4DV4O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv4O00
5LMUO 1FJGO 1IBMO 4OX9O 4YY3O 4YHHO 2VQEO 1HNZO 1A32A 2F4VO 4DV1O 1AILA 4LFAO 3T1HO 4JYAO 2DJVA 5BY1A 2N74A 4DV5O 4DV4O 4DR1O 4DR7O 2UXCO 1XNQO 4NXNO 3O65A 1FYJA 4AQYO 1XEQA 4K0KO 1D2DA 1DK1A 1FKAO 4B3RO 1I94O 5FLXN 1X59A 1XNRO 1G1XB 4JI2O 4LF6O 3JAMN 4X64O 2UUCO 4OPAA 5LMNO 1IBLO 1N33O 3T1YO 1R6TA 1HNXO 4LF4O 4DV3O 4LF9O 2UUBO 3F5TA 4DR2O 2ZKOA 2UXBO 4A5UB 2JRIA 4DV0O 5IT9N 3RT3C 1XMOO 4JI5O 5A2QN 4X62O 1IBKO 1F7YA 5H5NA 3SDLA 4LFCO 4DV2O 4DR6O 1N32O 2AGAA 1HNWO 4DR4O 4X65O 4DV7O 4JV5O 3M8AA 4OPHA 5IWAO 1R1BA 3J81N 4NXMO 3J80N 3J7AU 2LW7A 4JI4O 4B3SO 1YZBA 4GKJO 1N36O 2DOSA 2UU9O 4KHPO 1AB3A 3OTOO 2FKXA 4LF7O 4JI0O 4JI1O 4GKKO 4DUZO 2E5LO 1HR0O 1N34O 5BXZA 5LL6Y 2ZM6O 4JI6O 4DR3O 4B3MO 2UUAO 4LFBO 1KUQA 2VQFO 4LF8O 4LF5O 4DV6O 1NS1A 4JI7O 2HHHO 5BR8O 4X66O 4JI8O 2UXDO 4DR5O 3R66A 4DUYO 1J5EO 2Z0AA 1XMQO 4JI3O 4B3TO
chains in the Genus database with same CATH superfamily
1FJGO 4YY3O 1HNZO 2UU9B 4KXRA 4EB6A 4DR5B 1MABG 4LNUB 4LFAO 5LXTB 1SQBH 3IJ4A 3FB8C 2PI4A 2QJ1A 1VQLV 1MG1A 4X88A 3O65A 1AVMA 4W4KA 2PUSA 1KECA 3CC7V 1VQNV 4MS2A 1XNRO 2F93B 3JCUZ 3CXCU 5BR8B 3BA8A 3HKBA 4FFKA 2Y4TA 2JS5A 4PA9A 1XHZA 3F5TA 3ZMVA 1TUBA 4UCOA 1FS0G 3WFVA 4IHJB 4K8XA 1F4NA 5IYBO 2P4KA 5B3SB 4QGPA 5DM6V 1G4YB 1SQGA 4P9PA 3BVOA 2A06H 4WF9V 1QVGU 2GBOA 2FTKA 4UXNA 1K92A 3HKCA 2LW7A 4F4LA 4I9QA 1AB3A 2ZINA 1SF9A 4ZI7A 1YDXA 4JI0O 3CCQV 1HNXB 2E5LO 3KG2A 1AP5A 3ETGA 5H6QA 2UXBB 1DLBA 1XMOB 2UUAO 2BTOA 4J7ZA 2Q0AA 1TAEA 4RAIA 1V9PA 3ICXA 1OCZB 3THOA 2HG5C 1BCCH 2AHZA 3OGCC 4DR4B 1ZLZA 4DUYO 4CH4A 1PP9H 3FX7A 1XMQO 5EIBD 5HFLA 4X8AA 5LA6B 2Z3YA 1K5QA 3SPJA 3N27A 5IY5C 3FB6C 3QTCA 3U0ZA 1Y74B 5IJ0B 1AILA 3CRQA 1Z5VA 1S5JA 3K08A 1BQ0A 1U96A 1SQXH 1WAZA 3O9OA 4G28B 1RM1B 2F4VB 3CRRA 1XEQA 3HKDA 5KHIA 5ITZB 3BA9A 4DV4B 1R6NA 1X59A 4O2AB 1XUQA 4QPKA 3HB3B 4F6RB 3B4SA 1R73A 4WFFA 2DN9A 2UUBO 1TUEB 1KP2A 1QQCA 5BMVA 3LDCA 1MZEA 1I0HA 5H5NA 1M57C 4I50A 3OR6C 2EIJB 4X62B 2MK3A 1JMKC 3J81N 4UFZA 4DRXA 2KSDA 1YZBA 2IH1C 3LSQA 2OTJV 3X2QB 1LUVA 2ZNIA 4W4LA 2CTWA 1NVPD 4DUZO 3T1YB 4FMTA 3T4ZA 1NQTA 5EZYB 2DE0X 4PDLA 4GT1A 3G67A 2XUMA 3UO2A 2WLJA 4LFBO 4JTAB 4H37A 2Q73A 1KUQA 5JJNB 3Q4HA 4IYIA 1NR7A 3CCUV 4JI7O 1N32B 3D8CA 2H94A 1AJNA 3OUSA 1EN4A 3LNNA 1B3QA 2IH3C 3CCJV 4JI4B 5KA5A 3F5WC 5LMUO 3QF7A 4OX9O 4RUEA 4D7TA 4TQFA 1HWYA 3RW0A 5B1BC 2W0XA 1Q82W 1GM9A 4JYBA 1IVSA 1E1RG 4J9ZB 2V7QG 3RYCB 2ZM6B 3QO7A 3OGIB 1H38A 3ZRXA 2QDOA 4DR3B 4K8ZA 2X0LA 1GM8A 3G4SV 2QKAA 4HNAB 4R6ZA 2KKWA 4RO2A 4UVBA 5GTHZ 1IDSA 5CN0A 1EM1A 1RPOA 4Z2WA 2P7TC 1NTZH 1PD3A 3JATA 3E22B 1R6TA 4B3TB 2AZ0A 4AHCA 4A5UB 5CBFA 5IT9N 3CWBH 1L0LH 1KC8W 4FLVA 4JYAB 4EB6B 2OCHA 2BTQB 4DR7B 2C2AA 1US6A 2ZD9A 2AGAA 1YJWV 5CB4A 3SYAA 4NXMO 4CS2A 4GZRB 4DV2B 2UU9O 2ILMA 2FKXA 1CP9A 2RDCA 5B1AB 3SYOA 4YIOA 2P90A 1WPXA 2EIMC 1JVMA 3HKBB 4KHPB 1AR4A 1TUBB 1IBKB 1GTOA 1OCCB 3ETDA 2CDYA 1GAXA 3BCCH 4LNUA 2AHYA 5LXTA 1EN5A 4PDMA 1XBLA 4C7UA 4DO2A 5BR8O 4X66O 4X65B 3G6BA 3ABKC 2GTAA 4U7OA 1S5LZ 1WPBA 1FXVA 2Z0AA 4O2BA 1COWG 3HKCB 4QPJA 2N04A 2JGDA 3CPWU 2HKOA 4DV5O 1NH2D 4GX1A 4ZI7B 2GUZB 1BT8A 1KD1W 1GH6A 4BAYA 1H2KA 3BFRA 3JARA 3CP1A 1N0JA 2YEVA 1VQPV 4LH7A 4L8JA 4MSWC 1HNXO 2YICA 1P7GA 1VIBA 2UXBO 1XMOO 1IBLB 3TGUH 4H13B 4ZOLA 2YIBD 2K1EA 2E76B 1M56B 3JASB 5B5EZ 3SGIA 4UVAA 1BZKA 2RN9A 3WB1A 4LWSA 4MW8A 3RYFA 3HKEB 4DR4O 3QNEA 1I08A 2P4VA 1I94B 4B3SO 4LFCB 3QG5A 1QR8A 1DF5A 3HKDB 2DOSA 3ETEA 5D5QA 3ABMB 1LNQA 3CCMV 4IGGA 1EN6A 3SPIA 1R3JC 3DC5A 3B40A 4DW1A 2A3QA 4MVQA 4TSFG 4G27B 2ADQB 4XDKA 5LA6A 4Z1VA 2ADPA 4UV9A 5BMVB 1HR0B 5KUMA 1RFYA 1Y74A 4YJ2B 3H1LH 4LBEC 5IJ0A 4XDLA 1R3LC 1HDJA 5DN6G 2WSSG 5LGUA 4JPRA 4UUJC 4BIUA 1TVKB 2Q4PA 5IWAB 2WWWA 4IL6Z 4LF5B 4FLUA 3HPLC 1KB9F 1QCEA 2JGUA 2OIGA 2UXDB 4DRXB 5L3EA 1QHTA 1H8HG 4O2AA 5KMGB 3E8GA 3SYPA 2YIAA 1Q81W 2X6AA 4F6RA 4IT5A 3DC6A 4N23A 2QE7G 1FYJA 5K1PA 3H9VA 2W6IG 1WNSA 2BSKA 4FLTA 3UKMA 2D2CB 4WFAV 2E74B 3K59A 3Q4HB 2GHYA 2ITCC 3ZBHA 2XAGA 3T1YO 4PA6A 3CE2A 4MVRA 2OIEA 4LF6B 2HP8A 4LF9O 4X64B 3H1JH 1YEWA 2OT5A 2HJDA 3DTUB 3G71V 3W7UA 2HLDG 4IIJB 4BW9A 1CEZA 4GX0A 2LJ2A 5KAFZ 4X1YB 4J11A 4NXNB 1VF7A 3CJHA 5E79Z 1Q43A 1N32O 3K9SA 2QWRB 1D5AA 4B7KA 4JV5O 2D3OW 2CAZC 2YS8A 1PV0A 3CCLV 2XTAA 5CMUA 4JI4O 3RYHA 5L3FA 1VQ6V 4FVMA 4NR1A 2AW9A 3OMIB 2CH7B 3UO3A 4MT8A 3L70H 1R6KA 4D7SA 3IC7A 1JPXA 3K0GA 4DV3B 1XL6A 1EZJA 3OTOB 2ZM6O 3JATB 1S3JA 4DR3O 5CBGA 1YTFB 4LP8A 2QA4V 2OCCC 3K5NA 2WA4A 1K9MW 4GLXA 1XDCA 5IY5B 4FFBA 3AG3C 1FXKC 4DV7B 4JGSA 2KG7A 1OCRC 4AI8A 4RWUA 4B3TO 5CB4B 1WN7A 4JI8B 2EJRA 4HNAA 4JYAO 4GX2A 1WP7A 3I56V 1K4CC 1VARA 4NB5A 3RFRA 1NJIW 4DR7O 2ZNJA 2GV9A 4X89A 5AG2A 2ZDIC 3OR7C 4AQYO 3IC9A 4UB6Z 2WLKA 2VQFB 3UCSC 3K0DA 1H8EG 4PHZA 5K1XA 5C8YA 3PJSK 3M7MX 2BTQA 2CK3G 4B3RB 1M57B 4B7EA 3ZIAG 4UCSA 5J9PC 1NH2B 3JD0A 4CBCA 4FPPA 2JRIA 1I7FA 4K35A 4O2BB 5A2QN 5IYZA 1IBKO 1SQQH 1VEWA 1PNLA 1AP6A 2R70A 2JGDB 3G80A 1GK9A 3ZS8C 1H2GA 1U97A 2ZIOA 4X65O 2A0LA 3OUFA 1RSOA 2HR3A 4OPHA 3WU2Z 1R1BA 3CCVV 3VQYA 4GKJO 4PA7A 2GDSA 3JARB 3K58A 4BWAA 1FFXB 5EBLC 4O4JB 4K3AA 1SC5B 4JTCB 2Y48A 2QKCA 2R9IA 4X1KB 2YEVB 3F7VC 1H2NA 2NNUA 4EFBA 1MA1A 3CX5F 3FYEB 1ZSPA 1W0KG 3HR0A 1CXZB 4ZOLB 2A9HA 3ZHQA 1VF6C 2JEUA 2X7RB 4MVSA 2VS0A 5B1BB 4LWSB 2JJ2G 3BHPA 3KCXA 4MVMA 2GUZA 3RYFB 3ML0A 2Q5ZA 2PY5A 5A9GA 3ETQA 2JJ1G 4FIPC 2EZOA 2ZE8A 5KHHA 4JI3B 2H8PC 2PF4E 1IBMB 2BOBC 1QLNA 4JI6B 2Q8VA 4B08A 4QNHB 3SR2C 2XAFA 1JX9A 1NTMH 2DWEC 1I94O 3SPHA 1YF2A 4UCVA 1G1XB 4DV6B 1M1KW 1WA8A 2HHHB 4YJ3B 3JASA 3K03A 1FXKA 1JR9A 3HKEA 4NTXA 2VQEB 2UUCB 1AI5A 2CTPA 3B77A 2W6JG 1M9NA 5LHGA 3ZHRA 2V4DA 2YXLA 3FYIB 3SDLA 4CH3A 2Y69C 5B66Z 5IWAO 2JVDA 2EIMB 3E8HA 1XL4A 2ZDIA 2E75B 2BSKB 3K5MA 4UCTA 1ENVA 4YJ2A 1N0NA 4JI1O 4OXSA 5KX5B 3P32A 4J7JA 4TV8B 1TVKA 2P6JA 5L3GA 3ABKB 1OHHG 2EJ7A 3L74H 2QM8A 3MHHC 3K5LA 4FLZA 2EX3A 3H1HH 5KMGA 2B9ZA 1JOYA 1YHQV 3EXAA 3R66A 4YIPA 1N4CA 4KUMA 4NVPA 3L9DA 3CCRV 3CJHB 1FD9A 3EFFK 2YC0A 3JCZA 1PNKA 5H9CA 4BR6A 4DW0A 3RYHB 3STZC 5GONB 1B06A 4MW3A 2L35A 4LH6A 3K9AA 1KBHA 3AG2C 2P22C 2BCCH 5BY1A 2N74A 4PI0A 1N34B 3T2MA 1AROP 1S77D 3H1KH 3QVNA 4ZBMA 4B3MB 4NXNO 2BE3A 3RVZA 3ZHSA 3OT7A 1ORQC 2YDEA 5FLXN 2F43G 4ZHQA 5IJ9A 3CHXA 5CBHA 4IIJA 3TETA 5D5PA 2F23A 2EINC 3RWRD 5JWPA 1J5EB 4FFBB 4H44B 3JAKB 4X1YA 2QWQB 1JFFB 2IJHA 1Y67A 1SQVH 4FZ0A 4DV3O 4DR2O 2KG7B 2IJIA 3APOA 2RCVA 1GN6A 1K4DC 3CXHF 2KQXA 1K97A 5EBMC 4LF4B 2CH7A 3AG4C 3W7XA 2ZE7A 3G6EV 4WFHA 5LOVA 5DEDA 4JF3A 4DV7O 3OW2U 3NXSA 1V54C 1YVWA 1WB7A 2ZR3A 3BPZA 2UXNA 1TGOA 1MSWD 2NN4A 3APQA 3SPCA 3WB0A 1ZX3A 1Q6HA 1N33B 4GX5A 1KU9A 5C8YB 1XHXA 5JH7B 5LL6Y 1OZ0A 4JI5B 5JQGB 3A0HZ 1Q5OA 2EILC 4GYCB 1NTKH 2XAHA 3ZJZA 2VQFO 3AEIA 5IYZB 3A2FA 1QVFU 2QWNB 3MDSA 1HNWB 2X6BA 4DR5O 1SKVA 4PD4F 3K79A 1AI6A 4I55B 2RNBA 1RSOB 4DK0A 4CZZA 2Y0PA 2CE4A 1H2MA 1EFRG 4PA3A 1ZL8B 2ZR2A 4UCRA 1FJGB 2XAQA 3VOUA 2EIKC 3P3NA 4LFAB 2JK5C 1M4UA 1KYOF 1M5IA 3CB2A 2ZE5A 1OV9A 1FKAO 2ZQMA 3A0BZ 3TXSA 4UCUA 1NT2B 4E4EA 2PYLA 4J9YB 4CC5A 1XNRB 3I55V 4X1IA 4I4TA 3CSXA 2BOCC 3T1HB 1NZ6A 2P06A 3UQ8A 4R8CA 4MTGA 5LHHA 4DR1B 1FFXA 4O4JA 2JDIG 3CMAV 1YITV 2WLNA 3VQWA 2YIBA 4X1KA 1VQOV 1L1FA 1K3EA 3IFXA 2XOKG 4U7NA 2Q7EA 3K06A 1H2SB 5IYCO 4JI2B 1EBOA 1SERA 1Q86W 2HJFC 4O4HA 1F51A 1SS3A 4KL1A 1P84F 1WA8B 1K7DA 2XHBA 2IU3A 5HFMA 4ABMA 1ZUQA 3RYIA 2DWDC 3AG3B 1FXKB 4JI6O 4QIWF 4TUYB 3ZRWA 4JI0B 1OCRB 2DYSC 4JYYA 3ZMZA 1T5EA 5LGNA 1DTOA 1VQ8V 4DV6O 2UUAB 2QTSA 2HHHO 2QTOA 1L8DA 2RJZA 4CC6A 2ZT9B 1G8MA 2P67A 4RUFA 2VQEO 3ABLC 2LQTA 3AG1C 1BGYH 1S72V 2F4VO 1K5SA 1XMQB 3LUTB 4LC1A 4YJ3A 4DV4O 1SQFA 3CC2V 4JASA 5LHIA 1BQZA 4UB8Z 5KHJA 5EBWC 1SQPH 2B5UA 3E89A 1BSMA 1UFIA 3FAVA 1NVPB 4KFMA 2LGWA 2R72A 3H01A 2NR5A 4PDRA 3A8TA 4PDVA 1DGSA 3DXRA 3OEEG 4PV1B 3MD0A 1M93A 3QO8A 3ZN0A 1VP7A 2QM7A 1B04A 1Q6UA 1I5XA 2LFSA 4X62O 2UUBB 3N2GA 5FNVA 3ZCCA 2UXCB 1KP3A 5KX5A 4HBNA 3OTFA 4TV8A 4O4LA 5J2TA 1AI7A 4P30A 2G38A 5H2FZ 3UT5B 2LP7A 2Q7HA 1V55C 2ATKC 5KHKA 1IXBA 4P9OA 3N2KB 4ZHQB 1BL8A 3QO5A 5IJ9B 1NKDA 3OMAB 1Z2GA 1N34O 2IJKA 5EK0A 2QWPB 2WLIB 4B3MO 1XILA 4DUZB 4I0XA 4HAMA 3AK3A 4FZ1A 3CCEV 1OCOC 3WG7C 5GONA 3ZHUA 3S3XA 3OMNB 3SYQA 4DR6B 4LFBB 3GWKC 1J5EO 3KCYA 3TXQA 5LOVB 1MSDA 4QE7A 3D3QA 2UXXA 1SZTA 2QKSA 4JTDB 3STLC 2XASA 5FPRA 1PL4A 1YI2V 4LF7B 1AJPA 3ZX6A 5H6RA 1SA0A 4FK5C 4TWKA 3K3WA 4I9WA 4N21A 4BW5A 3JAKA 1JFFA 3AG7A 3LSUA 3CEIA 4NTYA 4E2LA 4WFBV 2ARHA 2Q68A 1Y76B 5CA3A 1MOFA 5L3CA 1H2LA 1Y6XA 3ASOC 3VQXA 1N33O 3RBZA 4CH6A 3FFQA 1S0VA 2Y69B 4JI5O 1W2BU 3JD2A 2Y0IA 1K8AW 1F7YA 3IGAC 5JJEB 3L71H 4FM1A 2B1GA 4O4IB 4DV2O 1HNWO 4PI2A 5EYPA 3M99B 2CTRA 3CRCA 5JH7A 5JCOC 3I5DA 3LNMB 4WBNA 2XT9A 2CGNA 5JQGA 4KHPO 3D3IA 2Q67A 2HEPA 2YI9A 5CA0A 4KP4A 5LMNB 4ASUG 1KQSU 4NXMB 4CH5A 3B8NA 1G6UA 5LP6C 5BXZA 3ASNC 1YSCA 4BIOA 4X1IB 4I55A 4I4TB 1Q7YW 3AK1A 5CA1B 4H0LB 1BHAA 3GB7C 1TA8A 1ZL8A 2O57A 3L75H 3AG2B 1Y4MA 1IZ3A 1WB8A 3MHSC 3ZHVA 1E1QG 4X66B 1W0JG 2YI8A 4MVUA 4X20B 1XQ8A 3T1HO 3LDEA 1VQ5V 1SRYA 2ETNA 4ZKIA 1P7BA 4O4HB 3D36C 4DR1O 3MAQA 2EINB 4PA4A 2WPDG 3LDDA 2YSUB 5J2UA 3RYIB 1WLEA 1D2DA 1DK1A 4DV5B 4LF8B 3PN1A 2IU0A 3ZRWB 4JI2O 5JVDB 2Q7GA 1Q8IA 4U3JA 1IBLO 4JAVA 1IX9A 3CRMA 4FJCC 3ZN1A 3AG4B 4I7ZB 1ZWIC 4J10A 4JZ2A 4H33A 4EKWA 4Q6GA 3RT3C 1GN2A 2CGOA 1QLEC 2XNDG 3GVMA 4NYKA 3T1CA 1V54B 4TT3G 4LFCO 2ZXWC 4ZIBA 2PGGA 1SZXA 4TV9B 2DW4A 1YJ9V 1FFTB 3SYCA 4K0KB 3EVKA 3J80N 3J7AU 3CMEV 3JD1A 4TUYA 2LFRA 2HVJC 4JZGA 3ZMTA 1B6QA 1WP8A 3FAVB 2EILB 3TK1A 1O9HA 4B3SB 1LR1A 1BE3H 1HR0O 2W0FC 3CRAA 5KLVH 3DXRB 3KZIZ 5GW7A 1NBMG 3JAWB 3ABUA 3BRCA 2ZIMA 3FB7C 1ROPA 2N05A 4LF5O 4IYHA 1CPYA 3E8FA 3N2GB 2UXDO 2QEXV 2R9RB 5FNVB 2P5OA 1UPGA 2EIKB 5JCOA 2E3CA 4O4LB 5J2TB 1VQ4V 4P2ZA 4TQDA 2YUAA 2WLLA 5LBQA 4F6EA 3RVYA 1SETA 1YJNV 2DYRC 2DJVA 2FYUH 1SESA 4HZ3A 2UXCO 1MNGA 3CD6V 1OJHA 5IDJA 5LP6A 4Q20A 3ZEDA 1GM7A 4RQFA 1L0NH 2EBOA 4LF6O 3ZMUA 4I0XB 4R7CA 4X64O 4QJFB 1JJ2U 2B1IA 1E79G 5FL7G 4YHHB 4DV1B 3KKYA 4DK1A 3UT5A 1K34A 1IURA 4LF9B 4CS4A 1J95A 3N2KA 1XNQB 3FB5C 4DR6O 1SA0B 3D36A 5F2VO 3L72H 2CTQA 3M8AA 4JAAA 4LR3A 5KHGA 3OE7G 1VF6A 1FAFA 2WLIA 5B3SC 3H1IH 4PJ0Z 1NR1A 2ZE6A 1VQ9V 1KKCA 1FXHA 3OTOO 4JV5B 2DYSB 2OTLV 4LF7O 2WLMA 2R9AA 3R65A 3BY6A 4R50A 1R3IC 1AR5A 1BHBA 4EFEA 4DV0B 1YCIA 1N8RW 3C3TA 1VF5B 3B8MA 1QR9A 4MVZA 1JQ0A 3ABLB 3AG1B 2M6YA 1NS1A 4ICGA 4JI8O 3E86A 1IXMA 4MVOA 3DGEA 4D6TH 4AILC 1ZTEA 3JALA 3JSNA 1I5YA 2QM4A 5IYDO 1N36B 5EYPB 1OCZC 3ZRVA 4G2KA 3JSLA 1S76D 1GMGA 4MTOA 4WBNB 4J42A 3U11A 2X6CA 4CS3A 1QU7A 2WLHA 4GKKB 1Y76A 5CA0B 1GN3A 2YIDA 2PI5A 1DF4A 4J80A 2DMXA 2XAJA 3JYCA 3BABA 5KA6A 2LGQA 4FLXA 5DECA 3T4DA 3ABTA 3CS5A 4B3RO 2QR4A 1YTFD 1PPJH 1O9GA 2VWKA 1RM1C 4OPAA 1LUWA 1GN4A 4AQYB 5LMNO 2LW1A 1MZFA 1QNMA 1Q3EA 4O4IA 1AI4A 1AR1B 5LYJA 4YY3B 1HNZB 1PL0A 3P30A 2JEXA 1YIJV 3E8BA 3K04A 1PNMA 4HYOA 4J7KA 4JYCA 2NLJC 2RQ6A 2EULA 1VMGA 4WCEV 4MTFA 1V55B 2A7WA 2HVKC 3OD4A 1F4MA 2JIZG 3K5OA 3SJAC 5J2UB 3CYOA 2IJJA 2AXTZ 3IAYA 2ZCEA 5L3DA 1M90W 1F23A 2EIJC 3B2EE 4XBFA 4U3JB 5CA1A 3W7SA 1NI8A 4GKJB 3C90A 1KKDA 1OCOB 3WG7B 5KUKA 2LO1A 2AZ2A 2QWOB 1XI1A 3CCSV 2PZSA 3X2QC 1QBZA 2OWOA 5TISZ 4LF8O 4QE9A 4X20A 4TOIA 4L87A 5FPOA 2OCCB 2VWJA 4FLYA 3S3WA 5IE9A 3C3SA 1KMIZ 3SJCC 1UJWB 4JI3O 4IHJA 4YXWG 3VBBA 3B09A 1IBMO 3E35A 2JS3A 2KB1A 3BEHA 5JVDA 2EZPA 4I5SA 2V1DA 5EC2C 2GTSA 2WA3A 2E5LB 1NU1H 2OYQA 2Q0OC 3JD3A 1GKFA 1W59A 3ASOB 4MTXA 1WJZA 2H3OA 2F95B 3SPGA 4K0KO 3K57A 3E2EA 1FPOA 1R3KC 2UUCO 4GUNA 1P49A 4DUYB 1HP8A 1VQ7V 2K9PA 4TV9A 5KAIZ 2F1MA 1X4TA 2Q9LA 3RN4A 5LGTA 2YXYA 1D5NA 2FL4A 3DSQA 2WLLB 4Z1MG 1Y66A 4DYLA 2IBZH 5LP6B 1RP3B 1VQKV 2FB5A 2A79B 3JAWA 1MMMA 3ASNB 5B1OA 2Y4UA 4LCUC 3RGBA 3JD4A 5L3BA 4I50B 3L73H 3SJBC 2Q69A 3F7YC 2MW2B 2Z5UA 5ITZA 4X9QA 5B1AC 1BMFG 4JI1B 3EHBB 1XOUA 3GWOA 2ITDC 1HW7A 3WB2A 1JCHA 1P4RA 1S5HC 4UVCA 3ZHTA 1AJQA 2ODMA 4OGQB 4FM2A 4XDJA 3OM3B 3LSSA 1OCCC 1URFA 4WFGA 4YHHO 2IW5A 5JJJB 1A32A 1GO3F 4DV1O 2M7WA 4RQEA 1GRJA 1ZAUA 4BIZA 1Q90D 3FD9A 4NTWA 1XNQO 1RPRA 3E83A 3FKSG 3OFNG 1JA8A 3UM7A 2F66C 5C93A 4WFEA 2PTMA 2CUGA 4JAUA 5BZBA 2WAMA 2QGNA 1EZVH 3W7TA 3JAMN 4JI7B 5EC1C 1QLEB 3A0RA 1BS3A 5EZYA 3P3PA 2IM9A 5LMUB 4LF4O 4OX9B 2ZXWB 3SJQC 4GCZA 5EIBC 3OAAG 2DQ3A 2ZKOA 4FM0A 3JALB 4DV0O 3ZMSA 3OEHG 4DR2B 5B1NA 1PKXA 5E1AC 1Z5WA 3U10A 3AK2A 1PM9A 2Q6AA 1XREA 3BAAA 3W7WA 4FLWA 1K33A 3TCUA 1M56C 1N36O 2YXHA 2GSMB 1JJOA 4U3FH 1YXBA 3CC4V 5GTIZ 3RYCA 3NR7A 3VQVA 2RMKB 4GKKO 2PYJA 4NKGB 2L6LA 2QSAA 3TJTA 3ABMC 5LYJB 4DXWA 1VQMV 1Q6IA 2DQ0A 2HFEC 4UV8A 1THZA 2FMLA 3E22A 4J41A 4EEQA 2VRZA 2DYRB 1K73W 4PELA 3ZRSA
chains in the Genus database with same CATH topology
5LMUO 1FJGO 1IBMO 4OX9O 4YY3O 4YHHO 2VQEO 1HNZO 1A32A 2F4VO 4DV1O 1AILA 4LFAO 3T1HO 4JYAO 2DJVA 5BY1A 2N74A 4DV5O 4DV4O 4DR1O 4DR7O 2UXCO 1XNQO 4NXNO 3O65A 1FYJA 4AQYO 1XEQA 4K0KO 1D2DA 1DK1A 1FKAO 4B3RO 1I94O 5FLXN 1X59A 1XNRO 1G1XB 4JI2O 4LF6O 3JAMN 4X64O 2UUCO 4OPAA 5LMNO 1IBLO 1N33O 3T1YO 1R6TA 1HNXO 4LF4O 4DV3O 4LF9O 2UUBO 3F5TA 4DR2O 2ZKOA 2UXBO 4A5UB 2JRIA 4DV0O 5IT9N 3RT3C 1XMOO 4JI5O 5A2QN 4X62O 1IBKO 1F7YA 5H5NA 3SDLA 4LFCO 4DV2O 4DR6O 1N32O 2AGAA 1HNWO 4DR4O 4X65O 4DV7O 4JV5O 3M8AA 4OPHA 5IWAO 1R1BA 3J81N 4NXMO 3J80N 3J7AU 2LW7A 4JI4O 4B3SO 1YZBA 4GKJO 1N36O 2DOSA 2UU9O 4KHPO 1AB3A 3OTOO 2FKXA 4LF7O 4JI0O 4JI1O 4GKKO 4DUZO 2E5LO 1HR0O 1N34O 5BXZA 5LL6Y 2ZM6O 4JI6O 4DR3O 4B3MO 2UUAO 4LFBO 1KUQA 2VQFO 4LF8O 4LF5O 4DV6O 1NS1A 4JI7O 2HHHO 5BR8O 4X66O 4JI8O 2UXDO 4DR5O 3R66A 4DUYO 1J5EO 2Z0AA 1XMQO 4JI3O 4B3TO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU O;  1FJG O;  1IBM O;  4OX9 O;  4YY3 O;  4YHH O;  2VQE O;  1HNZ O;  1A32 A;  2F4V O;  4DV1 O;  1AIL A;  4LFA O;  3T1H O;  4JYA O;  2DJV A;  5BY1 A;  2N74 A;  4DV5 O;  4DV4 O;  4DR1 O;  4DR7 O;  2UXC O;  1XNQ O;  4NXN O;  3O65 A;  1FYJ A;  4AQY O;  1XEQ A;  4K0K O;  1D2D A;  1DK1 A;  1FKA O;  4B3R O;  1I94 O;  5FLX N;  1X59 A;  1XNR O;  1G1X B;  4JI2 O;  4LF6 O;  3JAM N;  4X64 O;  2UUC O;  4OPA A;  5LMN O;  1IBL O;  1N33 O;  3T1Y O;  1R6T A;  1HNX O;  4LF4 O;  4DV3 O;  4LF9 O;  2UUB O;  3F5T A;  4DR2 O;  2ZKO A;  2UXB O;  4A5U B;  2JRI A;  4DV0 O;  5IT9 N;  3RT3 C;  1XMO O;  4JI5 O;  5A2Q N;  4X62 O;  1IBK O;  1F7Y A;  5H5N A;  3SDL A;  4LFC O;  4DV2 O;  4DR6 O;  1N32 O;  2AGA A;  1HNW O;  4DR4 O;  4X65 O;  4DV7 O;  4JV5 O;  3M8A A;  4OPH A;  5IWA O;  1R1B A;  3J81 N;  4NXM O;  3J80 N;  3J7A U;  2LW7 A;  4JI4 O;  4B3S O;  1YZB A;  4GKJ O;  1N36 O;  2DOS A;  2UU9 O;  4KHP O;  1AB3 A;  3OTO O;  2FKX A;  4LF7 O;  4JI0 O;  4JI1 O;  4GKK O;  4DUZ O;  2E5L O;  1HR0 O;  1N34 O;  5BXZ A;  5LL6 Y;  2ZM6 O;  4JI6 O;  4DR3 O;  4B3M O;  2UUA O;  4LFB O;  1KUQ A;  2VQF O;  4LF8 O;  4LF5 O;  4DV6 O;  1NS1 A;  4JI7 O;  2HHH O;  5BR8 O;  4X66 O;  4JI8 O;  2UXD O;  4DR5 O;  3R66 A;  4DUY O;  1J5E O;  2Z0A A;  1XMQ O;  4JI3 O;  4B3T O; 
#chains in the Genus database with same CATH topology
 1FJG O;  4YY3 O;  1HNZ O;  2UU9 B;  4KXR A;  4EB6 A;  4DR5 B;  1MAB G;  4LNU B;  4LFA O;  5LXT B;  1SQB H;  3IJ4 A;  3FB8 C;  2PI4 A;  2QJ1 A;  1VQL V;  1MG1 A;  4X88 A;  3O65 A;  1AVM A;  4W4K A;  2PUS A;  1KEC A;  3CC7 V;  1VQN V;  4MS2 A;  1XNR O;  2F93 B;  3JCU Z;  3CXC U;  5BR8 B;  3BA8 A;  3HKB A;  4FFK A;  2Y4T A;  2JS5 A;  4PA9 A;  1XHZ A;  3F5T A;  3ZMV A;  1TUB A;  4UCO A;  1FS0 G;  3WFV A;  4IHJ B;  4K8X A;  1F4N A;  5IYB O;  2P4K A;  5B3S B;  4QGP A;  5DM6 V;  1G4Y B;  1SQG A;  4P9P A;  3BVO A;  2A06 H;  4WF9 V;  1QVG U;  2GBO A;  2FTK A;  4UXN A;  1K92 A;  3HKC A;  2LW7 A;  4F4L A;  4I9Q A;  1AB3 A;  2ZIN A;  1SF9 A;  4ZI7 A;  1YDX A;  4JI0 O;  3CCQ V;  1HNX B;  2E5L O;  3KG2 A;  1AP5 A;  3ETG A;  5H6Q A;  2UXB B;  1DLB A;  1XMO B;  2UUA O;  2BTO A;  4J7Z A;  2Q0A A;  1TAE A;  4RAI A;  1V9P A;  3ICX A;  1OCZ B;  3THO A;  2HG5 C;  1BCC H;  2AHZ A;  3OGC C;  4DR4 B;  1ZLZ A;  4DUY O;  4CH4 A;  1PP9 H;  3FX7 A;  1XMQ O;  5EIB D;  5HFL A;  4X8A A;  5LA6 B;  2Z3Y A;  1K5Q A;  3SPJ A;  3N27 A;  5IY5 C;  3FB6 C;  3QTC A;  3U0Z A;  1Y74 B;  5IJ0 B;  1AIL A;  3CRQ A;  1Z5V A;  1S5J A;  3K08 A;  1BQ0 A;  1U96 A;  1SQX H;  1WAZ A;  3O9O A;  4G28 B;  1RM1 B;  2F4V B;  3CRR A;  1XEQ A;  3HKD A;  5KHI A;  5ITZ B;  3BA9 A;  4DV4 B;  1R6N A;  1X59 A;  4O2A B;  1XUQ A;  4QPK A;  3HB3 B;  4F6R B;  3B4S A;  1R73 A;  4WFF A;  2DN9 A;  2UUB O;  1TUE B;  1KP2 A;  1QQC A;  5BMV A;  3LDC A;  1MZE A;  1I0H A;  5H5N A;  1M57 C;  4I50 A;  3OR6 C;  2EIJ B;  4X62 B;  2MK3 A;  1JMK C;  3J81 N;  4UFZ A;  4DRX A;  2KSD A;  1YZB A;  2IH1 C;  3LSQ A;  2OTJ V;  3X2Q B;  1LUV A;  2ZNI A;  4W4L A;  2CTW A;  1NVP D;  4DUZ O;  3T1Y B;  4FMT A;  3T4Z A;  1NQT A;  5EZY B;  2DE0 X;  4PDL A;  4GT1 A;  3G67 A;  2XUM A;  3UO2 A;  2WLJ A;  4LFB O;  4JTA B;  4H37 A;  2Q73 A;  1KUQ A;  5JJN B;  3Q4H A;  4IYI A;  1NR7 A;  3CCU V;  4JI7 O;  1N32 B;  3D8C A;  2H94 A;  1AJN A;  3OUS A;  1EN4 A;  3LNN A;  1B3Q A;  2IH3 C;  3CCJ V;  4JI4 B;  5KA5 A;  3F5W C;  5LMU O;  3QF7 A;  4OX9 O;  4RUE A;  4D7T A;  4TQF A;  1HWY A;  3RW0 A;  5B1B C;  2W0X A;  1Q82 W;  1GM9 A;  4JYB A;  1IVS A;  1E1R G;  4J9Z B;  2V7Q G;  3RYC B;  2ZM6 B;  3QO7 A;  3OGI B;  1H38 A;  3ZRX A;  2QDO A;  4DR3 B;  4K8Z A;  2X0L A;  1GM8 A;  3G4S V;  2QKA A;  4HNA B;  4R6Z A;  2KKW A;  4RO2 A;  4UVB A;  5GTH Z;  1IDS A;  5CN0 A;  1EM1 A;  1RPO A;  4Z2W A;  2P7T C;  1NTZ H;  1PD3 A;  3JAT A;  3E22 B;  1R6T A;  4B3T B;  2AZ0 A;  4AHC A;  4A5U B;  5CBF A;  5IT9 N;  3CWB H;  1L0L H;  1KC8 W;  4FLV A;  4JYA B;  4EB6 B;  2OCH A;  2BTQ B;  4DR7 B;  2C2A A;  1US6 A;  2ZD9 A;  2AGA A;  1YJW V;  5CB4 A;  3SYA A;  4NXM O;  4CS2 A;  4GZR B;  4DV2 B;  2UU9 O;  2ILM A;  2FKX A;  1CP9 A;  2RDC A;  5B1A B;  3SYO A;  4YIO A;  2P90 A;  1WPX A;  2EIM C;  1JVM A;  3HKB B;  4KHP B;  1AR4 A;  1TUB B;  1IBK B;  1GTO A;  1OCC B;  3ETD A;  2CDY A;  1GAX A;  3BCC H;  4LNU A;  2AHY A;  5LXT A;  1EN5 A;  4PDM A;  1XBL A;  4C7U A;  4DO2 A;  5BR8 O;  4X66 O;  4X65 B;  3G6B A;  3ABK C;  2GTA A;  4U7O A;  1S5L Z;  1WPB A;  1FXV A;  2Z0A A;  4O2B A;  1COW G;  3HKC B;  4QPJ A;  2N04 A;  2JGD A;  3CPW U;  2HKO A;  4DV5 O;  1NH2 D;  4GX1 A;  4ZI7 B;  2GUZ B;  1BT8 A;  1KD1 W;  1GH6 A;  4BAY A;  1H2K A;  3BFR A;  3JAR A;  3CP1 A;  1N0J A;  2YEV A;  1VQP V;  4LH7 A;  4L8J A;  4MSW C;  1HNX O;  2YIC A;  1P7G A;  1VIB A;  2UXB O;  1XMO O;  1IBL B;  3TGU H;  4H13 B;  4ZOL A;  2YIB D;  2K1E A;  2E76 B;  1M56 B;  3JAS B;  5B5E Z;  3SGI A;  4UVA A;  1BZK A;  2RN9 A;  3WB1 A;  4LWS A;  4MW8 A;  3RYF A;  3HKE B;  4DR4 O;  3QNE A;  1I08 A;  2P4V A;  1I94 B;  4B3S O;  4LFC B;  3QG5 A;  1QR8 A;  1DF5 A;  3HKD B;  2DOS A;  3ETE A;  5D5Q A;  3ABM B;  1LNQ A;  3CCM V;  4IGG A;  1EN6 A;  3SPI A;  1R3J C;  3DC5 A;  3B40 A;  4DW1 A;  2A3Q A;  4MVQ A;  4TSF G;  4G27 B;  2ADQ B;  4XDK A;  5LA6 A;  4Z1V A;  2ADP A;  4UV9 A;  5BMV B;  1HR0 B;  5KUM A;  1RFY A;  1Y74 A;  4YJ2 B;  3H1L H;  4LBE C;  5IJ0 A;  4XDL A;  1R3L C;  1HDJ A;  5DN6 G;  2WSS G;  5LGU A;  4JPR A;  4UUJ C;  4BIU A;  1TVK B;  2Q4P A;  5IWA B;  2WWW A;  4IL6 Z;  4LF5 B;  4FLU A;  3HPL C;  1KB9 F;  1QCE A;  2JGU A;  2OIG A;  2UXD B;  4DRX B;  5L3E A;  1QHT A;  1H8H G;  4O2A A;  5KMG B;  3E8G A;  3SYP A;  2YIA A;  1Q81 W;  2X6A A;  4F6R A;  4IT5 A;  3DC6 A;  4N23 A;  2QE7 G;  1FYJ A;  5K1P A;  3H9V A;  2W6I G;  1WNS A;  2BSK A;  4FLT A;  3UKM A;  2D2C B;  4WFA V;  2E74 B;  3K59 A;  3Q4H B;  2GHY A;  2ITC C;  3ZBH A;  2XAG A;  3T1Y O;  4PA6 A;  3CE2 A;  4MVR A;  2OIE A;  4LF6 B;  2HP8 A;  4LF9 O;  4X64 B;  3H1J H;  1YEW A;  2OT5 A;  2HJD A;  3DTU B;  3G71 V;  3W7U A;  2HLD G;  4IIJ B;  4BW9 A;  1CEZ A;  4GX0 A;  2LJ2 A;  5KAF Z;  4X1Y B;  4J11 A;  4NXN B;  1VF7 A;  3CJH A;  5E79 Z;  1Q43 A;  1N32 O;  3K9S A;  2QWR B;  1D5A A;  4B7K A;  4JV5 O;  2D3O W;  2CAZ C;  2YS8 A;  1PV0 A;  3CCL V;  2XTA A;  5CMU A;  4JI4 O;  3RYH A;  5L3F A;  1VQ6 V;  4FVM A;  4NR1 A;  2AW9 A;  3OMI B;  2CH7 B;  3UO3 A;  4MT8 A;  3L70 H;  1R6K A;  4D7S A;  3IC7 A;  1JPX A;  3K0G A;  4DV3 B;  1XL6 A;  1EZJ A;  3OTO B;  2ZM6 O;  3JAT B;  1S3J A;  4DR3 O;  5CBG A;  1YTF B;  4LP8 A;  2QA4 V;  2OCC C;  3K5N A;  2WA4 A;  1K9M W;  4GLX A;  1XDC A;  5IY5 B;  4FFB A;  3AG3 C;  1FXK C;  4DV7 B;  4JGS A;  2KG7 A;  1OCR C;  4AI8 A;  4RWU A;  4B3T O;  5CB4 B;  1WN7 A;  4JI8 B;  2EJR A;  4HNA A;  4JYA O;  4GX2 A;  1WP7 A;  3I56 V;  1K4C C;  1VAR A;  4NB5 A;  3RFR A;  1NJI W;  4DR7 O;  2ZNJ A;  2GV9 A;  4X89 A;  5AG2 A;  2ZDI C;  3OR7 C;  4AQY O;  3IC9 A;  4UB6 Z;  2WLK A;  2VQF B;  3UCS C;  3K0D A;  1H8E G;  4PHZ A;  5K1X A;  5C8Y A;  3PJS K;  3M7M X;  2BTQ A;  2CK3 G;  4B3R B;  1M57 B;  4B7E A;  3ZIA G;  4UCS A;  5J9P C;  1NH2 B;  3JD0 A;  4CBC A;  4FPP A;  2JRI A;  1I7F A;  4K35 A;  4O2B B;  5A2Q N;  5IYZ A;  1IBK O;  1SQQ H;  1VEW A;  1PNL A;  1AP6 A;  2R70 A;  2JGD B;  3G80 A;  1GK9 A;  3ZS8 C;  1H2G A;  1U97 A;  2ZIO A;  4X65 O;  2A0L A;  3OUF A;  1RSO A;  2HR3 A;  4OPH A;  3WU2 Z;  1R1B A;  3CCV V;  3VQY A;  4GKJ O;  4PA7 A;  2GDS A;  3JAR B;  3K58 A;  4BWA A;  1FFX B;  5EBL C;  4O4J B;  4K3A A;  1SC5 B;  4JTC B;  2Y48 A;  2QKC A;  2R9I A;  4X1K B;  2YEV B;  3F7V C;  1H2N A;  2NNU A;  4EFB A;  1MA1 A;  3CX5 F;  3FYE B;  1ZSP A;  1W0K G;  3HR0 A;  1CXZ B;  4ZOL B;  2A9H A;  3ZHQ A;  1VF6 C;  2JEU A;  2X7R B;  4MVS A;  2VS0 A;  5B1B B;  4LWS B;  2JJ2 G;  3BHP A;  3KCX A;  4MVM A;  2GUZ A;  3RYF B;  3ML0 A;  2Q5Z A;  2PY5 A;  5A9G A;  3ETQ A;  2JJ1 G;  4FIP C;  2EZO A;  2ZE8 A;  5KHH A;  4JI3 B;  2H8P C;  2PF4 E;  1IBM B;  2BOB C;  1QLN A;  4JI6 B;  2Q8V A;  4B08 A;  4QNH B;  3SR2 C;  2XAF A;  1JX9 A;  1NTM H;  2DWE C;  1I94 O;  3SPH A;  1YF2 A;  4UCV A;  1G1X B;  4DV6 B;  1M1K W;  1WA8 A;  2HHH B;  4YJ3 B;  3JAS A;  3K03 A;  1FXK A;  1JR9 A;  3HKE A;  4NTX A;  2VQE B;  2UUC B;  1AI5 A;  2CTP A;  3B77 A;  2W6J G;  1M9N A;  5LHG A;  3ZHR A;  2V4D A;  2YXL A;  3FYI B;  3SDL A;  4CH3 A;  2Y69 C;  5B66 Z;  5IWA O;  2JVD A;  2EIM B;  3E8H A;  1XL4 A;  2ZDI A;  2E75 B;  2BSK B;  3K5M A;  4UCT A;  1ENV A;  4YJ2 A;  1N0N A;  4JI1 O;  4OXS A;  5KX5 B;  3P32 A;  4J7J A;  4TV8 B;  1TVK A;  2P6J A;  5L3G A;  3ABK B;  1OHH G;  2EJ7 A;  3L74 H;  2QM8 A;  3MHH C;  3K5L A;  4FLZ A;  2EX3 A;  3H1H H;  5KMG A;  2B9Z A;  1JOY A;  1YHQ V;  3EXA A;  3R66 A;  4YIP A;  1N4C A;  4KUM A;  4NVP A;  3L9D A;  3CCR V;  3CJH B;  1FD9 A;  3EFF K;  2YC0 A;  3JCZ A;  1PNK A;  5H9C A;  4BR6 A;  4DW0 A;  3RYH B;  3STZ C;  5GON B;  1B06 A;  4MW3 A;  2L35 A;  4LH6 A;  3K9A A;  1KBH A;  3AG2 C;  2P22 C;  2BCC H;  5BY1 A;  2N74 A;  4PI0 A;  1N34 B;  3T2M A;  1ARO P;  1S77 D;  3H1K H;  3QVN A;  4ZBM A;  4B3M B;  4NXN O;  2BE3 A;  3RVZ A;  3ZHS A;  3OT7 A;  1ORQ C;  2YDE A;  5FLX N;  2F43 G;  4ZHQ A;  5IJ9 A;  3CHX A;  5CBH A;  4IIJ A;  3TET A;  5D5P A;  2F23 A;  2EIN C;  3RWR D;  5JWP A;  1J5E B;  4FFB B;  4H44 B;  3JAK B;  4X1Y A;  2QWQ B;  1JFF B;  2IJH A;  1Y67 A;  1SQV H;  4FZ0 A;  4DV3 O;  4DR2 O;  2KG7 B;  2IJI A;  3APO A;  2RCV A;  1GN6 A;  1K4D C;  3CXH F;  2KQX A;  1K97 A;  5EBM C;  4LF4 B;  2CH7 A;  3AG4 C;  3W7X A;  2ZE7 A;  3G6E V;  4WFH A;  5LOV A;  5DED A;  4JF3 A;  4DV7 O;  3OW2 U;  3NXS A;  1V54 C;  1YVW A;  1WB7 A;  2ZR3 A;  3BPZ A;  2UXN A;  1TGO A;  1MSW D;  2NN4 A;  3APQ A;  3SPC A;  3WB0 A;  1ZX3 A;  1Q6H A;  1N33 B;  4GX5 A;  1KU9 A;  5C8Y B;  1XHX A;  5JH7 B;  5LL6 Y;  1OZ0 A;  4JI5 B;  5JQG B;  3A0H Z;  1Q5O A;  2EIL C;  4GYC B;  1NTK H;  2XAH A;  3ZJZ A;  2VQF O;  3AEI A;  5IYZ B;  3A2F A;  1QVF U;  2QWN B;  3MDS A;  1HNW B;  2X6B A;  4DR5 O;  1SKV A;  4PD4 F;  3K79 A;  1AI6 A;  4I55 B;  2RNB A;  1RSO B;  4DK0 A;  4CZZ A;  2Y0P A;  2CE4 A;  1H2M A;  1EFR G;  4PA3 A;  1ZL8 B;  2ZR2 A;  4UCR A;  1FJG B;  2XAQ A;  3VOU A;  2EIK C;  3P3N A;  4LFA B;  2JK5 C;  1M4U A;  1KYO F;  1M5I A;  3CB2 A;  2ZE5 A;  1OV9 A;  1FKA O;  2ZQM A;  3A0B Z;  3TXS A;  4UCU A;  1NT2 B;  4E4E A;  2PYL A;  4J9Y B;  4CC5 A;  1XNR B;  3I55 V;  4X1I A;  4I4T A;  3CSX A;  2BOC C;  3T1H B;  1NZ6 A;  2P06 A;  3UQ8 A;  4R8C A;  4MTG A;  5LHH A;  4DR1 B;  1FFX A;  4O4J A;  2JDI G;  3CMA V;  1YIT V;  2WLN A;  3VQW A;  2YIB A;  4X1K A;  1VQO V;  1L1F A;  1K3E A;  3IFX A;  2XOK G;  4U7N A;  2Q7E A;  3K06 A;  1H2S B;  5IYC O;  4JI2 B;  1EBO A;  1SER A;  1Q86 W;  2HJF C;  4O4H A;  1F51 A;  1SS3 A;  4KL1 A;  1P84 F;  1WA8 B;  1K7D A;  2XHB A;  2IU3 A;  5HFM A;  4ABM A;  1ZUQ A;  3RYI A;  2DWD C;  3AG3 B;  1FXK B;  4JI6 O;  4QIW F;  4TUY B;  3ZRW A;  4JI0 B;  1OCR B;  2DYS C;  4JYY A;  3ZMZ A;  1T5E A;  5LGN A;  1DTO A;  1VQ8 V;  4DV6 O;  2UUA B;  2QTS A;  2HHH O;  2QTO A;  1L8D A;  2RJZ A;  4CC6 A;  2ZT9 B;  1G8M A;  2P67 A;  4RUF A;  2VQE O;  3ABL C;  2LQT A;  3AG1 C;  1BGY H;  1S72 V;  2F4V O;  1K5S A;  1XMQ B;  3LUT B;  4LC1 A;  4YJ3 A;  4DV4 O;  1SQF A;  3CC2 V;  4JAS A;  5LHI A;  1BQZ A;  4UB8 Z;  5KHJ A;  5EBW C;  1SQP H;  2B5U A;  3E89 A;  1BSM A;  1UFI A;  3FAV A;  1NVP B;  4KFM A;  2LGW A;  2R72 A;  3H01 A;  2NR5 A;  4PDR A;  3A8T A;  4PDV A;  1DGS A;  3DXR A;  3OEE G;  4PV1 B;  3MD0 A;  1M93 A;  3QO8 A;  3ZN0 A;  1VP7 A;  2QM7 A;  1B04 A;  1Q6U A;  1I5X A;  2LFS A;  4X62 O;  2UUB B;  3N2G A;  5FNV A;  3ZCC A;  2UXC B;  1KP3 A;  5KX5 A;  4HBN A;  3OTF A;  4TV8 A;  4O4L A;  5J2T A;  1AI7 A;  4P30 A;  2G38 A;  5H2F Z;  3UT5 B;  2LP7 A;  2Q7H A;  1V55 C;  2ATK C;  5KHK A;  1IXB A;  4P9O A;  3N2K B;  4ZHQ B;  1BL8 A;  3QO5 A;  5IJ9 B;  1NKD A;  3OMA B;  1Z2G A;  1N34 O;  2IJK A;  5EK0 A;  2QWP B;  2WLI B;  4B3M O;  1XIL A;  4DUZ B;  4I0X A;  4HAM A;  3AK3 A;  4FZ1 A;  3CCE V;  1OCO C;  3WG7 C;  5GON A;  3ZHU A;  3S3X A;  3OMN B;  3SYQ A;  4DR6 B;  4LFB B;  3GWK C;  1J5E O;  3KCY A;  3TXQ A;  5LOV B;  1MSD A;  4QE7 A;  3D3Q A;  2UXX A;  1SZT A;  2QKS A;  4JTD B;  3STL C;  2XAS A;  5FPR A;  1PL4 A;  1YI2 V;  4LF7 B;  1AJP A;  3ZX6 A;  5H6R A;  1SA0 A;  4FK5 C;  4TWK A;  3K3W A;  4I9W A;  4N21 A;  4BW5 A;  3JAK A;  1JFF A;  3AG7 A;  3LSU A;  3CEI A;  4NTY A;  4E2L A;  4WFB V;  2ARH A;  2Q68 A;  1Y76 B;  5CA3 A;  1MOF A;  5L3C A;  1H2L A;  1Y6X A;  3ASO C;  3VQX A;  1N33 O;  3RBZ A;  4CH6 A;  3FFQ A;  1S0V A;  2Y69 B;  4JI5 O;  1W2B U;  3JD2 A;  2Y0I A;  1K8A W;  1F7Y A;  3IGA C;  5JJE B;  3L71 H;  4FM1 A;  2B1G A;  4O4I B;  4DV2 O;  1HNW O;  4PI2 A;  5EYP A;  3M99 B;  2CTR A;  3CRC A;  5JH7 A;  5JCO C;  3I5D A;  3LNM B;  4WBN A;  2XT9 A;  2CGN A;  5JQG A;  4KHP O;  3D3I A;  2Q67 A;  2HEP A;  2YI9 A;  5CA0 A;  4KP4 A;  5LMN B;  4ASU G;  1KQS U;  4NXM B;  4CH5 A;  3B8N A;  1G6U A;  5LP6 C;  5BXZ A;  3ASN C;  1YSC A;  4BIO A;  4X1I B;  4I55 A;  4I4T B;  1Q7Y W;  3AK1 A;  5CA1 B;  4H0L B;  1BHA A;  3GB7 C;  1TA8 A;  1ZL8 A;  2O57 A;  3L75 H;  3AG2 B;  1Y4M A;  1IZ3 A;  1WB8 A;  3MHS C;  3ZHV A;  1E1Q G;  4X66 B;  1W0J G;  2YI8 A;  4MVU A;  4X20 B;  1XQ8 A;  3T1H O;  3LDE A;  1VQ5 V;  1SRY A;  2ETN A;  4ZKI A;  1P7B A;  4O4H B;  3D36 C;  4DR1 O;  3MAQ A;  2EIN B;  4PA4 A;  2WPD G;  3LDD A;  2YSU B;  5J2U A;  3RYI B;  1WLE A;  1D2D A;  1DK1 A;  4DV5 B;  4LF8 B;  3PN1 A;  2IU0 A;  3ZRW B;  4JI2 O;  5JVD B;  2Q7G A;  1Q8I A;  4U3J A;  1IBL O;  4JAV A;  1IX9 A;  3CRM A;  4FJC C;  3ZN1 A;  3AG4 B;  4I7Z B;  1ZWI C;  4J10 A;  4JZ2 A;  4H33 A;  4EKW A;  4Q6G A;  3RT3 C;  1GN2 A;  2CGO A;  1QLE C;  2XND G;  3GVM A;  4NYK A;  3T1C A;  1V54 B;  4TT3 G;  4LFC O;  2ZXW C;  4ZIB A;  2PGG A;  1SZX A;  4TV9 B;  2DW4 A;  1YJ9 V;  1FFT B;  3SYC A;  4K0K B;  3EVK A;  3J80 N;  3J7A U;  3CME V;  3JD1 A;  4TUY A;  2LFR A;  2HVJ C;  4JZG A;  3ZMT A;  1B6Q A;  1WP8 A;  3FAV B;  2EIL B;  3TK1 A;  1O9H A;  4B3S B;  1LR1 A;  1BE3 H;  1HR0 O;  2W0F C;  3CRA A;  5KLV H;  3DXR B;  3KZI Z;  5GW7 A;  1NBM G;  3JAW B;  3ABU A;  3BRC A;  2ZIM A;  3FB7 C;  1ROP A;  2N05 A;  4LF5 O;  4IYH A;  1CPY A;  3E8F A;  3N2G B;  2UXD O;  2QEX V;  2R9R B;  5FNV B;  2P5O A;  1UPG A;  2EIK B;  5JCO A;  2E3C A;  4O4L B;  5J2T B;  1VQ4 V;  4P2Z A;  4TQD A;  2YUA A;  2WLL A;  5LBQ A;  4F6E A;  3RVY A;  1SET A;  1YJN V;  2DYR C;  2DJV A;  2FYU H;  1SES A;  4HZ3 A;  2UXC O;  1MNG A;  3CD6 V;  1OJH A;  5IDJ A;  5LP6 A;  4Q20 A;  3ZED A;  1GM7 A;  4RQF A;  1L0N H;  2EBO A;  4LF6 O;  3ZMU A;  4I0X B;  4R7C A;  4X64 O;  4QJF B;  1JJ2 U;  2B1I A;  1E79 G;  5FL7 G;  4YHH B;  4DV1 B;  3KKY A;  4DK1 A;  3UT5 A;  1K34 A;  1IUR A;  4LF9 B;  4CS4 A;  1J95 A;  3N2K A;  1XNQ B;  3FB5 C;  4DR6 O;  1SA0 B;  3D36 A;  5F2V O;  3L72 H;  2CTQ A;  3M8A A;  4JAA A;  4LR3 A;  5KHG A;  3OE7 G;  1VF6 A;  1FAF A;  2WLI A;  5B3S C;  3H1I H;  4PJ0 Z;  1NR1 A;  2ZE6 A;  1VQ9 V;  1KKC A;  1FXH A;  3OTO O;  4JV5 B;  2DYS B;  2OTL V;  4LF7 O;  2WLM A;  2R9A A;  3R65 A;  3BY6 A;  4R50 A;  1R3I C;  1AR5 A;  1BHB A;  4EFE A;  4DV0 B;  1YCI A;  1N8R W;  3C3T A;  1VF5 B;  3B8M A;  1QR9 A;  4MVZ A;  1JQ0 A;  3ABL B;  3AG1 B;  2M6Y A;  1NS1 A;  4ICG A;  4JI8 O;  3E86 A;  1IXM A;  4MVO A;  3DGE A;  4D6T H;  4AIL C;  1ZTE A;  3JAL A;  3JSN A;  1I5Y A;  2QM4 A;  5IYD O;  1N36 B;  5EYP B;  1OCZ C;  3ZRV A;  4G2K A;  3JSL A;  1S76 D;  1GMG A;  4MTO A;  4WBN B;  4J42 A;  3U11 A;  2X6C A;  4CS3 A;  1QU7 A;  2WLH A;  4GKK B;  1Y76 A;  5CA0 B;  1GN3 A;  2YID A;  2PI5 A;  1DF4 A;  4J80 A;  2DMX A;  2XAJ A;  3JYC A;  3BAB A;  5KA6 A;  2LGQ A;  4FLX A;  5DEC A;  3T4D A;  3ABT A;  3CS5 A;  4B3R O;  2QR4 A;  1YTF D;  1PPJ H;  1O9G A;  2VWK A;  1RM1 C;  4OPA A;  1LUW A;  1GN4 A;  4AQY B;  5LMN O;  2LW1 A;  1MZF A;  1QNM A;  1Q3E A;  4O4I A;  1AI4 A;  1AR1 B;  5LYJ A;  4YY3 B;  1HNZ B;  1PL0 A;  3P30 A;  2JEX A;  1YIJ V;  3E8B A;  3K04 A;  1PNM A;  4HYO A;  4J7K A;  4JYC A;  2NLJ C;  2RQ6 A;  2EUL A;  1VMG A;  4WCE V;  4MTF A;  1V55 B;  2A7W A;  2HVK C;  3OD4 A;  1F4M A;  2JIZ G;  3K5O A;  3SJA C;  5J2U B;  3CYO A;  2IJJ A;  2AXT Z;  3IAY A;  2ZCE A;  5L3D A;  1M90 W;  1F23 A;  2EIJ C;  3B2E E;  4XBF A;  4U3J B;  5CA1 A;  3W7S A;  1NI8 A;  4GKJ B;  3C90 A;  1KKD A;  1OCO B;  3WG7 B;  5KUK A;  2LO1 A;  2AZ2 A;  2QWO B;  1XI1 A;  3CCS V;  2PZS A;  3X2Q C;  1QBZ A;  2OWO A;  5TIS Z;  4LF8 O;  4QE9 A;  4X20 A;  4TOI A;  4L87 A;  5FPO A;  2OCC B;  2VWJ A;  4FLY A;  3S3W A;  5IE9 A;  3C3S A;  1KMI Z;  3SJC C;  1UJW B;  4JI3 O;  4IHJ A;  4YXW G;  3VBB A;  3B09 A;  1IBM O;  3E35 A;  2JS3 A;  2KB1 A;  3BEH A;  5JVD A;  2EZP A;  4I5S A;  2V1D A;  5EC2 C;  2GTS A;  2WA3 A;  2E5L B;  1NU1 H;  2OYQ A;  2Q0O C;  3JD3 A;  1GKF A;  1W59 A;  3ASO B;  4MTX A;  1WJZ A;  2H3O A;  2F95 B;  3SPG A;  4K0K O;  3K57 A;  3E2E A;  1FPO A;  1R3K C;  2UUC O;  4GUN A;  1P49 A;  4DUY B;  1HP8 A;  1VQ7 V;  2K9P A;  4TV9 A;  5KAI Z;  2F1M A;  1X4T A;  2Q9L A;  3RN4 A;  5LGT A;  2YXY A;  1D5N A;  2FL4 A;  3DSQ A;  2WLL B;  4Z1M G;  1Y66 A;  4DYL A;  2IBZ H;  5LP6 B;  1RP3 B;  1VQK V;  2FB5 A;  2A79 B;  3JAW A;  1MMM A;  3ASN B;  5B1O A;  2Y4U A;  4LCU C;  3RGB A;  3JD4 A;  5L3B A;  4I50 B;  3L73 H;  3SJB C;  2Q69 A;  3F7Y C;  2MW2 B;  2Z5U A;  5ITZ A;  4X9Q A;  5B1A C;  1BMF G;  4JI1 B;  3EHB B;  1XOU A;  3GWO A;  2ITD C;  1HW7 A;  3WB2 A;  1JCH A;  1P4R A;  1S5H C;  4UVC A;  3ZHT A;  1AJQ A;  2ODM A;  4OGQ B;  4FM2 A;  4XDJ A;  3OM3 B;  3LSS A;  1OCC C;  1URF A;  4WFG A;  4YHH O;  2IW5 A;  5JJJ B;  1A32 A;  1GO3 F;  4DV1 O;  2M7W A;  4RQE A;  1GRJ A;  1ZAU A;  4BIZ A;  1Q90 D;  3FD9 A;  4NTW A;  1XNQ O;  1RPR A;  3E83 A;  3FKS G;  3OFN G;  1JA8 A;  3UM7 A;  2F66 C;  5C93 A;  4WFE A;  2PTM A;  2CUG A;  4JAU A;  5BZB A;  2WAM A;  2QGN A;  1EZV H;  3W7T A;  3JAM N;  4JI7 B;  5EC1 C;  1QLE B;  3A0R A;  1BS3 A;  5EZY A;  3P3P A;  2IM9 A;  5LMU B;  4LF4 O;  4OX9 B;  2ZXW B;  3SJQ C;  4GCZ A;  5EIB C;  3OAA G;  2DQ3 A;  2ZKO A;  4FM0 A;  3JAL B;  4DV0 O;  3ZMS A;  3OEH G;  4DR2 B;  5B1N A;  1PKX A;  5E1A C;  1Z5W A;  3U10 A;  3AK2 A;  1PM9 A;  2Q6A A;  1XRE A;  3BAA A;  3W7W A;  4FLW A;  1K33 A;  3TCU A;  1M56 C;  1N36 O;  2YXH A;  2GSM B;  1JJO A;  4U3F H;  1YXB A;  3CC4 V;  5GTI Z;  3RYC A;  3NR7 A;  3VQV A;  2RMK B;  4GKK O;  2PYJ A;  4NKG B;  2L6L A;  2QSA A;  3TJT A;  3ABM C;  5LYJ B;  4DXW A;  1VQM V;  1Q6I A;  2DQ0 A;  2HFE C;  4UV8 A;  1THZ A;  2FML A;  3E22 A;  4J41 A;  4EEQ A;  2VRZ A;  2DYR B;  1K73 W;  4PEL A;  3ZRS A; 
#chains in the Genus database with same CATH homology
 5LMU O;  1FJG O;  1IBM O;  4OX9 O;  4YY3 O;  4YHH O;  2VQE O;  1HNZ O;  1A32 A;  2F4V O;  4DV1 O;  1AIL A;  4LFA O;  3T1H O;  4JYA O;  2DJV A;  5BY1 A;  2N74 A;  4DV5 O;  4DV4 O;  4DR1 O;  4DR7 O;  2UXC O;  1XNQ O;  4NXN O;  3O65 A;  1FYJ A;  4AQY O;  1XEQ A;  4K0K O;  1D2D A;  1DK1 A;  1FKA O;  4B3R O;  1I94 O;  5FLX N;  1X59 A;  1XNR O;  1G1X B;  4JI2 O;  4LF6 O;  3JAM N;  4X64 O;  2UUC O;  4OPA A;  5LMN O;  1IBL O;  1N33 O;  3T1Y O;  1R6T A;  1HNX O;  4LF4 O;  4DV3 O;  4LF9 O;  2UUB O;  3F5T A;  4DR2 O;  2ZKO A;  2UXB O;  4A5U B;  2JRI A;  4DV0 O;  5IT9 N;  3RT3 C;  1XMO O;  4JI5 O;  5A2Q N;  4X62 O;  1IBK O;  1F7Y A;  5H5N A;  3SDL A;  4LFC O;  4DV2 O;  4DR6 O;  1N32 O;  2AGA A;  1HNW O;  4DR4 O;  4X65 O;  4DV7 O;  4JV5 O;  3M8A A;  4OPH A;  5IWA O;  1R1B A;  3J81 N;  4NXM O;  3J80 N;  3J7A U;  2LW7 A;  4JI4 O;  4B3S O;  1YZB A;  4GKJ O;  1N36 O;  2DOS A;  2UU9 O;  4KHP O;  1AB3 A;  3OTO O;  2FKX A;  4LF7 O;  4JI0 O;  4JI1 O;  4GKK O;  4DUZ O;  2E5L O;  1HR0 O;  1N34 O;  5BXZ A;  5LL6 Y;  2ZM6 O;  4JI6 O;  4DR3 O;  4B3M O;  2UUA O;  4LFB O;  1KUQ A;  2VQF O;  4LF8 O;  4LF5 O;  4DV6 O;  1NS1 A;  4JI7 O;  2HHH O;  5BR8 O;  4X66 O;  4JI8 O;  2UXD O;  4DR5 O;  3R66 A;  4DUY O;  1J5E O;  2Z0A A;  1XMQ O;  4JI3 O;  4B3T O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...