4DV4O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv4O00
2F4VO 4B3TO 1J5EO 4GKKO 4JI2O 4JI8O 4DR7O 4JI7O 1F7YA 1N32O 2HHHO 4DR6O 2ZKOA 1R6TA 2LW7A 3M8AA 5LL6Y 1DK1A 1HNWO 2ZM6O 5BY1A 4LF7O 1XNRO 1X59A 4DV6O 1R1BA 4DR5O 3T1HO 1HNXO 1HR0O 4NXNO 1XMQO 4OPAA 2VQFO 4LFBO 4X62O 1FYJA 3J81N 4JI5O 4LFAO 1IBMO 4DV4O 4YHHO 4LFCO 4DR4O 3F5TA 4JV5O 1YZBA 4X65O 1HNZO 2UXCO 4JI3O 2UUBO 2Z0AA 2FKXA 4X66O 2DOSA 5IWAO 4NXMO 4X64O 4DR1O 4DUZO 5A2QN 3JAMN 1IBKO 2UUAO 5BXZA 2VQEO 5LMNO 1N34O 1D2DA 1KUQA 2UUCO 3J7AU 1XEQA 2AGAA 2UXBO 4LF5O 5H5NA 4DR3O 2JRIA 3SDLA 2N74A 1XNQO 1N36O 1AB3A 4JI4O 3T1YO 3RT3C 3J80N 4DV3O 2DJVA 4B3RO 1N33O 3R66A 1IBLO 4LF9O 3O65A 4LF4O 2UU9O 4A5UB 5BR8O 2E5LO 1I94O 1A32A 4LF8O 4DV0O 1FKAO 4JYAO 4DR2O 4OX9O 1G1XB 4B3MO 4DUYO 4K0KO 4JI1O 1XMOO 4KHPO 4GKJO 2UXDO 4DV7O 3OTOO 4JI0O 4OPHA 4AQYO 1NS1A 4JI6O 5LMUO 4DV5O 5FLXN 4YY3O 1AILA 4LF6O 4B3SO 1FJGO 5IT9N 4DV1O 4DV2O
chains in the Genus database with same CATH superfamily
1CPYA 3LNNA 4ABMA 3HKEA 3ZHTA 3UM7A 3SPGA 2QTSA 4I55B 1E1RG 4K35A 1R6TA 5LYJA 1M57B 1BGYH 1MNGA 1KB9F 5JWPA 1RSOA 4EB6A 1FFXA 3TXSA 4DR7B 4DR5O 1MG1A 2UXXA 4IIJA 1NBMG 3IGAC 1HNXO 1HR0O 1K4CC 5EIBD 3H1HH 2UUBB 4DUZB 2EIMB 1V55C 3L73H 4O4JA 3F5TA 1BHBA 1GRJA 3BHPA 4F6RA 3AG1B 2E3CA 5BXZA 3H1JH 4JI4B 2UUCO 2DWDC 3JCZA 2UXBO 4CH6A 5IWAB 4O2BA 3SDLA 4LH7A 2UUAB 5LMNB 4QE9A 4MTGA 1PKXA 4JYAB 4FJCC 4F4LA 2D3OW 1VQNV 2HLDG 2GUZB 3OTFA 2YI9A 5JJNB 3WB2A 4CC6A 1AROP 2DQ0A 3FB5C 2YXYA 1GN3A 2JJ2G 3CCJV 1YSCA 2Q7GA 5B1AC 4JI2B 1XI1A 4GX1A 4CH4A 2HHHB 3LDEA 5B1BB 1OV9A 2F4VO 2KQXA 2E75B 5C93A 1XNRB 3WFVA 4MVMA 2OT5A 4TQDA 5A9GA 4BW5A 4BIUA 3JD0A 4FLZA 1RPOA 4EFEA 4DV1B 3L70H 1Q6IA 2YIBD 4GT1A 4IYIA 4Q6GA 4RQFA 4CS3A 1PL4A 1VQKV 4XDKA 2Y0IA 4DXWA 3QVNA 4FLYA 2ZM6B 2YIAA 4GLXA 2YEVA 3JD1A 3JSNA 3ZRSA 5KA6A 1WP8A 2JVDA 3MHSC 5JH7A 1EZJA 1OCCB 3VQXA 4FK5C 2LQTA 3BA9A 1QCEA 4YIOA 1W0JG 4JV5B 2CGOA 1WPBA 3OUFA 1KUQA 5B5EZ 2NLJC 5KX5A 2PZSA 4UB8Z 1L0NH 2Q6AA 2WLLA 3RT3C 5JJEB 1Q86W 1OJHA 2A7WA 1YJWV 4KHPB 4GZRB 2P06A 3MD0A 4JTAB 1M1KW 3H1KH 1UPGA 2WLMA 1BL8A 4DUYO 5D5QA 3RYIB 4YY3B 1GAXA 3DXRA 5BR8B 4JI0O 5EYPB 3ZRVA 4ZKIA 3HKBA 4JI8B 1XHXA 5LOVA 1XQ8A 4FLUA 1HW7A 2OWOA 1I08A 1P84F 4X1KB 5L3CA 5LBQA 5B1AB 2WSSG 1K33A 4WBNB 4PDMA 1XL6A 4CS2A 1H2KA 2ETNA 4YJ2A 2QWRB 2VQFB 1HNWO 3OR7C 3E8BA 3IC7A 1K5SA 3ZX6A 1EN6A 2AHZA 2QE7G 4LFBO 1Q5OA 2EIJB 4LFAO 4FVMA 4DV4O 2F93B 2WA3A 2X7RB 1FFTB 3MAQA 1RFYA 3UT5B 4JI3O 3ABKC 1HP8A 3G4SV 2EJRA 4FIPC 4RAIA 4Z2WA 1TVKA 1GM7A 4PDRA 2DW4A 1F4NA 3AG7A 1K73W 3N2KA 2OCCC 4B7KA 5ITZB 1DLBA 4ZOLA 4E4EA 2UXCB 3SPJA 1SQGA 2KSDA 4I0XA 4I55A 1OCOC 2VWJA 2WA4A 4I7ZB 4LF4B 4X8AA 1ENVA 2XNDG 1P7BA 3CMEV 2A06H 1NR1A 1EN5A 4P2ZA 3EFFK 1K9MW 3U0ZA 5KHGA 4R6ZA 1H2NA 1XILA 5IDJA 1I94O 3JASB 4R7CA 3CCQV 4DV0O 2ZDIC 4ZHQA 2EIKB 1XREA 3HKEB 3SJBC 4K0KO 2DWEC 3ZJZA 2HJFC 4OPHA 1QBZA 2EINC 5LYJB 4MVOA 1Q43A 2MW2B 4J10A 4NTWA 1N32B 5KA5A 1P7GA 4BR6A 4EB6B 1FFXB 1BE3H 1YDXA 2ZT9B 2EBOA 5GW7A 2IH1C 1R3LC 3ZIAG 4GKKO 4DV6B 3L74H 3AEIA 4O4JB 2LW7A 3KG2A 1N0JA 1VARA 3QTCA 3ABTA 1PNMA 2XAFA 2CH7B 3BA8A 3T1HO 1M5IA 4LFCB 5L3GA 3BABA 2QDOA 1FD9A 2YUAA 5LHIA 1BSMA 2P7TC 1CXZB 3JCUZ 4O2BB 3F7VC 4MTFA 1VQ8V 5K1XA 3IJ4A 2Z0AA 3JYCA 4JZ2A 3TJTA 1B6QA 3SPCA 4FM2A 1YEWA 1GN4A 1QVGU 4KP4A 1N34O 4CH3A 1YXBA 1JQ0A 5L3FA 2R9AA 3K5NA 1AP5A 1QLEC 3BPZA 4JAAA 1YJNV 4D7SA 1IDSA 3LSSA 2OCCB 1NR7A 3CRQA 3CCLV 3OM3B 1BQ0A 1N33O 2F66C 4FPPA 4W4KA 4LF5B 4MSWC 2E5LO 4AQYB 1JCHA 1K97A 4NKGB 3LDDA 2F95B 1OHHG 3MDSA 2OYQA 2ZR2A 2PI5A 3LSQA 4GKJO 4WFHA 3OEEG 4JAVA 3M99B 2W0FC 4MTXA 1SZXA 2Q73A 4DR2B 3FYIB 1ORQC 3B4SA 5FLXN 1XMOB 4NTXA 4X1YA 4DV7B 1EN4A 3CPWU 2KKWA 2X0LA 2XT9A 3THOA 2Q0AA 3GWKC 4DR5B 1HNXB 1AVMA 1HR0B 2ZKOA 2H94A 1G6UA 2YEVB 5LL6Y 4DV2B 3AG2C 4GX2A 2QGNA 3AK2A 1J5EB 5DECA 2YXLA 5JH7B 1PPJH 1RP3B 2ATKC 3TETA 5LP6C 4UCOA 4OPAA 3UO2A 4X62O 2IU3A 1G4YB 4J41A 2RMKB 3HPLC 4FZ1A 2IW5A 3SPIA 5EYPA 2WLJA 3FAVA 2M6YA 1Q6HA 2FKXA 2WLLB 4G2KA 3CSXA 1ZWIC 2ZE7A 2N04A 5A2QN 5CA0A 3BY6A 3SJCC 4TOIA 3ZEDA 1GKFA 1PM9A 4PELA 5EK0A 2QJ1A 1Q82W 3OFNG 1XNQO 4ASUG 3ASNB 3OMNB 3DXRB 1M90W 1S5HC 4JTDB 1QLEB 1QU7A 1M4UA 4LR3A 4X20A 3R65A 4DR3B 2UU9O 4PDVA 2HR3A 1Z5WA 1A32A 1UJWB 4LF8O 1G1XB 2DN9A 2PF4E 4IYHA 1K34A 3ZRWB 2GTSA 4NYKA 3F5WC 2Q67A 2F4VB 1IZ3A 4HZ3A 4YJ2B 4FLWA 1JOYA 2EX3A 3GVMA 3RFRA 3AG3B 1UFIA 1D5AA 2ZNIA 3C3SA 4R50A 4PA9A 1AJQA 4B3TO 3GB7C 1EZVH 4ZIBA 4JI6B 2G38A 2O57A 3P30A 1P4RA 5HFLA 3K57A 2XHBA 3VQWA 2YIBA 2ARHA 1TAEA 3QO7A 2IJIA 3X2QC 1TVKB 3S3XA 4PA3A 3SJQC 4KL1A 3AG2B 3N2KB 2ODMA 2RNBA 4ZOLB 1JJOA 1ZX3A 3DSQA 1N4CA 2Q9LA 3JD4A 1WA8B 2YI8A 5IYDO 4I0XB 1KKCA 4EFBA 2LFSA 5LP6B 3E8GA 3WU2Z 5IYBO 3K5LA 2YDEA 3VQVA 5LA6B 1Y66A 2LJ2A 1MA1A 3UO3A 1KP3A 1OCZC 3WB1A 4DR1O 1WB8A 4OXSA 2Q7EA 1NVPB 2D2CB 1NJIW 4DW1A 1IBKO 3ZMZA 5EBWC 2QA4V 5EZYA 4ZHQB 4TWKA 3B2EE 1H38A 3D3IA 2VQEB 3CC2V 4K8XA 3L9DA 2R9RB 1HDJA 1Q90D 2B5UA 1YTFB 2CH7A 3O65A 4UVCA 4MVRA 1Z2GA 3SYPA 4WFGA 1BMFG 4JI0B 3CRAA 3B77A 1R3JC 2EULA 2XAGA 1T5EA 2HKOA 2KB1A 3OE7G 1NS1A 3AK3A 5EIBC 4ZBMA 3ZMSA 4H13B 3A0RA 3QF7A 1U96A 2FTKA 4X89A 2JJ1G 2YC0A 4KXRA 5KUKA 1HNWB 3EHBB 3TGUH 3SR2C 2LGQA 1MABG 4PV1B 1FS0G 2Q68A 5BZBA 1XHZA 3D36C 1FJGB 4I4TA 4LFBB 4MW8A 2EZOA 1K5QA 2PYJA 1PNLA 1KD1W 4LFAB 1TUEB 2RJZA 3JSLA 1R1BA 4JI7B 4DV4B 3APQA 3IAYA 4BWAA 3C90A 3OGCC 5TISZ 3J81N 4P9OA 5FPRA 5L3DA 3X2QB 2CTWA 3TK1A 1S77D 3P32A 4B08A 4YHHO 4U7OA 3ZHUA 1ZLZA 2BE3A 1NQTA 4LNUB 2ZDIA 5JJJB 4UCRA 3HKDA 1SQFA 1KU9A 1FPOA 1D2DA 1H2GA 1TUBA 5CBGA 1K7DA 2WLIA 4GCZA 1XEQA 3KKYA 5LHHA 5H5NA 2ZR3A 2XTAA 1ROPA 3ZMTA 4PA7A 1QQCA 1I94B 1AB3A 1R3IC 1ZTEA 4DV3O 1PD3A 2FL4A 3ZMVA 4B3RO 1JFFB 3CMAV 3AK1A 4LF9O 1V55B 3S3WA 1BCCH 2WWWA 2V7QG 1FXVA 2JIZG 1WJZA 4X1YB 4DO2A 1L8DA 3ASOC 1GN6A 4IGGA 3CRMA 4H44B 5J9PC 1Y76B 1Q3EA 2UXDO 1AJNA 4GUNA 1EFRG 3P3NA 4KUMA 3DC5A 4GKKB 2DMXA 4DV5O 1PV0A 2AW9A 4YXWG 2GBOA 3NXSA 2W6JG 4UCTA 1TGOA 2ZNJA 3L71H 2KG7A 4UFZA 4DR7O 3ABLC 5LMUB 4K3AA 4O2AA 1Y4MA 2Y4UA 2UXNA 1DF5A 3BCCH 1O9HA 5KLVH 3E83A 4ICGA 3PJSK 3FAVB 1Y74B 1W2BU 3I55V 1NTKH 5KHHA 2Q0OC 1JPXA 4F6EA 1SZTA 1GK9A 1S72V 5CA0B 4DR6B 4I5SA 1XMQO 2JK5C 1CEZA 3HR0A 2Z3YA 4O4LA 1GO3F 1Q81W 5IJ0B 3ZRWA 4GX0A 5KHJA 3N2GA 4FLTA 1KECA 5KHIA 5IWAO 1QHTA 4X64O 3G6BA 4JI5B 3CC4V 1MSWD 4X20B 2UUAO 5HFMA 5LMNO 3W7SA 1LUWA 2OTLV 3P3PA 4G28B 4TUYA 1MSDA 4CBCA 1N36O 5GONB 1XUQA 1VMGA 1BS3A 3FX7A 4WFBV 3RBZA 2PYLA 1QNMA 2YICA 3B09A 1AP6A 1Q6UA 3STZC 1QLNA 3BVOA 3L75H 3OAAG 4MVQA 5GTHZ 4IHJA 3IC9A 3NR7A 4OX9O 3H01A 3I5DA 1WA8A 5LP6A 1GTOA 3CEIA 2FB5A 4DK0A 2P22C 5LA6A 2V1DA 4ZI7A 2IJKA 4LH6A 4DRXB 2NNUA 5CA1A 2QWPB 4U3FH 4B3MB 4JASA 4LF6O 4B3SO 4DV1O 3O9OA 2ZCEA 2IU0A 1NH2B 3E22B 2R70A 2Y4TA 5LGUA 1IVSA 3SGIA 2ZM6O 1B3QA 4LF7O 3ABLB 3B40A 3ETQA 4CH5A 1VQMV 3ICXA 3K0GA 4NXNO 1YF2A 4J80A 3JAWA 2CGNA 2ZE6A 2QM7A 3UKMA 4H0LB 5FL7G 3FD9A 3CCEV 5EZYB 4JV5O 3T4DA 3OR6C 1M9NA 4JTCB 4U7NA 4MVZA 2HEPA 2P5OA 5KHKA 3E89A 1XNQB 1FXKC 4PD4F 5DN6G 4DR4B 3WB0A 1HNZB 1V9PA 1QVFU 4NXMB 1Q8IA 3OUSA 2UU9B 5IY5C 4LP8A 3U11A 2JS5A 4LF8B 2DJVA 1WLEA 5FPOA 1OCRC 2BTQA 5BR8O 1W59A 4GX5A 2Q7HA 3VQYA 4UB6Z 3B8MA 2YXHA 3ABKB 5H2FZ 1FKAO 1SERA 3SYQA 2XAHA 5IJ9A 5CA3A 1XL4A 1H8HG 2ZE5A 3K9AA 4LNUA 3OTOO 2Y48A 2DYSC 3FB7C 4MVUA 3K3WA 5FNVA 4I4TB 1Z5VA 4Z1VA 1NTZH 1OCOB 1AILA 4HBNA 3D8CA 3JATB 4UV9A 3RYHA 5JCOC 4TV8A 4YJ3B 3AG4C 2QKCA 2ADQB 1JA8A 3M8AA 4JYCA 1LR1A 1JFFA 4J7JA 5CB4B 4X9QA 4CZZA 2QSAA 1R3KC 1FXHA 1SETA 3HKDB 2PI4A 4QGPA 2ZIOA 3ABMC 4TV9A 3G71V 4FFKA 2EINB 5JVDB 2RCVA 2H3OA 1TA8A 1TUBB 1FYJA 3SYOA 2QM8A 4N21A 2WLIB 2WAMA 4DR1B 1Y76A 1KP2A 3OMAB 1X4TA 4X65O 1NTMH 1K8AW 3G80A 3ZN1A 3T1CA 2UXCO 2LO1A 5H9CA 4E2LA 5J2UA 1V54C 3G67A 1KBHA 2HFEC 3CCRV 1G8MA 3QNEA 3F7YC 3A2FA 2MK3A 3ZHRA 3DTUB 3N27A 3BFRA 1YTFD 1Y74A 3W7XA 2UUCB 5C8YA 3FYEB 3LNMB 3R66A 3ML0A 1YHQV 3RWRD 2UXBB 3D36A 5KMGA 4QJFB 3CCSV 1S3JA 1M57C 2HVJC 3KZIZ 4UCUA 1OCRB 1ZSPA 2KG7B 5IJ0A 1MMMA 1J95A 3A8TA 4O2AB 2ITDC 2F23A 1SF9A 1JJ2U 2QKAA 3OGIB 3U10A 1U97A 4X1IA 2QWQB 2PTMA 3OD4A 5E1AC 4MTOA 4WFEA 3M7MX 3CE2A 1ZAUA 4O4LB 3AG1C 5GONA 5BMVA 3JALA 1SQPH 2VRZA 3CX5F 3N2GB 5KUMA 1DF4A 4PA4A 4O4HA 5KAIZ 5DM6V 5BY1A 3CWBH 4HAMA 4B7EA 4C7UA 4YHHB 2HP8A 2ZQMA 3IFXA 1SESA 3ZRXA 4Z1MG 3LUTB 5EC1C 3WG7C 2JS3A 2M7WA 3E8FA 1H8EG 1IBMO 4TUYB 3ABMB 1Q7YW 4LCUC 4DRXA 4YIPA 1Y67A 4BIZA 2CTRA 5L3BA 3FB8C 2AXTZ 1VQ4V 5JQGA 3PN1A 3CRRA 4FFBA 2PUSA 2CK3G 2FMLA 2JEXA 4DV3B 2BCCH 1VF5B 5LGNA 1VF6C 2JGUA 4IHJB 1EBOA 4LF5O 2XUMA 2LW1A 4O4IA 3E22A 2RDCA 1VEWA 1V54B 3JARA 3T2MA 3T1YO 4J42A 2IH3C 3J80N 2Q8VA 1NKDA 3GWOA 2Q69A 2ZINA 2EILC 4ZI7B 1VQ5V 3VBBA 5CA1B 1IBLO 5H6QA 2OTJV 3A0HZ 2DYRC 3RVYA 2CTQA 4HYOA 5LXTB 2UXDB 3W7UA 2QR4A 4DR2O 4DV5B 3K08A 1XMOO 1PNKA 1SQBH 4DV7O 5EBMC 1AI4A 2XAQA 3ZS8C 4DUYB 2BTOA 3BEHA 2WLKA 2P67A 4RQEA 4DV2O 1K4DC 2NN4A 3D3QA 3JAWB 2AZ2A 1J5EO 1OCCC 2OIGA 1XMQB 1F4MA 2CDYA 2R9IA 1WB7A 2DE0X 3LSUA 1THZA 3ZCCA 1JR9A 4NVPA 3K5OA 1BQZA 2ZIMA 1SQVH 5B1OA 3ETEA 2ZD9A 2CUGA 1VQOV 5B66Z 4X64B 3T4ZA 2HVKC 4G27B 3RW0A 2BOBC 4UXNA 5CBFA 3JAKB 1H2MA 3WG7B 4X66O 2DOSA 5K1PA 1F23A 3RN4A 4FMTA 2JEUA 3JATA 1VP7A 4WFFA 3JAMN 5CBHA 1N36B 1Y6XA 2BTQB 4RUEA 1YITV 4YJ3A 2ZXWC 2XASA 4JI3B 3CJHA 1WPXA 4DR3O 2JRIA 1E1QG 5IJ9B 1ZUQA 2BOCC 5CB4A 3EXAA 2F1MA 2NR5A 1AR5A 1M93A 1WNSA 1GMGA 4OX9B 5FNVB 4UV8A 1S76D 2IJHA 4WF9V 3ETGA 4PHZA 5JVDA 4EKWA 4I50A 1I5XA 2BSKA 3RYHB 4TV8B 2EILB 5J2TB 1OCZB 1N0NA 2P4KA 4JI1O 4LBEC 3B8NA 2DYRB 4LF6B 1D5NA 4B3SB 3VOUA 2X6AA 3RYCA 2GV9A 4JI6O 2EIJC 4DV0B 4MT8A 2B9ZA 3W7TA 4BAYA 2Q4PA 4P30A 4D6TH 3KCXA 4K0KB 4UCSA 2GHYA 4W4LA 5EBLC 3CXCU 2P4VA 1AI7A 3H1IH 4TV9B 1AI5A 3H9VA 4LF7B 4JZGA 1NH2D 1F7YA 1FXKA 4FM1A 4NXNB 4PI0A 4UVAA 1R6KA 1KQSU 2EJ7A 1X59A 1R73A 2QM4A 1SA0B 1IXMA 1HWYA 2LFRA 4FM0A 2WLNA 5J2UB 2L35A 1K92A 1YVWA 1AR4A 4D7TA 2Q5ZA 3LDCA 1ZL8B 1AI6A 3Q4HA 3T1HB 2UUBO 2PY5A 4IL6Z 3JD3A 1S0VA 2EIKC 1DGSA 4DUZO 5C8YB 3CS5A 2VQEO 1XBLA 4AILC 5KMGB 5IYZA 4LC1A 1IX9A 2PGGA 2Y69C 4TT3G 5JCOA 4PI2A 3ZHQA 4PJ0Z 4XBFA 5H6RA 4JI4O 1N34B 2ZXWB 4L87A 4FLVA 1QR8A 1PP9H 3CYOA 1SC5B 2CTPA 2QEXV 3SYCA 2E76B 4I9QA 3OTOB 4X1IB 3OEHG 2YS8A 1URFA 4QPKA 4JYAO 3SPHA 4N23A 2WPDG 1N33B 4CS4A 3K5MA 1JMKC 3ZMUA 4AI8A 5BMVB 2E5LB 3JALB 2HG5C 1M56C 1LNQA 4MS2A 4O4HB 3CC7V 1L0LH 3QO8A 4LWSA 2GSMB 4J9ZB 3DC6A 1FJGO 1SQQH 5IT9N 4U3JA 4GKJB 2CAZC 2W6IG 2LP7A 1I7FA 1JX9A 4JI2O 3K04A 4JI7O 3DGEA 1R6NA 2HHHO 5LGTA 1US6A 4WCEV 3HKCA 1XNRO 3ASOB 4AHCA 3E2EA 1P49A 5JQGB 2JGDA 5LXTA 3E35A 4FFBB 2AZ0A 5D5PA 2QWOB 5L3EA 5EC2C 3RYFB 4X65B 1WP7A 1H2LA 4CC5A 1JVMA 1FAFA 3BAAA 4MVSA 4O4IB 4KFMA 4FZ0A 3JARB 2DQ3A 3K59A 5KAFZ 4X62B 4RO2A 4BW9A 5IYCO 3CD6V 1GH6A 4R8CA 4HNAB 1SS3A 2EZPA 2QKSA 5LHGA 4OGQB 2V4DA 1RM1C 1NI8A 2F43G 1W0KG 3J7AU 2AGAA 1K3EA 3C3TA 1GM8A 4EEQA 1LUVA 2LGWA 1VQ9V 2YIDA 2VS0A 4L8JA 2Y69B 1S5JA 1WN7A 3BRCA 3ETDA 4IT5A 2H8PC 2ADPA 1RSOB 3SJAC 3FB6C 2C2AA 4IIJB 4X88A 1AJPA 4RUFA 1COWG 2K9PA 1YIJV 3UQ8A 4H37A 4KHPO 4QNHB 3JAKA 5DEDA 3CP1A 5LMUO 4K8ZA 2GUZA 4F6RB 1SQXH 4YY3O 4UUJC 1IURA 2ZE8A 1M56B 4QE7A 1E79G 1MOFA 2A9HA 1BHAA 4BIOA 4JI8O 2GDSA 1B06A 5B3SC 5AG2A 1GM9A 3STLC 1KMIZ 4GYCB 4DR6O 3ABUA 2X6CA 1VF6A 2AHYA 1DK1A 4FLXA 5CN0A 4B3TB 4JAUA 1MZEA 1F51A 2A0LA 1IBMB 2R72A 3ASNC 1GN2A 2W0XA 4MW3A 5CMUA 4J11A 2VQFO 2P90A 5J2TA 3H1LH 1VQ6V 2YSUB 4JI5O 4WFAV 4UCVA 3CJHB 4JYBA 1YZBA 1MZFA 4NB5A 1KKDA 2QWNB 3UCSC 3FFQA 3TXQA 3G6EV 1SRYA 3L72H 2IJJA 3E8HA 3OMIB 4PA6A 3T1YB 4UVBA 3RGBA 4I50B 1VQ7V 5GTIZ 2BSKB 3K79A 4QIWF 1IBLB 1QR9A 2N74A 3AG3C 3TCUA 3K0DA 4RWUA 3W7WA 1RM1B 2A79B 3FKSG 1IBKB 2JDIG 1BZKA 1KYOF 2IM9A 3RYCB 3ZBHA 1NVPD 1SA0A 4J7KA 1O9GA 4LF4O 4A5UB 2ILMA 1NU1H 4JF3A 4DYLA 3ZHVA 2L6LA 3CCVV 4B3MO 3KCYA 1ZL8A 4XDJA 4JPRA 1FXKB 2B1IA 2FYUH 1H2SB 1WAZA 4Q20A 4NTYA 1YCIA 3CCUV 1DTOA 5IY5B 3CRCA 3A0BZ 2E74B 4P9PA 3RYIA 2RN9A 2CE4A 5KX5B 1N32O 3K06A 3K03A 1KC8W 4J9YB 3QO5A 1VF7A 4JYYA 1S5LZ 3Q4HB 3ZHSA 1VQPV 3JD2A 5B3SB 1EM1A 5IE9A 4DV6O 4NR1A 3HB3B 3CCMV 4X1KA 2EIMC 2XAJA 5B1NA 2P6JA 2DYSB 4QPJA 4WBNA 2B1GA 5IYZB 4JGSA 1NT2B 2IBZH 4X66B 4TQFA 1I0HA 2RQ6A 4LFCO 4DR4O 5F2VO 1YJ9V 1HNZO 1XOUA 4NXMO 2VWKA 2N05A 3HKBB 4DW0A 3CHXA 4PDLA 4DK1A 2Z5UA 3AG4B 5LOVB 3EVKA 1B04A 1YI2V 3SYAA 1N8RW 2A3QA 1VIBA 2XOKG 3I56V 1L1FA 2ITCC 1XDCA 2Y0PA 1RPRA 3UT5A 5E79Z 3APOA 3ZN0A 4JI1B 1VQLV 1IXBA 5ITZA 2GTAA 3K58A 3RYFA 4LWSB 4U3JB 3QG5A 3K9SA 2OIEA 4B3RB 1BT8A 2WLHA 2HJDA 1OZ0A 4LF9B 4H33A 4I9WA 4J7ZA 5B1BC 3OW2U 4AQYO 1SKVA 3MHHC 3CXHF 2K1EA 1AR1B 1CP9A 1I5YA 4HNAA 3HKCB 4TSFG 1PL0A 4XDLA 1NZ6A 3JASA 2OCHA 3RVZA 2X6BA 3E86A 3CB2A 2QTOA 2JGDB 3OT7A
chains in the Genus database with same CATH topology
2F4VO 4B3TO 1J5EO 4GKKO 4JI2O 4JI8O 4DR7O 4JI7O 1F7YA 1N32O 2HHHO 4DR6O 2ZKOA 1R6TA 2LW7A 3M8AA 5LL6Y 1DK1A 1HNWO 2ZM6O 5BY1A 4LF7O 1XNRO 1X59A 4DV6O 1R1BA 4DR5O 3T1HO 1HNXO 1HR0O 4NXNO 1XMQO 4OPAA 2VQFO 4LFBO 4X62O 1FYJA 3J81N 4JI5O 4LFAO 1IBMO 4DV4O 4YHHO 4LFCO 4DR4O 3F5TA 4JV5O 1YZBA 4X65O 1HNZO 2UXCO 4JI3O 2UUBO 2Z0AA 2FKXA 4X66O 2DOSA 5IWAO 4NXMO 4X64O 4DR1O 4DUZO 5A2QN 3JAMN 1IBKO 2UUAO 5BXZA 2VQEO 5LMNO 1N34O 1D2DA 1KUQA 2UUCO 3J7AU 1XEQA 2AGAA 2UXBO 4LF5O 5H5NA 4DR3O 2JRIA 3SDLA 2N74A 1XNQO 1N36O 1AB3A 4JI4O 3T1YO 3RT3C 3J80N 4DV3O 2DJVA 4B3RO 1N33O 3R66A 1IBLO 4LF9O 3O65A 4LF4O 2UU9O 4A5UB 5BR8O 2E5LO 1I94O 1A32A 4LF8O 4DV0O 1FKAO 4JYAO 4DR2O 4OX9O 1G1XB 4B3MO 4DUYO 4K0KO 4JI1O 1XMOO 4KHPO 4GKJO 2UXDO 4DV7O 3OTOO 4JI0O 4OPHA 4AQYO 1NS1A 4JI6O 5LMUO 4DV5O 5FLXN 4YY3O 1AILA 4LF6O 4B3SO 1FJGO 5IT9N 4DV1O 4DV2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V O;  4B3T O;  1J5E O;  4GKK O;  4JI2 O;  4JI8 O;  4DR7 O;  4JI7 O;  1F7Y A;  1N32 O;  2HHH O;  4DR6 O;  2ZKO A;  1R6T A;  2LW7 A;  3M8A A;  5LL6 Y;  1DK1 A;  1HNW O;  2ZM6 O;  5BY1 A;  4LF7 O;  1XNR O;  1X59 A;  4DV6 O;  1R1B A;  4DR5 O;  3T1H O;  1HNX O;  1HR0 O;  4NXN O;  1XMQ O;  4OPA A;  2VQF O;  4LFB O;  4X62 O;  1FYJ A;  3J81 N;  4JI5 O;  4LFA O;  1IBM O;  4DV4 O;  4YHH O;  4LFC O;  4DR4 O;  3F5T A;  4JV5 O;  1YZB A;  4X65 O;  1HNZ O;  2UXC O;  4JI3 O;  2UUB O;  2Z0A A;  2FKX A;  4X66 O;  2DOS A;  5IWA O;  4NXM O;  4X64 O;  4DR1 O;  4DUZ O;  5A2Q N;  3JAM N;  1IBK O;  2UUA O;  5BXZ A;  2VQE O;  5LMN O;  1N34 O;  1D2D A;  1KUQ A;  2UUC O;  3J7A U;  1XEQ A;  2AGA A;  2UXB O;  4LF5 O;  5H5N A;  4DR3 O;  2JRI A;  3SDL A;  2N74 A;  1XNQ O;  1N36 O;  1AB3 A;  4JI4 O;  3T1Y O;  3RT3 C;  3J80 N;  4DV3 O;  2DJV A;  4B3R O;  1N33 O;  3R66 A;  1IBL O;  4LF9 O;  3O65 A;  4LF4 O;  2UU9 O;  4A5U B;  5BR8 O;  2E5L O;  1I94 O;  1A32 A;  4LF8 O;  4DV0 O;  1FKA O;  4JYA O;  4DR2 O;  4OX9 O;  1G1X B;  4B3M O;  4DUY O;  4K0K O;  4JI1 O;  1XMO O;  4KHP O;  4GKJ O;  2UXD O;  4DV7 O;  3OTO O;  4JI0 O;  4OPH A;  4AQY O;  1NS1 A;  4JI6 O;  5LMU O;  4DV5 O;  5FLX N;  4YY3 O;  1AIL A;  4LF6 O;  4B3S O;  1FJG O;  5IT9 N;  4DV1 O;  4DV2 O; 
#chains in the Genus database with same CATH topology
 1CPY A;  3LNN A;  4ABM A;  3HKE A;  3ZHT A;  3UM7 A;  3SPG A;  2QTS A;  4I55 B;  1E1R G;  4K35 A;  1R6T A;  5LYJ A;  1M57 B;  1BGY H;  1MNG A;  1KB9 F;  5JWP A;  1RSO A;  4EB6 A;  1FFX A;  3TXS A;  4DR7 B;  4DR5 O;  1MG1 A;  2UXX A;  4IIJ A;  1NBM G;  3IGA C;  1HNX O;  1HR0 O;  1K4C C;  5EIB D;  3H1H H;  2UUB B;  4DUZ B;  2EIM B;  1V55 C;  3L73 H;  4O4J A;  3F5T A;  1BHB A;  1GRJ A;  3BHP A;  4F6R A;  3AG1 B;  2E3C A;  5BXZ A;  3H1J H;  4JI4 B;  2UUC O;  2DWD C;  3JCZ A;  2UXB O;  4CH6 A;  5IWA B;  4O2B A;  3SDL A;  4LH7 A;  2UUA B;  5LMN B;  4QE9 A;  4MTG A;  1PKX A;  4JYA B;  4FJC C;  4F4L A;  2D3O W;  1VQN V;  2HLD G;  2GUZ B;  3OTF A;  2YI9 A;  5JJN B;  3WB2 A;  4CC6 A;  1ARO P;  2DQ0 A;  3FB5 C;  2YXY A;  1GN3 A;  2JJ2 G;  3CCJ V;  1YSC A;  2Q7G A;  5B1A C;  4JI2 B;  1XI1 A;  4GX1 A;  4CH4 A;  2HHH B;  3LDE A;  5B1B B;  1OV9 A;  2F4V O;  2KQX A;  2E75 B;  5C93 A;  1XNR B;  3WFV A;  4MVM A;  2OT5 A;  4TQD A;  5A9G A;  4BW5 A;  4BIU A;  3JD0 A;  4FLZ A;  1RPO A;  4EFE A;  4DV1 B;  3L70 H;  1Q6I A;  2YIB D;  4GT1 A;  4IYI A;  4Q6G A;  4RQF A;  4CS3 A;  1PL4 A;  1VQK V;  4XDK A;  2Y0I A;  4DXW A;  3QVN A;  4FLY A;  2ZM6 B;  2YIA A;  4GLX A;  2YEV A;  3JD1 A;  3JSN A;  3ZRS A;  5KA6 A;  1WP8 A;  2JVD A;  3MHS C;  5JH7 A;  1EZJ A;  1OCC B;  3VQX A;  4FK5 C;  2LQT A;  3BA9 A;  1QCE A;  4YIO A;  1W0J G;  4JV5 B;  2CGO A;  1WPB A;  3OUF A;  1KUQ A;  5B5E Z;  2NLJ C;  5KX5 A;  2PZS A;  4UB8 Z;  1L0N H;  2Q6A A;  2WLL A;  3RT3 C;  5JJE B;  1Q86 W;  1OJH A;  2A7W A;  1YJW V;  4KHP B;  4GZR B;  2P06 A;  3MD0 A;  4JTA B;  1M1K W;  3H1K H;  1UPG A;  2WLM A;  1BL8 A;  4DUY O;  5D5Q A;  3RYI B;  4YY3 B;  1GAX A;  3DXR A;  5BR8 B;  4JI0 O;  5EYP B;  3ZRV A;  4ZKI A;  3HKB A;  4JI8 B;  1XHX A;  5LOV A;  1XQ8 A;  4FLU A;  1HW7 A;  2OWO A;  1I08 A;  1P84 F;  4X1K B;  5L3C A;  5LBQ A;  5B1A B;  2WSS G;  1K33 A;  4WBN B;  4PDM A;  1XL6 A;  4CS2 A;  1H2K A;  2ETN A;  4YJ2 A;  2QWR B;  2VQF B;  1HNW O;  3OR7 C;  3E8B A;  3IC7 A;  1K5S A;  3ZX6 A;  1EN6 A;  2AHZ A;  2QE7 G;  4LFB O;  1Q5O A;  2EIJ B;  4LFA O;  4FVM A;  4DV4 O;  2F93 B;  2WA3 A;  2X7R B;  1FFT B;  3MAQ A;  1RFY A;  3UT5 B;  4JI3 O;  3ABK C;  1HP8 A;  3G4S V;  2EJR A;  4FIP C;  4RAI A;  4Z2W A;  1TVK A;  1GM7 A;  4PDR A;  2DW4 A;  1F4N A;  3AG7 A;  1K73 W;  3N2K A;  2OCC C;  4B7K A;  5ITZ B;  1DLB A;  4ZOL A;  4E4E A;  2UXC B;  3SPJ A;  1SQG A;  2KSD A;  4I0X A;  4I55 A;  1OCO C;  2VWJ A;  2WA4 A;  4I7Z B;  4LF4 B;  4X8A A;  1ENV A;  2XND G;  1P7B A;  3CME V;  2A06 H;  1NR1 A;  1EN5 A;  4P2Z A;  3EFF K;  1K9M W;  3U0Z A;  5KHG A;  4R6Z A;  1H2N A;  1XIL A;  5IDJ A;  1I94 O;  3JAS B;  4R7C A;  3CCQ V;  4DV0 O;  2ZDI C;  4ZHQ A;  2EIK B;  1XRE A;  3HKE B;  3SJB C;  4K0K O;  2DWE C;  3ZJZ A;  2HJF C;  4OPH A;  1QBZ A;  2EIN C;  5LYJ B;  4MVO A;  1Q43 A;  2MW2 B;  4J10 A;  4NTW A;  1N32 B;  5KA5 A;  1P7G A;  4BR6 A;  4EB6 B;  1FFX B;  1BE3 H;  1YDX A;  2ZT9 B;  2EBO A;  5GW7 A;  2IH1 C;  1R3L C;  3ZIA G;  4GKK O;  4DV6 B;  3L74 H;  3AEI A;  4O4J B;  2LW7 A;  3KG2 A;  1N0J A;  1VAR A;  3QTC A;  3ABT A;  1PNM A;  2XAF A;  2CH7 B;  3BA8 A;  3T1H O;  1M5I A;  4LFC B;  5L3G A;  3BAB A;  2QDO A;  1FD9 A;  2YUA A;  5LHI A;  1BSM A;  2P7T C;  1CXZ B;  3JCU Z;  4O2B B;  3F7V C;  4MTF A;  1VQ8 V;  5K1X A;  3IJ4 A;  2Z0A A;  3JYC A;  4JZ2 A;  3TJT A;  1B6Q A;  3SPC A;  4FM2 A;  1YEW A;  1GN4 A;  1QVG U;  4KP4 A;  1N34 O;  4CH3 A;  1YXB A;  1JQ0 A;  5L3F A;  2R9A A;  3K5N A;  1AP5 A;  1QLE C;  3BPZ A;  4JAA A;  1YJN V;  4D7S A;  1IDS A;  3LSS A;  2OCC B;  1NR7 A;  3CRQ A;  3CCL V;  3OM3 B;  1BQ0 A;  1N33 O;  2F66 C;  4FPP A;  4W4K A;  4LF5 B;  4MSW C;  2E5L O;  4AQY B;  1JCH A;  1K97 A;  4NKG B;  3LDD A;  2F95 B;  1OHH G;  3MDS A;  2OYQ A;  2ZR2 A;  2PI5 A;  3LSQ A;  4GKJ O;  4WFH A;  3OEE G;  4JAV A;  3M99 B;  2W0F C;  4MTX A;  1SZX A;  2Q73 A;  4DR2 B;  3FYI B;  1ORQ C;  3B4S A;  5FLX N;  1XMO B;  4NTX A;  4X1Y A;  4DV7 B;  1EN4 A;  3CPW U;  2KKW A;  2X0L A;  2XT9 A;  3THO A;  2Q0A A;  3GWK C;  4DR5 B;  1HNX B;  1AVM A;  1HR0 B;  2ZKO A;  2H94 A;  1G6U A;  2YEV B;  5LL6 Y;  4DV2 B;  3AG2 C;  4GX2 A;  2QGN A;  3AK2 A;  1J5E B;  5DEC A;  2YXL A;  5JH7 B;  1PPJ H;  1RP3 B;  2ATK C;  3TET A;  5LP6 C;  4UCO A;  4OPA A;  3UO2 A;  4X62 O;  2IU3 A;  1G4Y B;  4J41 A;  2RMK B;  3HPL C;  4FZ1 A;  2IW5 A;  3SPI A;  5EYP A;  2WLJ A;  3FAV A;  2M6Y A;  1Q6H A;  2FKX A;  2WLL B;  4G2K A;  3CSX A;  1ZWI C;  2ZE7 A;  2N04 A;  5A2Q N;  5CA0 A;  3BY6 A;  3SJC C;  4TOI A;  3ZED A;  1GKF A;  1PM9 A;  4PEL A;  5EK0 A;  2QJ1 A;  1Q82 W;  3OFN G;  1XNQ O;  4ASU G;  3ASN B;  3OMN B;  3DXR B;  1M90 W;  1S5H C;  4JTD B;  1QLE B;  1QU7 A;  1M4U A;  4LR3 A;  4X20 A;  3R65 A;  4DR3 B;  2UU9 O;  4PDV A;  2HR3 A;  1Z5W A;  1A32 A;  1UJW B;  4LF8 O;  1G1X B;  2DN9 A;  2PF4 E;  4IYH A;  1K34 A;  3ZRW B;  2GTS A;  4NYK A;  3F5W C;  2Q67 A;  2F4V B;  1IZ3 A;  4HZ3 A;  4YJ2 B;  4FLW A;  1JOY A;  2EX3 A;  3GVM A;  3RFR A;  3AG3 B;  1UFI A;  1D5A A;  2ZNI A;  3C3S A;  4R50 A;  4PA9 A;  1AJQ A;  4B3T O;  3GB7 C;  1EZV H;  4ZIB A;  4JI6 B;  2G38 A;  2O57 A;  3P30 A;  1P4R A;  5HFL A;  3K57 A;  2XHB A;  3VQW A;  2YIB A;  2ARH A;  1TAE A;  3QO7 A;  2IJI A;  3X2Q C;  1TVK B;  3S3X A;  4PA3 A;  3SJQ C;  4KL1 A;  3AG2 B;  3N2K B;  2ODM A;  2RNB A;  4ZOL B;  1JJO A;  1ZX3 A;  3DSQ A;  1N4C A;  2Q9L A;  3JD4 A;  1WA8 B;  2YI8 A;  5IYD O;  4I0X B;  1KKC A;  4EFB A;  2LFS A;  5LP6 B;  3E8G A;  3WU2 Z;  5IYB O;  3K5L A;  2YDE A;  3VQV A;  5LA6 B;  1Y66 A;  2LJ2 A;  1MA1 A;  3UO3 A;  1KP3 A;  1OCZ C;  3WB1 A;  4DR1 O;  1WB8 A;  4OXS A;  2Q7E A;  1NVP B;  2D2C B;  1NJI W;  4DW1 A;  1IBK O;  3ZMZ A;  5EBW C;  2QA4 V;  5EZY A;  4ZHQ B;  4TWK A;  3B2E E;  1H38 A;  3D3I A;  2VQE B;  3CC2 V;  4K8X A;  3L9D A;  2R9R B;  1HDJ A;  1Q90 D;  2B5U A;  1YTF B;  2CH7 A;  3O65 A;  4UVC A;  4MVR A;  1Z2G A;  3SYP A;  4WFG A;  1BMF G;  4JI0 B;  3CRA A;  3B77 A;  1R3J C;  2EUL A;  2XAG A;  1T5E A;  2HKO A;  2KB1 A;  3OE7 G;  1NS1 A;  3AK3 A;  5EIB C;  4ZBM A;  3ZMS A;  4H13 B;  3A0R A;  3QF7 A;  1U96 A;  2FTK A;  4X89 A;  2JJ1 G;  2YC0 A;  4KXR A;  5KUK A;  1HNW B;  3EHB B;  3TGU H;  3SR2 C;  2LGQ A;  1MAB G;  4PV1 B;  1FS0 G;  2Q68 A;  5BZB A;  1XHZ A;  3D36 C;  1FJG B;  4I4T A;  4LFB B;  4MW8 A;  2EZO A;  1K5Q A;  2PYJ A;  1PNL A;  1KD1 W;  4LFA B;  1TUE B;  2RJZ A;  3JSL A;  1R1B A;  4JI7 B;  4DV4 B;  3APQ A;  3IAY A;  4BWA A;  3C90 A;  3OGC C;  5TIS Z;  3J81 N;  4P9O A;  5FPR A;  5L3D A;  3X2Q B;  2CTW A;  3TK1 A;  1S77 D;  3P32 A;  4B08 A;  4YHH O;  4U7O A;  3ZHU A;  1ZLZ A;  2BE3 A;  1NQT A;  4LNU B;  2ZDI A;  5JJJ B;  4UCR A;  3HKD A;  1SQF A;  1KU9 A;  1FPO A;  1D2D A;  1H2G A;  1TUB A;  5CBG A;  1K7D A;  2WLI A;  4GCZ A;  1XEQ A;  3KKY A;  5LHH A;  5H5N A;  2ZR3 A;  2XTA A;  1ROP A;  3ZMT A;  4PA7 A;  1QQC A;  1I94 B;  1AB3 A;  1R3I C;  1ZTE A;  4DV3 O;  1PD3 A;  2FL4 A;  3ZMV A;  4B3R O;  1JFF B;  3CMA V;  3AK1 A;  4LF9 O;  1V55 B;  3S3W A;  1BCC H;  2WWW A;  2V7Q G;  1FXV A;  2JIZ G;  1WJZ A;  4X1Y B;  4DO2 A;  1L8D A;  3ASO C;  1GN6 A;  4IGG A;  3CRM A;  4H44 B;  5J9P C;  1Y76 B;  1Q3E A;  2UXD O;  1AJN A;  4GUN A;  1EFR G;  3P3N A;  4KUM A;  3DC5 A;  4GKK B;  2DMX A;  4DV5 O;  1PV0 A;  2AW9 A;  4YXW G;  2GBO A;  3NXS A;  2W6J G;  4UCT A;  1TGO A;  2ZNJ A;  3L71 H;  2KG7 A;  4UFZ A;  4DR7 O;  3ABL C;  5LMU B;  4K3A A;  4O2A A;  1Y4M A;  2Y4U A;  2UXN A;  1DF5 A;  3BCC H;  1O9H A;  5KLV H;  3E83 A;  4ICG A;  3PJS K;  3FAV B;  1Y74 B;  1W2B U;  3I55 V;  1NTK H;  5KHH A;  2Q0O C;  1JPX A;  4F6E A;  1SZT A;  1GK9 A;  1S72 V;  5CA0 B;  4DR6 B;  4I5S A;  1XMQ O;  2JK5 C;  1CEZ A;  3HR0 A;  2Z3Y A;  4O4L A;  1GO3 F;  1Q81 W;  5IJ0 B;  3ZRW A;  4GX0 A;  5KHJ A;  3N2G A;  4FLT A;  1KEC A;  5KHI A;  5IWA O;  1QHT A;  4X64 O;  3G6B A;  4JI5 B;  3CC4 V;  1MSW D;  4X20 B;  2UUA O;  5HFM A;  5LMN O;  3W7S A;  1LUW A;  2OTL V;  3P3P A;  4G28 B;  4TUY A;  1MSD A;  4CBC A;  1N36 O;  5GON B;  1XUQ A;  1VMG A;  1BS3 A;  3FX7 A;  4WFB V;  3RBZ A;  2PYL A;  1QNM A;  2YIC A;  3B09 A;  1AP6 A;  1Q6U A;  3STZ C;  1QLN A;  3BVO A;  3L75 H;  3OAA G;  4MVQ A;  5GTH Z;  4IHJ A;  3IC9 A;  3NR7 A;  4OX9 O;  3H01 A;  3I5D A;  1WA8 A;  5LP6 A;  1GTO A;  3CEI A;  2FB5 A;  4DK0 A;  2P22 C;  5LA6 A;  2V1D A;  4ZI7 A;  2IJK A;  4LH6 A;  4DRX B;  2NNU A;  5CA1 A;  2QWP B;  4U3F H;  4B3M B;  4JAS A;  4LF6 O;  4B3S O;  4DV1 O;  3O9O A;  2ZCE A;  2IU0 A;  1NH2 B;  3E22 B;  2R70 A;  2Y4T A;  5LGU A;  1IVS A;  3SGI A;  2ZM6 O;  1B3Q A;  4LF7 O;  3ABL B;  3B40 A;  3ETQ A;  4CH5 A;  1VQM V;  3ICX A;  3K0G A;  4NXN O;  1YF2 A;  4J80 A;  3JAW A;  2CGN A;  2ZE6 A;  2QM7 A;  3UKM A;  4H0L B;  5FL7 G;  3FD9 A;  3CCE V;  5EZY B;  4JV5 O;  3T4D A;  3OR6 C;  1M9N A;  4JTC B;  4U7N A;  4MVZ A;  2HEP A;  2P5O A;  5KHK A;  3E89 A;  1XNQ B;  1FXK C;  4PD4 F;  5DN6 G;  4DR4 B;  3WB0 A;  1HNZ B;  1V9P A;  1QVF U;  4NXM B;  1Q8I A;  3OUS A;  2UU9 B;  5IY5 C;  4LP8 A;  3U11 A;  2JS5 A;  4LF8 B;  2DJV A;  1WLE A;  5FPO A;  1OCR C;  2BTQ A;  5BR8 O;  1W59 A;  4GX5 A;  2Q7H A;  3VQY A;  4UB6 Z;  3B8M A;  2YXH A;  3ABK B;  5H2F Z;  1FKA O;  1SER A;  3SYQ A;  2XAH A;  5IJ9 A;  5CA3 A;  1XL4 A;  1H8H G;  2ZE5 A;  3K9A A;  4LNU A;  3OTO O;  2Y48 A;  2DYS C;  3FB7 C;  4MVU A;  3K3W A;  5FNV A;  4I4T B;  1Z5V A;  4Z1V A;  1NTZ H;  1OCO B;  1AIL A;  4HBN A;  3D8C A;  3JAT B;  4UV9 A;  3RYH A;  5JCO C;  4TV8 A;  4YJ3 B;  3AG4 C;  2QKC A;  2ADQ B;  1JA8 A;  3M8A A;  4JYC A;  1LR1 A;  1JFF A;  4J7J A;  5CB4 B;  4X9Q A;  4CZZ A;  2QSA A;  1R3K C;  1FXH A;  1SET A;  3HKD B;  2PI4 A;  4QGP A;  2ZIO A;  3ABM C;  4TV9 A;  3G71 V;  4FFK A;  2EIN B;  5JVD B;  2RCV A;  2H3O A;  1TA8 A;  1TUB B;  1FYJ A;  3SYO A;  2QM8 A;  4N21 A;  2WLI B;  2WAM A;  4DR1 B;  1Y76 A;  1KP2 A;  3OMA B;  1X4T A;  4X65 O;  1NTM H;  1K8A W;  3G80 A;  3ZN1 A;  3T1C A;  2UXC O;  2LO1 A;  5H9C A;  4E2L A;  5J2U A;  1V54 C;  3G67 A;  1KBH A;  2HFE C;  3CCR V;  1G8M A;  3QNE A;  3F7Y C;  3A2F A;  2MK3 A;  3ZHR A;  3DTU B;  3N27 A;  3BFR A;  1YTF D;  1Y74 A;  3W7X A;  2UUC B;  5C8Y A;  3FYE B;  3LNM B;  3R66 A;  3ML0 A;  1YHQ V;  3RWR D;  2UXB B;  3D36 A;  5KMG A;  4QJF B;  3CCS V;  1S3J A;  1M57 C;  2HVJ C;  3KZI Z;  4UCU A;  1OCR B;  1ZSP A;  2KG7 B;  5IJ0 A;  1MMM A;  1J95 A;  3A8T A;  4O2A B;  2ITD C;  2F23 A;  1SF9 A;  1JJ2 U;  2QKA A;  3OGI B;  3U10 A;  1U97 A;  4X1I A;  2QWQ B;  2PTM A;  3OD4 A;  5E1A C;  4MTO A;  4WFE A;  3M7M X;  3CE2 A;  1ZAU A;  4O4L B;  3AG1 C;  5GON A;  5BMV A;  3JAL A;  1SQP H;  2VRZ A;  3CX5 F;  3N2G B;  5KUM A;  1DF4 A;  4PA4 A;  4O4H A;  5KAI Z;  5DM6 V;  5BY1 A;  3CWB H;  4HAM A;  4B7E A;  4C7U A;  4YHH B;  2HP8 A;  2ZQM A;  3IFX A;  1SES A;  3ZRX A;  4Z1M G;  3LUT B;  5EC1 C;  3WG7 C;  2JS3 A;  2M7W A;  3E8F A;  1H8E G;  1IBM O;  4TUY B;  3ABM B;  1Q7Y W;  4LCU C;  4DRX A;  4YIP A;  1Y67 A;  4BIZ A;  2CTR A;  5L3B A;  3FB8 C;  2AXT Z;  1VQ4 V;  5JQG A;  3PN1 A;  3CRR A;  4FFB A;  2PUS A;  2CK3 G;  2FML A;  2JEX A;  4DV3 B;  2BCC H;  1VF5 B;  5LGN A;  1VF6 C;  2JGU A;  4IHJ B;  1EBO A;  4LF5 O;  2XUM A;  2LW1 A;  4O4I A;  3E22 A;  2RDC A;  1VEW A;  1V54 B;  3JAR A;  3T2M A;  3T1Y O;  4J42 A;  2IH3 C;  3J80 N;  2Q8V A;  1NKD A;  3GWO A;  2Q69 A;  2ZIN A;  2EIL C;  4ZI7 B;  1VQ5 V;  3VBB A;  5CA1 B;  1IBL O;  5H6Q A;  2OTJ V;  3A0H Z;  2DYR C;  3RVY A;  2CTQ A;  4HYO A;  5LXT B;  2UXD B;  3W7U A;  2QR4 A;  4DR2 O;  4DV5 B;  3K08 A;  1XMO O;  1PNK A;  1SQB H;  4DV7 O;  5EBM C;  1AI4 A;  2XAQ A;  3ZS8 C;  4DUY B;  2BTO A;  3BEH A;  2WLK A;  2P67 A;  4RQE A;  4DV2 O;  1K4D C;  2NN4 A;  3D3Q A;  3JAW B;  2AZ2 A;  1J5E O;  1OCC C;  2OIG A;  1XMQ B;  1F4M A;  2CDY A;  2R9I A;  1WB7 A;  2DE0 X;  3LSU A;  1THZ A;  3ZCC A;  1JR9 A;  4NVP A;  3K5O A;  1BQZ A;  2ZIM A;  1SQV H;  5B1O A;  3ETE A;  2ZD9 A;  2CUG A;  1VQO V;  5B66 Z;  4X64 B;  3T4Z A;  2HVK C;  4G27 B;  3RW0 A;  2BOB C;  4UXN A;  5CBF A;  3JAK B;  1H2M A;  3WG7 B;  4X66 O;  2DOS A;  5K1P A;  1F23 A;  3RN4 A;  4FMT A;  2JEU A;  3JAT A;  1VP7 A;  4WFF A;  3JAM N;  5CBH A;  1N36 B;  1Y6X A;  2BTQ B;  4RUE A;  1YIT V;  4YJ3 A;  2ZXW C;  2XAS A;  4JI3 B;  3CJH A;  1WPX A;  4DR3 O;  2JRI A;  1E1Q G;  5IJ9 B;  1ZUQ A;  2BOC C;  5CB4 A;  3EXA A;  2F1M A;  2NR5 A;  1AR5 A;  1M93 A;  1WNS A;  1GMG A;  4OX9 B;  5FNV B;  4UV8 A;  1S76 D;  2IJH A;  4WF9 V;  3ETG A;  4PHZ A;  5JVD A;  4EKW A;  4I50 A;  1I5X A;  2BSK A;  3RYH B;  4TV8 B;  2EIL B;  5J2T B;  1OCZ B;  1N0N A;  2P4K A;  4JI1 O;  4LBE C;  3B8N A;  2DYR B;  4LF6 B;  1D5N A;  4B3S B;  3VOU A;  2X6A A;  3RYC A;  2GV9 A;  4JI6 O;  2EIJ C;  4DV0 B;  4MT8 A;  2B9Z A;  3W7T A;  4BAY A;  2Q4P A;  4P30 A;  4D6T H;  3KCX A;  4K0K B;  4UCS A;  2GHY A;  4W4L A;  5EBL C;  3CXC U;  2P4V A;  1AI7 A;  3H1I H;  4TV9 B;  1AI5 A;  3H9V A;  4LF7 B;  4JZG A;  1NH2 D;  1F7Y A;  1FXK A;  4FM1 A;  4NXN B;  4PI0 A;  4UVA A;  1R6K A;  1KQS U;  2EJ7 A;  1X59 A;  1R73 A;  2QM4 A;  1SA0 B;  1IXM A;  1HWY A;  2LFR A;  4FM0 A;  2WLN A;  5J2U B;  2L35 A;  1K92 A;  1YVW A;  1AR4 A;  4D7T A;  2Q5Z A;  3LDC A;  1ZL8 B;  1AI6 A;  3Q4H A;  3T1H B;  2UUB O;  2PY5 A;  4IL6 Z;  3JD3 A;  1S0V A;  2EIK C;  1DGS A;  4DUZ O;  5C8Y B;  3CS5 A;  2VQE O;  1XBL A;  4AIL C;  5KMG B;  5IYZ A;  4LC1 A;  1IX9 A;  2PGG A;  2Y69 C;  4TT3 G;  5JCO A;  4PI2 A;  3ZHQ A;  4PJ0 Z;  4XBF A;  5H6R A;  4JI4 O;  1N34 B;  2ZXW B;  4L87 A;  4FLV A;  1QR8 A;  1PP9 H;  3CYO A;  1SC5 B;  2CTP A;  2QEX V;  3SYC A;  2E76 B;  4I9Q A;  3OTO B;  4X1I B;  3OEH G;  2YS8 A;  1URF A;  4QPK A;  4JYA O;  3SPH A;  4N23 A;  2WPD G;  1N33 B;  4CS4 A;  3K5M A;  1JMK C;  3ZMU A;  4AI8 A;  5BMV B;  2E5L B;  3JAL B;  2HG5 C;  1M56 C;  1LNQ A;  4MS2 A;  4O4H B;  3CC7 V;  1L0L H;  3QO8 A;  4LWS A;  2GSM B;  4J9Z B;  3DC6 A;  1FJG O;  1SQQ H;  5IT9 N;  4U3J A;  4GKJ B;  2CAZ C;  2W6I G;  2LP7 A;  1I7F A;  1JX9 A;  4JI2 O;  3K04 A;  4JI7 O;  3DGE A;  1R6N A;  2HHH O;  5LGT A;  1US6 A;  4WCE V;  3HKC A;  1XNR O;  3ASO B;  4AHC A;  3E2E A;  1P49 A;  5JQG B;  2JGD A;  5LXT A;  3E35 A;  4FFB B;  2AZ0 A;  5D5P A;  2QWO B;  5L3E A;  5EC2 C;  3RYF B;  4X65 B;  1WP7 A;  1H2L A;  4CC5 A;  1JVM A;  1FAF A;  3BAA A;  4MVS A;  4O4I B;  4KFM A;  4FZ0 A;  3JAR B;  2DQ3 A;  3K59 A;  5KAF Z;  4X62 B;  4RO2 A;  4BW9 A;  5IYC O;  3CD6 V;  1GH6 A;  4R8C A;  4HNA B;  1SS3 A;  2EZP A;  2QKS A;  5LHG A;  4OGQ B;  2V4D A;  1RM1 C;  1NI8 A;  2F43 G;  1W0K G;  3J7A U;  2AGA A;  1K3E A;  3C3T A;  1GM8 A;  4EEQ A;  1LUV A;  2LGW A;  1VQ9 V;  2YID A;  2VS0 A;  4L8J A;  2Y69 B;  1S5J A;  1WN7 A;  3BRC A;  3ETD A;  4IT5 A;  2H8P C;  2ADP A;  1RSO B;  3SJA C;  3FB6 C;  2C2A A;  4IIJ B;  4X88 A;  1AJP A;  4RUF A;  1COW G;  2K9P A;  1YIJ V;  3UQ8 A;  4H37 A;  4KHP O;  4QNH B;  3JAK A;  5DED A;  3CP1 A;  5LMU O;  4K8Z A;  2GUZ A;  4F6R B;  1SQX H;  4YY3 O;  4UUJ C;  1IUR A;  2ZE8 A;  1M56 B;  4QE7 A;  1E79 G;  1MOF A;  2A9H A;  1BHA A;  4BIO A;  4JI8 O;  2GDS A;  1B06 A;  5B3S C;  5AG2 A;  1GM9 A;  3STL C;  1KMI Z;  4GYC B;  4DR6 O;  3ABU A;  2X6C A;  1VF6 A;  2AHY A;  1DK1 A;  4FLX A;  5CN0 A;  4B3T B;  4JAU A;  1MZE A;  1F51 A;  2A0L A;  1IBM B;  2R72 A;  3ASN C;  1GN2 A;  2W0X A;  4MW3 A;  5CMU A;  4J11 A;  2VQF O;  2P90 A;  5J2T A;  3H1L H;  1VQ6 V;  2YSU B;  4JI5 O;  4WFA V;  4UCV A;  3CJH B;  4JYB A;  1YZB A;  1MZF A;  4NB5 A;  1KKD A;  2QWN B;  3UCS C;  3FFQ A;  3TXQ A;  3G6E V;  1SRY A;  3L72 H;  2IJJ A;  3E8H A;  3OMI B;  4PA6 A;  3T1Y B;  4UVB A;  3RGB A;  4I50 B;  1VQ7 V;  5GTI Z;  2BSK B;  3K79 A;  4QIW F;  1IBL B;  1QR9 A;  2N74 A;  3AG3 C;  3TCU A;  3K0D A;  4RWU A;  3W7W A;  1RM1 B;  2A79 B;  3FKS G;  1IBK B;  2JDI G;  1BZK A;  1KYO F;  2IM9 A;  3RYC B;  3ZBH A;  1NVP D;  1SA0 A;  4J7K A;  1O9G A;  4LF4 O;  4A5U B;  2ILM A;  1NU1 H;  4JF3 A;  4DYL A;  3ZHV A;  2L6L A;  3CCV V;  4B3M O;  3KCY A;  1ZL8 A;  4XDJ A;  4JPR A;  1FXK B;  2B1I A;  2FYU H;  1H2S B;  1WAZ A;  4Q20 A;  4NTY A;  1YCI A;  3CCU V;  1DTO A;  5IY5 B;  3CRC A;  3A0B Z;  2E74 B;  4P9P A;  3RYI A;  2RN9 A;  2CE4 A;  5KX5 B;  1N32 O;  3K06 A;  3K03 A;  1KC8 W;  4J9Y B;  3QO5 A;  1VF7 A;  4JYY A;  1S5L Z;  3Q4H B;  3ZHS A;  1VQP V;  3JD2 A;  5B3S B;  1EM1 A;  5IE9 A;  4DV6 O;  4NR1 A;  3HB3 B;  3CCM V;  4X1K A;  2EIM C;  2XAJ A;  5B1N A;  2P6J A;  2DYS B;  4QPJ A;  4WBN A;  2B1G A;  5IYZ B;  4JGS A;  1NT2 B;  2IBZ H;  4X66 B;  4TQF A;  1I0H A;  2RQ6 A;  4LFC O;  4DR4 O;  5F2V O;  1YJ9 V;  1HNZ O;  1XOU A;  4NXM O;  2VWK A;  2N05 A;  3HKB B;  4DW0 A;  3CHX A;  4PDL A;  4DK1 A;  2Z5U A;  3AG4 B;  5LOV B;  3EVK A;  1B04 A;  1YI2 V;  3SYA A;  1N8R W;  2A3Q A;  1VIB A;  2XOK G;  3I56 V;  1L1F A;  2ITC C;  1XDC A;  2Y0P A;  1RPR A;  3UT5 A;  5E79 Z;  3APO A;  3ZN0 A;  4JI1 B;  1VQL V;  1IXB A;  5ITZ A;  2GTA A;  3K58 A;  3RYF A;  4LWS B;  4U3J B;  3QG5 A;  3K9S A;  2OIE A;  4B3R B;  1BT8 A;  2WLH A;  2HJD A;  1OZ0 A;  4LF9 B;  4H33 A;  4I9W A;  4J7Z A;  5B1B C;  3OW2 U;  4AQY O;  1SKV A;  3MHH C;  3CXH F;  2K1E A;  1AR1 B;  1CP9 A;  1I5Y A;  4HNA A;  3HKC B;  4TSF G;  1PL0 A;  4XDL A;  1NZ6 A;  3JAS A;  2OCH A;  3RVZ A;  2X6B A;  3E86 A;  3CB2 A;  2QTO A;  2JGD B;  3OT7 A; 
#chains in the Genus database with same CATH homology
 2F4V O;  4B3T O;  1J5E O;  4GKK O;  4JI2 O;  4JI8 O;  4DR7 O;  4JI7 O;  1F7Y A;  1N32 O;  2HHH O;  4DR6 O;  2ZKO A;  1R6T A;  2LW7 A;  3M8A A;  5LL6 Y;  1DK1 A;  1HNW O;  2ZM6 O;  5BY1 A;  4LF7 O;  1XNR O;  1X59 A;  4DV6 O;  1R1B A;  4DR5 O;  3T1H O;  1HNX O;  1HR0 O;  4NXN O;  1XMQ O;  4OPA A;  2VQF O;  4LFB O;  4X62 O;  1FYJ A;  3J81 N;  4JI5 O;  4LFA O;  1IBM O;  4DV4 O;  4YHH O;  4LFC O;  4DR4 O;  3F5T A;  4JV5 O;  1YZB A;  4X65 O;  1HNZ O;  2UXC O;  4JI3 O;  2UUB O;  2Z0A A;  2FKX A;  4X66 O;  2DOS A;  5IWA O;  4NXM O;  4X64 O;  4DR1 O;  4DUZ O;  5A2Q N;  3JAM N;  1IBK O;  2UUA O;  5BXZ A;  2VQE O;  5LMN O;  1N34 O;  1D2D A;  1KUQ A;  2UUC O;  3J7A U;  1XEQ A;  2AGA A;  2UXB O;  4LF5 O;  5H5N A;  4DR3 O;  2JRI A;  3SDL A;  2N74 A;  1XNQ O;  1N36 O;  1AB3 A;  4JI4 O;  3T1Y O;  3RT3 C;  3J80 N;  4DV3 O;  2DJV A;  4B3R O;  1N33 O;  3R66 A;  1IBL O;  4LF9 O;  3O65 A;  4LF4 O;  2UU9 O;  4A5U B;  5BR8 O;  2E5L O;  1I94 O;  1A32 A;  4LF8 O;  4DV0 O;  1FKA O;  4JYA O;  4DR2 O;  4OX9 O;  1G1X B;  4B3M O;  4DUY O;  4K0K O;  4JI1 O;  1XMO O;  4KHP O;  4GKJ O;  2UXD O;  4DV7 O;  3OTO O;  4JI0 O;  4OPH A;  4AQY O;  1NS1 A;  4JI6 O;  5LMU O;  4DV5 O;  5FLX N;  4YY3 O;  1AIL A;  4LF6 O;  4B3S O;  1FJG O;  5IT9 N;  4DV1 O;  4DV2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...