3CCLV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cclV00
1Q7YW 3CCMV 1YITV 1YJ9V 1VQ9V 3CXCU 1R73A 3CMEV 3OW2U 3CMAV 1VQ8V 3CCVV 1NJIW 1S72V 1YJWV 3G71V 2QA4V 1VQLV 3CD6V 2OTJV 1QVFU 3CCRV 2D3OW 1VQ4V 1VQOV 3CCJV 1VQ6V 3CPWU 3CC2V 3CCLV 1Q86W 1VQ7V 1YIJV 1VQ5V 1Q81W 3G4SV 1YI2V 1KD1W 1M1KW 3I56V 3CC7V 1Q82W 1KQSU 3CCUV 1QVGU 1YHQV 1YJNV 1K8AW 3G6EV 3I55V 1K9MW 4WFBV 1VQKV 4WCEV 2OTLV 5DM6V 1M90W 1VQPV 2QEXV 3CC4V 1VQNV 4WF9V 1JJ2U 1K73W 1VQMV 1KC8W 3CCQV 1W2BU 3CCEV 1N8RW 3CCSV 4WFAV
chains in the Genus database with same CATH superfamily
1ZUQA 1BHBA 2GTSA 1PL4A 3RVZA 2P67A 3K79A 2UUCO 1QBZA 4F6RA 4NXNO 1I94O 5JCOA 4J7JA 2NNUA 2B1IA 1Y76A 1K73W 4DR1O 2JRIA 4YHHO 2DE0X 3E35A 4DV5O 5IY5C 3MHHC 3CMEV 4LWSA 2QTSA 5EYPA 2F95B 5KA5A 3F5TA 2WLHA 1L8DA 2QGNA 1M5IA 2ATKC 3ZIAG 5LHIA 1V9PA 1N33O 3OR6C 3K57A 3JARB 3I5DA 4FLZA 4OXSA 5B1AB 3K5LA 1GN2A 1JR9A 1OZ0A 1A32A 2UXCO 2QM7A 1Y4MA 1QQCA 2JGDB 5CMUA 4LF9O 4JGSA 2ZM6O 4RAIA 4CBCA 3G6BA 3ETQA 4D7TA 4TUYB 1NH2D 2CTPA 2CH7A 2L35A 1XHXA 4JF3A 4UCRA 4DV3B 4GX1A 3JCUZ 3NXSA 3OD4A 4GKKB 5CA3A 1FYJA 2XTAA 2E3CA 4G2KA 4QE7A 4B3RO 1EFRG 3N2KB 4TWKA 4ZKIA 3GB7C 3FB7C 4TV8B 3RYHB 1HR0B 4IT5A 2VQEO 3ABLB 1G1XB 2Z3YA 4B3SB 4DV2O 4Q6GA 5J2UA 1WB7A 3UCSC 5JVDA 4OX9B 4UVCA 4X64B 1X59A 4BW5A 5GTIZ 4DR6B 2PY5A 3CHXA 4X9QA 5IJ0B 1SS3A 2XNDG 3TK1A 4KHPB 3OUSA 1U97A 3JSNA 3B8MA 3K3WA 4CH3A 3CJHB 4PA7A 1WA8B 1HNWB 1Q6UA 3ZHTA 1KB9F 2WPDG 2X6CA 2VQFO 3E8HA 4AQYO 5C8YA 1W0JG 4X20B 5LA6B 5KUKA 2CTRA 5LGUA 4DR3B 1WAZA 3OTOB 1KKCA 1WLEA 4YJ2B 3ZRVA 1VQ6V 4I55A 2YXHA 4DV7B 1SKVA 1KYOF 1K34A 3AG2B 1KD1W 4GX2A 4J11A 3K5OA 2ADPA 2CTWA 1BMFG 2QWQB 4W4LA 2PYJA 4ZI7A 4L87A 2UXBO 1W2BU 1E1QG 5J2TA 4PELA 2LQTA 2ZKOA 1Q90D 4GCZA 5GONA 3ABLC 1NTKH 4X1KA 1R3KC 4JI1O 1JQ0A 2GUZA 2LW1A 3H1IH 3K9SA 2HLDG 2YI8A 4J7KA 1Q82W 1XOUA 1JX9A 4LNUA 1K7DA 1BT8A 1OCOC 1THZA 1US6A 1QU7A 2E75B 2EIMB 4WF9V 3K04A 1HNXB 2A7WA 1B6QA 3AK3A 4DUYB 3N27A 1D5AA 4J80A 5IYZB 3ABKC 2E5LO 1AILA 3AK1A 3BPZA 2DYSB 5JH7B 2LP7A 1RFYA 2WA3A 4LF5B 5B3SC 2H94A 1V54C 3JD4A 2ZQMA 4WFEA 2XAJA 5DM6V 2UXNA 3VQVA 2QWNB 2HJFC 3CS5A 2DW4A 1N34O 1YITV 3IC7A 3UO3A 4KXRA 4BW9A 5L3FA 2JK5C 4FPPA 3L72H 5LL6Y 3SJAC 4IIJB 4LFCB 2QWOB 1NQTA 1KUQA 2FMLA 4LR3A 4MVSA 3KG2A 4IYHA 4GYCB 1YEWA 1PP9H 1OV9A 3BY6A 3K58A 4H13B 1JOYA 5K1PA 4EB6A 2P4VA 2HFEC 4HAMA 4GT1A 4J42A 3JARA 2PI4A 1R73A 2H8PC 2IBZH 2V4DA 1EN6A 4K8ZA 1BQZA 1CPYA 1M93A 4X66O 2D2CB 3VQWA 4JI4O 2JGDA 1K8AW 3AEIA 2FTKA 3DTUB 1S3JA 2L6LA 2RJZA 1AJNA 2LFRA 5KHJA 4TUYA 1MSWD 1J5EO 1IZ3A 1BE3H 1VQ4V 4BIZA 3L9DA 3OTFA 2QTOA 3N2KA 4YJ3B 2EILC 4TV8A 1VF7A 1NKDA 3RYHA 2Y48A 3T4DA 1F7YA 2OCCB 1TGOA 4FIPC 5FPOA 2A79B 4BIUA 1IBLO 4ZHQA 2ZXWB 3AG4B 4WBNB 1DLBA 3UM7A 5JQGB 1ZX3A 2W0FC 4J9ZB 1F4NA 2AHYA 3RYCA 1M57B 3HR0A 3ZMZA 3ZMVA 3CRAA 3GWKC 4PDRA 4X65O 4K3AA 1AI5A 3CJHA 1R6TA 1WA8A 2EIKC 4LC1A 4I5SA 4HBNA 1SF9A 1G4YB 4F6EA 1K5SA 3BA9A 3PN1A 3RVYA 3T1YB 4LF6O 4BAYA 4R50A 3JD2A 4X20A 1PM9A 5LA6A 3T1HB 4JI3O 2N74A 2Y0PA 3SYCA 3K03A 1KMIZ 1PPJH 4YJ2A 3J80N 4GKJO 2UXDB 4LFBO 2PUSA 2Q5ZA 1GN6A 5IJ9B 5CBGA 5KX5B 4PHZA 3AG3B 5KHHA 1EZJA 4FM0A 4DV0B 3G71V 1K4CC 4JTCB 5KUMA 4H37A 1OCRC 1W59A 3P3NA 3ZRWB 4DR4B 3CWBH 1CEZA 1ZAUA 2DJVA 3RYIB 2W0XA 2QKSA 1HNZB 1GAXA 3CRQA 1AVMA 3OUFA 5KAIZ 4JAVA 3QO5A 5C93A 2ITDC 4JI5O 3CCMV 4QGPA 4JI2O 1ENVA 4RQEA 4LF7B 2VWJA 1M56C 1IURA 3L73H 1JCHA 2ZNJA 2QDOA 4FMTA 2OYQA 3JAKB 5LGTA 5IYZA 2ETNA 4MVUA 3RBZA 2UUCB 1JMKC 4NXNB 5JH7A 3H1HH 2X0LA 1I94B 3E22A 1Q7YW 1CXZB 3CXCU 1I7FA 3SPCA 2Y0IA 1P7GA 2RNBA 3ASOB 4DR1B 4DW1A 2XAQA 1T5EA 1KU9A 4O2AB 1P4RA 4I50B 3LDCA 4YHHB 4DV5B 5FPRA 3G4SV 3M7MX 1NR1A 1XILA 4IYIA 4X1IB 4ZOLB 1BHAA 1YJNV 4MVOA 3WU2Z 2Z0AA 3ZHVA 4X89A 1N33B 1ZWIC 2P06A 1ZL8B 1HDJA 2D3OW 4UV8A 3SPJA 3CCJV 2WWWA 2UXCB 4XBFA 5EIBC 4LF9B 1AROP 2G38A 2ZM6B 3X2QB 3HKDB 5H2FZ 4CC5A 5DN6G 4IHJB 3R66A 3DSQA 3E86A 2PTMA 1FFXB 2F43G 1B06A 2K1EA 2KG7A 1BCCH 4B3RB 2BOBC 3O9OA 1VQ5V 3Q4HB 3LSSA 4RQFA 4A5UB 1AB3A 3S3WA 2VQEB 1EN5A 4DV1O 4RO2A 3U11A 3JAMN 3KZIZ 2JJ1G 1E1RG 3S3XA 5EBWC 3H1KH 3W7XA 1Y67A 3ZN0A 4TQDA 3ABMB 2VS0A 5JJJB 4MVRA 4K0KO 3G67A 3B77A 2HP8A 4I4TA 5KMGA 4WFHA 1F23A 1DF4A 5JQGA 1M90W 3ZEDA 2QEXV 2IH3C 2GHYA 2OIGA 2VQFB 2IJJA 4GX0A 1L0NH 2LJ2A 1GM8A 2W6IG 1I5YA 1VQ8V 2YC0A 1V55C 1HP8A 5LMNO 4AQYB 1XI1A 1NJIW 1XNQO 3SR2C 2P4KA 1YZBA 2EZPA 3W7WA 1RSOB 1IVSA 3R65A 2NR5A 3CC4V 2Q7EA 1MOFA 3CCQV 2ZDIA 2OT5A 3E8FA 3U0ZA 2DYRB 3BRCA 1SQGA 4CS3A 2UXBB 5IJ9A 5KX5A 2JGUA 2ZD9A 5B66Z 4HNAB 2F23A 4YY3O 4W4KA 3P30A 4DV4O 4JI1B 2WLNA 2B1GA 3KKYA 3ZRWA 2ZT9B 4O4LB 3RYIA 1N8RW 3CCSV 4OGQB 2Q9LA 1BZKA 4P30A 4UCVA 1TUEB 4L8JA 4J10A 2Q67A 4LH7A 1R6NA 1WNSA 2E5LB 5JJNB 2Y4UA 1JVMA 4DK0A 3E8GA 2QM4A 5IYBO 3ZHQA 4E2LA 1K92A 3JAKA 5EZYB 5KHKA 1PV0A 3L74H 3E8BA 3JD0A 1N34B 4X1YB 2Q6AA 4LH6A 4PA3A 1BSMA 1PNKA 4PA4A 2YIBD 4DUZO 3TCUA 1VF5B 3JAWA 2Y4TA 4UB8Z 3APQA 3OMAB 4CH4A 4X1IA 4ZOLA 3FD9A 1VQ9V 3CEIA 3MDSA 3H1JH 1BQ0A 3CD6V 1OCZC 3BABA 4PDMA 1RM1B 3CCRV 2OCHA 3JALB 1ORQC 2JEUA 4JZGA 2HKOA 4B3TO 2F1MA 3K5MA 4X66B 2Y69C 2YUAA 1GM9A 4JI4B 4CH5A 4LF4O 1RPOA 1FAFA 4B3MB 1NVPD 3QO8A 4JI8O 4QJFB 3HKDA 1VQLV 2UUBO 2WA4A 5EC1C 1J5EB 2EZOA 4LBEC 4I9QA 4O4IA 1NVPB 1MMMA 1SETA 3AG1B 3HKEB 2P6JA 2FB5A 4DR5O 5E1AC 3Q4HA 1Z5VA 4FJCC 3MD0A 2PYLA 4NYKA 4NXMO 1NTMH 1KECA 2VWKA 2F4VO 1PNMA 1SC5B 2JDIG 2EIJB 1QVFU 2R70A 1IBLB 3UKMA 1XREA 2A3QA 1UJWB 5B1AC 2IU0A 3N2GB 2BSKB 2HVKC 4CS2A 3BHPA 5B5EZ 5ITZB 5CA1B 1JA8A 3E2EA 1S5HC 3ZS8C 1Q8IA 4Z2WA 1FJGO 4WFAV 1VARA 4X65B 1QLEB 4PD4F 3FX7A 3EXAA 2ZCEA 4U7OA 5KHIA 4RWUA 3FYEB 1XEQA 3CXHF 4LF6B 2OTLV 3M8AA 1URFA 2R9RB 3SYOA 4ZIBA 4JI3B 1RSOA 2AGAA 3A0BZ 1YDXA 4GKJB 4LFBB 3BEHA 4FVMA 5BR8O 2BTQB 3JD3A 1QHTA 2GSMB 2JIZG 3HKCB 1H2SB 5IYDO 4NKGB 1NBMG 5K1XA 1KP2A 3RT3C 4K8XA 4MTXA 3K9AA 2ZE7A 3JSLA 2YEVA 5EC2C 2E76B 4JI5B 3ZX6A 3ZHRA 4JI2B 1AJPA 2LO1A 3EVKA 1D2DA 1O9HA 1SESA 1N36O 3TETA 1FFTB 2ZINA 2GDSA 4BIOA 1BL8A 3AG2C 5CN0A 5EZYA 5B1OA 3EHBB 3C3TA 3DGEA 2P22C 1SQVH 2KQXA 5TISZ 1Y6XA 1G8MA 2H3OA 4D6TH 4JYAO 1TAEA 1Y74B 4NTXA 1OCCB 1SQQH 1E79G 2HG5C 3UT5B 1GN4A 1L0LH 2YIBA 3OGCC 2EIMC 2LGWA 3WB2A 3JALA 5IYCO 4TOIA 1KC8W 5FL7G 1VP7A 2QE7G 1XDCA 4O4HB 5BZBA 2DYSC 5EK0A 5LP6B 5JWPA 1M9NA 4CS4A 3BVOA 1SRYA 2AZ2A 2ZE8A 1JFFB 2RMKB 5AG2A 1M1KW 5IT9N 1OHHG 1VIBA 4DV6O 4ICGA 4JASA 4O2BB 4R7CA 4DXWA 2MW2B 5HFMA 3JASB 3HKEA 4DV1B 2Q69A 3UQ8A 2NN4A 3H9VA 4KUMA 5KHGA 2FKXA 4ABMA 4B08A 5IJ0A 3RFRA 4JI7O 1JPXA 4MW8A 4K0KB 4RUEA 3ETEA 4C7UA 2YIDA 2E74B 1ZSPA 2UUAO 1WP7A 1VQPV 3N2GA 2BSKA 3DC5A 5B1NA 3HKBB 4PI0A 1SQXH 2XT9A 5ITZA 1M4UA 2EINB 1Q43A 3ABTA 2RCVA 1TVKB 3D3IA 3G80A 4JAUA 1NR7A 1PNLA 1WPBA 5LMNB 3SPIA 1XNQB 3FFQA 3L75H 1IBKO 4PA6A 3ETGA 4P9PA 2HHHO 5BMVB 4MTFA 1SA0B 2EX3A 5L3CA 1GM7A 2DN9A 3OMNB 4RUFA 3OE7G 2P90A 3CCLV 4LF8O 2XAHA 4NR1A 1D5NA 1SERA 3WG7B 2OCCC 4FLXA 5DEDA 4WCEV 2BTQA 1FS0G 4DV4B 4FM2A 4X88A 3HKCA 2ZXWC 3AG4C 2A9HA 3CMAV 3DC6A 3A0RA 1SQFA 4JYBA 4MTOA 2Q0AA 3GVMA 1IBMO 1M57C 5A9GA 4CH6A 4QPKA 2Z5UA 1KQSU 3LNNA 2P7TC 2DQ3A 2FYUH 3FB8C 1YSCA 5JJEB 1RPRA 3LUTB 4KFMA 1LNQA 4UCSA 1VQNV 4YXWG 5LOVB 2QSAA 5KA6A 1EBOA 1UPGA 2A06H 1VF6C 1ZTEA 1H2MA 1Y76B 2W6JG 2ZDIC 2ZE6A 1N0NA 4X62O 2CE4A 3CE2A 1K5QA 2UU9O 1N0JA 4QIWF 4IIJA 4XDLA 3AG3C 3OFNG 4ZBMA 3D36A 2IJHA 4X8AA 3FAVB 4DUZB 3OW2U 2HEPA 1XBLA 2CGOA 1XMOO 1Q81W 1Y74A 1BS3A 1H2KA 3CCUV 1L1FA 1B04A 3JATB 1Q6HA 2Q73A 1K9MW 3B2EE 2R9IA 3OGIB 1FXKB 3SYQA 3UT5A 4B3TB 2QKCA 4MT8A 3KCYA 5LYJB 1N32O 2IJKA 1LUVA 1WJZA 4LF4B 1J95A 3QVNA 4JI8B 4GLXA 3O65A 2UUBB 2M7WA 4O4HA 3ASNB 2IH1C 4F4LA 4QNHB 5LP6A 5HFLA 4JI0O 1AI4A 4DV2B 3OR7C 2DQ0A 1JFFA 4YJ3A 4FLWA 3ASOC 5CB4B 1WP8A 4DR5B 4NXMB 4O2BA 1HW7A 2F4VB 2ILMA 2AW9A 3A2FA 4WBNA 1YCIA 3FB6C 4NB5A 3RGBA 3JCZA 3LSQA 5H5NA 2C2AA 2F66C 2BCCH 5B1BB 5L3EA 2ITCC 5EBMC 3ZMTA 4G28B 1YJWV 3H01A 1FJGB 2CTQA 5EBLC 5C8YB 3T1CA 1AP5A 4AILC 3HKBA 3X2QC 3TGUH 1DGSA 1RP3B 2FL4A 1VF6A 4PV1B 3VQYA 1QCEA 4QE9A 2AXTZ 1NTZH 4PJ0Z 1GN3A 2PGGA 2DOSA 3A0HZ 1AP6A 4MVMA 1S5JA 1K97A 1P49A 2EBOA 5IY5B 3K5NA 3ABUA 4KP4A 4AHCA 2ZNIA 3E83A 2N05A 1GRJA 2AHZA 5BR8B 3ZMUA 3I55V 4J7ZA 3HB3B 3OT7A 3WB0A 4FLVA 1R3JC 1H2GA 3ABMC 2IM9A 4PDVA 2ZIMA 2ZE5A 3D3QA 3RWRD 1GO3F 3HPLC 4IL6Z 1K3EA 4UVAA 4FLYA 4EEQA 5L3BA 1DTOA 3CP1A 1KP3A 1PKXA 5LBQA 5IWAO 1XL4A 3THOA 2A0LA 2CAZC 2WLKA 1G6UA 3L70H 2QR4A 3DXRB 1XL6A 1N36B 3OEHG 2HJDA 1S5LZ 1LR1A 5LOVA 1DF5A 4QPJA 1P7BA 3BA8A 4O2AA 4I50A 3PJSK 3H1LH 1VQMV 3K08A 3F7VC 2DYRC 3ML0A 2JJ2G 2X6BA 2V7QG 3AK2A 1S72V 4EB6B 4JYAB 1ZL8A 1MSDA 3FAVA 4H0LB 3OEEG 2ADQB 1WPXA 4LFAO 3BAAA 4P2ZA 3M99B 3LDEA 3TJTA 3OMIB 2KSDA 3LDDA 5IE9A 2QWRB 3JATA 3QO7A 5LHGA 4DR7O 3STLC 3ZJZA 1MA1A 3U10A 1FXKA 4JPRA 1WB8A 1ZLZA 2Q68A 5GTHZ 3CPWU 4K35A 4FLUA 4IHJA 5LYJA 1NI8A 2BOCC 5F2VO 1FFXA 2ZIOA 1S77D 1XQ8A 4ASUG 3ZBHA 3QTCA 3SGIA 2WLIB 1NH2B 4DV6B 1I0HA 1TUBB 3J7AU 3MHSC 1Q86W 2WLMA 1R3IC 2XOKG 3B40A 2Q7GA 4PDLA 5CB4A 1AR1B 1XNRO 3SJBC 4ZHQB 2Q8VA 3VQXA 1GKFA 5D5QA 1OCOB 1R3LC 2QM8A 4JI7B 4P9OA 4J41A 1X4TA 3RYCB 1RM1C 4TV9B 1QLNA 4XDKA 1QR8A 4UVBA 2ZR2A 2UUAB 5D5PA 4R8CA 2YIAA 1R6KA 4PI2A 2RN9A 4DR2O 2WAMA 3ABKB 3SJCC 3ZRXA 2QWPB 3BFRA 3ZRSA 4UFZA 3G6EV 3F5WC 3QNEA 1AI7A 1XUQA 4KL1A 4OPHA 5B3SB 1V54B 3L71H 3A8TA 5LMUO 1XMQO 1VEWA 5E79Z 1IBKB 2CGNA 1H2NA 4R6ZA 2HHHB 4Q20A 2YXYA 4JYYA 3TXQA 4JI6O 4JV5O 3AG1C 2NLJC 4IGGA 4TQFA 1YTFD 1K33A 2O57A 3C90A 4LF8B 4G27B 3FKSG 4HNAA 4JAAA 3W7SA 2RQ6A 2V1DA 1NT2B 3SYPA 2EIJC 3SYAA 2Q7HA 1YTFB 3IGAC 1OJHA 1H8HG 4FFBB 1Z2GA 4HZ3A 4O4LA 4NTYA 3APOA 3VBBA 1Q3EA 4GZRB 4FK5C 4DRXB 1IBMB 4UXNA 1P84F 1HWYA 1JJ2U 4NVPA 5CA0B 1QLEC 2M6YA 3K0DA 3SPGA 1SQPH 3SDLA 1MZEA 3KCXA 4XDJA 3C3SA 1QR9A 5FLXN 3K06A 2WLLB 1I5XA 2ODMA 1GK9A 3E22B 3DXRA 2QJ1A 3W7TA 2EILB 2UXXA 4X1YA 3CX5F 3B4SA 1DK1A 1EN4A 4B7EA 3LNMB 4X62B 3CC7V 2UU9B 2IW5A 2B5UA 4U7NA 3J81N 4LP8A 3CC2V 1NU1H 3W7UA 3RYFB 3JYCA 1LUWA 4PA9A 1XMOB 1S0VA 1AJQA 5GW7A 1GTOA 4O4JB 2N04A 2BTOA 2EIKB 5IDJA 3UO2A 4WFGA 2YICA 1H38A 2EULA 4TSFG 3IC9A 3IFXA 1N32B 1MABG 4DV3O 4EKWA 4GKKO 4BWAA 2PI5A 4B3MO 5H9CA 1O9GA 1GH6A 2KG7B 1N4CA 1SZXA 1HR0O 3ZHSA 2CK3G 3ZMSA 4JI0B 1B3QA 4B3SO 2P5OA 1YXBA 2OWOA 1QNMA 1JJOA 4UCUA 2KKWA 3D36C 3STZC 1VQ7V 4FLTA 1MNGA 4J9YB 2WLIA 4OX9O 3TXSA 2YI9A 4X64O 1YI2V 1OCRB 3T4ZA 4DR6O 1TUBA 3WFVA 2K9PA 5LHHA 1MG1A 4UCOA 4KHPO 1EZVH 3CCEV 4LCUC 4DYLA 4UCTA 3RN4A 1R1BA 3CRCA 4I4TB 3K59A 3BCCH 5KMGB 4FM1A 1HNWO 2WSSG 3P32A 1OCCC 5CA1A 2LFSA 3CSXA 4E4EA 1M56B 4H33A 4U3JB 1AR4A 1IDSA 5FNVB 4TV9A 2Q4PA 3I56V 3SPHA 1PL0A 3CB2A 5BY1A 1PD3A 4DR3O 5LGNA 3OTOO 2LGQA 2XHBA 4DV7O 1TA8A 4JTDB 5LXTB 3T2MA 2YS8A 5LP6C 5CBFA 2OTJV 1IXBA 1VQOV 4NTWA 1YF2A 4OPAA 1I08A 3P3PA 1KKDA 3ICXA 1F51A 4YY3B 4FZ1A 3VOUA 3MAQA 3QG5A 2JS5A 2IU3A 5EIBD 1EM1A 4JTAB 4D7SA 3ZN1A 2JS3A 4CZZA 4I0XB 2VRZA 2HR3A 4MTGA 1IXMA 1HNXO 3WB1A 1BGYH 2XASA 4FFBA 2PZSA 1YVWA 2EJRA 4DUYO 4AI8A 4JZ2A 4UB6Z 3QF7A 3E89A 5H6QA 4B7KA 3F7YC 2DWEC 4F6RB 2YSUB 2EINC 4TT3G 4DRXA 4EFEA 1IX9A 5IWAB 3SJQC 4LF5O 1H8EG 2X6AA 2DMXA 2HVJC 5CA0A 2JVDA 1YIJV 2R9AA 3OM3B 1FD9A 2YXLA 4Z1MG 4JYCA 2B9ZA 4LWSB 5J9PC 2WLLA 3IJ4A 5EYPB 1CP9A 5L3DA 3RW0A 1KBHA 3B8NA 4LFCO 1AR5A 2XAFA 4MVZA 3CCVV 1GMGA 3JAWB 1FKAO 2PF4E 2GBOA 1FXVA 2DWDC 2F93B 3WG7C 3LSUA 3ZHUA 2R72A 3GWOA 1ROPA 1NZ6A 2IJIA 4MVQA 5KAFZ 2ARHA 4MSWC 3RYFA 4LFAB 1WN7A 3CRRA 2AZ0A 3K0GA 1XHZA 2Q0OC 2QA4V 3B09A 4O4JA 1V55B 3ZCCA 2CH7B 2QKAA 4DR7B 3NR7A 4DW0A 2ZR3A 4UV9A 2LW7A 1FXHA 2OIEA 5CBHA 2MK3A 1U96A 4Z1VA 5JCOC 4GX5A 1YJ9V 4O4IB 5J2UB 4U3FH 5JVDB 1Y66A 2GV9A 3ETDA 3IAYA 3AG7A 3JASA 3FB5C 1S76D 4YIOA 2X7RB 5L3GA 1XNRB 4MW3A 2BE3A 1K4DC 1Z5WA 1NS1A 2CUGA 3OAAG 2WLJA 1H2LA 1FXKC 4MS2A 3CYOA 4HYOA 2RDCA 4FZ0A 4DR2B 4U3JA 2XAGA 2EJ7A 3EFFK 5FNVA 1TVKA 1COWG 4I9WA 4I55B 4WFBV 3JD1A 3T1YO 1Q5OA 1UFIA 3T1HO 5LMUB 4DK1A 1XMQB 1F4MA 2GTAA 4EFBA 2UXDO 5LXTA 3ASNC 4ZI7B 5BMVA 3CRMA 5J2TB 1SA0A 2CDYA 2KB1A 4BR6A 1QVGU 1FPOA 3FYIB 5KLVH 5GONB 4X1KB 4DV0O 4JI6B 4JV5B 1MZFA 4GUNA 2GUZB 4YIPA 2XUMA 4CC6A 5BXZA 1AI6A 4DR4O 1SQBH 4N23A 5A2QN 4LNUB 1HNZO 1Q6IA 1OCZB 4H44B 1W0KG 2YDEA 4I7ZB 4N21A 4WFFA 1YHQV 1VMGA 4DO2A 1VQKV 2YEVB 3D8CA 5B1BC 5H6RA 4LF7O 2JEXA 4I0XA 2Y69B 4UUJC 5DECA 4FFKA 1SZTA
chains in the Genus database with same CATH topology
5HFMA 1BHBA 2Q69A 4R6ZA 3RVZA 4KUMA 2D3OW 2P67A 4UV8A 3SPJA 3CCJV 4Q20A 3K79A 1QBZA 2WWWA 4XBFA 3AG1C 2NLJC 1YTFD 1K33A 1JPXA 1AROP 4MW8A 4G27B 3X2QB 4RUEA 2NNUA 3FKSG 3ETEA 2B1IA 3W7SA 1K73W 5DN6G 2V1DA 1VQPV 3E35A 3E86A 3SYPA 5B1NA 2F43G 3MHHC 2EIJC 5IY5C 3CMEV 3SYAA 1YTFB 2K1EA 3IGAC 2EINB 1H8HG 5KA5A 2WLHA 4HZ3A 2BOBC 2ATKC 3ABTA 3D3IA 3LSSA 1VQ5V 3ZIAG 4JAUA 1NR7A 1PNLA 5LHIA 3SPIA 3VBBA 4RQFA 3OR6C 4FK5C 4UXNA 4OXSA 5B1AB 4RO2A 1HWYA 4PA6A 1JJ2U 3ETGA 1OZ0A 1QLEC 4P9PA 2JJ1G 3K0DA 1E1RG 4MTFA 3SPGA 5EBWC 3W7XA 3ZN0A 5L3CA 1GM7A 2QM7A 3OMNB 1Y4MA 4XDJA 5CMUA 1QR9A 4JGSA 3ABMB 3K06A 2WLLB 4RUFA 3OE7G 2P90A 1I5XA 4MVRA 2XAHA 4RAIA 4CBCA 3CCLV 3B77A 1GK9A 4WFHA 1SERA 1NH2D 3WG7B 2OCCC 3W7TA 1F23A 2EILB 1DF4A 2UXXA 4WCEV 4JF3A 1M90W 4GX1A 2QEXV 1FS0G 2IH3C 2GHYA 3NXSA 3LNMB 4X88A 5CA3A 2ZXWC 3AG4C 2IJJA 4G2KA 4GX0A 4QE7A 3CC7V 1GM8A 2W6IG 1I5YA 1VQ8V 1EFRG 2A9HA 4TWKA 3CMAV 4ZKIA 3A0RA 1V55C 2IW5A 3GB7C 1NJIW 3FB7C 2B5UA 4U7NA 4JYBA 4LP8A 4MTOA 3CC2V 3ABLB 1M57C 2Z3YA 2EZPA 3W7WA 3W7UA 4QPKA 2Z5UA 1KQSU 3JYCA 2P7TC 2DQ3A 3FB8C 1YSCA 1RPRA 3LUTB 3R65A 4KFMA 4PA9A 1S0VA 1AJQA 1LNQA 4UVCA 3CC4V 1VQNV 5GW7A 1GTOA 1MOFA 4YXWG 4BW5A 3CCQV 2ZDIA 2EIKB 5IDJA 2OT5A 5KA6A 1EBOA 3E8FA 2DYRB 4WFGA 2XNDG 1H38A 3TK1A 4TSFG 3OUSA 2ZD9A 3B8MA 2W6JG 3K3WA 3IFXA 4PA7A 2ZDIC 1MABG 3P30A 4EKWA 2WLNA 2WPDG 2PI5A 5H9CA 2X6CA 3E8HA 1K5QA 2B1GA 4QIWF 4XDLA 3ZRWA 3AG3C 1W0JG 3OFNG 4ZBMA 3D36A 2IJHA 4X8AA 3CCSV 1N8RW 2CK3G 3OW2U 3ZMSA 5KUKA 5LGUA 1WLEA 4P30A 3ZRVA 1VQ6V 1TUEB 3STZC 1VQ7V 4J9YB 1K34A 1Q81W 2WLIA 3AG2B 1YI2V 2Q67A 1KD1W 1OCRB 4GX2A 3CCUV 1R6NA 1L1FA 3T4ZA 1K9MW 1JVMA 1BMFG 2R9IA 3E8GA 1FXKB 3WFVA 3SYQA 5LHHA 1MG1A 4L87A 5IYBO 4E2LA 1K92A 1W2BU 1E1QG 3CCEV 4LCUC 4MT8A 4PELA 2IJKA 4GCZA 3ABLC 3E8BA 1R3KC 2WSSG 3P32A 1OCCC 1JQ0A 1J95A 3JD0A 2LFSA 1M56B 2Q6AA 4H33A 4PA3A 1PNKA 2HLDG 4PA4A 3I56V 1Q82W 2M7WA 1JX9A 3SPHA 1K7DA 3ASNB 2IH1C 3TCUA 1OCOC 1THZA 4F4LA 4QNHB 1PL0A 5HFLA 1AI4A 2EIMB 3OMAB 1PD3A 4WF9V 3OR7C 5LGNA 3K04A 2DQ0A 1B6QA 4JTDB 3ASOC 1VQ9V 3T2MA 5CBFA 3CD6V 1OCZC 4PDMA 2OTJV 1RM1B 3CCRV 3ABKC 1VQOV 1ORQC 2JEUA 2DYSB 2LP7A 2HKOA 5B3SC 2H94A 1V54C 3FB6C 3JD4A 2ZQMA 4WFEA 3JCZA 3LSQA 1KKDA 2Y69C 2XAJA 1GM9A 2C2AA 5DM6V 1F51A 2UXNA 3VOUA 2HJFC 1RPOA 2DW4A 5B1BB 5L3EA 1YITV 3IC7A 1NVPD 3QO8A 2IU3A 2ITCC 5EBMC 5L3FA 2JK5C 4FPPA 3ZMTA 4QJFB 4G28B 1YJWV 1VQLV 3H01A 4JTAB 5EC1C 1NQTA 3ZN1A 5EBLC 4MVSA 3T1CA 2EZOA 4CZZA 3KG2A 4LBEC 2HR3A 4MTGA 1IXMA 1NVPB 3X2QC 2XASA 3BY6A 1JOYA 1SETA 3AG1B 2P6JA 2EJRA 5E1AC 3E89A 1QCEA 5H6QA 4FJCC 2HFEC 3MD0A 3F7YC 2DWEC 4HAMA 4GT1A 1KECA 4QE9A 1PNMA 2YSUB 2EINC 4TT3G 2PI4A 1R73A 2H8PC 2JDIG 4MVMA 1K97A 2EBOA 5IY5B 2EIJB 1QVFU 3SJQC 1H8EG 2X6AA 2HVJC 3ABUA 4KP4A 1CPYA 3UKMA 1YIJV 3E83A 3OM3B 5B1AC 1UJWB 2IU0A 2HVKC 4Z1MG 1K8AW 3AEIA 4JYCA 2AHZA 3ZMUA 3I55V 2FTKA 3DTUB 5J9PC 2WLLA 1S3JA 3HB3B 3E2EA 1S5HC 1AJNA 1CP9A 5L3DA 2LFRA 3RW0A 3B8NA 4WFAV 1R3JC 2XAFA 1MSWD 4MVZA 1H2GA 3CCVV 1QLEB 3ABMC 4PDVA 1GMGA 1VQ4V 4BIZA 1GO3F 3HPLC 1FXVA 2DWDC 3WG7C 2QTOA 4U7OA 1K3EA 2EILC 4UVAA 3GWOA 1NKDA 3FYEB 1ROPA 2Y48A 5L3BA 4MVQA 1DTOA 2IJIA 3T4DA 2OTLV 3CP1A 1KP3A 2R9RB 1PKXA 5LBQA 2OCCB 3SYOA 1XL4A 4FIPC 4MSWC 2A0LA 2A79B 4BIUA 2WLKA 2ZXWB 3AG4B 3K0GA 1DLBA 1XL6A 2QA4V 3BEHA 3UM7A 3OEHG 1V55B 3ZCCA 2W0FC 3JD3A 4J9ZB 1F4NA 1DF5A 2AHYA 2GSMB 2JIZG 2ZR3A 1M57B 4UV9A 3ZMZA 3ZMVA 1FXHA 4QPJA 4PDRA 5IYDO 1NBMG 1P7BA 1AI5A 5CBHA 3PJSK 1KP2A 2EIKC 4MTXA 2MK3A 3K08A 3F7VC 1VQMV 4LC1A 3K9AA 2DYRC 4GX5A 1YJ9V 3ML0A 2JJ2G 2X6BA 2V7QG 4I5SA 1G4YB 1S72V 2YEVA 5EC2C 1K5SA 1Y66A 3RVYA 3ETDA 4BAYA 4R50A 3JD2A 1AJPA 3OEEG 3FB5C 1WPXA 3SYCA 3K03A 1S76D 2X7RB 3M99B 4P2ZA 3LDEA 5L3GA 5CBGA 4MW3A 1SESA 3OMIB 3LDDA 3AG3B 3TETA 3QO7A 1EZJA 1FFTB 5LHGA 3STLC 3ZJZA 3G71V 1K4CC 1FXKA 1K4DC 4JTCB 4JPRA 1BL8A 2Q68A 3AG2C 5KUMA 3CPWU 4H37A 1OCRC 5CN0A 3ZRWB 3OAAG 1CEZA 2BOCC 5B1OA 2WLJA 2QKSA 3EHBB 1S77D 1FXKC 4MS2A 3CYOA 4HYOA 2XAGA 3DGEA 3OUFA 4ASUG 5C93A 3EFFK 3QO5A 4JAVA 1G8MA 2ITDC 4I9WA 1COWG 4WFBV 3CCMV 3JD1A 2WLIB 1ENVA 1NH2B 4RQEA 1M56C 1JCHA 1F4MA 3MHSC 1OCCB 4FMTA 1Q86W 2WLMA 1R3IC 2XOKG 3ASNC 4PDLA 1E79G 2HG5C 1AR1B 5LGTA 2KB1A 1QVGU 3OGCC 4MVUA 2EIMC 3RBZA 3FYIB 5IYCO 1GKFA 1OCOB 2X0LA 1R3LC 2QM8A 1KC8W 1AI6A 4P9OA 1Q7YW 5FL7G 2QE7G 3CXCU 1QLNA 1RM1C 4XDKA 1QR8A 3SPCA 4N23A 4UVBA 2ZR2A 3ASOB 5BZBA 2DYSC 4R8CA 2XAQA 5EK0A 1R6KA 1P4RA 1M9NA 3LDCA 1OCZB 1W0KG 1SRYA 3ABKB 2WAMA 3ZRXA 4N21A 3G4SV 1NR1A 1M1KW 4WFFA 3ZRSA 1BHAA 1YHQV 1YJNV 4MVOA 3G6EV 3F5WC 1OHHG 4DO2A 3QNEA 1AI7A 1VQKV 2YEVB 5B1BC 4X89A 5H6RA 5B3SB 1V54B 2JEXA 4JASA 4R7CA 4DXWA 2Y69B 1ZWIC 4UUJC 1SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y W;  3CCM V;  1YIT V;  1YJ9 V;  1VQ9 V;  3CXC U;  1R73 A;  3CME V;  3OW2 U;  3CMA V;  1VQ8 V;  3CCV V;  1NJI W;  1S72 V;  1YJW V;  3G71 V;  2QA4 V;  1VQL V;  3CD6 V;  2OTJ V;  1QVF U;  3CCR V;  2D3O W;  1VQ4 V;  1VQO V;  3CCJ V;  1VQ6 V;  3CPW U;  3CC2 V;  3CCL V;  1Q86 W;  1VQ7 V;  1YIJ V;  1VQ5 V;  1Q81 W;  3G4S V;  1YI2 V;  1KD1 W;  1M1K W;  3I56 V;  3CC7 V;  1Q82 W;  1KQS U;  3CCU V;  1QVG U;  1YHQ V;  1YJN V;  1K8A W;  3G6E V;  3I55 V;  1K9M W;  4WFB V;  1VQK V;  4WCE V;  2OTL V;  5DM6 V;  1M90 W;  1VQP V;  2QEX V;  3CC4 V;  1VQN V;  4WF9 V;  1JJ2 U;  1K73 W;  1VQM V;  1KC8 W;  3CCQ V;  1W2B U;  3CCE V;  1N8R W;  3CCS V;  4WFA V; 
#chains in the Genus database with same CATH topology
 1ZUQ A;  1BHB A;  2GTS A;  1PL4 A;  3RVZ A;  2P67 A;  3K79 A;  2UUC O;  1QBZ A;  4F6R A;  4NXN O;  1I94 O;  5JCO A;  4J7J A;  2NNU A;  2B1I A;  1Y76 A;  1K73 W;  4DR1 O;  2JRI A;  4YHH O;  2DE0 X;  3E35 A;  4DV5 O;  5IY5 C;  3MHH C;  3CME V;  4LWS A;  2QTS A;  5EYP A;  2F95 B;  5KA5 A;  3F5T A;  2WLH A;  1L8D A;  2QGN A;  1M5I A;  2ATK C;  3ZIA G;  5LHI A;  1V9P A;  1N33 O;  3OR6 C;  3K57 A;  3JAR B;  3I5D A;  4FLZ A;  4OXS A;  5B1A B;  3K5L A;  1GN2 A;  1JR9 A;  1OZ0 A;  1A32 A;  2UXC O;  2QM7 A;  1Y4M A;  1QQC A;  2JGD B;  5CMU A;  4LF9 O;  4JGS A;  2ZM6 O;  4RAI A;  4CBC A;  3G6B A;  3ETQ A;  4D7T A;  4TUY B;  1NH2 D;  2CTP A;  2CH7 A;  2L35 A;  1XHX A;  4JF3 A;  4UCR A;  4DV3 B;  4GX1 A;  3JCU Z;  3NXS A;  3OD4 A;  4GKK B;  5CA3 A;  1FYJ A;  2XTA A;  2E3C A;  4G2K A;  4QE7 A;  4B3R O;  1EFR G;  3N2K B;  4TWK A;  4ZKI A;  3GB7 C;  3FB7 C;  4TV8 B;  3RYH B;  1HR0 B;  4IT5 A;  2VQE O;  3ABL B;  1G1X B;  2Z3Y A;  4B3S B;  4DV2 O;  4Q6G A;  5J2U A;  1WB7 A;  3UCS C;  5JVD A;  4OX9 B;  4UVC A;  4X64 B;  1X59 A;  4BW5 A;  5GTI Z;  4DR6 B;  2PY5 A;  3CHX A;  4X9Q A;  5IJ0 B;  1SS3 A;  2XND G;  3TK1 A;  4KHP B;  3OUS A;  1U97 A;  3JSN A;  3B8M A;  3K3W A;  4CH3 A;  3CJH B;  4PA7 A;  1WA8 B;  1HNW B;  1Q6U A;  3ZHT A;  1KB9 F;  2WPD G;  2X6C A;  2VQF O;  3E8H A;  4AQY O;  5C8Y A;  1W0J G;  4X20 B;  5LA6 B;  5KUK A;  2CTR A;  5LGU A;  4DR3 B;  1WAZ A;  3OTO B;  1KKC A;  1WLE A;  4YJ2 B;  3ZRV A;  1VQ6 V;  4I55 A;  2YXH A;  4DV7 B;  1SKV A;  1KYO F;  1K34 A;  3AG2 B;  1KD1 W;  4GX2 A;  4J11 A;  3K5O A;  2ADP A;  2CTW A;  1BMF G;  2QWQ B;  4W4L A;  2PYJ A;  4ZI7 A;  4L87 A;  2UXB O;  1W2B U;  1E1Q G;  5J2T A;  4PEL A;  2LQT A;  2ZKO A;  1Q90 D;  4GCZ A;  5GON A;  3ABL C;  1NTK H;  4X1K A;  1R3K C;  4JI1 O;  1JQ0 A;  2GUZ A;  2LW1 A;  3H1I H;  3K9S A;  2HLD G;  2YI8 A;  4J7K A;  1Q82 W;  1XOU A;  1JX9 A;  4LNU A;  1K7D A;  1BT8 A;  1OCO C;  1THZ A;  1US6 A;  1QU7 A;  2E75 B;  2EIM B;  4WF9 V;  3K04 A;  1HNX B;  2A7W A;  1B6Q A;  3AK3 A;  4DUY B;  3N27 A;  1D5A A;  4J80 A;  5IYZ B;  3ABK C;  2E5L O;  1AIL A;  3AK1 A;  3BPZ A;  2DYS B;  5JH7 B;  2LP7 A;  1RFY A;  2WA3 A;  4LF5 B;  5B3S C;  2H94 A;  1V54 C;  3JD4 A;  2ZQM A;  4WFE A;  2XAJ A;  5DM6 V;  2UXN A;  3VQV A;  2QWN B;  2HJF C;  3CS5 A;  2DW4 A;  1N34 O;  1YIT V;  3IC7 A;  3UO3 A;  4KXR A;  4BW9 A;  5L3F A;  2JK5 C;  4FPP A;  3L72 H;  5LL6 Y;  3SJA C;  4IIJ B;  4LFC B;  2QWO B;  1NQT A;  1KUQ A;  2FML A;  4LR3 A;  4MVS A;  3KG2 A;  4IYH A;  4GYC B;  1YEW A;  1PP9 H;  1OV9 A;  3BY6 A;  3K58 A;  4H13 B;  1JOY A;  5K1P A;  4EB6 A;  2P4V A;  2HFE C;  4HAM A;  4GT1 A;  4J42 A;  3JAR A;  2PI4 A;  1R73 A;  2H8P C;  2IBZ H;  2V4D A;  1EN6 A;  4K8Z A;  1BQZ A;  1CPY A;  1M93 A;  4X66 O;  2D2C B;  3VQW A;  4JI4 O;  2JGD A;  1K8A W;  3AEI A;  2FTK A;  3DTU B;  1S3J A;  2L6L A;  2RJZ A;  1AJN A;  2LFR A;  5KHJ A;  4TUY A;  1MSW D;  1J5E O;  1IZ3 A;  1BE3 H;  1VQ4 V;  4BIZ A;  3L9D A;  3OTF A;  2QTO A;  3N2K A;  4YJ3 B;  2EIL C;  4TV8 A;  1VF7 A;  1NKD A;  3RYH A;  2Y48 A;  3T4D A;  1F7Y A;  2OCC B;  1TGO A;  4FIP C;  5FPO A;  2A79 B;  4BIU A;  1IBL O;  4ZHQ A;  2ZXW B;  3AG4 B;  4WBN B;  1DLB A;  3UM7 A;  5JQG B;  1ZX3 A;  2W0F C;  4J9Z B;  1F4N A;  2AHY A;  3RYC A;  1M57 B;  3HR0 A;  3ZMZ A;  3ZMV A;  3CRA A;  3GWK C;  4PDR A;  4X65 O;  4K3A A;  1AI5 A;  3CJH A;  1R6T A;  1WA8 A;  2EIK C;  4LC1 A;  4I5S A;  4HBN A;  1SF9 A;  1G4Y B;  4F6E A;  1K5S A;  3BA9 A;  3PN1 A;  3RVY A;  3T1Y B;  4LF6 O;  4BAY A;  4R50 A;  3JD2 A;  4X20 A;  1PM9 A;  5LA6 A;  3T1H B;  4JI3 O;  2N74 A;  2Y0P A;  3SYC A;  3K03 A;  1KMI Z;  1PPJ H;  4YJ2 A;  3J80 N;  4GKJ O;  2UXD B;  4LFB O;  2PUS A;  2Q5Z A;  1GN6 A;  5IJ9 B;  5CBG A;  5KX5 B;  4PHZ A;  3AG3 B;  5KHH A;  1EZJ A;  4FM0 A;  4DV0 B;  3G71 V;  1K4C C;  4JTC B;  5KUM A;  4H37 A;  1OCR C;  1W59 A;  3P3N A;  3ZRW B;  4DR4 B;  3CWB H;  1CEZ A;  1ZAU A;  2DJV A;  3RYI B;  2W0X A;  2QKS A;  1HNZ B;  1GAX A;  3CRQ A;  1AVM A;  3OUF A;  5KAI Z;  4JAV A;  3QO5 A;  5C93 A;  2ITD C;  4JI5 O;  3CCM V;  4QGP A;  4JI2 O;  1ENV A;  4RQE A;  4LF7 B;  2VWJ A;  1M56 C;  1IUR A;  3L73 H;  1JCH A;  2ZNJ A;  2QDO A;  4FMT A;  2OYQ A;  3JAK B;  5LGT A;  5IYZ A;  2ETN A;  4MVU A;  3RBZ A;  2UUC B;  1JMK C;  4NXN B;  5JH7 A;  3H1H H;  2X0L A;  1I94 B;  3E22 A;  1Q7Y W;  1CXZ B;  3CXC U;  1I7F A;  3SPC A;  2Y0I A;  1P7G A;  2RNB A;  3ASO B;  4DR1 B;  4DW1 A;  2XAQ A;  1T5E A;  1KU9 A;  4O2A B;  1P4R A;  4I50 B;  3LDC A;  4YHH B;  4DV5 B;  5FPR A;  3G4S V;  3M7M X;  1NR1 A;  1XIL A;  4IYI A;  4X1I B;  4ZOL B;  1BHA A;  1YJN V;  4MVO A;  3WU2 Z;  2Z0A A;  3ZHV A;  4X89 A;  1N33 B;  1ZWI C;  2P06 A;  1ZL8 B;  1HDJ A;  2D3O W;  4UV8 A;  3SPJ A;  3CCJ V;  2WWW A;  2UXC B;  4XBF A;  5EIB C;  4LF9 B;  1ARO P;  2G38 A;  2ZM6 B;  3X2Q B;  3HKD B;  5H2F Z;  4CC5 A;  5DN6 G;  4IHJ B;  3R66 A;  3DSQ A;  3E86 A;  2PTM A;  1FFX B;  2F43 G;  1B06 A;  2K1E A;  2KG7 A;  1BCC H;  4B3R B;  2BOB C;  3O9O A;  1VQ5 V;  3Q4H B;  3LSS A;  4RQF A;  4A5U B;  1AB3 A;  3S3W A;  2VQE B;  1EN5 A;  4DV1 O;  4RO2 A;  3U11 A;  3JAM N;  3KZI Z;  2JJ1 G;  1E1R G;  3S3X A;  5EBW C;  3H1K H;  3W7X A;  1Y67 A;  3ZN0 A;  4TQD A;  3ABM B;  2VS0 A;  5JJJ B;  4MVR A;  4K0K O;  3G67 A;  3B77 A;  2HP8 A;  4I4T A;  5KMG A;  4WFH A;  1F23 A;  1DF4 A;  5JQG A;  1M90 W;  3ZED A;  2QEX V;  2IH3 C;  2GHY A;  2OIG A;  2VQF B;  2IJJ A;  4GX0 A;  1L0N H;  2LJ2 A;  1GM8 A;  2W6I G;  1I5Y A;  1VQ8 V;  2YC0 A;  1V55 C;  1HP8 A;  5LMN O;  4AQY B;  1XI1 A;  1NJI W;  1XNQ O;  3SR2 C;  2P4K A;  1YZB A;  2EZP A;  3W7W A;  1RSO B;  1IVS A;  3R65 A;  2NR5 A;  3CC4 V;  2Q7E A;  1MOF A;  3CCQ V;  2ZDI A;  2OT5 A;  3E8F A;  3U0Z A;  2DYR B;  3BRC A;  1SQG A;  4CS3 A;  2UXB B;  5IJ9 A;  5KX5 A;  2JGU A;  2ZD9 A;  5B66 Z;  4HNA B;  2F23 A;  4YY3 O;  4W4K A;  3P30 A;  4DV4 O;  4JI1 B;  2WLN A;  2B1G A;  3KKY A;  3ZRW A;  2ZT9 B;  4O4L B;  3RYI A;  1N8R W;  3CCS V;  4OGQ B;  2Q9L A;  1BZK A;  4P30 A;  4UCV A;  1TUE B;  4L8J A;  4J10 A;  2Q67 A;  4LH7 A;  1R6N A;  1WNS A;  2E5L B;  5JJN B;  2Y4U A;  1JVM A;  4DK0 A;  3E8G A;  2QM4 A;  5IYB O;  3ZHQ A;  4E2L A;  1K92 A;  3JAK A;  5EZY B;  5KHK A;  1PV0 A;  3L74 H;  3E8B A;  3JD0 A;  1N34 B;  4X1Y B;  2Q6A A;  4LH6 A;  4PA3 A;  1BSM A;  1PNK A;  4PA4 A;  2YIB D;  4DUZ O;  3TCU A;  1VF5 B;  3JAW A;  2Y4T A;  4UB8 Z;  3APQ A;  3OMA B;  4CH4 A;  4X1I A;  4ZOL A;  3FD9 A;  1VQ9 V;  3CEI A;  3MDS A;  3H1J H;  1BQ0 A;  3CD6 V;  1OCZ C;  3BAB A;  4PDM A;  1RM1 B;  3CCR V;  2OCH A;  3JAL B;  1ORQ C;  2JEU A;  4JZG A;  2HKO A;  4B3T O;  2F1M A;  3K5M A;  4X66 B;  2Y69 C;  2YUA A;  1GM9 A;  4JI4 B;  4CH5 A;  4LF4 O;  1RPO A;  1FAF A;  4B3M B;  1NVP D;  3QO8 A;  4JI8 O;  4QJF B;  3HKD A;  1VQL V;  2UUB O;  2WA4 A;  5EC1 C;  1J5E B;  2EZO A;  4LBE C;  4I9Q A;  4O4I A;  1NVP B;  1MMM A;  1SET A;  3AG1 B;  3HKE B;  2P6J A;  2FB5 A;  4DR5 O;  5E1A C;  3Q4H A;  1Z5V A;  4FJC C;  3MD0 A;  2PYL A;  4NYK A;  4NXM O;  1NTM H;  1KEC A;  2VWK A;  2F4V O;  1PNM A;  1SC5 B;  2JDI G;  2EIJ B;  1QVF U;  2R70 A;  1IBL B;  3UKM A;  1XRE A;  2A3Q A;  1UJW B;  5B1A C;  2IU0 A;  3N2G B;  2BSK B;  2HVK C;  4CS2 A;  3BHP A;  5B5E Z;  5ITZ B;  5CA1 B;  1JA8 A;  3E2E A;  1S5H C;  3ZS8 C;  1Q8I A;  4Z2W A;  1FJG O;  4WFA V;  1VAR A;  4X65 B;  1QLE B;  4PD4 F;  3FX7 A;  3EXA A;  2ZCE A;  4U7O A;  5KHI A;  4RWU A;  3FYE B;  1XEQ A;  3CXH F;  4LF6 B;  2OTL V;  3M8A A;  1URF A;  2R9R B;  3SYO A;  4ZIB A;  4JI3 B;  1RSO A;  2AGA A;  3A0B Z;  1YDX A;  4GKJ B;  4LFB B;  3BEH A;  4FVM A;  5BR8 O;  2BTQ B;  3JD3 A;  1QHT A;  2GSM B;  2JIZ G;  3HKC B;  1H2S B;  5IYD O;  4NKG B;  1NBM G;  5K1X A;  1KP2 A;  3RT3 C;  4K8X A;  4MTX A;  3K9A A;  2ZE7 A;  3JSL A;  2YEV A;  5EC2 C;  2E76 B;  4JI5 B;  3ZX6 A;  3ZHR A;  4JI2 B;  1AJP A;  2LO1 A;  3EVK A;  1D2D A;  1O9H A;  1SES A;  1N36 O;  3TET A;  1FFT B;  2ZIN A;  2GDS A;  4BIO A;  1BL8 A;  3AG2 C;  5CN0 A;  5EZY A;  5B1O A;  3EHB B;  3C3T A;  3DGE A;  2P22 C;  1SQV H;  2KQX A;  5TIS Z;  1Y6X A;  1G8M A;  2H3O A;  4D6T H;  4JYA O;  1TAE A;  1Y74 B;  4NTX A;  1OCC B;  1SQQ H;  1E79 G;  2HG5 C;  3UT5 B;  1GN4 A;  1L0L H;  2YIB A;  3OGC C;  2EIM C;  2LGW A;  3WB2 A;  3JAL A;  5IYC O;  4TOI A;  1KC8 W;  5FL7 G;  1VP7 A;  2QE7 G;  1XDC A;  4O4H B;  5BZB A;  2DYS C;  5EK0 A;  5LP6 B;  5JWP A;  1M9N A;  4CS4 A;  3BVO A;  1SRY A;  2AZ2 A;  2ZE8 A;  1JFF B;  2RMK B;  5AG2 A;  1M1K W;  5IT9 N;  1OHH G;  1VIB A;  4DV6 O;  4ICG A;  4JAS A;  4O2B B;  4R7C A;  4DXW A;  2MW2 B;  5HFM A;  3JAS B;  3HKE A;  4DV1 B;  2Q69 A;  3UQ8 A;  2NN4 A;  3H9V A;  4KUM A;  5KHG A;  2FKX A;  4ABM A;  4B08 A;  5IJ0 A;  3RFR A;  4JI7 O;  1JPX A;  4MW8 A;  4K0K B;  4RUE A;  3ETE A;  4C7U A;  2YID A;  2E74 B;  1ZSP A;  2UUA O;  1WP7 A;  1VQP V;  3N2G A;  2BSK A;  3DC5 A;  5B1N A;  3HKB B;  4PI0 A;  1SQX H;  2XT9 A;  5ITZ A;  1M4U A;  2EIN B;  1Q43 A;  3ABT A;  2RCV A;  1TVK B;  3D3I A;  3G80 A;  4JAU A;  1NR7 A;  1PNL A;  1WPB A;  5LMN B;  3SPI A;  1XNQ B;  3FFQ A;  3L75 H;  1IBK O;  4PA6 A;  3ETG A;  4P9P A;  2HHH O;  5BMV B;  4MTF A;  1SA0 B;  2EX3 A;  5L3C A;  1GM7 A;  2DN9 A;  3OMN B;  4RUF A;  3OE7 G;  2P90 A;  3CCL V;  4LF8 O;  2XAH A;  4NR1 A;  1D5N A;  1SER A;  3WG7 B;  2OCC C;  4FLX A;  5DED A;  4WCE V;  2BTQ A;  1FS0 G;  4DV4 B;  4FM2 A;  4X88 A;  3HKC A;  2ZXW C;  3AG4 C;  2A9H A;  3CMA V;  3DC6 A;  3A0R A;  1SQF A;  4JYB A;  4MTO A;  2Q0A A;  3GVM A;  1IBM O;  1M57 C;  5A9G A;  4CH6 A;  4QPK A;  2Z5U A;  1KQS U;  3LNN A;  2P7T C;  2DQ3 A;  2FYU H;  3FB8 C;  1YSC A;  5JJE B;  1RPR A;  3LUT B;  4KFM A;  1LNQ A;  4UCS A;  1VQN V;  4YXW G;  5LOV B;  2QSA A;  5KA6 A;  1EBO A;  1UPG A;  2A06 H;  1VF6 C;  1ZTE A;  1H2M A;  1Y76 B;  2W6J G;  2ZDI C;  2ZE6 A;  1N0N A;  4X62 O;  2CE4 A;  3CE2 A;  1K5Q A;  2UU9 O;  1N0J A;  4QIW F;  4IIJ A;  4XDL A;  3AG3 C;  3OFN G;  4ZBM A;  3D36 A;  2IJH A;  4X8A A;  3FAV B;  4DUZ B;  3OW2 U;  2HEP A;  1XBL A;  2CGO A;  1XMO O;  1Q81 W;  1Y74 A;  1BS3 A;  1H2K A;  3CCU V;  1L1F A;  1B04 A;  3JAT B;  1Q6H A;  2Q73 A;  1K9M W;  3B2E E;  2R9I A;  3OGI B;  1FXK B;  3SYQ A;  3UT5 A;  4B3T B;  2QKC A;  4MT8 A;  3KCY A;  5LYJ B;  1N32 O;  2IJK A;  1LUV A;  1WJZ A;  4LF4 B;  1J95 A;  3QVN A;  4JI8 B;  4GLX A;  3O65 A;  2UUB B;  2M7W A;  4O4H A;  3ASN B;  2IH1 C;  4F4L A;  4QNH B;  5LP6 A;  5HFL A;  4JI0 O;  1AI4 A;  4DV2 B;  3OR7 C;  2DQ0 A;  1JFF A;  4YJ3 A;  4FLW A;  3ASO C;  5CB4 B;  1WP8 A;  4DR5 B;  4NXM B;  4O2B A;  1HW7 A;  2F4V B;  2ILM A;  2AW9 A;  3A2F A;  4WBN A;  1YCI A;  3FB6 C;  4NB5 A;  3RGB A;  3JCZ A;  3LSQ A;  5H5N A;  2C2A A;  2F66 C;  2BCC H;  5B1B B;  5L3E A;  2ITC C;  5EBM C;  3ZMT A;  4G28 B;  1YJW V;  3H01 A;  1FJG B;  2CTQ A;  5EBL C;  5C8Y B;  3T1C A;  1AP5 A;  4AIL C;  3HKB A;  3X2Q C;  3TGU H;  1DGS A;  1RP3 B;  2FL4 A;  1VF6 A;  4PV1 B;  3VQY A;  1QCE A;  4QE9 A;  2AXT Z;  1NTZ H;  4PJ0 Z;  1GN3 A;  2PGG A;  2DOS A;  3A0H Z;  1AP6 A;  4MVM A;  1S5J A;  1K97 A;  1P49 A;  2EBO A;  5IY5 B;  3K5N A;  3ABU A;  4KP4 A;  4AHC A;  2ZNI A;  3E83 A;  2N05 A;  1GRJ A;  2AHZ A;  5BR8 B;  3ZMU A;  3I55 V;  4J7Z A;  3HB3 B;  3OT7 A;  3WB0 A;  4FLV A;  1R3J C;  1H2G A;  3ABM C;  2IM9 A;  4PDV A;  2ZIM A;  2ZE5 A;  3D3Q A;  3RWR D;  1GO3 F;  3HPL C;  4IL6 Z;  1K3E A;  4UVA A;  4FLY A;  4EEQ A;  5L3B A;  1DTO A;  3CP1 A;  1KP3 A;  1PKX A;  5LBQ A;  5IWA O;  1XL4 A;  3THO A;  2A0L A;  2CAZ C;  2WLK A;  1G6U A;  3L70 H;  2QR4 A;  3DXR B;  1XL6 A;  1N36 B;  3OEH G;  2HJD A;  1S5L Z;  1LR1 A;  5LOV A;  1DF5 A;  4QPJ A;  1P7B A;  3BA8 A;  4O2A A;  4I50 A;  3PJS K;  3H1L H;  1VQM V;  3K08 A;  3F7V C;  2DYR C;  3ML0 A;  2JJ2 G;  2X6B A;  2V7Q G;  3AK2 A;  1S72 V;  4EB6 B;  4JYA B;  1ZL8 A;  1MSD A;  3FAV A;  4H0L B;  3OEE G;  2ADQ B;  1WPX A;  4LFA O;  3BAA A;  4P2Z A;  3M99 B;  3LDE A;  3TJT A;  3OMI B;  2KSD A;  3LDD A;  5IE9 A;  2QWR B;  3JAT A;  3QO7 A;  5LHG A;  4DR7 O;  3STL C;  3ZJZ A;  1MA1 A;  3U10 A;  1FXK A;  4JPR A;  1WB8 A;  1ZLZ A;  2Q68 A;  5GTH Z;  3CPW U;  4K35 A;  4FLU A;  4IHJ A;  5LYJ A;  1NI8 A;  2BOC C;  5F2V O;  1FFX A;  2ZIO A;  1S77 D;  1XQ8 A;  4ASU G;  3ZBH A;  3QTC A;  3SGI A;  2WLI B;  1NH2 B;  4DV6 B;  1I0H A;  1TUB B;  3J7A U;  3MHS C;  1Q86 W;  2WLM A;  1R3I C;  2XOK G;  3B40 A;  2Q7G A;  4PDL A;  5CB4 A;  1AR1 B;  1XNR O;  3SJB C;  4ZHQ B;  2Q8V A;  3VQX A;  1GKF A;  5D5Q A;  1OCO B;  1R3L C;  2QM8 A;  4JI7 B;  4P9O A;  4J41 A;  1X4T A;  3RYC B;  1RM1 C;  4TV9 B;  1QLN A;  4XDK A;  1QR8 A;  4UVB A;  2ZR2 A;  2UUA B;  5D5P A;  4R8C A;  2YIA A;  1R6K A;  4PI2 A;  2RN9 A;  4DR2 O;  2WAM A;  3ABK B;  3SJC C;  3ZRX A;  2QWP B;  3BFR A;  3ZRS A;  4UFZ A;  3G6E V;  3F5W C;  3QNE A;  1AI7 A;  1XUQ A;  4KL1 A;  4OPH A;  5B3S B;  1V54 B;  3L71 H;  3A8T A;  5LMU O;  1XMQ O;  1VEW A;  5E79 Z;  1IBK B;  2CGN A;  1H2N A;  4R6Z A;  2HHH B;  4Q20 A;  2YXY A;  4JYY A;  3TXQ A;  4JI6 O;  4JV5 O;  3AG1 C;  2NLJ C;  4IGG A;  4TQF A;  1YTF D;  1K33 A;  2O57 A;  3C90 A;  4LF8 B;  4G27 B;  3FKS G;  4HNA A;  4JAA A;  3W7S A;  2RQ6 A;  2V1D A;  1NT2 B;  3SYP A;  2EIJ C;  3SYA A;  2Q7H A;  1YTF B;  3IGA C;  1OJH A;  1H8H G;  4FFB B;  1Z2G A;  4HZ3 A;  4O4L A;  4NTY A;  3APO A;  3VBB A;  1Q3E A;  4GZR B;  4FK5 C;  4DRX B;  1IBM B;  4UXN A;  1P84 F;  1HWY A;  1JJ2 U;  4NVP A;  5CA0 B;  1QLE C;  2M6Y A;  3K0D A;  3SPG A;  1SQP H;  3SDL A;  1MZE A;  3KCX A;  4XDJ A;  3C3S A;  1QR9 A;  5FLX N;  3K06 A;  2WLL B;  1I5X A;  2ODM A;  1GK9 A;  3E22 B;  3DXR A;  2QJ1 A;  3W7T A;  2EIL B;  2UXX A;  4X1Y A;  3CX5 F;  3B4S A;  1DK1 A;  1EN4 A;  4B7E A;  3LNM B;  4X62 B;  3CC7 V;  2UU9 B;  2IW5 A;  2B5U A;  4U7N A;  3J81 N;  4LP8 A;  3CC2 V;  1NU1 H;  3W7U A;  3RYF B;  3JYC A;  1LUW A;  4PA9 A;  1XMO B;  1S0V A;  1AJQ A;  5GW7 A;  1GTO A;  4O4J B;  2N04 A;  2BTO A;  2EIK B;  5IDJ A;  3UO2 A;  4WFG A;  2YIC A;  1H38 A;  2EUL A;  4TSF G;  3IC9 A;  3IFX A;  1N32 B;  1MAB G;  4DV3 O;  4EKW A;  4GKK O;  4BWA A;  2PI5 A;  4B3M O;  5H9C A;  1O9G A;  1GH6 A;  2KG7 B;  1N4C A;  1SZX A;  1HR0 O;  3ZHS A;  2CK3 G;  3ZMS A;  4JI0 B;  1B3Q A;  4B3S O;  2P5O A;  1YXB A;  2OWO A;  1QNM A;  1JJO A;  4UCU A;  2KKW A;  3D36 C;  3STZ C;  1VQ7 V;  4FLT A;  1MNG A;  4J9Y B;  2WLI A;  4OX9 O;  3TXS A;  2YI9 A;  4X64 O;  1YI2 V;  1OCR B;  3T4Z A;  4DR6 O;  1TUB A;  3WFV A;  2K9P A;  5LHH A;  1MG1 A;  4UCO A;  4KHP O;  1EZV H;  3CCE V;  4LCU C;  4DYL A;  4UCT A;  3RN4 A;  1R1B A;  3CRC A;  4I4T B;  3K59 A;  3BCC H;  5KMG B;  4FM1 A;  1HNW O;  2WSS G;  3P32 A;  1OCC C;  5CA1 A;  2LFS A;  3CSX A;  4E4E A;  1M56 B;  4H33 A;  4U3J B;  1AR4 A;  1IDS A;  5FNV B;  4TV9 A;  2Q4P A;  3I56 V;  3SPH A;  1PL0 A;  3CB2 A;  5BY1 A;  1PD3 A;  4DR3 O;  5LGN A;  3OTO O;  2LGQ A;  2XHB A;  4DV7 O;  1TA8 A;  4JTD B;  5LXT B;  3T2M A;  2YS8 A;  5LP6 C;  5CBF A;  2OTJ V;  1IXB A;  1VQO V;  4NTW A;  1YF2 A;  4OPA A;  1I08 A;  3P3P A;  1KKD A;  3ICX A;  1F51 A;  4YY3 B;  4FZ1 A;  3VOU A;  3MAQ A;  3QG5 A;  2JS5 A;  2IU3 A;  5EIB D;  1EM1 A;  4JTA B;  4D7S A;  3ZN1 A;  2JS3 A;  4CZZ A;  4I0X B;  2VRZ A;  2HR3 A;  4MTG A;  1IXM A;  1HNX O;  3WB1 A;  1BGY H;  2XAS A;  4FFB A;  2PZS A;  1YVW A;  2EJR A;  4DUY O;  4AI8 A;  4JZ2 A;  4UB6 Z;  3QF7 A;  3E89 A;  5H6Q A;  4B7K A;  3F7Y C;  2DWE C;  4F6R B;  2YSU B;  2EIN C;  4TT3 G;  4DRX A;  4EFE A;  1IX9 A;  5IWA B;  3SJQ C;  4LF5 O;  1H8E G;  2X6A A;  2DMX A;  2HVJ C;  5CA0 A;  2JVD A;  1YIJ V;  2R9A A;  3OM3 B;  1FD9 A;  2YXL A;  4Z1M G;  4JYC A;  2B9Z A;  4LWS B;  5J9P C;  2WLL A;  3IJ4 A;  5EYP B;  1CP9 A;  5L3D A;  3RW0 A;  1KBH A;  3B8N A;  4LFC O;  1AR5 A;  2XAF A;  4MVZ A;  3CCV V;  1GMG A;  3JAW B;  1FKA O;  2PF4 E;  2GBO A;  1FXV A;  2DWD C;  2F93 B;  3WG7 C;  3LSU A;  3ZHU A;  2R72 A;  3GWO A;  1ROP A;  1NZ6 A;  2IJI A;  4MVQ A;  5KAF Z;  2ARH A;  4MSW C;  3RYF A;  4LFA B;  1WN7 A;  3CRR A;  2AZ0 A;  3K0G A;  1XHZ A;  2Q0O C;  2QA4 V;  3B09 A;  4O4J A;  1V55 B;  3ZCC A;  2CH7 B;  2QKA A;  4DR7 B;  3NR7 A;  4DW0 A;  2ZR3 A;  4UV9 A;  2LW7 A;  1FXH A;  2OIE A;  5CBH A;  2MK3 A;  1U96 A;  4Z1V A;  5JCO C;  4GX5 A;  1YJ9 V;  4O4I B;  5J2U B;  4U3F H;  5JVD B;  1Y66 A;  2GV9 A;  3ETD A;  3IAY A;  3AG7 A;  3JAS A;  3FB5 C;  1S76 D;  4YIO A;  2X7R B;  5L3G A;  1XNR B;  4MW3 A;  2BE3 A;  1K4D C;  1Z5W A;  1NS1 A;  2CUG A;  3OAA G;  2WLJ A;  1H2L A;  1FXK C;  4MS2 A;  3CYO A;  4HYO A;  2RDC A;  4FZ0 A;  4DR2 B;  4U3J A;  2XAG A;  2EJ7 A;  3EFF K;  5FNV A;  1TVK A;  1COW G;  4I9W A;  4I55 B;  4WFB V;  3JD1 A;  3T1Y O;  1Q5O A;  1UFI A;  3T1H O;  5LMU B;  4DK1 A;  1XMQ B;  1F4M A;  2GTA A;  4EFB A;  2UXD O;  5LXT A;  3ASN C;  4ZI7 B;  5BMV A;  3CRM A;  5J2T B;  1SA0 A;  2CDY A;  2KB1 A;  4BR6 A;  1QVG U;  1FPO A;  3FYI B;  5KLV H;  5GON B;  4X1K B;  4DV0 O;  4JI6 B;  4JV5 B;  1MZF A;  4GUN A;  2GUZ B;  4YIP A;  2XUM A;  4CC6 A;  5BXZ A;  1AI6 A;  4DR4 O;  1SQB H;  4N23 A;  5A2Q N;  4LNU B;  1HNZ O;  1Q6I A;  1OCZ B;  4H44 B;  1W0K G;  2YDE A;  4I7Z B;  4N21 A;  4WFF A;  1YHQ V;  1VMG A;  4DO2 A;  1VQK V;  2YEV B;  3D8C A;  5B1B C;  5H6R A;  4LF7 O;  2JEX A;  4I0X A;  2Y69 B;  4UUJ C;  5DEC A;  4FFK A;  1SZT A; 
#chains in the Genus database with same CATH homology
 5HFM A;  1BHB A;  2Q69 A;  4R6Z A;  3RVZ A;  4KUM A;  2D3O W;  2P67 A;  4UV8 A;  3SPJ A;  3CCJ V;  4Q20 A;  3K79 A;  1QBZ A;  2WWW A;  4XBF A;  3AG1 C;  2NLJ C;  1YTF D;  1K33 A;  1JPX A;  1ARO P;  4MW8 A;  4G27 B;  3X2Q B;  4RUE A;  2NNU A;  3FKS G;  3ETE A;  2B1I A;  3W7S A;  1K73 W;  5DN6 G;  2V1D A;  1VQP V;  3E35 A;  3E86 A;  3SYP A;  5B1N A;  2F43 G;  3MHH C;  2EIJ C;  5IY5 C;  3CME V;  3SYA A;  1YTF B;  2K1E A;  3IGA C;  2EIN B;  1H8H G;  5KA5 A;  2WLH A;  4HZ3 A;  2BOB C;  2ATK C;  3ABT A;  3D3I A;  3LSS A;  1VQ5 V;  3ZIA G;  4JAU A;  1NR7 A;  1PNL A;  5LHI A;  3SPI A;  3VBB A;  4RQF A;  3OR6 C;  4FK5 C;  4UXN A;  4OXS A;  5B1A B;  4RO2 A;  1HWY A;  4PA6 A;  1JJ2 U;  3ETG A;  1OZ0 A;  1QLE C;  4P9P A;  2JJ1 G;  3K0D A;  1E1R G;  4MTF A;  3SPG A;  5EBW C;  3W7X A;  3ZN0 A;  5L3C A;  1GM7 A;  2QM7 A;  3OMN B;  1Y4M A;  4XDJ A;  5CMU A;  1QR9 A;  4JGS A;  3ABM B;  3K06 A;  2WLL B;  4RUF A;  3OE7 G;  2P90 A;  1I5X A;  4MVR A;  2XAH A;  4RAI A;  4CBC A;  3CCL V;  3B77 A;  1GK9 A;  4WFH A;  1SER A;  1NH2 D;  3WG7 B;  2OCC C;  3W7T A;  1F23 A;  2EIL B;  1DF4 A;  2UXX A;  4WCE V;  4JF3 A;  1M90 W;  4GX1 A;  2QEX V;  1FS0 G;  2IH3 C;  2GHY A;  3NXS A;  3LNM B;  4X88 A;  5CA3 A;  2ZXW C;  3AG4 C;  2IJJ A;  4G2K A;  4GX0 A;  4QE7 A;  3CC7 V;  1GM8 A;  2W6I G;  1I5Y A;  1VQ8 V;  1EFR G;  2A9H A;  4TWK A;  3CMA V;  4ZKI A;  3A0R A;  1V55 C;  2IW5 A;  3GB7 C;  1NJI W;  3FB7 C;  2B5U A;  4U7N A;  4JYB A;  4LP8 A;  4MTO A;  3CC2 V;  3ABL B;  1M57 C;  2Z3Y A;  2EZP A;  3W7W A;  3W7U A;  4QPK A;  2Z5U A;  1KQS U;  3JYC A;  2P7T C;  2DQ3 A;  3FB8 C;  1YSC A;  1RPR A;  3LUT B;  3R65 A;  4KFM A;  4PA9 A;  1S0V A;  1AJQ A;  1LNQ A;  4UVC A;  3CC4 V;  1VQN V;  5GW7 A;  1GTO A;  1MOF A;  4YXW G;  4BW5 A;  3CCQ V;  2ZDI A;  2EIK B;  5IDJ A;  2OT5 A;  5KA6 A;  1EBO A;  3E8F A;  2DYR B;  4WFG A;  2XND G;  1H38 A;  3TK1 A;  4TSF G;  3OUS A;  2ZD9 A;  3B8M A;  2W6J G;  3K3W A;  3IFX A;  4PA7 A;  2ZDI C;  1MAB G;  3P30 A;  4EKW A;  2WLN A;  2WPD G;  2PI5 A;  5H9C A;  2X6C A;  3E8H A;  1K5Q A;  2B1G A;  4QIW F;  4XDL A;  3ZRW A;  3AG3 C;  1W0J G;  3OFN G;  4ZBM A;  3D36 A;  2IJH A;  4X8A A;  3CCS V;  1N8R W;  2CK3 G;  3OW2 U;  3ZMS A;  5KUK A;  5LGU A;  1WLE A;  4P30 A;  3ZRV A;  1VQ6 V;  1TUE B;  3STZ C;  1VQ7 V;  4J9Y B;  1K34 A;  1Q81 W;  2WLI A;  3AG2 B;  1YI2 V;  2Q67 A;  1KD1 W;  1OCR B;  4GX2 A;  3CCU V;  1R6N A;  1L1F A;  3T4Z A;  1K9M W;  1JVM A;  1BMF G;  2R9I A;  3E8G A;  1FXK B;  3WFV A;  3SYQ A;  5LHH A;  1MG1 A;  4L87 A;  5IYB O;  4E2L A;  1K92 A;  1W2B U;  1E1Q G;  3CCE V;  4LCU C;  4MT8 A;  4PEL A;  2IJK A;  4GCZ A;  3ABL C;  3E8B A;  1R3K C;  2WSS G;  3P32 A;  1OCC C;  1JQ0 A;  1J95 A;  3JD0 A;  2LFS A;  1M56 B;  2Q6A A;  4H33 A;  4PA3 A;  1PNK A;  2HLD G;  4PA4 A;  3I56 V;  1Q82 W;  2M7W A;  1JX9 A;  3SPH A;  1K7D A;  3ASN B;  2IH1 C;  3TCU A;  1OCO C;  1THZ A;  4F4L A;  4QNH B;  1PL0 A;  5HFL A;  1AI4 A;  2EIM B;  3OMA B;  1PD3 A;  4WF9 V;  3OR7 C;  5LGN A;  3K04 A;  2DQ0 A;  1B6Q A;  4JTD B;  3ASO C;  1VQ9 V;  3T2M A;  5CBF A;  3CD6 V;  1OCZ C;  4PDM A;  2OTJ V;  1RM1 B;  3CCR V;  3ABK C;  1VQO V;  1ORQ C;  2JEU A;  2DYS B;  2LP7 A;  2HKO A;  5B3S C;  2H94 A;  1V54 C;  3FB6 C;  3JD4 A;  2ZQM A;  4WFE A;  3JCZ A;  3LSQ A;  1KKD A;  2Y69 C;  2XAJ A;  1GM9 A;  2C2A A;  5DM6 V;  1F51 A;  2UXN A;  3VOU A;  2HJF C;  1RPO A;  2DW4 A;  5B1B B;  5L3E A;  1YIT V;  3IC7 A;  1NVP D;  3QO8 A;  2IU3 A;  2ITC C;  5EBM C;  5L3F A;  2JK5 C;  4FPP A;  3ZMT A;  4QJF B;  4G28 B;  1YJW V;  1VQL V;  3H01 A;  4JTA B;  5EC1 C;  1NQT A;  3ZN1 A;  5EBL C;  4MVS A;  3T1C A;  2EZO A;  4CZZ A;  3KG2 A;  4LBE C;  2HR3 A;  4MTG A;  1IXM A;  1NVP B;  3X2Q C;  2XAS A;  3BY6 A;  1JOY A;  1SET A;  3AG1 B;  2P6J A;  2EJR A;  5E1A C;  3E89 A;  1QCE A;  5H6Q A;  4FJC C;  2HFE C;  3MD0 A;  3F7Y C;  2DWE C;  4HAM A;  4GT1 A;  1KEC A;  4QE9 A;  1PNM A;  2YSU B;  2EIN C;  4TT3 G;  2PI4 A;  1R73 A;  2H8P C;  2JDI G;  4MVM A;  1K97 A;  2EBO A;  5IY5 B;  2EIJ B;  1QVF U;  3SJQ C;  1H8E G;  2X6A A;  2HVJ C;  3ABU A;  4KP4 A;  1CPY A;  3UKM A;  1YIJ V;  3E83 A;  3OM3 B;  5B1A C;  1UJW B;  2IU0 A;  2HVK C;  4Z1M G;  1K8A W;  3AEI A;  4JYC A;  2AHZ A;  3ZMU A;  3I55 V;  2FTK A;  3DTU B;  5J9P C;  2WLL A;  1S3J A;  3HB3 B;  3E2E A;  1S5H C;  1AJN A;  1CP9 A;  5L3D A;  2LFR A;  3RW0 A;  3B8N A;  4WFA V;  1R3J C;  2XAF A;  1MSW D;  4MVZ A;  1H2G A;  3CCV V;  1QLE B;  3ABM C;  4PDV A;  1GMG A;  1VQ4 V;  4BIZ A;  1GO3 F;  3HPL C;  1FXV A;  2DWD C;  3WG7 C;  2QTO A;  4U7O A;  1K3E A;  2EIL C;  4UVA A;  3GWO A;  1NKD A;  3FYE B;  1ROP A;  2Y48 A;  5L3B A;  4MVQ A;  1DTO A;  2IJI A;  3T4D A;  2OTL V;  3CP1 A;  1KP3 A;  2R9R B;  1PKX A;  5LBQ A;  2OCC B;  3SYO A;  1XL4 A;  4FIP C;  4MSW C;  2A0L A;  2A79 B;  4BIU A;  2WLK A;  2ZXW B;  3AG4 B;  3K0G A;  1DLB A;  1XL6 A;  2QA4 V;  3BEH A;  3UM7 A;  3OEH G;  1V55 B;  3ZCC A;  2W0F C;  3JD3 A;  4J9Z B;  1F4N A;  1DF5 A;  2AHY A;  2GSM B;  2JIZ G;  2ZR3 A;  1M57 B;  4UV9 A;  3ZMZ A;  3ZMV A;  1FXH A;  4QPJ A;  4PDR A;  5IYD O;  1NBM G;  1P7B A;  1AI5 A;  5CBH A;  3PJS K;  1KP2 A;  2EIK C;  4MTX A;  2MK3 A;  3K08 A;  3F7V C;  1VQM V;  4LC1 A;  3K9A A;  2DYR C;  4GX5 A;  1YJ9 V;  3ML0 A;  2JJ2 G;  2X6B A;  2V7Q G;  4I5S A;  1G4Y B;  1S72 V;  2YEV A;  5EC2 C;  1K5S A;  1Y66 A;  3RVY A;  3ETD A;  4BAY A;  4R50 A;  3JD2 A;  1AJP A;  3OEE G;  3FB5 C;  1WPX A;  3SYC A;  3K03 A;  1S76 D;  2X7R B;  3M99 B;  4P2Z A;  3LDE A;  5L3G A;  5CBG A;  4MW3 A;  1SES A;  3OMI B;  3LDD A;  3AG3 B;  3TET A;  3QO7 A;  1EZJ A;  1FFT B;  5LHG A;  3STL C;  3ZJZ A;  3G71 V;  1K4C C;  1FXK A;  1K4D C;  4JTC B;  4JPR A;  1BL8 A;  2Q68 A;  3AG2 C;  5KUM A;  3CPW U;  4H37 A;  1OCR C;  5CN0 A;  3ZRW B;  3OAA G;  1CEZ A;  2BOC C;  5B1O A;  2WLJ A;  2QKS A;  3EHB B;  1S77 D;  1FXK C;  4MS2 A;  3CYO A;  4HYO A;  2XAG A;  3DGE A;  3OUF A;  4ASU G;  5C93 A;  3EFF K;  3QO5 A;  4JAV A;  1G8M A;  2ITD C;  4I9W A;  1COW G;  4WFB V;  3CCM V;  3JD1 A;  2WLI B;  1ENV A;  1NH2 B;  4RQE A;  1M56 C;  1JCH A;  1F4M A;  3MHS C;  1OCC B;  4FMT A;  1Q86 W;  2WLM A;  1R3I C;  2XOK G;  3ASN C;  4PDL A;  1E79 G;  2HG5 C;  1AR1 B;  5LGT A;  2KB1 A;  1QVG U;  3OGC C;  4MVU A;  2EIM C;  3RBZ A;  3FYI B;  5IYC O;  1GKF A;  1OCO B;  2X0L A;  1R3L C;  2QM8 A;  1KC8 W;  1AI6 A;  4P9O A;  1Q7Y W;  5FL7 G;  2QE7 G;  3CXC U;  1QLN A;  1RM1 C;  4XDK A;  1QR8 A;  3SPC A;  4N23 A;  4UVB A;  2ZR2 A;  3ASO B;  5BZB A;  2DYS C;  4R8C A;  2XAQ A;  5EK0 A;  1R6K A;  1P4R A;  1M9N A;  3LDC A;  1OCZ B;  1W0K G;  1SRY A;  3ABK B;  2WAM A;  3ZRX A;  4N21 A;  3G4S V;  1NR1 A;  1M1K W;  4WFF A;  3ZRS A;  1BHA A;  1YHQ V;  1YJN V;  4MVO A;  3G6E V;  3F5W C;  1OHH G;  4DO2 A;  3QNE A;  1AI7 A;  1VQK V;  2YEV B;  5B1B C;  4X89 A;  5H6R A;  5B3S B;  1V54 B;  2JEX A;  4JAS A;  4R7C A;  4DXW A;  2Y69 B;  1ZWI C;  4UUJ C;  1SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...