4X64O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x64O00
2AGAA 4LF5O 1XMQO 4DR4O 2UXBO 4LF8O 4X65O 1HR0O 3RT3C 1N34O 3SDLA 2JRIA 5H5NA 5IWAO 3F5TA 1FYJA 1XNRO 2DJVA 1R1BA 1I94O 1G1XB 4DR1O 2Z0AA 4JI8O 4DV2O 4DUZO 2DOSA 3T1YO 2FKXA 2UU9O 2UUCO 4LFAO 4X62O 3R66A 4LFBO 4JI7O 5LMNO 4JI1O 4B3TO 1N32O 3M8AA 5BXZA 4DV7O 5LMUO 4DV4O 1FKAO 4K0KO 4GKJO 1XNQO 1HNXO 2N74A 1A32A 1N36O 4GKKO 4JI0O 4JI4O 1D2DA 1AILA 4LF6O 1HNZO 5LL6Y 4B3MO 2ZM6O 3T1HO 4DUYO 2F4VO 5BY1A 4DR5O 4OPAA 4NXMO 1YZBA 3OTOO 4A5UB 4DR6O 4JI5O 4OX9O 1NS1A 4KHPO 4JYAO 3J80N 4DR7O 5FLXN 4JI6O 4LF7O 3J7AU 4LF9O 1AB3A 3JAMN 1KUQA 1DK1A 2UUBO 4B3RO 4DV1O 4DV0O 4LF4O 2UXCO 2VQFO 4DR3O 4B3SO 2VQEO 4DR2O 4JI3O 1R6TA 2UXDO 1X59A 2HHHO 5A2QN 4OPHA 2E5LO 4NXNO 4LFCO 4DV6O 1F7YA 1IBLO 1N33O 3J81N 5IT9N 4JV5O 1IBMO 1J5EO 4DV5O 4X66O 4JI2O 1XMOO 1XEQA 4X64O 4DV3O 1HNWO 2LW7A 3O65A 2UUAO 4YY3O 4YHHO 2ZKOA 5BR8O 1FJGO 4AQYO 1IBKO
chains in the Genus database with same CATH superfamily
1JQ0A 3RWRD 2ITCC 4B3SB 3JSLA 3N2GB 2WWWA 5FPRA 2XHBA 5KHIA 4H13B 3BA9A 4X65B 2DJVA 4MVQA 5IJ9B 1V55C 2Z0AA 5BMVB 2ZE5A 4MVSA 2GTAA 3ZMZA 2DMXA 3ETGA 4GX1A 2YS8A 3I56V 2DOSA 2FTKA 4JI4B 2CTPA 4DV2B 3CCUV 4I5SA 5EC1C 1BCCH 2Q6AA 4UCOA 4JI7B 3N2KB 3AG3B 1QVFU 2WLMA 1M57C 3ZEDA 2V7QG 1SA0A 1DLBA 2ZDIA 4YIOA 1HNZO 2IM9A 2QSAA 3VQVA 5EBMC 4UUJC 4H37A 3BFRA 3BCCH 1QBZA 3FYIB 3OW2U 5D5PA 1DTOA 2IJKA 5LHHA 4DR7O 4GT1A 3H1IH 3CC2V 5DEDA 1H2SB 3DC5A 3ZRWB 4UV8A 3FB5C 5KMGB 4DV1O 4LF4O 3RBZA 1NVPD 1AI7A 4JYBA 1FXVA 5L3BA 2X6BA 4Z2WA 5JH7B 1S3JA 3QF7A 3J81N 3CCQV 1IBLB 1R3KC 4LNUA 3TGUH 1JCHA 1SQBH 2QDOA 1H8HG 4DV5B 1XMOB 4DV3B 2AGAA 5E79Z 1J95A 1QLEC 1FXHA 2R70A 4TUYB 4AQYB 1VEWA 3AG2C 3SDLA 5IE9A 3CCJV 4RO2A 2YI8A 4DR4B 2YXLA 3L72H 2RCVA 5IYBO 4G28B 3SR2C 4O2AA 2WA4A 3OMNB 3BRCA 4FK5C 3T1YO 3RVYA 1YEWA 1E1QG 3CYOA 1B04A 4K8ZA 2UU9B 2HR3A 2P5OA 2KQXA 5LYJB 4MVMA 1JFFA 2DWDC 4U3JB 3JAWA 5H6QA 3APQA 3SYCA 2ODMA 4W4LA 2P22C 1YIJV 4FLUA 1I5YA 1AR5A 4GKJB 2QGNA 4QIWF 1HNXB 3KZIZ 1AILA 3VQYA 4B3MO 2CTWA 1TUBA 1JJ2U 1NH2D 3LNNA 4LF6B 3ETDA 3EXAA 4LCUC 4XBFA 4DUYB 3SJBC 4X8AA 3UCSC 2E74B 2ZINA 5FPOA 1ZSPA 1OJHA 4NR1A 3HKEA 3KKYA 4LF7B 1BS3A 1Q86W 4TWKA 1FFXB 5JQGB 3CB2A 3ABMB 1NT2B 2GV9A 2UUBB 4EKWA 1F51A 3TJTA 1R73A 1R6TA 5CB4B 3NXSA 4ZBMA 3K79A 1Q6HA 4I4TA 3X2QC 1LR1A 2N05A 4DV6O 4W4KA 1VQKV 2ZE7A 4NXNB 4LR3A 1SQQH 3HKDB 4KXRA 4JV5B 3RYHB 1SS3A 2IH1C 2YDEA 2PY5A 3K57A 2JS3A 4LWSA 1JPXA 2ZKOA 4J7KA 4D7TA 1FXKC 2KG7A 2IH3C 2W6JG 1XL4A 2PGGA 4N21A 2UXBO 1AJQA 1IBKB 5KUMA 3QO7A 4IHJB 1YDXA 1WA8A 1E1RG 4MVUA 4LF5B 1Q6UA 3JAKB 3CMEV 1HR0B 2GHYA 1URFA 3W7XA 5IWAB 3WG7C 4PDMA 4BIOA 2A9HA 1HNZB 1OCRB 2OTJV 4DUZB 4GX2A 2C2AA 2JEUA 4JYYA 2ZNJA 3AG7A 4F6RB 3E8GA 2JGDA 4JI1B 4HBNA 1KB9F 1F4NA 4PA3A 2DQ3A 3PN1A 2VRZA 3E2EA 2YUAA 1M93A 4D6TH 4MW8A 1N36O 2ZXWB 1GO3F 1YVWA 2PI5A 5GONA 2JS5A 1R6NA 2DE0X 1T5EA 2F43G 1XOUA 1XHZA 4LF4B 2QKSA 2E3CA 3QVNA 1AI6A 2ILMA 2Q73A 3OUFA 4ZHQA 5FLXN 1B6QA 2GSMB 1KUQA 4CS2A 1K34A 4WFFA 4PHZA 3GWOA 2XT9A 4FLXA 4X1KA 1PL0A 3CRRA 4FLVA 3KCYA 4PI2A 2R9AA 3FAVA 2DYSC 1XUQA 2RQ6A 2Q0OC 4DRXB 2W0FC 3I5DA 1WB8A 1RM1B 2EIJC 5DECA 5L3GA 1WPBA 4ZI7A 4LFCB 2Q7EA 4I0XB 4LH7A 4FLZA 5CN0A 1Q3EA 1J5EB 3HPLC 1VIBA 4YY3O 3G71V 5EIBC 1GRJA 3JSNA 3F7YC 4L8JA 3LDDA 1W59A 4RUFA 3G6BA 3JATB 3DGEA 3B8MA 2H3OA 2K9PA 2YIBA 3FB8C 5K1XA 2EJRA 3ZHVA 4O4LA 5B5EZ 3H9VA 2FKXA 3L9DA 5LGNA 4B3MB 4I55B 4O4IB 4FFBA 3C3SA 3ZHSA 4DO2A 1Y76B 4LFBB 4LBEC 4DV7O 4WF9V 4K0KO 1VP7A 3DC6A 2YICA 4Z1MG 5IYZB 1SKVA 3C90A 3OTFA 3F5WC 1GN4A 4KUMA 1H38A 4QE7A 1NTZH 3A2FA 4OPAA 4TOIA 2IW5A 4FPPA 4J7ZA 4A5UB 2HVKC 2RJZA 1OCZB 2YC0A 1PKXA 2ETNA 1ENVA 1GTOA 5CA0B 1P7BA 2AXTZ 3K9SA 4XDJA 1MABG 3JARB 1SQGA 2ZE8A 1OCCB 4QJFB 1UJWB 1ORQC 1G6UA 4X20B 2P6JA 2CTQA 5B3SB 4J80A 2EZPA 3DSQA 4FFKA 4UXNA 3CRAA 1X59A 5LBQA 1Y74B 1PP9H 5LOVA 3CCEV 3VBBA 3Q4HB 1F7YA 5B1AC 2UXDB 2IJHA 5L3CA 4TV8B 3MAQA 3E8HA 1WB7A 3EVKA 1K3EA 3O9OA 2QTSA 3JCUZ 2WLLB 5K1PA 3H1HH 1F4MA 2OWOA 3T2MA 2Y69B 3ABLB 3K0DA 4LF8O 3B2EE 3APOA 4CH3A 3P30A 2P4KA 4JZGA 3BHPA 1FYJA 4BR6A 1AJNA 1N0NA 3ML0A 2WLHA 2ITDC 3JASB 1PNLA 3FB6C 1XI1A 4DR1B 3M7MX 4I7ZB 4JI8B 1RFYA 5H6RA 3I55V 5J2UB 2EX3A 4YIPA 2IU3A 4J9YB 4I9QA 1NTMH 2CGOA 1S72V 4PDVA 1YXBA 3ABUA 4MW3A 2V1DA 4YJ2B 4U3JA 1TAEA 2N74A 4YJ3B 4O4HA 1PV0A 3E35A 1M4UA 2CH7B 3T1HO 3U0ZA 3HKBA 4NXMO 1XL6A 1QLNA 4PJ0Z 2PUSA 3RFRA 4OX9O 2Q7GA 1HW7A 1AROP 3E22A 4JI6O 3AG1B 3A0HZ 3GB7C 3LSSA 1AB3A 3R65A 3W7WA 4WFBV 5H2FZ 1MZFA 2UXCO 4X1YA 1G4YB 2VQFO 4FVMA 1AP5A 4MVOA 4U3FH 5LXTA 2VQEO 4DR2O 1JR9A 4BIZA 4GX5A 5GTHZ 2Q4PA 3CP1A 3AK1A 5KA6A 2PF4E 5KA5A 5CMUA 4GCZA 1K5SA 4BIUA 5KAFZ 2OCCC 4GYCB 1JMKC 5EBLC 3DXRA 3ASOB 5GW7A 3TCUA 1HNWO 1MSWD 3ZS8C 1TGOA 2HEPA 3S3WA 1R1BA 2MK3A 5FNVB 1AI4A 2UUAB 1L1FA 1Q43A 5CA1B 3K03A 3L75H 2WSSG 2DYRB 3JD2A 3K3WA 4JPRA 3SPIA 1FXKA 1MA1A 3C3TA 1H2NA 4I50B 2JEXA 2LW1A 2RDCA 1B3QA 2ADPA 5IY5B 2BTQA 4TT3G 2AW9A 2HG5C 1X4TA 4N23A 3R66A 1S5LZ 2ZQMA 1M56C 3JYCA 3WFVA 4LFAB 1RSOB 3ZIAG 1BZKA 3M8AA 1MG1A 3ASNB 2Q7HA 3BA8A 1Z2GA 3JALB 2QKCA 4NB5A 4WBNB 4UB8Z 1K9MW 4O4JA 4K8XA 2DQ0A 3K06A 1ZX3A 3UT5A 3K5LA 4FM2A 3K58A 3RYFB 2A7WA 5LHGA 2W6IG 2B5UA 4DXWA 2Q68A 3AG3C 2EIMC 1FAFA 5EK0A 4KHPB 4JYAB 5IDJA 3SPHA 3WB1A 1AJPA 3ZN0A 4B3RO 2FMLA 1ZL8A 1GH6A 2HP8A 1V55B 1H2GA 1Y66A 1SERA 3P3NA 1P7GA 5LA6B 5IJ0B 1TA8A 1YTFB 1WPXA 3H1JH 3CJHB 2XNDG 3JD3A 2E5LB 2EIKB 5KUKA 1R6KA 3U10A 2BE3A 1M57B 1SQPH 3JD0A 4YHHO 1YSCA 3CCMV 5TISZ 4X1IA 2QWOB 1TVKA 1CP9A 2ATKC 3OEEG 3PJSK 2K1EA 5H5NA 3K5MA 4P9PA 1N34B 1XNRO 3ABKB 5B1BB 4FJCC 3L70H 3EHBB 1K5QA 2WLIB 3FX7A 1FS0G 3SJCC 1NI8A 1EZVH 4UCTA 1YHQV 2QTOA 1Y6XA 3CRCA 3CX5F 5ITZB 5A9GA 2PZSA 3ZX6A 1H2KA 3H1KH 5LMNO 3QO8A 2R9IA 2UUCB 2X0LA 2A06H 3BEHA 2Q67A 4X62B 4OX9B 4JYCA 4QPKA 4F4LA 2FB5A 3N27A 3BAAA 4WCEV 2Y0IA 4GKKO 3D8CA 2CK3G 5IYZA 3MD0A 3M99B 3IJ4A 1KP2A 3OMAB 4IT5A 3IC7A 1SQVH 2F4VO 4HNAA 3ZHTA 1NBMG 5HFLA 1P4RA 1BE3H 4DR6B 3RYCB 2ZR2A 1Z5WA 2DN9A 3AG2B 2DW4A 4RQEA 5L3EA 1SF9A 3T4ZA 1GN6A 2H94A 1RPRA 3AEIA 3HKCB 4B7KA 3UM7A 2EILC 1JA8A 1AP6A 4IIJB 2HHHO 3KG2A 2QE7G 1Y67A 4P30A 3Q4HA 4PA4A 5B66Z 4FZ1A 3ABMC 1M9NA 3TXQA 4RQFA 1LUWA 1IBMB 2R9RB 1PNMA 4GZRB 2QR4A 2ZIOA 1KBHA 5C93A 3RW0A 3ZMTA 4FM0A 1K4DC 1FJGB 5BZBA 3BPZA 3A0RA 3GWKC 4BW5A 3WB0A 2YEVA 4NKGB 3F5TA 3SPCA 2N04A 1I94O 5JCOA 2BOCC 3CCLV 1SC5B 3AK2A 3ZBHA 5EYPB 1LUVA 3E8BA 1QNMA 5LP6B 1PD3A 4J41A 3SGIA 5EZYA 4GUNA 4WFHA 2NNUA 2DWEC 1VQ9V 1QQCA 1SZXA 3X2QB 4YJ2A 4DK1A 5KHKA 4JI0O 3LDEA 4YJ3A 1BSMA 3RYIB 1OCRC 4B3RB 1Q82W 5LL6Y 1XHXA 4EB6A 4NVPA 3JD1A 3AG4B 2W0XA 3CPWU 4EEQA 1S5HC 4JI5O 2JJ2G 2GUZB 5CBGA 4Z1VA 4DR7B 4CS3A 2XUMA 4UCRA 2M7WA 4DV0O 5JVDB 2XAGA 4DV1B 1MOFA 2EINC 1VQPV 5L3DA 5A2QN 1WP7A 2PYLA 1IX9A 1N33O 5KX5A 4GX0A 4E2LA 1AR4A 3FB7C 4X66O 4ZOLA 3K04A 1US6A 5JWPA 4AHCA 4ABMA 2Q9LA 3ICXA 1PL4A 3CEIA 4O2BA 3K59A 1RM1C 4H0LB 4U7NA 5J2TA 1XMQO 2Y0PA 4DK0A 4TV9A 1E79G 1CXZB 1K4CC 1B06A 2X6CA 1SA0B 1NTKH 1S5JA 1G1XB 2BCCH 3D36C 3OFNG 3ZHUA 4CBCA 4MS2A 5IYCO 1FPOA 4R8CA 1GMGA 1JVMA 2OIEA 3QO5A 1COWG 3ZRSA 1BMFG 2EZOA 3ZMUA 3T1YB 4Q20A 3T4DA 3QG5A 3S3XA 2BTOA 1Q8IA 4B3TO 2DYSB 3OR6C 1D5NA 3N2GA 1XDCA 3OT7A 1CPYA 4DV4O 2EIJB 4LH6A 1OCOB 1M5IA 5CBFA 1EN5A 3OUSA 5IJ9A 1Q7YW 2P06A 1I7FA 1N4CA 5BMVA 1NZ6A 2CDYA 5BY1A 4DR5O 2XOKG 1WAZA 5EBWC 3E83A 1W0JG 1NS1A 2HHHB 3W7UA 4LF9O 2IJJA 3N2KA 3NR7A 1Y4MA 1S76D 4QNHB 4LNUB 2HLDG 2QJ1A 4JTCB 4MVZA 4RUEA 5D5QA 4DR3O 3ZRVA 3DTUB 1WNSA 1ROPA 3OR7C 4OPHA 1P49A 3ZCCA 4BWAA 3CC7V 3KCXA 1OCCC 4DV6B 4O2AB 1NQTA 3ZRWA 2Z3YA 4NTYA 5KMGA 5DN6G 5BR8O 3A8TA 1YJNV 4B3SO 3B77A 2Z5UA 1JFFB 4G2KA 4X65O 3JAWB 3AK3A 4JZ2A 1PM9A 2UXBB 5JH7A 2R72A 2GDSA 3OD4A 3RN4A 1SQFA 5L3FA 4DV2O 3FD9A 3CD6V 1THZA 1ZLZA 3E89A 2F95B 3SJAC 4JI7O 2NLJC 5H9CA 5FL7G 5JCOC 3W7SA 4TUYA 4PDLA 3ZMVA 3L73H 1PNKA 2XAHA 5B1AB 1KYOF 1N36B 4DW0A 1IXBA 2ZE6A 1N8RW 1P84F 4I4TB 1W2BU 3B8NA 3HR0A 3L74H 3CC4V 1HWYA 4KFMA 1IDSA 1AVMA 5LYJA 3K5OA 1BHBA 5JJJB 1DK1A 4FZ0A 3CRQA 1LNQA 2WLKA 4LWSB 2BSKB 4QGPA 4HYOA 3OMIB 3E86A 3UO3A 2KG7B 2GBOA 3SYOA 5EC2C 3ZN1A 4BW9A 1VF5B 3AG1C 1VF7A 3VOUA 1BHAA 1WA8B 2H8PC 1K97A 1IZ3A 5J9PC 1IBLO 4IYIA 3LUTB 4DV5O 3ETQA 4UVAA 1XMOO 4DV3O 3CWBH 2EJ7A 1FFXA 5KHGA 5JQGA 4FM1A 1IVSA 3QTCA 4J7JA 4AQYO 1L0NH 4K35A 4YY3B 2JGDB 5CB4A 4DR4O 4WFGA 2CUGA 3CS5A 2JRIA 2HJFC 3VQXA 4CC5A 1EM1A 1JX9A 4H33A 2X7RB 2EBOA 2B1IA 5GONB 2YIDA 1MSDA 2VS0A 4MTFA 1NVPB 4J11A 2VWJA 3HKDA 5C8YB 1QCEA 5EYPA 3RYHA 1V54C 2UU9O 3IAYA 2ADQB 3UKMA 4MTXA 2YXHA 4ZHQB 1DF4A 1N32O 1FFTB 4JTAB 4CC6A 4IHJA 3QNEA 4GKJO 1HNXO 3JAKA 1A32A 4X1KB 2YXYA 4YXWG 4DV7B 4K0KB 4UFZA 4LF6O 3FAVB 4DUYO 4JGSA 4UB6Z 3OTOO 3U11A 4ASUG 4RAIA 3VQWA 2JDIG 4UVBA 4ZI7B 2YSUB 4LF7O 4R7CA 4F6RA 1Q90D 4FLTA 1VQ7V 2UUBO 1MZEA 3ZRXA 2ZIMA 4G27B 1VQ6V 3ZHRA 2LJ2A 1W0KG 2LFRA 2BOBC 4WFEA 5BR8B 3K9AA 4CS4A 1M56B 4NXNO 4LP8A 1XREA 5B1NA 4JV5O 1VARA 4X89A 4O4LB 4JI2O 4MVRA 1DF5A 1MNGA 4R6ZA 4OGQB 3ZHQA 3MHSC 1KQSU 2NN4A 1NH2B 3MDSA 2Y4TA 5F2VO 4FFBB 1IBKO 4LF5O 2AZ0A 1HR0O 4DRXA 1QHTA 2EIKC 4UV9A 1K8AW 2XAFA 5KHJA 2P4VA 4NTXA 2AHZA 5IWAO 4LF8B 2EIMB 3CCVV 1VQOV 2P67A 5HFMA 3IFXA 1HDJA 4I0XA 3CHXA 4DUZO 2ZT9B 4DYLA 1VQ4V 2A79B 5GTIZ 4NYKA 4JI1O 2NR5A 3D36A 2WPDG 3WB2A 3ABKC 1H2LA 4UVCA 5B1BC 2FL4A 4K3AA 1GM9A 1KMIZ 3CRMA 3JATA 2LGWA 3STZC 4D7SA 4B7EA 4IGGA 4UCUA 1SZTA 2HVJC 3IC9A 2ZD9A 3TXSA 4LC1A 2L6LA 5LOVB 3B09A 3T1HB 4I55A 5IYDO 4NXMB 4O4IA 2KKWA 1Y76A 3FYEB 2OTLV 3H1LH 2WA3A 4ZKIA 4JI6B 3P32A 1VQ5V 4KP4A 1U96A 3THOA 4PA7A 1KKDA 5E1AC 1VF6C 3D3QA 1KC8W 2Y48A 2UXCB 2OYQA 2VQFB 3K08A 3RGBA 1M1KW 2VQEB 3SPJA 1KU9A 1QU7A 4DR2B 4LFCO 5AG2A 2RN9A 1QLEB 2Q0AA 5JJEB 5IT9N 2YIAA 3OGCC 4AI8A 4U7OA 3B4SA 1J5EO 4PV1B 5CA0A 4OXSA 2RMKB 2QWPB 1GM7A 3JARA 1NU1H 2M6YA 1QR8A 2Q8VA 2JVDA 1HP8A 5JJNB 3G67A 1HNWB 1F23A 4BAYA 4X20A 3UO2A 4FLYA 2G38A 1ZAUA 4PD4F 1BGYH 3G4SV 2GTSA 1AI5A 1Y74A 1R3JC 1N32B 2ARHA 2F1MA 4O4HB 2YIBD 4XDLA 3SYAA 1CEZA 2X6AA 3SYPA 3F7VC 4PELA 4TV8A 3OE7G 3LSQA 1RP3B 3HKBB 1L0LH 1GK9A 4LFBO 2WLLA 4HAMA 2XAJA 1SESA 1YF2A 3E22B 2EILB 1KKCA 3OTOB 2CAZC 1YITV 4H44B 5LGUA 1R3IC 3UQ8A 4IL6Z 1YTFD 5LMUO 3K5NA 4FLWA 1IURA 1I08A 2QM8A 1VMGA 1M90W 1H8EG 4PDRA 2XAQA 1O9HA 4X1YB 3OEHG 5LP6C 3JASA 5LXTB 3LDCA 3TETA 2F66C 4MTOA 2JJ1G 1K73W 4FIPC 3J80N 5J2UA 3OGIB 5DM6V 4UCSA 2XASA 4GLXA 3JD4A 3ZMSA 5KHHA 3JAMN 4JTDB 2VWKA 3DXRB 1YI2V 4CH6A 3AG4C 1NKDA 3TK1A 4JI2B 2CGNA 3CCRV 2BSKA 2CH7A 4MT8A 3ZJZA 3A0BZ 1EBOA 2UXDO 1SRYA 3B40A 2QWQB 2KB1A 1FXKB 4QE9A 1YJ9V 2PYJA 2ZXWC 4EFEA 1XQ8A 4NTWA 2BTQB 3T1CA 2LW7A 1L8DA 4JAVA 2D3OW 3WG7B 1NR7A 1S0VA 4YHHB 1K33A 1EN6A 4P9OA 3EFFK 4O4JB 2UXXA 4DR1O 3UT5B 4JI8O 4MTGA 3CCSV 1XNRB 4TQFA 3H01A 3JCZA 5C8YA 2LP7A 1EFRG 1R3LC 4F6EA 1GM8A 3LSUA 1VQLV 5FNVA 3STLC 5CA1A 5LMNB 2EINB 4RWUA 2AHYA 4CH5A 2WLNA 2ZDIC 1WLEA 1FKAO 1NR1A 1JOYA 1XNQO 2WLJA 5CA3A 1UPGA 1ZL8B 4TSFG 2JGUA 2HFEC 4I50A 3SYQA 4GKKB 2ZM6O 2LGQA 3HB3B 2F4VB 1OCOC 1RSOA 3J7AU 4MSWC 2YI9A 3MHHC 2QEXV 3JALA 4ICGA 1U97A 4WBNA 1K92A 1YCIA 1PPJH 4XDKA 4J10A 3BABA 1Q6IA 4X1IB 4JI3O 4Q6GA 2QWNB 1AR1B 1JJOA 3RYFA 1TVKB 2EULA 2CE4A 1I0HA 3G6EV 2A0LA 4JAAA 2Y4UA 4PI0A 3W7TA 2OIGA 3FFQA 4X64O 2LO1A 4DW1A 2E75B 2OT5A 3CE2A 2UUAO 1OCZC 3D3IA 1VQNV 4PA6A 1BQ0A 1QR9A 1GAXA 1OHHG 1KD1W 5LA6A 2E76B 4ZIBA 5IJ0A 3SJQC 2QM7A 3RVZA 4J42A 4X9QA 1WN7A 3K0GA 2HKOA 3CJHA 5LMUB 1VQMV 3G80A 4HNAB 5B3SC 1I94B 2F23A 4R50A 1O9GA 1TUEB 4LFAO 2PI4A 1Q81W 1OZ0A 2JIZG 2ZR3A 4L87A 1K7DA 3CXHF 2ZCEA 2AZ2A 1VQ8V 3CXCU 1XBLA 1GKFA 1DGSA 2RNBA 4HZ3A 5LGTA 1WJZA 4JI4O 1D2DA 1GN3A 2A3QA 2FYUH 1TUBB 4JI0B 2Y69C 3ABLC 4IYHA 2WLIA 2QWRB 2XTAA 2B1GA 4P2ZA 3SPGA 5ITZA 1ZUQA 2HJDA 4KHPO 4JYAO 1QVGU 3GVMA 4CH4A 2F93B 4JI5B 3HKEB 1SETA 3FKSG 2LQTA 2QKAA 1V9PA 3OAAG 2QM4A 2WAMA 4DV0B 1D5AA 2QA4V 2YEVB 2E5LO 1VF6A 2P90A 3BY6A 5KLVH 3RYCA 2KSDA 1G8MA 2Q5ZA 1N33B 1OV9A 2OCHA 3LNMB 3E8FA 1RPOA 4WFAV 4B08A 4X66B 4I9WA 3CMAV 3HKCA 5EZYB 1BT8A 4IIJA 3L71H 3RT3C 1N34O 1XMQB 5EIBD 1I5XA 2IBZH 1KECA 2L35A 2V4DA 2IJIA 1XNQB 4CZZA 2ZNIA 1XILA 4EB6B 5B1OA 2LFSA 2JK5C 2UUCO 4JASA 2CTRA 4X62O 2P7TC 2ZM6B 3ETEA 2D2CB 1UFIA 2IU0A 3WU2Z 1YJWV 1H2MA 5BXZA 4UCVA 4B3TB 3ASOC 3P3PA 2MW2B 4C7UA 4QPJA 4FMTA 4DV4B 1EZJA 2UXNA 5KAIZ 3OM3B 1YZBA 3CSXA 2DYRC 4J9ZB 4DR6O 1IXMA 4JAUA 4JI3B 4DR5B 1ZTEA 5LP6A 5KX5B 4E4EA 2Q69A 1WP8A 1EN4A 4ZOLB 5IY5C 1BQZA 1BL8A 1ZWIC 2O57A 4EFBA 4PA9A 4LF9B 3IGAC 4O2BB 2OCCB 3RYIA 4X64B 5J2TB 3BVOA 4KL1A 4TV9B 1Q5OA 3ABTA 1V54B 1N0JA 1NJIW 4DR3B 3ASNC 1SQXH 5LHIA 2GUZA 1GN2A 4X88A 2PTMA 4AILC 1IBMO 5CBHA 2B9ZA 1MMMA 1XEQA 1KP3A 1Z5VA 1S77D 4JF3A 3O65A 5JVDA 1FJGO 1FD9A 4TQDA
chains in the Genus database with same CATH topology
2AGAA 4LF5O 1XMQO 4DR4O 2UXBO 4LF8O 4X65O 1HR0O 3RT3C 1N34O 3SDLA 2JRIA 5H5NA 5IWAO 3F5TA 1FYJA 1XNRO 2DJVA 1R1BA 1I94O 1G1XB 4DR1O 2Z0AA 4JI8O 4DV2O 4DUZO 2DOSA 3T1YO 2FKXA 2UU9O 2UUCO 4LFAO 4X62O 3R66A 4LFBO 4JI7O 5LMNO 4JI1O 4B3TO 1N32O 3M8AA 5BXZA 4DV7O 5LMUO 4DV4O 1FKAO 4K0KO 4GKJO 1XNQO 1HNXO 2N74A 1A32A 1N36O 4GKKO 4JI0O 4JI4O 1D2DA 1AILA 4LF6O 1HNZO 5LL6Y 4B3MO 2ZM6O 3T1HO 4DUYO 2F4VO 5BY1A 4DR5O 4OPAA 4NXMO 1YZBA 3OTOO 4A5UB 4DR6O 4JI5O 4OX9O 1NS1A 4KHPO 4JYAO 3J80N 4DR7O 5FLXN 4JI6O 4LF7O 3J7AU 4LF9O 1AB3A 3JAMN 1KUQA 1DK1A 2UUBO 4B3RO 4DV1O 4DV0O 4LF4O 2UXCO 2VQFO 4DR3O 4B3SO 2VQEO 4DR2O 4JI3O 1R6TA 2UXDO 1X59A 2HHHO 5A2QN 4OPHA 2E5LO 4NXNO 4LFCO 4DV6O 1F7YA 1IBLO 1N33O 3J81N 5IT9N 4JV5O 1IBMO 1J5EO 4DV5O 4X66O 4JI2O 1XMOO 1XEQA 4X64O 4DV3O 1HNWO 2LW7A 3O65A 2UUAO 4YY3O 4YHHO 2ZKOA 5BR8O 1FJGO 4AQYO 1IBKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  4LF5 O;  1XMQ O;  4DR4 O;  2UXB O;  4LF8 O;  4X65 O;  1HR0 O;  3RT3 C;  1N34 O;  3SDL A;  2JRI A;  5H5N A;  5IWA O;  3F5T A;  1FYJ A;  1XNR O;  2DJV A;  1R1B A;  1I94 O;  1G1X B;  4DR1 O;  2Z0A A;  4JI8 O;  4DV2 O;  4DUZ O;  2DOS A;  3T1Y O;  2FKX A;  2UU9 O;  2UUC O;  4LFA O;  4X62 O;  3R66 A;  4LFB O;  4JI7 O;  5LMN O;  4JI1 O;  4B3T O;  1N32 O;  3M8A A;  5BXZ A;  4DV7 O;  5LMU O;  4DV4 O;  1FKA O;  4K0K O;  4GKJ O;  1XNQ O;  1HNX O;  2N74 A;  1A32 A;  1N36 O;  4GKK O;  4JI0 O;  4JI4 O;  1D2D A;  1AIL A;  4LF6 O;  1HNZ O;  5LL6 Y;  4B3M O;  2ZM6 O;  3T1H O;  4DUY O;  2F4V O;  5BY1 A;  4DR5 O;  4OPA A;  4NXM O;  1YZB A;  3OTO O;  4A5U B;  4DR6 O;  4JI5 O;  4OX9 O;  1NS1 A;  4KHP O;  4JYA O;  3J80 N;  4DR7 O;  5FLX N;  4JI6 O;  4LF7 O;  3J7A U;  4LF9 O;  1AB3 A;  3JAM N;  1KUQ A;  1DK1 A;  2UUB O;  4B3R O;  4DV1 O;  4DV0 O;  4LF4 O;  2UXC O;  2VQF O;  4DR3 O;  4B3S O;  2VQE O;  4DR2 O;  4JI3 O;  1R6T A;  2UXD O;  1X59 A;  2HHH O;  5A2Q N;  4OPH A;  2E5L O;  4NXN O;  4LFC O;  4DV6 O;  1F7Y A;  1IBL O;  1N33 O;  3J81 N;  5IT9 N;  4JV5 O;  1IBM O;  1J5E O;  4DV5 O;  4X66 O;  4JI2 O;  1XMO O;  1XEQ A;  4X64 O;  4DV3 O;  1HNW O;  2LW7 A;  3O65 A;  2UUA O;  4YY3 O;  4YHH O;  2ZKO A;  5BR8 O;  1FJG O;  4AQY O;  1IBK O; 
#chains in the Genus database with same CATH topology
 1JQ0 A;  3RWR D;  2ITC C;  4B3S B;  3JSL A;  3N2G B;  2WWW A;  5FPR A;  2XHB A;  5KHI A;  4H13 B;  3BA9 A;  4X65 B;  2DJV A;  4MVQ A;  5IJ9 B;  1V55 C;  2Z0A A;  5BMV B;  2ZE5 A;  4MVS A;  2GTA A;  3ZMZ A;  2DMX A;  3ETG A;  4GX1 A;  2YS8 A;  3I56 V;  2DOS A;  2FTK A;  4JI4 B;  2CTP A;  4DV2 B;  3CCU V;  4I5S A;  5EC1 C;  1BCC H;  2Q6A A;  4UCO A;  4JI7 B;  3N2K B;  3AG3 B;  1QVF U;  2WLM A;  1M57 C;  3ZED A;  2V7Q G;  1SA0 A;  1DLB A;  2ZDI A;  4YIO A;  1HNZ O;  2IM9 A;  2QSA A;  3VQV A;  5EBM C;  4UUJ C;  4H37 A;  3BFR A;  3BCC H;  1QBZ A;  3FYI B;  3OW2 U;  5D5P A;  1DTO A;  2IJK A;  5LHH A;  4DR7 O;  4GT1 A;  3H1I H;  3CC2 V;  5DED A;  1H2S B;  3DC5 A;  3ZRW B;  4UV8 A;  3FB5 C;  5KMG B;  4DV1 O;  4LF4 O;  3RBZ A;  1NVP D;  1AI7 A;  4JYB A;  1FXV A;  5L3B A;  2X6B A;  4Z2W A;  5JH7 B;  1S3J A;  3QF7 A;  3J81 N;  3CCQ V;  1IBL B;  1R3K C;  4LNU A;  3TGU H;  1JCH A;  1SQB H;  2QDO A;  1H8H G;  4DV5 B;  1XMO B;  4DV3 B;  2AGA A;  5E79 Z;  1J95 A;  1QLE C;  1FXH A;  2R70 A;  4TUY B;  4AQY B;  1VEW A;  3AG2 C;  3SDL A;  5IE9 A;  3CCJ V;  4RO2 A;  2YI8 A;  4DR4 B;  2YXL A;  3L72 H;  2RCV A;  5IYB O;  4G28 B;  3SR2 C;  4O2A A;  2WA4 A;  3OMN B;  3BRC A;  4FK5 C;  3T1Y O;  3RVY A;  1YEW A;  1E1Q G;  3CYO A;  1B04 A;  4K8Z A;  2UU9 B;  2HR3 A;  2P5O A;  2KQX A;  5LYJ B;  4MVM A;  1JFF A;  2DWD C;  4U3J B;  3JAW A;  5H6Q A;  3APQ A;  3SYC A;  2ODM A;  4W4L A;  2P22 C;  1YIJ V;  4FLU A;  1I5Y A;  1AR5 A;  4GKJ B;  2QGN A;  4QIW F;  1HNX B;  3KZI Z;  1AIL A;  3VQY A;  4B3M O;  2CTW A;  1TUB A;  1JJ2 U;  1NH2 D;  3LNN A;  4LF6 B;  3ETD A;  3EXA A;  4LCU C;  4XBF A;  4DUY B;  3SJB C;  4X8A A;  3UCS C;  2E74 B;  2ZIN A;  5FPO A;  1ZSP A;  1OJH A;  4NR1 A;  3HKE A;  3KKY A;  4LF7 B;  1BS3 A;  1Q86 W;  4TWK A;  1FFX B;  5JQG B;  3CB2 A;  3ABM B;  1NT2 B;  2GV9 A;  2UUB B;  4EKW A;  1F51 A;  3TJT A;  1R73 A;  1R6T A;  5CB4 B;  3NXS A;  4ZBM A;  3K79 A;  1Q6H A;  4I4T A;  3X2Q C;  1LR1 A;  2N05 A;  4DV6 O;  4W4K A;  1VQK V;  2ZE7 A;  4NXN B;  4LR3 A;  1SQQ H;  3HKD B;  4KXR A;  4JV5 B;  3RYH B;  1SS3 A;  2IH1 C;  2YDE A;  2PY5 A;  3K57 A;  2JS3 A;  4LWS A;  1JPX A;  2ZKO A;  4J7K A;  4D7T A;  1FXK C;  2KG7 A;  2IH3 C;  2W6J G;  1XL4 A;  2PGG A;  4N21 A;  2UXB O;  1AJQ A;  1IBK B;  5KUM A;  3QO7 A;  4IHJ B;  1YDX A;  1WA8 A;  1E1R G;  4MVU A;  4LF5 B;  1Q6U A;  3JAK B;  3CME V;  1HR0 B;  2GHY A;  1URF A;  3W7X A;  5IWA B;  3WG7 C;  4PDM A;  4BIO A;  2A9H A;  1HNZ B;  1OCR B;  2OTJ V;  4DUZ B;  4GX2 A;  2C2A A;  2JEU A;  4JYY A;  2ZNJ A;  3AG7 A;  4F6R B;  3E8G A;  2JGD A;  4JI1 B;  4HBN A;  1KB9 F;  1F4N A;  4PA3 A;  2DQ3 A;  3PN1 A;  2VRZ A;  3E2E A;  2YUA A;  1M93 A;  4D6T H;  4MW8 A;  1N36 O;  2ZXW B;  1GO3 F;  1YVW A;  2PI5 A;  5GON A;  2JS5 A;  1R6N A;  2DE0 X;  1T5E A;  2F43 G;  1XOU A;  1XHZ A;  4LF4 B;  2QKS A;  2E3C A;  3QVN A;  1AI6 A;  2ILM A;  2Q73 A;  3OUF A;  4ZHQ A;  5FLX N;  1B6Q A;  2GSM B;  1KUQ A;  4CS2 A;  1K34 A;  4WFF A;  4PHZ A;  3GWO A;  2XT9 A;  4FLX A;  4X1K A;  1PL0 A;  3CRR A;  4FLV A;  3KCY A;  4PI2 A;  2R9A A;  3FAV A;  2DYS C;  1XUQ A;  2RQ6 A;  2Q0O C;  4DRX B;  2W0F C;  3I5D A;  1WB8 A;  1RM1 B;  2EIJ C;  5DEC A;  5L3G A;  1WPB A;  4ZI7 A;  4LFC B;  2Q7E A;  4I0X B;  4LH7 A;  4FLZ A;  5CN0 A;  1Q3E A;  1J5E B;  3HPL C;  1VIB A;  4YY3 O;  3G71 V;  5EIB C;  1GRJ A;  3JSN A;  3F7Y C;  4L8J A;  3LDD A;  1W59 A;  4RUF A;  3G6B A;  3JAT B;  3DGE A;  3B8M A;  2H3O A;  2K9P A;  2YIB A;  3FB8 C;  5K1X A;  2EJR A;  3ZHV A;  4O4L A;  5B5E Z;  3H9V A;  2FKX A;  3L9D A;  5LGN A;  4B3M B;  4I55 B;  4O4I B;  4FFB A;  3C3S A;  3ZHS A;  4DO2 A;  1Y76 B;  4LFB B;  4LBE C;  4DV7 O;  4WF9 V;  4K0K O;  1VP7 A;  3DC6 A;  2YIC A;  4Z1M G;  5IYZ B;  1SKV A;  3C90 A;  3OTF A;  3F5W C;  1GN4 A;  4KUM A;  1H38 A;  4QE7 A;  1NTZ H;  3A2F A;  4OPA A;  4TOI A;  2IW5 A;  4FPP A;  4J7Z A;  4A5U B;  2HVK C;  2RJZ A;  1OCZ B;  2YC0 A;  1PKX A;  2ETN A;  1ENV A;  1GTO A;  5CA0 B;  1P7B A;  2AXT Z;  3K9S A;  4XDJ A;  1MAB G;  3JAR B;  1SQG A;  2ZE8 A;  1OCC B;  4QJF B;  1UJW B;  1ORQ C;  1G6U A;  4X20 B;  2P6J A;  2CTQ A;  5B3S B;  4J80 A;  2EZP A;  3DSQ A;  4FFK A;  4UXN A;  3CRA A;  1X59 A;  5LBQ A;  1Y74 B;  1PP9 H;  5LOV A;  3CCE V;  3VBB A;  3Q4H B;  1F7Y A;  5B1A C;  2UXD B;  2IJH A;  5L3C A;  4TV8 B;  3MAQ A;  3E8H A;  1WB7 A;  3EVK A;  1K3E A;  3O9O A;  2QTS A;  3JCU Z;  2WLL B;  5K1P A;  3H1H H;  1F4M A;  2OWO A;  3T2M A;  2Y69 B;  3ABL B;  3K0D A;  4LF8 O;  3B2E E;  3APO A;  4CH3 A;  3P30 A;  2P4K A;  4JZG A;  3BHP A;  1FYJ A;  4BR6 A;  1AJN A;  1N0N A;  3ML0 A;  2WLH A;  2ITD C;  3JAS B;  1PNL A;  3FB6 C;  1XI1 A;  4DR1 B;  3M7M X;  4I7Z B;  4JI8 B;  1RFY A;  5H6R A;  3I55 V;  5J2U B;  2EX3 A;  4YIP A;  2IU3 A;  4J9Y B;  4I9Q A;  1NTM H;  2CGO A;  1S72 V;  4PDV A;  1YXB A;  3ABU A;  4MW3 A;  2V1D A;  4YJ2 B;  4U3J A;  1TAE A;  2N74 A;  4YJ3 B;  4O4H A;  1PV0 A;  3E35 A;  1M4U A;  2CH7 B;  3T1H O;  3U0Z A;  3HKB A;  4NXM O;  1XL6 A;  1QLN A;  4PJ0 Z;  2PUS A;  3RFR A;  4OX9 O;  2Q7G A;  1HW7 A;  1ARO P;  3E22 A;  4JI6 O;  3AG1 B;  3A0H Z;  3GB7 C;  3LSS A;  1AB3 A;  3R65 A;  3W7W A;  4WFB V;  5H2F Z;  1MZF A;  2UXC O;  4X1Y A;  1G4Y B;  2VQF O;  4FVM A;  1AP5 A;  4MVO A;  4U3F H;  5LXT A;  2VQE O;  4DR2 O;  1JR9 A;  4BIZ A;  4GX5 A;  5GTH Z;  2Q4P A;  3CP1 A;  3AK1 A;  5KA6 A;  2PF4 E;  5KA5 A;  5CMU A;  4GCZ A;  1K5S A;  4BIU A;  5KAF Z;  2OCC C;  4GYC B;  1JMK C;  5EBL C;  3DXR A;  3ASO B;  5GW7 A;  3TCU A;  1HNW O;  1MSW D;  3ZS8 C;  1TGO A;  2HEP A;  3S3W A;  1R1B A;  2MK3 A;  5FNV B;  1AI4 A;  2UUA B;  1L1F A;  1Q43 A;  5CA1 B;  3K03 A;  3L75 H;  2WSS G;  2DYR B;  3JD2 A;  3K3W A;  4JPR A;  3SPI A;  1FXK A;  1MA1 A;  3C3T A;  1H2N A;  4I50 B;  2JEX A;  2LW1 A;  2RDC A;  1B3Q A;  2ADP A;  5IY5 B;  2BTQ A;  4TT3 G;  2AW9 A;  2HG5 C;  1X4T A;  4N23 A;  3R66 A;  1S5L Z;  2ZQM A;  1M56 C;  3JYC A;  3WFV A;  4LFA B;  1RSO B;  3ZIA G;  1BZK A;  3M8A A;  1MG1 A;  3ASN B;  2Q7H A;  3BA8 A;  1Z2G A;  3JAL B;  2QKC A;  4NB5 A;  4WBN B;  4UB8 Z;  1K9M W;  4O4J A;  4K8X A;  2DQ0 A;  3K06 A;  1ZX3 A;  3UT5 A;  3K5L A;  4FM2 A;  3K58 A;  3RYF B;  2A7W A;  5LHG A;  2W6I G;  2B5U A;  4DXW A;  2Q68 A;  3AG3 C;  2EIM C;  1FAF A;  5EK0 A;  4KHP B;  4JYA B;  5IDJ A;  3SPH A;  3WB1 A;  1AJP A;  3ZN0 A;  4B3R O;  2FML A;  1ZL8 A;  1GH6 A;  2HP8 A;  1V55 B;  1H2G A;  1Y66 A;  1SER A;  3P3N A;  1P7G A;  5LA6 B;  5IJ0 B;  1TA8 A;  1YTF B;  1WPX A;  3H1J H;  3CJH B;  2XND G;  3JD3 A;  2E5L B;  2EIK B;  5KUK A;  1R6K A;  3U10 A;  2BE3 A;  1M57 B;  1SQP H;  3JD0 A;  4YHH O;  1YSC A;  3CCM V;  5TIS Z;  4X1I A;  2QWO B;  1TVK A;  1CP9 A;  2ATK C;  3OEE G;  3PJS K;  2K1E A;  5H5N A;  3K5M A;  4P9P A;  1N34 B;  1XNR O;  3ABK B;  5B1B B;  4FJC C;  3L70 H;  3EHB B;  1K5Q A;  2WLI B;  3FX7 A;  1FS0 G;  3SJC C;  1NI8 A;  1EZV H;  4UCT A;  1YHQ V;  2QTO A;  1Y6X A;  3CRC A;  3CX5 F;  5ITZ B;  5A9G A;  2PZS A;  3ZX6 A;  1H2K A;  3H1K H;  5LMN O;  3QO8 A;  2R9I A;  2UUC B;  2X0L A;  2A06 H;  3BEH A;  2Q67 A;  4X62 B;  4OX9 B;  4JYC A;  4QPK A;  4F4L A;  2FB5 A;  3N27 A;  3BAA A;  4WCE V;  2Y0I A;  4GKK O;  3D8C A;  2CK3 G;  5IYZ A;  3MD0 A;  3M99 B;  3IJ4 A;  1KP2 A;  3OMA B;  4IT5 A;  3IC7 A;  1SQV H;  2F4V O;  4HNA A;  3ZHT A;  1NBM G;  5HFL A;  1P4R A;  1BE3 H;  4DR6 B;  3RYC B;  2ZR2 A;  1Z5W A;  2DN9 A;  3AG2 B;  2DW4 A;  4RQE A;  5L3E A;  1SF9 A;  3T4Z A;  1GN6 A;  2H94 A;  1RPR A;  3AEI A;  3HKC B;  4B7K A;  3UM7 A;  2EIL C;  1JA8 A;  1AP6 A;  4IIJ B;  2HHH O;  3KG2 A;  2QE7 G;  1Y67 A;  4P30 A;  3Q4H A;  4PA4 A;  5B66 Z;  4FZ1 A;  3ABM C;  1M9N A;  3TXQ A;  4RQF A;  1LUW A;  1IBM B;  2R9R B;  1PNM A;  4GZR B;  2QR4 A;  2ZIO A;  1KBH A;  5C93 A;  3RW0 A;  3ZMT A;  4FM0 A;  1K4D C;  1FJG B;  5BZB A;  3BPZ A;  3A0R A;  3GWK C;  4BW5 A;  3WB0 A;  2YEV A;  4NKG B;  3F5T A;  3SPC A;  2N04 A;  1I94 O;  5JCO A;  2BOC C;  3CCL V;  1SC5 B;  3AK2 A;  3ZBH A;  5EYP B;  1LUV A;  3E8B A;  1QNM A;  5LP6 B;  1PD3 A;  4J41 A;  3SGI A;  5EZY A;  4GUN A;  4WFH A;  2NNU A;  2DWE C;  1VQ9 V;  1QQC A;  1SZX A;  3X2Q B;  4YJ2 A;  4DK1 A;  5KHK A;  4JI0 O;  3LDE A;  4YJ3 A;  1BSM A;  3RYI B;  1OCR C;  4B3R B;  1Q82 W;  5LL6 Y;  1XHX A;  4EB6 A;  4NVP A;  3JD1 A;  3AG4 B;  2W0X A;  3CPW U;  4EEQ A;  1S5H C;  4JI5 O;  2JJ2 G;  2GUZ B;  5CBG A;  4Z1V A;  4DR7 B;  4CS3 A;  2XUM A;  4UCR A;  2M7W A;  4DV0 O;  5JVD B;  2XAG A;  4DV1 B;  1MOF A;  2EIN C;  1VQP V;  5L3D A;  5A2Q N;  1WP7 A;  2PYL A;  1IX9 A;  1N33 O;  5KX5 A;  4GX0 A;  4E2L A;  1AR4 A;  3FB7 C;  4X66 O;  4ZOL A;  3K04 A;  1US6 A;  5JWP A;  4AHC A;  4ABM A;  2Q9L A;  3ICX A;  1PL4 A;  3CEI A;  4O2B A;  3K59 A;  1RM1 C;  4H0L B;  4U7N A;  5J2T A;  1XMQ O;  2Y0P A;  4DK0 A;  4TV9 A;  1E79 G;  1CXZ B;  1K4C C;  1B06 A;  2X6C A;  1SA0 B;  1NTK H;  1S5J A;  1G1X B;  2BCC H;  3D36 C;  3OFN G;  3ZHU A;  4CBC A;  4MS2 A;  5IYC O;  1FPO A;  4R8C A;  1GMG A;  1JVM A;  2OIE A;  3QO5 A;  1COW G;  3ZRS A;  1BMF G;  2EZO A;  3ZMU A;  3T1Y B;  4Q20 A;  3T4D A;  3QG5 A;  3S3X A;  2BTO A;  1Q8I A;  4B3T O;  2DYS B;  3OR6 C;  1D5N A;  3N2G A;  1XDC A;  3OT7 A;  1CPY A;  4DV4 O;  2EIJ B;  4LH6 A;  1OCO B;  1M5I A;  5CBF A;  1EN5 A;  3OUS A;  5IJ9 A;  1Q7Y W;  2P06 A;  1I7F A;  1N4C A;  5BMV A;  1NZ6 A;  2CDY A;  5BY1 A;  4DR5 O;  2XOK G;  1WAZ A;  5EBW C;  3E83 A;  1W0J G;  1NS1 A;  2HHH B;  3W7U A;  4LF9 O;  2IJJ A;  3N2K A;  3NR7 A;  1Y4M A;  1S76 D;  4QNH B;  4LNU B;  2HLD G;  2QJ1 A;  4JTC B;  4MVZ A;  4RUE A;  5D5Q A;  4DR3 O;  3ZRV A;  3DTU B;  1WNS A;  1ROP A;  3OR7 C;  4OPH A;  1P49 A;  3ZCC A;  4BWA A;  3CC7 V;  3KCX A;  1OCC C;  4DV6 B;  4O2A B;  1NQT A;  3ZRW A;  2Z3Y A;  4NTY A;  5KMG A;  5DN6 G;  5BR8 O;  3A8T A;  1YJN V;  4B3S O;  3B77 A;  2Z5U A;  1JFF B;  4G2K A;  4X65 O;  3JAW B;  3AK3 A;  4JZ2 A;  1PM9 A;  2UXB B;  5JH7 A;  2R72 A;  2GDS A;  3OD4 A;  3RN4 A;  1SQF A;  5L3F A;  4DV2 O;  3FD9 A;  3CD6 V;  1THZ A;  1ZLZ A;  3E89 A;  2F95 B;  3SJA C;  4JI7 O;  2NLJ C;  5H9C A;  5FL7 G;  5JCO C;  3W7S A;  4TUY A;  4PDL A;  3ZMV A;  3L73 H;  1PNK A;  2XAH A;  5B1A B;  1KYO F;  1N36 B;  4DW0 A;  1IXB A;  2ZE6 A;  1N8R W;  1P84 F;  4I4T B;  1W2B U;  3B8N A;  3HR0 A;  3L74 H;  3CC4 V;  1HWY A;  4KFM A;  1IDS A;  1AVM A;  5LYJ A;  3K5O A;  1BHB A;  5JJJ B;  1DK1 A;  4FZ0 A;  3CRQ A;  1LNQ A;  2WLK A;  4LWS B;  2BSK B;  4QGP A;  4HYO A;  3OMI B;  3E86 A;  3UO3 A;  2KG7 B;  2GBO A;  3SYO A;  5EC2 C;  3ZN1 A;  4BW9 A;  1VF5 B;  3AG1 C;  1VF7 A;  3VOU A;  1BHA A;  1WA8 B;  2H8P C;  1K97 A;  1IZ3 A;  5J9P C;  1IBL O;  4IYI A;  3LUT B;  4DV5 O;  3ETQ A;  4UVA A;  1XMO O;  4DV3 O;  3CWB H;  2EJ7 A;  1FFX A;  5KHG A;  5JQG A;  4FM1 A;  1IVS A;  3QTC A;  4J7J A;  4AQY O;  1L0N H;  4K35 A;  4YY3 B;  2JGD B;  5CB4 A;  4DR4 O;  4WFG A;  2CUG A;  3CS5 A;  2JRI A;  2HJF C;  3VQX A;  4CC5 A;  1EM1 A;  1JX9 A;  4H33 A;  2X7R B;  2EBO A;  2B1I A;  5GON B;  2YID A;  1MSD A;  2VS0 A;  4MTF A;  1NVP B;  4J11 A;  2VWJ A;  3HKD A;  5C8Y B;  1QCE A;  5EYP A;  3RYH A;  1V54 C;  2UU9 O;  3IAY A;  2ADQ B;  3UKM A;  4MTX A;  2YXH A;  4ZHQ B;  1DF4 A;  1N32 O;  1FFT B;  4JTA B;  4CC6 A;  4IHJ A;  3QNE A;  4GKJ O;  1HNX O;  3JAK A;  1A32 A;  4X1K B;  2YXY A;  4YXW G;  4DV7 B;  4K0K B;  4UFZ A;  4LF6 O;  3FAV B;  4DUY O;  4JGS A;  4UB6 Z;  3OTO O;  3U11 A;  4ASU G;  4RAI A;  3VQW A;  2JDI G;  4UVB A;  4ZI7 B;  2YSU B;  4LF7 O;  4R7C A;  4F6R A;  1Q90 D;  4FLT A;  1VQ7 V;  2UUB O;  1MZE A;  3ZRX A;  2ZIM A;  4G27 B;  1VQ6 V;  3ZHR A;  2LJ2 A;  1W0K G;  2LFR A;  2BOB C;  4WFE A;  5BR8 B;  3K9A A;  4CS4 A;  1M56 B;  4NXN O;  4LP8 A;  1XRE A;  5B1N A;  4JV5 O;  1VAR A;  4X89 A;  4O4L B;  4JI2 O;  4MVR A;  1DF5 A;  1MNG A;  4R6Z A;  4OGQ B;  3ZHQ A;  3MHS C;  1KQS U;  2NN4 A;  1NH2 B;  3MDS A;  2Y4T A;  5F2V O;  4FFB B;  1IBK O;  4LF5 O;  2AZ0 A;  1HR0 O;  4DRX A;  1QHT A;  2EIK C;  4UV9 A;  1K8A W;  2XAF A;  5KHJ A;  2P4V A;  4NTX A;  2AHZ A;  5IWA O;  4LF8 B;  2EIM B;  3CCV V;  1VQO V;  2P67 A;  5HFM A;  3IFX A;  1HDJ A;  4I0X A;  3CHX A;  4DUZ O;  2ZT9 B;  4DYL A;  1VQ4 V;  2A79 B;  5GTI Z;  4NYK A;  4JI1 O;  2NR5 A;  3D36 A;  2WPD G;  3WB2 A;  3ABK C;  1H2L A;  4UVC A;  5B1B C;  2FL4 A;  4K3A A;  1GM9 A;  1KMI Z;  3CRM A;  3JAT A;  2LGW A;  3STZ C;  4D7S A;  4B7E A;  4IGG A;  4UCU A;  1SZT A;  2HVJ C;  3IC9 A;  2ZD9 A;  3TXS A;  4LC1 A;  2L6L A;  5LOV B;  3B09 A;  3T1H B;  4I55 A;  5IYD O;  4NXM B;  4O4I A;  2KKW A;  1Y76 A;  3FYE B;  2OTL V;  3H1L H;  2WA3 A;  4ZKI A;  4JI6 B;  3P32 A;  1VQ5 V;  4KP4 A;  1U96 A;  3THO A;  4PA7 A;  1KKD A;  5E1A C;  1VF6 C;  3D3Q A;  1KC8 W;  2Y48 A;  2UXC B;  2OYQ A;  2VQF B;  3K08 A;  3RGB A;  1M1K W;  2VQE B;  3SPJ A;  1KU9 A;  1QU7 A;  4DR2 B;  4LFC O;  5AG2 A;  2RN9 A;  1QLE B;  2Q0A A;  5JJE B;  5IT9 N;  2YIA A;  3OGC C;  4AI8 A;  4U7O A;  3B4S A;  1J5E O;  4PV1 B;  5CA0 A;  4OXS A;  2RMK B;  2QWP B;  1GM7 A;  3JAR A;  1NU1 H;  2M6Y A;  1QR8 A;  2Q8V A;  2JVD A;  1HP8 A;  5JJN B;  3G67 A;  1HNW B;  1F23 A;  4BAY A;  4X20 A;  3UO2 A;  4FLY A;  2G38 A;  1ZAU A;  4PD4 F;  1BGY H;  3G4S V;  2GTS A;  1AI5 A;  1Y74 A;  1R3J C;  1N32 B;  2ARH A;  2F1M A;  4O4H B;  2YIB D;  4XDL A;  3SYA A;  1CEZ A;  2X6A A;  3SYP A;  3F7V C;  4PEL A;  4TV8 A;  3OE7 G;  3LSQ A;  1RP3 B;  3HKB B;  1L0L H;  1GK9 A;  4LFB O;  2WLL A;  4HAM A;  2XAJ A;  1SES A;  1YF2 A;  3E22 B;  2EIL B;  1KKC A;  3OTO B;  2CAZ C;  1YIT V;  4H44 B;  5LGU A;  1R3I C;  3UQ8 A;  4IL6 Z;  1YTF D;  5LMU O;  3K5N A;  4FLW A;  1IUR A;  1I08 A;  2QM8 A;  1VMG A;  1M90 W;  1H8E G;  4PDR A;  2XAQ A;  1O9H A;  4X1Y B;  3OEH G;  5LP6 C;  3JAS A;  5LXT B;  3LDC A;  3TET A;  2F66 C;  4MTO A;  2JJ1 G;  1K73 W;  4FIP C;  3J80 N;  5J2U A;  3OGI B;  5DM6 V;  4UCS A;  2XAS A;  4GLX A;  3JD4 A;  3ZMS A;  5KHH A;  3JAM N;  4JTD B;  2VWK A;  3DXR B;  1YI2 V;  4CH6 A;  3AG4 C;  1NKD A;  3TK1 A;  4JI2 B;  2CGN A;  3CCR V;  2BSK A;  2CH7 A;  4MT8 A;  3ZJZ A;  3A0B Z;  1EBO A;  2UXD O;  1SRY A;  3B40 A;  2QWQ B;  2KB1 A;  1FXK B;  4QE9 A;  1YJ9 V;  2PYJ A;  2ZXW C;  4EFE A;  1XQ8 A;  4NTW A;  2BTQ B;  3T1C A;  2LW7 A;  1L8D A;  4JAV A;  2D3O W;  3WG7 B;  1NR7 A;  1S0V A;  4YHH B;  1K33 A;  1EN6 A;  4P9O A;  3EFF K;  4O4J B;  2UXX A;  4DR1 O;  3UT5 B;  4JI8 O;  4MTG A;  3CCS V;  1XNR B;  4TQF A;  3H01 A;  3JCZ A;  5C8Y A;  2LP7 A;  1EFR G;  1R3L C;  4F6E A;  1GM8 A;  3LSU A;  1VQL V;  5FNV A;  3STL C;  5CA1 A;  5LMN B;  2EIN B;  4RWU A;  2AHY A;  4CH5 A;  2WLN A;  2ZDI C;  1WLE A;  1FKA O;  1NR1 A;  1JOY A;  1XNQ O;  2WLJ A;  5CA3 A;  1UPG A;  1ZL8 B;  4TSF G;  2JGU A;  2HFE C;  4I50 A;  3SYQ A;  4GKK B;  2ZM6 O;  2LGQ A;  3HB3 B;  2F4V B;  1OCO C;  1RSO A;  3J7A U;  4MSW C;  2YI9 A;  3MHH C;  2QEX V;  3JAL A;  4ICG A;  1U97 A;  4WBN A;  1K92 A;  1YCI A;  1PPJ H;  4XDK A;  4J10 A;  3BAB A;  1Q6I A;  4X1I B;  4JI3 O;  4Q6G A;  2QWN B;  1AR1 B;  1JJO A;  3RYF A;  1TVK B;  2EUL A;  2CE4 A;  1I0H A;  3G6E V;  2A0L A;  4JAA A;  2Y4U A;  4PI0 A;  3W7T A;  2OIG A;  3FFQ A;  4X64 O;  2LO1 A;  4DW1 A;  2E75 B;  2OT5 A;  3CE2 A;  2UUA O;  1OCZ C;  3D3I A;  1VQN V;  4PA6 A;  1BQ0 A;  1QR9 A;  1GAX A;  1OHH G;  1KD1 W;  5LA6 A;  2E76 B;  4ZIB A;  5IJ0 A;  3SJQ C;  2QM7 A;  3RVZ A;  4J42 A;  4X9Q A;  1WN7 A;  3K0G A;  2HKO A;  3CJH A;  5LMU B;  1VQM V;  3G80 A;  4HNA B;  5B3S C;  1I94 B;  2F23 A;  4R50 A;  1O9G A;  1TUE B;  4LFA O;  2PI4 A;  1Q81 W;  1OZ0 A;  2JIZ G;  2ZR3 A;  4L87 A;  1K7D A;  3CXH F;  2ZCE A;  2AZ2 A;  1VQ8 V;  3CXC U;  1XBL A;  1GKF A;  1DGS A;  2RNB A;  4HZ3 A;  5LGT A;  1WJZ A;  4JI4 O;  1D2D A;  1GN3 A;  2A3Q A;  2FYU H;  1TUB B;  4JI0 B;  2Y69 C;  3ABL C;  4IYH A;  2WLI A;  2QWR B;  2XTA A;  2B1G A;  4P2Z A;  3SPG A;  5ITZ A;  1ZUQ A;  2HJD A;  4KHP O;  4JYA O;  1QVG U;  3GVM A;  4CH4 A;  2F93 B;  4JI5 B;  3HKE B;  1SET A;  3FKS G;  2LQT A;  2QKA A;  1V9P A;  3OAA G;  2QM4 A;  2WAM A;  4DV0 B;  1D5A A;  2QA4 V;  2YEV B;  2E5L O;  1VF6 A;  2P90 A;  3BY6 A;  5KLV H;  3RYC A;  2KSD A;  1G8M A;  2Q5Z A;  1N33 B;  1OV9 A;  2OCH A;  3LNM B;  3E8F A;  1RPO A;  4WFA V;  4B08 A;  4X66 B;  4I9W A;  3CMA V;  3HKC A;  5EZY B;  1BT8 A;  4IIJ A;  3L71 H;  3RT3 C;  1N34 O;  1XMQ B;  5EIB D;  1I5X A;  2IBZ H;  1KEC A;  2L35 A;  2V4D A;  2IJI A;  1XNQ B;  4CZZ A;  2ZNI A;  1XIL A;  4EB6 B;  5B1O A;  2LFS A;  2JK5 C;  2UUC O;  4JAS A;  2CTR A;  4X62 O;  2P7T C;  2ZM6 B;  3ETE A;  2D2C B;  1UFI A;  2IU0 A;  3WU2 Z;  1YJW V;  1H2M A;  5BXZ A;  4UCV A;  4B3T B;  3ASO C;  3P3P A;  2MW2 B;  4C7U A;  4QPJ A;  4FMT A;  4DV4 B;  1EZJ A;  2UXN A;  5KAI Z;  3OM3 B;  1YZB A;  3CSX A;  2DYR C;  4J9Z B;  4DR6 O;  1IXM A;  4JAU A;  4JI3 B;  4DR5 B;  1ZTE A;  5LP6 A;  5KX5 B;  4E4E A;  2Q69 A;  1WP8 A;  1EN4 A;  4ZOL B;  5IY5 C;  1BQZ A;  1BL8 A;  1ZWI C;  2O57 A;  4EFB A;  4PA9 A;  4LF9 B;  3IGA C;  4O2B B;  2OCC B;  3RYI A;  4X64 B;  5J2T B;  3BVO A;  4KL1 A;  4TV9 B;  1Q5O A;  3ABT A;  1V54 B;  1N0J A;  1NJI W;  4DR3 B;  3ASN C;  1SQX H;  5LHI A;  2GUZ A;  1GN2 A;  4X88 A;  2PTM A;  4AIL C;  1IBM O;  5CBH A;  2B9Z A;  1MMM A;  1XEQ A;  1KP3 A;  1Z5V A;  1S77 D;  4JF3 A;  3O65 A;  5JVD A;  1FJG O;  1FD9 A;  4TQD A; 
#chains in the Genus database with same CATH homology
 2AGA A;  4LF5 O;  1XMQ O;  4DR4 O;  2UXB O;  4LF8 O;  4X65 O;  1HR0 O;  3RT3 C;  1N34 O;  3SDL A;  2JRI A;  5H5N A;  5IWA O;  3F5T A;  1FYJ A;  1XNR O;  2DJV A;  1R1B A;  1I94 O;  1G1X B;  4DR1 O;  2Z0A A;  4JI8 O;  4DV2 O;  4DUZ O;  2DOS A;  3T1Y O;  2FKX A;  2UU9 O;  2UUC O;  4LFA O;  4X62 O;  3R66 A;  4LFB O;  4JI7 O;  5LMN O;  4JI1 O;  4B3T O;  1N32 O;  3M8A A;  5BXZ A;  4DV7 O;  5LMU O;  4DV4 O;  1FKA O;  4K0K O;  4GKJ O;  1XNQ O;  1HNX O;  2N74 A;  1A32 A;  1N36 O;  4GKK O;  4JI0 O;  4JI4 O;  1D2D A;  1AIL A;  4LF6 O;  1HNZ O;  5LL6 Y;  4B3M O;  2ZM6 O;  3T1H O;  4DUY O;  2F4V O;  5BY1 A;  4DR5 O;  4OPA A;  4NXM O;  1YZB A;  3OTO O;  4A5U B;  4DR6 O;  4JI5 O;  4OX9 O;  1NS1 A;  4KHP O;  4JYA O;  3J80 N;  4DR7 O;  5FLX N;  4JI6 O;  4LF7 O;  3J7A U;  4LF9 O;  1AB3 A;  3JAM N;  1KUQ A;  1DK1 A;  2UUB O;  4B3R O;  4DV1 O;  4DV0 O;  4LF4 O;  2UXC O;  2VQF O;  4DR3 O;  4B3S O;  2VQE O;  4DR2 O;  4JI3 O;  1R6T A;  2UXD O;  1X59 A;  2HHH O;  5A2Q N;  4OPH A;  2E5L O;  4NXN O;  4LFC O;  4DV6 O;  1F7Y A;  1IBL O;  1N33 O;  3J81 N;  5IT9 N;  4JV5 O;  1IBM O;  1J5E O;  4DV5 O;  4X66 O;  4JI2 O;  1XMO O;  1XEQ A;  4X64 O;  4DV3 O;  1HNW O;  2LW7 A;  3O65 A;  2UUA O;  4YY3 O;  4YHH O;  2ZKO A;  5BR8 O;  1FJG O;  4AQY O;  1IBK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...