4X8AA

Navms pore and c-terminal domain grown from protein purified in licl
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus sp. (strain mc-1)
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x8aA00
2BOBC 5EC1C 3K0GA 4J9YB 4LBEC 1OCCC 1M56C 3OR6C 4RUFA 3VOUA 2QTOA 2DYRC 2WLNA 3LNMB 4R6ZA 2ITDC 4RO2A 3SYQA 3WG7C 1QLEC 5KUMA 2A79B 4OXSA 4LCUC 2JK5C 4J9ZB 3SYCA 3ZRSA 4WFFA 2EIMC 2EIJC 4GX1A 3SPJA 1XL6A 1M57C 3BEHA 3OR7C 3T1CA 4MVZA 1P7BA 3SYAA 4DXWA 3LDEA 4MTGA 5EBWC 2R9RB 1S5HC 5IY5C 3GB7C 4HZ3A 4BW5A 2ITCC 3IGAC 4MVUA 2A0LA 4G28B 1R3KC 3F7VC 2DYSC 4PA6A 3ZJZA 3E8FA 3OUSA 1R3LC 2ATKC 3AG2C 2AHZA 3K03A 3SPCA 3ABLC 4X89A 3RBZA 3AG3C 3TETA 1KKDA 3EFFK 4CBCA 1V55C 2Q69A 2DWEC 2EINC 3ABKC 4MW8A 2HVJC 3OGCC 4PDMA 3T4DA 4PDRA 2WLLA 4JTCB 2Q67A 4JTDB 3SYOA 3E8BA 2NLJC 2YEVA 4I9WA 4MVQA 4ZBMA 2Y69C 1JVMA 2IH1C 4PA3A 4PDVA 4XDJA 3ASOC 2WLIA 3E86A 4TWKA 5E1AC 5J9PC 3E8GA 2X6CA 3E8HA 4RAIA 3FB8C 2KB1A 3AG4C 3FB7C 3LDDA 4RUEA 4H37A 4G27B 1ZWIC 3F5WC 4P9OA 3STZC 3E83A 4P30A 4MVRA 4WFHA 4GX0A 2IH3C 4F4LA 1G4YB 3FB5C 3KG2A 4QNHB 5EBMC 4P9PA 1K4DC 3IFXA 2EIKC 3LDCA 4EKWA 3F7YC 3JYCA 5KUKA 1R3IC 4MVSA 1LNQA 5CBGA 4WFEA 4P2ZA 5CBHA 3STLC 2OCCC 2A9HA 1OCOC 2Q6AA 3E89A 3SPHA 2ZD9A 2Q68A 4MS2A 3SPGA 5EC2C 1BL8A 3K06A 4JTAB 3RVZA 4MTFA 1R3JC 4WFGA 4LP8A 4MVOA 4X8AA 3R65A 5B1BC 3LUTB 2X6BA 5BZBA 5EBLC 2DWDC 4MVMA 1OCZC 4R7CA 4KFMA 3X2QC 4HYOA 4XDLA 2HVKC 4GX2A 1J95A 2P7TC 3FB6C 5B3SC 3T2MA 4R8CA 2HJFC 4MW3A 1V54C 4PDLA 4GX5A 2W0FC 2BOCC 2ZXWC 4UUJC 4PA4A 3K0DA 2WLLB 3ASNC 1K4CC 2QKSA 3RW0A 2WLHA 3ABMC 2H8PC 3SYPA 2WLMA 2WLIB 5EK0A 3SJQC 3HPLC 5B1AC 4XDKA 3UKMA 3K04A 2HG5C 4PA9A 3TCUA 3PJSK 3K08A 3OUFA 3T4ZA 4H33A 4MTOA 4MSWC 4PA7A 1XL4A 4R50A 3RVYA 4X88A 2WLKA 2WLJA 3SPIA 1ORQC 3UM7A 4QE9A 5CBFA 1OCRC 2AHYA 4QE7A 2X6AA 3AG1C 2K1EA 2HFEC 2EILC
chains in the Genus database with same CATH superfamily
2PYLA 1G1XB 4BIOA 1JA8A 2DN9A 1H8HG 4DR3B 1US6A 2B1IA 5B1OA 1FAFA 1M57C 1TAEA 3OR7C 3T1CA 1QVFU 4UXNA 2LO1A 3N2GB 5EBWC 3HKCA 5A9GA 1QLNA 1MG1A 4Z2WA 2Q0OC 5H6RA 1JX9A 2HP8A 3IGAC 4MVUA 1Y76B 2EJRA 1O9GA 3F7VC 1Z5VA 4EB6B 3SPCA 4MT8A 3B09A 1GM9A 1HNZB 1AJQA 2HVJC 2LW7A 1YJ9V 1K33A 4FPPA 4TOIA 3K5OA 4RAIA 4K0KB 1K92A 4LF4B 1ZWIC 4WFHA 3RT3C 3L75H 4QNHB 5IE9A 1MSDA 4DUZB 5LHHA 3CCVV 5LBQA 2AGAA 4JI2O 1SQQH 5EC2C 2Q0AA 5F2VO 2JS5A 4MVOA 2OCCB 4GKJO 3OFNG 5BZBA 3QVNA 1VQ6V 3CPWU 2HVKC 4DV7O 2R70A 1H8EG 4EFBA 2V4DA 1XMOO 1LUVA 3HPLC 4NKGB 3CC7V 1GN2A 3DGEA 2CDYA 1JMKC 3ETEA 4X88A 3BCCH 2HLDG 2HHHB 2EILC 4NTYA 1TUBA 3JD2A 1M56C 1NU1H 3CJHB 3BFRA 3A8TA 1EN5A 2LQTA 3JD1A 1IBMB 3BAAA 1YIJV 3T1HB 3H1HH 2XAQA 1FFXB 5JH7A 5IWAB 4TSFG 1XNRB 4IYHA 4KHPO 2HKOA 3LSSA 3P3PA 3ABLC 1O9HA 3CCMV 1KKDA 5GONA 1D2DA 3CS5A 4JI6B 4JI3O 3DC6A 3ZRXA 2Q67A 5GTIZ 1FJGB 1JVMA 4JI8B 3AK3A 4C7UA 3BABA 1B04A 3ZN1A 2OIEA 3FB5C 1I0HA 2VQEO 4CH3A 3MHHC 4MVSA 2A9HA 1CP9A 3L72H 3D36C 1JFFB 3K06A 2YDEA 4WFGA 4FLYA 2YIDA 2L6LA 4B7EA 3X2QC 1AILA 3FB6C 4F6RA 3T2MA 1WA8B 4JAVA 3OMNB 1QQCA 4JGSA 4DR7O 1OCZB 1L1FA 1I5XA 2X7RB 1V54B 2YI9A 4DV6O 3S3XA 4JI7B 3U10A 2JGDA 4FFBB 3TK1A 1S72V 1PNLA 3SJCC 2Q7GA 1E1RG 1KP3A 4H13B 1OCRB 2Q9LA 1FYJA 3SYQA 1QLEC 3CCJV 2UXNA 1S5LZ 3ZMUA 1DF4A 4DR4B 5KHGA 2XAGA 5IJ9B 1XDCA 5LA6A 5CA0B 2ZDIA 4QPJA 1VF5B 2ITCC 5K1PA 1DF5A 5KHHA 1JQ0A 4FK5C 2N74A 2B1GA 1R3LC 3HKDA 1FXHA 3I55V 3K03A 2FYUH 4LNUA 5JJNB 2Q69A 4L8JA 1ZSPA 4JI4B 4FLTA 3OGCC 1P4RA 3L73H 5FPOA 4DUYB 3HR0A 1RPOA 2Y69C 4B3TO 4Q20A 3A0RA 4DR1O 1EBOA 4LF9B 1SQFA 3O65A 5H9CA 3WB1A 4I55A 5JH7B 2XASA 1YITV 3FFQA 4OX9O 4I5SA 3G71V 3FYIB 3CX5F 3OMIB 1K34A 2DWDC 3CRQA 1TUEB 2P7TC 1U97A 4O2BA 4YY3O 1Q43A 2W0FC 1S5JA 4DV3O 3CRMA 2QKSA 1Q6UA 1XUQA 4JI0B 2UUCO 2O57A 3ZHVA 2QR4A 1YVWA 2HG5C 4F6EA 5BR8B 4KL1A 3LNNA 1XEQA 1AR1B 2XT9A 3K5LA 1UPGA 4LFBB 4ASUG 2K1EA 2HFEC 2DQ3A 1KBHA 1I7FA 2DJVA 4RO2A 4X1IA 4BIZA 4WFFA 1D5AA 2ETNA 2QWNB 5BMVA 2VWKA 5IYDO 2R9RB 2Q7EA 4X64B 5IT9N 4AI8A 3ZN0A 1VQ9V 2ZQMA 4GT1A 1YZBA 3AG3C 4QPKA 1F7YA 2IJKA 5JQGA 2UUBB 4CBCA 3AG2B 2B5UA 1RM1C 4LFCO 1R6TA 4K3AA 4DR5O 4WFAV 1YJNV 1S76D 4ZBMA 1VQ8V 4AQYB 2QDOA 1QVGU 2IH1C 3ABKB 2KSDA 3RYCA 3B8NA 3E86A 1N4CA 2D3OW 5LHGA 4DR2B 1HP8A 4H0LB 1CEZA 5A2QN 4X20A 5LA6B 1NT2B 3TGUH 2CH7A 1PM9A 3QO7A 4J7ZA 3ZMVA 2WWWA 4DK0A 1PL4A 3HKDB 5EBLC 1SERA 1VQ5V 1XHXA 1H2KA 2PZSA 4MW3A 1RSOB 2LJ2A 4PD4F 2GTSA 5KMGA 4J7JA 2IJHA 4XDKA 2CE4A 3T4ZA 4CZZA 1AR4A 2PTMA 3RVYA 2GDSA 4BAYA 5DEDA 1N34O 1W59A 4I55B 2OCHA 1VEWA 1Q5OA 3R66A 4CC6A 3QO8A 4RUFA 3GVMA 1Y76A 4ZHQB 3BEHA 4LF5O 4G2KA 2YIAA 1M57B 4JI2B 1MOFA 5EZYB 1OV9A 5LGTA 1Q6IA 2KKWA 4LWSB 2AHZA 4JASA 3BHPA 3VQXA 3EFFK 4DV7B 1YF2A 3G67A 1KD1W 2QM4A 2E74B 1YHQV 3JSNA 1GK9A 2NLJC 4MVQA 3K9SA 1XMOB 2LP7A 2VRZA 3K58A 3K9AA 3FYEB 2BTQB 1NVPB 3LDDA 4H37A 4DYLA 5LYJB 4DW0A 1W0JG 3KG2A 2X0LA 5LGUA 5LXTB 1ENVA 2PGGA 1MABG 4Q6GA 5KHKA 3M99B 2ZE7A 1FXKC 3QTCA 4MVMA 1DLBA 3JARB 5KLVH 3M7MX 2GV9A 4KXRA 4CS3A 4J80A 1HNWO 4XBFA 3JD4A 1GMGA 1AB3A 2LW1A 1IXBA 1NQTA 4KHPB 1GO3F 2UXCO 4UVBA 1SQXH 4JI3B 1FFTB 5CBFA 2CTQA 4X20B 1XREA 3AG1C 1SZTA 2BSKB 4QGPA 2QKAA 1SC5B 1VQKV 2DYRC 3B2EE 3LNMB 2EILB 5LOVB 4OXSA 4LCUC 3CWBH 2VQFO 1KP2A 2EIMC 1M56B 1T5EA 1TVKB 2ZE8A 2NR5A 3GWOA 2VQEB 3N2KB 4PJ0Z 1HNXO 1SA0A 2DW4A 3B4SA 3GB7C 3M8AA 2UUAO 1N32B 5KMGB 1YXBA 1AI6A 1AR5A 3LSUA 5H6QA 1M90W 1VQMV 2LGWA 1VP7A 1V55C 2RN9A 1G8MA 3ABLB 4DR7B 1V9PA 1H2MA 4NXNO 4FFKA 1OCOB 4ZIBA 3QNEA 4DV6B 3RYHB 4YIOA 1H2LA 3E8HA 3RWRD 3FB8C 2Z3YA 1JFFA 3AK2A 2JIZG 4DR6O 3IC7A 1K5QA 1YI2V 2YEVB 3IFXA 2EIKC 3QF7A 4EKWA 3F7YC 3CC2V 1WP7A 4P2ZA 2CAZC 1K8AW 1WA8A 4UB6Z 1WLEA 3E89A 4JZGA 3SPHA 3BY6A 3CXCU 5LMUO 4LP8A 2M7WA 4BR6A 2L35A 2X6BA 5JVDB 2P4KA 1BE3H 1A32A 4X1YB 4GX2A 3W7SA 1AVMA 2HJFC 3Q4HA 1R6KA 2ZM6O 5HFLA 5GW7A 1FXVA 3X2QB 1H2GA 4FFBA 3ASNC 1PNKA 2UXDO 3ABMC 3P30A 4QJFB 1BMFG 3ZMTA 2JDIG 5B1AC 5IYZA 5TISZ 2A06H 3PJSK 1MSWD 2OTLV 2E3CA 2DQ0A 5GTHZ 2F4VO 3UM7A 1ORQC 5KA5A 1WPBA 4GUNA 4NTXA 5CA1B 1NJIW 4X9QA 2BOBC 5IJ9A 1IVSA 2VS0A 4B3TB 1EZVH 5CA0A 3VOUA 3CB2A 1VQLV 4YHHO 4IIJB 3ZRSA 4DR1B 2P6JA 5FLXN 1MZFA 3CCSV 3VQYA 2YICA 1QLEB 3DSQA 1WP8A 5HFMA 1S77D 2YC0A 2IJIA 4OX9B 4KP4A 5EIBD 3RGBA 3ZJZA 5JCOC 1PKXA 3JAWB 2YS8A 3ZEDA 1QCEA 3WB2A 3CE2A 4X89A 1BQ0A 3WB0A 4YY3B 2CGOA 3MDSA 4JV5O 4DV3B 1QNMA 1IURA 3BPZA 2BTOA 1NBMG 4PA3A 2P90A 3E22B 2BE3A 2UUCB 4JZ2A 3CYOA 2JVDA 4BWAA 2QWRB 1GM7A 3EHBB 1YCIA 1XQ8A 2Y69B 4G27B 1XILA 1GKFA 1RPRA 3JASB 3K79A 1NI8A 1K4DC 2Q8VA 4NB5A 3ZMZA 5CBGA 1LNQA 4UVAA 1SA0B 3EVKA 4JI5O 2QWPB 1OCOC 2HR3A 3AG7A 3N27A 4DV5O 1I94O 5B1BC 4GKKO 4R7CA 2Z0AA 4CS4A 4TUYA 4IHJB 4DV2O 2XTAA 4R8CA 1H2SB 3D8CA 1ROPA 4PA4A 2Z5UA 3H1IH 4NVPA 2EX3A 3S3WA 4FZ0A 3W7TA 4LFAO 4UCUA 3CCUV 2QE7G 4CS2A 3G6EV 1DK1A 4LFCB 2MK3A 4DR5B 1VF7A 4RQFA 3K0GA 3UQ8A 1IZ3A 2N04A 3JSLA 2HEPA 2P06A 1X4TA 4CH5A 1M93A 2ITDC 3IC9A 4FLVA 2AXTZ 2WA4A 1MNGA 1Q6HA 3SYCA 2EIJC 4DV4O 1XL6A 4WBNB 2AZ2A 4MVZA 3W7WA 3Q4HB 1IDSA 2F93B 2MW2B 2GUZB 2N05A 3ZHRA 4B7KA 5L3FA 2W6JG 1SKVA 3E8FA 3K3WA 2QWQB 1FS0G 5IYZB 1SZXA 3TETA 3VBBA 3JALB 2ODMA 4MW8A 4LF6O 3AG3B 3T4DA 2QWOB 4UCSA 2ZINA 2H94A 3UT5B 1XI1A 3BRCA 4JI1O 1RM1B 1S0VA 3CRAA 3AK1A 3H1KH 2KB1A 4DV1O 2ZIOA 4GCZA 1N34B 5LHIA 1H38A 5D5PA 4UV9A 2C2AA 3O9OA 2G38A 1OZ0A 5IJ0A 1QBZA 1RSOA 1QR9A 1Y74B 3RVZA 3ZHTA 2RQ6A 1WPXA 1IX9A 4DUZO 3L9DA 3OTOO 1R6NA 4XDLA 2JRIA 4B08A 4LF5B 2AW9A 1W0KG 4NR1A 2JJ1G 5D5QA 4E4EA 3RW0A 1HR0O 5C8YB 1SQGA 4PHZA 4H44B 1R73A 3TJTA 3OEHG 4YXWG 3JCZA 1YDXA 3UKMA 4FLUA 4B3RO 1EFRG 3ZRWB 4HNAB 1AROP 3OTFA 5IYCO 4YJ3A 4ZHQA 4LBEC 2GHYA 1KYOF 1MA1A 1OCCC 3FKSG 4LH7A 3RN4A 3CHXA 4JYAO 5EZYA 4ZI7B 1Y4MA 1PV0A 3UO3A 2YXYA 3JAKA 4GX1A 2ZNIA 2OIGA 4LWSA 4TUYB 1OHHG 1S3JA 3SYAA 1YSCA 1XMQB 1XNQO 4ICGA 5L3DA 2JS3A 2EJ7A 5IY5C 4GZRB 3ZIAG 4BW5A 3ZRVA 3W7UA 4G28B 3QG5A 2QM7A 1L8DA 2BTQA 1NVPD 3G6BA 2DWEC 5LYJA 4I7ZB 1HNWB 3ICXA 1UFIA 4JTDB 5LXTA 2VWJA 3L71H 1KU9A 3PN1A 5E1AC 2P67A 3JD0A 4QIWF 4X66O 2UXBO 3HKEA 2UXCB 2FTKA 2A7WA 3BVOA 2UU9O 3E83A 4P30A 2QEXV 4F4LA 5EBMC 3CRRA 1I08A 3MHSC 3JYCA 3JARA 1FJGO 1JJ2U 4JYBA 3LSQA 2Q6AA 4CH6A 3C3TA 2VQFB 3AEIA 1NTZH 5FPRA 3LUTB 3RYIB 3I5DA 5FNVA 1J5EO 3J80N 2XAHA 1FXKB 3BA8A 1HNXB 2BOCC 5L3GA 1IBLO 1H2NA 2XOKG 5LMNO 1M4UA 2UUAB 3ETQA 2WLMA 3SJQC 4DV0O 2BSKA 3K08A 2ZT9B 4D7TA 5J2TB 4H33A 4MSWC 1XL4A 5LOVA 2QSAA 4HBNA 1PP9H 2ILMA 1B06A 3D3IA 1TVKA 2R9AA 4GLXA 2QA4V 5IJ0B 4NXNB 3N2KA 3OT7A 3JATB 3GWKC 2IJJA 3SJAC 3AG1B 4AHCA 4DR6B 4WCEV 2DYRB 2F23A 1B3QA 2XAFA 2EIMB 1K73W 1Q90D 1Y6XA 1BHAA 2CGNA 4W4KA 5B66Z 2A0LA 3BA9A 5LMUB 1R3KC 2DYSC 2V1DA 3SGIA 4FZ1A 2KG7A 3RYHA 5E79Z 2ZM6B 4YJ3B 2F66C 4LF8O 1IXMA 4I9QA 4LH6A 2UXDB 2YEVA 1JJOA 4NTWA 1V55B 1WB8A 3KCYA 1E79G 1GH6A 3CCRV 3APQA 5BXZA 3A0HZ 3JAKB 4MVRA 2F4VB 4J7KA 1G4YB 4GKJB 4NXMO 1WB7A 3D36A 5JVDA 3FAVB 4UB8Z 4YIPA 4X1YA 2QGNA 4OPAA 2D2CB 4BIUA 5KA6A 1BGYH 2EIKB 4O4LB 3ABTA 4JTAB 2ZE6A 3CRCA 4YHHB 4D7SA 1GN3A 2IBZH 1VIBA 3ML0A 5B3SC 3SJBC 1VQ4V 2ZXWC 2OWOA 5LP6C 1F23A 3I56V 5CA1A 5LL6Y 1NKDA 3ASNB 3HKEB 4PA9A 1N36O 3KKYA 1F51A 3ABMB 1L0NH 4YJ2B 3CMEV 4JPRA 5B1AB 4TV8B 4IIJA 1IBKO 3EXAA 1KUQA 4QE7A 2X6AA 1MMMA 1SQBH 2E5LO 5EC1C 2DOSA 4IYIA 2RCVA 2WLNA 2PY5A 3WG7C 1K7DA 4B3MO 3JAWA 5FNVB 2WA3A 4MTGA 4O4IB 4UCRA 4JI5B 4FIPC 4IGGA 2NNUA 3ABUA 1HDJA 3SR2C 1I94B 2ZDIC 3H1LH 4UFZA 3E22A 2XAJA 4DV2B 3WU2Z 2EINC 3RYFB 4PI0A 2OTJV 4JTCB 3JASA 2QKCA 4PI2A 1W2BU 4DRXA 4LFAB 3OW2U 2E76B 3OEEG 1EZJA 1U96A 3E8GA 2K9PA 5KAFZ 3FX7A 3AG4C 2KQXA 3C90A 1MZEA 4JF3A 5DN6G 1R3IC 2WAMA 4IT5A 1NTMH 1Q3EA 5C93A 4IHJA 4OPHA 2CK3G 3ZHUA 2QJ1A 3P3NA 1P49A 3ZHQA 1QHTA 1GN4A 4D6TH 4X8AA 4K8XA 4UCTA 1GM8A 1N0NA 2KG7B 1JOYA 4RWUA 1Y66A 2CTRA 2QM8A 5B1BB 3W7XA 3ZMSA 3U0ZA 2W6IG 5CN0A 1VARA 3HB3B 4CC5A 2LFSA 4PELA 2ZR2A 4WF9V 4LF7O 3OUFA 4PA7A 1VQNV 2RJZA 5CB4B 3JAMN 2FB5A 1PPJH 4LF6B 3L74H 1PNMA 2YI8A 4UCOA 4ZKIA 2ADPA 4TQFA 2DE0X 4WBNA 3E2EA 3SDLA 1WAZA 4JI1B 3JD3A 3OR6C 2FL4A 1KMIZ 1NH2B 4KUMA 3OGIB 2GUZA 4DV1B 3FD9A 3LDEA 2EIJB 1S5HC 3JALA 5EYPB 1I5YA 2Q7HA 2PUSA 3ZHSA 2JEUA 4I0XB 3UT5A 3OTOB 2ZE5A 4X1KB 1K97A 1QU7A 2XHBA 1VMGA 1XOUA 1XHZA 1AP6A 1K9MW 2WLLA 3KCXA 5B5EZ 1R1BA 5IDJA 1HR0B 5KX5A 4XDJA 2ZCEA 4X65O 3ASOC 2X6CA 4FLZA 1ZAUA 3H01A 2P22C 4B3RB 1Y74A 2EULA 4GX0A 2QTSA 1TGOA 4B3SO 3B77A 3H9VA 3STLC 1NTKH 4A5UB 5K1XA 2Y48A 2ZD9A 4MS2A 5JJJB 3CSXA 1BL8A 4JYAB 2CTPA 3K5NA 4ABMA 5C8YA 1AI7A 1GTOA 3CD6V 1WJZA 4I50A 4HYOA 3G4SV 5DECA 1XNQB 4CH4A 2ZR3A 4X62O 2ADQB 3ZRWA 4HNAA 1M1KW 1K4CC 2Q4PA 4DRXB 2H8PC 4AILC 4O4HB 4TQDA 1NS1A 1DGSA 3T1YO 4ZI7A 2WLKA 3SPIA 3K59A 2AHYA 3DXRA 2LFRA 4I4TB 3ZS8C 2Y0PA 1F4MA 4FJCC 4U3JB 5H2FZ 4X66B 3CCQV 2UXBB 1KC8W 1P7GA 4O4JB 2UU9B 1OCCB 3SPJA 1Y67A 1L0LH 5ITZB 1P7BA 3VQVA 4N23A 1FPOA 4UV8A 3U11A 2PF4E 5KHJA 1LR1A 1K5SA 2RNBA 3WFVA 4GYCB 1VQPV 5IY5B 1J5EB 1N33O 3HKCB 5J2UA 4FLWA 4MTXA 3UO2A 2XNDG 1X59A 2F1MA 3KZIZ 1N32O 4J10A 1IBLB 3E8BA 3DC5A 4IL6Z 5LMNB 2HHHO 2M6YA 1NR7A 1CXZB 1EN6A 2WLIA 5LP6A 1G6UA 4DV0B 4L87A 4DR3O 4UVCA 1NZ6A 3STZC 3F5WC 1GAXA 4FMTA 3TXSA 2OT5A 1AI5A 1OJHA 1YEWA 3RYIA 2P5OA 4TV9A 5KUKA 2OCCC 1FXKA 1ZX3A 5IYBO 1R3JC 2IU3A 3ZCCA 2ZKOA 4TT3G 3R65A 1Z5WA 1E1QG 1FKAO 2UXXA 1HNZO 1LUWA 2WPDG 5J2TA 4PDLA 1GN6A 1QR8A 2WLLB 1F4NA 1VQOV 1M5IA 2WLHA 5KX5B 4UCVA 1BS3A 1M9NA 1SQVH 4K0KO 3TCUA 3JATA 4LF4O 2FKXA 1XBLA 2W0XA 2WLJA 4LF8B 4QE9A 2Q73A 3CCLV 2A3QA 3JCUZ 3ETDA 4LR3A 1KB9F 2GTAA 2PYJA 2CTWA 1AP5A 3HKBA 4HAMA 1VQ7V 1SF9A 2JK5C 4J9ZB 1VF6C 4NXMB 4I50B 2B9ZA 1TUBB 2GBOA 1RP3B 4U7NA 1BQZA 4JYCA 4PA6A 4K8ZA 1EN4A 4Z1VA 2ATKC 2EZOA 1COWG 3OMAB 4W4LA 3K57A 2DYSB 5L3BA 3NR7A 3DXRB 1SQPH 4I9WA 4J41A 2PI5A 3FAVA 2F95B 1N36B 5GONB 1N0JA 4RUEA 4O4LA 3NXSA 3QO5A 3OAAG 1BZKA 1AJNA 2YUAA 3RFRA 1BSMA 3ZX6A 1IBKB 2JEXA 1IBMO 1BT8A 3T1HO 2E5LB 4WFEA 4FM0A 5IWAO 3ZBHA 4BW9A 2HJDA 2Q68A 2ZIMA 1XNRO 1URFA 4JAAA 3CEIA 1Q82W 4B3MB 1OCZC 3E35A 5J2UB 1THZA 1V54C 4YJ2A 4JI6O 2R72A 1BHBA 1CPYA 4TV8A 3VQWA 1RFYA 1DTOA 3OE7G 4J42A 5B3SB 5JJEB 2ZXWB 2WLIB 4JI8O 5LP6B 2Y4TA 1ZUQA 3A2FA 5B1NA 4EEQA 4F6RB 1UJWB 1ZL8A 3L70H 5CMUA 2BCCH 1BCCH 1OCRC 2CUGA 4JYYA 1P84F 4TV9B 1Q7YW 4MTOA 1NR1A 1K3EA 4O4IA 3H1JH 2ZNJA 4R6ZA 2JGDB 5KUMA 4OGQB 2A79B 1N8RW 2FMLA 3ETGA 4DW1A 1B6QA 1Z2GA 3WG7B 4DXWA 2Q5ZA 5JCOA 1EM1A 3MAQA 2H3OA 3RYFA 5AG2A 4O2AA 1AI4A 3CXHF 2ARHA 3CMAV 3D3QA 5EIBC 3OUSA 1HW7A 4PV1B 4JI7O 4RQEA 3CC4V 4ZOLA 3IJ4A 2LGQA 4PDRA 2EBOA 2WSSG 1JCHA 4J11A 3F5TA 4PDVA 2EINB 4TWKA 5J9PC 5L3CA 4LNUB 1YTFD 2R9IA 3HKBB 3FB7C 4LF7B 1WNSA 4DR4O 3AG4B 4JAUA 5H5NA 5CBHA 1PD3A 3SPGA 4MTFA 4LC1A 1Q8IA 1AJPA 4WFBV 3OD4A 2IU0A 1ZTEA 5L3EA 3N2GA 2PI4A 2YSUB 4JI4O 1KKCA 3K0DA 5CB4A 1GRJA 4FM2A 4DUYO 3B8MA 4FM1A 2YXLA 5KHIA 2JJ2G 5EK0A 3DTUB 1ZLZA 3K04A 4EB6A 4O2BB 2F43G 3J7AU 4NYKA 4R50A 1NH2D 1KQSU 4LF9O 4DO2A 3THOA 2YIBA 1SETA 4J9YB 4N21A 2YIBD 4Z1MG 3MD0A 4X65B 2OYQA 1FD9A 2RDCA 3P32A 2QTOA 5EYPA 3C3SA 3TXQA 2IM9A 2Y0IA 4I0XA 4B3SB 5LGNA 4X1KA 2V7QG 1SESA 4FVMA 4K35A 1D5NA 4X1IB 4HZ3A 4JV5B 1WN7A 2P4VA 4JI0O 3J81N 5BMVB 3AG2C 1XMQO 3RBZA 1ZL8B 1PL0A 1Q81W 5BR8O 4X62B 1JR9A 3ABKC 1SRYA 4PDMA 4LFBO 3SYOA 3OM3B 1SS3A 4EFEA 5JQGB 4U7OA 2E75B 4P9OA 1YJWV 1Q86W 4DV5B 1JPXA 3ASOB 3T1YB 2IH3C 4P9PA 4GKKB 5CA3A 3LDCA 3RYCB 3B40A 4X64O 4E2LA 1HWYA 3G80A 3UCSC 1KECA 2AZ0A 4O2AB 1TA8A 4FLXA 2DMXA 3CJHA 2Y4UA 2GSMB 2NN4A 4KFMA 4O4HA 3CCEV 1J95A 3APOA 2UUBO 5BY1A 1VF6A 2CH7B 4ZOLB 1FFXA 4GX5A 4UUJC 5KAIZ 3K5MA 2YXHA 4AQYO 3SYPA 4I4TA 1YTFB 2RMKB 4U3JA 3CP1A 1N33B 2JGUA 4DR2O 5JWPA 2EZPA 2XUMA 3A0BZ 4O4JA 4U3FH 4DK1A 5DM6V 3IAYA 2IW5A 4DV4B 5ITZA 5FL7G
chains in the Genus database with same CATH topology
4LBEC 4FJCC 2GHYA 1OCCC 3FKSG 3QO8A 4RUFA 3CCQV 1KC8W 1H8HG 2B1IA 1Y4MA 1OCCB 4GX1A 5B1OA 3SPJA 1M57C 3BEHA 3OR7C 3T1CA 1QVFU 4UXNA 4G2KA 1OHHG 1P7BA 1S3JA 1YSCA 4N23A 3SYAA 5EBWC 1QLNA 1MG1A 4UV8A 5L3DA 1M57B 5IY5C 3ZIAG 5H6RA 1JX9A 1K5SA 1MOFA 4BW5A 3IGAC 4MVUA 3ZRVA 3W7UA 2EJRA 4G28B 3F7VC 5LGTA 3WFVA 1VQPV 5IY5B 2QM7A 2AHZA 3SPCA 4JASA 4MT8A 1GM9A 4MTXA 3EFFK 2XNDG 1NVPD 1KD1W 1AJQA 2DWEC 2HVJC 4JTDB 1YHQV 3E8BA 1GK9A 2NLJC 1YJ9V 4MVQA 2LP7A 1K33A 4FPPA 5E1AC 1NR7A 2WLIA 2P67A 3JD0A 4QIWF 3K9AA 3FYEB 4L87A 4RAIA 1NVPB 1K92A 2FTKA 4UVCA 3LDDA 3STZC 4H37A 1ZWIC 3F5WC 4FMTA 3E83A 4P30A 4WFHA 1W0JG 2QEXV 2OT5A 4F4LA 4QNHB 3KG2A 1AI5A 2X0LA 5EBMC 5LGUA 5LHHA 1ENVA 3MHSC 1MABG 3JYCA 5KUKA 3CCVV 1JJ2U 4JYBA 5LBQA 2OCCC 3LSQA 1FXKA 2Q6AA 3M99B 5EC2C 5IYBO 1R3JC 2IU3A 3ZCCA 4MVOA 4TT3G 2OCCB 3R65A 3OFNG 3AEIA 3LUTB 1FXKC 5BZBA 1E1QG 4MVMA 2UXXA 1DLBA 1VQ6V 3CPWU 2HVKC 2XAHA 2WPDG 1FXKB 4PDLA 2BOCC 4XBFA 3JD4A 1QR8A 2WLLB 1H8EG 1GMGA 5L3GA 1F4NA 2XOKG 1VQOV 2WLHA 2WLMA 1NQTA 1GO3F 1M9NA 3SJQC 3HPLC 3CC7V 3TCUA 4UVBA 3DGEA 3K08A 4H33A 4MSWC 1XL4A 3ETEA 4X88A 2WLJA 1FFTB 4QE9A 5CBFA 3D3IA 3CCLV 3ETDA 3AG1C 2HLDG 1SZTA 2QA4V 2EILC 2IJJA 3JD2A 1M56C 1VQKV 2DYRC 3AG1B 3LNMB 4HAMA 2EILB 1VQ7V 4OXSA 4LCUC 2JK5C 4J9ZB 1KP2A 2EIMC 1M56B 4WCEV 2DYRB 3JD1A 3GWOA 1YIJV 2XAQA 2XAFA 2EIMB 1K73W 4TSFG 2DW4A 3GB7C 1BHAA 4U7NA 2A0LA 4JYCA 1R3KC 4PA6A 2DYSC 2V1DA 1AI6A 2HKOA 3LSSA 2ATKC 3ABLC 5H6QA 1M90W 2EZOA 1VQMV 1COWG 3OMAB 3CCMV 1KKDA 2DYSB 1V55C 1G8MA 5L3BA 3ABLB 3ZRXA 1IXMA 2Q67A 2YEVA 4I9WA 1V55B 2PI5A 1JVMA 1OCOB 3QNEA 1E79G 3E8HA 3CCRV 3FB8C 4RUEA 2Z3YA 3NXSA 4MVRA 3QO5A 3OAAG 2JIZG 3ZN1A 1G4YB 1AJNA 1K5QA 3FB5C 3IC7A 1YI2V 2YEVB 2JEXA 3D36A 3IFXA 2EIKC 4EKWA 3F7YC 3CC2V 3MHHC 4MVSA 4WFEA 4P2ZA 1K8AW 2A9HA 1CP9A 4BIUA 5KA6A 1WLEA 3E89A 3SPHA 2EIKB 2Q68A 3BY6A 3ABTA 3K06A 4JTAB 4WFGA 3CXCU 4LP8A 1Q82W 2M7WA 2X6BA 1OCZC 3E35A 3ML0A 3X2QC 4GX2A 5B3SC 3FB6C 3T2MA 3W7SA 1VQ4V 4JAVA 1THZA 2HJFC 3OMNB 1R6KA 1V54C 5HFLA 4JGSA 2ZXWC 1BHBA 5GW7A 1OCZB 1FXVA 1L1FA 1I5XA 1CPYA 2X7RB 3ASNC 1H2GA 1PNKA 3X2QB 1F23A 5B3SB 1DTOA 3OE7G 3I56V 3ABMC 3P30A 4QJFB 1V54B 1BMFG 3ZMTA 2ZXWB 2WLIB 2JDIG 1NKDA 5B1AC 3ASNB 4PA9A 5B1NA 3PJSK 1F51A 1UJWB 2OTLV 1MSWD 3ABMB 5CMUA 3CMEV 4JPRA 2DQ0A 5B1AB 3TK1A 3UM7A 1ORQC 5KA5A 1S72V 1OCRC 1PNLA 4QE7A 1NJIW 2X6AA 1Q7YW 4MTOA 1NR1A 1E1RG 2BOBC 5EC1C 1KP3A 1K3EA 1OCRB 3VOUA 1VQLV 2WLNA 4R6ZA 3SYQA 3WG7C 1QLEC 1K7DA 5KUMA 2A79B 3CCJV 2UXNA 3ZMUA 1N8RW 3ZRSA 1DF4A 3ETGA 2P6JA 3CCSV 2XAGA 1B6QA 3WG7B 1QLEB 4DXWA 4MTGA 5HFMA 1S77D 4FIPC 2IJIA 2ZDIA 4QPJA 2NNUA 2ITCC 3ABUA 4KP4A 1DF5A 1AI4A 3ZJZA 1PKXA 1JQ0A 3CMAV 2ZDIC 3OUSA 2B1GA 1R3LC 4FK5C 1FXHA 1QCEA 3I55V 3K03A 4X89A 2XAJA 4RQEA 2Q69A 3CC4V 2EINC 2OTJV 3OGCC 1P4RA 4PDRA 2EBOA 4JTCB 2WSSG 1JCHA 1W2BU 1NBMG 1RPOA 2Y69C 4PDVA 2EINB 4PA3A 3OW2U 4TWKA 2P90A 3OEEG 1EZJA 5J9PC 5L3CA 3E8GA 3CYOA 2R9IA 1YTFD 4Q20A 1GM7A 3AG4C 3EHBB 3FB7C 2Y69B 4G27B 3A0RA 1GKFA 1EBOA 1RPRA 3K79A 3AG4B 4JAUA 1K4DC 3ZMZA 4JF3A 5H9CA 5DN6G 1R3IC 2WAMA 2XASA 1LNQA 4UVAA 5CBGA 5CBHA 1YITV 1PD3A 5C93A 1OCOC 2CK3G 2HR3A 4I5SA 3SPGA 4MTFA 3G71V 4LC1A 3FYIB 4X8AA 3OMIB 5B1BC 1GM8A 1AJPA 1K34A 2DWDC 4WFBV 2IU0A 1JOYA 4R7CA 5L3EA 1Y66A 1TUEB 2P7TC 2QM8A 4R8CA 5B1BB 3W7XA 2PI4A 2W0FC 2YSUB 1ROPA 3ZMSA 4PA4A 2Z5UA 3K0DA 2W6IG 5CN0A 2QKSA 3HB3B 3W7TA 3B8MA 2JJ2G 2LFSA 5EK0A 4PELA 3DTUB 3CCUV 3K04A 2HG5C 2ZR2A 2QE7G 4WF9V 3OUFA 2F43G 4PA7A 3G6EV 1VQNV 4R50A 1NH2D 1KQSU 1AR1B 1PNMA 4DO2A 4ZKIA 2MK3A 4ASUG 4RQFA 2K1EA 2HFEC 1SETA 3K0GA 4J9YB 3E2EA 4N21A 4Z1MG 3MD0A 2DQ3A 3JD3A 3OR6C 3P32A 2QTOA 1NH2B 4KUMA 4RO2A 2ITDC 3SYCA 4BIZA 4WFFA 2EIJC 1XL6A 4MVZA 5IYDO 3W7WA 3LDEA 2R9RB 5LGNA 2EIJB 2V7QG 1SESA 1S5HC 4HZ3A 1I5YA 3ZN0A 5L3FA 2W6JG 3E8FA 1VQ9V 3K3WA 2ZQMA 1FS0G 4GT1A 2JEUA 3AG2C 3RBZA 3AG3C 1PL0A 3TETA 4QPKA 1Q81W 3VBBA 1K97A 2IJKA 4CBCA 3AG2B 3ABKC 4MW8A 2B5UA 1SRYA 3AG3B 1K9MW 4PDMA 3T4DA 1RM1C 2WLLA 3SYOA 3OM3B 4WFAV 5IDJA 1YJNV 1S76D 4ZBMA 1VQ8V 2H94A 1QVGU 2IH1C 4XDJA 3ABKB 3ASOC 3B8NA 3E86A 1RM1B 2D3OW 2X6CA 1S0VA 3H01A 2KB1A 5LHGA 4U7OA 4P9OA 1YJWV 1Q86W 1JPXA 3ASOB 4GX0A 2IH3C 4GCZA 4P9PA 1CEZA 5LHIA 1H38A 5CA3A 3LDCA 4UV9A 2C2AA 3B77A 1OZ0A 3STLC 4E2LA 1HWYA 2Y48A 1QBZA 2ZD9A 3QO7A 4MS2A 3ZMVA 1KECA 2WWWA 1QR9A 1BL8A 3RVZA 1WPXA 1AI7A 2GSMB 1GTOA 5EBLC 3CD6V 1SERA 1VQ5V 1R6NA 4KFMA 4HYOA 4XDLA 3G4SV 3CCEV 1J95A 2ZR3A 1W0KG 4MW3A 3ZRWA 4GX5A 1M1KW 2JJ1G 4UUJC 1K4CC 3RW0A 2H8PC 3SYPA 1R73A 1YTFB 3OEHG 4YXWG 2IJHA 3JCZA 4XDKA 3UKMA 3CP1A 1EFRG 3ZRWB 3T4ZA 4CZZA 2EZPA 1AROP 3RVYA 5IYCO 5DM6V 2WLKA 3SPIA 4BAYA 2IW5A 2AHYA 2LFRA 1F4MA 5FL7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOB C;  5EC1 C;  3K0G A;  4J9Y B;  4LBE C;  1OCC C;  1M56 C;  3OR6 C;  4RUF A;  3VOU A;  2QTO A;  2DYR C;  2WLN A;  3LNM B;  4R6Z A;  2ITD C;  4RO2 A;  3SYQ A;  3WG7 C;  1QLE C;  5KUM A;  2A79 B;  4OXS A;  4LCU C;  2JK5 C;  4J9Z B;  3SYC A;  3ZRS A;  4WFF A;  2EIM C;  2EIJ C;  4GX1 A;  3SPJ A;  1XL6 A;  1M57 C;  3BEH A;  3OR7 C;  3T1C A;  4MVZ A;  1P7B A;  3SYA A;  4DXW A;  3LDE A;  4MTG A;  5EBW C;  2R9R B;  1S5H C;  5IY5 C;  3GB7 C;  4HZ3 A;  4BW5 A;  2ITC C;  3IGA C;  4MVU A;  2A0L A;  4G28 B;  1R3K C;  3F7V C;  2DYS C;  4PA6 A;  3ZJZ A;  3E8F A;  3OUS A;  1R3L C;  2ATK C;  3AG2 C;  2AHZ A;  3K03 A;  3SPC A;  3ABL C;  4X89 A;  3RBZ A;  3AG3 C;  3TET A;  1KKD A;  3EFF K;  4CBC A;  1V55 C;  2Q69 A;  2DWE C;  2EIN C;  3ABK C;  4MW8 A;  2HVJ C;  3OGC C;  4PDM A;  3T4D A;  4PDR A;  2WLL A;  4JTC B;  2Q67 A;  4JTD B;  3SYO A;  3E8B A;  2NLJ C;  2YEV A;  4I9W A;  4MVQ A;  4ZBM A;  2Y69 C;  1JVM A;  2IH1 C;  4PA3 A;  4PDV A;  4XDJ A;  3ASO C;  2WLI A;  3E86 A;  4TWK A;  5E1A C;  5J9P C;  3E8G A;  2X6C A;  3E8H A;  4RAI A;  3FB8 C;  2KB1 A;  3AG4 C;  3FB7 C;  3LDD A;  4RUE A;  4H37 A;  4G27 B;  1ZWI C;  3F5W C;  4P9O A;  3STZ C;  3E83 A;  4P30 A;  4MVR A;  4WFH A;  4GX0 A;  2IH3 C;  4F4L A;  1G4Y B;  3FB5 C;  3KG2 A;  4QNH B;  5EBM C;  4P9P A;  1K4D C;  3IFX A;  2EIK C;  3LDC A;  4EKW A;  3F7Y C;  3JYC A;  5KUK A;  1R3I C;  4MVS A;  1LNQ A;  5CBG A;  4WFE A;  4P2Z A;  5CBH A;  3STL C;  2OCC C;  2A9H A;  1OCO C;  2Q6A A;  3E89 A;  3SPH A;  2ZD9 A;  2Q68 A;  4MS2 A;  3SPG A;  5EC2 C;  1BL8 A;  3K06 A;  4JTA B;  3RVZ A;  4MTF A;  1R3J C;  4WFG A;  4LP8 A;  4MVO A;  4X8A A;  3R65 A;  5B1B C;  3LUT B;  2X6B A;  5BZB A;  5EBL C;  2DWD C;  4MVM A;  1OCZ C;  4R7C A;  4KFM A;  3X2Q C;  4HYO A;  4XDL A;  2HVK C;  4GX2 A;  1J95 A;  2P7T C;  3FB6 C;  5B3S C;  3T2M A;  4R8C A;  2HJF C;  4MW3 A;  1V54 C;  4PDL A;  4GX5 A;  2W0F C;  2BOC C;  2ZXW C;  4UUJ C;  4PA4 A;  3K0D A;  2WLL B;  3ASN C;  1K4C C;  2QKS A;  3RW0 A;  2WLH A;  3ABM C;  2H8P C;  3SYP A;  2WLM A;  2WLI B;  5EK0 A;  3SJQ C;  3HPL C;  5B1A C;  4XDK A;  3UKM A;  3K04 A;  2HG5 C;  4PA9 A;  3TCU A;  3PJS K;  3K08 A;  3OUF A;  3T4Z A;  4H33 A;  4MTO A;  4MSW C;  4PA7 A;  1XL4 A;  4R50 A;  3RVY A;  4X88 A;  2WLK A;  2WLJ A;  3SPI A;  1ORQ C;  3UM7 A;  4QE9 A;  5CBF A;  1OCR C;  2AHY A;  4QE7 A;  2X6A A;  3AG1 C;  2K1E A;  2HFE C;  2EIL C; 
#chains in the Genus database with same CATH topology
 2PYL A;  1G1X B;  4BIO A;  1JA8 A;  2DN9 A;  1H8H G;  4DR3 B;  1US6 A;  2B1I A;  5B1O A;  1FAF A;  1M57 C;  1TAE A;  3OR7 C;  3T1C A;  1QVF U;  4UXN A;  2LO1 A;  3N2G B;  5EBW C;  3HKC A;  5A9G A;  1QLN A;  1MG1 A;  4Z2W A;  2Q0O C;  5H6R A;  1JX9 A;  2HP8 A;  3IGA C;  4MVU A;  1Y76 B;  2EJR A;  1O9G A;  3F7V C;  1Z5V A;  4EB6 B;  3SPC A;  4MT8 A;  3B09 A;  1GM9 A;  1HNZ B;  1AJQ A;  2HVJ C;  2LW7 A;  1YJ9 V;  1K33 A;  4FPP A;  4TOI A;  3K5O A;  4RAI A;  4K0K B;  1K92 A;  4LF4 B;  1ZWI C;  4WFH A;  3RT3 C;  3L75 H;  4QNH B;  5IE9 A;  1MSD A;  4DUZ B;  5LHH A;  3CCV V;  5LBQ A;  2AGA A;  4JI2 O;  1SQQ H;  5EC2 C;  2Q0A A;  5F2V O;  2JS5 A;  4MVO A;  2OCC B;  4GKJ O;  3OFN G;  5BZB A;  3QVN A;  1VQ6 V;  3CPW U;  2HVK C;  4DV7 O;  2R70 A;  1H8E G;  4EFB A;  2V4D A;  1XMO O;  1LUV A;  3HPL C;  4NKG B;  3CC7 V;  1GN2 A;  3DGE A;  2CDY A;  1JMK C;  3ETE A;  4X88 A;  3BCC H;  2HLD G;  2HHH B;  2EIL C;  4NTY A;  1TUB A;  3JD2 A;  1M56 C;  1NU1 H;  3CJH B;  3BFR A;  3A8T A;  1EN5 A;  2LQT A;  3JD1 A;  1IBM B;  3BAA A;  1YIJ V;  3T1H B;  3H1H H;  2XAQ A;  1FFX B;  5JH7 A;  5IWA B;  4TSF G;  1XNR B;  4IYH A;  4KHP O;  2HKO A;  3LSS A;  3P3P A;  3ABL C;  1O9H A;  3CCM V;  1KKD A;  5GON A;  1D2D A;  3CS5 A;  4JI6 B;  4JI3 O;  3DC6 A;  3ZRX A;  2Q67 A;  5GTI Z;  1FJG B;  1JVM A;  4JI8 B;  3AK3 A;  4C7U A;  3BAB A;  1B04 A;  3ZN1 A;  2OIE A;  3FB5 C;  1I0H A;  2VQE O;  4CH3 A;  3MHH C;  4MVS A;  2A9H A;  1CP9 A;  3L72 H;  3D36 C;  1JFF B;  3K06 A;  2YDE A;  4WFG A;  4FLY A;  2YID A;  2L6L A;  4B7E A;  3X2Q C;  1AIL A;  3FB6 C;  4F6R A;  3T2M A;  1WA8 B;  4JAV A;  3OMN B;  1QQC A;  4JGS A;  4DR7 O;  1OCZ B;  1L1F A;  1I5X A;  2X7R B;  1V54 B;  2YI9 A;  4DV6 O;  3S3X A;  4JI7 B;  3U10 A;  2JGD A;  4FFB B;  3TK1 A;  1S72 V;  1PNL A;  3SJC C;  2Q7G A;  1E1R G;  1KP3 A;  4H13 B;  1OCR B;  2Q9L A;  1FYJ A;  3SYQ A;  1QLE C;  3CCJ V;  2UXN A;  1S5L Z;  3ZMU A;  1DF4 A;  4DR4 B;  5KHG A;  2XAG A;  5IJ9 B;  1XDC A;  5LA6 A;  5CA0 B;  2ZDI A;  4QPJ A;  1VF5 B;  2ITC C;  5K1P A;  1DF5 A;  5KHH A;  1JQ0 A;  4FK5 C;  2N74 A;  2B1G A;  1R3L C;  3HKD A;  1FXH A;  3I55 V;  3K03 A;  2FYU H;  4LNU A;  5JJN B;  2Q69 A;  4L8J A;  1ZSP A;  4JI4 B;  4FLT A;  3OGC C;  1P4R A;  3L73 H;  5FPO A;  4DUY B;  3HR0 A;  1RPO A;  2Y69 C;  4B3T O;  4Q20 A;  3A0R A;  4DR1 O;  1EBO A;  4LF9 B;  1SQF A;  3O65 A;  5H9C A;  3WB1 A;  4I55 A;  5JH7 B;  2XAS A;  1YIT V;  3FFQ A;  4OX9 O;  4I5S A;  3G71 V;  3FYI B;  3CX5 F;  3OMI B;  1K34 A;  2DWD C;  3CRQ A;  1TUE B;  2P7T C;  1U97 A;  4O2B A;  4YY3 O;  1Q43 A;  2W0F C;  1S5J A;  4DV3 O;  3CRM A;  2QKS A;  1Q6U A;  1XUQ A;  4JI0 B;  2UUC O;  2O57 A;  3ZHV A;  2QR4 A;  1YVW A;  2HG5 C;  4F6E A;  5BR8 B;  4KL1 A;  3LNN A;  1XEQ A;  1AR1 B;  2XT9 A;  3K5L A;  1UPG A;  4LFB B;  4ASU G;  2K1E A;  2HFE C;  2DQ3 A;  1KBH A;  1I7F A;  2DJV A;  4RO2 A;  4X1I A;  4BIZ A;  4WFF A;  1D5A A;  2ETN A;  2QWN B;  5BMV A;  2VWK A;  5IYD O;  2R9R B;  2Q7E A;  4X64 B;  5IT9 N;  4AI8 A;  3ZN0 A;  1VQ9 V;  2ZQM A;  4GT1 A;  1YZB A;  3AG3 C;  4QPK A;  1F7Y A;  2IJK A;  5JQG A;  2UUB B;  4CBC A;  3AG2 B;  2B5U A;  1RM1 C;  4LFC O;  1R6T A;  4K3A A;  4DR5 O;  4WFA V;  1YJN V;  1S76 D;  4ZBM A;  1VQ8 V;  4AQY B;  2QDO A;  1QVG U;  2IH1 C;  3ABK B;  2KSD A;  3RYC A;  3B8N A;  3E86 A;  1N4C A;  2D3O W;  5LHG A;  4DR2 B;  1HP8 A;  4H0L B;  1CEZ A;  5A2Q N;  4X20 A;  5LA6 B;  1NT2 B;  3TGU H;  2CH7 A;  1PM9 A;  3QO7 A;  4J7Z A;  3ZMV A;  2WWW A;  4DK0 A;  1PL4 A;  3HKD B;  5EBL C;  1SER A;  1VQ5 V;  1XHX A;  1H2K A;  2PZS A;  4MW3 A;  1RSO B;  2LJ2 A;  4PD4 F;  2GTS A;  5KMG A;  4J7J A;  2IJH A;  4XDK A;  2CE4 A;  3T4Z A;  4CZZ A;  1AR4 A;  2PTM A;  3RVY A;  2GDS A;  4BAY A;  5DED A;  1N34 O;  1W59 A;  4I55 B;  2OCH A;  1VEW A;  1Q5O A;  3R66 A;  4CC6 A;  3QO8 A;  4RUF A;  3GVM A;  1Y76 A;  4ZHQ B;  3BEH A;  4LF5 O;  4G2K A;  2YIA A;  1M57 B;  4JI2 B;  1MOF A;  5EZY B;  1OV9 A;  5LGT A;  1Q6I A;  2KKW A;  4LWS B;  2AHZ A;  4JAS A;  3BHP A;  3VQX A;  3EFF K;  4DV7 B;  1YF2 A;  3G67 A;  1KD1 W;  2QM4 A;  2E74 B;  1YHQ V;  3JSN A;  1GK9 A;  2NLJ C;  4MVQ A;  3K9S A;  1XMO B;  2LP7 A;  2VRZ A;  3K58 A;  3K9A A;  3FYE B;  2BTQ B;  1NVP B;  3LDD A;  4H37 A;  4DYL A;  5LYJ B;  4DW0 A;  1W0J G;  3KG2 A;  2X0L A;  5LGU A;  5LXT B;  1ENV A;  2PGG A;  1MAB G;  4Q6G A;  5KHK A;  3M99 B;  2ZE7 A;  1FXK C;  3QTC A;  4MVM A;  1DLB A;  3JAR B;  5KLV H;  3M7M X;  2GV9 A;  4KXR A;  4CS3 A;  4J80 A;  1HNW O;  4XBF A;  3JD4 A;  1GMG A;  1AB3 A;  2LW1 A;  1IXB A;  1NQT A;  4KHP B;  1GO3 F;  2UXC O;  4UVB A;  1SQX H;  4JI3 B;  1FFT B;  5CBF A;  2CTQ A;  4X20 B;  1XRE A;  3AG1 C;  1SZT A;  2BSK B;  4QGP A;  2QKA A;  1SC5 B;  1VQK V;  2DYR C;  3B2E E;  3LNM B;  2EIL B;  5LOV B;  4OXS A;  4LCU C;  3CWB H;  2VQF O;  1KP2 A;  2EIM C;  1M56 B;  1T5E A;  1TVK B;  2ZE8 A;  2NR5 A;  3GWO A;  2VQE B;  3N2K B;  4PJ0 Z;  1HNX O;  1SA0 A;  2DW4 A;  3B4S A;  3GB7 C;  3M8A A;  2UUA O;  1N32 B;  5KMG B;  1YXB A;  1AI6 A;  1AR5 A;  3LSU A;  5H6Q A;  1M90 W;  1VQM V;  2LGW A;  1VP7 A;  1V55 C;  2RN9 A;  1G8M A;  3ABL B;  4DR7 B;  1V9P A;  1H2M A;  4NXN O;  4FFK A;  1OCO B;  4ZIB A;  3QNE A;  4DV6 B;  3RYH B;  4YIO A;  1H2L A;  3E8H A;  3RWR D;  3FB8 C;  2Z3Y A;  1JFF A;  3AK2 A;  2JIZ G;  4DR6 O;  3IC7 A;  1K5Q A;  1YI2 V;  2YEV B;  3IFX A;  2EIK C;  3QF7 A;  4EKW A;  3F7Y C;  3CC2 V;  1WP7 A;  4P2Z A;  2CAZ C;  1K8A W;  1WA8 A;  4UB6 Z;  1WLE A;  3E89 A;  4JZG A;  3SPH A;  3BY6 A;  3CXC U;  5LMU O;  4LP8 A;  2M7W A;  4BR6 A;  2L35 A;  2X6B A;  5JVD B;  2P4K A;  1BE3 H;  1A32 A;  4X1Y B;  4GX2 A;  3W7S A;  1AVM A;  2HJF C;  3Q4H A;  1R6K A;  2ZM6 O;  5HFL A;  5GW7 A;  1FXV A;  3X2Q B;  1H2G A;  4FFB A;  3ASN C;  1PNK A;  2UXD O;  3ABM C;  3P30 A;  4QJF B;  1BMF G;  3ZMT A;  2JDI G;  5B1A C;  5IYZ A;  5TIS Z;  2A06 H;  3PJS K;  1MSW D;  2OTL V;  2E3C A;  2DQ0 A;  5GTH Z;  2F4V O;  3UM7 A;  1ORQ C;  5KA5 A;  1WPB A;  4GUN A;  4NTX A;  5CA1 B;  1NJI W;  4X9Q A;  2BOB C;  5IJ9 A;  1IVS A;  2VS0 A;  4B3T B;  1EZV H;  5CA0 A;  3VOU A;  3CB2 A;  1VQL V;  4YHH O;  4IIJ B;  3ZRS A;  4DR1 B;  2P6J A;  5FLX N;  1MZF A;  3CCS V;  3VQY A;  2YIC A;  1QLE B;  3DSQ A;  1WP8 A;  5HFM A;  1S77 D;  2YC0 A;  2IJI A;  4OX9 B;  4KP4 A;  5EIB D;  3RGB A;  3ZJZ A;  5JCO C;  1PKX A;  3JAW B;  2YS8 A;  3ZED A;  1QCE A;  3WB2 A;  3CE2 A;  4X89 A;  1BQ0 A;  3WB0 A;  4YY3 B;  2CGO A;  3MDS A;  4JV5 O;  4DV3 B;  1QNM A;  1IUR A;  3BPZ A;  2BTO A;  1NBM G;  4PA3 A;  2P90 A;  3E22 B;  2BE3 A;  2UUC B;  4JZ2 A;  3CYO A;  2JVD A;  4BWA A;  2QWR B;  1GM7 A;  3EHB B;  1YCI A;  1XQ8 A;  2Y69 B;  4G27 B;  1XIL A;  1GKF A;  1RPR A;  3JAS B;  3K79 A;  1NI8 A;  1K4D C;  2Q8V A;  4NB5 A;  3ZMZ A;  5CBG A;  1LNQ A;  4UVA A;  1SA0 B;  3EVK A;  4JI5 O;  2QWP B;  1OCO C;  2HR3 A;  3AG7 A;  3N27 A;  4DV5 O;  1I94 O;  5B1B C;  4GKK O;  4R7C A;  2Z0A A;  4CS4 A;  4TUY A;  4IHJ B;  4DV2 O;  2XTA A;  4R8C A;  1H2S B;  3D8C A;  1ROP A;  4PA4 A;  2Z5U A;  3H1I H;  4NVP A;  2EX3 A;  3S3W A;  4FZ0 A;  3W7T A;  4LFA O;  4UCU A;  3CCU V;  2QE7 G;  4CS2 A;  3G6E V;  1DK1 A;  4LFC B;  2MK3 A;  4DR5 B;  1VF7 A;  4RQF A;  3K0G A;  3UQ8 A;  1IZ3 A;  2N04 A;  3JSL A;  2HEP A;  2P06 A;  1X4T A;  4CH5 A;  1M93 A;  2ITD C;  3IC9 A;  4FLV A;  2AXT Z;  2WA4 A;  1MNG A;  1Q6H A;  3SYC A;  2EIJ C;  4DV4 O;  1XL6 A;  4WBN B;  2AZ2 A;  4MVZ A;  3W7W A;  3Q4H B;  1IDS A;  2F93 B;  2MW2 B;  2GUZ B;  2N05 A;  3ZHR A;  4B7K A;  5L3F A;  2W6J G;  1SKV A;  3E8F A;  3K3W A;  2QWQ B;  1FS0 G;  5IYZ B;  1SZX A;  3TET A;  3VBB A;  3JAL B;  2ODM A;  4MW8 A;  4LF6 O;  3AG3 B;  3T4D A;  2QWO B;  4UCS A;  2ZIN A;  2H94 A;  3UT5 B;  1XI1 A;  3BRC A;  4JI1 O;  1RM1 B;  1S0V A;  3CRA A;  3AK1 A;  3H1K H;  2KB1 A;  4DV1 O;  2ZIO A;  4GCZ A;  1N34 B;  5LHI A;  1H38 A;  5D5P A;  4UV9 A;  2C2A A;  3O9O A;  2G38 A;  1OZ0 A;  5IJ0 A;  1QBZ A;  1RSO A;  1QR9 A;  1Y74 B;  3RVZ A;  3ZHT A;  2RQ6 A;  1WPX A;  1IX9 A;  4DUZ O;  3L9D A;  3OTO O;  1R6N A;  4XDL A;  2JRI A;  4B08 A;  4LF5 B;  2AW9 A;  1W0K G;  4NR1 A;  2JJ1 G;  5D5Q A;  4E4E A;  3RW0 A;  1HR0 O;  5C8Y B;  1SQG A;  4PHZ A;  4H44 B;  1R73 A;  3TJT A;  3OEH G;  4YXW G;  3JCZ A;  1YDX A;  3UKM A;  4FLU A;  4B3R O;  1EFR G;  3ZRW B;  4HNA B;  1ARO P;  3OTF A;  5IYC O;  4YJ3 A;  4ZHQ A;  4LBE C;  2GHY A;  1KYO F;  1MA1 A;  1OCC C;  3FKS G;  4LH7 A;  3RN4 A;  3CHX A;  4JYA O;  5EZY A;  4ZI7 B;  1Y4M A;  1PV0 A;  3UO3 A;  2YXY A;  3JAK A;  4GX1 A;  2ZNI A;  2OIG A;  4LWS A;  4TUY B;  1OHH G;  1S3J A;  3SYA A;  1YSC A;  1XMQ B;  1XNQ O;  4ICG A;  5L3D A;  2JS3 A;  2EJ7 A;  5IY5 C;  4GZR B;  3ZIA G;  4BW5 A;  3ZRV A;  3W7U A;  4G28 B;  3QG5 A;  2QM7 A;  1L8D A;  2BTQ A;  1NVP D;  3G6B A;  2DWE C;  5LYJ A;  4I7Z B;  1HNW B;  3ICX A;  1UFI A;  4JTD B;  5LXT A;  2VWJ A;  3L71 H;  1KU9 A;  3PN1 A;  5E1A C;  2P67 A;  3JD0 A;  4QIW F;  4X66 O;  2UXB O;  3HKE A;  2UXC B;  2FTK A;  2A7W A;  3BVO A;  2UU9 O;  3E83 A;  4P30 A;  2QEX V;  4F4L A;  5EBM C;  3CRR A;  1I08 A;  3MHS C;  3JYC A;  3JAR A;  1FJG O;  1JJ2 U;  4JYB A;  3LSQ A;  2Q6A A;  4CH6 A;  3C3T A;  2VQF B;  3AEI A;  1NTZ H;  5FPR A;  3LUT B;  3RYI B;  3I5D A;  5FNV A;  1J5E O;  3J80 N;  2XAH A;  1FXK B;  3BA8 A;  1HNX B;  2BOC C;  5L3G A;  1IBL O;  1H2N A;  2XOK G;  5LMN O;  1M4U A;  2UUA B;  3ETQ A;  2WLM A;  3SJQ C;  4DV0 O;  2BSK A;  3K08 A;  2ZT9 B;  4D7T A;  5J2T B;  4H33 A;  4MSW C;  1XL4 A;  5LOV A;  2QSA A;  4HBN A;  1PP9 H;  2ILM A;  1B06 A;  3D3I A;  1TVK A;  2R9A A;  4GLX A;  2QA4 V;  5IJ0 B;  4NXN B;  3N2K A;  3OT7 A;  3JAT B;  3GWK C;  2IJJ A;  3SJA C;  3AG1 B;  4AHC A;  4DR6 B;  4WCE V;  2DYR B;  2F23 A;  1B3Q A;  2XAF A;  2EIM B;  1K73 W;  1Q90 D;  1Y6X A;  1BHA A;  2CGN A;  4W4K A;  5B66 Z;  2A0L A;  3BA9 A;  5LMU B;  1R3K C;  2DYS C;  2V1D A;  3SGI A;  4FZ1 A;  2KG7 A;  3RYH A;  5E79 Z;  2ZM6 B;  4YJ3 B;  2F66 C;  4LF8 O;  1IXM A;  4I9Q A;  4LH6 A;  2UXD B;  2YEV A;  1JJO A;  4NTW A;  1V55 B;  1WB8 A;  3KCY A;  1E79 G;  1GH6 A;  3CCR V;  3APQ A;  5BXZ A;  3A0H Z;  3JAK B;  4MVR A;  2F4V B;  4J7K A;  1G4Y B;  4GKJ B;  4NXM O;  1WB7 A;  3D36 A;  5JVD A;  3FAV B;  4UB8 Z;  4YIP A;  4X1Y A;  2QGN A;  4OPA A;  2D2C B;  4BIU A;  5KA6 A;  1BGY H;  2EIK B;  4O4L B;  3ABT A;  4JTA B;  2ZE6 A;  3CRC A;  4YHH B;  4D7S A;  1GN3 A;  2IBZ H;  1VIB A;  3ML0 A;  5B3S C;  3SJB C;  1VQ4 V;  2ZXW C;  2OWO A;  5LP6 C;  1F23 A;  3I56 V;  5CA1 A;  5LL6 Y;  1NKD A;  3ASN B;  3HKE B;  4PA9 A;  1N36 O;  3KKY A;  1F51 A;  3ABM B;  1L0N H;  4YJ2 B;  3CME V;  4JPR A;  5B1A B;  4TV8 B;  4IIJ A;  1IBK O;  3EXA A;  1KUQ A;  4QE7 A;  2X6A A;  1MMM A;  1SQB H;  2E5L O;  5EC1 C;  2DOS A;  4IYI A;  2RCV A;  2WLN A;  2PY5 A;  3WG7 C;  1K7D A;  4B3M O;  3JAW A;  5FNV B;  2WA3 A;  4MTG A;  4O4I B;  4UCR A;  4JI5 B;  4FIP C;  4IGG A;  2NNU A;  3ABU A;  1HDJ A;  3SR2 C;  1I94 B;  2ZDI C;  3H1L H;  4UFZ A;  3E22 A;  2XAJ A;  4DV2 B;  3WU2 Z;  2EIN C;  3RYF B;  4PI0 A;  2OTJ V;  4JTC B;  3JAS A;  2QKC A;  4PI2 A;  1W2B U;  4DRX A;  4LFA B;  3OW2 U;  2E76 B;  3OEE G;  1EZJ A;  1U96 A;  3E8G A;  2K9P A;  5KAF Z;  3FX7 A;  3AG4 C;  2KQX A;  3C90 A;  1MZE A;  4JF3 A;  5DN6 G;  1R3I C;  2WAM A;  4IT5 A;  1NTM H;  1Q3E A;  5C93 A;  4IHJ A;  4OPH A;  2CK3 G;  3ZHU A;  2QJ1 A;  3P3N A;  1P49 A;  3ZHQ A;  1QHT A;  1GN4 A;  4D6T H;  4X8A A;  4K8X A;  4UCT A;  1GM8 A;  1N0N A;  2KG7 B;  1JOY A;  4RWU A;  1Y66 A;  2CTR A;  2QM8 A;  5B1B B;  3W7X A;  3ZMS A;  3U0Z A;  2W6I G;  5CN0 A;  1VAR A;  3HB3 B;  4CC5 A;  2LFS A;  4PEL A;  2ZR2 A;  4WF9 V;  4LF7 O;  3OUF A;  4PA7 A;  1VQN V;  2RJZ A;  5CB4 B;  3JAM N;  2FB5 A;  1PPJ H;  4LF6 B;  3L74 H;  1PNM A;  2YI8 A;  4UCO A;  4ZKI A;  2ADP A;  4TQF A;  2DE0 X;  4WBN A;  3E2E A;  3SDL A;  1WAZ A;  4JI1 B;  3JD3 A;  3OR6 C;  2FL4 A;  1KMI Z;  1NH2 B;  4KUM A;  3OGI B;  2GUZ A;  4DV1 B;  3FD9 A;  3LDE A;  2EIJ B;  1S5H C;  3JAL A;  5EYP B;  1I5Y A;  2Q7H A;  2PUS A;  3ZHS A;  2JEU A;  4I0X B;  3UT5 A;  3OTO B;  2ZE5 A;  4X1K B;  1K97 A;  1QU7 A;  2XHB A;  1VMG A;  1XOU A;  1XHZ A;  1AP6 A;  1K9M W;  2WLL A;  3KCX A;  5B5E Z;  1R1B A;  5IDJ A;  1HR0 B;  5KX5 A;  4XDJ A;  2ZCE A;  4X65 O;  3ASO C;  2X6C A;  4FLZ A;  1ZAU A;  3H01 A;  2P22 C;  4B3R B;  1Y74 A;  2EUL A;  4GX0 A;  2QTS A;  1TGO A;  4B3S O;  3B77 A;  3H9V A;  3STL C;  1NTK H;  4A5U B;  5K1X A;  2Y48 A;  2ZD9 A;  4MS2 A;  5JJJ B;  3CSX A;  1BL8 A;  4JYA B;  2CTP A;  3K5N A;  4ABM A;  5C8Y A;  1AI7 A;  1GTO A;  3CD6 V;  1WJZ A;  4I50 A;  4HYO A;  3G4S V;  5DEC A;  1XNQ B;  4CH4 A;  2ZR3 A;  4X62 O;  2ADQ B;  3ZRW A;  4HNA A;  1M1K W;  1K4C C;  2Q4P A;  4DRX B;  2H8P C;  4AIL C;  4O4H B;  4TQD A;  1NS1 A;  1DGS A;  3T1Y O;  4ZI7 A;  2WLK A;  3SPI A;  3K59 A;  2AHY A;  3DXR A;  2LFR A;  4I4T B;  3ZS8 C;  2Y0P A;  1F4M A;  4FJC C;  4U3J B;  5H2F Z;  4X66 B;  3CCQ V;  2UXB B;  1KC8 W;  1P7G A;  4O4J B;  2UU9 B;  1OCC B;  3SPJ A;  1Y67 A;  1L0L H;  5ITZ B;  1P7B A;  3VQV A;  4N23 A;  1FPO A;  4UV8 A;  3U11 A;  2PF4 E;  5KHJ A;  1LR1 A;  1K5S A;  2RNB A;  3WFV A;  4GYC B;  1VQP V;  5IY5 B;  1J5E B;  1N33 O;  3HKC B;  5J2U A;  4FLW A;  4MTX A;  3UO2 A;  2XND G;  1X59 A;  2F1M A;  3KZI Z;  1N32 O;  4J10 A;  1IBL B;  3E8B A;  3DC5 A;  4IL6 Z;  5LMN B;  2HHH O;  2M6Y A;  1NR7 A;  1CXZ B;  1EN6 A;  2WLI A;  5LP6 A;  1G6U A;  4DV0 B;  4L87 A;  4DR3 O;  4UVC A;  1NZ6 A;  3STZ C;  3F5W C;  1GAX A;  4FMT A;  3TXS A;  2OT5 A;  1AI5 A;  1OJH A;  1YEW A;  3RYI A;  2P5O A;  4TV9 A;  5KUK A;  2OCC C;  1FXK A;  1ZX3 A;  5IYB O;  1R3J C;  2IU3 A;  3ZCC A;  2ZKO A;  4TT3 G;  3R65 A;  1Z5W A;  1E1Q G;  1FKA O;  2UXX A;  1HNZ O;  1LUW A;  2WPD G;  5J2T A;  4PDL A;  1GN6 A;  1QR8 A;  2WLL B;  1F4N A;  1VQO V;  1M5I A;  2WLH A;  5KX5 B;  4UCV A;  1BS3 A;  1M9N A;  1SQV H;  4K0K O;  3TCU A;  3JAT A;  4LF4 O;  2FKX A;  1XBL A;  2W0X A;  2WLJ A;  4LF8 B;  4QE9 A;  2Q73 A;  3CCL V;  2A3Q A;  3JCU Z;  3ETD A;  4LR3 A;  1KB9 F;  2GTA A;  2PYJ A;  2CTW A;  1AP5 A;  3HKB A;  4HAM A;  1VQ7 V;  1SF9 A;  2JK5 C;  4J9Z B;  1VF6 C;  4NXM B;  4I50 B;  2B9Z A;  1TUB B;  2GBO A;  1RP3 B;  4U7N A;  1BQZ A;  4JYC A;  4PA6 A;  4K8Z A;  1EN4 A;  4Z1V A;  2ATK C;  2EZO A;  1COW G;  3OMA B;  4W4L A;  3K57 A;  2DYS B;  5L3B A;  3NR7 A;  3DXR B;  1SQP H;  4I9W A;  4J41 A;  2PI5 A;  3FAV A;  2F95 B;  1N36 B;  5GON B;  1N0J A;  4RUE A;  4O4L A;  3NXS A;  3QO5 A;  3OAA G;  1BZK A;  1AJN A;  2YUA A;  3RFR A;  1BSM A;  3ZX6 A;  1IBK B;  2JEX A;  1IBM O;  1BT8 A;  3T1H O;  2E5L B;  4WFE A;  4FM0 A;  5IWA O;  3ZBH A;  4BW9 A;  2HJD A;  2Q68 A;  2ZIM A;  1XNR O;  1URF A;  4JAA A;  3CEI A;  1Q82 W;  4B3M B;  1OCZ C;  3E35 A;  5J2U B;  1THZ A;  1V54 C;  4YJ2 A;  4JI6 O;  2R72 A;  1BHB A;  1CPY A;  4TV8 A;  3VQW A;  1RFY A;  1DTO A;  3OE7 G;  4J42 A;  5B3S B;  5JJE B;  2ZXW B;  2WLI B;  4JI8 O;  5LP6 B;  2Y4T A;  1ZUQ A;  3A2F A;  5B1N A;  4EEQ A;  4F6R B;  1UJW B;  1ZL8 A;  3L70 H;  5CMU A;  2BCC H;  1BCC H;  1OCR C;  2CUG A;  4JYY A;  1P84 F;  4TV9 B;  1Q7Y W;  4MTO A;  1NR1 A;  1K3E A;  4O4I A;  3H1J H;  2ZNJ A;  4R6Z A;  2JGD B;  5KUM A;  4OGQ B;  2A79 B;  1N8R W;  2FML A;  3ETG A;  4DW1 A;  1B6Q A;  1Z2G A;  3WG7 B;  4DXW A;  2Q5Z A;  5JCO A;  1EM1 A;  3MAQ A;  2H3O A;  3RYF A;  5AG2 A;  4O2A A;  1AI4 A;  3CXH F;  2ARH A;  3CMA V;  3D3Q A;  5EIB C;  3OUS A;  1HW7 A;  4PV1 B;  4JI7 O;  4RQE A;  3CC4 V;  4ZOL A;  3IJ4 A;  2LGQ A;  4PDR A;  2EBO A;  2WSS G;  1JCH A;  4J11 A;  3F5T A;  4PDV A;  2EIN B;  4TWK A;  5J9P C;  5L3C A;  4LNU B;  1YTF D;  2R9I A;  3HKB B;  3FB7 C;  4LF7 B;  1WNS A;  4DR4 O;  3AG4 B;  4JAU A;  5H5N A;  5CBH A;  1PD3 A;  3SPG A;  4MTF A;  4LC1 A;  1Q8I A;  1AJP A;  4WFB V;  3OD4 A;  2IU0 A;  1ZTE A;  5L3E A;  3N2G A;  2PI4 A;  2YSU B;  4JI4 O;  1KKC A;  3K0D A;  5CB4 A;  1GRJ A;  4FM2 A;  4DUY O;  3B8M A;  4FM1 A;  2YXL A;  5KHI A;  2JJ2 G;  5EK0 A;  3DTU B;  1ZLZ A;  3K04 A;  4EB6 A;  4O2B B;  2F43 G;  3J7A U;  4NYK A;  4R50 A;  1NH2 D;  1KQS U;  4LF9 O;  4DO2 A;  3THO A;  2YIB A;  1SET A;  4J9Y B;  4N21 A;  2YIB D;  4Z1M G;  3MD0 A;  4X65 B;  2OYQ A;  1FD9 A;  2RDC A;  3P32 A;  2QTO A;  5EYP A;  3C3S A;  3TXQ A;  2IM9 A;  2Y0I A;  4I0X A;  4B3S B;  5LGN A;  4X1K A;  2V7Q G;  1SES A;  4FVM A;  4K35 A;  1D5N A;  4X1I B;  4HZ3 A;  4JV5 B;  1WN7 A;  2P4V A;  4JI0 O;  3J81 N;  5BMV B;  3AG2 C;  1XMQ O;  3RBZ A;  1ZL8 B;  1PL0 A;  1Q81 W;  5BR8 O;  4X62 B;  1JR9 A;  3ABK C;  1SRY A;  4PDM A;  4LFB O;  3SYO A;  3OM3 B;  1SS3 A;  4EFE A;  5JQG B;  4U7O A;  2E75 B;  4P9O A;  1YJW V;  1Q86 W;  4DV5 B;  1JPX A;  3ASO B;  3T1Y B;  2IH3 C;  4P9P A;  4GKK B;  5CA3 A;  3LDC A;  3RYC B;  3B40 A;  4X64 O;  4E2L A;  1HWY A;  3G80 A;  3UCS C;  1KEC A;  2AZ0 A;  4O2A B;  1TA8 A;  4FLX A;  2DMX A;  3CJH A;  2Y4U A;  2GSM B;  2NN4 A;  4KFM A;  4O4H A;  3CCE V;  1J95 A;  3APO A;  2UUB O;  5BY1 A;  1VF6 A;  2CH7 B;  4ZOL B;  1FFX A;  4GX5 A;  4UUJ C;  5KAI Z;  3K5M A;  2YXH A;  4AQY O;  3SYP A;  4I4T A;  1YTF B;  2RMK B;  4U3J A;  3CP1 A;  1N33 B;  2JGU A;  4DR2 O;  5JWP A;  2EZP A;  2XUM A;  3A0B Z;  4O4J A;  4U3F H;  4DK1 A;  5DM6 V;  3IAY A;  2IW5 A;  4DV4 B;  5ITZ A;  5FL7 G; 
#chains in the Genus database with same CATH homology
 4LBE C;  4FJC C;  2GHY A;  1OCC C;  3FKS G;  3QO8 A;  4RUF A;  3CCQ V;  1KC8 W;  1H8H G;  2B1I A;  1Y4M A;  1OCC B;  4GX1 A;  5B1O A;  3SPJ A;  1M57 C;  3BEH A;  3OR7 C;  3T1C A;  1QVF U;  4UXN A;  4G2K A;  1OHH G;  1P7B A;  1S3J A;  1YSC A;  4N23 A;  3SYA A;  5EBW C;  1QLN A;  1MG1 A;  4UV8 A;  5L3D A;  1M57 B;  5IY5 C;  3ZIA G;  5H6R A;  1JX9 A;  1K5S A;  1MOF A;  4BW5 A;  3IGA C;  4MVU A;  3ZRV A;  3W7U A;  2EJR A;  4G28 B;  3F7V C;  5LGT A;  3WFV A;  1VQP V;  5IY5 B;  2QM7 A;  2AHZ A;  3SPC A;  4JAS A;  4MT8 A;  1GM9 A;  4MTX A;  3EFF K;  2XND G;  1NVP D;  1KD1 W;  1AJQ A;  2DWE C;  2HVJ C;  4JTD B;  1YHQ V;  3E8B A;  1GK9 A;  2NLJ C;  1YJ9 V;  4MVQ A;  2LP7 A;  1K33 A;  4FPP A;  5E1A C;  1NR7 A;  2WLI A;  2P67 A;  3JD0 A;  4QIW F;  3K9A A;  3FYE B;  4L87 A;  4RAI A;  1NVP B;  1K92 A;  2FTK A;  4UVC A;  3LDD A;  3STZ C;  4H37 A;  1ZWI C;  3F5W C;  4FMT A;  3E83 A;  4P30 A;  4WFH A;  1W0J G;  2QEX V;  2OT5 A;  4F4L A;  4QNH B;  3KG2 A;  1AI5 A;  2X0L A;  5EBM C;  5LGU A;  5LHH A;  1ENV A;  3MHS C;  1MAB G;  3JYC A;  5KUK A;  3CCV V;  1JJ2 U;  4JYB A;  5LBQ A;  2OCC C;  3LSQ A;  1FXK A;  2Q6A A;  3M99 B;  5EC2 C;  5IYB O;  1R3J C;  2IU3 A;  3ZCC A;  4MVO A;  4TT3 G;  2OCC B;  3R65 A;  3OFN G;  3AEI A;  3LUT B;  1FXK C;  5BZB A;  1E1Q G;  4MVM A;  2UXX A;  1DLB A;  1VQ6 V;  3CPW U;  2HVK C;  2XAH A;  2WPD G;  1FXK B;  4PDL A;  2BOC C;  4XBF A;  3JD4 A;  1QR8 A;  2WLL B;  1H8E G;  1GMG A;  5L3G A;  1F4N A;  2XOK G;  1VQO V;  2WLH A;  2WLM A;  1NQT A;  1GO3 F;  1M9N A;  3SJQ C;  3HPL C;  3CC7 V;  3TCU A;  4UVB A;  3DGE A;  3K08 A;  4H33 A;  4MSW C;  1XL4 A;  3ETE A;  4X88 A;  2WLJ A;  1FFT B;  4QE9 A;  5CBF A;  3D3I A;  3CCL V;  3ETD A;  3AG1 C;  2HLD G;  1SZT A;  2QA4 V;  2EIL C;  2IJJ A;  3JD2 A;  1M56 C;  1VQK V;  2DYR C;  3AG1 B;  3LNM B;  4HAM A;  2EIL B;  1VQ7 V;  4OXS A;  4LCU C;  2JK5 C;  4J9Z B;  1KP2 A;  2EIM C;  1M56 B;  4WCE V;  2DYR B;  3JD1 A;  3GWO A;  1YIJ V;  2XAQ A;  2XAF A;  2EIM B;  1K73 W;  4TSF G;  2DW4 A;  3GB7 C;  1BHA A;  4U7N A;  2A0L A;  4JYC A;  1R3K C;  4PA6 A;  2DYS C;  2V1D A;  1AI6 A;  2HKO A;  3LSS A;  2ATK C;  3ABL C;  5H6Q A;  1M90 W;  2EZO A;  1VQM V;  1COW G;  3OMA B;  3CCM V;  1KKD A;  2DYS B;  1V55 C;  1G8M A;  5L3B A;  3ABL B;  3ZRX A;  1IXM A;  2Q67 A;  2YEV A;  4I9W A;  1V55 B;  2PI5 A;  1JVM A;  1OCO B;  3QNE A;  1E79 G;  3E8H A;  3CCR V;  3FB8 C;  4RUE A;  2Z3Y A;  3NXS A;  4MVR A;  3QO5 A;  3OAA G;  2JIZ G;  3ZN1 A;  1G4Y B;  1AJN A;  1K5Q A;  3FB5 C;  3IC7 A;  1YI2 V;  2YEV B;  2JEX A;  3D36 A;  3IFX A;  2EIK C;  4EKW A;  3F7Y C;  3CC2 V;  3MHH C;  4MVS A;  4WFE A;  4P2Z A;  1K8A W;  2A9H A;  1CP9 A;  4BIU A;  5KA6 A;  1WLE A;  3E89 A;  3SPH A;  2EIK B;  2Q68 A;  3BY6 A;  3ABT A;  3K06 A;  4JTA B;  4WFG A;  3CXC U;  4LP8 A;  1Q82 W;  2M7W A;  2X6B A;  1OCZ C;  3E35 A;  3ML0 A;  3X2Q C;  4GX2 A;  5B3S C;  3FB6 C;  3T2M A;  3W7S A;  1VQ4 V;  4JAV A;  1THZ A;  2HJF C;  3OMN B;  1R6K A;  1V54 C;  5HFL A;  4JGS A;  2ZXW C;  1BHB A;  5GW7 A;  1OCZ B;  1FXV A;  1L1F A;  1I5X A;  1CPY A;  2X7R B;  3ASN C;  1H2G A;  1PNK A;  3X2Q B;  1F23 A;  5B3S B;  1DTO A;  3OE7 G;  3I56 V;  3ABM C;  3P30 A;  4QJF B;  1V54 B;  1BMF G;  3ZMT A;  2ZXW B;  2WLI B;  2JDI G;  1NKD A;  5B1A C;  3ASN B;  4PA9 A;  5B1N A;  3PJS K;  1F51 A;  1UJW B;  2OTL V;  1MSW D;  3ABM B;  5CMU A;  3CME V;  4JPR A;  2DQ0 A;  5B1A B;  3TK1 A;  3UM7 A;  1ORQ C;  5KA5 A;  1S72 V;  1OCR C;  1PNL A;  4QE7 A;  1NJI W;  2X6A A;  1Q7Y W;  4MTO A;  1NR1 A;  1E1R G;  2BOB C;  5EC1 C;  1KP3 A;  1K3E A;  1OCR B;  3VOU A;  1VQL V;  2WLN A;  4R6Z A;  3SYQ A;  3WG7 C;  1QLE C;  1K7D A;  5KUM A;  2A79 B;  3CCJ V;  2UXN A;  3ZMU A;  1N8R W;  3ZRS A;  1DF4 A;  3ETG A;  2P6J A;  3CCS V;  2XAG A;  1B6Q A;  3WG7 B;  1QLE B;  4DXW A;  4MTG A;  5HFM A;  1S77 D;  4FIP C;  2IJI A;  2ZDI A;  4QPJ A;  2NNU A;  2ITC C;  3ABU A;  4KP4 A;  1DF5 A;  1AI4 A;  3ZJZ A;  1PKX A;  1JQ0 A;  3CMA V;  2ZDI C;  3OUS A;  2B1G A;  1R3L C;  4FK5 C;  1FXH A;  1QCE A;  3I55 V;  3K03 A;  4X89 A;  2XAJ A;  4RQE A;  2Q69 A;  3CC4 V;  2EIN C;  2OTJ V;  3OGC C;  1P4R A;  4PDR A;  2EBO A;  4JTC B;  2WSS G;  1JCH A;  1W2B U;  1NBM G;  1RPO A;  2Y69 C;  4PDV A;  2EIN B;  4PA3 A;  3OW2 U;  4TWK A;  2P90 A;  3OEE G;  1EZJ A;  5J9P C;  5L3C A;  3E8G A;  3CYO A;  2R9I A;  1YTF D;  4Q20 A;  1GM7 A;  3AG4 C;  3EHB B;  3FB7 C;  2Y69 B;  4G27 B;  3A0R A;  1GKF A;  1EBO A;  1RPR A;  3K79 A;  3AG4 B;  4JAU A;  1K4D C;  3ZMZ A;  4JF3 A;  5H9C A;  5DN6 G;  1R3I C;  2WAM A;  2XAS A;  1LNQ A;  4UVA A;  5CBG A;  5CBH A;  1YIT V;  1PD3 A;  5C93 A;  1OCO C;  2CK3 G;  2HR3 A;  4I5S A;  3SPG A;  4MTF A;  3G71 V;  4LC1 A;  3FYI B;  4X8A A;  3OMI B;  5B1B C;  1GM8 A;  1AJP A;  1K34 A;  2DWD C;  4WFB V;  2IU0 A;  1JOY A;  4R7C A;  5L3E A;  1Y66 A;  1TUE B;  2P7T C;  2QM8 A;  4R8C A;  5B1B B;  3W7X A;  2PI4 A;  2W0F C;  2YSU B;  1ROP A;  3ZMS A;  4PA4 A;  2Z5U A;  3K0D A;  2W6I G;  5CN0 A;  2QKS A;  3HB3 B;  3W7T A;  3B8M A;  2JJ2 G;  2LFS A;  5EK0 A;  4PEL A;  3DTU B;  3CCU V;  3K04 A;  2HG5 C;  2ZR2 A;  2QE7 G;  4WF9 V;  3OUF A;  2F43 G;  4PA7 A;  3G6E V;  1VQN V;  4R50 A;  1NH2 D;  1KQS U;  1AR1 B;  1PNM A;  4DO2 A;  4ZKI A;  2MK3 A;  4ASU G;  4RQF A;  2K1E A;  2HFE C;  1SET A;  3K0G A;  4J9Y B;  3E2E A;  4N21 A;  4Z1M G;  3MD0 A;  2DQ3 A;  3JD3 A;  3OR6 C;  3P32 A;  2QTO A;  1NH2 B;  4KUM A;  4RO2 A;  2ITD C;  3SYC A;  4BIZ A;  4WFF A;  2EIJ C;  1XL6 A;  4MVZ A;  5IYD O;  3W7W A;  3LDE A;  2R9R B;  5LGN A;  2EIJ B;  2V7Q G;  1SES A;  1S5H C;  4HZ3 A;  1I5Y A;  3ZN0 A;  5L3F A;  2W6J G;  3E8F A;  1VQ9 V;  3K3W A;  2ZQM A;  1FS0 G;  4GT1 A;  2JEU A;  3AG2 C;  3RBZ A;  3AG3 C;  1PL0 A;  3TET A;  4QPK A;  1Q81 W;  3VBB A;  1K97 A;  2IJK A;  4CBC A;  3AG2 B;  3ABK C;  4MW8 A;  2B5U A;  1SRY A;  3AG3 B;  1K9M W;  4PDM A;  3T4D A;  1RM1 C;  2WLL A;  3SYO A;  3OM3 B;  4WFA V;  5IDJ A;  1YJN V;  1S76 D;  4ZBM A;  1VQ8 V;  2H94 A;  1QVG U;  2IH1 C;  4XDJ A;  3ABK B;  3ASO C;  3B8N A;  3E86 A;  1RM1 B;  2D3O W;  2X6C A;  1S0V A;  3H01 A;  2KB1 A;  5LHG A;  4U7O A;  4P9O A;  1YJW V;  1Q86 W;  1JPX A;  3ASO B;  4GX0 A;  2IH3 C;  4GCZ A;  4P9P A;  1CEZ A;  5LHI A;  1H38 A;  5CA3 A;  3LDC A;  4UV9 A;  2C2A A;  3B77 A;  1OZ0 A;  3STL C;  4E2L A;  1HWY A;  2Y48 A;  1QBZ A;  2ZD9 A;  3QO7 A;  4MS2 A;  3ZMV A;  1KEC A;  2WWW A;  1QR9 A;  1BL8 A;  3RVZ A;  1WPX A;  1AI7 A;  2GSM B;  1GTO A;  5EBL C;  3CD6 V;  1SER A;  1VQ5 V;  1R6N A;  4KFM A;  4HYO A;  4XDL A;  3G4S V;  3CCE V;  1J95 A;  2ZR3 A;  1W0K G;  4MW3 A;  3ZRW A;  4GX5 A;  1M1K W;  2JJ1 G;  4UUJ C;  1K4C C;  3RW0 A;  2H8P C;  3SYP A;  1R73 A;  1YTF B;  3OEH G;  4YXW G;  2IJH A;  3JCZ A;  4XDK A;  3UKM A;  3CP1 A;  1EFR G;  3ZRW B;  3T4Z A;  4CZZ A;  2EZP A;  1ARO P;  3RVY A;  5IYC O;  5DM6 V;  2WLK A;  3SPI A;  4BAY A;  2IW5 A;  2AHY A;  2LFR A;  1F4M A;  5FL7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...