4X64O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x64O00
5BY1A 2LW7A 4JI6O 3M8AA 1DK1A 4JI2O 4DR2O 4YHHO 3JAMN 4DV4O 1HNXO 4YY3O 4OPAA 2UXDO 2HHHO 4DR7O 4JI4O 1FKAO 4OX9O 2UUCO 4B3RO 4K0KO 4LF6O 2VQFO 4LF9O 3J7AU 2AGAA 5IWAO 3J80N 1R6TA 4LFCO 3SDLA 5BXZA 1N34O 4JI1O 1XMQO 4B3MO 1XNQO 5A2QN 5LL6Y 4JYAO 3T1HO 2ZKOA 1R1BA 4DV1O 4NXMO 4OPHA 1XEQA 4LF8O 1YZBA 4GKKO 4LF5O 1HNWO 4NXNO 4DR4O 2UU9O 4AQYO 4LF7O 2DJVA 5LMNO 3R66A 1XNRO 1AB3A 3O65A 5FLXN 1KUQA 4B3SO 4DV6O 1X59A 4LFAO 4DV2O 3T1YO 1FYJA 1J5EO 1HNZO 4JI0O 4DR1O 1XMOO 2DOSA 4JI3O 5BR8O 1F7YA 4KHPO 3J81N 2UUBO 1IBMO 5IT9N 4DR3O 3RT3C 4DUZO 4DR5O 1FJGO 5LMUO 4JI5O 4A5UB 1I94O 1N36O 3F5TA 1A32A 4GKJO 2JRIA 4X62O 4JI8O 1G1XB 5H5NA 1IBKO 1IBLO 2E5LO 2UXCO 1NS1A 2VQEO 4DR6O 4X66O 4X65O 4LFBO 1N33O 1AILA 1D2DA 2FKXA 4DV5O 1N32O 3OTOO 4DUYO 4LF4O 2F4VO 2ZM6O 2Z0AA 4DV7O 4JI7O 2N74A 4JV5O 2UUAO 4B3TO 4X64O 4DV0O 4DV3O 2UXBO 1HR0O
chains in the Genus database with same CATH superfamily
2P5OA 1WP7A 4LFAB 1WPXA 4LBEC 4U3FH 3ZJZA 4DV4O 3ICXA 3CCEV 3SJCC 3K5NA 3K5OA 1O9HA 1R3KC 1N36B 3R65A 4ZHQB 5KMGB 2HEPA 1VF6C 3MDSA 1JFFB 2CTRA 3CSXA 1EN5A 1GMGA 1GN3A 4XDLA 3D36A 4O2BA 1NTMH 4JI0B 4DR1B 1D5NA 1QLNA 4CC6A 2ZM6B 2LO1A 1MG1A 4LH7A 1XI1A 3WG7B 4HZ3A 3L71H 2GV9A 2X6CA 5JH7A 2P06A 1BGYH 3T4ZA 1JJOA 1JVMA 2AW9A 4J10A 4U3JB 1IBLB 3ETGA 4MTGA 4JZ2A 2QWOB 5CBGA 3SPJA 3LSSA 4DK1A 5C8YB 3VQVA 3ZBHA 2CTWA 1Z5WA 1XHZA 4PDLA 1VQ6V 1N32B 1XBLA 2IJJA 4DV2O 4DV7B 4GYCB 4LF9B 4DW1A 1IBMO 3LDCA 3E2EA 4YJ2A 3RT3C 4K8XA 5E79Z 4GZRB 5EZYA 3E83A 3K0GA 4JI8O 4EB6B 1FS0G 4KL1A 3FB8C 1QQCA 4J7ZA 1XHXA 1WPBA 3L73H 3M7MX 1HNWB 1S5LZ 1PKXA 4ASUG 1N4CA 4YJ3A 4QJFB 5EIBC 3UO2A 4JAAA 4LWSB 2BTOA 1M57C 3KG2A 4YIOA 2K1EA 4DV0O 1AJQA 1XUQA 4RUEA 2LW7A 2M7WA 4JYBA 4NYKA 4CBCA 1K97A 1S76D 2R72A 4UCVA 4FZ1A 5KHIA 4QE9A 3RYCB 1NI8A 2JS3A 2JK5C 2Q6AA 5HFLA 4B08A 2R9IA 4LF7B 1S3JA 2HG5C 2RN9A 3I56V 1JX9A 4HNAA 4ZBMA 1RM1B 4MVSA 5BXZA 5CA1B 1IDSA 2KG7A 4IIJB 1PL0A 3VOUA 1K8AW 4JYAO 2JS5A 1Q6HA 4ZOLB 3T1HO 2V7QG 3RYHB 1WJZA 4JAUA 2P22C 1YZBA 3CCJV 2QGNA 1TUEB 1F4NA 3CCRV 1IBKB 1QBZA 2GDSA 2X0LA 3B4SA 5B5EZ 2N05A 1XNRO 4K3AA 2H8PC 1SRYA 1Y4MA 1AB3A 3WG7C 4TQFA 4DW0A 4GX1A 3JD3A 3MHSC 3GVMA 3VQYA 1H38A 2YSUB 5FL7G 4Q20A 5GTHZ 1M1KW 1HNZO 3SJBC 4LF6B 2OT5A 3HKEB 4CH3A 5BR8O 2UUBO 1Q8IA 1SQQH 4FVMA 4WF9V 3AK2A 2JGDA 3Q4HB 4J42A 3WB1A 3ZN1A 3N2GB 1VF5B 4JI1B 4JI2B 4DR2B 3A0BZ 3VBBA 1QR8A 4N21A 4JPRA 4QNHB 2Y4TA 3ZHTA 2E5LO 5CA0A 2VQEO 1DTOA 2BOBC 3ZHSA 2QA4V 4NXNB 1NTKH 3H1IH 2JJ1G 2FKXA 2QWNB 4EKWA 1K92A 3DGEA 5IE9A 3K04A 3BCCH 4I4TA 1YJWV 2WSSG 4DK0A 4W4LA 4D7SA 4QGPA 5BZBA 2F95B 1GAXA 3QO7A 4D6TH 3LNNA 3RYFB 3I55V 1AJPA 4LF8B 1WB7A 3SYAA 1GN2A 1ENVA 4O4IB 5B1AC 1NVPD 1OJHA 4B3RO 4HNAB 4DO2A 2B9ZA 3H1HH 1K73W 4BWAA 4MTXA 3T1YB 2ODMA 5KAIZ 5IDJA 3AK3A 1NH2D 1XL6A 3P32A 1U97A 3CP1A 3DTUB 4B3TB 2A3QA 3KCXA 1SETA 2Q5ZA 5CMUA 2WA4A 4F4LA 3OM3B 5FPOA 2CGOA 2IM9A 1BQ0A 2ILMA 3DSQA 1YCIA 3TK1A 1V55C 4D7TA 5JQGB 4ABMA 4O4HB 1X4TA 2F1MA 1FFXA 2OYQA 3WU2Z 2PI5A 3ABTA 5IYZB 2E76B 3AG7A 4JI4B 3F7YC 2R9AA 1FYJA 4MT8A 4PELA 4YXWG 4DRXA 2EILB 3SR2C 4DV3B 1Y74B 1FXKA 3VQXA 4DR3O 1SQGA 3JARA 3ZMUA 4DR5O 1S77D 5KX5B 1PNMA 4GKJO 4L87A 4IL6Z 4BR6A 2Y0IA 1FXVA 2A7WA 5H5NA 3CXCU 1DLBA 4X66O 2W0XA 4RUFA 1S5HC 3AG4B 4DV5O 3OR6C 4J80A 3DC5A 3FFQA 1EZJA 2XNDG 4XDKA 3AG3B 1Q6IA 3RW0A 2A79B 1F51A 1G6UA 1EM1A 1SA0B 2KSDA 1XL4A 2XOKG 1BCCH 2FMLA 1LNQA 1R6NA 1TUBB 5CB4A 2ZT9B 3UCSC 3ASOB 3CPWU 3DC6A 4TT3G 3FKSG 4R6ZA 2YC0A 3UT5B 1YITV 5LYJA 1TVKA 3JASB 4MVRA 2CTPA 4JZGA 2VS0A 1Z2GA 2ZIMA 4X1KA 1VQNV 2CAZC 1RPOA 1VP7A 2QKAA 3HB3B 3LSQA 2RCVA 1VARA 5JVDA 4J9ZB 1P7GA 2LGWA 3ZRVA 5KAFZ 5LHHA 3CCMV 4I9QA 3F5WC 2WLKA 3L70H 1IURA 2DWEC 4MVUA 1FJGB 1B04A 3OGIB 4GKKO 4UVAA 3FAVA 4CS2A 1CXZB 4AQYO 4KUMA 2ZDIA 4FLXA 3P3PA 1AJNA 1FFXB 2EZPA 1YI2V 1R6KA 1RSOA 2LQTA 2F4VB 1AI7A 1QLEB 2EJRA 3O9OA 2Q8VA 4P30A 2IJHA 4JV5B 4JI3O 1L0LH 3OR7C 3JSNA 3OMNB 3SYCA 2Y48A 5L3GA 5JJEB 2GBOA 1I94O 1ORQC 3F5TA 2L6LA 4O4JB 3HKDB 2YS8A 4IHJA 2EILC 4JAVA 3CEIA 2HHHB 3FYEB 5JCOC 5FNVA 2MW2B 3BA9A 4X20B 1I5XA 2JJ2G 3N2KA 4K0KB 2A06H 2XTAA 4PD4F 1YJNV 4G27B 2ZE7A 5B1BC 3G67A 4CH5A 3ZRWB 2UXBO 1XNQB 3ZCCA 2HLDG 3GB7C 3RVZA 5BY1A 3N27A 4JI6O 1YIJV 5J2TA 4DV1B 4E4EA 1KYOF 4IYHA 1RPRA 4FJCC 3AG4C 2VWKA 4GX0A 1XOUA 2Y69B 4RWUA 3AG3C 1GTOA 5L3EA 3ZMSA 3K5LA 2BCCH 2WLIB 4DR4B 1AP6A 1E79G 1YTFB 1Y6XA 2PGGA 4X89A 4H44B 2XT9A 5GTIZ 4G28B 3J80N 1R6TA 3BFRA 1ZL8A 4QIWF 4X8AA 4X1IB 2WLMA 4F6RA 4WCEV 4C7UA 5IJ0B 5LXTA 3ASOC 1YJ9V 3OTOB 4LNUB 5J9PC 1NZ6A 3ZMZA 3OT7A 4OGQB 1YVWA 2X7RB 1R3JC 5IYBO 3B09A 3KCYA 4I55A 1F4MA 5LBQA 3OEEG 1KKDA 1MZEA 3FYIB 3JAWB 1PP9H 1TGOA 1NBMG 4HAMA 5FLXN 1G4YB 1XILA 2CGNA 4JI0O 4DR1O 4AI8A 4X64B 3J81N 4FM1A 4PI0A 1ZAUA 1Q3EA 1SC5B 2IJKA 1A32A 1SQVH 4UB6Z 3RVYA 3OUSA 4UCRA 2JDIG 1Y76A 3MD0A 1VQ9V 1QLEC 1IBLO 5FNVB 2YI8A 1NKDA 3SJQC 5L3BA 2LP7A 3JATA 1S5JA 1KP2A 2AHZA 1N32O 3T2MA 3JAKA 3UM7A 3D3QA 4DV7O 2GTAA 4CH4A 3W7SA 2KKWA 4TUYB 3EHBB 3C3SA 3IC9A 3DXRA 1S0VA 3MHHC 4P9OA 3M8AA 4MVMA 5H6RA 5EYPB 1M90W 1IXBA 2R70A 3SYQA 5KA6A 4FFBA 2PTMA 1OHHG 2BSKA 2ZXWB 4IT5A 3SGIA 3E89A 1ZUQA 1MOFA 1K5QA 4LF5B 3JALA 4I50A 3JD4A 5LHIA 1HW7A 1K34A 5EBLC 2WLLB 4X62B 2DQ0A 3HKBB 5IYCO 4BIZA 1P7BA 5LXTB 2RMKB 2PYJA 2Y69C 2AZ0A 1J5EB 2IW5A 2ZINA 1BE3H 2MK3A 2A0LA 4UVBA 1VQ4V 3ABLB 5J2UA 2P6JA 1SZTA 5E1AC 1HR0B 5ITZB 2YIDA 2CH7B 2Q68A 3SYPA 3W7WA 1H2LA 4PDMA 4H37A 2UU9O 1XREA 4J9YB 3K57A 4LF7O 3JCZA 3E22A 3CE2A 1MSWD 3UQ8A 2EINC 1Y67A 1B06A 1WLEA 1KECA 3CB2A 1KUQA 3H1KH 1UFIA 4B3SO 4TOIA 3W7UA 1G8MA 5D5PA 1Q81W 5LGNA 3KZIZ 2ZE5A 1N0NA 4H33A 3CRMA 3G6BA 5IJ9B 2W0FC 2Y0PA 3CCSV 3T4DA 1N34B 4B3MB 1Y76B 2HP8A 2ARHA 2XAHA 3ZRSA 1NVPB 4WBNA 2XAQA 3CCLV 1IBKO 2UXDB 3ABMC 3CYOA 1NS1A 4B7KA 2NR5A 3U11A 3K08A 1VQ5V 4KP4A 1AILA 3IJ4A 2YXYA 2EULA 3K59A 5IWAB 1QVGU 5LMNB 2QWPB 3SJAC 3BA8A 2QM4A 1SZXA 3CWBH 1DK1A 2DMXA 4JI2O 1GH6A 4DR2O 4NXMB 2PI4A 2RDCA 3BVOA 5B3SB 3E8BA 5LP6B 2FB5A 4O4LA 1AI5A 1MZFA 3QO5A 4PJ0Z 2ZE8A 1THZA 1OCCB 2LGQA 3FB5C 3B77A 4CC5A 2BTQA 5LOVA 2OIGA 1GKFA 1XMOB 5A2QN 1BHAA 4KHPB 4ZI7A 2EX3A 2WAMA 4PDVA 5A9GA 1H2SB 4UV9A 2P4KA 3IGAC 4LF8O 1BT8A 1UPGA 3CJHA 4UV8A 2EIKB 4I0XA 3P30A 2Q7EA 3ABLC 4O2BB 2DJVA 2H3OA 3W7XA 3MAQA 1W59A 1GN6A 4DV6O 3T1YO 2CK3G 2OWOA 1ZWIC 1K4CC 2DOSA 1OV9A 4X88A 5JH7B 5IT9N 3RFRA 2DQ3A 4B7EA 2ADPA 3B8MA 4KFMA 2Q67A 2OTLV 4X1YA 5GONA 2ZNJA 4LC1A 5H9CA 4TV9A 1GK9A 3AK1A 3CRQA 2XASA 3B2EE 1JQ0A 3STZC 3GWOA 4U7NA 1CEZA 1VQPV 4YJ2B 3L9DA 1EN4A 1Z5VA 2QM8A 5CN0A 5TISZ 4DV3O 3A0RA 5EZYB 4E2LA 1PD3A 3SYOA 1WP8A 1D5AA 2WWWA 4GT1A 2HFEC 3CRCA 3ZMVA 1HNXO 2EIJB 3STLC 4PDRA 1N0JA 2NNUA 2RQ6A 4YJ3B 3APOA 2M6YA 4IGGA 5F2VO 1WA8A 5JCOA 3LDDA 2FYUH 3J7AU 3E86A 1KMIZ 4UUJC 1VQOV 3H1LH 3SDLA 3TETA 4DXWA 1Q5OA 4TV8A 2OCCB 5JJJB 5LA6A 1WAZA 5LP6C 3WB0A 3ML0A 1VMGA 4QE7A 3CCUV 2CE4A 4FIPC 3B8NA 1L0NH 1K5SA 2QWQB 1M9NA 3K0DA 4Z2WA 4JI5B 4DV0B 2E3CA 2VRZA 4PV1B 2D3OW 3FX7A 2Y4UA 3OMAB 4J7JA 1EN6A 4FLUA 2KG7B 3R66A 3D3IA 4DUYB 3P3NA 1PPJH 2OCHA 2EIKC 5LGUA 4EFBA 3GWKC 3D36C 2WLNA 2YEVA 1RM1C 1FJGO 1V54B 3I5DA 2AXTZ 3FB7C 1SQPH 4FLWA 3T1HB 3ABKB 1ROPA 3JD2A 5D5QA 3ZX6A 3K5MA 4OX9B 3TXSA 1D2DA 2JGDB 1BHBA 2F4VO 1R73A 1I0HA 2Q7HA 2ITDC 2WPDG 2QEXV 4JV5O 1VQMV 1EBOA 1KD1W 1ZTEA 1LUWA 5CA0B 4YHHO 1HNZB 4GCZA 4FLZA 1JOYA 5B1NA 5AG2A 3CMEV 3TJTA 1V9PA 2HHHO 3K03A 2V1DA 3CHXA 4I4TB 2QE7G 2LFSA 4K0KO 3S3WA 2AZ2A 1AVMA 3K9SA 4YIPA 2EIJC 3ZHRA 3WFVA 4UFZA 5L3CA 1XNQO 3ZEDA 2XUMA 2VWJA 2E74B 2Q4PA 1R1BA 4DV1O 1OCOB 1MSDA 4O2AA 1IX9A 4CS3A 2GUZA 4GX2A 1GM9A 4DR4O 2ZE6A 2OCCC 2DYSB 1EZVH 3JCUZ 1YDXA 1HDJA 2OIEA 2HJDA 3HKCA 3RYIA 2PZSA 4MS2A 1BQZA 3H9VA 4LF4B 4JI7B 1BMFG 3F7VC 5BMVA 4MVQA 3QO8A 3ZHQA 2UUAB 2JEXA 1P84F 1RP3B 2PF4E 4MW3A 1GRJA 2G38A 2JRIA 4YY3B 1IXMA 1VF6A 1NU1H 4K35A 4IYIA 4DRXB 2UUCB 1V54C 1FXKB 2QM7A 3JARB 2IU0A 3AG2B 4X64O 3BHPA 1JR9A 3OE7G 1NR1A 2B1IA 3ABKC 4RAIA 1FPOA 3OW2U 4PA6A 1QHTA 2Q69A 4GX5A 2PUSA 2CUGA 3X2QB 1W0KG 4DR3B 2ADQB 1M93A 3H01A 1EFRG 1LR1A 2IU3A 1MABG 1E1RG 1JCHA 4JF3A 5IYDO 4X66B 1ZSPA 4LFCO 1NT2B 2F93B 1GM8A 2Q0AA 4P9PA 1GN4A 4DV5B 5CB4B 3K06A 4DUZB 2HJFC 2NN4A 4R8CA 2YDEA 3TXQA 5LYJB 1TVKB 2NLJC 4LF5O 3ZIAG 3CC4V 4EEQA 5B66Z 4TSFG 3JD1A 4X1KB 3G71V 5EC2C 5JVDB 4X65B 5DN6G 4AILC 4LFBB 1NR7A 1N33B 1OCOC 1CPYA 4LFAO 1IVSA 3SPHA 4AHCA 2HR3A 4P2ZA 2IJIA 1J5EO 2D2CB 1F7YA 1AP5A 2DYSC 4KXRA 3FAVB 4MVZA 3NR7A 2XAFA 3RWRD 1R3IC 4A5UB 1N36O 5FPRA 4BAYA 3HR0A 4MW8A 4UVCA 4Q6GA 1RSOB 3OGCC 4QPJA 4FFKA 1DGSA 2ITCC 1Q90D 3ZHUA 3PJSK 4AQYB 2VQFB 2ZM6O 4ZHQA 5KMGA 3BRCA 4J11A 1VQKV 2B1GA 1XMQB 1H2MA 1JFFA 2XAJA 3T1CA 1BS3A 4IHJB 1B6QA 4H13B 1FXKC 1Q7YW 1H2GA 4H0LB 4WFEA 3AG2C 3N2KB 3G80A 2UXDO 1I94B 3CC2V 4GUNA 5KHHA 1FXHA 4LF9O 2AGAA 2IH1C 5IWAO 4FLVA 4U3JA 5J2TB 3AG1B 1OCRB 2UXNA 3BPZA 5C8YA 3VQWA 2ZR3A 1M56B 2LJ2A 4NXMO 1K7DA 4I5SA 1KBHA 2UXBB 1PNLA 2Q7GA 1JA8A 5KHJA 1QNMA 1HNWO 4N23A 2ZR2A 2QKCA 1ZL8B 4HYOA 2UXCB 4F6RB 1F23A 1JPXA 4DR6B 1FAFA 2ETNA 3A2FA 1BSMA 2O57A 4EB6A 4LR3A 5JWPA 5H2FZ 2EBOA 1XMOO 4KHPO 1T5EA 3CRRA 2DN9A 2Z5UA 4BIOA 3CX5F 4I55B 1SQFA 4LWSA 2YI9A 4J7KA 3E8GA 2QKSA 2FTKA 1AI4A 1G1XB 4DR7B 1BL8A 1JMKC 3E8HA 5DECA 1NTZH 2C2AA 3RYCA 2ZDIC 2CTQA 2ZCEA 4JYCA 4FPPA 2YIAA 4NTWA 3OEHG 3RBZA 3QG5A 3CC7V 5EC1C 5CA1A 4R7CA 4IIJA 3JATB 3OD4A 1MNGA 4ZOLA 3JAKB 1Q82W 3RYHA 1J95A 3ETDA 5EBWC 3CCVV 1NH2B 3DXRB 4LF6O 3OUFA 2F23A 1VIBA 3U10A 4FFBB 4JI1O 1AR1B 1YTFD 2BSKB 3ZMTA 1PL4A 1NQTA 2ZKOA 3JALB 4I50B 4ICGA 5LMUB 1XEQA 2P90A 3HKEA 4ZIBA 4FZ0A 3AG1C 1OCRC 4NXNO 3LSUA 3Q4HA 3N2GA 1KP3A 1XDCA 3IC7A 4F6EA 4WFHA 5KUMA 2R9RB 2L35A 2ZXWC 3FB6C 1M56C 4EFEA 3K9AA 3O65A 4R50A 5J2UB 3EXAA 1PM9A 1Q86W 1MA1A 2H94A 5EBMC 1QVFU 2WLHA 2B5UA 2DWDC 1R3LC 2YUAA 3TCUA 5C93A 4XDJA 4JI5O 5B1AB 3E22B 2V4DA 1HP8A 4DV4B 1KC8W 1COWG 2Z3YA 2JVDA 2X6AA 3BABA 1YSCA 2N04A 3OMIB 4PA4A 2QWRB 2ATKC 3RYFA 2RJZA 4OXSA 2Q73A 2UU9B 3LUTB 2YIBD 5L3DA 1AR4A 4DUYO 2GSMB 4O4IA 4RQEA 1H2NA 4PA3A 2N74A 4B3TO 1VQ7V 4TWKA 4B3SB 2F66C 4JTCB 4WBNB 1AROP 3SPGA 2ZD9A 1US6A 2DE0X 1V55B 3ABUA 4X9QA 2JGUA 3B40A 4XBFA 4MTFA 4NKGB 5EIBD 2FL4A 4UCSA 1H8EG 4JI4O 4OX9O 2E75B 3JYCA 2EJ7A 1K33A 3BY6A 5JQGA 4O4HA 2IBZH 3EFFK 5GW7A 3SPIA 4DV2B 1IBMB 5IYZA 2A9HA 2EIMB 4O4LB 1QU7A 3BEHA 2PYLA 3UO3A 1YEWA 1Y74A 1SS3A 4JI8B 4PI2A 5LOVB 2BTQB 5B3SC 2UXXA 5KX5A 2JIZG 2OTJV 1WB8A 2Q9LA 1E1QG 4ZI7B 4HBNA 1PV0A 5KHGA 2PY5A 1X59A 2GHYA 3CMAV 3S3XA 2LW1A 4BW9A 5EK0A 1DF5A 3ZN0A 3RN4A 4PHZA 3CJHB 1ZLZA 1OCCC 1Q6UA 5K1PA 4I0XB 1SQBH 1GO3F 1MMMA 1RFYA 4CS4A 2P7TC 3ZRXA 5KUKA 4I9WA 1SA0A 1I5YA 4FM2A 3G6EV 1TUBA 1W2BU 3D8CA 3QVNA 4L8JA 5DM6V 4LF4O 2Z0AA 4JI7O 1VF7A 1M5IA 3ASNB 2UUAO 3LDEA 3UT5A 4X1YB 2DYRB 5GONB 3JASA 5IY5B 3A8TA 4TV9B 4UXNA 4DV6B 2ZIOA 4JYAB 1H8HG 1P49A 3CS5A 1DF4A 4YY3O 4Z1VA 1N8RW 4WFAV 1M4UA 1OZ0A 5CBHA 4PA9A 2Q0OC 5HFMA 1FKAO 4WFBV 3APQA 2UUCO 1SERA 4NR1A 5H6QA 1XNRB 1K9MW 4UCUA 1PNKA 2ZNIA 5BR8B 4NTYA 5LL6Y 2UUBB 2KB1A 4OPHA 1WA8B 2YXHA 3SPCA 2K9PA 3OFNG 2P67A 5CA3A 2GTSA 1CP9A 2E5LB 5DEDA 1HNXB 5B1BB 2VQEB 4TV8B 5LA6B 1UJWB 2EIMC 4O4JA 3HKDA 1QCEA 4CZZA 4LH6A 3ZS8C 1OCZB 1IZ3A 3QTCA 2XAGA 4LCUC 2BE3A 4X20A 3BAAA 4UB8Z 1L8DA 2ZQMA 2DW4A 4DUZO 1KQSU 1SQXH 5KHKA 1O9GA 3E35A 3ZRWA 4U7OA 4JYYA 1HWYA 3A0HZ 4ZKIA 2BOCC 4FMTA 1AI6A 4X65O 4LFBO 1N33O 4B3RB 3CD6V 4NB5A 3THOA 3KKYA 3OTOO 2WLIA 3C90A 2YEVB 3JSLA 2F43G 4JGSA 1JJ2U 2AHYA 1I08A 4NVPA 4W4KA 1NJIW 1SKVA 1XQ8A 1VEWA 5KLVH 4X1IA 3JAMN 1YXBA 5IJ0A 1VQ8V 5JJNB 1KU9A 4LNUA 3AEIA 1VQLV 3ASNC 4MTOA 1URFA 2DYRC 1Y66A 1QR9A 5IY5C 3WB2A 1B3QA 4QPKA 2WLJA 4WFFA 1YF2A 1K3EA 4UCTA 2VQFO 1U96A 4PA7A 4FLYA 1XMQO 3JAWA 5K1XA 4RO2A 3OAAG 4DR5B 2HVJC 3IFXA 3ETQA 4MSWC 4K8ZA 4UCOA 4GKJB 4Z1MG 4YHHB 2QDOA 4GLXA 1YHQV 4I7ZB 4MVOA 2YIBA 1K4DC 1W0JG 2W6IG 2JEUA 4O2AB 3CXHF 2GUZB 4G2KA 3K79A 3FD9A 2KQXA 1LUVA 3CRAA 3UKMA 3ETEA 4TUYA 1OCZC 4X62O 2YICA 3HKCB 3L72H 3M99B 3RYIB 3QNEA 2WA3A 5EYPA 2UXCO 4FM0A 4DR6O 4LP8A 5BMVB 2QJ1A 2QR4A 4NTXA 3LNMB 2EZOA 3ZHVA 4DYLA 2HVKC 2IH3C 2P4VA 5B1OA 2WLLA 4CH6A 4RQFA 3HKBA 1HR0O 3TGUH 3U0ZA 3H1JH 3L75H 2EINB 1TA8A 1KKCA 3RGBA 4OPAA 5CBFA 3OTFA 4GKKB 4DR7O 1FD9A 3K3WA 5ITZA 2CH7A 1H2KA 3IAYA 3C3TA 1KB9F 4TQDA 4FK5C 1N34O 5LHGA 4B3MO 4JTDB 1SF9A 2HKOA 4JI3B 3EVKA 1WN7A 1P4RA 1FFTB 3ABMB 3CCQV 3W7TA 2QTSA 4JASA 1WNSA 5IJ9A 2RNBA 2YXLA 3G4SV 3X2QC 5LMNO 2XHBA 1SESA 2CDYA 4BW5A 5LGTA 1ZX3A 5L3FA 2X6BA 1GM7A 4LFCB 3QF7A 1S72V 4JI6B 5LMUO 4J41A 1TAEA 4BIUA 3E8FA 4WFGA 1M57B 2LFRA 1L1FA 1BZKA 1Q43A 3JD0A 2W6JG 5KA5A 4JTAB 2QTOA 3L74H 3NXSA 4FLTA 1I7FA 1AR5A 5LP6A 3PN1A 3HPLC 2QSAA 3K58A
chains in the Genus database with same CATH topology
5BY1A 2LW7A 4JI6O 3M8AA 1DK1A 4JI2O 4DR2O 4YHHO 3JAMN 4DV4O 1HNXO 4YY3O 4OPAA 2UXDO 2HHHO 4DR7O 4JI4O 1FKAO 4OX9O 2UUCO 4B3RO 4K0KO 4LF6O 2VQFO 4LF9O 3J7AU 2AGAA 5IWAO 3J80N 1R6TA 4LFCO 3SDLA 5BXZA 1N34O 4JI1O 1XMQO 4B3MO 1XNQO 5A2QN 5LL6Y 4JYAO 3T1HO 2ZKOA 1R1BA 4DV1O 4NXMO 4OPHA 1XEQA 4LF8O 1YZBA 4GKKO 4LF5O 1HNWO 4NXNO 4DR4O 2UU9O 4AQYO 4LF7O 2DJVA 5LMNO 3R66A 1XNRO 1AB3A 3O65A 5FLXN 1KUQA 4B3SO 4DV6O 1X59A 4LFAO 4DV2O 3T1YO 1FYJA 1J5EO 1HNZO 4JI0O 4DR1O 1XMOO 2DOSA 4JI3O 5BR8O 1F7YA 4KHPO 3J81N 2UUBO 1IBMO 5IT9N 4DR3O 3RT3C 4DUZO 4DR5O 1FJGO 5LMUO 4JI5O 4A5UB 1I94O 1N36O 3F5TA 1A32A 4GKJO 2JRIA 4X62O 4JI8O 1G1XB 5H5NA 1IBKO 1IBLO 2E5LO 2UXCO 1NS1A 2VQEO 4DR6O 4X66O 4X65O 4LFBO 1N33O 1AILA 1D2DA 2FKXA 4DV5O 1N32O 3OTOO 4DUYO 4LF4O 2F4VO 2ZM6O 2Z0AA 4DV7O 4JI7O 2N74A 4JV5O 2UUAO 4B3TO 4X64O 4DV0O 4DV3O 2UXBO 1HR0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BY1 A;  2LW7 A;  4JI6 O;  3M8A A;  1DK1 A;  4JI2 O;  4DR2 O;  4YHH O;  3JAM N;  4DV4 O;  1HNX O;  4YY3 O;  4OPA A;  2UXD O;  2HHH O;  4DR7 O;  4JI4 O;  1FKA O;  4OX9 O;  2UUC O;  4B3R O;  4K0K O;  4LF6 O;  2VQF O;  4LF9 O;  3J7A U;  2AGA A;  5IWA O;  3J80 N;  1R6T A;  4LFC O;  3SDL A;  5BXZ A;  1N34 O;  4JI1 O;  1XMQ O;  4B3M O;  1XNQ O;  5A2Q N;  5LL6 Y;  4JYA O;  3T1H O;  2ZKO A;  1R1B A;  4DV1 O;  4NXM O;  4OPH A;  1XEQ A;  4LF8 O;  1YZB A;  4GKK O;  4LF5 O;  1HNW O;  4NXN O;  4DR4 O;  2UU9 O;  4AQY O;  4LF7 O;  2DJV A;  5LMN O;  3R66 A;  1XNR O;  1AB3 A;  3O65 A;  5FLX N;  1KUQ A;  4B3S O;  4DV6 O;  1X59 A;  4LFA O;  4DV2 O;  3T1Y O;  1FYJ A;  1J5E O;  1HNZ O;  4JI0 O;  4DR1 O;  1XMO O;  2DOS A;  4JI3 O;  5BR8 O;  1F7Y A;  4KHP O;  3J81 N;  2UUB O;  1IBM O;  5IT9 N;  4DR3 O;  3RT3 C;  4DUZ O;  4DR5 O;  1FJG O;  5LMU O;  4JI5 O;  4A5U B;  1I94 O;  1N36 O;  3F5T A;  1A32 A;  4GKJ O;  2JRI A;  4X62 O;  4JI8 O;  1G1X B;  5H5N A;  1IBK O;  1IBL O;  2E5L O;  2UXC O;  1NS1 A;  2VQE O;  4DR6 O;  4X66 O;  4X65 O;  4LFB O;  1N33 O;  1AIL A;  1D2D A;  2FKX A;  4DV5 O;  1N32 O;  3OTO O;  4DUY O;  4LF4 O;  2F4V O;  2ZM6 O;  2Z0A A;  4DV7 O;  4JI7 O;  2N74 A;  4JV5 O;  2UUA O;  4B3T O;  4X64 O;  4DV0 O;  4DV3 O;  2UXB O;  1HR0 O; 
#chains in the Genus database with same CATH topology
 2P5O A;  1WP7 A;  4LFA B;  1WPX A;  4LBE C;  4U3F H;  3ZJZ A;  4DV4 O;  3ICX A;  3CCE V;  3SJC C;  3K5N A;  3K5O A;  1O9H A;  1R3K C;  1N36 B;  3R65 A;  4ZHQ B;  5KMG B;  2HEP A;  1VF6 C;  3MDS A;  1JFF B;  2CTR A;  3CSX A;  1EN5 A;  1GMG A;  1GN3 A;  4XDL A;  3D36 A;  4O2B A;  1NTM H;  4JI0 B;  4DR1 B;  1D5N A;  1QLN A;  4CC6 A;  2ZM6 B;  2LO1 A;  1MG1 A;  4LH7 A;  1XI1 A;  3WG7 B;  4HZ3 A;  3L71 H;  2GV9 A;  2X6C A;  5JH7 A;  2P06 A;  1BGY H;  3T4Z A;  1JJO A;  1JVM A;  2AW9 A;  4J10 A;  4U3J B;  1IBL B;  3ETG A;  4MTG A;  4JZ2 A;  2QWO B;  5CBG A;  3SPJ A;  3LSS A;  4DK1 A;  5C8Y B;  3VQV A;  3ZBH A;  2CTW A;  1Z5W A;  1XHZ A;  4PDL A;  1VQ6 V;  1N32 B;  1XBL A;  2IJJ A;  4DV2 O;  4DV7 B;  4GYC B;  4LF9 B;  4DW1 A;  1IBM O;  3LDC A;  3E2E A;  4YJ2 A;  3RT3 C;  4K8X A;  5E79 Z;  4GZR B;  5EZY A;  3E83 A;  3K0G A;  4JI8 O;  4EB6 B;  1FS0 G;  4KL1 A;  3FB8 C;  1QQC A;  4J7Z A;  1XHX A;  1WPB A;  3L73 H;  3M7M X;  1HNW B;  1S5L Z;  1PKX A;  4ASU G;  1N4C A;  4YJ3 A;  4QJF B;  5EIB C;  3UO2 A;  4JAA A;  4LWS B;  2BTO A;  1M57 C;  3KG2 A;  4YIO A;  2K1E A;  4DV0 O;  1AJQ A;  1XUQ A;  4RUE A;  2LW7 A;  2M7W A;  4JYB A;  4NYK A;  4CBC A;  1K97 A;  1S76 D;  2R72 A;  4UCV A;  4FZ1 A;  5KHI A;  4QE9 A;  3RYC B;  1NI8 A;  2JS3 A;  2JK5 C;  2Q6A A;  5HFL A;  4B08 A;  2R9I A;  4LF7 B;  1S3J A;  2HG5 C;  2RN9 A;  3I56 V;  1JX9 A;  4HNA A;  4ZBM A;  1RM1 B;  4MVS A;  5BXZ A;  5CA1 B;  1IDS A;  2KG7 A;  4IIJ B;  1PL0 A;  3VOU A;  1K8A W;  4JYA O;  2JS5 A;  1Q6H A;  4ZOL B;  3T1H O;  2V7Q G;  3RYH B;  1WJZ A;  4JAU A;  2P22 C;  1YZB A;  3CCJ V;  2QGN A;  1TUE B;  1F4N A;  3CCR V;  1IBK B;  1QBZ A;  2GDS A;  2X0L A;  3B4S A;  5B5E Z;  2N05 A;  1XNR O;  4K3A A;  2H8P C;  1SRY A;  1Y4M A;  1AB3 A;  3WG7 C;  4TQF A;  4DW0 A;  4GX1 A;  3JD3 A;  3MHS C;  3GVM A;  3VQY A;  1H38 A;  2YSU B;  5FL7 G;  4Q20 A;  5GTH Z;  1M1K W;  1HNZ O;  3SJB C;  4LF6 B;  2OT5 A;  3HKE B;  4CH3 A;  5BR8 O;  2UUB O;  1Q8I A;  1SQQ H;  4FVM A;  4WF9 V;  3AK2 A;  2JGD A;  3Q4H B;  4J42 A;  3WB1 A;  3ZN1 A;  3N2G B;  1VF5 B;  4JI1 B;  4JI2 B;  4DR2 B;  3A0B Z;  3VBB A;  1QR8 A;  4N21 A;  4JPR A;  4QNH B;  2Y4T A;  3ZHT A;  2E5L O;  5CA0 A;  2VQE O;  1DTO A;  2BOB C;  3ZHS A;  2QA4 V;  4NXN B;  1NTK H;  3H1I H;  2JJ1 G;  2FKX A;  2QWN B;  4EKW A;  1K92 A;  3DGE A;  5IE9 A;  3K04 A;  3BCC H;  4I4T A;  1YJW V;  2WSS G;  4DK0 A;  4W4L A;  4D7S A;  4QGP A;  5BZB A;  2F95 B;  1GAX A;  3QO7 A;  4D6T H;  3LNN A;  3RYF B;  3I55 V;  1AJP A;  4LF8 B;  1WB7 A;  3SYA A;  1GN2 A;  1ENV A;  4O4I B;  5B1A C;  1NVP D;  1OJH A;  4B3R O;  4HNA B;  4DO2 A;  2B9Z A;  3H1H H;  1K73 W;  4BWA A;  4MTX A;  3T1Y B;  2ODM A;  5KAI Z;  5IDJ A;  3AK3 A;  1NH2 D;  1XL6 A;  3P32 A;  1U97 A;  3CP1 A;  3DTU B;  4B3T B;  2A3Q A;  3KCX A;  1SET A;  2Q5Z A;  5CMU A;  2WA4 A;  4F4L A;  3OM3 B;  5FPO A;  2CGO A;  2IM9 A;  1BQ0 A;  2ILM A;  3DSQ A;  1YCI A;  3TK1 A;  1V55 C;  4D7T A;  5JQG B;  4ABM A;  4O4H B;  1X4T A;  2F1M A;  1FFX A;  2OYQ A;  3WU2 Z;  2PI5 A;  3ABT A;  5IYZ B;  2E76 B;  3AG7 A;  4JI4 B;  3F7Y C;  2R9A A;  1FYJ A;  4MT8 A;  4PEL A;  4YXW G;  4DRX A;  2EIL B;  3SR2 C;  4DV3 B;  1Y74 B;  1FXK A;  3VQX A;  4DR3 O;  1SQG A;  3JAR A;  3ZMU A;  4DR5 O;  1S77 D;  5KX5 B;  1PNM A;  4GKJ O;  4L87 A;  4IL6 Z;  4BR6 A;  2Y0I A;  1FXV A;  2A7W A;  5H5N A;  3CXC U;  1DLB A;  4X66 O;  2W0X A;  4RUF A;  1S5H C;  3AG4 B;  4DV5 O;  3OR6 C;  4J80 A;  3DC5 A;  3FFQ A;  1EZJ A;  2XND G;  4XDK A;  3AG3 B;  1Q6I A;  3RW0 A;  2A79 B;  1F51 A;  1G6U A;  1EM1 A;  1SA0 B;  2KSD A;  1XL4 A;  2XOK G;  1BCC H;  2FML A;  1LNQ A;  1R6N A;  1TUB B;  5CB4 A;  2ZT9 B;  3UCS C;  3ASO B;  3CPW U;  3DC6 A;  4TT3 G;  3FKS G;  4R6Z A;  2YC0 A;  3UT5 B;  1YIT V;  5LYJ A;  1TVK A;  3JAS B;  4MVR A;  2CTP A;  4JZG A;  2VS0 A;  1Z2G A;  2ZIM A;  4X1K A;  1VQN V;  2CAZ C;  1RPO A;  1VP7 A;  2QKA A;  3HB3 B;  3LSQ A;  2RCV A;  1VAR A;  5JVD A;  4J9Z B;  1P7G A;  2LGW A;  3ZRV A;  5KAF Z;  5LHH A;  3CCM V;  4I9Q A;  3F5W C;  2WLK A;  3L70 H;  1IUR A;  2DWE C;  4MVU A;  1FJG B;  1B04 A;  3OGI B;  4GKK O;  4UVA A;  3FAV A;  4CS2 A;  1CXZ B;  4AQY O;  4KUM A;  2ZDI A;  4FLX A;  3P3P A;  1AJN A;  1FFX B;  2EZP A;  1YI2 V;  1R6K A;  1RSO A;  2LQT A;  2F4V B;  1AI7 A;  1QLE B;  2EJR A;  3O9O A;  2Q8V A;  4P30 A;  2IJH A;  4JV5 B;  4JI3 O;  1L0L H;  3OR7 C;  3JSN A;  3OMN B;  3SYC A;  2Y48 A;  5L3G A;  5JJE B;  2GBO A;  1I94 O;  1ORQ C;  3F5T A;  2L6L A;  4O4J B;  3HKD B;  2YS8 A;  4IHJ A;  2EIL C;  4JAV A;  3CEI A;  2HHH B;  3FYE B;  5JCO C;  5FNV A;  2MW2 B;  3BA9 A;  4X20 B;  1I5X A;  2JJ2 G;  3N2K A;  4K0K B;  2A06 H;  2XTA A;  4PD4 F;  1YJN V;  4G27 B;  2ZE7 A;  5B1B C;  3G67 A;  4CH5 A;  3ZRW B;  2UXB O;  1XNQ B;  3ZCC A;  2HLD G;  3GB7 C;  3RVZ A;  5BY1 A;  3N27 A;  4JI6 O;  1YIJ V;  5J2T A;  4DV1 B;  4E4E A;  1KYO F;  4IYH A;  1RPR A;  4FJC C;  3AG4 C;  2VWK A;  4GX0 A;  1XOU A;  2Y69 B;  4RWU A;  3AG3 C;  1GTO A;  5L3E A;  3ZMS A;  3K5L A;  2BCC H;  2WLI B;  4DR4 B;  1AP6 A;  1E79 G;  1YTF B;  1Y6X A;  2PGG A;  4X89 A;  4H44 B;  2XT9 A;  5GTI Z;  4G28 B;  3J80 N;  1R6T A;  3BFR A;  1ZL8 A;  4QIW F;  4X8A A;  4X1I B;  2WLM A;  4F6R A;  4WCE V;  4C7U A;  5IJ0 B;  5LXT A;  3ASO C;  1YJ9 V;  3OTO B;  4LNU B;  5J9P C;  1NZ6 A;  3ZMZ A;  3OT7 A;  4OGQ B;  1YVW A;  2X7R B;  1R3J C;  5IYB O;  3B09 A;  3KCY A;  4I55 A;  1F4M A;  5LBQ A;  3OEE G;  1KKD A;  1MZE A;  3FYI B;  3JAW B;  1PP9 H;  1TGO A;  1NBM G;  4HAM A;  5FLX N;  1G4Y B;  1XIL A;  2CGN A;  4JI0 O;  4DR1 O;  4AI8 A;  4X64 B;  3J81 N;  4FM1 A;  4PI0 A;  1ZAU A;  1Q3E A;  1SC5 B;  2IJK A;  1A32 A;  1SQV H;  4UB6 Z;  3RVY A;  3OUS A;  4UCR A;  2JDI G;  1Y76 A;  3MD0 A;  1VQ9 V;  1QLE C;  1IBL O;  5FNV B;  2YI8 A;  1NKD A;  3SJQ C;  5L3B A;  2LP7 A;  3JAT A;  1S5J A;  1KP2 A;  2AHZ A;  1N32 O;  3T2M A;  3JAK A;  3UM7 A;  3D3Q A;  4DV7 O;  2GTA A;  4CH4 A;  3W7S A;  2KKW A;  4TUY B;  3EHB B;  3C3S A;  3IC9 A;  3DXR A;  1S0V A;  3MHH C;  4P9O A;  3M8A A;  4MVM A;  5H6R A;  5EYP B;  1M90 W;  1IXB A;  2R70 A;  3SYQ A;  5KA6 A;  4FFB A;  2PTM A;  1OHH G;  2BSK A;  2ZXW B;  4IT5 A;  3SGI A;  3E89 A;  1ZUQ A;  1MOF A;  1K5Q A;  4LF5 B;  3JAL A;  4I50 A;  3JD4 A;  5LHI A;  1HW7 A;  1K34 A;  5EBL C;  2WLL B;  4X62 B;  2DQ0 A;  3HKB B;  5IYC O;  4BIZ A;  1P7B A;  5LXT B;  2RMK B;  2PYJ A;  2Y69 C;  2AZ0 A;  1J5E B;  2IW5 A;  2ZIN A;  1BE3 H;  2MK3 A;  2A0L A;  4UVB A;  1VQ4 V;  3ABL B;  5J2U A;  2P6J A;  1SZT A;  5E1A C;  1HR0 B;  5ITZ B;  2YID A;  2CH7 B;  2Q68 A;  3SYP A;  3W7W A;  1H2L A;  4PDM A;  4H37 A;  2UU9 O;  1XRE A;  4J9Y B;  3K57 A;  4LF7 O;  3JCZ A;  3E22 A;  3CE2 A;  1MSW D;  3UQ8 A;  2EIN C;  1Y67 A;  1B06 A;  1WLE A;  1KEC A;  3CB2 A;  1KUQ A;  3H1K H;  1UFI A;  4B3S O;  4TOI A;  3W7U A;  1G8M A;  5D5P A;  1Q81 W;  5LGN A;  3KZI Z;  2ZE5 A;  1N0N A;  4H33 A;  3CRM A;  3G6B A;  5IJ9 B;  2W0F C;  2Y0P A;  3CCS V;  3T4D A;  1N34 B;  4B3M B;  1Y76 B;  2HP8 A;  2ARH A;  2XAH A;  3ZRS A;  1NVP B;  4WBN A;  2XAQ A;  3CCL V;  1IBK O;  2UXD B;  3ABM C;  3CYO A;  1NS1 A;  4B7K A;  2NR5 A;  3U11 A;  3K08 A;  1VQ5 V;  4KP4 A;  1AIL A;  3IJ4 A;  2YXY A;  2EUL A;  3K59 A;  5IWA B;  1QVG U;  5LMN B;  2QWP B;  3SJA C;  3BA8 A;  2QM4 A;  1SZX A;  3CWB H;  1DK1 A;  2DMX A;  4JI2 O;  1GH6 A;  4DR2 O;  4NXM B;  2PI4 A;  2RDC A;  3BVO A;  5B3S B;  3E8B A;  5LP6 B;  2FB5 A;  4O4L A;  1AI5 A;  1MZF A;  3QO5 A;  4PJ0 Z;  2ZE8 A;  1THZ A;  1OCC B;  2LGQ A;  3FB5 C;  3B77 A;  4CC5 A;  2BTQ A;  5LOV A;  2OIG A;  1GKF A;  1XMO B;  5A2Q N;  1BHA A;  4KHP B;  4ZI7 A;  2EX3 A;  2WAM A;  4PDV A;  5A9G A;  1H2S B;  4UV9 A;  2P4K A;  3IGA C;  4LF8 O;  1BT8 A;  1UPG A;  3CJH A;  4UV8 A;  2EIK B;  4I0X A;  3P30 A;  2Q7E A;  3ABL C;  4O2B B;  2DJV A;  2H3O A;  3W7X A;  3MAQ A;  1W59 A;  1GN6 A;  4DV6 O;  3T1Y O;  2CK3 G;  2OWO A;  1ZWI C;  1K4C C;  2DOS A;  1OV9 A;  4X88 A;  5JH7 B;  5IT9 N;  3RFR A;  2DQ3 A;  4B7E A;  2ADP A;  3B8M A;  4KFM A;  2Q67 A;  2OTL V;  4X1Y A;  5GON A;  2ZNJ A;  4LC1 A;  5H9C A;  4TV9 A;  1GK9 A;  3AK1 A;  3CRQ A;  2XAS A;  3B2E E;  1JQ0 A;  3STZ C;  3GWO A;  4U7N A;  1CEZ A;  1VQP V;  4YJ2 B;  3L9D A;  1EN4 A;  1Z5V A;  2QM8 A;  5CN0 A;  5TIS Z;  4DV3 O;  3A0R A;  5EZY B;  4E2L A;  1PD3 A;  3SYO A;  1WP8 A;  1D5A A;  2WWW A;  4GT1 A;  2HFE C;  3CRC A;  3ZMV A;  1HNX O;  2EIJ B;  3STL C;  4PDR A;  1N0J A;  2NNU A;  2RQ6 A;  4YJ3 B;  3APO A;  2M6Y A;  4IGG A;  5F2V O;  1WA8 A;  5JCO A;  3LDD A;  2FYU H;  3J7A U;  3E86 A;  1KMI Z;  4UUJ C;  1VQO V;  3H1L H;  3SDL A;  3TET A;  4DXW A;  1Q5O A;  4TV8 A;  2OCC B;  5JJJ B;  5LA6 A;  1WAZ A;  5LP6 C;  3WB0 A;  3ML0 A;  1VMG A;  4QE7 A;  3CCU V;  2CE4 A;  4FIP C;  3B8N A;  1L0N H;  1K5S A;  2QWQ B;  1M9N A;  3K0D A;  4Z2W A;  4JI5 B;  4DV0 B;  2E3C A;  2VRZ A;  4PV1 B;  2D3O W;  3FX7 A;  2Y4U A;  3OMA B;  4J7J A;  1EN6 A;  4FLU A;  2KG7 B;  3R66 A;  3D3I A;  4DUY B;  3P3N A;  1PPJ H;  2OCH A;  2EIK C;  5LGU A;  4EFB A;  3GWK C;  3D36 C;  2WLN A;  2YEV A;  1RM1 C;  1FJG O;  1V54 B;  3I5D A;  2AXT Z;  3FB7 C;  1SQP H;  4FLW A;  3T1H B;  3ABK B;  1ROP A;  3JD2 A;  5D5Q A;  3ZX6 A;  3K5M A;  4OX9 B;  3TXS A;  1D2D A;  2JGD B;  1BHB A;  2F4V O;  1R73 A;  1I0H A;  2Q7H A;  2ITD C;  2WPD G;  2QEX V;  4JV5 O;  1VQM V;  1EBO A;  1KD1 W;  1ZTE A;  1LUW A;  5CA0 B;  4YHH O;  1HNZ B;  4GCZ A;  4FLZ A;  1JOY A;  5B1N A;  5AG2 A;  3CME V;  3TJT A;  1V9P A;  2HHH O;  3K03 A;  2V1D A;  3CHX A;  4I4T B;  2QE7 G;  2LFS A;  4K0K O;  3S3W A;  2AZ2 A;  1AVM A;  3K9S A;  4YIP A;  2EIJ C;  3ZHR A;  3WFV A;  4UFZ A;  5L3C A;  1XNQ O;  3ZED A;  2XUM A;  2VWJ A;  2E74 B;  2Q4P A;  1R1B A;  4DV1 O;  1OCO B;  1MSD A;  4O2A A;  1IX9 A;  4CS3 A;  2GUZ A;  4GX2 A;  1GM9 A;  4DR4 O;  2ZE6 A;  2OCC C;  2DYS B;  1EZV H;  3JCU Z;  1YDX A;  1HDJ A;  2OIE A;  2HJD A;  3HKC A;  3RYI A;  2PZS A;  4MS2 A;  1BQZ A;  3H9V A;  4LF4 B;  4JI7 B;  1BMF G;  3F7V C;  5BMV A;  4MVQ A;  3QO8 A;  3ZHQ A;  2UUA B;  2JEX A;  1P84 F;  1RP3 B;  2PF4 E;  4MW3 A;  1GRJ A;  2G38 A;  2JRI A;  4YY3 B;  1IXM A;  1VF6 A;  1NU1 H;  4K35 A;  4IYI A;  4DRX B;  2UUC B;  1V54 C;  1FXK B;  2QM7 A;  3JAR B;  2IU0 A;  3AG2 B;  4X64 O;  3BHP A;  1JR9 A;  3OE7 G;  1NR1 A;  2B1I A;  3ABK C;  4RAI A;  1FPO A;  3OW2 U;  4PA6 A;  1QHT A;  2Q69 A;  4GX5 A;  2PUS A;  2CUG A;  3X2Q B;  1W0K G;  4DR3 B;  2ADQ B;  1M93 A;  3H01 A;  1EFR G;  1LR1 A;  2IU3 A;  1MAB G;  1E1R G;  1JCH A;  4JF3 A;  5IYD O;  4X66 B;  1ZSP A;  4LFC O;  1NT2 B;  2F93 B;  1GM8 A;  2Q0A A;  4P9P A;  1GN4 A;  4DV5 B;  5CB4 B;  3K06 A;  4DUZ B;  2HJF C;  2NN4 A;  4R8C A;  2YDE A;  3TXQ A;  5LYJ B;  1TVK B;  2NLJ C;  4LF5 O;  3ZIA G;  3CC4 V;  4EEQ A;  5B66 Z;  4TSF G;  3JD1 A;  4X1K B;  3G71 V;  5EC2 C;  5JVD B;  4X65 B;  5DN6 G;  4AIL C;  4LFB B;  1NR7 A;  1N33 B;  1OCO C;  1CPY A;  4LFA O;  1IVS A;  3SPH A;  4AHC A;  2HR3 A;  4P2Z A;  2IJI A;  1J5E O;  2D2C B;  1F7Y A;  1AP5 A;  2DYS C;  4KXR A;  3FAV B;  4MVZ A;  3NR7 A;  2XAF A;  3RWR D;  1R3I C;  4A5U B;  1N36 O;  5FPR A;  4BAY A;  3HR0 A;  4MW8 A;  4UVC A;  4Q6G A;  1RSO B;  3OGC C;  4QPJ A;  4FFK A;  1DGS A;  2ITC C;  1Q90 D;  3ZHU A;  3PJS K;  4AQY B;  2VQF B;  2ZM6 O;  4ZHQ A;  5KMG A;  3BRC A;  4J11 A;  1VQK V;  2B1G A;  1XMQ B;  1H2M A;  1JFF A;  2XAJ A;  3T1C A;  1BS3 A;  4IHJ B;  1B6Q A;  4H13 B;  1FXK C;  1Q7Y W;  1H2G A;  4H0L B;  4WFE A;  3AG2 C;  3N2K B;  3G80 A;  2UXD O;  1I94 B;  3CC2 V;  4GUN A;  5KHH A;  1FXH A;  4LF9 O;  2AGA A;  2IH1 C;  5IWA O;  4FLV A;  4U3J A;  5J2T B;  3AG1 B;  1OCR B;  2UXN A;  3BPZ A;  5C8Y A;  3VQW A;  2ZR3 A;  1M56 B;  2LJ2 A;  4NXM O;  1K7D A;  4I5S A;  1KBH A;  2UXB B;  1PNL A;  2Q7G A;  1JA8 A;  5KHJ A;  1QNM A;  1HNW O;  4N23 A;  2ZR2 A;  2QKC A;  1ZL8 B;  4HYO A;  2UXC B;  4F6R B;  1F23 A;  1JPX A;  4DR6 B;  1FAF A;  2ETN A;  3A2F A;  1BSM A;  2O57 A;  4EB6 A;  4LR3 A;  5JWP A;  5H2F Z;  2EBO A;  1XMO O;  4KHP O;  1T5E A;  3CRR A;  2DN9 A;  2Z5U A;  4BIO A;  3CX5 F;  4I55 B;  1SQF A;  4LWS A;  2YI9 A;  4J7K A;  3E8G A;  2QKS A;  2FTK A;  1AI4 A;  1G1X B;  4DR7 B;  1BL8 A;  1JMK C;  3E8H A;  5DEC A;  1NTZ H;  2C2A A;  3RYC A;  2ZDI C;  2CTQ A;  2ZCE A;  4JYC A;  4FPP A;  2YIA A;  4NTW A;  3OEH G;  3RBZ A;  3QG5 A;  3CC7 V;  5EC1 C;  5CA1 A;  4R7C A;  4IIJ A;  3JAT B;  3OD4 A;  1MNG A;  4ZOL A;  3JAK B;  1Q82 W;  3RYH A;  1J95 A;  3ETD A;  5EBW C;  3CCV V;  1NH2 B;  3DXR B;  4LF6 O;  3OUF A;  2F23 A;  1VIB A;  3U10 A;  4FFB B;  4JI1 O;  1AR1 B;  1YTF D;  2BSK B;  3ZMT A;  1PL4 A;  1NQT A;  2ZKO A;  3JAL B;  4I50 B;  4ICG A;  5LMU B;  1XEQ A;  2P90 A;  3HKE A;  4ZIB A;  4FZ0 A;  3AG1 C;  1OCR C;  4NXN O;  3LSU A;  3Q4H A;  3N2G A;  1KP3 A;  1XDC A;  3IC7 A;  4F6E A;  4WFH A;  5KUM A;  2R9R B;  2L35 A;  2ZXW C;  3FB6 C;  1M56 C;  4EFE A;  3K9A A;  3O65 A;  4R50 A;  5J2U B;  3EXA A;  1PM9 A;  1Q86 W;  1MA1 A;  2H94 A;  5EBM C;  1QVF U;  2WLH A;  2B5U A;  2DWD C;  1R3L C;  2YUA A;  3TCU A;  5C93 A;  4XDJ A;  4JI5 O;  5B1A B;  3E22 B;  2V4D A;  1HP8 A;  4DV4 B;  1KC8 W;  1COW G;  2Z3Y A;  2JVD A;  2X6A A;  3BAB A;  1YSC A;  2N04 A;  3OMI B;  4PA4 A;  2QWR B;  2ATK C;  3RYF A;  2RJZ A;  4OXS A;  2Q73 A;  2UU9 B;  3LUT B;  2YIB D;  5L3D A;  1AR4 A;  4DUY O;  2GSM B;  4O4I A;  4RQE A;  1H2N A;  4PA3 A;  2N74 A;  4B3T O;  1VQ7 V;  4TWK A;  4B3S B;  2F66 C;  4JTC B;  4WBN B;  1ARO P;  3SPG A;  2ZD9 A;  1US6 A;  2DE0 X;  1V55 B;  3ABU A;  4X9Q A;  2JGU A;  3B40 A;  4XBF A;  4MTF A;  4NKG B;  5EIB D;  2FL4 A;  4UCS A;  1H8E G;  4JI4 O;  4OX9 O;  2E75 B;  3JYC A;  2EJ7 A;  1K33 A;  3BY6 A;  5JQG A;  4O4H A;  2IBZ H;  3EFF K;  5GW7 A;  3SPI A;  4DV2 B;  1IBM B;  5IYZ A;  2A9H A;  2EIM B;  4O4L B;  1QU7 A;  3BEH A;  2PYL A;  3UO3 A;  1YEW A;  1Y74 A;  1SS3 A;  4JI8 B;  4PI2 A;  5LOV B;  2BTQ B;  5B3S C;  2UXX A;  5KX5 A;  2JIZ G;  2OTJ V;  1WB8 A;  2Q9L A;  1E1Q G;  4ZI7 B;  4HBN A;  1PV0 A;  5KHG A;  2PY5 A;  1X59 A;  2GHY A;  3CMA V;  3S3X A;  2LW1 A;  4BW9 A;  5EK0 A;  1DF5 A;  3ZN0 A;  3RN4 A;  4PHZ A;  3CJH B;  1ZLZ A;  1OCC C;  1Q6U A;  5K1P A;  4I0X B;  1SQB H;  1GO3 F;  1MMM A;  1RFY A;  4CS4 A;  2P7T C;  3ZRX A;  5KUK A;  4I9W A;  1SA0 A;  1I5Y A;  4FM2 A;  3G6E V;  1TUB A;  1W2B U;  3D8C A;  3QVN A;  4L8J A;  5DM6 V;  4LF4 O;  2Z0A A;  4JI7 O;  1VF7 A;  1M5I A;  3ASN B;  2UUA O;  3LDE A;  3UT5 A;  4X1Y B;  2DYR B;  5GON B;  3JAS A;  5IY5 B;  3A8T A;  4TV9 B;  4UXN A;  4DV6 B;  2ZIO A;  4JYA B;  1H8H G;  1P49 A;  3CS5 A;  1DF4 A;  4YY3 O;  4Z1V A;  1N8R W;  4WFA V;  1M4U A;  1OZ0 A;  5CBH A;  4PA9 A;  2Q0O C;  5HFM A;  1FKA O;  4WFB V;  3APQ A;  2UUC O;  1SER A;  4NR1 A;  5H6Q A;  1XNR B;  1K9M W;  4UCU A;  1PNK A;  2ZNI A;  5BR8 B;  4NTY A;  5LL6 Y;  2UUB B;  2KB1 A;  4OPH A;  1WA8 B;  2YXH A;  3SPC A;  2K9P A;  3OFN G;  2P67 A;  5CA3 A;  2GTS A;  1CP9 A;  2E5L B;  5DED A;  1HNX B;  5B1B B;  2VQE B;  4TV8 B;  5LA6 B;  1UJW B;  2EIM C;  4O4J A;  3HKD A;  1QCE A;  4CZZ A;  4LH6 A;  3ZS8 C;  1OCZ B;  1IZ3 A;  3QTC A;  2XAG A;  4LCU C;  2BE3 A;  4X20 A;  3BAA A;  4UB8 Z;  1L8D A;  2ZQM A;  2DW4 A;  4DUZ O;  1KQS U;  1SQX H;  5KHK A;  1O9G A;  3E35 A;  3ZRW A;  4U7O A;  4JYY A;  1HWY A;  3A0H Z;  4ZKI A;  2BOC C;  4FMT A;  1AI6 A;  4X65 O;  4LFB O;  1N33 O;  4B3R B;  3CD6 V;  4NB5 A;  3THO A;  3KKY A;  3OTO O;  2WLI A;  3C90 A;  2YEV B;  3JSL A;  2F43 G;  4JGS A;  1JJ2 U;  2AHY A;  1I08 A;  4NVP A;  4W4K A;  1NJI W;  1SKV A;  1XQ8 A;  1VEW A;  5KLV H;  4X1I A;  3JAM N;  1YXB A;  5IJ0 A;  1VQ8 V;  5JJN B;  1KU9 A;  4LNU A;  3AEI A;  1VQL V;  3ASN C;  4MTO A;  1URF A;  2DYR C;  1Y66 A;  1QR9 A;  5IY5 C;  3WB2 A;  1B3Q A;  4QPK A;  2WLJ A;  4WFF A;  1YF2 A;  1K3E A;  4UCT A;  2VQF O;  1U96 A;  4PA7 A;  4FLY A;  1XMQ O;  3JAW A;  5K1X A;  4RO2 A;  3OAA G;  4DR5 B;  2HVJ C;  3IFX A;  3ETQ A;  4MSW C;  4K8Z A;  4UCO A;  4GKJ B;  4Z1M G;  4YHH B;  2QDO A;  4GLX A;  1YHQ V;  4I7Z B;  4MVO A;  2YIB A;  1K4D C;  1W0J G;  2W6I G;  2JEU A;  4O2A B;  3CXH F;  2GUZ B;  4G2K A;  3K79 A;  3FD9 A;  2KQX A;  1LUV A;  3CRA A;  3UKM A;  3ETE A;  4TUY A;  1OCZ C;  4X62 O;  2YIC A;  3HKC B;  3L72 H;  3M99 B;  3RYI B;  3QNE A;  2WA3 A;  5EYP A;  2UXC O;  4FM0 A;  4DR6 O;  4LP8 A;  5BMV B;  2QJ1 A;  2QR4 A;  4NTX A;  3LNM B;  2EZO A;  3ZHV A;  4DYL A;  2HVK C;  2IH3 C;  2P4V A;  5B1O A;  2WLL A;  4CH6 A;  4RQF A;  3HKB A;  1HR0 O;  3TGU H;  3U0Z A;  3H1J H;  3L75 H;  2EIN B;  1TA8 A;  1KKC A;  3RGB A;  4OPA A;  5CBF A;  3OTF A;  4GKK B;  4DR7 O;  1FD9 A;  3K3W A;  5ITZ A;  2CH7 A;  1H2K A;  3IAY A;  3C3T A;  1KB9 F;  4TQD A;  4FK5 C;  1N34 O;  5LHG A;  4B3M O;  4JTD B;  1SF9 A;  2HKO A;  4JI3 B;  3EVK A;  1WN7 A;  1P4R A;  1FFT B;  3ABM B;  3CCQ V;  3W7T A;  2QTS A;  4JAS A;  1WNS A;  5IJ9 A;  2RNB A;  2YXL A;  3G4S V;  3X2Q C;  5LMN O;  2XHB A;  1SES A;  2CDY A;  4BW5 A;  5LGT A;  1ZX3 A;  5L3F A;  2X6B A;  1GM7 A;  4LFC B;  3QF7 A;  1S72 V;  4JI6 B;  5LMU O;  4J41 A;  1TAE A;  4BIU A;  3E8F A;  4WFG A;  1M57 B;  2LFR A;  1L1F A;  1BZK A;  1Q43 A;  3JD0 A;  2W6J G;  5KA5 A;  4JTA B;  2QTO A;  3L74 H;  3NXS A;  4FLT A;  1I7F A;  1AR5 A;  5LP6 A;  3PN1 A;  3HPL C;  2QSA A;  3K58 A; 
#chains in the Genus database with same CATH homology
 5BY1 A;  2LW7 A;  4JI6 O;  3M8A A;  1DK1 A;  4JI2 O;  4DR2 O;  4YHH O;  3JAM N;  4DV4 O;  1HNX O;  4YY3 O;  4OPA A;  2UXD O;  2HHH O;  4DR7 O;  4JI4 O;  1FKA O;  4OX9 O;  2UUC O;  4B3R O;  4K0K O;  4LF6 O;  2VQF O;  4LF9 O;  3J7A U;  2AGA A;  5IWA O;  3J80 N;  1R6T A;  4LFC O;  3SDL A;  5BXZ A;  1N34 O;  4JI1 O;  1XMQ O;  4B3M O;  1XNQ O;  5A2Q N;  5LL6 Y;  4JYA O;  3T1H O;  2ZKO A;  1R1B A;  4DV1 O;  4NXM O;  4OPH A;  1XEQ A;  4LF8 O;  1YZB A;  4GKK O;  4LF5 O;  1HNW O;  4NXN O;  4DR4 O;  2UU9 O;  4AQY O;  4LF7 O;  2DJV A;  5LMN O;  3R66 A;  1XNR O;  1AB3 A;  3O65 A;  5FLX N;  1KUQ A;  4B3S O;  4DV6 O;  1X59 A;  4LFA O;  4DV2 O;  3T1Y O;  1FYJ A;  1J5E O;  1HNZ O;  4JI0 O;  4DR1 O;  1XMO O;  2DOS A;  4JI3 O;  5BR8 O;  1F7Y A;  4KHP O;  3J81 N;  2UUB O;  1IBM O;  5IT9 N;  4DR3 O;  3RT3 C;  4DUZ O;  4DR5 O;  1FJG O;  5LMU O;  4JI5 O;  4A5U B;  1I94 O;  1N36 O;  3F5T A;  1A32 A;  4GKJ O;  2JRI A;  4X62 O;  4JI8 O;  1G1X B;  5H5N A;  1IBK O;  1IBL O;  2E5L O;  2UXC O;  1NS1 A;  2VQE O;  4DR6 O;  4X66 O;  4X65 O;  4LFB O;  1N33 O;  1AIL A;  1D2D A;  2FKX A;  4DV5 O;  1N32 O;  3OTO O;  4DUY O;  4LF4 O;  2F4V O;  2ZM6 O;  2Z0A A;  4DV7 O;  4JI7 O;  2N74 A;  4JV5 O;  2UUA O;  4B3T O;  4X64 O;  4DV0 O;  4DV3 O;  2UXB O;  1HR0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...