4X8AA

Navms pore and c-terminal domain grown from protein purified in licl
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus sp. (strain mc-1)
molecule tags Transport protein
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x8aA00
3STLC 4LBEC 2DYRC 1LNQA 3AG2C 1OCRC 4MW8A 4RO2A 5J9PC 4MS2A 3FB5C 4CBCA 2YEVA 4R50A 4PA6A 3STZC 2ITDC 4I9WA 4QNHB 3SPIA 2JK5C 3EFFK 3E83A 3K0DA 3K03A 3K0GA 4PA4A 1JVMA 2R9RB 4H37A 4MVQA 4XDKA 3RVYA 5B3SC 2WLMA 4P9OA 2H8PC 4MTGA 4DXWA 2Q68A 4P30A 2A79B 1R3JC 2IH3C 3K04A 4H33A 1XL4A 4WFGA 2WLIA 2DWDC 4BW5A 3AG3C 4GX2A 4MSWC 2EILC 3RBZA 1G4YB 1V54C 2EIJC 3OR7C 3SYCA 3SPJA 2X6AA 2DWEC 3F5WC 4MW3A 3K08A 2W0FC 2WLHA 4X8AA 3SPGA 2NLJC 1M56C 3OUSA 3ZRSA 3F7VC 2HFEC 5CBHA 2WLNA 3LDEA 5E1AC 3ZJZA 1S5HC 3BEHA 3PJSK 4EKWA 3OUFA 3KG2A 4JTCB 4QE7A 5EC1C 3FB7C 2Q69A 3SPCA 2WLIB 3UM7A 5IY5C 2WLLB 2AHZA 4P9PA 4WFFA 2ITCC 1V55C 4RUEA 1R3KC 2WLLA 3FB8C 4R6ZA 4X88A 4PDRA 3SYAA 4J9YB 3SYPA 2AHYA 3K06A 4PDLA 3T2MA 2BOCC 1ORQC 2EIKC 2P7TC 1OCOC 4MTFA 2KB1A 2WLJA 3E8FA 4PA7A 3TCUA 5KUKA 3T1CA 4MVOA 1M57C 3T4ZA 4GX5A 4WFHA 3LUTB 1R3IC 3IFXA 4OXSA 4PDMA 2X6BA 4PDVA 2HG5C 1XL6A 3GB7C 2BOBC 3ABMC 1OCZC 2ZXWC 3R65A 5EBWC 3SJQC 2Q6AA 3FB6C 4GX1A 2EINC 2OCCC 5B1AC 2HJFC 3LDDA 4G27B 2Q67A 4PA9A 3JYCA 3E8GA 3E89A 4MVMA 2WLKA 4MVRA 1J95A 3WG7C 4RUFA 3ABKC 4LCUC 5CBGA 4XDJA 1K4DC 2QKSA 1R3LC 4HZ3A 4P2ZA 5CBFA 3IGAC 5EK0A 3SYOA 4JTDB 3VOUA 1OCCC 4J9ZB 2ZD9A 4F4LA 3E8BA 2QTOA 4GX0A 4R7CA 3E86A 3SPHA 2IH1C 4RAIA 3F7YC 4MVZA 4ZBMA 4LP8A 5BZBA 3OGCC 4JTAB 2EIMC 2HVKC 1QLEC 1K4CC 3RVZA 3SYQA 2X6CA 2K1EA 3ASOC 4MVSA 5EBMC 3T4DA 3TETA 3E8HA 3OR6C 1ZWIC 2A9HA 2Y69C 4PA3A 3LDCA 4X89A 4XDLA 4G28B 3ABLC 1KKDA 4TWKA 3LNMB 1BL8A 2HVJC 3HPLC 5EBLC 4MTOA 4MVUA 2A0LA 4R8CA 1P7BA 3ASNC 3RW0A 4UUJC 5B1BC 4QE9A 5EC2C 3X2QC 3AG4C 2ATKC 4WFEA 3UKMA 3AG1C 2DYSC 5KUMA 4KFMA 4HYOA
chains in the Genus database with same CATH superfamily
1K34A 1NVPD 5JH7B 2F4VO 4QNHB 3ZMUA 5LXTA 2KG7A 5BMVA 5LGUA 5B3SC 4MTGA 2Q9LA 1RP3B 1GM9A 1S5JA 4NKGB 3K04A 3JSLA 4DV6O 5KX5B 1H8HG 1DTOA 2YSUB 3UCSC 1FFXB 1PL4A 2GV9A 4BWAA 4Q6GA 5CB4A 2UXNA 1Q6HA 3M7MX 2KG7B 1S5HC 4U7OA 1R1BA 4K8ZA 3CMAV 3FB7C 2Q69A 1AP6A 3SPCA 2WLLB 2Q7HA 2IU3A 4RUEA 1R3KC 4NXNB 3I5DA 4JYCA 5CB4B 4UFZA 4PDMA 2ZE8A 5KHIA 1GM8A 3FB6C 4GX1A 2EINC 2EINB 4UCUA 4NXNO 1FJGB 1XBLA 3S3WA 4JI8B 3U10A 4XDJA 1K4DC 4J7ZA 4PI2A 4JTDB 4LF4B 3L71H 1VQNV 1K73W 3BY6A 3QF7A 5DEDA 2EZPA 3B2EE 3H9VA 4UVAA 2ARHA 4TWKA 3WU2Z 1FJGO 1BL8A 4CS2A 1SZTA 3A8TA 1P84F 4JI8O 4X9QA 4JPRA 2NR5A 4QE9A 1JJ2U 4LF4O 4E4EA 4DR5B 1OCRC 2QR4A 1OCRB 3SGIA 4TV9B 3ZCCA 3CXCU 4U3JA 3K0GA 1SQXH 4H37A 3JAKA 2WLMA 3H1JH 2WA4A 2A06H 3ZBHA 1NR1A 2HJDA 3K57A 2QGNA 4LFAB 4U3FH 4DR5O 3KCYA 2LGQA 2VWKA 1Q6IA 3HKBA 2QWQB 1EBOA 4FFBA 3BEHA 2CUGA 1SQFA 1EN5A 4E2LA 4BIUA 4LF7B 4LFAO 1YEWA 2XAGA 2ZKOA 3T1CA 1UFIA 2N74A 2R9IA 2EIMB 2JRIA 1SQPH 3WFVA 2JIZG 1XL6A 3JASB 4LFCB 3FKSG 4PHZA 4LF7O 3CWBH 3SJAC 5K1PA 1BHAA 1JMKC 3HR0A 4MVRA 5IYZA 4LNUB 5H2FZ 4IHJA 3OAAG 3NR7A 1NH2D 5KAFZ 3CRRA 5CA3A 2P67A 1W0KG 2P6JA 1KC8W 2D2CB 4HBNA 4X62B 3L72H 2M6YA 5IWAB 3K5LA 3A0BZ 3TETA 2KKWA 3ZHSA 3FYIB 3HKDA 3RYFB 2LW7A 1MSWD 4JYAB 5GTIZ 4IHJB 1F7YA 2QTSA 3OMNB 2ATKC 3DSQA 3ZN0A 4DRXA 1LNQA 4X62O 1VQ7V 1XOUA 1GM7A 1W2BU 2Q8VA 2JDIG 1VF6A 4IIJA 3I56V 1YI2V 4IGGA 1K97A 2Q4PA 3H1LH 1R3JC 4JYAO 1PL0A 1XL4A 4MSWC 1G4YB 2F95B 4CH3A 1AR4A 4DRXB 1H2NA 2HHHO 2OWOA 2NLJC 5CA0B 1CPYA 1TAEA 3L75H 3A0HZ 4FLZA 4DUYB 1IBMB 4QE7A 4LC1A 5EC1C 1N8RW 2DW4A 2YIBA 1VQOV 1NTZH 2Q0AA 3AK1A 4P9PA 5F2VO 1AROP 3OTOO 3U0ZA 2ZIOA 3ETEA 4EFBA 4GUNA 1JFFB 3IJ4A 5LHHA 4MTFA 4I0XA 4GCZA 4B3MB 1JPXA 4GLXA 4UV8A 4DUYO 4PDVA 4A5UB 1THZA 1IBMO 4AILC 1M4UA 2FYUH 4UV9A 3JSNA 3RGBA 1PNLA 2OCCC 3P3PA 2OCCB 1DGSA 1FXHA 4B7KA 3CYOA 4FMTA 2DYSB 4B3MO 2XTAA 5EIBC 4QJFB 3E8BA 4LFBO 4B08A 2FMLA 4RAIA 4BIZA 1SQGA 5EBMC 3E8HA 4PV1B 1BCCH 3M99B 2JGUA 3S3XA 4IYIA 3IC9A 4CH5A 3A0RA 4R8CA 5B1BC 2A7WA 1XQ8A 1XUQA 5B1BB 1E1QG 1FXKC 5L3GA 3ZHVA 4KFMA 4IYHA 1FXKB 4HYOA 4FZ1A 3H1KH 1Z5WA 2JJ2G 4B3SB 1N34B 2RCVA 1MOFA 1GTOA 1RSOB 2HKOA 2VQEB 3STZC 2YIBD 1MNGA 3ICXA 3JD4A 4K0KB 4O4LB 4P9OA 2OIEA 3SJCC 1AP5A 4WCEV 2V7QG 2UXDB 5B5EZ 1EZVH 1SQBH 3OR7C 1N34O 2VQEO 2IJJA 1GN2A 1Q7YW 2F93B 2QM4A 5CBHA 2WLNA 3OT7A 4K0KO 4X66B 5IJ9A 2UXDO 2XNDG 1YVWA 3SYAA 1BMFG 3FAVA 3QO8A 2ADPA 1RM1C 5LMNB 2PUSA 1RM1B 4NVPA 2KSDA 3TCUA 1FS0G 2QWOB 2Y4TA 2PYLA 4AQYB 2JGDB 4ZI7A 1VARA 1L0LH 4X66O 3C3TA 1Y76A 3VQVA 2P06A 4Q20A 1J95A 2F43G 5LMNO 1R3LC 5L3DA 3IGAC 4WFAV 4JAUA 1S72V 1A32A 2R9AA 5BZBA 4X1YB 4AQYO 5CA1A 1KBHA 4L8JA 2IJHA 1R73A 5AG2A 3W7WA 4YJ3A 2FTKA 4PA3A 3MHSC 5DN6G 4MTOA 2IJIA 2A0LA 3CE2A 2CTWA 5EC2C 2B1IA 3Q4HA 1ROPA 5LHIA 1BQ0A 1HR0B 1M9NA 3KCXA 3B4SA 5CA1B 3D36A 4LWSA 1H2GA 4FLXA 3JD2A 1XHZA 3O65A 3JATB 4YJ3B 5LL6Y 4DV3O 2W6JG 4CH4A 3BA9A 1HR0O 1HNWB 4D7SA 2X6AA 3D36C 1VQPV 2A3QA 2H94A 2LW1A 1Q43A 4UCSA 3RYCB 4FM0A 1YCIA 2XAQA 4EKWA 1PKXA 2QSAA 1Q82W 4F6RA 1QVGU 4K8XA 1HNWO 1K33A 1VQKV 4J9YB 4X20A 1KU9A 4YY3B 1ORQC 2KB1A 2ZNIA 4OXSA 1QNMA 1YIJV 3BPZA 5EZYA 1MSDA 3G67A 1DF5A 1TA8A 2WPDG 3ETDA 1X59A 1ZLZA 4F6RB 3P3NA 4TV8B 4MVMA 1DK1A 5C8YA 1D5NA 3NXSA 4YY3O 1GN4A 2DQ0A 3M8AA 5IJ0B 4RWUA 4FIPC 4MTXA 5EK0A 1I7FA 1N33B 4J9ZB 1TUEB 3ZS8C 3O9OA 3SPHA 3F7YC 4MVZA 5EZYB 1J5EB 4X65B 2YDEA 2XAFA 2P22C 1IBKB 2JEUA 4UXNA 3ABLC 2MK3A 3ABLB 5FPRA 3CB2A 4KP4A 4DW0A 2PY5A 3ASNC 1IURA 3ASNB 1KP3A 3UKMA 3AG1C 1N33O 3AG1B 4N21A 2EZOA 4JV5B 3CCVV 1J5EO 4X65O 3VBBA 2ITDC 1W59A 5JH7A 3EFFK 1QHTA 2IM9A 3G6BA 3JARB 4DXWA 1L8DA 2RQ6A 3SJBC 1PV0A 4LF5B 4XBFA 2YS8A 2AZ0A 1YJNV 1KP2A 1JCHA 2ILMA 1X4TA 4JV5O 1FFXA 2WSSG 1N36B 4ASUG 4I9QA 2GUZB 2FL4A 3ZJZA 3MDSA 4JGSA 1VIBA 1QR9A 4JTCB 1RPOA 3DC5A 4JI4B 3F5TA 4GT1A 3JAWA 3MD0A 4X1KA 2PYJA 1SETA 2WLLA 1PNKA 1NT2B 3T2MA 2EIKC 1KQSU 3W7SA 2WLJA 2EIKB 1S76D 4MVOA 1N36O 1GMGA 1US6A 2JEXA 4JYYA 3BCCH 1WPXA 1K92A 2GTSA 2K9PA 1VQ8V 4JI4O 5A9GA 1SERA 1BSMA 2HJFC 2YXHA 3JAWB 4X1KB 2X0LA 2O57A 1NQTA 1XNQB 1KKCA 2CGNA 4P2ZA 1N0NA 3BVOA 2RNBA 1RFYA 2DYRB 3AG2B 2ZD9A 4F4LA 3G71V 3FD9A 4I4TB 5JVDB 2CTPA 3E2EA 5J2TA 3OR6C 3BABA 2ZE5A 1WN7A 1AR5A 2F1MA 2P90A 1XNQO 3RW0A 3KKYA 1VF5B 4YIOA 1PPJH 4ZIBA 2HR3A 2OTLV 4PA6A 1YDXA 2JK5C 5J2TB 3HKCA 4TV9A 1EFRG 2JS5A 4DR2B 4JZGA 2QKAA 2LFRA 1EN6A 1VQ5V 3AG3C 3AG3B 1SF9A 2Q7GA 1K3EA 1GN6A 2EIJC 3CCUV 3G80A 3OE7G 2EIJB 3N2KB 1GRJA 4JI6B 3CSXA 4HNAA 3OUSA 2YXLA 4C7UA 5E1AC 3HKCB 2MW2B 5D5QA 1G8MA 4DR2O 3ABUA 4PELA 2WWWA 1Q6UA 5HFMA 1MA1A 2F23A 4PDRA 2ZIMA 3UO2A 5IE9A 4JI6O 4JZ2A 4HNAB 2LJ2A 2BCCH 3JALB 1QCEA 4I5SA 1FXVA 5JWPA 1NU1H 4FPPA 3JASA 3LDDA 1TUBB 2QKSA 1VQ6V 4CC6A 4LNUA 1WAZA 1QBZA 3E86A 2EIMC 2Y0PA 2OCHA 1WP8A 1K7DA 3K9AA 2Z0AA 4TOIA 2A9HA 2XAHA 1KKDA 3D3IA 2PGGA 3HPLC 5EBLC 3RYFA 1P7BA 4UUJC 4EB6B 1DF4A 4NTXA 5IT9N 4MW8A 1M56B 1HNXB 3SPIA 2YI8A 5GTHZ 4LFCO 4CC5A 2QEXV 4XDKA 2DJVA 5LHGA 1O9GA 4O2AA 2YI9A 2E5LB 2R70A 3KZIZ 4DUZB 4WBNB 3RN4A 3ZHRA 4GX2A 4O2BB 1YZBA 2LP7A 1ENVA 3CJHB 4FZ0A 4MW3A 2WLHA 4H13B 1HNXO 3CCQV 3ZX6A 3D3QA 3ZRSA 1YJWV 3OTFA 1WP7A 4DYLA 3IAYA 1K9MW 1EM1A 5CA0A 5IWAO 2YIAA 3OEEG 3APQA 1H2SB 1HP8A 4X64B 4O2AB 2E5LO 1JA8A 1KB9F 2E76B 4DUZO 1B04A 1ZL8B 2F66C 1YF2A 3FX7A 2P4VA 3ABTA 2E74B 1CP9A 3SDLA 3RYIA 3B8NA 2ZE6A 4YXWG 1JFFA 3LSQA 3CMEV 2HG5C 1Y66A 4X64O 1H2MA 1JOYA 1MZFA 2DQ3A 4RQEA 2EX3A 3JD3A 1AJPA 3ZIAG 3JAMN 4D6TH 4DV5B 1R6NA 5H6QA 4JI1B 5CBGA 3RYIB 4OX9B 4RQFA 2ZT9B 2QTOA 2ZE7A 3VQWA 3TK1A 3T4DA 3ETQA 4TUYA 1CEZA 3J7AU 3BFRA 1I08A 4QIWF 2RDCA 4G28B 4DV5O 4MVUA 4JI1O 3RWRD 5GONA 3I55V 5LYJB 4OX9O 2DYSC 1M5IA 5KUMA 3AG7A 1FXKA 4NTWA 4CZZA 1RSOA 2CE4A 4TUYB 1O9HA 4PA4A 2V1DA 4DV1B 4LF6B 4BR6A 4DK1A 2H8PC 1B6QA 3P32A 4O4LA 1P49A 3DC6A 2DWDC 5GONB 4O4IB 2AXTZ 1VQLV 1F4NA 1F23A 1D2DA 2ZNJA 3QTCA 1MABG 1IXBA 4OPHA 1P4RA 3F7VC 5H6RA 3PN1A 4TQFA 1VQMV 1Z5VA 1MMMA 2Y4UA 4DV1O 4LF6O 4Z1MG 4JI3B 4UCOA 5TISZ 2FKXA 3OGIB 3HB3B 3BA8A 2AHZA 3JCUZ 1YTFD 3ZHUA 2QM8A 1S3JA 2FB5A 4UCVA 2ZR3A 5JQGA 1WPBA 4B3SO 4YIPA 3T4ZA 2Q0OC 4WFHA 2DE0X 3IFXA 2PZSA 4FLVA 2LQTA 2BOBC 3L73H 4JI3O 2OYQA 2JGDA 4IL6Z 3C90A 3DGEA 5JJEB 3JYCA 3E8GA 2ODMA 3E89A 3GWKC 3CCLV 1SQVH 1IZ3A 2UUBB 4EFEA 5JQGB 4DR7B 1F4MA 4TSFG 4X1YA 4H0LB 3LSUA 2XT9A 3D8CA 1M93A 1ZWIC 5IYBO 3MHHC 5FLXN 4OGQB 5FNVB 5KAIZ 1N0JA 2UUBO 1XILA 4QPKA 3CRCA 1NS1A 1KMIZ 5L3BA 4DR7O 1PD3A 2R72A 1NTMH 1AB3A 1LUWA 1N4CA 1SESA 2IBZH 1EZJA 3E83A 1JVMA 3J81N 3JATA 2A79B 2IH3C 2B1GA 4X1IB 4ABMA 2WLIA 2BTQA 2YC0A 3E22B 2HP8A 4AHCA 2GTAA 3CP1A 3WB2A 5L3FA 3UT5B 3K3WA 4H44B 3PJSK 3RYCA 3RT3C 1V9PA 4DV0B 2WLIB 2BTQB 5LGTA 2QE7G 1FAFA 3T1HB 1PP9H 1ZUQA 2BOCC 5IYDO 2QDOA 3N27A 3E8FA 4UCRA 4DR4B 4GX5A 4G2KA 3K79A 3CEIA 1Y4MA 3CCEV 3H01A 5EBWC 3ZRVA 4BIOA 2LFSA 4DR6B 1WB8A 5ITZA 2PI5A 1SKVA 2XHBA 4I50B 3T1HO 2ADQB 4TV8A 3U11A 3IC7A 1H2KA 4DR4O 4PD4F 3CRMA 3ML0A 5IJ0A 1N32B 3MAQA 2IH1C 3QO7A 1S0VA 1OHHG 5DECA 3K5MA 1AI4A 1Y74A 4DR6O 2Y69C 4XDLA 4BW9A 5ITZB 4ZOLA 2Y69B 4LF9B 3GWOA 1GN3A 1LR1A 4JI2B 1FD9A 4WFEA 1NKDA 3SYCA 2UXBB 3K59A 1N32O 4RO2A 3FFQA 1XI1A 5J2UB 1BHBA 4O4HB 1R6KA 1Y74B 2R9RB 1AI6A 4ZOLB 4LF9O 2Q68A 3B40A 3B8MA 1XREA 4LH6A 3JARA 5A2QN 3T1YB 4JI2O 3K5NA 2QM7A 4CS3A 1R6TA 2UXBO 2Q7EA 3SPJA 4FM2A 1SC5B 1QVFU 2JS3A 1WNSA 4FLWA 1IX9A 5L3EA 1NVPB 4I7ZB 2P5OA 1FKAO 2GUZA 1IBKO 3BRCA 4DW1A 1Q5OA 4I55B 4U7NA 2AGAA 2Y48A 3K06A 4J7KA 2UUCB 3W7UA 4PA7A 4D7TA 3LUTB 4J80A 1NTKH 1XNRB 3J80N 3GB7C 2L35A 1QQCA 4PI0A 3VQXA 4IT5A 1NZ6A 2JJ1G 1Q3EA 4G27B 4TQDA 4LF5O 4KHPB 1K8AW 1JJOA 4NTYA 5LA6B 4FVMA 2UUCO 3N2GA 5B66Z 2UXXA 3RYHA 1ZSPA 5CBFA 2G38A 3K9SA 4DR1B 1Q86W 1OV9A 4J7JA 4JI5B 2IW5A 1YITV 4OPAA 3OGCC 4FLUA 1XNRO 1VQ9V 2NNUA 2PF4E 4I4TA 1FYJA 5JVDA 1L1FA 5B3SB 4FLYA 4FK5C 5FPOA 5E79Z 2CDYA 3LNMB 4KHPO 3DXRB 1VP7A 4CS4A 3N2GB 1S77D 3RYHB 3CC2V 4DR1O 5KHHA 4JI5O 1HWYA 2DYRC 3AG2C 3P30A 4CBCA 2RJZA 5LXTB 1Q81W 1IVSA 5BR8B 5BMVB 4FM1A 2UUAB 1WLEA 1EN4A 5LBQA 4UVBA 2H3OA 2VS0A 2C2AA 4ICGA 4GKKB 4ZKIA 4WFGA 5JCOA 2ETNA 1L0NH 3G6EV 1TGOA 2EULA 2B5UA 3ZHQA 5KLVH 2DN9A 1IXMA 4KUMA 4X8AA 3N2KA 4J41A 3RFRA 5BR8O 2UUAO 3ZN1A 2JVDA 1PM9A 5B1OA 5KHJA 1KUQA 5JCOC 4GKKO 1S5LZ 5IY5C 4YHHB 4WFFA 5IY5B 4X88A 4J42A 3CCRV 3CCMV 4DO2A 1H38A 5C93A 3JALA 2QJ1A 1W0JG 2NN4A 4YHHO 2Q67A 2XAJA 2WAMA 3ZRXA 3WG7C 4AI8A 2QA4V 4LCUC 4W4KA 1URFA 1MG1A 3WG7B 3B77A 1TUBA 2Q5ZA 4NB5A 4EEQA 1OCCC 3CCJV 1OCCB 2X7RB 3ZMTA 5BXZA 2E3CA 2XOKG 3ASOC 2K1EA 5JJNB 4TT3G 3ASOB 1NBMG 4F6EA 5H9CA 1BS3A 2EBOA 2AZ2A 4EB6A 4LBEC 1NH2B 2YEVA 4WFBV 3CC4V 4I9WA 4U3JB 1OZ0A 3JAKB 3CXHF 1SA0A 4P30A 3W7TA 5L3CA 4JAAA 3LNNA 3VQYA 2RMKB 4JI7B 4WBNA 3C3SA 1VQ4V 1F51A 5LMUB 4O2BA 3F5WC 3K08A 5CN0A 1OJHA 1YSCA 2YEVB 3CJHA 3HKBB 1M56C 1QU7A 1I0HA 2BTOA 4FFBB 3UQ8A 1NJIW 1SA0B 2BE3A 1QLNA 2VQFB 5JJJB 2DMXA 1H2LA 4JI7O 4Z1VA 1ZL8A 2ITCC 3EVKA 3FB8C 1NI8A 1VF7A 5IYCO 1BT8A 1G6UA 5LMUO 1Z2GA 1U97A 3CX5F 1UPGA 2YUAA 1K5QA 1COWG 1M90W 3ABMC 2VQFO 3ABMB 1BGYH 2GHYA 2BSKA 3L74H 4PA9A 5IYZB 3CD6V 3B09A 4JYBA 4GKJB 3AEIA 2ZQMA 4N23A 2HHHB 4B3RB 4R7CA 2GSMB 4JASA 4DV2B 4UCTA 2XASA 5KA6A 1QLEC 4O4JA 3HKDB 1QLEB 4JF3A 1SRYA 2BSKB 2HVJC 5DM6V 4GKJO 1GKFA 3OTOB 2KQXA 2QWPB 3R66A 4MVSA 1FPOA 4B3RO 5CMUA 3CS5A 5LYJA 2PTMA 3HKEA 1I5YA 4DV2O 4MS2A 1VF6C 4O4JB 4IIJB 4K3AA 5D5PA 1AILA 4MVQA 1B3QA 2VWJA 4DV7B 2CGOA 4BW5A 2EILC 3RBZA 5KMGA 2OT5A 2EILB 4CH6A 4FFKA 4O4IA 3HKEB 3WB0A 4LFBB 4UB8Z 1AI5A 3AK3A 2PI4A 5LP6A 5H5NA 1AI7A 2Y0IA 1D5AA 2Z3YA 3KG2A 4DV7O 4PJ0Z 4LH7A 1TVKA 5KMGB 2GDSA 1V55C 3JD1A 3ZHTA 1V55B 1YTFB 4I0XB 1AJQA 1Y67A 2L6LA 5KA5A 1KD1W 5LP6C 1R3IC 5LP6B 3TXQA 3DTUB 2UU9B 1OCZC 4YJ2A 3R65A 1JX9A 1OCZB 1G1XB 1XMQB 5B1AC 1VMGA 5B1AB 1TVKB 1NR7A 4FLTA 3QG5A 1BQZA 3A2FA 2QWNB 3ABKC 3JCZA 2CK3G 3ABKB 2CTQA 4HZ3A 2AW9A 5EIBD 3SYOA 4JAVA 4LF8B 3THOA 1XHXA 4GX0A 4KL1A 3GVMA 4ZBMA 4LP8A 3QVNA 2UU9O 1Q90D 4DK0A 4YJ2B 2Q73A 1XDCA 3EHBB 2CTRA 1H8EG 1XMQO 2ZR2A 4L87A 4B7EA 1RPRA 2GBOA 3G4SV 4DV4B 2CH7A 3AG4C 5FNVA 3AG4B 1ZTEA 4J10A 4LF8O 5K1XA 3STLC 2YIDA 3BAAA 3OEHG 3FB5C 1GK9A 4UB6Z 1PNMA 2ZCEA 3QNEA 4B3TB 3ETGA 3K0DA 3K03A 3AK2A 3ZMVA 3K58A 1GAXA 4Z2WA 2P4KA 2D3OW 4H33A 4DV4O 2CH7B 1WA8A 4HAMA 4X1IA 2IJKA 4UVCA 1V54C 1QR8A 1V54B 3APOA 3E22A 1SZXA 5EYPA 2DWEC 2W0FC 2XUMA 3SPGA 3WB1A 2LGWA 4B3TO 1YXBA 2IU0A 3L9DA 2QWRB 3UT5A 2W6IG 3OUFA 1M1KW 1XEQA 4NYKA 5IJ9B 2V4DA 1ZAUA 2B9ZA 1WA8B 3FAVB 1T5EA 1K5SA 2ZINA 4R6ZA 2AHYA 5EYPB 1OCOC 4ZHQA 1OCOB 1M57C 1E79G 1IDSA 1KYOF 1M57B 4ZI7B 1DLBA 2X6BA 3ZMZA 5IDJA 1JR9A 1KECA 3E35A 4FJCC 2HEPA 3SJQC 4NR1A 3OMAB 1Y76B 1AR1B 4LR3A 2WA3A 2E75B 1MZEA 3CRQA 4DV3B 1U96A 2WLKA 3L70H 1HNZB 2QKCA 4RUFA 4I50A 4ZHQB 3BHPA 1WJZA 5BY1A 3VOUA 3LSSA 1YHQV 1K4CC 3SYQA 3SR2C 2X6CA 3UO3A 2ZM6B 3QO5A 5LOVA 1YJ9V 1I94B 1BZKA 4DV0O 3H1IH 3LDCA 3CC7V 4GYCB 1HNZO 3JD0A 3ZEDA 4NXMB 3Q4HB 1GO3F 3X2QC 2OIGA 3X2QB 4JI0B 1XMOB 1HDJA 4LWSB 2Z5UA 5J9PC 3CPWU 3OM3B 4R50A 1SS3A 5J2UA 2ZM6O 2N04A 4QPJA 5LOVB 3OD4A 1I94O 1ZX3A 4O4HA 3RVYA 3OW2U 4KXRA 4NXMO 4BAYA 1IBLB 4QGPA 5B1NA 4WF9V 1AVMA 2M7WA 2CAZC 4JI0O 2RN9A 1GH6A 1I5XA 1XMOO 1FFTB 2EJRA 1LUVA 5HFLA 2ZDIA 5KHKA 3ZRWA 3TJTA 1B06A 5GW7A 3OMIB 1AJNA 2HFEC 4GZRB 3LDEA 1SQQH 3ZMSA 2VRZA 1JQ0A 3UM7A 1IBLO 3K5OA 4X20B 4K35A 3TGUH 1VEWA 2YICA 3SYPA 4I55A 2ZDIC 4PDLA 2P7TC 5KUKA 2N05A 3ZRWB 3W7XA 1P7GA 1CXZB 3FYEB 1UJWB 3TXSA 4W4LA 3OFNG 2ZXWC 3H1HH 2Q6AA 3EXAA 2ZXWB 2LO1A 2UXCB 5C8YB 3T1YO 2HLDG 1Q8IA 5LA6A 1Y6XA 4DR3B 4MT8A 5KHGA 1WB7A 4JTAB 4J11A 2F4VB 1BE3H 2EJ7A 2HVKC 3RVZA 2DOSA 2UXCO 4X89A 2OTJV 3CCSV 2W0XA 3CRAA 5LGNA 1E1RG 5FL7G 4DV6B 3DXRA 5KX5A 3CHXA 2YXYA 4DR3O 1HW7A
chains in the Genus database with same CATH topology
1M9NA 1K34A 4LBEC 1NVPD 1FXKA 1NH2B 3D36A 1H2GA 2YEVA 4CZZA 4WFBV 4QNHB 4I9WA 3CC4V 1OZ0A 3ZMUA 3JD2A 4PA4A 2V1DA 5LGUA 5B3SC 2H8PC 4MTGA 4P30A 3W7TA 1B6QA 3P32A 1GM9A 5L3CA 3K04A 2W6JG 2DWDC 1VQ4V 1H8HG 1VQLV 1F51A 1DTOA 2YSUB 1F4NA 2X6AA 1F23A 3F5WC 3K08A 1VQPV 5CN0A 1MABG 1YSCA 2YEVB 1M56C 2UXNA 1P4RA 3F7VC 2H94A 5H6RA 1VQMV 1S5HC 4U7OA 2XAQA 4Z1MG 4EKWA 1PKXA 3CMAV 1NJIW 1QLNA 3FB7C 3HB3B 2Q69A 1Q82W 3SPCA 2WLLB 2AHZA 2IU3A 2ITCC 1YTFD 1QVGU 4RUEA 1R3KC 3FB8C 1K33A 1VQKV 5IYCO 4J9YB 4JYCA 2QM8A 1S3JA 1ORQC 2ZR3A 2KB1A 3T4ZA 4WFHA 3IFXA 4OXSA 4PDMA 1K5QA 1COWG 1YIJV 1M90W 2BOBC 3ABMC 1DF5A 1GM8A 3ABMB 2GHYA 2WPDG 3ETDA 2EINC 3DGEA 3FB6C 4GX1A 2EINB 4PA9A 3JYCA 3E8GA 3E89A 4MVMA 3CD6V 3CCLV 4JYBA 3NXSA 4XDJA 3AEIA 1K4DC 2DQ0A 4FIPC 2ZQMA 4MTXA 4N23A 5EK0A 4JTDB 4J9ZB 1TUEB 4R7CA 2GSMB 3SPHA 4JASA 3F7YC 4MVZA 1F4MA 1K73W 1VQNV 3BY6A 4TSFG 2XASA 5KA6A 1QLEC 2XAFA 1QLEB 2EZPA 1ZWIC 2JEUA 4JF3A 1SRYA 5IYBO 4UXNA 4UVAA 3ABLC 2MK3A 4TWKA 1BL8A 2HVJC 3ABLB 3MHHC 5DM6V 1SZTA 4KP4A 3ASNC 1GKFA 3ASNB 1KP3A 4JPRA 4QE9A 4QPKA 3UKMA 3AG1C 4MVSA 3AG1B 5L3BA 1JJ2U 5CMUA 1PD3A 4N21A 1I5YA 1OCRC 2EZOA 3CCVV 4MS2A 1OCRB 1SESA 3VBBA 2ITDC 1EZJA 3EFFK 3E83A 3ZCCA 3CXCU 3K0GA 1JVMA 4H37A 4MVQA 2WLMA 4DXWA 2A79B 2IH3C 2B1GA 1NR1A 2WLIA 4BW5A 4XBFA 2EILC 3RBZA 2OT5A 1YJNV 2EILB 3CP1A 1KP2A 1JCHA 2WSSG 5L3FA 1AI5A 4ASUG 2PI4A 3K3WA 1AI7A 3ZJZA 1EBOA 4JGSA 3BEHA 3PJSK 2Z3YA 1QR9A 3KG2A 1RPOA 4JTCB 4E2LA 2WLIB 4GT1A 4BIUA 5LGTA 3MD0A 2QE7G 1V55C 3JD1A 1SETA 2WLLA 1PNKA 1V55B 1YTFB 1AJQA 3T2MA 2BOCC 2EIKC 5IYDO 3W7SA 1KQSU 2WLJA 2XAGA 2EIKB 3E8FA 3T1CA 5KA5A 1S76D 4MVOA 1KD1W 1GMGA 4GX5A 2JEXA 1R3IC 4G2KA 3K79A 2R9IA 2EIMB 3DTUB 3WFVA 2JIZG 1XL6A 1Y4MA 3CCEV 1WPXA 1OCZC 1K92A 3H01A 3R65A 5EBWC 1VQ8V 1JX9A 1OCZB 3ZRVA 1SERA 5B1AC 3FKSG 2HJFC 2LFSA 5B1AB 1NR7A 2X0LA 2PI5A 1BHAA 4MVRA 1NQTA 3ABKC 3JCZA 2CK3G 3IC7A 3ABKB 3OAAG 4HZ3A 4P2ZA 1NH2D 3SYOA 4JAVA 5CA3A 3AG2B 2DYRB 2P67A 2ZD9A 3ML0A 4GX0A 4F4LA 1W0KG 2IH1C 2P6JA 3QO7A 4ZBMA 3G71V 4LP8A 1KC8W 1S0VA 1OHHG 3E2EA 3TETA 3EHBB 1AI4A 1H8EG 3FYIB 2ZR2A 3OR6C 2Y69C 4XDLA 2Y69B 1MSWD 4L87A 3GWOA 1RPRA 2P90A 3G4SV 3OMNB 3RW0A 3AG4C 2ATKC 4WFEA 1NKDA 3AG4B 3SYCA 3ZN0A 3STLC 1LNQA 4RO2A 3OEHG 2HR3A 3FB5C 1GK9A 2OTLV 1VQ7V 1PNMA 4PA6A 3QNEA 1GM7A 1W2BU 2JK5C 1BHBA 3ETGA 2JDIG 1R6KA 3K0DA 3K03A 3I56V 1EFRG 3ZMVA 2R9RB 1YI2V 1AI6A 2LFRA 1K97A 2Q68A 2D3OW 3B8MA 1VQ5V 1R3JC 1PL0A 4H33A 1XL4A 2QM7A 3AG3C 4HAMA 4MSWC 3AG3B 1G4YB 2IJKA 1K3EA 4UVCA 1V54C 2EIJC 3CCUV 1QR8A 3OE7G 3SPJA 1V54B 2EIJB 1QVFU 2DWEC 2W0FC 3SPGA 2NLJC 3OUSA 1CPYA 5L3EA 1NVPB 2IU0A 5E1AC 1G8MA 2W6IG 3OUFA 3ABUA 1M1KW 4PELA 4LC1A 4QE7A 2WWWA 5EC1C 1N8RW 2DW4A 1VQOV 5HFMA 4P9PA 1AROP 1K5SA 4R6ZA 4U7NA 4PDRA 3ETEA 2Y48A 2AHYA 3K06A 3W7UA 5LHHA 1OCOC 4MTFA 4PA7A 1OCOB 4GCZA 1JPXA 1M57C 1E79G 3LUTB 4UV8A 1M57B 1QCEA 1DLBA 2X6BA 3ZMZA 5IDJA 1KECA 4I5SA 3E35A 1FXVA 4PDVA 1THZA 4FJCC 3GB7C 3SJQC 4FPPA 3OMAB 4UV9A 1PNLA 2OCCC 1AR1B 2OCCB 3LDDA 2JJ1G 1FXHA 4G27B 3CYOA 2WLKA 1K8AW 4RUFA 2QKSA 2UXXA 4FMTA 1VQ6V 2DYSB 5CBFA 1Q86W 1QBZA 3VOUA 4QJFB 3E8BA 2IW5A 3E86A 3LSSA 1YITV 4RAIA 4BIZA 3OGCC 2EIMC 1YHQV 1VQ9V 2NNUA 1K4CC 3SYQA 2X6CA 5EBMC 3QO5A 1L1FA 3E8HA 5B3SB 1YJ9V 1K7DA 3K9AA 2A9HA 2XAHA 3LDCA 3M99B 3D3IA 4FK5C 3CC7V 1KKDA 3LNMB 3JD0A 3HPLC 5EBLC 3A0RA 1P7BA 4R8CA 4UUJC 5B1BC 1GO3F 1S77D 3X2QC 1DF4A 5B1BB 1E1QG 1FXKC 5L3GA 3X2QB 3CC2V 4KFMA 1FXKB 4HYOA 1HWYA 2DYRC 2JJ2G 3AG2C 3P30A 2Z5UA 4MW8A 5J9PC 3CPWU 4CBCA 1M56B 1GTOA 1MOFA 2HKOA 3OM3B 4R50A 3STZC 1Q81W 3SPIA 1WLEA 4QPJA 2QEXV 4XDKA 3JD4A 5LBQA 4UVBA 3RVYA 5LHGA 4P9OA 2C2AA 3OW2U 4ZKIA 4WFGA 4BAYA 4GX2A 5B1NA 4WF9V 4WCEV 2M7WA 2V7QG 2LP7A 3G6EV 3OR7C 1I5XA 1FFTB 1ENVA 2B5UA 2EJRA 4KUMA 1IXMA 4MW3A 2WLHA 2ZDIA 4X8AA 5HFLA 3ZRWA 3CCQV 2IJJA 3ZRSA 1YJWV 5GW7A 1Q7YW 3ZN1A 3OMIB 1AJNA 2HFEC 5CBHA 2WLNA 3LDEA 1K9MW 3OEEG 5B1OA 3ZMSA 1JQ0A 3UM7A 5IY5C 4WFFA 5IY5B 4X88A 3ABTA 2XNDG 1CP9A 3SYAA 1BMFG 3CCRV 3CCMV 3SYPA 3QO8A 4DO2A 2ZDIC 4PDLA 1H38A 1RM1C 2P7TC 3B8NA 5KUKA 1RM1B 3ZRWB 3TCUA 4YXWG 3LSQA 1FS0G 3W7XA 3FYEB 1UJWB 5C93A 3CMEV 2HG5C 1Y66A 3OFNG 1JOYA 1W0JG 2DQ3A 4RQEA 2ZXWC 2Q6AA 2ZXWB 3JD3A 1AJPA 3ZIAG 2Q67A 2XAJA 2WAMA 3ZRXA 4Q20A 1R6NA 1J95A 5H6QA 3WG7C 2QA4V 2HLDG 4LCUC 2F43G 5CBGA 1MG1A 3WG7B 3B77A 1R3LC 5L3DA 3IGAC 4WFAV 4JAUA 4RQFA 1OCCC 3CCJV 1S72V 2QTOA 4MT8A 1OCCB 2X7RB 5BZBA 3ZMTA 4JTAB 2XOKG 3TK1A 2HVKC 3RVZA 2IJHA 3ASOC 2K1EA 4TT3G 3T4DA 3ASOB 1NBMG 1R73A 1CEZA 3W7WA 4QIWF 2FTKA 4PA3A 4X89A 2OTJV 4G28B 3MHSC 5H9CA 3CCSV 5DN6G 5LGNA 4MTOA 2IJIA 4MVUA 2A0LA 2EBOA 1E1RG 5FL7G 5EC2C 2B1IA 3I55V 1ROPA 5LHIA 2DYSC 5KUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STL C;  4LBE C;  2DYR C;  1LNQ A;  3AG2 C;  1OCR C;  4MW8 A;  4RO2 A;  5J9P C;  4MS2 A;  3FB5 C;  4CBC A;  2YEV A;  4R50 A;  4PA6 A;  3STZ C;  2ITD C;  4I9W A;  4QNH B;  3SPI A;  2JK5 C;  3EFF K;  3E83 A;  3K0D A;  3K03 A;  3K0G A;  4PA4 A;  1JVM A;  2R9R B;  4H37 A;  4MVQ A;  4XDK A;  3RVY A;  5B3S C;  2WLM A;  4P9O A;  2H8P C;  4MTG A;  4DXW A;  2Q68 A;  4P30 A;  2A79 B;  1R3J C;  2IH3 C;  3K04 A;  4H33 A;  1XL4 A;  4WFG A;  2WLI A;  2DWD C;  4BW5 A;  3AG3 C;  4GX2 A;  4MSW C;  2EIL C;  3RBZ A;  1G4Y B;  1V54 C;  2EIJ C;  3OR7 C;  3SYC A;  3SPJ A;  2X6A A;  2DWE C;  3F5W C;  4MW3 A;  3K08 A;  2W0F C;  2WLH A;  4X8A A;  3SPG A;  2NLJ C;  1M56 C;  3OUS A;  3ZRS A;  3F7V C;  2HFE C;  5CBH A;  2WLN A;  3LDE A;  5E1A C;  3ZJZ A;  1S5H C;  3BEH A;  3PJS K;  4EKW A;  3OUF A;  3KG2 A;  4JTC B;  4QE7 A;  5EC1 C;  3FB7 C;  2Q69 A;  3SPC A;  2WLI B;  3UM7 A;  5IY5 C;  2WLL B;  2AHZ A;  4P9P A;  4WFF A;  2ITC C;  1V55 C;  4RUE A;  1R3K C;  2WLL A;  3FB8 C;  4R6Z A;  4X88 A;  4PDR A;  3SYA A;  4J9Y B;  3SYP A;  2AHY A;  3K06 A;  4PDL A;  3T2M A;  2BOC C;  1ORQ C;  2EIK C;  2P7T C;  1OCO C;  4MTF A;  2KB1 A;  2WLJ A;  3E8F A;  4PA7 A;  3TCU A;  5KUK A;  3T1C A;  4MVO A;  1M57 C;  3T4Z A;  4GX5 A;  4WFH A;  3LUT B;  1R3I C;  3IFX A;  4OXS A;  4PDM A;  2X6B A;  4PDV A;  2HG5 C;  1XL6 A;  3GB7 C;  2BOB C;  3ABM C;  1OCZ C;  2ZXW C;  3R65 A;  5EBW C;  3SJQ C;  2Q6A A;  3FB6 C;  4GX1 A;  2EIN C;  2OCC C;  5B1A C;  2HJF C;  3LDD A;  4G27 B;  2Q67 A;  4PA9 A;  3JYC A;  3E8G A;  3E89 A;  4MVM A;  2WLK A;  4MVR A;  1J95 A;  3WG7 C;  4RUF A;  3ABK C;  4LCU C;  5CBG A;  4XDJ A;  1K4D C;  2QKS A;  1R3L C;  4HZ3 A;  4P2Z A;  5CBF A;  3IGA C;  5EK0 A;  3SYO A;  4JTD B;  3VOU A;  1OCC C;  4J9Z B;  2ZD9 A;  4F4L A;  3E8B A;  2QTO A;  4GX0 A;  4R7C A;  3E86 A;  3SPH A;  2IH1 C;  4RAI A;  3F7Y C;  4MVZ A;  4ZBM A;  4LP8 A;  5BZB A;  3OGC C;  4JTA B;  2EIM C;  2HVK C;  1QLE C;  1K4C C;  3RVZ A;  3SYQ A;  2X6C A;  2K1E A;  3ASO C;  4MVS A;  5EBM C;  3T4D A;  3TET A;  3E8H A;  3OR6 C;  1ZWI C;  2A9H A;  2Y69 C;  4PA3 A;  3LDC A;  4X89 A;  4XDL A;  4G28 B;  3ABL C;  1KKD A;  4TWK A;  3LNM B;  1BL8 A;  2HVJ C;  3HPL C;  5EBL C;  4MTO A;  4MVU A;  2A0L A;  4R8C A;  1P7B A;  3ASN C;  3RW0 A;  4UUJ C;  5B1B C;  4QE9 A;  5EC2 C;  3X2Q C;  3AG4 C;  2ATK C;  4WFE A;  3UKM A;  3AG1 C;  2DYS C;  5KUM A;  4KFM A;  4HYO A; 
#chains in the Genus database with same CATH topology
 1K34 A;  1NVP D;  5JH7 B;  2F4V O;  4QNH B;  3ZMU A;  5LXT A;  2KG7 A;  5BMV A;  5LGU A;  5B3S C;  4MTG A;  2Q9L A;  1RP3 B;  1GM9 A;  1S5J A;  4NKG B;  3K04 A;  3JSL A;  4DV6 O;  5KX5 B;  1H8H G;  1DTO A;  2YSU B;  3UCS C;  1FFX B;  1PL4 A;  2GV9 A;  4BWA A;  4Q6G A;  5CB4 A;  2UXN A;  1Q6H A;  3M7M X;  2KG7 B;  1S5H C;  4U7O A;  1R1B A;  4K8Z A;  3CMA V;  3FB7 C;  2Q69 A;  1AP6 A;  3SPC A;  2WLL B;  2Q7H A;  2IU3 A;  4RUE A;  1R3K C;  4NXN B;  3I5D A;  4JYC A;  5CB4 B;  4UFZ A;  4PDM A;  2ZE8 A;  5KHI A;  1GM8 A;  3FB6 C;  4GX1 A;  2EIN C;  2EIN B;  4UCU A;  4NXN O;  1FJG B;  1XBL A;  3S3W A;  4JI8 B;  3U10 A;  4XDJ A;  1K4D C;  4J7Z A;  4PI2 A;  4JTD B;  4LF4 B;  3L71 H;  1VQN V;  1K73 W;  3BY6 A;  3QF7 A;  5DED A;  2EZP A;  3B2E E;  3H9V A;  4UVA A;  2ARH A;  4TWK A;  3WU2 Z;  1FJG O;  1BL8 A;  4CS2 A;  1SZT A;  3A8T A;  1P84 F;  4JI8 O;  4X9Q A;  4JPR A;  2NR5 A;  4QE9 A;  1JJ2 U;  4LF4 O;  4E4E A;  4DR5 B;  1OCR C;  2QR4 A;  1OCR B;  3SGI A;  4TV9 B;  3ZCC A;  3CXC U;  4U3J A;  3K0G A;  1SQX H;  4H37 A;  3JAK A;  2WLM A;  3H1J H;  2WA4 A;  2A06 H;  3ZBH A;  1NR1 A;  2HJD A;  3K57 A;  2QGN A;  4LFA B;  4U3F H;  4DR5 O;  3KCY A;  2LGQ A;  2VWK A;  1Q6I A;  3HKB A;  2QWQ B;  1EBO A;  4FFB A;  3BEH A;  2CUG A;  1SQF A;  1EN5 A;  4E2L A;  4BIU A;  4LF7 B;  4LFA O;  1YEW A;  2XAG A;  2ZKO A;  3T1C A;  1UFI A;  2N74 A;  2R9I A;  2EIM B;  2JRI A;  1SQP H;  3WFV A;  2JIZ G;  1XL6 A;  3JAS B;  4LFC B;  3FKS G;  4PHZ A;  4LF7 O;  3CWB H;  3SJA C;  5K1P A;  1BHA A;  1JMK C;  3HR0 A;  4MVR A;  5IYZ A;  4LNU B;  5H2F Z;  4IHJ A;  3OAA G;  3NR7 A;  1NH2 D;  5KAF Z;  3CRR A;  5CA3 A;  2P67 A;  1W0K G;  2P6J A;  1KC8 W;  2D2C B;  4HBN A;  4X62 B;  3L72 H;  2M6Y A;  5IWA B;  3K5L A;  3A0B Z;  3TET A;  2KKW A;  3ZHS A;  3FYI B;  3HKD A;  3RYF B;  2LW7 A;  1MSW D;  4JYA B;  5GTI Z;  4IHJ B;  1F7Y A;  2QTS A;  3OMN B;  2ATK C;  3DSQ A;  3ZN0 A;  4DRX A;  1LNQ A;  4X62 O;  1VQ7 V;  1XOU A;  1GM7 A;  1W2B U;  2Q8V A;  2JDI G;  1VF6 A;  4IIJ A;  3I56 V;  1YI2 V;  4IGG A;  1K97 A;  2Q4P A;  3H1L H;  1R3J C;  4JYA O;  1PL0 A;  1XL4 A;  4MSW C;  1G4Y B;  2F95 B;  4CH3 A;  1AR4 A;  4DRX B;  1H2N A;  2HHH O;  2OWO A;  2NLJ C;  5CA0 B;  1CPY A;  1TAE A;  3L75 H;  3A0H Z;  4FLZ A;  4DUY B;  1IBM B;  4QE7 A;  4LC1 A;  5EC1 C;  1N8R W;  2DW4 A;  2YIB A;  1VQO V;  1NTZ H;  2Q0A A;  3AK1 A;  4P9P A;  5F2V O;  1ARO P;  3OTO O;  3U0Z A;  2ZIO A;  3ETE A;  4EFB A;  4GUN A;  1JFF B;  3IJ4 A;  5LHH A;  4MTF A;  4I0X A;  4GCZ A;  4B3M B;  1JPX A;  4GLX A;  4UV8 A;  4DUY O;  4PDV A;  4A5U B;  1THZ A;  1IBM O;  4AIL C;  1M4U A;  2FYU H;  4UV9 A;  3JSN A;  3RGB A;  1PNL A;  2OCC C;  3P3P A;  2OCC B;  1DGS A;  1FXH A;  4B7K A;  3CYO A;  4FMT A;  2DYS B;  4B3M O;  2XTA A;  5EIB C;  4QJF B;  3E8B A;  4LFB O;  4B08 A;  2FML A;  4RAI A;  4BIZ A;  1SQG A;  5EBM C;  3E8H A;  4PV1 B;  1BCC H;  3M99 B;  2JGU A;  3S3X A;  4IYI A;  3IC9 A;  4CH5 A;  3A0R A;  4R8C A;  5B1B C;  2A7W A;  1XQ8 A;  1XUQ A;  5B1B B;  1E1Q G;  1FXK C;  5L3G A;  3ZHV A;  4KFM A;  4IYH A;  1FXK B;  4HYO A;  4FZ1 A;  3H1K H;  1Z5W A;  2JJ2 G;  4B3S B;  1N34 B;  2RCV A;  1MOF A;  1GTO A;  1RSO B;  2HKO A;  2VQE B;  3STZ C;  2YIB D;  1MNG A;  3ICX A;  3JD4 A;  4K0K B;  4O4L B;  4P9O A;  2OIE A;  3SJC C;  1AP5 A;  4WCE V;  2V7Q G;  2UXD B;  5B5E Z;  1EZV H;  1SQB H;  3OR7 C;  1N34 O;  2VQE O;  2IJJ A;  1GN2 A;  1Q7Y W;  2F93 B;  2QM4 A;  5CBH A;  2WLN A;  3OT7 A;  4K0K O;  4X66 B;  5IJ9 A;  2UXD O;  2XND G;  1YVW A;  3SYA A;  1BMF G;  3FAV A;  3QO8 A;  2ADP A;  1RM1 C;  5LMN B;  2PUS A;  1RM1 B;  4NVP A;  2KSD A;  3TCU A;  1FS0 G;  2QWO B;  2Y4T A;  2PYL A;  4AQY B;  2JGD B;  4ZI7 A;  1VAR A;  1L0L H;  4X66 O;  3C3T A;  1Y76 A;  3VQV A;  2P06 A;  4Q20 A;  1J95 A;  2F43 G;  5LMN O;  1R3L C;  5L3D A;  3IGA C;  4WFA V;  4JAU A;  1S72 V;  1A32 A;  2R9A A;  5BZB A;  4X1Y B;  4AQY O;  5CA1 A;  1KBH A;  4L8J A;  2IJH A;  1R73 A;  5AG2 A;  3W7W A;  4YJ3 A;  2FTK A;  4PA3 A;  3MHS C;  5DN6 G;  4MTO A;  2IJI A;  2A0L A;  3CE2 A;  2CTW A;  5EC2 C;  2B1I A;  3Q4H A;  1ROP A;  5LHI A;  1BQ0 A;  1HR0 B;  1M9N A;  3KCX A;  3B4S A;  5CA1 B;  3D36 A;  4LWS A;  1H2G A;  4FLX A;  3JD2 A;  1XHZ A;  3O65 A;  3JAT B;  4YJ3 B;  5LL6 Y;  4DV3 O;  2W6J G;  4CH4 A;  3BA9 A;  1HR0 O;  1HNW B;  4D7S A;  2X6A A;  3D36 C;  1VQP V;  2A3Q A;  2H94 A;  2LW1 A;  1Q43 A;  4UCS A;  3RYC B;  4FM0 A;  1YCI A;  2XAQ A;  4EKW A;  1PKX A;  2QSA A;  1Q82 W;  4F6R A;  1QVG U;  4K8X A;  1HNW O;  1K33 A;  1VQK V;  4J9Y B;  4X20 A;  1KU9 A;  4YY3 B;  1ORQ C;  2KB1 A;  2ZNI A;  4OXS A;  1QNM A;  1YIJ V;  3BPZ A;  5EZY A;  1MSD A;  3G67 A;  1DF5 A;  1TA8 A;  2WPD G;  3ETD A;  1X59 A;  1ZLZ A;  4F6R B;  3P3N A;  4TV8 B;  4MVM A;  1DK1 A;  5C8Y A;  1D5N A;  3NXS A;  4YY3 O;  1GN4 A;  2DQ0 A;  3M8A A;  5IJ0 B;  4RWU A;  4FIP C;  4MTX A;  5EK0 A;  1I7F A;  1N33 B;  4J9Z B;  1TUE B;  3ZS8 C;  3O9O A;  3SPH A;  3F7Y C;  4MVZ A;  5EZY B;  1J5E B;  4X65 B;  2YDE A;  2XAF A;  2P22 C;  1IBK B;  2JEU A;  4UXN A;  3ABL C;  2MK3 A;  3ABL B;  5FPR A;  3CB2 A;  4KP4 A;  4DW0 A;  2PY5 A;  3ASN C;  1IUR A;  3ASN B;  1KP3 A;  3UKM A;  3AG1 C;  1N33 O;  3AG1 B;  4N21 A;  2EZO A;  4JV5 B;  3CCV V;  1J5E O;  4X65 O;  3VBB A;  2ITD C;  1W59 A;  5JH7 A;  3EFF K;  1QHT A;  2IM9 A;  3G6B A;  3JAR B;  4DXW A;  1L8D A;  2RQ6 A;  3SJB C;  1PV0 A;  4LF5 B;  4XBF A;  2YS8 A;  2AZ0 A;  1YJN V;  1KP2 A;  1JCH A;  2ILM A;  1X4T A;  4JV5 O;  1FFX A;  2WSS G;  1N36 B;  4ASU G;  4I9Q A;  2GUZ B;  2FL4 A;  3ZJZ A;  3MDS A;  4JGS A;  1VIB A;  1QR9 A;  4JTC B;  1RPO A;  3DC5 A;  4JI4 B;  3F5T A;  4GT1 A;  3JAW A;  3MD0 A;  4X1K A;  2PYJ A;  1SET A;  2WLL A;  1PNK A;  1NT2 B;  3T2M A;  2EIK C;  1KQS U;  3W7S A;  2WLJ A;  2EIK B;  1S76 D;  4MVO A;  1N36 O;  1GMG A;  1US6 A;  2JEX A;  4JYY A;  3BCC H;  1WPX A;  1K92 A;  2GTS A;  2K9P A;  1VQ8 V;  4JI4 O;  5A9G A;  1SER A;  1BSM A;  2HJF C;  2YXH A;  3JAW B;  4X1K B;  2X0L A;  2O57 A;  1NQT A;  1XNQ B;  1KKC A;  2CGN A;  4P2Z A;  1N0N A;  3BVO A;  2RNB A;  1RFY A;  2DYR B;  3AG2 B;  2ZD9 A;  4F4L A;  3G71 V;  3FD9 A;  4I4T B;  5JVD B;  2CTP A;  3E2E A;  5J2T A;  3OR6 C;  3BAB A;  2ZE5 A;  1WN7 A;  1AR5 A;  2F1M A;  2P90 A;  1XNQ O;  3RW0 A;  3KKY A;  1VF5 B;  4YIO A;  1PPJ H;  4ZIB A;  2HR3 A;  2OTL V;  4PA6 A;  1YDX A;  2JK5 C;  5J2T B;  3HKC A;  4TV9 A;  1EFR G;  2JS5 A;  4DR2 B;  4JZG A;  2QKA A;  2LFR A;  1EN6 A;  1VQ5 V;  3AG3 C;  3AG3 B;  1SF9 A;  2Q7G A;  1K3E A;  1GN6 A;  2EIJ C;  3CCU V;  3G80 A;  3OE7 G;  2EIJ B;  3N2K B;  1GRJ A;  4JI6 B;  3CSX A;  4HNA A;  3OUS A;  2YXL A;  4C7U A;  5E1A C;  3HKC B;  2MW2 B;  5D5Q A;  1G8M A;  4DR2 O;  3ABU A;  4PEL A;  2WWW A;  1Q6U A;  5HFM A;  1MA1 A;  2F23 A;  4PDR A;  2ZIM A;  3UO2 A;  5IE9 A;  4JI6 O;  4JZ2 A;  4HNA B;  2LJ2 A;  2BCC H;  3JAL B;  1QCE A;  4I5S A;  1FXV A;  5JWP A;  1NU1 H;  4FPP A;  3JAS A;  3LDD A;  1TUB B;  2QKS A;  1VQ6 V;  4CC6 A;  4LNU A;  1WAZ A;  1QBZ A;  3E86 A;  2EIM C;  2Y0P A;  2OCH A;  1WP8 A;  1K7D A;  3K9A A;  2Z0A A;  4TOI A;  2A9H A;  2XAH A;  1KKD A;  3D3I A;  2PGG A;  3HPL C;  5EBL C;  3RYF A;  1P7B A;  4UUJ C;  4EB6 B;  1DF4 A;  4NTX A;  5IT9 N;  4MW8 A;  1M56 B;  1HNX B;  3SPI A;  2YI8 A;  5GTH Z;  4LFC O;  4CC5 A;  2QEX V;  4XDK A;  2DJV A;  5LHG A;  1O9G A;  4O2A A;  2YI9 A;  2E5L B;  2R70 A;  3KZI Z;  4DUZ B;  4WBN B;  3RN4 A;  3ZHR A;  4GX2 A;  4O2B B;  1YZB A;  2LP7 A;  1ENV A;  3CJH B;  4FZ0 A;  4MW3 A;  2WLH A;  4H13 B;  1HNX O;  3CCQ V;  3ZX6 A;  3D3Q A;  3ZRS A;  1YJW V;  3OTF A;  1WP7 A;  4DYL A;  3IAY A;  1K9M W;  1EM1 A;  5CA0 A;  5IWA O;  2YIA A;  3OEE G;  3APQ A;  1H2S B;  1HP8 A;  4X64 B;  4O2A B;  2E5L O;  1JA8 A;  1KB9 F;  2E76 B;  4DUZ O;  1B04 A;  1ZL8 B;  2F66 C;  1YF2 A;  3FX7 A;  2P4V A;  3ABT A;  2E74 B;  1CP9 A;  3SDL A;  3RYI A;  3B8N A;  2ZE6 A;  4YXW G;  1JFF A;  3LSQ A;  3CME V;  2HG5 C;  1Y66 A;  4X64 O;  1H2M A;  1JOY A;  1MZF A;  2DQ3 A;  4RQE A;  2EX3 A;  3JD3 A;  1AJP A;  3ZIA G;  3JAM N;  4D6T H;  4DV5 B;  1R6N A;  5H6Q A;  4JI1 B;  5CBG A;  3RYI B;  4OX9 B;  4RQF A;  2ZT9 B;  2QTO A;  2ZE7 A;  3VQW A;  3TK1 A;  3T4D A;  3ETQ A;  4TUY A;  1CEZ A;  3J7A U;  3BFR A;  1I08 A;  4QIW F;  2RDC A;  4G28 B;  4DV5 O;  4MVU A;  4JI1 O;  3RWR D;  5GON A;  3I55 V;  5LYJ B;  4OX9 O;  2DYS C;  1M5I A;  5KUM A;  3AG7 A;  1FXK A;  4NTW A;  4CZZ A;  1RSO A;  2CE4 A;  4TUY B;  1O9H A;  4PA4 A;  2V1D A;  4DV1 B;  4LF6 B;  4BR6 A;  4DK1 A;  2H8P C;  1B6Q A;  3P32 A;  4O4L A;  1P49 A;  3DC6 A;  2DWD C;  5GON B;  4O4I B;  2AXT Z;  1VQL V;  1F4N A;  1F23 A;  1D2D A;  2ZNJ A;  3QTC A;  1MAB G;  1IXB A;  4OPH A;  1P4R A;  3F7V C;  5H6R A;  3PN1 A;  4TQF A;  1VQM V;  1Z5V A;  1MMM A;  2Y4U A;  4DV1 O;  4LF6 O;  4Z1M G;  4JI3 B;  4UCO A;  5TIS Z;  2FKX A;  3OGI B;  3HB3 B;  3BA8 A;  2AHZ A;  3JCU Z;  1YTF D;  3ZHU A;  2QM8 A;  1S3J A;  2FB5 A;  4UCV A;  2ZR3 A;  5JQG A;  1WPB A;  4B3S O;  4YIP A;  3T4Z A;  2Q0O C;  4WFH A;  2DE0 X;  3IFX A;  2PZS A;  4FLV A;  2LQT A;  2BOB C;  3L73 H;  4JI3 O;  2OYQ A;  2JGD A;  4IL6 Z;  3C90 A;  3DGE A;  5JJE B;  3JYC A;  3E8G A;  2ODM A;  3E89 A;  3GWK C;  3CCL V;  1SQV H;  1IZ3 A;  2UUB B;  4EFE A;  5JQG B;  4DR7 B;  1F4M A;  4TSF G;  4X1Y A;  4H0L B;  3LSU A;  2XT9 A;  3D8C A;  1M93 A;  1ZWI C;  5IYB O;  3MHH C;  5FLX N;  4OGQ B;  5FNV B;  5KAI Z;  1N0J A;  2UUB O;  1XIL A;  4QPK A;  3CRC A;  1NS1 A;  1KMI Z;  5L3B A;  4DR7 O;  1PD3 A;  2R72 A;  1NTM H;  1AB3 A;  1LUW A;  1N4C A;  1SES A;  2IBZ H;  1EZJ A;  3E83 A;  1JVM A;  3J81 N;  3JAT A;  2A79 B;  2IH3 C;  2B1G A;  4X1I B;  4ABM A;  2WLI A;  2BTQ A;  2YC0 A;  3E22 B;  2HP8 A;  4AHC A;  2GTA A;  3CP1 A;  3WB2 A;  5L3F A;  3UT5 B;  3K3W A;  4H44 B;  3PJS K;  3RYC A;  3RT3 C;  1V9P A;  4DV0 B;  2WLI B;  2BTQ B;  5LGT A;  2QE7 G;  1FAF A;  3T1H B;  1PP9 H;  1ZUQ A;  2BOC C;  5IYD O;  2QDO A;  3N27 A;  3E8F A;  4UCR A;  4DR4 B;  4GX5 A;  4G2K A;  3K79 A;  3CEI A;  1Y4M A;  3CCE V;  3H01 A;  5EBW C;  3ZRV A;  4BIO A;  2LFS A;  4DR6 B;  1WB8 A;  5ITZ A;  2PI5 A;  1SKV A;  2XHB A;  4I50 B;  3T1H O;  2ADQ B;  4TV8 A;  3U11 A;  3IC7 A;  1H2K A;  4DR4 O;  4PD4 F;  3CRM A;  3ML0 A;  5IJ0 A;  1N32 B;  3MAQ A;  2IH1 C;  3QO7 A;  1S0V A;  1OHH G;  5DEC A;  3K5M A;  1AI4 A;  1Y74 A;  4DR6 O;  2Y69 C;  4XDL A;  4BW9 A;  5ITZ B;  4ZOL A;  2Y69 B;  4LF9 B;  3GWO A;  1GN3 A;  1LR1 A;  4JI2 B;  1FD9 A;  4WFE A;  1NKD A;  3SYC A;  2UXB B;  3K59 A;  1N32 O;  4RO2 A;  3FFQ A;  1XI1 A;  5J2U B;  1BHB A;  4O4H B;  1R6K A;  1Y74 B;  2R9R B;  1AI6 A;  4ZOL B;  4LF9 O;  2Q68 A;  3B40 A;  3B8M A;  1XRE A;  4LH6 A;  3JAR A;  5A2Q N;  3T1Y B;  4JI2 O;  3K5N A;  2QM7 A;  4CS3 A;  1R6T A;  2UXB O;  2Q7E A;  3SPJ A;  4FM2 A;  1SC5 B;  1QVF U;  2JS3 A;  1WNS A;  4FLW A;  1IX9 A;  5L3E A;  1NVP B;  4I7Z B;  2P5O A;  1FKA O;  2GUZ A;  1IBK O;  3BRC A;  4DW1 A;  1Q5O A;  4I55 B;  4U7N A;  2AGA A;  2Y48 A;  3K06 A;  4J7K A;  2UUC B;  3W7U A;  4PA7 A;  4D7T A;  3LUT B;  4J80 A;  1NTK H;  1XNR B;  3J80 N;  3GB7 C;  2L35 A;  1QQC A;  4PI0 A;  3VQX A;  4IT5 A;  1NZ6 A;  2JJ1 G;  1Q3E A;  4G27 B;  4TQD A;  4LF5 O;  4KHP B;  1K8A W;  1JJO A;  4NTY A;  5LA6 B;  4FVM A;  2UUC O;  3N2G A;  5B66 Z;  2UXX A;  3RYH A;  1ZSP A;  5CBF A;  2G38 A;  3K9S A;  4DR1 B;  1Q86 W;  1OV9 A;  4J7J A;  4JI5 B;  2IW5 A;  1YIT V;  4OPA A;  3OGC C;  4FLU A;  1XNR O;  1VQ9 V;  2NNU A;  2PF4 E;  4I4T A;  1FYJ A;  5JVD A;  1L1F A;  5B3S B;  4FLY A;  4FK5 C;  5FPO A;  5E79 Z;  2CDY A;  3LNM B;  4KHP O;  3DXR B;  1VP7 A;  4CS4 A;  3N2G B;  1S77 D;  3RYH B;  3CC2 V;  4DR1 O;  5KHH A;  4JI5 O;  1HWY A;  2DYR C;  3AG2 C;  3P30 A;  4CBC A;  2RJZ A;  5LXT B;  1Q81 W;  1IVS A;  5BR8 B;  5BMV B;  4FM1 A;  2UUA B;  1WLE A;  1EN4 A;  5LBQ A;  4UVB A;  2H3O A;  2VS0 A;  2C2A A;  4ICG A;  4GKK B;  4ZKI A;  4WFG A;  5JCO A;  2ETN A;  1L0N H;  3G6E V;  1TGO A;  2EUL A;  2B5U A;  3ZHQ A;  5KLV H;  2DN9 A;  1IXM A;  4KUM A;  4X8A A;  3N2K A;  4J41 A;  3RFR A;  5BR8 O;  2UUA O;  3ZN1 A;  2JVD A;  1PM9 A;  5B1O A;  5KHJ A;  1KUQ A;  5JCO C;  4GKK O;  1S5L Z;  5IY5 C;  4YHH B;  4WFF A;  5IY5 B;  4X88 A;  4J42 A;  3CCR V;  3CCM V;  4DO2 A;  1H38 A;  5C93 A;  3JAL A;  2QJ1 A;  1W0J G;  2NN4 A;  4YHH O;  2Q67 A;  2XAJ A;  2WAM A;  3ZRX A;  3WG7 C;  4AI8 A;  2QA4 V;  4LCU C;  4W4K A;  1URF A;  1MG1 A;  3WG7 B;  3B77 A;  1TUB A;  2Q5Z A;  4NB5 A;  4EEQ A;  1OCC C;  3CCJ V;  1OCC B;  2X7R B;  3ZMT A;  5BXZ A;  2E3C A;  2XOK G;  3ASO C;  2K1E A;  5JJN B;  4TT3 G;  3ASO B;  1NBM G;  4F6E A;  5H9C A;  1BS3 A;  2EBO A;  2AZ2 A;  4EB6 A;  4LBE C;  1NH2 B;  2YEV A;  4WFB V;  3CC4 V;  4I9W A;  4U3J B;  1OZ0 A;  3JAK B;  3CXH F;  1SA0 A;  4P30 A;  3W7T A;  5L3C A;  4JAA A;  3LNN A;  3VQY A;  2RMK B;  4JI7 B;  4WBN A;  3C3S A;  1VQ4 V;  1F51 A;  5LMU B;  4O2B A;  3F5W C;  3K08 A;  5CN0 A;  1OJH A;  1YSC A;  2YEV B;  3CJH A;  3HKB B;  1M56 C;  1QU7 A;  1I0H A;  2BTO A;  4FFB B;  3UQ8 A;  1NJI W;  1SA0 B;  2BE3 A;  1QLN A;  2VQF B;  5JJJ B;  2DMX A;  1H2L A;  4JI7 O;  4Z1V A;  1ZL8 A;  2ITC C;  3EVK A;  3FB8 C;  1NI8 A;  1VF7 A;  5IYC O;  1BT8 A;  1G6U A;  5LMU O;  1Z2G A;  1U97 A;  3CX5 F;  1UPG A;  2YUA A;  1K5Q A;  1COW G;  1M90 W;  3ABM C;  2VQF O;  3ABM B;  1BGY H;  2GHY A;  2BSK A;  3L74 H;  4PA9 A;  5IYZ B;  3CD6 V;  3B09 A;  4JYB A;  4GKJ B;  3AEI A;  2ZQM A;  4N23 A;  2HHH B;  4B3R B;  4R7C A;  2GSM B;  4JAS A;  4DV2 B;  4UCT A;  2XAS A;  5KA6 A;  1QLE C;  4O4J A;  3HKD B;  1QLE B;  4JF3 A;  1SRY A;  2BSK B;  2HVJ C;  5DM6 V;  4GKJ O;  1GKF A;  3OTO B;  2KQX A;  2QWP B;  3R66 A;  4MVS A;  1FPO A;  4B3R O;  5CMU A;  3CS5 A;  5LYJ A;  2PTM A;  3HKE A;  1I5Y A;  4DV2 O;  4MS2 A;  1VF6 C;  4O4J B;  4IIJ B;  4K3A A;  5D5P A;  1AIL A;  4MVQ A;  1B3Q A;  2VWJ A;  4DV7 B;  2CGO A;  4BW5 A;  2EIL C;  3RBZ A;  5KMG A;  2OT5 A;  2EIL B;  4CH6 A;  4FFK A;  4O4I A;  3HKE B;  3WB0 A;  4LFB B;  4UB8 Z;  1AI5 A;  3AK3 A;  2PI4 A;  5LP6 A;  5H5N A;  1AI7 A;  2Y0I A;  1D5A A;  2Z3Y A;  3KG2 A;  4DV7 O;  4PJ0 Z;  4LH7 A;  1TVK A;  5KMG B;  2GDS A;  1V55 C;  3JD1 A;  3ZHT A;  1V55 B;  1YTF B;  4I0X B;  1AJQ A;  1Y67 A;  2L6L A;  5KA5 A;  1KD1 W;  5LP6 C;  1R3I C;  5LP6 B;  3TXQ A;  3DTU B;  2UU9 B;  1OCZ C;  4YJ2 A;  3R65 A;  1JX9 A;  1OCZ B;  1G1X B;  1XMQ B;  5B1A C;  1VMG A;  5B1A B;  1TVK B;  1NR7 A;  4FLT A;  3QG5 A;  1BQZ A;  3A2F A;  2QWN B;  3ABK C;  3JCZ A;  2CK3 G;  3ABK B;  2CTQ A;  4HZ3 A;  2AW9 A;  5EIB D;  3SYO A;  4JAV A;  4LF8 B;  3THO A;  1XHX A;  4GX0 A;  4KL1 A;  3GVM A;  4ZBM A;  4LP8 A;  3QVN A;  2UU9 O;  1Q90 D;  4DK0 A;  4YJ2 B;  2Q73 A;  1XDC A;  3EHB B;  2CTR A;  1H8E G;  1XMQ O;  2ZR2 A;  4L87 A;  4B7E A;  1RPR A;  2GBO A;  3G4S V;  4DV4 B;  2CH7 A;  3AG4 C;  5FNV A;  3AG4 B;  1ZTE A;  4J10 A;  4LF8 O;  5K1X A;  3STL C;  2YID A;  3BAA A;  3OEH G;  3FB5 C;  1GK9 A;  4UB6 Z;  1PNM A;  2ZCE A;  3QNE A;  4B3T B;  3ETG A;  3K0D A;  3K03 A;  3AK2 A;  3ZMV A;  3K58 A;  1GAX A;  4Z2W A;  2P4K A;  2D3O W;  4H33 A;  4DV4 O;  2CH7 B;  1WA8 A;  4HAM A;  4X1I A;  2IJK A;  4UVC A;  1V54 C;  1QR8 A;  1V54 B;  3APO A;  3E22 A;  1SZX A;  5EYP A;  2DWE C;  2W0F C;  2XUM A;  3SPG A;  3WB1 A;  2LGW A;  4B3T O;  1YXB A;  2IU0 A;  3L9D A;  2QWR B;  3UT5 A;  2W6I G;  3OUF A;  1M1K W;  1XEQ A;  4NYK A;  5IJ9 B;  2V4D A;  1ZAU A;  2B9Z A;  1WA8 B;  3FAV B;  1T5E A;  1K5S A;  2ZIN A;  4R6Z A;  2AHY A;  5EYP B;  1OCO C;  4ZHQ A;  1OCO B;  1M57 C;  1E79 G;  1IDS A;  1KYO F;  1M57 B;  4ZI7 B;  1DLB A;  2X6B A;  3ZMZ A;  5IDJ A;  1JR9 A;  1KEC A;  3E35 A;  4FJC C;  2HEP A;  3SJQ C;  4NR1 A;  3OMA B;  1Y76 B;  1AR1 B;  4LR3 A;  2WA3 A;  2E75 B;  1MZE A;  3CRQ A;  4DV3 B;  1U96 A;  2WLK A;  3L70 H;  1HNZ B;  2QKC A;  4RUF A;  4I50 A;  4ZHQ B;  3BHP A;  1WJZ A;  5BY1 A;  3VOU A;  3LSS A;  1YHQ V;  1K4C C;  3SYQ A;  3SR2 C;  2X6C A;  3UO3 A;  2ZM6 B;  3QO5 A;  5LOV A;  1YJ9 V;  1I94 B;  1BZK A;  4DV0 O;  3H1I H;  3LDC A;  3CC7 V;  4GYC B;  1HNZ O;  3JD0 A;  3ZED A;  4NXM B;  3Q4H B;  1GO3 F;  3X2Q C;  2OIG A;  3X2Q B;  4JI0 B;  1XMO B;  1HDJ A;  4LWS B;  2Z5U A;  5J9P C;  3CPW U;  3OM3 B;  4R50 A;  1SS3 A;  5J2U A;  2ZM6 O;  2N04 A;  4QPJ A;  5LOV B;  3OD4 A;  1I94 O;  1ZX3 A;  4O4H A;  3RVY A;  3OW2 U;  4KXR A;  4NXM O;  4BAY A;  1IBL B;  4QGP A;  5B1N A;  4WF9 V;  1AVM A;  2M7W A;  2CAZ C;  4JI0 O;  2RN9 A;  1GH6 A;  1I5X A;  1XMO O;  1FFT B;  2EJR A;  1LUV A;  5HFL A;  2ZDI A;  5KHK A;  3ZRW A;  3TJT A;  1B06 A;  5GW7 A;  3OMI B;  1AJN A;  2HFE C;  4GZR B;  3LDE A;  1SQQ H;  3ZMS A;  2VRZ A;  1JQ0 A;  3UM7 A;  1IBL O;  3K5O A;  4X20 B;  4K35 A;  3TGU H;  1VEW A;  2YIC A;  3SYP A;  4I55 A;  2ZDI C;  4PDL A;  2P7T C;  5KUK A;  2N05 A;  3ZRW B;  3W7X A;  1P7G A;  1CXZ B;  3FYE B;  1UJW B;  3TXS A;  4W4L A;  3OFN G;  2ZXW C;  3H1H H;  2Q6A A;  3EXA A;  2ZXW B;  2LO1 A;  2UXC B;  5C8Y B;  3T1Y O;  2HLD G;  1Q8I A;  5LA6 A;  1Y6X A;  4DR3 B;  4MT8 A;  5KHG A;  1WB7 A;  4JTA B;  4J11 A;  2F4V B;  1BE3 H;  2EJ7 A;  2HVK C;  3RVZ A;  2DOS A;  2UXC O;  4X89 A;  2OTJ V;  3CCS V;  2W0X A;  3CRA A;  5LGN A;  1E1R G;  5FL7 G;  4DV6 B;  3DXR A;  5KX5 A;  3CHX A;  2YXY A;  4DR3 O;  1HW7 A; 
#chains in the Genus database with same CATH homology
 1M9N A;  1K34 A;  4LBE C;  1NVP D;  1FXK A;  1NH2 B;  3D36 A;  1H2G A;  2YEV A;  4CZZ A;  4WFB V;  4QNH B;  4I9W A;  3CC4 V;  1OZ0 A;  3ZMU A;  3JD2 A;  4PA4 A;  2V1D A;  5LGU A;  5B3S C;  2H8P C;  4MTG A;  4P30 A;  3W7T A;  1B6Q A;  3P32 A;  1GM9 A;  5L3C A;  3K04 A;  2W6J G;  2DWD C;  1VQ4 V;  1H8H G;  1VQL V;  1F51 A;  1DTO A;  2YSU B;  1F4N A;  2X6A A;  1F23 A;  3F5W C;  3K08 A;  1VQP V;  5CN0 A;  1MAB G;  1YSC A;  2YEV B;  1M56 C;  2UXN A;  1P4R A;  3F7V C;  2H94 A;  5H6R A;  1VQM V;  1S5H C;  4U7O A;  2XAQ A;  4Z1M G;  4EKW A;  1PKX A;  3CMA V;  1NJI W;  1QLN A;  3FB7 C;  3HB3 B;  2Q69 A;  1Q82 W;  3SPC A;  2WLL B;  2AHZ A;  2IU3 A;  2ITC C;  1YTF D;  1QVG U;  4RUE A;  1R3K C;  3FB8 C;  1K33 A;  1VQK V;  5IYC O;  4J9Y B;  4JYC A;  2QM8 A;  1S3J A;  1ORQ C;  2ZR3 A;  2KB1 A;  3T4Z A;  4WFH A;  3IFX A;  4OXS A;  4PDM A;  1K5Q A;  1COW G;  1YIJ V;  1M90 W;  2BOB C;  3ABM C;  1DF5 A;  1GM8 A;  3ABM B;  2GHY A;  2WPD G;  3ETD A;  2EIN C;  3DGE A;  3FB6 C;  4GX1 A;  2EIN B;  4PA9 A;  3JYC A;  3E8G A;  3E89 A;  4MVM A;  3CD6 V;  3CCL V;  4JYB A;  3NXS A;  4XDJ A;  3AEI A;  1K4D C;  2DQ0 A;  4FIP C;  2ZQM A;  4MTX A;  4N23 A;  5EK0 A;  4JTD B;  4J9Z B;  1TUE B;  4R7C A;  2GSM B;  3SPH A;  4JAS A;  3F7Y C;  4MVZ A;  1F4M A;  1K73 W;  1VQN V;  3BY6 A;  4TSF G;  2XAS A;  5KA6 A;  1QLE C;  2XAF A;  1QLE B;  2EZP A;  1ZWI C;  2JEU A;  4JF3 A;  1SRY A;  5IYB O;  4UXN A;  4UVA A;  3ABL C;  2MK3 A;  4TWK A;  1BL8 A;  2HVJ C;  3ABL B;  3MHH C;  5DM6 V;  1SZT A;  4KP4 A;  3ASN C;  1GKF A;  3ASN B;  1KP3 A;  4JPR A;  4QE9 A;  4QPK A;  3UKM A;  3AG1 C;  4MVS A;  3AG1 B;  5L3B A;  1JJ2 U;  5CMU A;  1PD3 A;  4N21 A;  1I5Y A;  1OCR C;  2EZO A;  3CCV V;  4MS2 A;  1OCR B;  1SES A;  3VBB A;  2ITD C;  1EZJ A;  3EFF K;  3E83 A;  3ZCC A;  3CXC U;  3K0G A;  1JVM A;  4H37 A;  4MVQ A;  2WLM A;  4DXW A;  2A79 B;  2IH3 C;  2B1G A;  1NR1 A;  2WLI A;  4BW5 A;  4XBF A;  2EIL C;  3RBZ A;  2OT5 A;  1YJN V;  2EIL B;  3CP1 A;  1KP2 A;  1JCH A;  2WSS G;  5L3F A;  1AI5 A;  4ASU G;  2PI4 A;  3K3W A;  1AI7 A;  3ZJZ A;  1EBO A;  4JGS A;  3BEH A;  3PJS K;  2Z3Y A;  1QR9 A;  3KG2 A;  1RPO A;  4JTC B;  4E2L A;  2WLI B;  4GT1 A;  4BIU A;  5LGT A;  3MD0 A;  2QE7 G;  1V55 C;  3JD1 A;  1SET A;  2WLL A;  1PNK A;  1V55 B;  1YTF B;  1AJQ A;  3T2M A;  2BOC C;  2EIK C;  5IYD O;  3W7S A;  1KQS U;  2WLJ A;  2XAG A;  2EIK B;  3E8F A;  3T1C A;  5KA5 A;  1S76 D;  4MVO A;  1KD1 W;  1GMG A;  4GX5 A;  2JEX A;  1R3I C;  4G2K A;  3K79 A;  2R9I A;  2EIM B;  3DTU B;  3WFV A;  2JIZ G;  1XL6 A;  1Y4M A;  3CCE V;  1WPX A;  1OCZ C;  1K92 A;  3H01 A;  3R65 A;  5EBW C;  1VQ8 V;  1JX9 A;  1OCZ B;  3ZRV A;  1SER A;  5B1A C;  3FKS G;  2HJF C;  2LFS A;  5B1A B;  1NR7 A;  2X0L A;  2PI5 A;  1BHA A;  4MVR A;  1NQT A;  3ABK C;  3JCZ A;  2CK3 G;  3IC7 A;  3ABK B;  3OAA G;  4HZ3 A;  4P2Z A;  1NH2 D;  3SYO A;  4JAV A;  5CA3 A;  3AG2 B;  2DYR B;  2P67 A;  2ZD9 A;  3ML0 A;  4GX0 A;  4F4L A;  1W0K G;  2IH1 C;  2P6J A;  3QO7 A;  4ZBM A;  3G71 V;  4LP8 A;  1KC8 W;  1S0V A;  1OHH G;  3E2E A;  3TET A;  3EHB B;  1AI4 A;  1H8E G;  3FYI B;  2ZR2 A;  3OR6 C;  2Y69 C;  4XDL A;  2Y69 B;  1MSW D;  4L87 A;  3GWO A;  1RPR A;  2P90 A;  3G4S V;  3OMN B;  3RW0 A;  3AG4 C;  2ATK C;  4WFE A;  1NKD A;  3AG4 B;  3SYC A;  3ZN0 A;  3STL C;  1LNQ A;  4RO2 A;  3OEH G;  2HR3 A;  3FB5 C;  1GK9 A;  2OTL V;  1VQ7 V;  1PNM A;  4PA6 A;  3QNE A;  1GM7 A;  1W2B U;  2JK5 C;  1BHB A;  3ETG A;  2JDI G;  1R6K A;  3K0D A;  3K03 A;  3I56 V;  1EFR G;  3ZMV A;  2R9R B;  1YI2 V;  1AI6 A;  2LFR A;  1K97 A;  2Q68 A;  2D3O W;  3B8M A;  1VQ5 V;  1R3J C;  1PL0 A;  4H33 A;  1XL4 A;  2QM7 A;  3AG3 C;  4HAM A;  4MSW C;  3AG3 B;  1G4Y B;  2IJK A;  1K3E A;  4UVC A;  1V54 C;  2EIJ C;  3CCU V;  1QR8 A;  3OE7 G;  3SPJ A;  1V54 B;  2EIJ B;  1QVF U;  2DWE C;  2W0F C;  3SPG A;  2NLJ C;  3OUS A;  1CPY A;  5L3E A;  1NVP B;  2IU0 A;  5E1A C;  1G8M A;  2W6I G;  3OUF A;  3ABU A;  1M1K W;  4PEL A;  4LC1 A;  4QE7 A;  2WWW A;  5EC1 C;  1N8R W;  2DW4 A;  1VQO V;  5HFM A;  4P9P A;  1ARO P;  1K5S A;  4R6Z A;  4U7N A;  4PDR A;  3ETE A;  2Y48 A;  2AHY A;  3K06 A;  3W7U A;  5LHH A;  1OCO C;  4MTF A;  4PA7 A;  1OCO B;  4GCZ A;  1JPX A;  1M57 C;  1E79 G;  3LUT B;  4UV8 A;  1M57 B;  1QCE A;  1DLB A;  2X6B A;  3ZMZ A;  5IDJ A;  1KEC A;  4I5S A;  3E35 A;  1FXV A;  4PDV A;  1THZ A;  4FJC C;  3GB7 C;  3SJQ C;  4FPP A;  3OMA B;  4UV9 A;  1PNL A;  2OCC C;  1AR1 B;  2OCC B;  3LDD A;  2JJ1 G;  1FXH A;  4G27 B;  3CYO A;  2WLK A;  1K8A W;  4RUF A;  2QKS A;  2UXX A;  4FMT A;  1VQ6 V;  2DYS B;  5CBF A;  1Q86 W;  1QBZ A;  3VOU A;  4QJF B;  3E8B A;  2IW5 A;  3E86 A;  3LSS A;  1YIT V;  4RAI A;  4BIZ A;  3OGC C;  2EIM C;  1YHQ V;  1VQ9 V;  2NNU A;  1K4C C;  3SYQ A;  2X6C A;  5EBM C;  3QO5 A;  1L1F A;  3E8H A;  5B3S B;  1YJ9 V;  1K7D A;  3K9A A;  2A9H A;  2XAH A;  3LDC A;  3M99 B;  3D3I A;  4FK5 C;  3CC7 V;  1KKD A;  3LNM B;  3JD0 A;  3HPL C;  5EBL C;  3A0R A;  1P7B A;  4R8C A;  4UUJ C;  5B1B C;  1GO3 F;  1S77 D;  3X2Q C;  1DF4 A;  5B1B B;  1E1Q G;  1FXK C;  5L3G A;  3X2Q B;  3CC2 V;  4KFM A;  1FXK B;  4HYO A;  1HWY A;  2DYR C;  2JJ2 G;  3AG2 C;  3P30 A;  2Z5U A;  4MW8 A;  5J9P C;  3CPW U;  4CBC A;  1M56 B;  1GTO A;  1MOF A;  2HKO A;  3OM3 B;  4R50 A;  3STZ C;  1Q81 W;  3SPI A;  1WLE A;  4QPJ A;  2QEX V;  4XDK A;  3JD4 A;  5LBQ A;  4UVB A;  3RVY A;  5LHG A;  4P9O A;  2C2A A;  3OW2 U;  4ZKI A;  4WFG A;  4BAY A;  4GX2 A;  5B1N A;  4WF9 V;  4WCE V;  2M7W A;  2V7Q G;  2LP7 A;  3G6E V;  3OR7 C;  1I5X A;  1FFT B;  1ENV A;  2B5U A;  2EJR A;  4KUM A;  1IXM A;  4MW3 A;  2WLH A;  2ZDI A;  4X8A A;  5HFL A;  3ZRW A;  3CCQ V;  2IJJ A;  3ZRS A;  1YJW V;  5GW7 A;  1Q7Y W;  3ZN1 A;  3OMI B;  1AJN A;  2HFE C;  5CBH A;  2WLN A;  3LDE A;  1K9M W;  3OEE G;  5B1O A;  3ZMS A;  1JQ0 A;  3UM7 A;  5IY5 C;  4WFF A;  5IY5 B;  4X88 A;  3ABT A;  2XND G;  1CP9 A;  3SYA A;  1BMF G;  3CCR V;  3CCM V;  3SYP A;  3QO8 A;  4DO2 A;  2ZDI C;  4PDL A;  1H38 A;  1RM1 C;  2P7T C;  3B8N A;  5KUK A;  1RM1 B;  3ZRW B;  3TCU A;  4YXW G;  3LSQ A;  1FS0 G;  3W7X A;  3FYE B;  1UJW B;  5C93 A;  3CME V;  2HG5 C;  1Y66 A;  3OFN G;  1JOY A;  1W0J G;  2DQ3 A;  4RQE A;  2ZXW C;  2Q6A A;  2ZXW B;  3JD3 A;  1AJP A;  3ZIA G;  2Q67 A;  2XAJ A;  2WAM A;  3ZRX A;  4Q20 A;  1R6N A;  1J95 A;  5H6Q A;  3WG7 C;  2QA4 V;  2HLD G;  4LCU C;  2F43 G;  5CBG A;  1MG1 A;  3WG7 B;  3B77 A;  1R3L C;  5L3D A;  3IGA C;  4WFA V;  4JAU A;  4RQF A;  1OCC C;  3CCJ V;  1S72 V;  2QTO A;  4MT8 A;  1OCC B;  2X7R B;  5BZB A;  3ZMT A;  4JTA B;  2XOK G;  3TK1 A;  2HVK C;  3RVZ A;  2IJH A;  3ASO C;  2K1E A;  4TT3 G;  3T4D A;  3ASO B;  1NBM G;  1R73 A;  1CEZ A;  3W7W A;  4QIW F;  2FTK A;  4PA3 A;  4X89 A;  2OTJ V;  4G28 B;  3MHS C;  5H9C A;  3CCS V;  5DN6 G;  5LGN A;  4MTO A;  2IJI A;  4MVU A;  2A0L A;  2EBO A;  1E1R G;  5FL7 G;  5EC2 C;  2B1I A;  3I55 V;  1ROP A;  5LHI A;  2DYS C;  5KUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...