4X64O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x64O00
5BR8O 3R66A 2N74A 1X59A 1AB3A 1IBLO 2DOSA 5BY1A 1IBKO 4DV1O 3J81N 4X64O 4DV3O 4NXNO 1R1BA 4DV2O 4B3SO 4DV6O 4JI2O 1F7YA 1HNWO 5LMNO 1N34O 4OX9O 1FJGO 4YY3O 2UXDO 4OPHA 4DUZO 2UU9O 4JI7O 3RT3C 1R6TA 5IT9N 2DJVA 4DUYO 4B3TO 1J5EO 1N36O 2JRIA 4X66O 2F4VO 4DR6O 3J80N 4AQYO 4X65O 2VQFO 2E5LO 4K0KO 1N32O 3M8AA 1XMQO 2ZM6O 4DR4O 1D2DA 1FYJA 1G1XB 4JI5O 2VQEO 1XNRO 4GKKO 4NXMO 1KUQA 2LW7A 2FKXA 1DK1A 4JI8O 2UUAO 4JI1O 3F5TA 5LMUO 3SDLA 5FLXN 1HR0O 4B3MO 4DR3O 2ZKOA 2Z0AA 4JI0O 4JV5O 1XNQO 4JI3O 2AGAA 4LF7O 2UXCO 2UUBO 4LF8O 4LF6O 1A32A 4A5UB 1AILA 4JI6O 4DR1O 4LFCO 4DR7O 4KHPO 4JI4O 4YHHO 1YZBA 4LF4O 4B3RO 3OTOO 4LFAO 4DV4O 5BXZA 4JYAO 1FKAO 3T1HO 4GKJO 4DV5O 4OPAA 4DR2O 1HNZO 3JAMN 4LF5O 4DV0O 3O65A 3T1YO 5H5NA 1IBMO 4X62O 4LF9O 1N33O 5IWAO 2UUCO 4DV7O 1I94O 1XMOO 2UXBO 4DR5O 5LL6Y 1NS1A 1HNXO 4LFBO 3J7AU 5A2QN 2HHHO 1XEQA
chains in the Genus database with same CATH superfamily
2QWPB 5L3FA 1DF4A 4R7CA 4NB5A 1CXZB 3K5MA 3ZN0A 4Z1MG 3DSQA 3W7TA 2A9HA 4LH6A 1K7DA 1EBOA 3QO5A 5CB4B 4NXNB 2UU9O 3BEHA 2F23A 4DUYO 3UCSC 1YI2V 2E74B 4YY3B 1IXBA 2A06H 2JEUA 1N32O 4IT5A 1K8AW 2JGDA 2OTJV 4E4EA 3E8BA 3QG5A 3U0ZA 3AG2B 4I5SA 1D5AA 1JCHA 1D5NA 4NXMO 4WFAV 2ZM6B 1PNKA 2BCCH 3P3PA 4MSWC 2CDYA 4RQEA 4TUYB 2ZNIA 1H2KA 1PKXA 1M4UA 5FPRA 2WLNA 4PA7A 1S5JA 2DQ0A 3ABLB 3FX7A 5AG2A 5LP6C 5C8YA 3TXQA 4O2AB 2GV9A 4AQYB 2O57A 3CMEV 3P30A 1G8MA 2LO1A 4DRXB 1VQ6V 2QE7G 3RYHA 1M1KW 5B3SB 2IW5A 3K9SA 3LNMB 1E79G 4DYLA 4GYCB 2F43G 4IL6Z 1SQXH 4P9OA 2ZDIA 1MZEA 3APQA 1HR0B 4LF4B 5B1AB 2P90A 3CP1A 2X6BA 3CXCU 3UQ8A 2DYSB 5LL6Y 3RYFB 3CCJV 5KHKA 3J81N 4ZBMA 4NTXA 3E35A 3LDEA 2ZE6A 2DW4A 1ZUQA 4UXNA 2CGOA 1P4RA 4O4HA 5B1NA 4EKWA 3JALA 1QBZA 3OTOB 1BQ0A 4JI2B 1GN2A 3E22B 5LMNB 3OE7G 1OCZB 1Q6IA 3L70H 1Q7YW 4DUZB 1VQPV 1WAZA 4JI7B 4J11A 2F4VO 2XAQA 2PUSA 3D36C 4CZZA 2QM7A 4UCUA 3L73H 4EFEA 3K5OA 5GW7A 1NJIW 3UO2A 1Y76B 2M6YA 1H2LA 1IVSA 2E5LB 1XNRO 1QR8A 3F7VC 3ASOC 3F5TA 2H8PC 2PYLA 3ZCCA 1SQGA 3UKMA 1WLEA 2ZKOA 4BW5A 4JI0O 1FXKA 2ZD9A 5EIBD 2EIKC 1M57B 4BIUA 3OMAB 2JVDA 2XT9A 1ZLZA 3S3XA 2DN9A 3M99B 1YTFB 4MW8A 2HR3A 4CC5A 1GN3A 4QPJA 1L8DA 4DR7O 3FB5C 2BTOA 5D5PA 3IFXA 5B66Z 1XQ8A 4DR1B 5BMVB 3O9OA 3JAKB 4WFFA 4JYYA 1MZFA 2VWKA 3AG1B 5IYZB 4GKJO 2ARHA 2Y4UA 3D8CA 3CD6V 2WLLA 4LFAB 1JMKC 1XMOO 2DYRB 2IH3C 4LF7B 1ROPA 2UUBB 2GBOA 2N74A 1SA0A 5IWAB 4DK1A 3NR7A 2GSMB 1JR9A 3OEHG 2MK3A 2QM4A 5BR8B 1Q82W 1GAXA 1H2MA 3K04A 1QLNA 4I55B 3L75H 4FPPA 2VS0A 4UV8A 4X89A 4B3TO 2ZNJA 1QVFU 4MVSA 3K59A 1IX9A 1M56C 5LA6A 3CCSV 4DR6O 1JQ0A 3RBZA 2K9PA 3Q4HB 1Y74B 3SYCA 5JVDA 1SZTA 4FFBA 4MTXA 1T5EA 1TVKA 1WA8A 1AROP 4MTOA 4X64B 3RVZA 4Z1VA 3QO7A 3WB1A 1US6A 2QKCA 3JD4A 3KCYA 2FMLA 4IHJA 3KZIZ 5H6QA 3LUTB 4NR1A 4DR3O 1KP2A 4PDRA 2ZQMA 2XHBA 1VQ5V 1CPYA 1Y6XA 3ICXA 1IXMA 2P4KA 1SQFA 3KG2A 2IJKA 5JJJB 3SJBC 4FFKA 4MVOA 2EIJC 4R8CA 4FLUA 1V55C 4X1YA 4JI5B 1M93A 3B2EE 1U97A 1Y66A 2KB1A 5E1AC 5KHHA 5L3EA 3QTCA 4B08A 4ZI7A 3B09A 2OIGA 1H38A 3QVNA 3CCQV 2Q73A 2RCVA 3T1YO 1LUVA 4LWSA 5LXTA 1KECA 3E8HA 2UXCB 2D3OW 4HNAB 3CC4V 1JJOA 1AB3A 4TSFG 2E75B 1Q3EA 3A8TA 2LW1A 1NU1H 1FS0G 1XDCA 2KG7A 4DV7B 3ZRXA 4ZHQB 4G27B 1XBLA 4RAIA 2LP7A 4JZ2A 2CGNA 1BL8A 2YI8A 4FM1A 4JYAB 2HFEC 2F66C 4H13B 1WNSA 2EIMB 1SA0B 2ODMA 4UB6Z 4FK5C 4AQYO 3AG7A 1TUEB 4PV1B 4CH6A 1AJPA 1EZJA 3LDCA 3STZC 4GZRB 1JA8A 3HKEA 4NVPA 2LW7A 2Q0OC 3AG4B 3L72H 2JK5C 5LHHA 3SDLA 1HR0O 5J2TB 3X2QB 2ZXWB 2IM9A 4UCVA 2Q9LA 4X88A 5IY5C 1TVKB 2L35A 2AHYA 4O2BA 4X65B 5DN6G 5IJ0A 1WP8A 3CCRV 4RUFA 1VEWA 2L6LA 4I0XA 4IHJB 3JARA 4IYHA 1WB7A 4MVQA 3HB3B 4ZKIA 4GX0A 1KC8W 3A0RA 1ZTEA 2IBZH 5KA6A 1IZ3A 3OTOO 1M5IA 5BXZA 2Y69C 4MW3A 1BCCH 2QDOA 2ZCEA 4H37A 1B3QA 2OCCB 3ASNB 3IC9A 2XAHA 4JZGA 2H94A 3UM7A 1I94O 1SKVA 4ICGA 4X1YB 1HNWO 1PV0A 1VQ7V 1IBLO 1IBMB 2QWOB 2Y0PA 3SR2C 1S5LZ 5KAFZ 1FXHA 4DV1B 2GUZA 1WPXA 4OPHA 2YIDA 4YXWG 5JJNB 2LFRA 2EJRA 2ITDC 5EBLC 2M7WA 3G80A 4K8XA 1XREA 1R3KC 4OGQB 1O9HA 3CHXA 2UUCB 3S3WA 1OCCB 2EINB 2YEVB 3CC2V 1G1XB 4LNUA 3OW2U 4UCRA 2VQEO 5ITZB 4K0KB 2IJHA 1OCOC 4Q6GA 2WLHA 4PA4A 1P7GA 4XDLA 4DV6B 2YI9A 1AP5A 1BGYH 2YIBA 2IU3A 4LP8A 2EBOA 2GTSA 3ZHTA 3D36A 4KXRA 1K97A 1FFXA 2LGWA 4WBNB 3MHHC 4JI1B 2ZE8A 2XOKG 1NTKH 3JD2A 5HFMA 3H1LH 3C3TA 4LF7O 2HKOA 5JH7A 4K8ZA 2UUBO 1URFA 5IJ9A 1N36B 1K9MW 2JJ1G 5JQGA 5KLVH 4TV8A 4H33A 5H6RA 2PGGA 4JAAA 4YJ2A 2BTQA 3ZRWA 1ZL8B 2EILC 4P30A 3WU2Z 4BR6A 3ZHSA 1KKCA 4I9QA 4D6TH 5GTIZ 4Q20A 4PI2A 4B3RO 1YCIA 2AW9A 4DV5O 4LH7A 4DR2O 2EZOA 3AK2A 2BOBC 1N8RW 5CA1A 2PI4A 3BVOA 4JF3A 4I0XB 1YDXA 1LNQA 2YXHA 1VQ8V 4O4JB 4X1IB 3B8NA 5LYJB 5KUMA 1YSCA 4X62B 3ML0A 4X64O 1AI7A 3RFRA 3OGCC 5LP6B 5LHGA 4KHPB 5JCOC 3CRQA 1EM1A 1K4CC 1Q5OA 3VOUA 1BMFG 4XBFA 1OCRC 3EHBB 3RT3C 2QWRB 3SJQC 4DV4B 2YSUB 1NT2B 2ADPA 3LSUA 3K79A 3ZMSA 4P9PA 4FLWA 4H0LB 1GTOA 3N2GA 4X66O 1AJNA 4I50A 2IJIA 1FAFA 5IDJA 1I0HA 5FNVB 1KBHA 1J5EB 5A9GA 2Y4TA 2YICA 2X6AA 1VF7A 3JCUZ 4J42A 2XASA 4EB6A 4JI5O 5LOVA 2FYUH 4J9YB 2FKXA 3HKBB 1SERA 3OMNB 1KB9F 1N34B 1QLEB 1GMGA 2DQ3A 4JV5O 2ZE5A 4O4IB 1EFRG 1L0LH 5LMUB 1H2NA 1CP9A 3G6EV 4NTYA 4XDKA 2UXCO 4J10A 1JFFA 3H9VA 4AHCA 4MS2A 3E2EA 3JAWB 4I4TB 2VQFB 3F5WC 3JD1A 3CRRA 4QIWF 1YHQV 2Q4PA 3FYEB 1VF5B 3GWKC 3ETDA 1IURA 1V54C 3SYOA 1S0VA 3UT5A 1RPRA 2GHYA 5EYPA 4FZ0A 5GONB 5LGNA 4X20A 1JOYA 1YXBA 4AI8A 4JYAO 2DE0X 3K58A 1PNMA 2YUAA 3SGIA 1PPJH 4LR3A 2QA4V 4LF5O 3ASOB 4X9QA 4YJ2B 4JAVA 3APOA 4YJ3B 3EXAA 1GM8A 2UXBO 2P22C 1XHXA 4HYOA 3E8GA 3TCUA 3OGIB 3C3SA 1W59A 4IIJA 5J2UB 3GWOA 3DXRB 3WB2A 4WF9V 1AI5A 3ABKC 1QR9A 4DV2B 2DJVA 4F6EA 3SJCC 4MT8A 4QE7A 1XILA 2UXDB 4XDJA 1Z5WA 4BWAA 4I9WA 3RYIB 1E1QG 3U10A 4X65O 1D2DA 2JDIG 1KQSU 2V4DA 1EZVH 3HKCA 4J7KA 5FL7G 5TISZ 2KQXA 1KUQA 1XMQB 1XOUA 4B3SB 4MTFA 1VF6C 1FXVA 1H8HG 2B5UA 4I7ZB 2Q5ZA 2WLJA 3CJHA 2WLKA 5CBHA 2OIEA 2OTLV 3CX5F 1X4TA 3ZRVA 1NI8A 4EB6B 1WPBA 5LOVB 4PDLA 5EBWC 4TWKA 1BHAA 4CC6A 1M56B 2NR5A 2A7WA 4PA9A 1OZ0A 4UFZA 3JD3A 3CCMV 3RYCA 1YTFD 3B4SA 3FFQA 2Q8VA 1GN6A 4YIOA 4JYBA 3FD9A 3CPWU 2JGDB 1KD1W 1TGOA 5B1OA 4N23A 3ABLC 4YIPA 1P84F 5EC1C 1XNQB 1AI6A 2UUCO 2JS5A 3RN4A 1DLBA 4UB8Z 4LFBO 1NTMH 2Q67A 3MAQA 2HHHO 4UCSA 2ITCC 4R6ZA 1GK9A 1IBKO 4X20B 4PD4F 4JI6B 5B3SC 1FPOA 4ASUG 4DV6O 3JCZA 5C8YB 1FJGO 1IDSA 4DV3B 2YC0A 5GTHZ 2EIJB 2JGUA 5IT9N 1K5SA 3ZBHA 2YXLA 2RQ6A 3RYHB 3SPJA 1N36O 2DYSC 5LBQA 4IIJB 5JJEB 1ZX3A 3M8AA 2QTSA 1Q86W 1FYJA 3WB0A 3I5DA 5B1BB 5EBMC 3ABMC 4X8AA 3T2MA 3KCXA 2V1DA 5LHIA 4DR4B 2W6IG 1SETA 3BHPA 1Q6UA 1GH6A 4PELA 2WAMA 4KFMA 4TOIA 1OCZC 2Z0AA 4DO2A 1H2GA 2UUAB 5K1XA 3HKCB 5KA5A 2RMKB 4K3AA 4B3MB 2CK3G 4O4HB 1VQ4V 1R6KA 2QEXV 4PDMA 4LF6O 4A5UB 3JALB 3CCUV 4FVMA 2OWOA 4LFCO 3OR7C 3K0GA 3QNEA 4KHPO 4O4LA 3CJHB 4LF8B 3OEEG 3IJ4A 4GKKB 3BFRA 1K4DC 3ZHRA 1FD9A 3CRCA 4DV4O 1K33A 4YHHB 2UXXA 4JTDB 2JS3A 1M57C 4DK0A 5H5NA 2WLIA 3T1HB 3QO8A 1I5XA 3SYAA 4QGPA 2P06A 1NS1A 2XNDG 4BAYA 3RYCB 3SPGA 5KUKA 5EIBC 4F6RA 1FXKB 1N33B 4NXNO 1CEZA 4IGGA 2CH7A 2QR4A 3ZRSA 1U96A 3ZHUA 1N34O 3AG1C 4YY3O 3GVMA 2KKWA 4L8JA 1DGSA 2WPDG 3JASA 4JTAB 2DYRC 2EJ7A 4DV0B 2E3CA 4B7EA 4CS4A 5JCOA 3K57A 4LF9B 1PP9H 5F2VO 2VQFO 4DUYB 2ZM6O 4DR5B 2CUGA 1THZA 1L1FA 4FLZA 2KSDA 1NKDA 2WLLB 1N32B 4UCTA 4JGSA 3LDDA 2QKAA 5KMGA 4NXMB 1Q8IA 2JJ2G 2AZ2A 3JD0A 1NH2D 4JAUA 2P7TC 2GTAA 2Q7HA 4IYIA 3PJSK 2EX3A 1AILA 5KX5A 1NH2B 3ZMUA 3H1IH 3D3IA 4KP4A 4RWUA 4PA6A 3QF7A 4TQFA 4ZOLA 5LA6B 3SPIA 4LF4O 2QWNB 5JVDB 1QCEA 3CXHF 4FFBB 1TAEA 2Q6AA 5IYCO 2RN9A 1NZ6A 2PF4E 1OCOB 1WP7A 1QU7A 1WA8B 2LGQA 4K35A 5FPOA 3CEIA 2ZR2A 1QQCA 5K1PA 2Y48A 2YS8A 1G4YB 3B40A 3R66A 1X59A 3H1KH 1WN7A 1K73W 2NN4A 2N04A 3LSQA 3CC7V 4B3SO 1N4CA 4JI2O 2W0XA 3BAAA 1SS3A 1N0JA 4U3FH 1F4MA 5LMNO 1F7YA 3AK3A 1RFYA 4UVAA 4LCUC 4DUZO 4JI7O 1UJWB 1YVWA 1ORQC 5IYDO 5EZYA 4J41A 2B9ZA 3OD4A 2XAFA 1MSDA 5L3CA 2B1IA 1Y67A 1S3JA 2QWQB 2E5LO 4ZI7B 1BQZA 2CH7B 1RSOA 3MD0A 1V9PA 5CMUA 5CBGA 1XI1A 1BE3H 3AK1A 1UPGA 3OAAG 1WB8A 1ZWIC 1R73A 3AG3B 1VIBA 5L3BA 3W7UA 1P49A 4CBCA 3C90A 4LWSB 1GO3F 3JASB 5LXTB 3FB6C 4OX9B 1Y4MA 4QJFB 2EIMC 4N21A 1W0KG 2KG7B 1BHBA 1XUQA 1XNQO 3FAVA 3OFNG 4FIPC 3E83A 1KP3A 2UXNA 1VMGA 4GLXA 4JI0B 5CB4A 1VF6A 4JI6O 4DR1O 3CCLV 3W7SA 2A79B 3AG4C 4FMTA 1YZBA 3K06A 4JPRA 2QSAA 4LFAO 3OT7A 1FKAO 3ABUA 4OPAA 5LGUA 3ZX6A 3ZHVA 2Q0AA 2IU0A 3ZIAG 3HKEB 5IWAO 4GKJB 3K3WA 4ZOLB 3DGEA 5BR8O 2FB5A 2XAJA 3OM3B 3NXSA 3T1CA 1R6NA 4CH4A 1BS3A 4TUYA 3I55V 2FL4A 1AR1B 4JI4B 4MVUA 3B77A 3PN1A 1GRJA 3ZN1A 4O2AA 4O2BB 3B8MA 4J7JA 5IJ0B 2X0LA 1R6TA 3TXSA 1RM1C 3ASNC 1V54B 1PM9A 2R9AA 3RVYA 3JARB 1B06A 4DRXA 2P67A 2QGNA 4RQFA 2HVJC 1GM9A 1K34A 1GM7A 4B3TB 2HG5C 4CS2A 4DR6B 3N27A 4HZ3A 3WG7C 1SQQH 4GKKO 1GN4A 1JX9A 2YDEA 4G2KA 3F7YC 3VQYA 2QKSA 4OXSA 3RYFA 5EK0A 3OR6C 4DW0A 1YEWA 5C93A 4DR3B 1OCCC 2EINC 1JVMA 2GUZB 1LR1A 1GKFA 2AHZA 4UCOA 4BIZA 1YJNV 2ZIOA 1NVPD 2CTWA 3E22A 4P2ZA 1HP8A 2Q69A 3LNNA 3TGUH 2E76B 4H44B 5D5QA 4PHZA 1N0NA 1MG1A 4J7ZA 3FAVB 2YIBD 4JI8B 4PDVA 4CH3A 3A2FA 1Y76A 1NVPB 1Q43A 4LNUB 2PTMA 2Q68A 4DV0O 4LF9O 2PI5A 3R65A 4DV7O 3TK1A 1TA8A 3BABA 4JI3B 4DR5O 1I7FA 2G38A 2GDSA 4Z2WA 3T4ZA 3T1YB 1FFXB 4F4LA 2ZT9B 1MMMA 4JYCA 1Q90D 5JH7B 5IJ9B 4JASA 1EN5A 5JQGB 1SQBH 1M90W 3BA9A 4TV8B 1HWYA 2DMXA 1J95A 2BTQB 1COWG 1B04A 1PL0A 3ZRWB 4AILC 2RDCA 4FLXA 3MHSC 4GX2A 3HR0A 4RUEA 4WCEV 2EIKB 4W4LA 4WFGA 5BMVA 5CN0A 3JAKA 1XHZA 4WFHA 2X7RB 5IYZA 2N05A 2AXTZ 3K03A 5CA1B 1RP3B 1UFIA 1WJZA 2MW2B 3IAYA 2R72A 1F51A 2Y0IA 3M7MX 5FLXN 3W7XA 4PA3A 5L3DA 4U3JA 1SESA 5CBFA 2QTOA 3OUSA 2CTRA 1KU9A 3GB7C 1KMIZ 1TUBA 3EFFK 1M9NA 3DC5A 1P7BA 4I55A 2JIZG 2HJFC 2Z3YA 2Q7GA 4QNHB 4KUMA 1BZKA 3BY6A 3N2GB 2YXYA 4I50B 3RGBA 2D2CB 1QLEC 3WFVA 3Q4HA 1Y74A 3ABMB 3CYOA 3DTUB 5KAIZ 4FJCC 3ABTA 1IBMO 2RJZA 3K0DA 5DECA 3ZMZA 2DWDC 3AG2C 2ATKC 2P6JA 4E2LA 1DF5A 5DM6V 3MDSA 3CRMA 3P3NA 2DOSA 3TETA 5BY1A 4DV1O 2ZINA 1Q81W 1I94B 1R1BA 5KHIA 2OT5A 2BSKA 3L9DA 2IH1C 1HNWB 5J9PC 4OX9O 1JFFB 1IBLB 2EZPA 2A0LA 2CAZC 5IYBO 4QE9A 2P4VA 5DEDA 2WSSG 3UT5B 3ZMVA 1MA1A 5EYPB 3AEIA 3U11A 1OHHG 1SQVH 4K0KO 1XL6A 1QHTA 3P32A 4MVMA 1AP6A 1PD3A 4TQDA 3CCVV 1VQKV 5B1AC 1V55B 4JI1O 2F1MA 1S76D 4GCZA 4D7TA 2VQEB 4HNAA 4NYKA 3CB2A 3A0HZ 3VQXA 2H3OA 4FZ1A 4FLYA 1I08A 4ZHQA 3E89A 3CCEV 3D3QA 2QM8A 2XAGA 1EN6A 4G28B 4DXWA 3K5LA 2X6CA 1S77D 1I5YA 4JI4O 3H1HH 2CTQA 1BSMA 4U3JB 1VP7A 1R3IC 4MVRA 2BOCC 4RO2A 3K08A 3N2KA 1MABG 4PI0A 1TUBB 2W0FC 1VQ9V 1K5QA 4TT3G 3SPHA 3SPCA 4QPKA 1SQPH 1HW7A 4B3RB 1PL4A 4X62O 1MSWD 3SJAC 3EVKA 4DV5B 2OCHA 4DR2B 2OYQA 2ZIMA 1F4NA 3J7AU 5A2QN 5J2TA 3THOA 1ZSPA 1W2BU 1AJQA 1JJ2U 3W7WA 1XL4A 1OV9A 4CH5A 2WLMA 3ZHQA 1SRYA 3BPZA 4GX5A 1NQTA 4B7KA 2ZR3A 4UUJC 3SYPA 3BCCH 4EFBA 3ZEDA 1J5EO 1HNZB 5CA0A 3RWRD 2R9IA 2WA4A 5IY5B 3J80N 2R70A 1SZXA 1NTZH 3BRCA 3FKSG 2BSKB 1SC5B 3ETEA 4DW1A 1NBMG 1HNXB 3CWBH 1LUWA 1BT8A 3IC7A 4X66B 2C2AA 4FM2A 4X1KA 2WA3A 4JI8O 5LMUO 1VARA 1YITV 5HFLA 4ZIBA 5CA3A 2UU9B 1S72V 2Y69B 1ZAUA 2HP8A 2B1GA 4JI3O 2AGAA 4BW9A 1ENVA 2ZDIC 4GUNA 3E86A 1R3LC 2XTAA 1VQOV 4JV5B 3CSXA 2LFSA 5B1BC 5H2FZ 3IGAC 2XUMA 2HLDG 5BZBA 1MOFA 2R9RB 1K3EA 3A0BZ 3K5NA 3T4DA 4J80A 1FFTB 2AZ0A 1O9GA 2YEVA 4UVCA 3FB7C 5ITZA 4NTWA 2EULA 3K9AA 2DWEC 1AR4A 4W4KA 4LF5B 3H01A 5IE9A 3N2KB 4R50A 2UXBB 4WBNA 4D7SA 4DV2O 1VQNV 4WFBV 4HBNA 4MTGA 4TV9A 2UXDO 2CTPA 1S5HC 3H1JH 4O4LB 1L0NH 1PNLA 1ZL8A 2CE4A 1H2SB 5KHJA 1W0JG 2RNBA 1NR1A 1XMQO 1QVGU 2IJJA 1FXKC 4UVBA 2F93B 2FTKA 4FLVA 4J9ZB 2WWWA 2WLIB 2EILB 5L3GA 3JSNA 1DK1A 3G4SV 5CA0B 3HPLC 5E79Z 4O4JA 4X1IA 5LYJA 1YJ9V 2ADQB 3OTFA 4F6RB 4WFEA 3VQWA 4KL1A 3VBBA 2NLJC 3KKYA 5LP6A 2W6JG 3ETGA 1SF9A 4FM0A 2PYJA 3G71V 2YIAA 1RM1B 2Z5UA 2HVKC 1A32A 3TJTA 2F4VB 4X1KB 1KKDA 2VRZA 3JATA 1YJWV 2PZSA 3CE2A 5JWPA 4C7UA 3HKDA 4FLTA 1AVMA 4NKGB 1B6QA 1F23A 2P5OA 2Q7EA 5H9CA 3E8FA 1XNRB 1YIJV 3CRAA 1Z5VA 1EN4A 3RW0A 3ZMTA 5FNVA 3WG7B 1OCRB 1AR5A 5KHGA 4LC1A 1Q6HA 4U7OA 2A3QA 3JAMN 3O65A 5EC2C 4HAMA 3HKBA 2V7QG 4EEQA 3VQVA 2QJ1A 1KYOF 5KMGB 4MVZA 4DV3O 3ZJZA 3G6BA 3X2QC 2ZXWC 4DR7B 1JPXA 2PY5A 4O4IA 4LFBB 2HHHB 1H8EG 4L87A 1IBKB 2ETNA 1OJHA 3L74H 3L71H 3G67A 3JAWA 4I4TA 4GT1A 5KX5B 1Z2GA 3LSSA 2K1EA 1FJGB 2VWJA 3DC6A 2JRIA 1DTOA 1E1RG 3FB8C 3I56V 5GONA 1XMOB 3ETQA 4DR4O 1MNGA 4TV9B 1AI4A 3STLC 4ABMA 4UV9A 4LBEC 3BA8A 3UO3A 4YJ3A 2ZE7A 1YF2A 2UUAO 2BE3A 2OCCC 3CMAV 3OUFA 2LJ2A 4CS3A 3CS5A 1NR7A 4B3MO 3OMIB 3SYQA 1QNMA 2JEXA 4PJ0Z 1VQLV 1K92A 3FYIB 5J2UA 3JYCA 1RPOA 3DXRA 4LF8O 2HEPA 1VQMV 2F95B 3AG3C 5EZYB 2HJDA 4U7NA 5LGTA 4YHHO 4LF6B 2LQTA 2ILMA 3JSLA 4LFCB 3RYIA 1RSOB 1G6UA 3ZS8C 3T1HO 1HNZO 4BIOA 5B5EZ 3ABKB 3JATB 2NNUA 3HKDB 1R3JC 4JTCB 1N33O 1HDJA 1HNXO 4GX1A 1XEQA
chains in the Genus database with same CATH topology
5BR8O 3R66A 2N74A 1X59A 1AB3A 1IBLO 2DOSA 5BY1A 1IBKO 4DV1O 3J81N 4X64O 4DV3O 4NXNO 1R1BA 4DV2O 4B3SO 4DV6O 4JI2O 1F7YA 1HNWO 5LMNO 1N34O 4OX9O 1FJGO 4YY3O 2UXDO 4OPHA 4DUZO 2UU9O 4JI7O 3RT3C 1R6TA 5IT9N 2DJVA 4DUYO 4B3TO 1J5EO 1N36O 2JRIA 4X66O 2F4VO 4DR6O 3J80N 4AQYO 4X65O 2VQFO 2E5LO 4K0KO 1N32O 3M8AA 1XMQO 2ZM6O 4DR4O 1D2DA 1FYJA 1G1XB 4JI5O 2VQEO 1XNRO 4GKKO 4NXMO 1KUQA 2LW7A 2FKXA 1DK1A 4JI8O 2UUAO 4JI1O 3F5TA 5LMUO 3SDLA 5FLXN 1HR0O 4B3MO 4DR3O 2ZKOA 2Z0AA 4JI0O 4JV5O 1XNQO 4JI3O 2AGAA 4LF7O 2UXCO 2UUBO 4LF8O 4LF6O 1A32A 4A5UB 1AILA 4JI6O 4DR1O 4LFCO 4DR7O 4KHPO 4JI4O 4YHHO 1YZBA 4LF4O 4B3RO 3OTOO 4LFAO 4DV4O 5BXZA 4JYAO 1FKAO 3T1HO 4GKJO 4DV5O 4OPAA 4DR2O 1HNZO 3JAMN 4LF5O 4DV0O 3O65A 3T1YO 5H5NA 1IBMO 4X62O 4LF9O 1N33O 5IWAO 2UUCO 4DV7O 1I94O 1XMOO 2UXBO 4DR5O 5LL6Y 1NS1A 1HNXO 4LFBO 3J7AU 5A2QN 2HHHO 1XEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  3R66 A;  2N74 A;  1X59 A;  1AB3 A;  1IBL O;  2DOS A;  5BY1 A;  1IBK O;  4DV1 O;  3J81 N;  4X64 O;  4DV3 O;  4NXN O;  1R1B A;  4DV2 O;  4B3S O;  4DV6 O;  4JI2 O;  1F7Y A;  1HNW O;  5LMN O;  1N34 O;  4OX9 O;  1FJG O;  4YY3 O;  2UXD O;  4OPH A;  4DUZ O;  2UU9 O;  4JI7 O;  3RT3 C;  1R6T A;  5IT9 N;  2DJV A;  4DUY O;  4B3T O;  1J5E O;  1N36 O;  2JRI A;  4X66 O;  2F4V O;  4DR6 O;  3J80 N;  4AQY O;  4X65 O;  2VQF O;  2E5L O;  4K0K O;  1N32 O;  3M8A A;  1XMQ O;  2ZM6 O;  4DR4 O;  1D2D A;  1FYJ A;  1G1X B;  4JI5 O;  2VQE O;  1XNR O;  4GKK O;  4NXM O;  1KUQ A;  2LW7 A;  2FKX A;  1DK1 A;  4JI8 O;  2UUA O;  4JI1 O;  3F5T A;  5LMU O;  3SDL A;  5FLX N;  1HR0 O;  4B3M O;  4DR3 O;  2ZKO A;  2Z0A A;  4JI0 O;  4JV5 O;  1XNQ O;  4JI3 O;  2AGA A;  4LF7 O;  2UXC O;  2UUB O;  4LF8 O;  4LF6 O;  1A32 A;  4A5U B;  1AIL A;  4JI6 O;  4DR1 O;  4LFC O;  4DR7 O;  4KHP O;  4JI4 O;  4YHH O;  1YZB A;  4LF4 O;  4B3R O;  3OTO O;  4LFA O;  4DV4 O;  5BXZ A;  4JYA O;  1FKA O;  3T1H O;  4GKJ O;  4DV5 O;  4OPA A;  4DR2 O;  1HNZ O;  3JAM N;  4LF5 O;  4DV0 O;  3O65 A;  3T1Y O;  5H5N A;  1IBM O;  4X62 O;  4LF9 O;  1N33 O;  5IWA O;  2UUC O;  4DV7 O;  1I94 O;  1XMO O;  2UXB O;  4DR5 O;  5LL6 Y;  1NS1 A;  1HNX O;  4LFB O;  3J7A U;  5A2Q N;  2HHH O;  1XEQ A; 
#chains in the Genus database with same CATH topology
 2QWP B;  5L3F A;  1DF4 A;  4R7C A;  4NB5 A;  1CXZ B;  3K5M A;  3ZN0 A;  4Z1M G;  3DSQ A;  3W7T A;  2A9H A;  4LH6 A;  1K7D A;  1EBO A;  3QO5 A;  5CB4 B;  4NXN B;  2UU9 O;  3BEH A;  2F23 A;  4DUY O;  3UCS C;  1YI2 V;  2E74 B;  4YY3 B;  1IXB A;  2A06 H;  2JEU A;  1N32 O;  4IT5 A;  1K8A W;  2JGD A;  2OTJ V;  4E4E A;  3E8B A;  3QG5 A;  3U0Z A;  3AG2 B;  4I5S A;  1D5A A;  1JCH A;  1D5N A;  4NXM O;  4WFA V;  2ZM6 B;  1PNK A;  2BCC H;  3P3P A;  4MSW C;  2CDY A;  4RQE A;  4TUY B;  2ZNI A;  1H2K A;  1PKX A;  1M4U A;  5FPR A;  2WLN A;  4PA7 A;  1S5J A;  2DQ0 A;  3ABL B;  3FX7 A;  5AG2 A;  5LP6 C;  5C8Y A;  3TXQ A;  4O2A B;  2GV9 A;  4AQY B;  2O57 A;  3CME V;  3P30 A;  1G8M A;  2LO1 A;  4DRX B;  1VQ6 V;  2QE7 G;  3RYH A;  1M1K W;  5B3S B;  2IW5 A;  3K9S A;  3LNM B;  1E79 G;  4DYL A;  4GYC B;  2F43 G;  4IL6 Z;  1SQX H;  4P9O A;  2ZDI A;  1MZE A;  3APQ A;  1HR0 B;  4LF4 B;  5B1A B;  2P90 A;  3CP1 A;  2X6B A;  3CXC U;  3UQ8 A;  2DYS B;  5LL6 Y;  3RYF B;  3CCJ V;  5KHK A;  3J81 N;  4ZBM A;  4NTX A;  3E35 A;  3LDE A;  2ZE6 A;  2DW4 A;  1ZUQ A;  4UXN A;  2CGO A;  1P4R A;  4O4H A;  5B1N A;  4EKW A;  3JAL A;  1QBZ A;  3OTO B;  1BQ0 A;  4JI2 B;  1GN2 A;  3E22 B;  5LMN B;  3OE7 G;  1OCZ B;  1Q6I A;  3L70 H;  1Q7Y W;  4DUZ B;  1VQP V;  1WAZ A;  4JI7 B;  4J11 A;  2F4V O;  2XAQ A;  2PUS A;  3D36 C;  4CZZ A;  2QM7 A;  4UCU A;  3L73 H;  4EFE A;  3K5O A;  5GW7 A;  1NJI W;  3UO2 A;  1Y76 B;  2M6Y A;  1H2L A;  1IVS A;  2E5L B;  1XNR O;  1QR8 A;  3F7V C;  3ASO C;  3F5T A;  2H8P C;  2PYL A;  3ZCC A;  1SQG A;  3UKM A;  1WLE A;  2ZKO A;  4BW5 A;  4JI0 O;  1FXK A;  2ZD9 A;  5EIB D;  2EIK C;  1M57 B;  4BIU A;  3OMA B;  2JVD A;  2XT9 A;  1ZLZ A;  3S3X A;  2DN9 A;  3M99 B;  1YTF B;  4MW8 A;  2HR3 A;  4CC5 A;  1GN3 A;  4QPJ A;  1L8D A;  4DR7 O;  3FB5 C;  2BTO A;  5D5P A;  3IFX A;  5B66 Z;  1XQ8 A;  4DR1 B;  5BMV B;  3O9O A;  3JAK B;  4WFF A;  4JYY A;  1MZF A;  2VWK A;  3AG1 B;  5IYZ B;  4GKJ O;  2ARH A;  2Y4U A;  3D8C A;  3CD6 V;  2WLL A;  4LFA B;  1JMK C;  1XMO O;  2DYR B;  2IH3 C;  4LF7 B;  1ROP A;  2UUB B;  2GBO A;  2N74 A;  1SA0 A;  5IWA B;  4DK1 A;  3NR7 A;  2GSM B;  1JR9 A;  3OEH G;  2MK3 A;  2QM4 A;  5BR8 B;  1Q82 W;  1GAX A;  1H2M A;  3K04 A;  1QLN A;  4I55 B;  3L75 H;  4FPP A;  2VS0 A;  4UV8 A;  4X89 A;  4B3T O;  2ZNJ A;  1QVF U;  4MVS A;  3K59 A;  1IX9 A;  1M56 C;  5LA6 A;  3CCS V;  4DR6 O;  1JQ0 A;  3RBZ A;  2K9P A;  3Q4H B;  1Y74 B;  3SYC A;  5JVD A;  1SZT A;  4FFB A;  4MTX A;  1T5E A;  1TVK A;  1WA8 A;  1ARO P;  4MTO A;  4X64 B;  3RVZ A;  4Z1V A;  3QO7 A;  3WB1 A;  1US6 A;  2QKC A;  3JD4 A;  3KCY A;  2FML A;  4IHJ A;  3KZI Z;  5H6Q A;  3LUT B;  4NR1 A;  4DR3 O;  1KP2 A;  4PDR A;  2ZQM A;  2XHB A;  1VQ5 V;  1CPY A;  1Y6X A;  3ICX A;  1IXM A;  2P4K A;  1SQF A;  3KG2 A;  2IJK A;  5JJJ B;  3SJB C;  4FFK A;  4MVO A;  2EIJ C;  4R8C A;  4FLU A;  1V55 C;  4X1Y A;  4JI5 B;  1M93 A;  3B2E E;  1U97 A;  1Y66 A;  2KB1 A;  5E1A C;  5KHH A;  5L3E A;  3QTC A;  4B08 A;  4ZI7 A;  3B09 A;  2OIG A;  1H38 A;  3QVN A;  3CCQ V;  2Q73 A;  2RCV A;  3T1Y O;  1LUV A;  4LWS A;  5LXT A;  1KEC A;  3E8H A;  2UXC B;  2D3O W;  4HNA B;  3CC4 V;  1JJO A;  1AB3 A;  4TSF G;  2E75 B;  1Q3E A;  3A8T A;  2LW1 A;  1NU1 H;  1FS0 G;  1XDC A;  2KG7 A;  4DV7 B;  3ZRX A;  4ZHQ B;  4G27 B;  1XBL A;  4RAI A;  2LP7 A;  4JZ2 A;  2CGN A;  1BL8 A;  2YI8 A;  4FM1 A;  4JYA B;  2HFE C;  2F66 C;  4H13 B;  1WNS A;  2EIM B;  1SA0 B;  2ODM A;  4UB6 Z;  4FK5 C;  4AQY O;  3AG7 A;  1TUE B;  4PV1 B;  4CH6 A;  1AJP A;  1EZJ A;  3LDC A;  3STZ C;  4GZR B;  1JA8 A;  3HKE A;  4NVP A;  2LW7 A;  2Q0O C;  3AG4 B;  3L72 H;  2JK5 C;  5LHH A;  3SDL A;  1HR0 O;  5J2T B;  3X2Q B;  2ZXW B;  2IM9 A;  4UCV A;  2Q9L A;  4X88 A;  5IY5 C;  1TVK B;  2L35 A;  2AHY A;  4O2B A;  4X65 B;  5DN6 G;  5IJ0 A;  1WP8 A;  3CCR V;  4RUF A;  1VEW A;  2L6L A;  4I0X A;  4IHJ B;  3JAR A;  4IYH A;  1WB7 A;  4MVQ A;  3HB3 B;  4ZKI A;  4GX0 A;  1KC8 W;  3A0R A;  1ZTE A;  2IBZ H;  5KA6 A;  1IZ3 A;  3OTO O;  1M5I A;  5BXZ A;  2Y69 C;  4MW3 A;  1BCC H;  2QDO A;  2ZCE A;  4H37 A;  1B3Q A;  2OCC B;  3ASN B;  3IC9 A;  2XAH A;  4JZG A;  2H94 A;  3UM7 A;  1I94 O;  1SKV A;  4ICG A;  4X1Y B;  1HNW O;  1PV0 A;  1VQ7 V;  1IBL O;  1IBM B;  2QWO B;  2Y0P A;  3SR2 C;  1S5L Z;  5KAF Z;  1FXH A;  4DV1 B;  2GUZ A;  1WPX A;  4OPH A;  2YID A;  4YXW G;  5JJN B;  2LFR A;  2EJR A;  2ITD C;  5EBL C;  2M7W A;  3G80 A;  4K8X A;  1XRE A;  1R3K C;  4OGQ B;  1O9H A;  3CHX A;  2UUC B;  3S3W A;  1OCC B;  2EIN B;  2YEV B;  3CC2 V;  1G1X B;  4LNU A;  3OW2 U;  4UCR A;  2VQE O;  5ITZ B;  4K0K B;  2IJH A;  1OCO C;  4Q6G A;  2WLH A;  4PA4 A;  1P7G A;  4XDL A;  4DV6 B;  2YI9 A;  1AP5 A;  1BGY H;  2YIB A;  2IU3 A;  4LP8 A;  2EBO A;  2GTS A;  3ZHT A;  3D36 A;  4KXR A;  1K97 A;  1FFX A;  2LGW A;  4WBN B;  3MHH C;  4JI1 B;  2ZE8 A;  2XOK G;  1NTK H;  3JD2 A;  5HFM A;  3H1L H;  3C3T A;  4LF7 O;  2HKO A;  5JH7 A;  4K8Z A;  2UUB O;  1URF A;  5IJ9 A;  1N36 B;  1K9M W;  2JJ1 G;  5JQG A;  5KLV H;  4TV8 A;  4H33 A;  5H6R A;  2PGG A;  4JAA A;  4YJ2 A;  2BTQ A;  3ZRW A;  1ZL8 B;  2EIL C;  4P30 A;  3WU2 Z;  4BR6 A;  3ZHS A;  1KKC A;  4I9Q A;  4D6T H;  5GTI Z;  4Q20 A;  4PI2 A;  4B3R O;  1YCI A;  2AW9 A;  4DV5 O;  4LH7 A;  4DR2 O;  2EZO A;  3AK2 A;  2BOB C;  1N8R W;  5CA1 A;  2PI4 A;  3BVO A;  4JF3 A;  4I0X B;  1YDX A;  1LNQ A;  2YXH A;  1VQ8 V;  4O4J B;  4X1I B;  3B8N A;  5LYJ B;  5KUM A;  1YSC A;  4X62 B;  3ML0 A;  4X64 O;  1AI7 A;  3RFR A;  3OGC C;  5LP6 B;  5LHG A;  4KHP B;  5JCO C;  3CRQ A;  1EM1 A;  1K4C C;  1Q5O A;  3VOU A;  1BMF G;  4XBF A;  1OCR C;  3EHB B;  3RT3 C;  2QWR B;  3SJQ C;  4DV4 B;  2YSU B;  1NT2 B;  2ADP A;  3LSU A;  3K79 A;  3ZMS A;  4P9P A;  4FLW A;  4H0L B;  1GTO A;  3N2G A;  4X66 O;  1AJN A;  4I50 A;  2IJI A;  1FAF A;  5IDJ A;  1I0H A;  5FNV B;  1KBH A;  1J5E B;  5A9G A;  2Y4T A;  2YIC A;  2X6A A;  1VF7 A;  3JCU Z;  4J42 A;  2XAS A;  4EB6 A;  4JI5 O;  5LOV A;  2FYU H;  4J9Y B;  2FKX A;  3HKB B;  1SER A;  3OMN B;  1KB9 F;  1N34 B;  1QLE B;  1GMG A;  2DQ3 A;  4JV5 O;  2ZE5 A;  4O4I B;  1EFR G;  1L0L H;  5LMU B;  1H2N A;  1CP9 A;  3G6E V;  4NTY A;  4XDK A;  2UXC O;  4J10 A;  1JFF A;  3H9V A;  4AHC A;  4MS2 A;  3E2E A;  3JAW B;  4I4T B;  2VQF B;  3F5W C;  3JD1 A;  3CRR A;  4QIW F;  1YHQ V;  2Q4P A;  3FYE B;  1VF5 B;  3GWK C;  3ETD A;  1IUR A;  1V54 C;  3SYO A;  1S0V A;  3UT5 A;  1RPR A;  2GHY A;  5EYP A;  4FZ0 A;  5GON B;  5LGN A;  4X20 A;  1JOY A;  1YXB A;  4AI8 A;  4JYA O;  2DE0 X;  3K58 A;  1PNM A;  2YUA A;  3SGI A;  1PPJ H;  4LR3 A;  2QA4 V;  4LF5 O;  3ASO B;  4X9Q A;  4YJ2 B;  4JAV A;  3APO A;  4YJ3 B;  3EXA A;  1GM8 A;  2UXB O;  2P22 C;  1XHX A;  4HYO A;  3E8G A;  3TCU A;  3OGI B;  3C3S A;  1W59 A;  4IIJ A;  5J2U B;  3GWO A;  3DXR B;  3WB2 A;  4WF9 V;  1AI5 A;  3ABK C;  1QR9 A;  4DV2 B;  2DJV A;  4F6E A;  3SJC C;  4MT8 A;  4QE7 A;  1XIL A;  2UXD B;  4XDJ A;  1Z5W A;  4BWA A;  4I9W A;  3RYI B;  1E1Q G;  3U10 A;  4X65 O;  1D2D A;  2JDI G;  1KQS U;  2V4D A;  1EZV H;  3HKC A;  4J7K A;  5FL7 G;  5TIS Z;  2KQX A;  1KUQ A;  1XMQ B;  1XOU A;  4B3S B;  4MTF A;  1VF6 C;  1FXV A;  1H8H G;  2B5U A;  4I7Z B;  2Q5Z A;  2WLJ A;  3CJH A;  2WLK A;  5CBH A;  2OIE A;  2OTL V;  3CX5 F;  1X4T A;  3ZRV A;  1NI8 A;  4EB6 B;  1WPB A;  5LOV B;  4PDL A;  5EBW C;  4TWK A;  1BHA A;  4CC6 A;  1M56 B;  2NR5 A;  2A7W A;  4PA9 A;  1OZ0 A;  4UFZ A;  3JD3 A;  3CCM V;  3RYC A;  1YTF D;  3B4S A;  3FFQ A;  2Q8V A;  1GN6 A;  4YIO A;  4JYB A;  3FD9 A;  3CPW U;  2JGD B;  1KD1 W;  1TGO A;  5B1O A;  4N23 A;  3ABL C;  4YIP A;  1P84 F;  5EC1 C;  1XNQ B;  1AI6 A;  2UUC O;  2JS5 A;  3RN4 A;  1DLB A;  4UB8 Z;  4LFB O;  1NTM H;  2Q67 A;  3MAQ A;  2HHH O;  4UCS A;  2ITC C;  4R6Z A;  1GK9 A;  1IBK O;  4X20 B;  4PD4 F;  4JI6 B;  5B3S C;  1FPO A;  4ASU G;  4DV6 O;  3JCZ A;  5C8Y B;  1FJG O;  1IDS A;  4DV3 B;  2YC0 A;  5GTH Z;  2EIJ B;  2JGU A;  5IT9 N;  1K5S A;  3ZBH A;  2YXL A;  2RQ6 A;  3RYH B;  3SPJ A;  1N36 O;  2DYS C;  5LBQ A;  4IIJ B;  5JJE B;  1ZX3 A;  3M8A A;  2QTS A;  1Q86 W;  1FYJ A;  3WB0 A;  3I5D A;  5B1B B;  5EBM C;  3ABM C;  4X8A A;  3T2M A;  3KCX A;  2V1D A;  5LHI A;  4DR4 B;  2W6I G;  1SET A;  3BHP A;  1Q6U A;  1GH6 A;  4PEL A;  2WAM A;  4KFM A;  4TOI A;  1OCZ C;  2Z0A A;  4DO2 A;  1H2G A;  2UUA B;  5K1X A;  3HKC B;  5KA5 A;  2RMK B;  4K3A A;  4B3M B;  2CK3 G;  4O4H B;  1VQ4 V;  1R6K A;  2QEX V;  4PDM A;  4LF6 O;  4A5U B;  3JAL B;  3CCU V;  4FVM A;  2OWO A;  4LFC O;  3OR7 C;  3K0G A;  3QNE A;  4KHP O;  4O4L A;  3CJH B;  4LF8 B;  3OEE G;  3IJ4 A;  4GKK B;  3BFR A;  1K4D C;  3ZHR A;  1FD9 A;  3CRC A;  4DV4 O;  1K33 A;  4YHH B;  2UXX A;  4JTD B;  2JS3 A;  1M57 C;  4DK0 A;  5H5N A;  2WLI A;  3T1H B;  3QO8 A;  1I5X A;  3SYA A;  4QGP A;  2P06 A;  1NS1 A;  2XND G;  4BAY A;  3RYC B;  3SPG A;  5KUK A;  5EIB C;  4F6R A;  1FXK B;  1N33 B;  4NXN O;  1CEZ A;  4IGG A;  2CH7 A;  2QR4 A;  3ZRS A;  1U96 A;  3ZHU A;  1N34 O;  3AG1 C;  4YY3 O;  3GVM A;  2KKW A;  4L8J A;  1DGS A;  2WPD G;  3JAS A;  4JTA B;  2DYR C;  2EJ7 A;  4DV0 B;  2E3C A;  4B7E A;  4CS4 A;  5JCO A;  3K57 A;  4LF9 B;  1PP9 H;  5F2V O;  2VQF O;  4DUY B;  2ZM6 O;  4DR5 B;  2CUG A;  1THZ A;  1L1F A;  4FLZ A;  2KSD A;  1NKD A;  2WLL B;  1N32 B;  4UCT A;  4JGS A;  3LDD A;  2QKA A;  5KMG A;  4NXM B;  1Q8I A;  2JJ2 G;  2AZ2 A;  3JD0 A;  1NH2 D;  4JAU A;  2P7T C;  2GTA A;  2Q7H A;  4IYI A;  3PJS K;  2EX3 A;  1AIL A;  5KX5 A;  1NH2 B;  3ZMU A;  3H1I H;  3D3I A;  4KP4 A;  4RWU A;  4PA6 A;  3QF7 A;  4TQF A;  4ZOL A;  5LA6 B;  3SPI A;  4LF4 O;  2QWN B;  5JVD B;  1QCE A;  3CXH F;  4FFB B;  1TAE A;  2Q6A A;  5IYC O;  2RN9 A;  1NZ6 A;  2PF4 E;  1OCO B;  1WP7 A;  1QU7 A;  1WA8 B;  2LGQ A;  4K35 A;  5FPO A;  3CEI A;  2ZR2 A;  1QQC A;  5K1P A;  2Y48 A;  2YS8 A;  1G4Y B;  3B40 A;  3R66 A;  1X59 A;  3H1K H;  1WN7 A;  1K73 W;  2NN4 A;  2N04 A;  3LSQ A;  3CC7 V;  4B3S O;  1N4C A;  4JI2 O;  2W0X A;  3BAA A;  1SS3 A;  1N0J A;  4U3F H;  1F4M A;  5LMN O;  1F7Y A;  3AK3 A;  1RFY A;  4UVA A;  4LCU C;  4DUZ O;  4JI7 O;  1UJW B;  1YVW A;  1ORQ C;  5IYD O;  5EZY A;  4J41 A;  2B9Z A;  3OD4 A;  2XAF A;  1MSD A;  5L3C A;  2B1I A;  1Y67 A;  1S3J A;  2QWQ B;  2E5L O;  4ZI7 B;  1BQZ A;  2CH7 B;  1RSO A;  3MD0 A;  1V9P A;  5CMU A;  5CBG A;  1XI1 A;  1BE3 H;  3AK1 A;  1UPG A;  3OAA G;  1WB8 A;  1ZWI C;  1R73 A;  3AG3 B;  1VIB A;  5L3B A;  3W7U A;  1P49 A;  4CBC A;  3C90 A;  4LWS B;  1GO3 F;  3JAS B;  5LXT B;  3FB6 C;  4OX9 B;  1Y4M A;  4QJF B;  2EIM C;  4N21 A;  1W0K G;  2KG7 B;  1BHB A;  1XUQ A;  1XNQ O;  3FAV A;  3OFN G;  4FIP C;  3E83 A;  1KP3 A;  2UXN A;  1VMG A;  4GLX A;  4JI0 B;  5CB4 A;  1VF6 A;  4JI6 O;  4DR1 O;  3CCL V;  3W7S A;  2A79 B;  3AG4 C;  4FMT A;  1YZB A;  3K06 A;  4JPR A;  2QSA A;  4LFA O;  3OT7 A;  1FKA O;  3ABU A;  4OPA A;  5LGU A;  3ZX6 A;  3ZHV A;  2Q0A A;  2IU0 A;  3ZIA G;  3HKE B;  5IWA O;  4GKJ B;  3K3W A;  4ZOL B;  3DGE A;  5BR8 O;  2FB5 A;  2XAJ A;  3OM3 B;  3NXS A;  3T1C A;  1R6N A;  4CH4 A;  1BS3 A;  4TUY A;  3I55 V;  2FL4 A;  1AR1 B;  4JI4 B;  4MVU A;  3B77 A;  3PN1 A;  1GRJ A;  3ZN1 A;  4O2A A;  4O2B B;  3B8M A;  4J7J A;  5IJ0 B;  2X0L A;  1R6T A;  3TXS A;  1RM1 C;  3ASN C;  1V54 B;  1PM9 A;  2R9A A;  3RVY A;  3JAR B;  1B06 A;  4DRX A;  2P67 A;  2QGN A;  4RQF A;  2HVJ C;  1GM9 A;  1K34 A;  1GM7 A;  4B3T B;  2HG5 C;  4CS2 A;  4DR6 B;  3N27 A;  4HZ3 A;  3WG7 C;  1SQQ H;  4GKK O;  1GN4 A;  1JX9 A;  2YDE A;  4G2K A;  3F7Y C;  3VQY A;  2QKS A;  4OXS A;  3RYF A;  5EK0 A;  3OR6 C;  4DW0 A;  1YEW A;  5C93 A;  4DR3 B;  1OCC C;  2EIN C;  1JVM A;  2GUZ B;  1LR1 A;  1GKF A;  2AHZ A;  4UCO A;  4BIZ A;  1YJN V;  2ZIO A;  1NVP D;  2CTW A;  3E22 A;  4P2Z A;  1HP8 A;  2Q69 A;  3LNN A;  3TGU H;  2E76 B;  4H44 B;  5D5Q A;  4PHZ A;  1N0N A;  1MG1 A;  4J7Z A;  3FAV B;  2YIB D;  4JI8 B;  4PDV A;  4CH3 A;  3A2F A;  1Y76 A;  1NVP B;  1Q43 A;  4LNU B;  2PTM A;  2Q68 A;  4DV0 O;  4LF9 O;  2PI5 A;  3R65 A;  4DV7 O;  3TK1 A;  1TA8 A;  3BAB A;  4JI3 B;  4DR5 O;  1I7F A;  2G38 A;  2GDS A;  4Z2W A;  3T4Z A;  3T1Y B;  1FFX B;  4F4L A;  2ZT9 B;  1MMM A;  4JYC A;  1Q90 D;  5JH7 B;  5IJ9 B;  4JAS A;  1EN5 A;  5JQG B;  1SQB H;  1M90 W;  3BA9 A;  4TV8 B;  1HWY A;  2DMX A;  1J95 A;  2BTQ B;  1COW G;  1B04 A;  1PL0 A;  3ZRW B;  4AIL C;  2RDC A;  4FLX A;  3MHS C;  4GX2 A;  3HR0 A;  4RUE A;  4WCE V;  2EIK B;  4W4L A;  4WFG A;  5BMV A;  5CN0 A;  3JAK A;  1XHZ A;  4WFH A;  2X7R B;  5IYZ A;  2N05 A;  2AXT Z;  3K03 A;  5CA1 B;  1RP3 B;  1UFI A;  1WJZ A;  2MW2 B;  3IAY A;  2R72 A;  1F51 A;  2Y0I A;  3M7M X;  5FLX N;  3W7X A;  4PA3 A;  5L3D A;  4U3J A;  1SES A;  5CBF A;  2QTO A;  3OUS A;  2CTR A;  1KU9 A;  3GB7 C;  1KMI Z;  1TUB A;  3EFF K;  1M9N A;  3DC5 A;  1P7B A;  4I55 A;  2JIZ G;  2HJF C;  2Z3Y A;  2Q7G A;  4QNH B;  4KUM A;  1BZK A;  3BY6 A;  3N2G B;  2YXY A;  4I50 B;  3RGB A;  2D2C B;  1QLE C;  3WFV A;  3Q4H A;  1Y74 A;  3ABM B;  3CYO A;  3DTU B;  5KAI Z;  4FJC C;  3ABT A;  1IBM O;  2RJZ A;  3K0D A;  5DEC A;  3ZMZ A;  2DWD C;  3AG2 C;  2ATK C;  2P6J A;  4E2L A;  1DF5 A;  5DM6 V;  3MDS A;  3CRM A;  3P3N A;  2DOS A;  3TET A;  5BY1 A;  4DV1 O;  2ZIN A;  1Q81 W;  1I94 B;  1R1B A;  5KHI A;  2OT5 A;  2BSK A;  3L9D A;  2IH1 C;  1HNW B;  5J9P C;  4OX9 O;  1JFF B;  1IBL B;  2EZP A;  2A0L A;  2CAZ C;  5IYB O;  4QE9 A;  2P4V A;  5DED A;  2WSS G;  3UT5 B;  3ZMV A;  1MA1 A;  5EYP B;  3AEI A;  3U11 A;  1OHH G;  1SQV H;  4K0K O;  1XL6 A;  1QHT A;  3P32 A;  4MVM A;  1AP6 A;  1PD3 A;  4TQD A;  3CCV V;  1VQK V;  5B1A C;  1V55 B;  4JI1 O;  2F1M A;  1S76 D;  4GCZ A;  4D7T A;  2VQE B;  4HNA A;  4NYK A;  3CB2 A;  3A0H Z;  3VQX A;  2H3O A;  4FZ1 A;  4FLY A;  1I08 A;  4ZHQ A;  3E89 A;  3CCE V;  3D3Q A;  2QM8 A;  2XAG A;  1EN6 A;  4G28 B;  4DXW A;  3K5L A;  2X6C A;  1S77 D;  1I5Y A;  4JI4 O;  3H1H H;  2CTQ A;  1BSM A;  4U3J B;  1VP7 A;  1R3I C;  4MVR A;  2BOC C;  4RO2 A;  3K08 A;  3N2K A;  1MAB G;  4PI0 A;  1TUB B;  2W0F C;  1VQ9 V;  1K5Q A;  4TT3 G;  3SPH A;  3SPC A;  4QPK A;  1SQP H;  1HW7 A;  4B3R B;  1PL4 A;  4X62 O;  1MSW D;  3SJA C;  3EVK A;  4DV5 B;  2OCH A;  4DR2 B;  2OYQ A;  2ZIM A;  1F4N A;  3J7A U;  5A2Q N;  5J2T A;  3THO A;  1ZSP A;  1W2B U;  1AJQ A;  1JJ2 U;  3W7W A;  1XL4 A;  1OV9 A;  4CH5 A;  2WLM A;  3ZHQ A;  1SRY A;  3BPZ A;  4GX5 A;  1NQT A;  4B7K A;  2ZR3 A;  4UUJ C;  3SYP A;  3BCC H;  4EFB A;  3ZED A;  1J5E O;  1HNZ B;  5CA0 A;  3RWR D;  2R9I A;  2WA4 A;  5IY5 B;  3J80 N;  2R70 A;  1SZX A;  1NTZ H;  3BRC A;  3FKS G;  2BSK B;  1SC5 B;  3ETE A;  4DW1 A;  1NBM G;  1HNX B;  3CWB H;  1LUW A;  1BT8 A;  3IC7 A;  4X66 B;  2C2A A;  4FM2 A;  4X1K A;  2WA3 A;  4JI8 O;  5LMU O;  1VAR A;  1YIT V;  5HFL A;  4ZIB A;  5CA3 A;  2UU9 B;  1S72 V;  2Y69 B;  1ZAU A;  2HP8 A;  2B1G A;  4JI3 O;  2AGA A;  4BW9 A;  1ENV A;  2ZDI C;  4GUN A;  3E86 A;  1R3L C;  2XTA A;  1VQO V;  4JV5 B;  3CSX A;  2LFS A;  5B1B C;  5H2F Z;  3IGA C;  2XUM A;  2HLD G;  5BZB A;  1MOF A;  2R9R B;  1K3E A;  3A0B Z;  3K5N A;  3T4D A;  4J80 A;  1FFT B;  2AZ0 A;  1O9G A;  2YEV A;  4UVC A;  3FB7 C;  5ITZ A;  4NTW A;  2EUL A;  3K9A A;  2DWE C;  1AR4 A;  4W4K A;  4LF5 B;  3H01 A;  5IE9 A;  3N2K B;  4R50 A;  2UXB B;  4WBN A;  4D7S A;  4DV2 O;  1VQN V;  4WFB V;  4HBN A;  4MTG A;  4TV9 A;  2UXD O;  2CTP A;  1S5H C;  3H1J H;  4O4L B;  1L0N H;  1PNL A;  1ZL8 A;  2CE4 A;  1H2S B;  5KHJ A;  1W0J G;  2RNB A;  1NR1 A;  1XMQ O;  1QVG U;  2IJJ A;  1FXK C;  4UVB A;  2F93 B;  2FTK A;  4FLV A;  4J9Z B;  2WWW A;  2WLI B;  2EIL B;  5L3G A;  3JSN A;  1DK1 A;  3G4S V;  5CA0 B;  3HPL C;  5E79 Z;  4O4J A;  4X1I A;  5LYJ A;  1YJ9 V;  2ADQ B;  3OTF A;  4F6R B;  4WFE A;  3VQW A;  4KL1 A;  3VBB A;  2NLJ C;  3KKY A;  5LP6 A;  2W6J G;  3ETG A;  1SF9 A;  4FM0 A;  2PYJ A;  3G71 V;  2YIA A;  1RM1 B;  2Z5U A;  2HVK C;  1A32 A;  3TJT A;  2F4V B;  4X1K B;  1KKD A;  2VRZ A;  3JAT A;  1YJW V;  2PZS A;  3CE2 A;  5JWP A;  4C7U A;  3HKD A;  4FLT A;  1AVM A;  4NKG B;  1B6Q A;  1F23 A;  2P5O A;  2Q7E A;  5H9C A;  3E8F A;  1XNR B;  1YIJ V;  3CRA A;  1Z5V A;  1EN4 A;  3RW0 A;  3ZMT A;  5FNV A;  3WG7 B;  1OCR B;  1AR5 A;  5KHG A;  4LC1 A;  1Q6H A;  4U7O A;  2A3Q A;  3JAM N;  3O65 A;  5EC2 C;  4HAM A;  3HKB A;  2V7Q G;  4EEQ A;  3VQV A;  2QJ1 A;  1KYO F;  5KMG B;  4MVZ A;  4DV3 O;  3ZJZ A;  3G6B A;  3X2Q C;  2ZXW C;  4DR7 B;  1JPX A;  2PY5 A;  4O4I A;  4LFB B;  2HHH B;  1H8E G;  4L87 A;  1IBK B;  2ETN A;  1OJH A;  3L74 H;  3L71 H;  3G67 A;  3JAW A;  4I4T A;  4GT1 A;  5KX5 B;  1Z2G A;  3LSS A;  2K1E A;  1FJG B;  2VWJ A;  3DC6 A;  2JRI A;  1DTO A;  1E1R G;  3FB8 C;  3I56 V;  5GON A;  1XMO B;  3ETQ A;  4DR4 O;  1MNG A;  4TV9 B;  1AI4 A;  3STL C;  4ABM A;  4UV9 A;  4LBE C;  3BA8 A;  3UO3 A;  4YJ3 A;  2ZE7 A;  1YF2 A;  2UUA O;  2BE3 A;  2OCC C;  3CMA V;  3OUF A;  2LJ2 A;  4CS3 A;  3CS5 A;  1NR7 A;  4B3M O;  3OMI B;  3SYQ A;  1QNM A;  2JEX A;  4PJ0 Z;  1VQL V;  1K92 A;  3FYI B;  5J2U A;  3JYC A;  1RPO A;  3DXR A;  4LF8 O;  2HEP A;  1VQM V;  2F95 B;  3AG3 C;  5EZY B;  2HJD A;  4U7N A;  5LGT A;  4YHH O;  4LF6 B;  2LQT A;  2ILM A;  3JSL A;  4LFC B;  3RYI A;  1RSO B;  1G6U A;  3ZS8 C;  3T1H O;  1HNZ O;  4BIO A;  5B5E Z;  3ABK B;  3JAT B;  2NNU A;  3HKD B;  1R3J C;  4JTC B;  1N33 O;  1HDJ A;  1HNX O;  4GX1 A;  1XEQ A; 
#chains in the Genus database with same CATH homology
 5BR8 O;  3R66 A;  2N74 A;  1X59 A;  1AB3 A;  1IBL O;  2DOS A;  5BY1 A;  1IBK O;  4DV1 O;  3J81 N;  4X64 O;  4DV3 O;  4NXN O;  1R1B A;  4DV2 O;  4B3S O;  4DV6 O;  4JI2 O;  1F7Y A;  1HNW O;  5LMN O;  1N34 O;  4OX9 O;  1FJG O;  4YY3 O;  2UXD O;  4OPH A;  4DUZ O;  2UU9 O;  4JI7 O;  3RT3 C;  1R6T A;  5IT9 N;  2DJV A;  4DUY O;  4B3T O;  1J5E O;  1N36 O;  2JRI A;  4X66 O;  2F4V O;  4DR6 O;  3J80 N;  4AQY O;  4X65 O;  2VQF O;  2E5L O;  4K0K O;  1N32 O;  3M8A A;  1XMQ O;  2ZM6 O;  4DR4 O;  1D2D A;  1FYJ A;  1G1X B;  4JI5 O;  2VQE O;  1XNR O;  4GKK O;  4NXM O;  1KUQ A;  2LW7 A;  2FKX A;  1DK1 A;  4JI8 O;  2UUA O;  4JI1 O;  3F5T A;  5LMU O;  3SDL A;  5FLX N;  1HR0 O;  4B3M O;  4DR3 O;  2ZKO A;  2Z0A A;  4JI0 O;  4JV5 O;  1XNQ O;  4JI3 O;  2AGA A;  4LF7 O;  2UXC O;  2UUB O;  4LF8 O;  4LF6 O;  1A32 A;  4A5U B;  1AIL A;  4JI6 O;  4DR1 O;  4LFC O;  4DR7 O;  4KHP O;  4JI4 O;  4YHH O;  1YZB A;  4LF4 O;  4B3R O;  3OTO O;  4LFA O;  4DV4 O;  5BXZ A;  4JYA O;  1FKA O;  3T1H O;  4GKJ O;  4DV5 O;  4OPA A;  4DR2 O;  1HNZ O;  3JAM N;  4LF5 O;  4DV0 O;  3O65 A;  3T1Y O;  5H5N A;  1IBM O;  4X62 O;  4LF9 O;  1N33 O;  5IWA O;  2UUC O;  4DV7 O;  1I94 O;  1XMO O;  2UXB O;  4DR5 O;  5LL6 Y;  1NS1 A;  1HNX O;  4LFB O;  3J7A U;  5A2Q N;  2HHH O;  1XEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...