4DV4O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv4O00
4B3TO 1XMQO 4LFCO 3T1YO 2JRIA 4DV7O 4GKJO 4JI3O 5BY1A 2DJVA 5FLXN 3J80N 4DV0O 2UXCO 4X64O 2VQEO 4DV1O 4DV4O 4NXMO 4B3SO 2DOSA 2AGAA 4OX9O 1N34O 4NXNO 4DR6O 2UUCO 5BXZA 3RT3C 3J7AU 2ZM6O 4YY3O 4A5UB 4DV5O 4JV5O 4DR1O 2N74A 3OTOO 4B3RO 1IBKO 3T1HO 2Z0AA 1FKAO 4OPHA 2VQFO 1R1BA 4X62O 4LF8O 2UXDO 1HR0O 2UUAO 1J5EO 4DV3O 1A32A 4DV6O 1D2DA 5BR8O 4JYAO 5A2QN 4LF5O 4JI1O 1XNRO 2F4VO 1FYJA 1HNXO 5H5NA 2UUBO 1AB3A 4JI0O 1YZBA 1DK1A 5LMUO 2LW7A 1IBLO 1FJGO 2ZKOA 1XEQA 4YHHO 4JI5O 4DR4O 4GKKO 4JI4O 4DR5O 1N36O 2UXBO 4LFAO 1IBMO 4JI8O 4KHPO 1HNWO 1NS1A 4DV2O 4DR3O 5LMNO 1I94O 4LF6O 4DR2O 3R66A 5LL6Y 1G1XB 1X59A 4X65O 4LFBO 4LF9O 3F5TA 3JAMN 4JI6O 2HHHO 4JI7O 1R6TA 1N33O 1KUQA 1HNZO 4OPAA 5IT9N 3J81N 4DR7O 3O65A 5IWAO 4DUZO 2E5LO 4X66O 4K0KO 4LF4O 4JI2O 1AILA 4B3MO 1N32O 1F7YA 4AQYO 1XNQO 2FKXA 4DUYO 2UU9O 1XMOO 3M8AA 3SDLA 4LF7O
chains in the Genus database with same CATH superfamily
2P4VA 5KHHA 4O2BA 4JI0B 4NXNB 1XMQO 4ZI7A 1SQPH 1W2BU 3CSXA 4DV7O 1US6A 1SF9A 1SZXA 5H6RA 2ZE8A 1ZLZA 1N34O 3FAVB 3X2QB 4WFBV 1PL4A 4YIPA 4EB6B 3AG4B 1Q90D 2YI9A 3JASA 3IC9A 1D5NA 1H2MA 1SA0B 2H3OA 3UKMA 3CPWU 1R6NA 4MTGA 3QO8A 5B1NA 3LSSA 1JPXA 2HHHB 4PA9A 3ZMVA 2OIGA 5CA1B 1S5JA 1P4RA 1RSOA 4GUNA 3ZRXA 4MSWC 4BR6A 3LSQA 2ZIOA 2M6YA 3B09A 3H1KH 2B1IA 3E86A 4FLTA 1WJZA 2QKSA 1ZX3A 4WFEA 1RM1B 4X64B 1N4CA 3CCEV 1OCOC 4C7UA 2RN9A 2MK3A 4MVRA 4LCUC 3BY6A 1MMMA 3TK1A 1BHBA 4I50A 4RWUA 2F95B 2YEVA 1BQ0A 4XDJA 1K8AW 2YIAA 2AZ0A 5C8YA 4JI1B 3MAQA 1M57B 2GTSA 3WB2A 2HVJC 3QO5A 1GK9A 2K1EA 1CPYA 3S3WA 1R3KC 3L72H 1X4TA 3JASB 2Y4UA 3CS5A 5LXTA 4B3TO 2EILB 4GX2A 4JV5B 4U7OA 3T1YO 3AG7A 3AG3C 3JATB 1S77D 3TJTA 3PN1A 4MVSA 2HVKC 2PI5A 1TVKA 1Q5OA 3RYFA 3OEEG 2QA4V 1JOYA 1KC8W 5GW7A 1BS3A 2N74A 4JASA 4LF6B 1M93A 2JGDA 3T1HO 2QWNB 2XAFA 4PA3A 1FXKA 1M90W 1FFXA 2LFRA 3D3QA 4H33A 4TV8B 4MTFA 3RGBA 1B3QA 5J9PC 5L3BA 4EKWA 1MSDA 5EC1C 2KKWA 4GT1A 4DYLA 1NVPD 2JIZG 3FYEB 3ZX6A 2LW7A 1OCZB 3OUSA 5IJ0A 4DR4O 1FFTB 3BCCH 2LFSA 4IYIA 2F1MA 5EYPA 1GRJA 4J9YB 5D5QA 3EFFK 4LWSB 3LDDA 4E4EA 1VQ9V 5IWAB 3H1HH 2VWJA 2R9RB 3G80A 2EIJC 1QQCA 3RYHB 4WF9V 3K3WA 5L3GA 3AK2A 3MHSC 4FIPC 3SR2C 2AZ2A 5JJJB 5L3CA 1F4NA 2RJZA 4FK5C 3HB3B 4Z1MG 1XI1A 2EZPA 3DXRB 4F6RA 2H94A 1W59A 4RQFA 1XDCA 4HAMA 2DJVA 2ZDIC 2QWPB 3SYCA 3SPJA 3D3IA 1YI2V 4NXMO 2DQ0A 1WP8A 4NXNO 3ZMTA 1TUBB 1YITV 1FPOA 2WSSG 2F4VB 2QJ1A 1XMQB 1QR9A 3OTOO 1Q6UA 3ABMB 2NN4A 3JCZA 2XUMA 2ETNA 1OHHG 4I9WA 4X1IB 2UUAO 1Y76B 4B3MB 1JFFA 2PTMA 5GTIZ 4GCZA 4HZ3A 1LR1A 1F51A 4UCTA 2HLDG 3H1IH 1OCCC 3ZBHA 4ZOLA 3CXHF 1FXKB 4FMTA 2ZD9A 4WBNA 3E8HA 4LF4B 3FB7C 2FYUH 4OX9B 4FZ0A 4W4KA 5KA5A 2PYJA 3FB6C 3RVYA 1H2KA 4I7ZB 1Q82W 2XAGA 3D36C 2Y69B 4N21A 1KYOF 1QLNA 3CCMV 2EJRA 3TXSA 4MT8A 2GDSA 3APOA 1B6QA 1YJNV 2W0XA 4I9QA 4JI6O 1VQMV 2ZCEA 4B3SB 5B1BC 2KQXA 3P3NA 3F5WC 4TV9A 4MW3A 1Y74A 5LHIA 3X2QC 1PD3A 1LUWA 4NYKA 3G4SV 2CTRA 1S5HC 2EIMB 5LOVB 2WLMA 2XT9A 4DV0B 2IJKA 2KB1A 5IYZA 1F23A 1SQFA 5BY1A 5CB4A 2BTQB 1Y66A 2DN9A 3DTUB 1WB7A 4JI4B 5KHKA 3ASNC 4DV4O 3L73H 3N27A 2YI8A 4HNAB 5IY5B 2ZNIA 4DR6O 1FXKC 5FNVA 3M7MX 4B7KA 3I55V 4H37A 4KXRA 2BOCC 1IBKO 1N8RW 2QTSA 4GLXA 4LF7B 3H1JH 3U11A 4FZ1A 3Q4HA 1W0KG 4PI0A 4DV3O 3U0ZA 1FAFA 3DGEA 1YVWA 2IM9A 4JI8B 1XNRO 2QKAA 2HR3A 3UM7A 5J2TB 1V54C 4FJCC 1FXVA 2PI4A 3DXRA 2IU3A 4GYCB 4JI3B 4PV1B 1KKCA 5BMVB 4DK0A 4YIOA 3ZHSA 1XREA 3N2GB 1VP7A 5CA0B 2LP7A 1LNQA 5LBQA 1QR8A 2ILMA 3B77A 4MVOA 1BT8A 1YIJV 2ZT9B 3OM3B 4KHPO 4JZGA 5JQGB 4U3JA 2P4KA 2EIKB 2UXBB 3RN4A 1SC5B 2DE0X 1AR1B 3W7TA 5LL6Y 4PHZA 2B1GA 4X65O 4GX1A 2B5UA 4K0KB 4DV3B 2XAJA 4YJ2B 3LDCA 2CTPA 3UO2A 4CH5A 5JWPA 5IWAO 3ZHRA 4NKGB 1R3JC 1QLEC 4B7EA 3RYIB 2ZQMA 4PDMA 5EIBC 4DW1A 1M4UA 2RNBA 1WP7A 5EZYA 1HNWB 1KQSU 3DSQA 3JALB 3FAVA 4DV4B 2PZSA 4LNUA 4IYHA 3ETDA 5B66Z 3K5OA 4DV0O 5LHGA 2C2AA 4DRXA 3A0RA 4DV5B 3JATA 1NKDA 1ZSPA 3MHHC 5HFLA 4ZI7B 4DV5O 3SYOA 2YC0A 3LUTB 1QBZA 3ZRWA 2E74B 5BMVA 1FKAO 4OPHA 4FM1A 1NR1A 3ZRVA 3JD4A 4NTWA 3CCUV 3AG3B 3QO7A 3BRCA 4XBFA 4I50B 5JQGA 4NB5A 5J2UA 4LF9B 2ADQB 3P30A 4ZOLB 2CK3G 5JVDA 4WFGA 5E1AC 5CA0A 2D2CB 1PL0A 1DTOA 3CRCA 4PD4F 5JCOC 2OCHA 2W0FC 2X6AA 4IHJB 3CHXA 4TQFA 3JAWA 1DLBA 1WNSA 3TCUA 3APQA 3CC7V 2UXBO 5H6QA 4CC5A 1S3JA 4JAVA 1FD9A 5LOVA 4GKJB 4DUZB 2YS8A 5CN0A 4X62B 4X89A 2HJFC 4PDVA 1YHQV 3ABTA 1GN4A 1EFRG 4DUYB 5JJEB 2XAQA 5DN6G 4X66O 3RYIA 1SQQH 3TXQA 5KX5A 1HP8A 2WLLA 4LFBB 1L0LH 3OMIB 2Q5ZA 3L75H 3T4DA 4D7SA 3N2KB 3STZC 3CJHB 1K4CC 4LH6A 1NH2D 1FFXB 3T1CA 4CS4A 2XTAA 3AEIA 2DMXA 3JAWB 3MD0A 3JD2A 3SGIA 1NTZH 3BPZA 2Z3YA 3UT5A 1YF2A 5B1OA 1O9HA 4DV1O 3K0GA 1URFA 4QIWF 1GM8A 1R3LC 3L70H 4OX9O 3IFXA 5BXZA 3J7AU 3GVMA 2JS5A 3CRRA 1I94B 1N0NA 2Q69A 4EEQA 1MABG 3THOA 1NJIW 2YUAA 4LF8O 2YXLA 2DYRC 1K92A 4UCVA 2CAZC 4JI2B 4K3AA 1IBKB 1SQBH 3HKDA 4PDRA 5AG2A 2N05A 4D7TA 1H2NA 5H5NA 2NR5A 2WPDG 3QTCA 1OCOB 2IH3C 4IL6Z 2XOKG 4X1YB 5TISZ 5LMUO 2W6JG 5EBMC 1SERA 1HW7A 5B1BB 4B08A 4GKKO 2YIBD 4R8CA 3F7VC 3S3XA 1VQNV 3NR7A 1IBLB 4UCRA 2QWRB 4JYBA 1ROPA 1K4DC 1MNGA 1KBHA 1WA8A 5KMGB 2QWQB 5EYPB 4DO2A 1PNKA 1GKFA 2QSAA 4G2KA 1I08A 3JAMN 1M56C 2HEPA 4O4LA 4BWAA 4YJ2A 4CH4A 2DYSC 1Q43A 1YDXA 5IT9N 4Q6GA 5A9GA 3G6BA 4HBNA 5DECA 2R9IA 4OXSA 1N32O 4HYOA 2F93B 3VQXA 1GTOA 5IJ9B 2BTOA 2UXXA 1T5EA 4UVBA 2EIJB 1YTFB 1NR7A 4I0XB 3ABKB 1U97A 2ZIMA 3LNMB 1NBMG 4DK1A 4BAYA 3BFRA 4O4IB 4LFAB 2WLLB 3T1YB 1XNRB 4OGQB 4B3TB 1AR5A 2UUCO 4LF5B 2ZM6O 4I4TA 4DR4B 2Q67A 4J10A 4U3JB 3HKDB 4DR7B 4O2BB 1H2LA 4Z1VA 3ZMUA 4P2ZA 1COWG 1XL6A 4I55A 4FLUA 4JGSA 2WLHA 2F4VO 4LR3A 4QJFB 2BSKA 3L9DA 2HFEC 1RP3B 3B8NA 2DWEC 5JVDB 4IGGA 4FLWA 3ZJZA 1JVMA 3SYPA 4G27B 2UXDB 5B1AC 3A8TA 2ATKC 5LMUB 3OE7G 3UT5B 1VF7A 4QGPA 2LO1A 1PV0A 2ZXWC 3WB0A 3SJCC 1TVKB 5EIBD 1BE3H 3FB5C 5LA6A 2XAHA 4ZHQB 1Y74B 5H9CA 1YCIA 4PA6A 1E79G 2HHHO 2Y4TA 4MTOA 1NH2B 3H9VA 5BZBA 2B9ZA 2PYLA 3OMNB 5KA6A 1JA8A 1VIBA 2VWKA 1F7YA 4NTXA 4DR1B 4Z2WA 4AI8A 1FJGB 4J41A 3OEHG 4I4TB 1KMIZ 1BHAA 4O4LB 4ICGA 3P32A 3JARB 3CCVV 3SPGA 2CUGA 1G8MA 3OR7C 4UCSA 1J5EB 3EHBB 1EN4A 2IU0A 2O57A 4BIUA 5LGTA 1KKDA 4QE7A 2H8PC 4NTYA 3I5DA 4DR1O 2G38A 1ZL8A 2IH1C 3K0DA 2OCCC 3CX5F 1AVMA 3ASOC 4QPKA 3Q4HB 1MZEA 2F43G 4PDLA 2ARHA 2LQTA 5KHJA 5EBWC 4CS3A 4W4LA 2HP8A 1SQGA 2R70A 4NVPA 4DR3B 1WA8B 5KMGA 1S76D 1IXMA 2OIEA 1Q8IA 2UUBO 3RBZA 3E22A 4LP8A 2BE3A 5CBFA 4JI5O 4JAUA 3AG4C 3OAAG 1M1KW 3CMEV 1YXBA 2OTLV 5GONB 2OT5A 3K5NA 3T2MA 3ZHTA 1K34A 3SJBC 2CGOA 4JYAB 3U10A 1VMGA 3K59A 3E89A 3BVOA 3W7WA 4LFBO 3OUFA 1F4MA 1YJ9V 1ZWIC 4FM0A 1R6TA 2UU9B 5IY5C 5B1AB 3CCSV 2YDEA 4OPAA 5EC2C 2PUSA 3HKCB 4J7JA 3NXSA 4DR7O 1YTFD 2GV9A 3H01A 2ZXWB 1CP9A 1L8DA 2DQ3A 4F6EA 4X8AA 4TUYA 1M57C 1OJHA 5KAFZ 1AI6A 4DXWA 2Y48A 2PF4E 5FLXN 3J80N 1I0HA 1UJWB 4RO2A 1AJPA 2IBZH 4CS2A 3OW2U 2WLIA 3SPHA 4JZ2A 2CH7A 4YY3O 2EULA 4N23A 4ZHQA 4B3RO 4LH7A 1AP5A 1XMOB 1VQLV 1XUQA 1R1BA 3VQVA 3HKEB 3ZMSA 3ZHQA 1K9MW 4DV6O 1TGOA 2LJ2A 1EBOA 2JJ1G 3QNEA 4MVMA 4JI1O 5H2FZ 2XNDG 1PPJH 1QVGU 3GWOA 1AB3A 2AHYA 1H38A 1XEQA 5LXTB 3HR0A 1DF5A 1MZFA 4FLYA 1SESA 1WB8A 1B06A 2QEXV 1Q6HA 3ZHUA 3ZS8C 2CTWA 1XQ8A 1IBMO 4JAAA 1HNWO 4DV2O 5BR8B 2GUZA 2KSDA 3JD1A 4U7NA 4LFCB 1G1XB 5IYDO 2A06H 3BAAA 2Q6AA 4UV9A 2JGUA 2GTAA 4L8JA 2YEVB 2K9PA 2AXTZ 2ADPA 1HNZO 4FFBB 1OCZC 3J81N 3HPLC 4JI2O 4X65B 2GBOA 4I0XA 4NR1A 2RQ6A 2EIKC 5FPOA 2YXYA 1BQZA 5FNVB 4KP4A 2JRIA 4KFMA 1V55C 2DYRB 1GN2A 3FD9A 2RMKB 4P9OA 5CB4B 1JQ0A 2UXCO 3K06A 4RUFA 2VQFB 1S72V 3SJAC 3W7UA 5JCOA 2OYQA 1PP9H 5K1PA 4DV6B 1H2GA 1GH6A 1WLEA 1JR9A 1K7DA 3E8GA 3OFNG 1EN6A 1HNXB 2VQFO 2QM4A 4TQDA 4UVCA 2XASA 2JS3A 3ZRWB 4XDLA 1A32A 2BSKB 1AI4A 2Q4PA 2QWOB 3QG5A 1M9NA 4DR5B 2ZR3A 4FM2A 2UUAB 3CP1A 3K9AA 1OCRB 2P6JA 1YZBA 3RYCA 1AP6A 3OT7A 1VF5B 5LGNA 1IX9A 2EINC 2MW2B 1GO3F 2ZM6B 1XBLA 1QVFU 3QVNA 5B5EZ 1VQ8V 2R9AA 5ITZB 4UB8Z 2GUZB 1PNMA 1PNLA 4TV8A 5KHIA 2QM8A 1VF6C 4BIZA 4PELA 2ZR2A 3OMAB 1K97A 4DR2O 3OD4A 1JCHA 3CC4V 1X59A 2PGGA 3H1LH 5JJNB 4LF9O 3TETA 3CD6V 3BABA 1N33O 3P3PA 2E3CA 2WLIB 1RPRA 1Y76A 5JH7A 2Q8VA 4FFKA 4QE9A 1J95A 1S0VA 3K5MA 1TAEA 4PJ0Z 3CRMA 4AQYO 1XNQO 1XMOO 3M8AA 3SDLA 4LF7O 2QKCA 4UCOA 1QU7A 1UPGA 2YIBA 2YSUB 1P7BA 3BHPA 3AG2B 3CJHA 4JI3O 4AILC 3VQYA 1XILA 2Q7GA 1SKVA 4IHJA 5B3SC 3K58A 3UQ8A 3ZCCA 3I56V 4IT5A 4LBEC 1WPBA 3RYCB 3CCJV 1G6UA 1JMKC 2JEUA 3TGUH 5CA1A 1SETA 4CH6A 3FB8C 4TOIA 1JX9A 1V55B 1NU1H 3ABLC 2EIMC 1QHTA 3RFRA 3CB2A 3LNNA 4YJ3A 4DR6B 4ZIBA 1L0NH 3RVZA 3AG1C 5KUKA 1GM9A 5KX5B 4MVUA 3E8FA 4JI6B 3JYCA 3A0BZ 1I5YA 3LDEA 2ZKOA 4YHHO 5ITZA 4JYCA 3IAYA 1R73A 2ITDC 2OTJV 4R50A 2HJDA 3WG7B 4DR2B 2RCVA 4GZRB 4UVAA 1QLEB 2WLNA 4JF3A 1AI7A 3OTFA 3VBBA 3OTOB 2E5LB 2LGWA 4AQYB 4DW0A 1XNQB 3UCSC 1OCRC 5LP6A 1CXZB 3OGIB 5LHHA 3SJQC 3F5TA 2UUBB 4L87A 1FS0G 4X1IA 1Q81W 3BA9A 1VQ4V 1KUQA 2V1DA 1VQOV 4LC1A 1DGSA 4MS2A 2E5LO 1R6KA 2P5OA 4GX0A 1RSOB 3SYQA 2ODMA 3T4ZA 1ZUQA 1E1RG 4YY3B 4QNHB 3AG2C 3ZEDA 3IJ4A 1Y4MA 4JYYA 3JSNA 3E83A 4LFCO 2FTKA 5L3FA 4GKJO 1K73W 3R65A 4WBNB 2F23A 2P7TC 3CRQA 2XHBA 4FLVA 1KU9A 2Q7HA 1EZJA 1XL4A 3QF7A 2DW4A 3SPIA 2IJIA 2BOBC 2R72A 1O9GA 5IJ9A 4IIJB 2UXNA 2JGDB 2FMLA 5IYBO 4UB6Z 4X9QA 2GSMB 5E79Z 1GN3A 4H13B 1E1QG 2JEXA 1G4YB 3BEHA 4WFHA 1J5EO 5HFMA 2WA4A 4O2AA 3KZIZ 2UUCB 3STLC 4LF5O 4GKKB 2N04A 3K9SA 1FYJA 1NT2B 3JSLA 3C90A 3DC6A 3A0HZ 2L35A 5FL7G 4UUJC 2A3QA 1FJGO 1AI5A 2QGNA 2M7WA 1HNZB 2WA3A 4UXNA 1XOUA 1Q6IA 4I5SA 1ENVA 4X1KB 4JTDB 4KUMA 3B40A 2L6LA 3LSUA 2W6IG 3D36A 5LGUA 2LGQA 1ZAUA 1BZKA 1I94O 4J7ZA 5KLVH 3DC5A 1L1FA 1N36B 3OR6C 1EM1A 1AROP 1QCEA 4X66B 4JI7O 3K04A 4X20A 2Y0PA 3RW0A 3E35A 2YIDA 4WFFA 4JPRA 2ZE7A 1AILA 2CDYA 4O4JA 4RAIA 4B3MO 1BL8A 4RQEA 4PA4A 1S5LZ 5LP6B 5LA6B 4CH3A 3T1HB 1MG1A 3FFQA 1HR0B 1H2SB 4BW9A 1IURA 1RFYA 2Q0OC 3EXAA 3JAKB 5CMUA 1VQKV 4DRXB 4X64O 1U96A 1KD1W 2DOSA 2CGNA 2QDOA 2ZINA 1WPXA 2QTOA 2ZDIA 1VQ7V 4FPPA 4A5UB 1K33A 3CCLV 2E75B 4JI7B 2GHYA 1IVSA 2D3OW 2VRZA 2YXHA 4EFEA 1RPOA 2UXDO 1HR0O 2EILC 3CYOA 1XHXA 2A79B 4PA7A 3HKBA 1MSWD 3KCYA 1NTKH 3AK1A 4BIOA 4WCEV 1K3EA 1HWYA 2Y0IA 4IIJA 3GB7C 1UFIA 3E8BA 1THZA 5KAIZ 1NVPB 4HNAA 1Y67A 4D6TH 3CWBH 2PY5A 4JI4O 1WAZA 3CEIA 4JTAB 5IE9A 1N36O 1NZ6A 3N2KA 1NTMH 1AJQA 3SYAA 3ZMZA 2BTQA 3G6EV 1B04A 5JH7B 2DWDC 4O4HA 1H8HG 2X6BA 2JK5C 3BA8A 2WAMA 4ZBMA 1YSCA 3HKBB 2VS0A 4TV9B 3CC2V 3E2EA 5LP6C 4UFZA 4DUZO 4K0KO 4DV2B 1M56B 3CCQV 4G28B 3JD3A 1XHZA 2P22C 1V9PA 2Q68A 4KL1A 3JARA 1MOFA 4O2AB 4E2LA 1I5XA 3WFVA 2A7WA 3K5LA 3AG1B 4ABMA 1I7FA 1JJOA 2EBOA 3RYFB 5GONA 4AHCA 1OZ0A 4JV5O 2JJ2G 3CE2A 3VQWA 2E76B 1CEZA 1VQPV 1Z2GA 3WU2Z 5DEDA 4EB6A 2NLJC 2AHZA 3M99B 1BMFG 3ABUA 3RWRD 5D5PA 1N33B 2JDIG 3ZRSA 4UV8A 3ABMC 2CTQA 2A0LA 4TWKA 2Q9LA 2X7RB 1RM1C 5C8YB 4GX5A 1DK1A 3K57A 1WN7A 1IBLO 1NQTA 4TUYB 4O4HB 1TUEB 5C93A 2HG5C 3B4SA 3G67A 5FPRA 3JAKA 5K1XA 3K79A 3JD0A 1AJNA 4CC6A 4R6ZA 3E22B 2LW1A 1GMGA 4LFAO 2QR4A 2EX3A 1KECA 3CMAV 3AK3A 3HKEA 4J42A 1Q7YW 5KHGA 3R66A 4P30A 3ML0A 4EFBA 4LF8B 2UXCB 1H8EG 3ETGA 1EZVH 2EINB 1BSMA 4X20B 4MW8A 2Y69C 4YHHB 1PM9A 2CE4A 3O65A 4CZZA 3K03A 4YXWG 4FLXA 4FVMA 3FYIB 4CBCA 5F2VO 3ETQA 3L74H 2VQEB 1M5IA 2JVDA 2KG7A 4LWSA 1N34B 1TUBA 4J80A 1P84F 4DV1B 3N2GA 4RUEA 4JI5B 3OGCC 1HDJA 3C3SA 1KB9F 4O4IA 2VQEO 1GM7A 4XDKA 2V4DA 4F6RB 4B3SO 3ZHVA 3O9OA 2ITCC 5LYJB 5LMNB 4K35A 2F66C 1IZ3A 5CA3A 3ZIAG 2X6CA 1MA1A 4X62O 1SRYA 1N0JA 3A2FA 3B8MA 2OCCB 2AW9A 2ZE6A 5BR8O 2QM7A 1LUVA 5DM6V 1IBMB 2EJ7A 3FX7A 3WB1A 1HNXO 4WFAV 4JI0O 4BW5A 1D5AA 4H0LB 2WLJA 1Q86W 4KHPB 3W7XA 3D8CA 1W0JG 3SPCA 1JJ2U 3ETEA 5IDJA 5IJ0B 4J11A 1Z5VA 5EZYB 5L3DA 1BCCH 1P7GA 1Y6XA 4J7KA 4DR5O 3MDSA 3GWKC 3JALA 1YJWV 2A9HA 4X1KA 3RYHA 5LMNO 3EVKA 1P49A 2DYSB 1Z5WA 5CBGA 1N32B 1ZL8B 2P90A 4O4JB 1V54B 4K8ZA 1FXHA 1QNMA 1SS3A 4UCUA 2HKOA 3ASNB 2IW5A 2ZNJA 3VOUA 2Q73A 1R3IC 1SQXH 4JTCB 4TSFG 2YICA 2FKXA 4DUYO 3ABKC 1IXBA 4LNUB 3ABLB 4FFBA 2FB5A 2FL4A 3ASOB 3ZN1A 1SZTA 3CCRV 4ZKIA 1OV9A 1SA0A 4MTXA 4ASUG 2NNUA 4P9PA 4QPJA 3IGAC 1EN5A 1OCCB 5EK0A 4F4LA 2P67A 2AGAA 2Q7EA 3K08A 3RT3C 4I55B 2KG7B 3FKSG 5J2UB 4FLZA 1SQVH 1K5QA 1JFFB 3B2EE 2Z0AA 5IYCO 1VQ6V 4X88A 1VQ5V 1GAXA 1VARA 2V7QG 1D2DA 5L3EA 5B3SB 4JYAO 1NI8A 5A2QN 1VF6A 3PJSK 2IJJA 4NXMB 1VEWA 2RDCA 1ORQC 1ZTEA 3L71H 1Q3EA 2OWOA 4J9ZB 4K8XA 3JCUZ 1AR4A 4B3RB 2BCCH 3WG7C 1KP3A 3KKYA 1GN6A 5GTHZ 5J2TA 1BGYH 1PKXA 3IC7A 4TT3G 3ZN0A 2EZOA 4YJ3B 2QE7G 4X1YA 4JI8O 5IYZB 1K5SA 4R7CA 4MVQA 2ZE5A 1YEWA 1NS1A 2WWWA 4DR3O 4DV7B 4LF6O 3C3TA 2Q0AA 5LYJA 5CBHA 2X0LA 3UO3A 5KUMA 4PI2A 2IJHA 4Q20A 4H44B 1KP2A 4U3FH 3HKCA 3KG2A 2Z5UA 1DF4A 3CXCU 3G71V 4LF4O 3F7YC 3CRAA 3KCXA 2CH7B 3ICXA 5EBLC 2WLKA 3W7SA 2P06A 2UU9O 1TA8A 1IDSA 4MVZA
chains in the Genus database with same CATH topology
4B3TO 1XMQO 4LFCO 3T1YO 2JRIA 4DV7O 4GKJO 4JI3O 5BY1A 2DJVA 5FLXN 3J80N 4DV0O 2UXCO 4X64O 2VQEO 4DV1O 4DV4O 4NXMO 4B3SO 2DOSA 2AGAA 4OX9O 1N34O 4NXNO 4DR6O 2UUCO 5BXZA 3RT3C 3J7AU 2ZM6O 4YY3O 4A5UB 4DV5O 4JV5O 4DR1O 2N74A 3OTOO 4B3RO 1IBKO 3T1HO 2Z0AA 1FKAO 4OPHA 2VQFO 1R1BA 4X62O 4LF8O 2UXDO 1HR0O 2UUAO 1J5EO 4DV3O 1A32A 4DV6O 1D2DA 5BR8O 4JYAO 5A2QN 4LF5O 4JI1O 1XNRO 2F4VO 1FYJA 1HNXO 5H5NA 2UUBO 1AB3A 4JI0O 1YZBA 1DK1A 5LMUO 2LW7A 1IBLO 1FJGO 2ZKOA 1XEQA 4YHHO 4JI5O 4DR4O 4GKKO 4JI4O 4DR5O 1N36O 2UXBO 4LFAO 1IBMO 4JI8O 4KHPO 1HNWO 1NS1A 4DV2O 4DR3O 5LMNO 1I94O 4LF6O 4DR2O 3R66A 5LL6Y 1G1XB 1X59A 4X65O 4LFBO 4LF9O 3F5TA 3JAMN 4JI6O 2HHHO 4JI7O 1R6TA 1N33O 1KUQA 1HNZO 4OPAA 5IT9N 3J81N 4DR7O 3O65A 5IWAO 4DUZO 2E5LO 4X66O 4K0KO 4LF4O 4JI2O 1AILA 4B3MO 1N32O 1F7YA 4AQYO 1XNQO 2FKXA 4DUYO 2UU9O 1XMOO 3M8AA 3SDLA 4LF7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  1XMQ O;  4LFC O;  3T1Y O;  2JRI A;  4DV7 O;  4GKJ O;  4JI3 O;  5BY1 A;  2DJV A;  5FLX N;  3J80 N;  4DV0 O;  2UXC O;  4X64 O;  2VQE O;  4DV1 O;  4DV4 O;  4NXM O;  4B3S O;  2DOS A;  2AGA A;  4OX9 O;  1N34 O;  4NXN O;  4DR6 O;  2UUC O;  5BXZ A;  3RT3 C;  3J7A U;  2ZM6 O;  4YY3 O;  4A5U B;  4DV5 O;  4JV5 O;  4DR1 O;  2N74 A;  3OTO O;  4B3R O;  1IBK O;  3T1H O;  2Z0A A;  1FKA O;  4OPH A;  2VQF O;  1R1B A;  4X62 O;  4LF8 O;  2UXD O;  1HR0 O;  2UUA O;  1J5E O;  4DV3 O;  1A32 A;  4DV6 O;  1D2D A;  5BR8 O;  4JYA O;  5A2Q N;  4LF5 O;  4JI1 O;  1XNR O;  2F4V O;  1FYJ A;  1HNX O;  5H5N A;  2UUB O;  1AB3 A;  4JI0 O;  1YZB A;  1DK1 A;  5LMU O;  2LW7 A;  1IBL O;  1FJG O;  2ZKO A;  1XEQ A;  4YHH O;  4JI5 O;  4DR4 O;  4GKK O;  4JI4 O;  4DR5 O;  1N36 O;  2UXB O;  4LFA O;  1IBM O;  4JI8 O;  4KHP O;  1HNW O;  1NS1 A;  4DV2 O;  4DR3 O;  5LMN O;  1I94 O;  4LF6 O;  4DR2 O;  3R66 A;  5LL6 Y;  1G1X B;  1X59 A;  4X65 O;  4LFB O;  4LF9 O;  3F5T A;  3JAM N;  4JI6 O;  2HHH O;  4JI7 O;  1R6T A;  1N33 O;  1KUQ A;  1HNZ O;  4OPA A;  5IT9 N;  3J81 N;  4DR7 O;  3O65 A;  5IWA O;  4DUZ O;  2E5L O;  4X66 O;  4K0K O;  4LF4 O;  4JI2 O;  1AIL A;  4B3M O;  1N32 O;  1F7Y A;  4AQY O;  1XNQ O;  2FKX A;  4DUY O;  2UU9 O;  1XMO O;  3M8A A;  3SDL A;  4LF7 O; 
#chains in the Genus database with same CATH topology
 2P4V A;  5KHH A;  4O2B A;  4JI0 B;  4NXN B;  1XMQ O;  4ZI7 A;  1SQP H;  1W2B U;  3CSX A;  4DV7 O;  1US6 A;  1SF9 A;  1SZX A;  5H6R A;  2ZE8 A;  1ZLZ A;  1N34 O;  3FAV B;  3X2Q B;  4WFB V;  1PL4 A;  4YIP A;  4EB6 B;  3AG4 B;  1Q90 D;  2YI9 A;  3JAS A;  3IC9 A;  1D5N A;  1H2M A;  1SA0 B;  2H3O A;  3UKM A;  3CPW U;  1R6N A;  4MTG A;  3QO8 A;  5B1N A;  3LSS A;  1JPX A;  2HHH B;  4PA9 A;  3ZMV A;  2OIG A;  5CA1 B;  1S5J A;  1P4R A;  1RSO A;  4GUN A;  3ZRX A;  4MSW C;  4BR6 A;  3LSQ A;  2ZIO A;  2M6Y A;  3B09 A;  3H1K H;  2B1I A;  3E86 A;  4FLT A;  1WJZ A;  2QKS A;  1ZX3 A;  4WFE A;  1RM1 B;  4X64 B;  1N4C A;  3CCE V;  1OCO C;  4C7U A;  2RN9 A;  2MK3 A;  4MVR A;  4LCU C;  3BY6 A;  1MMM A;  3TK1 A;  1BHB A;  4I50 A;  4RWU A;  2F95 B;  2YEV A;  1BQ0 A;  4XDJ A;  1K8A W;  2YIA A;  2AZ0 A;  5C8Y A;  4JI1 B;  3MAQ A;  1M57 B;  2GTS A;  3WB2 A;  2HVJ C;  3QO5 A;  1GK9 A;  2K1E A;  1CPY A;  3S3W A;  1R3K C;  3L72 H;  1X4T A;  3JAS B;  2Y4U A;  3CS5 A;  5LXT A;  4B3T O;  2EIL B;  4GX2 A;  4JV5 B;  4U7O A;  3T1Y O;  3AG7 A;  3AG3 C;  3JAT B;  1S77 D;  3TJT A;  3PN1 A;  4MVS A;  2HVK C;  2PI5 A;  1TVK A;  1Q5O A;  3RYF A;  3OEE G;  2QA4 V;  1JOY A;  1KC8 W;  5GW7 A;  1BS3 A;  2N74 A;  4JAS A;  4LF6 B;  1M93 A;  2JGD A;  3T1H O;  2QWN B;  2XAF A;  4PA3 A;  1FXK A;  1M90 W;  1FFX A;  2LFR A;  3D3Q A;  4H33 A;  4TV8 B;  4MTF A;  3RGB A;  1B3Q A;  5J9P C;  5L3B A;  4EKW A;  1MSD A;  5EC1 C;  2KKW A;  4GT1 A;  4DYL A;  1NVP D;  2JIZ G;  3FYE B;  3ZX6 A;  2LW7 A;  1OCZ B;  3OUS A;  5IJ0 A;  4DR4 O;  1FFT B;  3BCC H;  2LFS A;  4IYI A;  2F1M A;  5EYP A;  1GRJ A;  4J9Y B;  5D5Q A;  3EFF K;  4LWS B;  3LDD A;  4E4E A;  1VQ9 V;  5IWA B;  3H1H H;  2VWJ A;  2R9R B;  3G80 A;  2EIJ C;  1QQC A;  3RYH B;  4WF9 V;  3K3W A;  5L3G A;  3AK2 A;  3MHS C;  4FIP C;  3SR2 C;  2AZ2 A;  5JJJ B;  5L3C A;  1F4N A;  2RJZ A;  4FK5 C;  3HB3 B;  4Z1M G;  1XI1 A;  2EZP A;  3DXR B;  4F6R A;  2H94 A;  1W59 A;  4RQF A;  1XDC A;  4HAM A;  2DJV A;  2ZDI C;  2QWP B;  3SYC A;  3SPJ A;  3D3I A;  1YI2 V;  4NXM O;  2DQ0 A;  1WP8 A;  4NXN O;  3ZMT A;  1TUB B;  1YIT V;  1FPO A;  2WSS G;  2F4V B;  2QJ1 A;  1XMQ B;  1QR9 A;  3OTO O;  1Q6U A;  3ABM B;  2NN4 A;  3JCZ A;  2XUM A;  2ETN A;  1OHH G;  4I9W A;  4X1I B;  2UUA O;  1Y76 B;  4B3M B;  1JFF A;  2PTM A;  5GTI Z;  4GCZ A;  4HZ3 A;  1LR1 A;  1F51 A;  4UCT A;  2HLD G;  3H1I H;  1OCC C;  3ZBH A;  4ZOL A;  3CXH F;  1FXK B;  4FMT A;  2ZD9 A;  4WBN A;  3E8H A;  4LF4 B;  3FB7 C;  2FYU H;  4OX9 B;  4FZ0 A;  4W4K A;  5KA5 A;  2PYJ A;  3FB6 C;  3RVY A;  1H2K A;  4I7Z B;  1Q82 W;  2XAG A;  3D36 C;  2Y69 B;  4N21 A;  1KYO F;  1QLN A;  3CCM V;  2EJR A;  3TXS A;  4MT8 A;  2GDS A;  3APO A;  1B6Q A;  1YJN V;  2W0X A;  4I9Q A;  4JI6 O;  1VQM V;  2ZCE A;  4B3S B;  5B1B C;  2KQX A;  3P3N A;  3F5W C;  4TV9 A;  4MW3 A;  1Y74 A;  5LHI A;  3X2Q C;  1PD3 A;  1LUW A;  4NYK A;  3G4S V;  2CTR A;  1S5H C;  2EIM B;  5LOV B;  2WLM A;  2XT9 A;  4DV0 B;  2IJK A;  2KB1 A;  5IYZ A;  1F23 A;  1SQF A;  5BY1 A;  5CB4 A;  2BTQ B;  1Y66 A;  2DN9 A;  3DTU B;  1WB7 A;  4JI4 B;  5KHK A;  3ASN C;  4DV4 O;  3L73 H;  3N27 A;  2YI8 A;  4HNA B;  5IY5 B;  2ZNI A;  4DR6 O;  1FXK C;  5FNV A;  3M7M X;  4B7K A;  3I55 V;  4H37 A;  4KXR A;  2BOC C;  1IBK O;  1N8R W;  2QTS A;  4GLX A;  4LF7 B;  3H1J H;  3U11 A;  4FZ1 A;  3Q4H A;  1W0K G;  4PI0 A;  4DV3 O;  3U0Z A;  1FAF A;  3DGE A;  1YVW A;  2IM9 A;  4JI8 B;  1XNR O;  2QKA A;  2HR3 A;  3UM7 A;  5J2T B;  1V54 C;  4FJC C;  1FXV A;  2PI4 A;  3DXR A;  2IU3 A;  4GYC B;  4JI3 B;  4PV1 B;  1KKC A;  5BMV B;  4DK0 A;  4YIO A;  3ZHS A;  1XRE A;  3N2G B;  1VP7 A;  5CA0 B;  2LP7 A;  1LNQ A;  5LBQ A;  1QR8 A;  2ILM A;  3B77 A;  4MVO A;  1BT8 A;  1YIJ V;  2ZT9 B;  3OM3 B;  4KHP O;  4JZG A;  5JQG B;  4U3J A;  2P4K A;  2EIK B;  2UXB B;  3RN4 A;  1SC5 B;  2DE0 X;  1AR1 B;  3W7T A;  5LL6 Y;  4PHZ A;  2B1G A;  4X65 O;  4GX1 A;  2B5U A;  4K0K B;  4DV3 B;  2XAJ A;  4YJ2 B;  3LDC A;  2CTP A;  3UO2 A;  4CH5 A;  5JWP A;  5IWA O;  3ZHR A;  4NKG B;  1R3J C;  1QLE C;  4B7E A;  3RYI B;  2ZQM A;  4PDM A;  5EIB C;  4DW1 A;  1M4U A;  2RNB A;  1WP7 A;  5EZY A;  1HNW B;  1KQS U;  3DSQ A;  3JAL B;  3FAV A;  4DV4 B;  2PZS A;  4LNU A;  4IYH A;  3ETD A;  5B66 Z;  3K5O A;  4DV0 O;  5LHG A;  2C2A A;  4DRX A;  3A0R A;  4DV5 B;  3JAT A;  1NKD A;  1ZSP A;  3MHH C;  5HFL A;  4ZI7 B;  4DV5 O;  3SYO A;  2YC0 A;  3LUT B;  1QBZ A;  3ZRW A;  2E74 B;  5BMV A;  1FKA O;  4OPH A;  4FM1 A;  1NR1 A;  3ZRV A;  3JD4 A;  4NTW A;  3CCU V;  3AG3 B;  3QO7 A;  3BRC A;  4XBF A;  4I50 B;  5JQG A;  4NB5 A;  5J2U A;  4LF9 B;  2ADQ B;  3P30 A;  4ZOL B;  2CK3 G;  5JVD A;  4WFG A;  5E1A C;  5CA0 A;  2D2C B;  1PL0 A;  1DTO A;  3CRC A;  4PD4 F;  5JCO C;  2OCH A;  2W0F C;  2X6A A;  4IHJ B;  3CHX A;  4TQF A;  3JAW A;  1DLB A;  1WNS A;  3TCU A;  3APQ A;  3CC7 V;  2UXB O;  5H6Q A;  4CC5 A;  1S3J A;  4JAV A;  1FD9 A;  5LOV A;  4GKJ B;  4DUZ B;  2YS8 A;  5CN0 A;  4X62 B;  4X89 A;  2HJF C;  4PDV A;  1YHQ V;  3ABT A;  1GN4 A;  1EFR G;  4DUY B;  5JJE B;  2XAQ A;  5DN6 G;  4X66 O;  3RYI A;  1SQQ H;  3TXQ A;  5KX5 A;  1HP8 A;  2WLL A;  4LFB B;  1L0L H;  3OMI B;  2Q5Z A;  3L75 H;  3T4D A;  4D7S A;  3N2K B;  3STZ C;  3CJH B;  1K4C C;  4LH6 A;  1NH2 D;  1FFX B;  3T1C A;  4CS4 A;  2XTA A;  3AEI A;  2DMX A;  3JAW B;  3MD0 A;  3JD2 A;  3SGI A;  1NTZ H;  3BPZ A;  2Z3Y A;  3UT5 A;  1YF2 A;  5B1O A;  1O9H A;  4DV1 O;  3K0G A;  1URF A;  4QIW F;  1GM8 A;  1R3L C;  3L70 H;  4OX9 O;  3IFX A;  5BXZ A;  3J7A U;  3GVM A;  2JS5 A;  3CRR A;  1I94 B;  1N0N A;  2Q69 A;  4EEQ A;  1MAB G;  3THO A;  1NJI W;  2YUA A;  4LF8 O;  2YXL A;  2DYR C;  1K92 A;  4UCV A;  2CAZ C;  4JI2 B;  4K3A A;  1IBK B;  1SQB H;  3HKD A;  4PDR A;  5AG2 A;  2N05 A;  4D7T A;  1H2N A;  5H5N A;  2NR5 A;  2WPD G;  3QTC A;  1OCO B;  2IH3 C;  4IL6 Z;  2XOK G;  4X1Y B;  5TIS Z;  5LMU O;  2W6J G;  5EBM C;  1SER A;  1HW7 A;  5B1B B;  4B08 A;  4GKK O;  2YIB D;  4R8C A;  3F7V C;  3S3X A;  1VQN V;  3NR7 A;  1IBL B;  4UCR A;  2QWR B;  4JYB A;  1ROP A;  1K4D C;  1MNG A;  1KBH A;  1WA8 A;  5KMG B;  2QWQ B;  5EYP B;  4DO2 A;  1PNK A;  1GKF A;  2QSA A;  4G2K A;  1I08 A;  3JAM N;  1M56 C;  2HEP A;  4O4L A;  4BWA A;  4YJ2 A;  4CH4 A;  2DYS C;  1Q43 A;  1YDX A;  5IT9 N;  4Q6G A;  5A9G A;  3G6B A;  4HBN A;  5DEC A;  2R9I A;  4OXS A;  1N32 O;  4HYO A;  2F93 B;  3VQX A;  1GTO A;  5IJ9 B;  2BTO A;  2UXX A;  1T5E A;  4UVB A;  2EIJ B;  1YTF B;  1NR7 A;  4I0X B;  3ABK B;  1U97 A;  2ZIM A;  3LNM B;  1NBM G;  4DK1 A;  4BAY A;  3BFR A;  4O4I B;  4LFA B;  2WLL B;  3T1Y B;  1XNR B;  4OGQ B;  4B3T B;  1AR5 A;  2UUC O;  4LF5 B;  2ZM6 O;  4I4T A;  4DR4 B;  2Q67 A;  4J10 A;  4U3J B;  3HKD B;  4DR7 B;  4O2B B;  1H2L A;  4Z1V A;  3ZMU A;  4P2Z A;  1COW G;  1XL6 A;  4I55 A;  4FLU A;  4JGS A;  2WLH A;  2F4V O;  4LR3 A;  4QJF B;  2BSK A;  3L9D A;  2HFE C;  1RP3 B;  3B8N A;  2DWE C;  5JVD B;  4IGG A;  4FLW A;  3ZJZ A;  1JVM A;  3SYP A;  4G27 B;  2UXD B;  5B1A C;  3A8T A;  2ATK C;  5LMU B;  3OE7 G;  3UT5 B;  1VF7 A;  4QGP A;  2LO1 A;  1PV0 A;  2ZXW C;  3WB0 A;  3SJC C;  1TVK B;  5EIB D;  1BE3 H;  3FB5 C;  5LA6 A;  2XAH A;  4ZHQ B;  1Y74 B;  5H9C A;  1YCI A;  4PA6 A;  1E79 G;  2HHH O;  2Y4T A;  4MTO A;  1NH2 B;  3H9V A;  5BZB A;  2B9Z A;  2PYL A;  3OMN B;  5KA6 A;  1JA8 A;  1VIB A;  2VWK A;  1F7Y A;  4NTX A;  4DR1 B;  4Z2W A;  4AI8 A;  1FJG B;  4J41 A;  3OEH G;  4I4T B;  1KMI Z;  1BHA A;  4O4L B;  4ICG A;  3P32 A;  3JAR B;  3CCV V;  3SPG A;  2CUG A;  1G8M A;  3OR7 C;  4UCS A;  1J5E B;  3EHB B;  1EN4 A;  2IU0 A;  2O57 A;  4BIU A;  5LGT A;  1KKD A;  4QE7 A;  2H8P C;  4NTY A;  3I5D A;  4DR1 O;  2G38 A;  1ZL8 A;  2IH1 C;  3K0D A;  2OCC C;  3CX5 F;  1AVM A;  3ASO C;  4QPK A;  3Q4H B;  1MZE A;  2F43 G;  4PDL A;  2ARH A;  2LQT A;  5KHJ A;  5EBW C;  4CS3 A;  4W4L A;  2HP8 A;  1SQG A;  2R70 A;  4NVP A;  4DR3 B;  1WA8 B;  5KMG A;  1S76 D;  1IXM A;  2OIE A;  1Q8I A;  2UUB O;  3RBZ A;  3E22 A;  4LP8 A;  2BE3 A;  5CBF A;  4JI5 O;  4JAU A;  3AG4 C;  3OAA G;  1M1K W;  3CME V;  1YXB A;  2OTL V;  5GON B;  2OT5 A;  3K5N A;  3T2M A;  3ZHT A;  1K34 A;  3SJB C;  2CGO A;  4JYA B;  3U10 A;  1VMG A;  3K59 A;  3E89 A;  3BVO A;  3W7W A;  4LFB O;  3OUF A;  1F4M A;  1YJ9 V;  1ZWI C;  4FM0 A;  1R6T A;  2UU9 B;  5IY5 C;  5B1A B;  3CCS V;  2YDE A;  4OPA A;  5EC2 C;  2PUS A;  3HKC B;  4J7J A;  3NXS A;  4DR7 O;  1YTF D;  2GV9 A;  3H01 A;  2ZXW B;  1CP9 A;  1L8D A;  2DQ3 A;  4F6E A;  4X8A A;  4TUY A;  1M57 C;  1OJH A;  5KAF Z;  1AI6 A;  4DXW A;  2Y48 A;  2PF4 E;  5FLX N;  3J80 N;  1I0H A;  1UJW B;  4RO2 A;  1AJP A;  2IBZ H;  4CS2 A;  3OW2 U;  2WLI A;  3SPH A;  4JZ2 A;  2CH7 A;  4YY3 O;  2EUL A;  4N23 A;  4ZHQ A;  4B3R O;  4LH7 A;  1AP5 A;  1XMO B;  1VQL V;  1XUQ A;  1R1B A;  3VQV A;  3HKE B;  3ZMS A;  3ZHQ A;  1K9M W;  4DV6 O;  1TGO A;  2LJ2 A;  1EBO A;  2JJ1 G;  3QNE A;  4MVM A;  4JI1 O;  5H2F Z;  2XND G;  1PPJ H;  1QVG U;  3GWO A;  1AB3 A;  2AHY A;  1H38 A;  1XEQ A;  5LXT B;  3HR0 A;  1DF5 A;  1MZF A;  4FLY A;  1SES A;  1WB8 A;  1B06 A;  2QEX V;  1Q6H A;  3ZHU A;  3ZS8 C;  2CTW A;  1XQ8 A;  1IBM O;  4JAA A;  1HNW O;  4DV2 O;  5BR8 B;  2GUZ A;  2KSD A;  3JD1 A;  4U7N A;  4LFC B;  1G1X B;  5IYD O;  2A06 H;  3BAA A;  2Q6A A;  4UV9 A;  2JGU A;  2GTA A;  4L8J A;  2YEV B;  2K9P A;  2AXT Z;  2ADP A;  1HNZ O;  4FFB B;  1OCZ C;  3J81 N;  3HPL C;  4JI2 O;  4X65 B;  2GBO A;  4I0X A;  4NR1 A;  2RQ6 A;  2EIK C;  5FPO A;  2YXY A;  1BQZ A;  5FNV B;  4KP4 A;  2JRI A;  4KFM A;  1V55 C;  2DYR B;  1GN2 A;  3FD9 A;  2RMK B;  4P9O A;  5CB4 B;  1JQ0 A;  2UXC O;  3K06 A;  4RUF A;  2VQF B;  1S72 V;  3SJA C;  3W7U A;  5JCO A;  2OYQ A;  1PP9 H;  5K1P A;  4DV6 B;  1H2G A;  1GH6 A;  1WLE A;  1JR9 A;  1K7D A;  3E8G A;  3OFN G;  1EN6 A;  1HNX B;  2VQF O;  2QM4 A;  4TQD A;  4UVC A;  2XAS A;  2JS3 A;  3ZRW B;  4XDL A;  1A32 A;  2BSK B;  1AI4 A;  2Q4P A;  2QWO B;  3QG5 A;  1M9N A;  4DR5 B;  2ZR3 A;  4FM2 A;  2UUA B;  3CP1 A;  3K9A A;  1OCR B;  2P6J A;  1YZB A;  3RYC A;  1AP6 A;  3OT7 A;  1VF5 B;  5LGN A;  1IX9 A;  2EIN C;  2MW2 B;  1GO3 F;  2ZM6 B;  1XBL A;  1QVF U;  3QVN A;  5B5E Z;  1VQ8 V;  2R9A A;  5ITZ B;  4UB8 Z;  2GUZ B;  1PNM A;  1PNL A;  4TV8 A;  5KHI A;  2QM8 A;  1VF6 C;  4BIZ A;  4PEL A;  2ZR2 A;  3OMA B;  1K97 A;  4DR2 O;  3OD4 A;  1JCH A;  3CC4 V;  1X59 A;  2PGG A;  3H1L H;  5JJN B;  4LF9 O;  3TET A;  3CD6 V;  3BAB A;  1N33 O;  3P3P A;  2E3C A;  2WLI B;  1RPR A;  1Y76 A;  5JH7 A;  2Q8V A;  4FFK A;  4QE9 A;  1J95 A;  1S0V A;  3K5M A;  1TAE A;  4PJ0 Z;  3CRM A;  4AQY O;  1XNQ O;  1XMO O;  3M8A A;  3SDL A;  4LF7 O;  2QKC A;  4UCO A;  1QU7 A;  1UPG A;  2YIB A;  2YSU B;  1P7B A;  3BHP A;  3AG2 B;  3CJH A;  4JI3 O;  4AIL C;  3VQY A;  1XIL A;  2Q7G A;  1SKV A;  4IHJ A;  5B3S C;  3K58 A;  3UQ8 A;  3ZCC A;  3I56 V;  4IT5 A;  4LBE C;  1WPB A;  3RYC B;  3CCJ V;  1G6U A;  1JMK C;  2JEU A;  3TGU H;  5CA1 A;  1SET A;  4CH6 A;  3FB8 C;  4TOI A;  1JX9 A;  1V55 B;  1NU1 H;  3ABL C;  2EIM C;  1QHT A;  3RFR A;  3CB2 A;  3LNN A;  4YJ3 A;  4DR6 B;  4ZIB A;  1L0N H;  3RVZ A;  3AG1 C;  5KUK A;  1GM9 A;  5KX5 B;  4MVU A;  3E8F A;  4JI6 B;  3JYC A;  3A0B Z;  1I5Y A;  3LDE A;  2ZKO A;  4YHH O;  5ITZ A;  4JYC A;  3IAY A;  1R73 A;  2ITD C;  2OTJ V;  4R50 A;  2HJD A;  3WG7 B;  4DR2 B;  2RCV A;  4GZR B;  4UVA A;  1QLE B;  2WLN A;  4JF3 A;  1AI7 A;  3OTF A;  3VBB A;  3OTO B;  2E5L B;  2LGW A;  4AQY B;  4DW0 A;  1XNQ B;  3UCS C;  1OCR C;  5LP6 A;  1CXZ B;  3OGI B;  5LHH A;  3SJQ C;  3F5T A;  2UUB B;  4L87 A;  1FS0 G;  4X1I A;  1Q81 W;  3BA9 A;  1VQ4 V;  1KUQ A;  2V1D A;  1VQO V;  4LC1 A;  1DGS A;  4MS2 A;  2E5L O;  1R6K A;  2P5O A;  4GX0 A;  1RSO B;  3SYQ A;  2ODM A;  3T4Z A;  1ZUQ A;  1E1R G;  4YY3 B;  4QNH B;  3AG2 C;  3ZED A;  3IJ4 A;  1Y4M A;  4JYY A;  3JSN A;  3E83 A;  4LFC O;  2FTK A;  5L3F A;  4GKJ O;  1K73 W;  3R65 A;  4WBN B;  2F23 A;  2P7T C;  3CRQ A;  2XHB A;  4FLV A;  1KU9 A;  2Q7H A;  1EZJ A;  1XL4 A;  3QF7 A;  2DW4 A;  3SPI A;  2IJI A;  2BOB C;  2R72 A;  1O9G A;  5IJ9 A;  4IIJ B;  2UXN A;  2JGD B;  2FML A;  5IYB O;  4UB6 Z;  4X9Q A;  2GSM B;  5E79 Z;  1GN3 A;  4H13 B;  1E1Q G;  2JEX A;  1G4Y B;  3BEH A;  4WFH A;  1J5E O;  5HFM A;  2WA4 A;  4O2A A;  3KZI Z;  2UUC B;  3STL C;  4LF5 O;  4GKK B;  2N04 A;  3K9S A;  1FYJ A;  1NT2 B;  3JSL A;  3C90 A;  3DC6 A;  3A0H Z;  2L35 A;  5FL7 G;  4UUJ C;  2A3Q A;  1FJG O;  1AI5 A;  2QGN A;  2M7W A;  1HNZ B;  2WA3 A;  4UXN A;  1XOU A;  1Q6I A;  4I5S A;  1ENV A;  4X1K B;  4JTD B;  4KUM A;  3B40 A;  2L6L A;  3LSU A;  2W6I G;  3D36 A;  5LGU A;  2LGQ A;  1ZAU A;  1BZK A;  1I94 O;  4J7Z A;  5KLV H;  3DC5 A;  1L1F A;  1N36 B;  3OR6 C;  1EM1 A;  1ARO P;  1QCE A;  4X66 B;  4JI7 O;  3K04 A;  4X20 A;  2Y0P A;  3RW0 A;  3E35 A;  2YID A;  4WFF A;  4JPR A;  2ZE7 A;  1AIL A;  2CDY A;  4O4J A;  4RAI A;  4B3M O;  1BL8 A;  4RQE A;  4PA4 A;  1S5L Z;  5LP6 B;  5LA6 B;  4CH3 A;  3T1H B;  1MG1 A;  3FFQ A;  1HR0 B;  1H2S B;  4BW9 A;  1IUR A;  1RFY A;  2Q0O C;  3EXA A;  3JAK B;  5CMU A;  1VQK V;  4DRX B;  4X64 O;  1U96 A;  1KD1 W;  2DOS A;  2CGN A;  2QDO A;  2ZIN A;  1WPX A;  2QTO A;  2ZDI A;  1VQ7 V;  4FPP A;  4A5U B;  1K33 A;  3CCL V;  2E75 B;  4JI7 B;  2GHY A;  1IVS A;  2D3O W;  2VRZ A;  2YXH A;  4EFE A;  1RPO A;  2UXD O;  1HR0 O;  2EIL C;  3CYO A;  1XHX A;  2A79 B;  4PA7 A;  3HKB A;  1MSW D;  3KCY A;  1NTK H;  3AK1 A;  4BIO A;  4WCE V;  1K3E A;  1HWY A;  2Y0I A;  4IIJ A;  3GB7 C;  1UFI A;  3E8B A;  1THZ A;  5KAI Z;  1NVP B;  4HNA A;  1Y67 A;  4D6T H;  3CWB H;  2PY5 A;  4JI4 O;  1WAZ A;  3CEI A;  4JTA B;  5IE9 A;  1N36 O;  1NZ6 A;  3N2K A;  1NTM H;  1AJQ A;  3SYA A;  3ZMZ A;  2BTQ A;  3G6E V;  1B04 A;  5JH7 B;  2DWD C;  4O4H A;  1H8H G;  2X6B A;  2JK5 C;  3BA8 A;  2WAM A;  4ZBM A;  1YSC A;  3HKB B;  2VS0 A;  4TV9 B;  3CC2 V;  3E2E A;  5LP6 C;  4UFZ A;  4DUZ O;  4K0K O;  4DV2 B;  1M56 B;  3CCQ V;  4G28 B;  3JD3 A;  1XHZ A;  2P22 C;  1V9P A;  2Q68 A;  4KL1 A;  3JAR A;  1MOF A;  4O2A B;  4E2L A;  1I5X A;  3WFV A;  2A7W A;  3K5L A;  3AG1 B;  4ABM A;  1I7F A;  1JJO A;  2EBO A;  3RYF B;  5GON A;  4AHC A;  1OZ0 A;  4JV5 O;  2JJ2 G;  3CE2 A;  3VQW A;  2E76 B;  1CEZ A;  1VQP V;  1Z2G A;  3WU2 Z;  5DED A;  4EB6 A;  2NLJ C;  2AHZ A;  3M99 B;  1BMF G;  3ABU A;  3RWR D;  5D5P A;  1N33 B;  2JDI G;  3ZRS A;  4UV8 A;  3ABM C;  2CTQ A;  2A0L A;  4TWK A;  2Q9L A;  2X7R B;  1RM1 C;  5C8Y B;  4GX5 A;  1DK1 A;  3K57 A;  1WN7 A;  1IBL O;  1NQT A;  4TUY B;  4O4H B;  1TUE B;  5C93 A;  2HG5 C;  3B4S A;  3G67 A;  5FPR A;  3JAK A;  5K1X A;  3K79 A;  3JD0 A;  1AJN A;  4CC6 A;  4R6Z A;  3E22 B;  2LW1 A;  1GMG A;  4LFA O;  2QR4 A;  2EX3 A;  1KEC A;  3CMA V;  3AK3 A;  3HKE A;  4J42 A;  1Q7Y W;  5KHG A;  3R66 A;  4P30 A;  3ML0 A;  4EFB A;  4LF8 B;  2UXC B;  1H8E G;  3ETG A;  1EZV H;  2EIN B;  1BSM A;  4X20 B;  4MW8 A;  2Y69 C;  4YHH B;  1PM9 A;  2CE4 A;  3O65 A;  4CZZ A;  3K03 A;  4YXW G;  4FLX A;  4FVM A;  3FYI B;  4CBC A;  5F2V O;  3ETQ A;  3L74 H;  2VQE B;  1M5I A;  2JVD A;  2KG7 A;  4LWS A;  1N34 B;  1TUB A;  4J80 A;  1P84 F;  4DV1 B;  3N2G A;  4RUE A;  4JI5 B;  3OGC C;  1HDJ A;  3C3S A;  1KB9 F;  4O4I A;  2VQE O;  1GM7 A;  4XDK A;  2V4D A;  4F6R B;  4B3S O;  3ZHV A;  3O9O A;  2ITC C;  5LYJ B;  5LMN B;  4K35 A;  2F66 C;  1IZ3 A;  5CA3 A;  3ZIA G;  2X6C A;  1MA1 A;  4X62 O;  1SRY A;  1N0J A;  3A2F A;  3B8M A;  2OCC B;  2AW9 A;  2ZE6 A;  5BR8 O;  2QM7 A;  1LUV A;  5DM6 V;  1IBM B;  2EJ7 A;  3FX7 A;  3WB1 A;  1HNX O;  4WFA V;  4JI0 O;  4BW5 A;  1D5A A;  4H0L B;  2WLJ A;  1Q86 W;  4KHP B;  3W7X A;  3D8C A;  1W0J G;  3SPC A;  1JJ2 U;  3ETE A;  5IDJ A;  5IJ0 B;  4J11 A;  1Z5V A;  5EZY B;  5L3D A;  1BCC H;  1P7G A;  1Y6X A;  4J7K A;  4DR5 O;  3MDS A;  3GWK C;  3JAL A;  1YJW V;  2A9H A;  4X1K A;  3RYH A;  5LMN O;  3EVK A;  1P49 A;  2DYS B;  1Z5W A;  5CBG A;  1N32 B;  1ZL8 B;  2P90 A;  4O4J B;  1V54 B;  4K8Z A;  1FXH A;  1QNM A;  1SS3 A;  4UCU A;  2HKO A;  3ASN B;  2IW5 A;  2ZNJ A;  3VOU A;  2Q73 A;  1R3I C;  1SQX H;  4JTC B;  4TSF G;  2YIC A;  2FKX A;  4DUY O;  3ABK C;  1IXB A;  4LNU B;  3ABL B;  4FFB A;  2FB5 A;  2FL4 A;  3ASO B;  3ZN1 A;  1SZT A;  3CCR V;  4ZKI A;  1OV9 A;  1SA0 A;  4MTX A;  4ASU G;  2NNU A;  4P9P A;  4QPJ A;  3IGA C;  1EN5 A;  1OCC B;  5EK0 A;  4F4L A;  2P67 A;  2AGA A;  2Q7E A;  3K08 A;  3RT3 C;  4I55 B;  2KG7 B;  3FKS G;  5J2U B;  4FLZ A;  1SQV H;  1K5Q A;  1JFF B;  3B2E E;  2Z0A A;  5IYC O;  1VQ6 V;  4X88 A;  1VQ5 V;  1GAX A;  1VAR A;  2V7Q G;  1D2D A;  5L3E A;  5B3S B;  4JYA O;  1NI8 A;  5A2Q N;  1VF6 A;  3PJS K;  2IJJ A;  4NXM B;  1VEW A;  2RDC A;  1ORQ C;  1ZTE A;  3L71 H;  1Q3E A;  2OWO A;  4J9Z B;  4K8X A;  3JCU Z;  1AR4 A;  4B3R B;  2BCC H;  3WG7 C;  1KP3 A;  3KKY A;  1GN6 A;  5GTH Z;  5J2T A;  1BGY H;  1PKX A;  3IC7 A;  4TT3 G;  3ZN0 A;  2EZO A;  4YJ3 B;  2QE7 G;  4X1Y A;  4JI8 O;  5IYZ B;  1K5S A;  4R7C A;  4MVQ A;  2ZE5 A;  1YEW A;  1NS1 A;  2WWW A;  4DR3 O;  4DV7 B;  4LF6 O;  3C3T A;  2Q0A A;  5LYJ A;  5CBH A;  2X0L A;  3UO3 A;  5KUM A;  4PI2 A;  2IJH A;  4Q20 A;  4H44 B;  1KP2 A;  4U3F H;  3HKC A;  3KG2 A;  2Z5U A;  1DF4 A;  3CXC U;  3G71 V;  4LF4 O;  3F7Y C;  3CRA A;  3KCX A;  2CH7 B;  3ICX A;  5EBL C;  2WLK A;  3W7S A;  2P06 A;  2UU9 O;  1TA8 A;  1IDS A;  4MVZ A; 
#chains in the Genus database with same CATH homology
 4B3T O;  1XMQ O;  4LFC O;  3T1Y O;  2JRI A;  4DV7 O;  4GKJ O;  4JI3 O;  5BY1 A;  2DJV A;  5FLX N;  3J80 N;  4DV0 O;  2UXC O;  4X64 O;  2VQE O;  4DV1 O;  4DV4 O;  4NXM O;  4B3S O;  2DOS A;  2AGA A;  4OX9 O;  1N34 O;  4NXN O;  4DR6 O;  2UUC O;  5BXZ A;  3RT3 C;  3J7A U;  2ZM6 O;  4YY3 O;  4A5U B;  4DV5 O;  4JV5 O;  4DR1 O;  2N74 A;  3OTO O;  4B3R O;  1IBK O;  3T1H O;  2Z0A A;  1FKA O;  4OPH A;  2VQF O;  1R1B A;  4X62 O;  4LF8 O;  2UXD O;  1HR0 O;  2UUA O;  1J5E O;  4DV3 O;  1A32 A;  4DV6 O;  1D2D A;  5BR8 O;  4JYA O;  5A2Q N;  4LF5 O;  4JI1 O;  1XNR O;  2F4V O;  1FYJ A;  1HNX O;  5H5N A;  2UUB O;  1AB3 A;  4JI0 O;  1YZB A;  1DK1 A;  5LMU O;  2LW7 A;  1IBL O;  1FJG O;  2ZKO A;  1XEQ A;  4YHH O;  4JI5 O;  4DR4 O;  4GKK O;  4JI4 O;  4DR5 O;  1N36 O;  2UXB O;  4LFA O;  1IBM O;  4JI8 O;  4KHP O;  1HNW O;  1NS1 A;  4DV2 O;  4DR3 O;  5LMN O;  1I94 O;  4LF6 O;  4DR2 O;  3R66 A;  5LL6 Y;  1G1X B;  1X59 A;  4X65 O;  4LFB O;  4LF9 O;  3F5T A;  3JAM N;  4JI6 O;  2HHH O;  4JI7 O;  1R6T A;  1N33 O;  1KUQ A;  1HNZ O;  4OPA A;  5IT9 N;  3J81 N;  4DR7 O;  3O65 A;  5IWA O;  4DUZ O;  2E5L O;  4X66 O;  4K0K O;  4LF4 O;  4JI2 O;  1AIL A;  4B3M O;  1N32 O;  1F7Y A;  4AQY O;  1XNQ O;  2FKX A;  4DUY O;  2UU9 O;  1XMO O;  3M8A A;  3SDL A;  4LF7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...