 2AZ0A 4JI8B 3AG2C 1WPXA 2Q67A 1KKDA 3WB0A 1N33O 1O9HA 1PL4A 1I08A 3SDLA 2KB1A 2N04A 2YEVB 3IC9A 5JJNB 3ABUA 4I55A 1JCHA 1TVKB 4C7UA 2UUBB 3B8MA 5GTIZ 3T1HB 3N2KA 4OPAA 3OUSA 1YTFB 2DQ3A 1GM8A 3U10A 5BMVA 4B3MO 4MTXA 3SYOA 2OIGA 1GH6A 3ABTA 4EKWA 1Q86W 4AHCA 2LGQA 1K7DA 1SQFA 1WP7A 3EXAA 3HPLC 4I4TB 3FYEB 2KG7A 4UFZA 3MDSA 1THZA 3ASOB 2CE4A 1EM1A 4WFAV 1KP2A 1MSDA 3QO8A 1SF9A 1SKVA 2QWRB 1H2SB 1OCZB 4H44B 5H9CA 2JGDB 4FVMA 5LXTA 4JI3O 2R72A 3F7VC 2X6BA 1MSWD 4MTFA 4BR6A 3FAVB 1FXKB 1YCIA 3A8TA 3AK1A 1KUQA 2XHBA 3RYFA 3UM7A 3W7WA 3K3WA 2QSAA 3D3IA 4LF6O 3CC7V 3SJQC 5EK0A 2DMXA 4H13B 1YJNV 3ZMTA 4JI4B 3BCCH 4H33A 4X1YA 4B3RO 3FX7A 2PYJA 1AJNA 2CUGA 2IJKA 2VWKA 2X0LA 3RYCA 2F66C 2ZNJA 3JCZA 1F4NA 4PELA 3JSLA 2Q7GA 1N36O 1Q43A 4N23A 4GX0A 3LDCA 5GONB 1UJWB 2GDSA 2ZE7A 1NJIW 4JI6O 1MABG 5EBWC 2M7WA 1N0JA 4B3TO 4XDLA 2Q5ZA 5EIBD 4W4LA 4R6ZA 4DO2A 1URFA 5C8YA 4CH5A 4FJCC 3T4ZA 4ZKIA 3K08A 1SESA 2A79B 3P30A 5DN6G 4B3SO 4JV5B 4QE7A 4FZ1A 2P67A 4UVCA 1Y6XA 3I55V 3H1HH 1RP3B 1N33B 5IE9A 4U7NA 4HAMA 1QLNA 1V9PA 4I55B 2WLLA 1BE3H 3J7AU 1B3QA 3OR7C 3K03A 1HNXO 1CXZB 1NU1H 4WBNA 5IT9N 2HJFC 1Q6UA 2DOSA 3ZBHA 2VQEO 3RBZA 1ZUQA 3E83A 5BMVB 1WPBA 4MT8A 3OTOB 1XMQO 2AZ2A 4CS2A 2JVDA 2PYLA 3MAQA 4BAYA 3LNNA 4FLYA 3HKCA 4WFHA 5KA5A 5EZYA 3ASNB 1RM1C 3A0BZ 3K9AA 1GO3F 2NLJC 3KZIZ 2UXCO 1DK1A 1QBZA 1Y66A 4U3FH 1OCOB 3CCJV 1O9GA 4JF3A 5LXTB 5KUKA 4FK5C 2R70A 4PA9A 1BL8A 4X62O 2P90A 1V55B 5CBFA 3CRQA 2Q6AA 1WA8A 3THOA 1YEWA 1IXMA 4JI3B 4DW0A 5JVDA 4QGPA 2Y69C 1ZL8B 4I7ZB 1AILA 1EBOA 2UU9O 2XAHA 4LF5O 5JCOC 1XILA 3L70H 1AI6A 4BIOA 1GMGA 3L72H 1H8HG 4LF6B 3SJCC 5LGTA 1JX9A 5A9GA 1IBKO 3X2QB 5LA6A 1K4CC 1AI4A 1QLEB 1GN6A 2CTWA 2WLKA 2AHYA 3FB6C 3MHSC 1F51A 3RYCB 4GYCB 1EZVH 2ITDC 2N74A 5LYJB 5D5QA 2F23A 3CB2A 1VF7A 3L71H 4UUJC 4JTCB 4PA4A 5DECA 1CEZA 4RO2A 1N36B 1XNQO 3E8GA 4FLXA 1R3KC 5C8YB 4JI6B 1JA8A 1FXVA 3ZMUA 5H6QA 2BTQA 1M93A 1GRJA 4B3TB 2ILMA 2GHYA 3JCUZ 5KHJA 3RW0A 1F23A 3CXHF 3B40A 3UKMA 4U3JA 1VQLV 2QR4A 4B3SB 4FM1A 2GBOA 4LCUC 2OT5A 3J81N 4FFKA 1NTZH 1M56B 2CAZC 4DW1A 1B6QA 4RUFA 3B8NA 3DXRA 3E8HA 2B1GA 2WLLB 1G4YB 1VQ4V 4MVQA 2WWWA 4J7KA 1XHXA 4J9ZB 1Q7YW 2V7QG 1DGSA 1ZSPA 2LP7A 1HNXB 2WLNA 4NVPA 1FFXA 4PA7A 5KMGA 3AG1C 2VQEB 1M90W 3BHPA 3C90A 3JAKA 2EJRA 1K97A 1R6KA 4KUMA 4JAVA 1KKCA 5JJJB 4I5SA 4O4HA 3K59A 4NTYA 3HKCB 4LH6A 3O9OA 1XMQB 3ETGA 2BSKA 5EZYB 3BY6A 1ORQC 3SYAA 3ZEDA 4XBFA 1G6UA 2HVJC 2DYSC 2WLIA 1KD1W 1IBLO 5KA6A 3UO3A 5ITZB 3K06A 2UXCB 4U7OA 3OT7A 3CMEV 3LSUA 2NNUA 2O57A 4DV4B 4GKJO 2A7WA 4X9QA 1WA8B 1SQVH 4RQFA 4IYIA 5BZBA 2ZXWC 4X62B 4UV9A 2MW2B 5L3BA 4CH4A 3I5DA 3U11A 4WFFA 5KHIA 3VQXA 4LFBO 3SJBC 2DYRC 2QM8A 3SJAC 3LSQA 2UU9B 2EJ7A 4LH7A 1N34O 2QKSA 4LF5B 2R9IA 3CRRA 3QNEA 5LBQA 2Y48A 5LA6B 3DGEA 1I0HA 1AJQA 1JFFB 3CCVV 5LP6C 1IBKB 3WG7B 3E8BA 4LBEC 1VP7A 1NTMH 1AROP 3EVKA 4TQDA 2A3QA 5B1BB 5KAIZ 4ZHQA 3FFQA 4GLXA 1YJ9V 3RT3C 2HG5C 1DLBA 4CS4A 1NS1A 4FLZA 5E1AC 1JJ2U 4UVBA 2BTQB 2EIKB 1X4TA 1L8DA 2RDCA 5A2QN 4EB6A 4JGSA 1R3IC 4QIWF 1PNKA 5HFMA 1JPXA 4R8CA 3ZMVA 2ATKC 5D5PA 3CRCA 3FYIB 2QWPB 2ZINA 3SPHA 3OFNG 1S5JA 3K79A 3M7MX 5CBHA 1EFRG 2R9AA 2Z5UA 4GCZA 4ZI7A 5JH7A 4MTGA 2YDEA 1U97A 3AG4B 2OWOA 1PNMA 5JQGA 3E22B 3IAYA 1AJPA 3VBBA 1HWYA 4J41A 1FFXB 1VARA 3ETDA 5KMGB 4WFGA 2YC0A 3ASOC 3CEIA 4OX9O 4TSFG 2L35A 3RWRD 2BSKB 5DM6V 3OGIB 4RAIA 4LF7O 4DV1O 1Y67A 1YI2V 5FNVA 1FPOA 1KQSU 1OCRC 2ZR2A 1SZTA 2A9HA 2JK5C 3H01A 1B06A 2M6YA 4X66O 1KYOF 4F6EA 1FXKC 4PA3A 1FD9A 1SQXH 1PNLA 4MS2A 4A5UB 3EFFK 2QGNA 3AK3A 1RSOA 4MTOA 4BIUA 1IBLB 2OTLV 4X65O 3ZCCA 2YXHA 1JJOA 2QM4A 2Q73A 3A0HZ 3B09A 3M99B 2CGNA 3DC5A 4GKJB 5J2UB 1R3LC 3BRCA 3CC2V 3E8FA 2QKCA 2DN9A 3B77A 2RQ6A 4HZ3A 4DXWA 4CH3A 1P4RA 1Q81W 1NTKH 2F1MA 4LFBB 2K1EA 1XQ8A 2OYQA 4LF9B 4IHJB 2ZCEA 5H2FZ 1N34B 3OMAB 3OAAG 2VWJA 1WJZA 3LSSA 2DW4A 1HR0O 3LDDA 3JAMN 2CGOA 5L3GA 5IYZB 3OTFA 1PPJH 2RN9A 1BQZA 2ZE5A 3C3SA 4TOIA 1IX9A 3APOA 1KC8W 1H8EG 1NT2B 3E89A 2Y4UA 2ZIMA 4O4LA 5CN0A 3F5WC 3RVYA 4ZOLA 2E5LO 4YJ3B 4JV5O 4UB8Z 4UCTA 3BAAA 4NTXA 2ZD9A 3Q4HA 4DUYO 4GUNA 4MVMA 2D3OW 2WLHA 1Y4MA 1PD3A 3L75H 2EILB 4ZI7B 5JH7B 2LFRA 1QR9A 1AI5A 2ZQMA 3ZHSA 3P3NA 4RQEA 5IYDO 5JQGB 4NTWA 2F93B 3CE2A 1SS3A 2AW9A 1VEWA 2G38A 2JDIG 3UT5B 2YIBA 3OTOO 1WB7A 3CS5A 2F95B 1K5QA 3RGBA 2W0FC 3D36A 1MZEA 4W4KA 1IVSA 3CCLV 3JARA 3IC7A 2YI9A 1OCOC 4OX9B 5FNVB 2N05A 4JYBA 4PHZA 2Y0PA 1SERA 1V55C 4B08A 4DUZO 4LF7B 4DV1B 4DV3O 3ZRSA 4AI8A 1FYJA 1A32A 2IJIA 4X66B 1RSOB 3GWKC 1RPRA 2YXYA 2Q7HA 4FMTA 3ZMSA 1M57B 2IH3C 4YJ2B 5EBLC 1ZX3A 5KAFZ 4X65B 1MA1A 2LW7A 2ZE8A 4H0LB 1AB3A 1GM9A 4NKGB 3X2QC 1AP6A 1ZTEA 2E76B 2A06H 3JSNA 2UXDO 1HNZO 2AXTZ 4RWUA 1FJGO 2EBOA 3UO2A 4FLWA 4O4JA 2KSDA 1EN5A 1HW7A 1K73W 3T1YO 2YUAA 2IJHA 2W6IG 1SQQH 4LR3A 5EC1C 2EINB 1RFYA 4LC1A 3G4SV 3ZRWA 5CA1B 1HR0B 1XBLA 2YIBD 1JMKC 3NXSA 3STZC 1VMGA 2YI8A 1NH2D 4MVSA 3ZJZA 2WLMA 2FKXA 4WFEA 4H37A 4ZOLB 2EIJC 1OCCC 2EX3A 4OXSA 2OCCC 1XNRO 4PDLA 2UXXA 3CCUV 4KHPB 1M56C 1M4UA 3Q4HB 3ZRXA 2E5LB 3W7UA 1X59A 2EIMB 3IJ4A 3CWBH 2EZOA 4DUYB 3OR6C 1SA0A 2NN4A 1P49A 1XOUA 3A2FA 4QNHB 4PI2A 4GX5A 4J11A 1J95A 1Q90D 2QTSA 5EYPA 3OUFA 4ICGA 1US6A 1FAFA 5EC2C 5LHGA 2PZSA 2KQXA 3N2KB 1OV9A 1NH2B 4GX2A 2GUZA 2P7TC 3AG3B 3HKDA 2JEXA 3RFRA 1LUWA 2RCVA 1H2NA 3LNMB 3JARB 2FTKA 5KHHA 3AG2B 5L3CA 4JAAA 1RPOA 2KG7B 1SQPH 1OJHA 1GK9A 3MHHC 5IWAO 1VF5B 4PI0A 1I5YA 5F2VO 4UCVA 1N4CA 4MVRA 4FZ0A 2QTOA 2IW5A 2PUSA 2D2CB 4X1IA 4DV4O 4DUZB 3S3XA 4DV3B 4CZZA 3UQ8A 2WA4A 1ZAUA 4J80A 2ZIOA
chains in the Genus database with same CATH topology
4LF4O 2VQFO 3T1YO 2UUCO 4JI0O 4DUYO 4OPHA 1HNWO 1IBKO 4DV6O 4B3SO 4GKJO 4OPAA 1XMOO 4OX9O 4DR4O 5LL6Y 3J80N 2Z0AA 2HHHO 4B3MO 2N74A 4DR1O 1IBMO 4KHPO 4LF7O 4DV1O 2FKXA 4GKKO 4DR6O 4DV2O 4LFBO 1I94O 4X66O 5LMNO 1XNQO 4LF8O 1XNRO 1D2DA 4DV7O 1N34O 3J7AU 4JYAO 4A5UB 1X59A 1HNXO 3OTOO 4JI2O 4JI4O 2DJVA 4DR5O 1N32O 5IT9N 4K0KO 1G1XB 4X65O 2DOSA 2VQEO 3R66A 4JI5O 1F7YA 4NXNO 1J5EO 5LMUO 4DR7O 2AGAA 4X64O 2JRIA 4JI8O 4JI3O 1R6TA 4JI7O 1XMQO 3J81N 2UXBO 4LF9O 1KUQA 3RT3C 5BY1A 4JI1O 1R1BA 4DR3O 1NS1A 4DUZO 4NXMO 4DV3O 2ZKOA 3M8AA 3O65A 4LFCO 1FYJA 1A32A 4DV0O 4DR2O 4LF6O 2UXCO 4DV5O 5FLXN 1DK1A 2UUBO 5A2QN 3T1HO 4YHHO 4LFAO 4AQYO 1HR0O 5BXZA 4YY3O 3JAMN 4B3RO 2LW7A 4X62O 5BR8O 1FKAO 2ZM6O 1YZBA 1AB3A 5IWAO 1XEQA 3F5TA 1N36O 1N33O 3SDLA 4JI6O 1AILA 2UU9O 2UUAO 2UXDO 1HNZO 5H5NA 1FJGO 2E5LO 4LF5O 4DV4O 4JV5O 4B3TO 1IBLO 2F4VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  2VQF O;  3T1Y O;  2UUC O;  4JI0 O;  4DUY O;  4OPH A;  1HNW O;  1IBK O;  4DV6 O;  4B3S O;  4GKJ O;  4OPA A;  1XMO O;  4OX9 O;  4DR4 O;  5LL6 Y;  3J80 N;  2Z0A A;  2HHH O;  4B3M O;  2N74 A;  4DR1 O;  1IBM O;  4KHP O;  4LF7 O;  4DV1 O;  2FKX A;  4GKK O;  4DR6 O;  4DV2 O;  4LFB O;  1I94 O;  4X66 O;  5LMN O;  1XNQ O;  4LF8 O;  1XNR O;  1D2D A;  4DV7 O;  1N34 O;  3J7A U;  4JYA O;  4A5U B;  1X59 A;  1HNX O;  3OTO O;  4JI2 O;  4JI4 O;  2DJV A;  4DR5 O;  1N32 O;  5IT9 N;  4K0K O;  1G1X B;  4X65 O;  2DOS A;  2VQE O;  3R66 A;  4JI5 O;  1F7Y A;  4NXN O;  1J5E O;  5LMU O;  4DR7 O;  2AGA A;  4X64 O;  2JRI A;  4JI8 O;  4JI3 O;  1R6T A;  4JI7 O;  1XMQ O;  3J81 N;  2UXB O;  4LF9 O;  1KUQ A;  3RT3 C;  5BY1 A;  4JI1 O;  1R1B A;  4DR3 O;  1NS1 A;  4DUZ O;  4NXM O;  4DV3 O;  2ZKO A;  3M8A A;  3O65 A;  4LFC O;  1FYJ A;  1A32 A;  4DV0 O;  4DR2 O;  4LF6 O;  2UXC O;  4DV5 O;  5FLX N;  1DK1 A;  2UUB O;  5A2Q N;  3T1H O;  4YHH O;  4LFA O;  4AQY O;  1HR0 O;  5BXZ A;  4YY3 O;  3JAM N;  4B3R O;  2LW7 A;  4X62 O;  5BR8 O;  1FKA O;  2ZM6 O;  1YZB A;  1AB3 A;  5IWA O;  1XEQ A;  3F5T A;  1N36 O;  1N33 O;  3SDL A;  4JI6 O;  1AIL A;  2UU9 O;  2UUA O;  2UXD O;  1HNZ O;  5H5N A;  1FJG O;  2E5L O;  4LF5 O;  4DV4 O;  4JV5 O;  4B3T O;  1IBL O;  2F4V O; 
#chains in the Genus database with same CATH topology
 2VQF O;  1QCE A;  2JGU A;  4YIP A;  1JR9 A;  3JAT A;  1Z5W A;  3N27 A;  3SPC A;  3RYF B;  1R73 A;  2JIZ G;  3FB8 C;  4DRX A;  2IBZ H;  5IY5 C;  1P84 F;  3D8C A;  4GKK O;  3HKE A;  4I9W A;  4O4J B;  1BHA A;  1H2L A;  2Y0I A;  2BOB C;  5J9P C;  1Y74 A;  2FYU H;  4X1Y B;  5B1B C;  4ASU G;  2GSM B;  2GTS A;  1HNZ B;  2UXD B;  2Z3Y A;  1FJG B;  3CCQ V;  4MSW C;  5IJ9 A;  4TT3 G;  3OW2 U;  3ZRW B;  3T1Y B;  2QKA A;  4IYH A;  3DTU B;  1MMM A;  1TUE B;  3AK2 A;  2JRI A;  1TUB A;  3WU2 Z;  1GTO A;  5DED A;  3H1J H;  2PY5 A;  3QVN A;  1CPY A;  3ABM C;  4TQF A;  5LMU B;  2IU3 A;  4D6T H;  3DC6 A;  3CMA V;  1GAX A;  2XOK G;  2XTA A;  4WCE V;  4K8X A;  4G2K A;  5JCO A;  4F4L A;  1XNR B;  3SPI A;  3ABK C;  2JJ1 G;  3AG4 C;  1TAE A;  1SA0 B;  3JAL A;  1H2G A;  3CJH A;  1QVG U;  4KL1 A;  2OCH A;  2DQ0 A;  4GX1 A;  4NB5 A;  4J42 A;  2W6J G;  1QHT A;  3T4D A;  5EYP B;  1VF6 C;  3K5O A;  4UCO A;  5B5E Z;  4WBN B;  5H5N A;  2F43 G;  1GN2 A;  2HVK C;  1NVP D;  4X88 A;  2GUZ B;  1MZF A;  3IGA C;  4Z1M G;  3LDE A;  1WAZ A;  2UUC O;  5FPO A;  4ZBM A;  3CRM A;  3TK1 A;  3ZN1 A;  1XDC A;  2LW1 A;  2A0L A;  1HP8 A;  3K9S A;  4DR4 O;  3OEE G;  2XND G;  5LL6 Y;  3ABL B;  1V54 B;  3RYH A;  1K33 A;  3HB3 B;  3WB2 A;  2WPD G;  5CA0 A;  2R9R B;  1K4D C;  5IWA B;  4X1I B;  4X8A A;  4JAS A;  1XI1 A;  4LF8 O;  1Z2G A;  4PV1 B;  1XHZ A;  4JYA O;  2EZP A;  3SPG A;  1S72 V;  3STL C;  3QO5 A;  4CS3 A;  3JAT B;  3P3P A;  4MW8 A;  2VQF B;  3R66 A;  4F6R A;  5JVD B;  1GKF A;  2FL4 A;  4CC6 A;  3VOU A;  5B3S C;  4X20 A;  2GV9 A;  4J7J A;  4LF9 O;  2LO1 A;  3P32 A;  3JAS A;  1JQ0 A;  4NR1 A;  3AEI A;  1RM1 B;  1DTO A;  2Q9L A;  4GKK B;  4LWS A;  2YS8 A;  3OD4 A;  1U96 A;  1MNG A;  3CYO A;  4TV8 A;  5IJ9 B;  4Q20 A;  2W0X A;  2XAG A;  2MK3 A;  1IUR A;  3QG5 A;  3BPZ A;  5L3E A;  4GT1 A;  1QU7 A;  1TUB B;  4YY3 O;  3G71 V;  3SR2 C;  2ZM6 O;  3WFV A;  4I50 A;  1NR7 A;  2V1D A;  4TV9 A;  3SYC A;  2CTQ A;  2BCC H;  1YVW A;  4U3J B;  3RN4 A;  1Q5O A;  1W2B U;  1QQC A;  1YIJ V;  1WNS A;  4O2B A;  2Q0A A;  2HP8 A;  3JAL B;  1N8R W;  3CJH B;  3KG2 A;  5LP6 A;  2LFS A;  3N2G A;  1LR1 A;  1BSM A;  3DXR B;  5KX5 A;  2Q68 A;  5CBG A;  2E3C A;  5KUM A;  1IBM O;  3E86 A;  4LNU A;  3JD3 A;  4DR6 O;  3KCY A;  2ARH A;  5LMN O;  1K34 A;  4CBC A;  3CXC U;  4I9Q A;  1UFI A;  1I5X A;  3JAK B;  1S3J A;  1S0V A;  2PTM A;  2ETN A;  3KKY A;  2Q4P A;  2H94 A;  2YEV A;  4O4H B;  4FLV A;  2UUC B;  4UCS A;  4QPK A;  2P5O A;  2VRZ A;  1G8M A;  2CTP A;  2LJ2 A;  3CRA A;  2GTA A;  1F7Y A;  3ZHQ A;  3RYH B;  2BE3 A;  1OCZ C;  3ZHT A;  1TVK A;  4MVO A;  5CA0 B;  4DR4 B;  4UXN A;  2WLI B;  2QWN B;  5IJ0 A;  3TXQ A;  1H2M A;  3FKS G;  2OTJ V;  1PV0 A;  3W7S A;  4DV0 O;  3CX5 F;  4LF8 B;  3JD0 A;  1VQ5 V;  5B66 Z;  3CP1 A;  4I4T A;  1BHB A;  2QA4 V;  2YXL A;  4JYA B;  3AG1 B;  3ICX A;  4AQY O;  1DF4 A;  1VQO V;  3JD4 A;  2Q8V A;  4LP8 A;  1JVM A;  4JYY A;  2ADQ B;  3HR0 A;  3JAS B;  3K5N A;  4EFB A;  4IT5 A;  5L3D A;  3H1I H;  3IFX A;  2Y4T A;  3NR7 A;  4LWS B;  4IGG A;  2DYS B;  4TUY A;  2LQT A;  1FXK A;  4FM0 A;  1TGO A;  3S3W A;  3K5M A;  1S76 D;  2ITC C;  1W0J G;  5GTH Z;  1HNW O;  1BCC H;  1IXB A;  2E75 B;  3U0Z A;  4ZHQ B;  1L0L H;  4HNA A;  1XMO O;  5B1N A;  4YY3 B;  2WAM A;  4D7T A;  4I50 B;  1QVF U;  4TV9 B;  3G6B A;  2EIM C;  3ZN0 A;  3CD6 V;  5AG2 A;  2PF4 E;  2ZM6 B;  2VS0 A;  4KHP O;  4JZ2 A;  1D5A A;  1EZJ A;  5IDJ A;  4EB6 B;  1QNM A;  4PDR A;  4I0X A;  4O2B B;  4J9Y B;  4PA6 A;  3W7X A;  1E1R G;  5LP6 B;  3N2G B;  1Q82 W;  5KX5 B;  4JAU A;  1J5E O;  5K1P A;  3CPW U;  4DR7 O;  1W59 A;  4RUE A;  3FB5 C;  3AG3 C;  5FPR A;  4J7Z A;  1COW G;  5EIB C;  4FFB A;  1IBM B;  3ZX6 A;  5LGU A;  4Q6G A;  4EEQ A;  2JS3 A;  2L6L A;  4DR6 B;  2ZDI A;  3CC4 V;  1D5N A;  3VQW A;  5LMN B;  2YIA A;  3ASN C;  4J10 A;  5B1A B;  1YHQ V;  5FLX N;  2P4V A;  3BVO A;  5BXZ A;  1FS0 G;  4HYO A;  2Q69 A;  4N21 A;  1SQG A;  1YZB A;  4YXW G;  2RMK B;  2C2A A;  5IJ0 B;  3ZHV A;  2UUA O;  3W7T A;  3OEH G;  1VQP V;  1L0N H;  4Z2W A;  3GB7 C;  2IJJ A;  4DV0 B;  4UVA A;  3D3Q A;  4WFB V;  1WN7 A;  2OIE A;  3HKB A;  4QPJ A;  4AQY B;  1QLE C;  4ABM A;  3K57 A;  4DR1 O;  1S5H C;  1NBM G;  1SZX A;  5CMU A;  1OCR B;  1AI7 A;  3VQY A;  4TUY B;  5C93 A;  1VQK V;  1VQ9 V;  4TWK A;  2P4K A;  3GVM A;  1B04 A;  1ZL8 A;  5EBM C;  4DR5 O;  2KKW A;  4DV7 B;  4HNA B;  4GZR B;  5CA3 A;  1HNW B;  5LHH A;  5LMU O;  4O4L B;  4JI2 B;  4X1K A;  3QTC A;  2UXB O;  1XMO B;  1S77 D;  4KXR A;  1H2K A;  4FLT A;  1XL6 A;  5BY1 A;  2EUL A;  1R1B A;  4MW3 A;  4JI1 O;  2H8P C;  1IZ3 A;  2LGW A;  4NXM O;  2QWO B;  4I0X B;  5LYJ A;  3O65 A;  3CCS V;  4LFC O;  2QE7 G;  4JTA B;  2ADP A;  1VQM V;  3SYP A;  3JAW A;  5CB4 A;  4YHH O;  3TJT A;  3JD2 A;  2QWQ B;  3LUT B;  1DF5 A;  1FKA O;  1BT8 A;  2Q7E A;  1J5E B;  1ROP A;  1P7B A;  1N0N A;  4DR7 B;  4FFB B;  5LOV A;  1Q3E A;  3ZMZ A;  3L74 H;  1ENV A;  3F5T A;  2CDY A;  1MG1 A;  1M9N A;  1AVM A;  3FD9 A;  3ABL C;  1V54 C;  2NR5 A;  1SQB H;  1KBH A;  2F4V O;  1VQN V;  1FFT B;  4P30 A;  4PD4 F;  1GM7 A;  1VQ7 V;  2V4D A;  1YF2 A;  2CTR A;  2JS5 A;  3QF7 A;  1M1K W;  4DV6 O;  2YSU B;  4HBN A;  2Z0A A;  2HHH O;  2UXN A;  3CCE V;  1BMF G;  4PDV A;  3H9V A;  3ZRV A;  3R65 A;  2B1I A;  1LNQ A;  4UB6 Z;  3ETQ A;  4G27 B;  3PN1 A;  1W0K G;  4DV2 O;  3G67 A;  4B3M B;  4ZIB A;  1T5E A;  1BZK A;  2UUA B;  3A0R A;  1NI8 A;  3HKB B;  3L9D A;  4X89 A;  1PL0 A;  4WF9 V;  3AG7 A;  3L73 H;  4X64 O;  2B5U A;  3DSQ A;  3WG7 C;  5ITZ A;  4DR1 B;  4R7C A;  5TIS Z;  3K58 A;  1EN6 A;  4DK0 A;  1AR1 B;  4DR2 O;  1YXB A;  3BFR A;  4DV5 O;  5KLV H;  2EIK C;  3JYC A;  2JEU A;  1F4M A;  3TCU A;  2H3O A;  2QEX V;  4DR5 B;  1Z5V A;  4FPP A;  4X1K B;  4OGQ B;  1BQ0 A;  3EHB B;  1JFF A;  1XEQ A;  2UXB B;  4B3R B;  1E1Q G;  1YSC A;  4JI1 B;  1GN4 A;  2XAQ A;  1IDS A;  1VQ6 V;  2ZE6 A;  4NXM B;  3JAW B;  5CB4 B;  2DWE C;  4LF4 O;  4LFC B;  3WB1 A;  4CH6 A;  2PI5 A;  1K5S A;  4OPH A;  3CHX A;  4O4I A;  2XT9 A;  4UCU A;  4BW9 A;  4YHH B;  2K9P A;  1YDX A;  3J80 N;  5LOV B;  1HDJ A;  4PJ0 Z;  2JJ2 G;  4XDJ A;  4IIJ A;  1LUV A;  3CSX A;  4QE9 A;  2EIJ B;  1OCC B;  1KMI Z;  2HLD G;  1AR4 A;  2OCC B;  3HKD B;  3ZHU A;  3ZS8 C;  1D2D A;  2FML A;  1QR8 A;  4P9O A;  3H1L H;  5J2T A;  4K35 A;  3VQV A;  2DJV A;  4K0K O;  2F4V B;  2PI4 A;  3T2M A;  4JI5 O;  3E22 A;  5FL7 G;  2CH7 A;  4PDM A;  4DV6 B;  4FLU A;  1R6T A;  4JI7 O;  3BA8 A;  2HHH B;  4UV8 A;  1WB8 A;  1VF6 A;  2X7R B;  4IL6 Z;  2IM9 A;  4DR3 O;  2HEP A;  1KP3 A;  3M8A A;  4DV2 B;  3CCR V;  2ODM A;  2P06 A;  3RVZ A;  1E79 G;  2IH1 C;  4R50 A;  2ZT9 B;  1SRY A;  4BW5 A;  4B7E A;  4DRX B;  4EFE A;  2FB5 A;  4LFA O;  1NVP B;  3JD1 A;  2AHZ A;  4JTD B;  3E2E A;  5BR8 O;  1OZ0 A;  3HKE B;  4X64 B;  3ZIA G;  3ZHR A;  1Y74 B;  5HFL A;  3OMN B;  4JPR A;  4K8Z A;  1SC5 B;  1AR5 A;  1TA8 A;  3PJS K;  3RYI A;  5J2U A;  4L87 A;  4MVU A;  3OM3 B;  4KFM A;  1K92 A;  1KU9 A;  4DR2 B;  4JI0 O;  4DK1 A;  4AIL C;  4DV5 B;  1K9M W;  2Q0O C;  3SYQ A;  2Y69 B;  4IHJ A;  3BAB A;  5IY5 B;  1S5L Z;  2EIL C;  4JYC A;  1PP9 H;  4NYK A;  5IYZ A;  4XDK A;  4FIP C;  5IYC O;  1VIB A;  1I94 O;  4G28 B;  2E74 B;  2HR3 A;  5K1X A;  4O4I B;  1L1F A;  5L3F A;  1XUQ A;  1N32 O;  1G1X B;  1K3E A;  2XAF A;  1AP5 A;  1XNQ B;  4LF4 B;  4YJ3 A;  1JOY A;  5JJE B;  1K8A W;  3G80 A;  3SPJ A;  4NXN O;  1BS3 A;  1XL4 A;  2AGA A;  5B1A C;  1Y76 A;  4JI8 O;  2IU0 A;  4IIJ B;  3ABM B;  2WA3 A;  5IYB O;  4P2Z A;  1R3J C;  4O2A A;  1I7F A;  2P22 C;  3C3T A;  1Q6H A;  3K5L A;  4P9P A;  2BTO A;  2ZKO A;  1NZ6 A;  1YJW V;  1YIT V;  1SET A;  5J2T B;  3SGI A;  3ABK B;  3UCS C;  3K0G A;  2UUB O;  2HKO A;  3TGU H;  3G6E V;  1ZLZ A;  3ML0 A;  3T1H O;  1VQ8 V;  2CH7 B;  1M57 C;  1ZWI C;  1MOF A;  5KHG A;  2XAS A;  4K0K B;  1NR1 A;  2ZNI A;  1M5I A;  1PM9 A;  4JI5 B;  3UT5 A;  1OHH G;  3QO7 A;  2RNB A;  5B1O A;  3OE7 G;  4K3A A;  3H1K H;  1Q6I A;  4JI7 B;  1WLE A;  4L8J A;  3KCX A;  3K0D A;  1CP9 A;  3F7Y C;  5LGN A;  1NKD A;  1KEC A;  1P7G A;  3K04 A;  4DR3 B;  3OGC C;  3CCM V;  4F6R B;  3BA9 A;  3E35 A;  3FB7 C;  4X20 B;  3BEH A;  2B9Z A;  1BGY H;  2RJZ A;  3GWO A;  2ZR3 A;  2EIN C;  4LFA B;  4FM2 A;  2JGD A;  4CC5 A;  5BR8 B;  4YJ2 A;  3RYI B;  4TV8 B;  1XRE A;  3FAV A;  4QJF B;  2DWD C;  3I56 V;  3TXS A;  2X6C A;  1WP8 A;  2YID A;  2WSS G;  1PKX A;  4DV7 O;  5KHK A;  2HFE C;  1EN4 A;  3TET A;  5H6R A;  2XUM A;  4JI2 O;  4JI4 O;  4Z1V A;  2ZXW B;  3OMI B;  4B7K A;  1H38 A;  2YIC A;  2QDO A;  2X6A A;  3MD0 A;  4MVZ A;  5B3S B;  4JI0 B;  4D7S A;  2DE0 X;  1UPG A;  2DYR B;  3T1C A;  2XAJ A;  1NQT A;  2BOC C;  5E79 Z;  4E2L A;  2CK3 G;  4DYL A;  4UCR A;  3B4S A;  5GW7 A;  5CA1 A;  2HJD A;  4JZG A;  1R6N A;  1FXH A;  3ETE A;  1YTF D;  3APQ A;  3B2E E;  5GON A;  1I94 B;  2PGG A;  4YIO A;  5LHI A;  2QJ1 A;  2ZDI C;  4BIZ A;  5JWP A;  1KB9 F;  1Y76 B;  4LNU B;  4BWA A;  1N32 B;  2WLJ A;  1GN3 A;  2QM7 A;  2P6J A;  4E4E A;  3D36 C;  1Q8I A;  4O2A B;  4NXN B;  4KP4 A;  2AZ0 A;  4JI8 B;  3AG2 C;  1WPX A;  2Q67 A;  1KKD A;  3WB0 A;  1N33 O;  1O9H A;  1PL4 A;  1I08 A;  3SDL A;  2KB1 A;  2N04 A;  2YEV B;  3IC9 A;  5JJN B;  3ABU A;  4I55 A;  1JCH A;  1TVK B;  4C7U A;  2UUB B;  3B8M A;  5GTI Z;  3T1H B;  3N2K A;  4OPA A;  3OUS A;  1YTF B;  2DQ3 A;  1GM8 A;  3U10 A;  5BMV A;  4B3M O;  4MTX A;  3SYO A;  2OIG A;  1GH6 A;  3ABT A;  4EKW A;  1Q86 W;  4AHC A;  2LGQ A;  1K7D A;  1SQF A;  1WP7 A;  3EXA A;  3HPL C;  4I4T B;  3FYE B;  2KG7 A;  4UFZ A;  3MDS A;  1THZ A;  3ASO B;  2CE4 A;  1EM1 A;  4WFA V;  1KP2 A;  1MSD A;  3QO8 A;  1SF9 A;  1SKV A;  2QWR B;  1H2S B;  1OCZ B;  4H44 B;  5H9C A;  2JGD B;  4FVM A;  5LXT A;  4JI3 O;  2R72 A;  3F7V C;  2X6B A;  1MSW D;  4MTF A;  4BR6 A;  3FAV B;  1FXK B;  1YCI A;  3A8T A;  3AK1 A;  1KUQ A;  2XHB A;  3RYF A;  3UM7 A;  3W7W A;  3K3W A;  2QSA A;  3D3I A;  4LF6 O;  3CC7 V;  3SJQ C;  5EK0 A;  2DMX A;  4H13 B;  1YJN V;  3ZMT A;  4JI4 B;  3BCC H;  4H33 A;  4X1Y A;  4B3R O;  3FX7 A;  2PYJ A;  1AJN A;  2CUG A;  2IJK A;  2VWK A;  2X0L A;  3RYC A;  2F66 C;  2ZNJ A;  3JCZ A;  1F4N A;  4PEL A;  3JSL A;  2Q7G A;  1N36 O;  1Q43 A;  4N23 A;  4GX0 A;  3LDC A;  5GON B;  1UJW B;  2GDS A;  2ZE7 A;  1NJI W;  4JI6 O;  1MAB G;  5EBW C;  2M7W A;  1N0J A;  4B3T O;  4XDL A;  2Q5Z A;  5EIB D;  4W4L A;  4R6Z A;  4DO2 A;  1URF A;  5C8Y A;  4CH5 A;  4FJC C;  3T4Z A;  4ZKI A;  3K08 A;  1SES A;  2A79 B;  3P30 A;  5DN6 G;  4B3S O;  4JV5 B;  4QE7 A;  4FZ1 A;  2P67 A;  4UVC A;  1Y6X A;  3I55 V;  3H1H H;  1RP3 B;  1N33 B;  5IE9 A;  4U7N A;  4HAM A;  1QLN A;  1V9P A;  4I55 B;  2WLL A;  1BE3 H;  3J7A U;  1B3Q A;  3OR7 C;  3K03 A;  1HNX O;  1CXZ B;  1NU1 H;  4WBN A;  5IT9 N;  2HJF C;  1Q6U A;  2DOS A;  3ZBH A;  2VQE O;  3RBZ A;  1ZUQ A;  3E83 A;  5BMV B;  1WPB A;  4MT8 A;  3OTO B;  1XMQ O;  2AZ2 A;  4CS2 A;  2JVD A;  2PYL A;  3MAQ A;  4BAY A;  3LNN A;  4FLY A;  3HKC A;  4WFH A;  5KA5 A;  5EZY A;  3ASN B;  1RM1 C;  3A0B Z;  3K9A A;  1GO3 F;  2NLJ C;  3KZI Z;  2UXC O;  1DK1 A;  1QBZ A;  1Y66 A;  4U3F H;  1OCO B;  3CCJ V;  1O9G A;  4JF3 A;  5LXT B;  5KUK A;  4FK5 C;  2R70 A;  4PA9 A;  1BL8 A;  4X62 O;  2P90 A;  1V55 B;  5CBF A;  3CRQ A;  2Q6A A;  1WA8 A;  3THO A;  1YEW A;  1IXM A;  4JI3 B;  4DW0 A;  5JVD A;  4QGP A;  2Y69 C;  1ZL8 B;  4I7Z B;  1AIL A;  1EBO A;  2UU9 O;  2XAH A;  4LF5 O;  5JCO C;  1XIL A;  3L70 H;  1AI6 A;  4BIO A;  1GMG A;  3L72 H;  1H8H G;  4LF6 B;  3SJC C;  5LGT A;  1JX9 A;  5A9G A;  1IBK O;  3X2Q B;  5LA6 A;  1K4C C;  1AI4 A;  1QLE B;  1GN6 A;  2CTW A;  2WLK A;  2AHY A;  3FB6 C;  3MHS C;  1F51 A;  3RYC B;  4GYC B;  1EZV H;  2ITD C;  2N74 A;  5LYJ B;  5D5Q A;  2F23 A;  3CB2 A;  1VF7 A;  3L71 H;  4UUJ C;  4JTC B;  4PA4 A;  5DEC A;  1CEZ A;  4RO2 A;  1N36 B;  1XNQ O;  3E8G A;  4FLX A;  1R3K C;  5C8Y B;  4JI6 B;  1JA8 A;  1FXV A;  3ZMU A;  5H6Q A;  2BTQ A;  1M93 A;  1GRJ A;  4B3T B;  2ILM A;  2GHY A;  3JCU Z;  5KHJ A;  3RW0 A;  1F23 A;  3CXH F;  3B40 A;  3UKM A;  4U3J A;  1VQL V;  2QR4 A;  4B3S B;  4FM1 A;  2GBO A;  4LCU C;  2OT5 A;  3J81 N;  4FFK A;  1NTZ H;  1M56 B;  2CAZ C;  4DW1 A;  1B6Q A;  4RUF A;  3B8N A;  3DXR A;  3E8H A;  2B1G A;  2WLL B;  1G4Y B;  1VQ4 V;  4MVQ A;  2WWW A;  4J7K A;  1XHX A;  4J9Z B;  1Q7Y W;  2V7Q G;  1DGS A;  1ZSP A;  2LP7 A;  1HNX B;  2WLN A;  4NVP A;  1FFX A;  4PA7 A;  5KMG A;  3AG1 C;  2VQE B;  1M90 W;  3BHP A;  3C90 A;  3JAK A;  2EJR A;  1K97 A;  1R6K A;  4KUM A;  4JAV A;  1KKC A;  5JJJ B;  4I5S A;  4O4H A;  3K59 A;  4NTY A;  3HKC B;  4LH6 A;  3O9O A;  1XMQ B;  3ETG A;  2BSK A;  5EZY B;  3BY6 A;  1ORQ C;  3SYA A;  3ZED A;  4XBF A;  1G6U A;  2HVJ C;  2DYS C;  2WLI A;  1KD1 W;  1IBL O;  5KA6 A;  3UO3 A;  5ITZ B;  3K06 A;  2UXC B;  4U7O A;  3OT7 A;  3CME V;  3LSU A;  2NNU A;  2O57 A;  4DV4 B;  4GKJ O;  2A7W A;  4X9Q A;  1WA8 B;  1SQV H;  4RQF A;  4IYI A;  5BZB A;  2ZXW C;  4X62 B;  4UV9 A;  2MW2 B;  5L3B A;  4CH4 A;  3I5D A;  3U11 A;  4WFF A;  5KHI A;  3VQX A;  4LFB O;  3SJB C;  2DYR C;  2QM8 A;  3SJA C;  3LSQ A;  2UU9 B;  2EJ7 A;  4LH7 A;  1N34 O;  2QKS A;  4LF5 B;  2R9I A;  3CRR A;  3QNE A;  5LBQ A;  2Y48 A;  5LA6 B;  3DGE A;  1I0H A;  1AJQ A;  1JFF B;  3CCV V;  5LP6 C;  1IBK B;  3WG7 B;  3E8B A;  4LBE C;  1VP7 A;  1NTM H;  1ARO P;  3EVK A;  4TQD A;  2A3Q A;  5B1B B;  5KAI Z;  4ZHQ A;  3FFQ A;  4GLX A;  1YJ9 V;  3RT3 C;  2HG5 C;  1DLB A;  4CS4 A;  1NS1 A;  4FLZ A;  5E1A C;  1JJ2 U;  4UVB A;  2BTQ B;  2EIK B;  1X4T A;  1L8D A;  2RDC A;  5A2Q N;  4EB6 A;  4JGS A;  1R3I C;  4QIW F;  1PNK A;  5HFM A;  1JPX A;  4R8C A;  3ZMV A;  2ATK C;  5D5P A;  3CRC A;  3FYI B;  2QWP B;  2ZIN A;  3SPH A;  3OFN G;  1S5J A;  3K79 A;  3M7M X;  5CBH A;  1EFR G;  2R9A A;  2Z5U A;  4GCZ A;  4ZI7 A;  5JH7 A;  4MTG A;  2YDE A;  1U97 A;  3AG4 B;  2OWO A;  1PNM A;  5JQG A;  3E22 B;  3IAY A;  1AJP A;  3VBB A;  1HWY A;  4J41 A;  1FFX B;  1VAR A;  3ETD A;  5KMG B;  4WFG A;  2YC0 A;  3ASO C;  3CEI A;  4OX9 O;  4TSF G;  2L35 A;  3RWR D;  2BSK B;  5DM6 V;  3OGI B;  4RAI A;  4LF7 O;  4DV1 O;  1Y67 A;  1YI2 V;  5FNV A;  1FPO A;  1KQS U;  1OCR C;  2ZR2 A;  1SZT A;  2A9H A;  2JK5 C;  3H01 A;  1B06 A;  2M6Y A;  4X66 O;  1KYO F;  4F6E A;  1FXK C;  4PA3 A;  1FD9 A;  1SQX H;  1PNL A;  4MS2 A;  4A5U B;  3EFF K;  2QGN A;  3AK3 A;  1RSO A;  4MTO A;  4BIU A;  1IBL B;  2OTL V;  4X65 O;  3ZCC A;  2YXH A;  1JJO A;  2QM4 A;  2Q73 A;  3A0H Z;  3B09 A;  3M99 B;  2CGN A;  3DC5 A;  4GKJ B;  5J2U B;  1R3L C;  3BRC A;  3CC2 V;  3E8F A;  2QKC A;  2DN9 A;  3B77 A;  2RQ6 A;  4HZ3 A;  4DXW A;  4CH3 A;  1P4R A;  1Q81 W;  1NTK H;  2F1M A;  4LFB B;  2K1E A;  1XQ8 A;  2OYQ A;  4LF9 B;  4IHJ B;  2ZCE A;  5H2F Z;  1N34 B;  3OMA B;  3OAA G;  2VWJ A;  1WJZ A;  3LSS A;  2DW4 A;  1HR0 O;  3LDD A;  3JAM N;  2CGO A;  5L3G A;  5IYZ B;  3OTF A;  1PPJ H;  2RN9 A;  1BQZ A;  2ZE5 A;  3C3S A;  4TOI A;  1IX9 A;  3APO A;  1KC8 W;  1H8E G;  1NT2 B;  3E89 A;  2Y4U A;  2ZIM A;  4O4L A;  5CN0 A;  3F5W C;  3RVY A;  4ZOL A;  2E5L O;  4YJ3 B;  4JV5 O;  4UB8 Z;  4UCT A;  3BAA A;  4NTX A;  2ZD9 A;  3Q4H A;  4DUY O;  4GUN A;  4MVM A;  2D3O W;  2WLH A;  1Y4M A;  1PD3 A;  3L75 H;  2EIL B;  4ZI7 B;  5JH7 B;  2LFR A;  1QR9 A;  1AI5 A;  2ZQM A;  3ZHS A;  3P3N A;  4RQE A;  5IYD O;  5JQG B;  4NTW A;  2F93 B;  3CE2 A;  1SS3 A;  2AW9 A;  1VEW A;  2G38 A;  2JDI G;  3UT5 B;  2YIB A;  3OTO O;  1WB7 A;  3CS5 A;  2F95 B;  1K5Q A;  3RGB A;  2W0F C;  3D36 A;  1MZE A;  4W4K A;  1IVS A;  3CCL V;  3JAR A;  3IC7 A;  2YI9 A;  1OCO C;  4OX9 B;  5FNV B;  2N05 A;  4JYB A;  4PHZ A;  2Y0P A;  1SER A;  1V55 C;  4B08 A;  4DUZ O;  4LF7 B;  4DV1 B;  4DV3 O;  3ZRS A;  4AI8 A;  1FYJ A;  1A32 A;  2IJI A;  4X66 B;  1RSO B;  3GWK C;  1RPR A;  2YXY A;  2Q7H A;  4FMT A;  3ZMS A;  1M57 B;  2IH3 C;  4YJ2 B;  5EBL C;  1ZX3 A;  5KAF Z;  4X65 B;  1MA1 A;  2LW7 A;  2ZE8 A;  4H0L B;  1AB3 A;  1GM9 A;  4NKG B;  3X2Q C;  1AP6 A;  1ZTE A;  2E76 B;  2A06 H;  3JSN A;  2UXD O;  1HNZ O;  2AXT Z;  4RWU A;  1FJG O;  2EBO A;  3UO2 A;  4FLW A;  4O4J A;  2KSD A;  1EN5 A;  1HW7 A;  1K73 W;  3T1Y O;  2YUA A;  2IJH A;  2W6I G;  1SQQ H;  4LR3 A;  5EC1 C;  2EIN B;  1RFY A;  4LC1 A;  3G4S V;  3ZRW A;  5CA1 B;  1HR0 B;  1XBL A;  2YIB D;  1JMK C;  3NXS A;  3STZ C;  1VMG A;  2YI8 A;  1NH2 D;  4MVS A;  3ZJZ A;  2WLM A;  2FKX A;  4WFE A;  4H37 A;  4ZOL B;  2EIJ C;  1OCC C;  2EX3 A;  4OXS A;  2OCC C;  1XNR O;  4PDL A;  2UXX A;  3CCU V;  4KHP B;  1M56 C;  1M4U A;  3Q4H B;  3ZRX A;  2E5L B;  3W7U A;  1X59 A;  2EIM B;  3IJ4 A;  3CWB H;  2EZO A;  4DUY B;  3OR6 C;  1SA0 A;  2NN4 A;  1P49 A;  1XOU A;  3A2F A;  4QNH B;  4PI2 A;  4GX5 A;  4J11 A;  1J95 A;  1Q90 D;  2QTS A;  5EYP A;  3OUF A;  4ICG A;  1US6 A;  1FAF A;  5EC2 C;  5LHG A;  2PZS A;  2KQX A;  3N2K B;  1OV9 A;  1NH2 B;  4GX2 A;  2GUZ A;  2P7T C;  3AG3 B;  3HKD A;  2JEX A;  3RFR A;  1LUW A;  2RCV A;  1H2N A;  3LNM B;  3JAR B;  2FTK A;  5KHH A;  3AG2 B;  5L3C A;  4JAA A;  1RPO A;  2KG7 B;  1SQP H;  1OJH A;  1GK9 A;  3MHH C;  5IWA O;  1VF5 B;  4PI0 A;  1I5Y A;  5F2V O;  4UCV A;  1N4C A;  4MVR A;  4FZ0 A;  2QTO A;  2IW5 A;  2PUS A;  2D2C B;  4X1I A;  4DV4 O;  4DUZ B;  3S3X A;  4DV3 B;  4CZZ A;  3UQ8 A;  2WA4 A;  1ZAU A;  4J80 A;  2ZIO A; 
#chains in the Genus database with same CATH homology
 4LF4 O;  2VQF O;  3T1Y O;  2UUC O;  4JI0 O;  4DUY O;  4OPH A;  1HNW O;  1IBK O;  4DV6 O;  4B3S O;  4GKJ O;  4OPA A;  1XMO O;  4OX9 O;  4DR4 O;  5LL6 Y;  3J80 N;  2Z0A A;  2HHH O;  4B3M O;  2N74 A;  4DR1 O;  1IBM O;  4KHP O;  4LF7 O;  4DV1 O;  2FKX A;  4GKK O;  4DR6 O;  4DV2 O;  4LFB O;  1I94 O;  4X66 O;  5LMN O;  1XNQ O;  4LF8 O;  1XNR O;  1D2D A;  4DV7 O;  1N34 O;  3J7A U;  4JYA O;  4A5U B;  1X59 A;  1HNX O;  3OTO O;  4JI2 O;  4JI4 O;  2DJV A;  4DR5 O;  1N32 O;  5IT9 N;  4K0K O;  1G1X B;  4X65 O;  2DOS A;  2VQE O;  3R66 A;  4JI5 O;  1F7Y A;  4NXN O;  1J5E O;  5LMU O;  4DR7 O;  2AGA A;  4X64 O;  2JRI A;  4JI8 O;  4JI3 O;  1R6T A;  4JI7 O;  1XMQ O;  3J81 N;  2UXB O;  4LF9 O;  1KUQ A;  3RT3 C;  5BY1 A;  4JI1 O;  1R1B A;  4DR3 O;  1NS1 A;  4DUZ O;  4NXM O;  4DV3 O;  2ZKO A;  3M8A A;  3O65 A;  4LFC O;  1FYJ A;  1A32 A;  4DV0 O;  4DR2 O;  4LF6 O;  2UXC O;  4DV5 O;  5FLX N;  1DK1 A;  2UUB O;  5A2Q N;  3T1H O;  4YHH O;  4LFA O;  4AQY O;  1HR0 O;  5BXZ A;  4YY3 O;  3JAM N;  4B3R O;  2LW7 A;  4X62 O;  5BR8 O;  1FKA O;  2ZM6 O;  1YZB A;  1AB3 A;  5IWA O;  1XEQ A;  3F5T A;  1N36 O;  1N33 O;  3SDL A;  4JI6 O;  1AIL A;  2UU9 O;  2UUA O;  2UXD O;  1HNZ O;  5H5N A;  1FJG O;  2E5L O;  4LF5 O;  4DV4 O;  4JV5 O;  4B3T O;  1IBL O;  2F4V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...