1K4CC

Potassium channel kcsa-fab complex in high concentration of k+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4cC00
3RVYA 5KUKA 3SPJA 4OXSA 4PA4A 4R50A 4WFEA 3AG1C 4PDLA 3E8GA 2ITDC 3EFFK 4X89A 5B1AC 3BEHA 2DYSC 3SJQC 5CBFA 2QTOA 4I9WA 4LP8A 4RO2A 2JK5C 2P7TC 2X6AA 4PA7A 4QE9A 4R7CA 4MVUA 5EBLC 4HZ3A 4G28B 5B1BC 3LDEA 2WLJA 2X6CA 2WLHA 2DWEC 1OCZC 1XL4A 3GB7C 3SYCA 3UKMA 3HPLC 1OCCC 2K1EA 2WLMA 3ABLC 3FB6C 3KG2A 2BOBC 4MS2A 1ORQC 2YEVA 3AG4C 3OR7C 3PJSK 1M56C 3OUSA 3R65A 1XL6A 2AHYA 3SPGA 4MTFA 1LNQA 3SYQA 4RUEA 4CBCA 2A0LA 3T2MA 2KB1A 2WLNA 4X8AA 3STZC 4PA9A 3K0GA 4WFFA 4P9OA 4PDRA 4PA6A 3TCUA 2Q67A 5EBWC 2H8PC 4H37A 3F7YC 3TETA 1ZWIC 4MVSA 4HYOA 4XDLA 1R3JC 1R3IC 1K4CC 1V54C 2A79B 2Q6AA 4JTAB 3UM7A 3E8FA 3WG7C 5BZBA 1J95A 5CBHA 4KFMA 4MW3A 4P2ZA 3SPHA 3SYPA 3K0DA 2WLIB 2W0FC 1JVMA 3E89A 3SPCA 4EKWA 3AG3C 3OUFA 2EIJC 2HVKC 4H33A 5EC1C 2IH3C 3VOUA 4PA3A 3E8BA 1OCOC 4GX0A 1OCRC 2ITCC 2A9HA 2ATKC 4PDMA 2HG5C 4R6ZA 1K4DC 5IY5C 2Q69A 2EILC 2EINC 3OR6C 3FB5C 3IFXA 4JTCB 5E1AC 1V55C 3ASOC 2NLJC 5J9PC 4MW8A 1P7BA 3LDCA 4LBEC 3E83A 3RBZA 3K03A 3OGCC 4J9ZB 1QLEC 1S5HC 3RW0A 3F5WC 5EC2C 3ZRSA 2HVJC 1BL8A 3F7VC 4F4LA 2X6BA 2HFEC 3K06A 4G27B 4P30A 2WLIA 4MVMA 2AHZA 2WLLB 4MVQA 3T1CA 3E86A 3FB7C 2QKSA 4RUFA 2WLLA 5EK0A 3K08A 3IGAC 2EIMC 4MVOA 4BW5A 4X88A 5B3SC 1R3LC 4MVRA 4DXWA 3STLC 3RVZA 3SYAA 2ZXWC 3LUTB 4R8CA 3ASNC 2WLKA 4QE7A 3SPIA 4PDVA 2HJFC 3T4ZA 4MTOA 5CBGA 3LNMB 4RAIA 4UUJC 2Y69C 5KUMA 3T4DA 3X2QC 4J9YB 4WFHA 2R9RB 2ZD9A 1G4YB 3K04A 3JYCA 4TWKA 4ZBMA 4XDKA 3SYOA 3FB8C 2EIKC 2IH1C 4GX1A 4LCUC 4MVZA 1KKDA 2Q68A 2BOCC 3E8HA 1R3KC 3ZJZA 2DWDC 3ABKC 3AG2C 4GX2A 4MSWC 4GX5A 3ABMC 4MTGA 4WFGA 4QNHB 2OCCC 4P9PA 4XDJA 5EBMC 1M57C 2DYRC 4JTDB 3LDDA
chains in the Genus database with same CATH superfamily
3CRQA 1IBMB 1N32B 1XHXA 2BSKB 3E8GA 5B1AC 1DLBA 4CH6A 4LP8A 3ETQA 4MVUA 1SQQH 1Q86W 2WLJA 4I50A 1XNRO 1GH6A 3BHPA 2K1EA 1KQSU 1ORQC 2RDCA 1B04A 4X1YA 3EHBB 3OTOO 4X8AA 2Q7EA 4UCSA 2C2AA 3D3IA 2E75B 3H9VA 3UM7A 1Q6IA 4JI7B 2WLIB 2ZE8A 5LGTA 1ZUQA 5KX5A 4PI0A 5GTIZ 5AG2A 3AG3C 1P49A 5A2QN 3OEEG 3W7WA 2KSDA 2ITCC 4D7SA 2FMLA 4DUZB 3AG4B 1N33B 3O9OA 1XBLA 2QE7G 4I55B 3ZHTA 3A2FA 1D5AA 5JCOC 4RQEA 2FTKA 1G8MA 1F51A 4AI8A 2ZR2A 4O4JA 4Z2WA 4JI0O 1AP6A 1IXMA 1SRYA 5H6QA 2UXBO 3L9DA 4IHJA 4UB8Z 3B09A 3ZN1A 1E79G 3LSQA 1S5JA 4QE7A 3U11A 5KA6A 1VQ8V 2UUCB 1VF7A 3CCSV 2UXXA 2VQFB 3WB2A 2R9RB 2JGDB 1H8EG 5B1NA 4DUYO 2Q68A 5B5EZ 3MHHC 5LMUO 4WF9V 1P7GA 1PL0A 1H2MA 1P84F 4QNHB 1THZA 1Y76B 1Q43A 3ASOC 4JTDB 3LDDA 1D5NA 4R50A 3ZN0A 3J81N 3GWKC 4R7CA 2HJDA 5LBQA 4HNAA 1DGSA 3G67A 1I5YA 2HHHO 3L73H 3OMIB 5CB4B 4IYHA 4PA9A 4X20B 3TETA 1SA0A 1HNZO 3WG7C 4MW3A 1RPOA 4IIJA 5LXTA 3RN4A 3E89A 2V1DA 3SPCA 1W59A 3FX7A 2OCHA 1M93A 4QJFB 2G38A 5BXZA 4DV0B 1Q8IA 4DK0A 1H38A 2ZCEA 4R6ZA 1I94O 4X66B 4LF9O 3FAVA 5J2TA 3OMAB 4I0XB 2P22C 4JI8B 2QSAA 3Q4HB 1QLEB 4O2AB 1M1KW 1V54B 1COWG 4G27B 4NXMB 4B3RO 3CRMA 3FKSG 4GT1A 1MMMA 4RUFA 4LH6A 5IWAO 3N27A 4LF7O 3K5MA 2BTQB 4FZ0A 5L3FA 2QTSA 1Q90D 3ZHUA 4BIOA 1NQTA 2EIMB 1HNWO 4ZKIA 1YJWV 1YSCA 5LOVB 1VQOV 5IJ0A 5KUMA 4TOIA 1V55B 4J11A 4G2KA 4LF6O 1ENVA 4X65B 1Y74A 1KU9A 4GX1A 3L74H 5FPRA 5IYBO 4TV9B 5L3GA 2DWDC 1XEQA 1P4RA 4LWSB 1M57C 5B3SB 3RVYA 5KUKA 3AG1C 1GMGA 2ZXWB 4FIPC 4X89A 3IC7A 5E79Z 4I4TA 3DXRB 3I56V 1IX9A 1OCZC 3UKMA 5GONA 3ABLC 1D2DA 1GN6A 3H1LH 2KB1A 3SJCC 3RWRD 1QU7A 4JASA 4PA6A 4DYLA 1AR1B 2GTAA 3F7YC 4WBNB 3ABMB 5K1XA 5JQGA 1DK1A 1CEZA 2JJ2G 4JTAB 2A79B 3ZRVA 1MA1A 3JD3A 3HKDB 4UV8A 2MW2B 1FKAO 2UUAO 1SQBH 5DN6G 2IJJA 1IXBA 4OPAA 3B8MA 2IJKA 3E8BA 1SQPH 2OIGA 1H2NA 2PYLA 4GX0A 5B66Z 3CYOA 2HKOA 4ZIBA 4YIPA 1OHHG 4GKKO 1K7DA 3LDCA 2UXDO 1DF4A 3IAYA 3RBZA 5IE9A 4F4LA 1BL8A 1GM7A 4UB6Z 3S3WA 2P67A 1PV0A 1Z5WA 4B3SO 4IYIA 3E86A 2UU9B 1GAXA 3T1YB 4DV3B 4CH5A 4DR2O 1XMOO 3K79A 4BW5A 3P30A 2F43G 3UCSC 3BA8A 1BS3A 4OX9B 3SPIA 1FXVA 3CSXA 2ZE7A 2N04A 4AQYO 4IL6Z 3HR0A 1SF9A 4CH3A 3CCUV 3G71V 2JGDA 1FFTB 4JYYA 5D5QA 1VQ4V 2UXNA 2ZNJA 5KHKA 4GX5A 1GN4A 1Y76A 1HR0B 3AK1A 4B3TO 5KAIZ 3UT5B 1RP3B 4KHPB 3RYHB 2YIAA 4LFBO 2JEUA 4DR6O 3TGUH 5EBLC 4PV1B 2RN9A 4J7JA 2CGOA 2KG7B 2DWEC 1VQMV 3NXSA 2ADPA 4O4LA 3PJSK 1AI4A 4CBCA 4RUEA 2WLNA 2M7WA 5CB4A 1I0HA 1VQNV 1QQCA 2ZR3A 3TCUA 4KXRA 5EBWC 3ZX6A 1AJNA 1NJIW 3ML0A 4X20A 3U0ZA 2ADQB 3SYPA 2YXLA 3N2KB 4WFBV 3OUFA 3NR7A 2IH3C 2PI5A 1FS0G 1EZJA 1EZVH 2F66C 1K4DC 4JTCB 1T5EA 1UFIA 3BA9A 1P7BA 3MAQA 2YI8A 4JZGA 5B1OA 4DR3B 3RW0A 4N23A 3J80N 3B77A 4PD4F 2EJRA 4FM1A 1TUEB 1AR5A 4X1IB 1VQ9V 4MVOA 4X88A 1Q6UA 1IBLB 1VF5B 5JJEB 2FYUH 1H2KA 1L1FA 4FK5C 3RYIB 1FFXB 1SESA 5LP6C 1NZ6A 5LOVA 3SJAC 3CRAA 5KMGA 4WFHA 1VP7A 5IT9N 1NH2B 2XASA 4MVZA 2VS0A 4FLXA 5CA0A 3AG2C 4PJ0Z 2UXBB 4GZRB 1BHBA 1AILA 3K5NA 4NYKA 4CH4A 4JI2B 4QGPA 1F23A 4U7OA 2V7QG 4O2BB 2ITDC 2XNDG 5LHGA 2RJZA 2LO1A 1K3EA 4FPPA 4HBNA 5JJNB 3OM3B 3DSQA 1XUQA 3DXRA 2W6JG 2NN4A 2UUBB 2ZINA 4DV5B 4DUYB 2R9IA 1Q7YW 4LFAO 4NVPA 1QBZA 4BR6A 2F1MA 5LMUB 4DR1B 4F6RB 4P9OA 1YF2A 3CCMV 2O57A 4WBNA 1FAFA 2F23A 3HKDA 5LYJB 2QEXV 3RYFB 3ZEDA 1YI2V 4JI3O 1J5EB 1L8DA 5EC1C 1X59A 2DE0X 2HHHB 2FKXA 1VF6A 1PP9H 3JALB 4X1KB 2Q69A 3L71H 2OT5A 3BPZA 4J41A 2DQ3A 1RM1B 3FYEB 1SC5B 2H3OA 3K03A 3L72H 1HNZB 3CCVV 4JAAA 1R6NA 5BMVB 4GYCB 5LHIA 2WLLB 1RPRA 4K3AA 1YCIA 4LF5O 3ZBHA 3JSLA 4O4IA 3CX5F 4KP4A 4JAUA 1QVGU 2ETNA 2XAGA 3T4DA 3X2QC 1KECA 5KHHA 5D5PA 3JD1A 2QDOA 2PZSA 3K9AA 4DV6O 3JATB 1VMGA 3ABKC 5EZYB 5IWAB 2OTLV 1N36O 1FXKA 4MTGA 1US6A 3BAAA 2QM4A 1GRJA 1H2LA 1WP7A 4PA4A 1HNWB 2ARHA 3ZMVA 3D36A 3JCZA 1OV9A 2LGWA 4I9QA 5EYPB 2VQEO 3A0BZ 4LF6B 4QIWF 2KG7A 5FNVB 2ZKOA 4KUMA 2AHYA 3CPWU 1BCCH 2B9ZA 4FFKA 3CMAV 2BE3A 1SQXH 4HYOA 1R3JC 3O65A 4NXNO 3ZRWB 2DYRB 2OWOA 2ZIOA 4W4LA 3DTUB 4TSFG 1FXKC 3B2EE 1N34B 3E2EA 1FJGO 2EIJC 5EIBD 4DW1A 1XI1A 1I08A 5GTHZ 2P4VA 2ATKC 3AG7A 3FB5C 1M9NA 1JA8A 3OGCC 2XAQA 5EC2C 2HVJC 3B8NA 2DOSA 1Q81W 2EZPA 2YXYA 1PD3A 2ZM6O 2UUAB 1K34A 1NH2D 1WN7A 4ZI7A 4X62B 2QWRB 1YTFB 3STLC 2W6IG 3RVZA 3M8AA 3JD0A 1K5QA 5H5NA 4JAVA 2JJ1G 5L3EA 4GKKB 3RYIA 4RAIA 2UXDB 2HR3A 3M7MX 3QO7A 3CXCU 4YJ3B 2E74B 3WFVA 1R73A 4I5SA 2UXCO 1G4YB 3HKEB 4B3SB 1YEWA 4ASUG 2LW7A 2EBOA 2K9PA 1FYJA 5KHGA 1WA8B 4DR2B 2LJ2A 3BVOA 5LGNA 3W7XA 4GKJB 2YUAA 4PDLA 1K92A 3EFFK 1IDSA 1UJWB 2ZE5A 1QHTA 4AQYB 4BW9A 1U96A 2ILMA 4DW0A 5B1BC 4BAYA 2Q73A 5GW7A 3HPLC 2IJIA 4JGSA 2LW1A 4O4HB 3SYQA 4JI5O 2EULA 1AROP 3K0GA 4YY3O 1VQKV 1EN4A 3U10A 4XDLA 1BE3H 4DV1O 4B3TB 2GV9A 4J7ZA 3SPHA 2XAHA 4LFBB 3HKCA 3BABA 4DR6B 1X4TA 4UV9A 1CXZB 1OCOC 4Q20A 1W0JG 2HG5C 5IY5C 2QWNB 1PPJH 4N21A 4MW8A 3E83A 3BRCA 4J9ZB 1S5HC 3F5WC 1XDCA 4DRXA 3D8CA 3KCXA 1WAZA 3TXSA 1YVWA 3JD4A 1Y67A 3RGBA 3FB7C 3W7UA 2WLLA 1FXHA 1BSMA 2LFSA 4DV2O 4MVRA 1DTOA 1Y66A 4DXWA 4YJ2B 3SYAA 2WAMA 5KLVH 3HKBB 2A7WA 2H94A 2RCVA 3RT3C 4B3MB 4UUJC 3W7SA 1HNXO 1JPXA 2QKAA 2WA3A 3UQ8A 2GUZB 3W7TA 5LP6B 4JYAB 1QCEA 3K04A 3MDSA 3KCYA 5FLXN 3JAWA 3SYOA 4J7KA 5CN0A 1JR9A 3JATA 4FVMA 4TT3G 4GX2A 1WNSA 5EZYA 3OT7A 2JS3A 3AG2B 4DR7O 4JV5O 1B06A 4JI6O 1CPYA 4NTXA 4PA7A 4QE9A 5JVDB 2CE4A 3GVMA 5EYPA 5F2VO 4QPKA 1XL4A 1OCCC 4EB6A 4YHHO 1PNLA 4LFCB 2Q8VA 5FNVA 3SPGA 3G80A 3ETGA 4I7ZB 3OTFA 4FFBA 4ABMA 2E5LO 3AK3A 2E76B 2Z3YA 4H37A 5JJJB 2OCCB 3OFNG 3SDLA 4B7EA 1EM1A 3ZRWA 2BSKA 3DC6A 2RMKB 4RWUA 3K5LA 3IC9A 2DYSB 1KMIZ 4FMTA 3K3WA 3L70H 1HW7A 1M90W 5BR8O 1K9MW 1XREA 4LFAB 2EILC 1KP2A 1TUBB 1MNGA 2NLJC 1YTFD 2QR4A 1RSOB 2YDEA 1N0NA 2R9AA 2L35A 2B1GA 1PKXA 2QWQB 2WLIA 2CTPA 2Y4UA 4MVMA 4HAMA 4H44B 5J2UB 3ZMZA 1ZX3A 3LUTB 4R8CA 2M6YA 1VQ6V 4J42A 1IZ3A 2EINB 4I55A 2OYQA 1AB3A 2XAJA 4YJ3A 5DM6V 3HKEA 2ZDIA 5KHIA 3ZJZA 1N33O 3CWBH 5EBMC 1WA8A 3ABKB 1MSWD 3JASB 4H13B 3C3SA 4BIUA 2XAFA 3RYCB 2CH7B 3SJQC 5CBFA 2JVDA 4DV4O 1B3QA 1NTKH 2Y69B 3ZHSA 3GB7C 2WLMA 3E22B 2WWWA 3AG4C 1W0KG 1LNQA 3AEIA 2P5OA 4PI2A 2EIKB 4FJCC 2D2CB 1N36B 2CGNA 1SS3A 3LSSA 2B5UA 2Q4PA 2ZDIC 1J95A 4CS3A 2Z5UA 4P2ZA 1JFFB 2QA4V 5B1AB 1DF5A 1GN3A 2VQEB 4B08A 4CS4A 3CC4V 5JWPA 5ITZB 4FLTA 1OCRC 2DJVA 4JI1B 2BTOA 5E1AC 3IFXA 4TV8B 2EX3A 2YS8A 2X6BA 4UVCA 3L75H 3ETEA 1ROPA 1S72V 1G1XB 4U3JB 2QKCA 3IGAC 1XNRB 3AG3B 3WB0A 2PF4E 2P06A 2CTRA 3WU2Z 3OTOB 3ASNC 5CA1B 5IYZB 3HKBA 3CCRV 1AP5A 2YIDA 3ZMTA 3H1HH 4I50B 4I0XA 1NI8A 4UVAA 5BY1A 1FD9A 1NKDA 3Q4HA 3JYCA 4O2AA 4XDKA 4LCUC 4X1YB 3MD0A 2X0LA 4X66O 1WP8A 2BTQA 3CJHB 4XDJA 1TVKB 2RNBA 4OXSA 1LUWA 1QR8A 4YIOA 3CD6V 1JOYA 5KX5B 2QTOA 4I9WA 2Y0PA 4NR1A 1WJZA 4GCZA 4G28B 1NS1A 5TISZ 5JVDA 4CC5A 2EJ7A 4AILC 1KUQA 4JI0B 1AI6A 1M56C 5IYCO 1WB7A 4TV9A 3STZC 3OW2U 4LWSA 4ZOLB 1HP8A 5LMNO 1V54C 1K4CC 5LHHA 3ASOB 4O4JB 4KFMA 4Z1VA 1NTMH 3FFQA 4ICGA 1B6QA 3KKYA 3A8TA 4EKWA 2XUMA 2QJ1A 1AVMA 4C7UA 3CCJV 2OTJV 2N05A 1OCOB 2EZOA 2QGNA 3OR6C 1ZAUA 4TQDA 4DR4O 1V55C 2ZE6A 4LBEC 2DN9A 1F4NA 3QNEA 1SZXA 4DV1B 1RSOA 2CAZC 1SZTA 5DEDA 3WG7B 4P30A 4JF3A 3VQWA 5HFLA 5B3SC 2ZXWC 1NR1A 5IJ9B 3SR2C 3K58A 2A06H 5C93A 1MOFA 3G4SV 3VQVA 5CBGA 1XOUA 4HNAB 1ZTEA 2KKWA 2ZD9A 4MT8A 3E8HA 2DMXA 1KKCA 3ABMC 1JCHA 4DV2B 3CCQV 2IM9A 1Q82W 1I94B 3BFRA 4WFEA 4LF9B 3JASA 2F4VO 1JX9A 4IIJB 3ZHQA 3RYCA 2CH7A 2IU3A 2P6JA 4E4EA 1HNXB 1VF6C 2WLHA 1Y4MA 4B3RB 3QVNA 2CTQA 1A32A 3OUSA 2A0LA 1KYOF 4LF7B 2GHYA 1ZWIC 4DR7B 2Q6AA 4JV5B 5BZBA 4EFBA 1M57B 2WSSG 3H01A 4JI6B 3UT5A 2GBOA 3RYHA 3AG1B 4FZ1A 4H33A 2QWOB 3A0RA 4PA3A 4JYCA 4DV7O 4YHHB 1OCZB 1LUVA 1EN6A 4U7NA 3ABLB 2LGQA 4KHPO 5IJ0B 4TV8A 4KL1A 1XNQO 1MZFA 1AJPA 4FM2A 2HFEC 1GN2A 1JMKC 3B40A 1VEWA 3ETDA 4X64O 4D7TA 2AHZA 3N2KA 2Q0OC 2Q5ZA 1G6UA 2N74A 3JAKB 3T1HO 4U3JA 1NR7A 4CC6A 3CE2A 3D36C 5BR8B 3B4SA 1EBOA 3DGEA 4YXWG 5CA1A 3T4ZA 5IYZA 3LNMB 3VQXA 3A0HZ 4I4TB 3E35A 4K8ZA 3H1IH 4F6EA 5GONB 3SJBC 4FLVA 5JCOA 3OD4A 2P4KA 4TWKA 1K97A 1IBKO 3FYIB 4OPHA 3CC7V 4X1IA 1IURA 4UCRA 2IU0A 4P9PA 3CCEV 4J10A 3CJHA 1Z5VA 5JQGB 4DR3O 5K1PA 1TVKA 3THOA 1W2BU 1VQPV 3JAMN 2D3OW 3JARB 3CP1A 3LNNA 3IJ4A 1FFXA 2JK5C 5LGUA 1UPGA 4HZ3A 1FPOA 3H1KH 1YHQV 5H2FZ 3SYCA 2Y48A 1U97A 1IBLO 4MS2A 3OR7C 1XL6A 4MTFA 3T2MA 1WPBA 1XMOB 1GTOA 4WFFA 2IJHA 2H8PC 2RQ6A 4MVSA 1RFYA 4ZOLA 5EIBC 4NTYA 3I5DA 4JPRA 3E8FA 2CTWA 4O2BA 1GKFA 1NU1H 4FM0A 3QTCA 5H9CA 4LNUB 4NB5A 3OEHG 4DV4B 1VARA 1BMFG 2VWKA 1VQ7V 2HLDG 5LA6B 1XMQO 3G6EV 1Q5OA 3D3QA 3EVKA 4JI2O 3UO2A 3CHXA 2V4DA 1OCRB 2NR5A 1S0VA 4F6RA 3ICXA 3CRRA 1VIBA 1L0LH 1VQLV 3EXAA 4L8JA 1XHZA 5LYJA 1YZBA 1TAEA 2UUBO 4DV5O 4X9QA 3T1CA 1Q3EA 3RYFA 3K08A 3ZHVA 5KAFZ 1HWYA 1SQVH 4TUYB 5L3CA 4DR1O 1R3LC 1H2GA 1M5IA 4JI4O 3JALA 4X1KA 5IJ9A 2YXHA 3N2GB 1OJHA 4MTOA 4FLZA 3ASNB 4J9YB 1J5EO 1BT8A 4O4LB 3FB8C 5BMVA 2PYJA 1SQGA 2CDYA 2Y0IA 1TA8A 3H1JH 4K35A 3CEIA 4JZ2A 1I7FA 4PELA 1ZL8B 3BEHA 3I55V 4LF8O 3MHSC 2ZT9B 1PNMA 1R6KA 2HP8A 5DECA 2X6CA 1XQ8A 2YSUB 1LR1A 2YEVB 5IYDO 4UFZA 1RM1C 1M56B 2ZQMA 2DQ0A 1O9HA 3ZRXA 3K59A 1AJQA 5L3BA 2FL4A 3BY6A 3KZIZ 1QVFU 3OAAG 4DR5O 2PI4A 1MZEA 2PY5A 4A5UB 3ZHRA 1F4MA 4FLWA 1E1QG 1IVSA 1ZLZA 5H6RA 1TGOA 1EFRG 1VQ5V 3WB1A 2A9HA 4ZHQB 1NBMG 4EFEA 3S3XA 3GWOA 4LF4O 1Z2GA 5KMGB 2X7RB 5LMNB 1NVPB 2JDIG 4K0KO 1YJ9V 4Z1MG 5KHJA 5CA0B 2HEPA 4FLYA 3JAKA 4WFAV 1IBMO 1K33A 1N32O 5L3DA 4DR4B 1NT2B 2VWJA 5CMUA 1BHAA 5IDJA 1N34O 1KBHA 1K73W 1YJNV 4H0LB 3R66A 2LP7A 4ZBMA 2LQTA 1KKDA 2AZ2A 4JI3B 1HDJA 3AK2A 2F93B 1JJ2U 2QM7A 1H2SB 4WFGA 3CXHF 2DYRC 4L87A 4JI7O 3TJTA 1S76D 1WB8A 4QPJA 3JARA 3C3TA 2P7TC 1K8AW 3X2QB 3KG2A 1SERA 4X62O 1GM8A 2B1IA 2AXTZ 4DUZO 4LF5B 1KB9F 2Q67A 1ZSPA 3TXQA 4W4KA 2OIEA 1N0JA 2Q7GA 5CBHA 1QLNA 2BCCH 2F4VB 2W0FC 4DK1A 1JVMA 1MABG 4LNUA 4FLUA 3VBBA 5HFMA 5FL7G 1QNMA 1O9GA 4UCUA 2HVKC 4O4IB 3CMEV 2IBZH 4DV6B 3JSNA 5LA6A 4EEQA 4JYBA 4GKJO 3ABUA 4O4HA 1YDXA 2A3QA 2LFRA 5JH7B 2UUCO 3APQA 3M99B 2KQXA 2VQFO 1SETA 3SGIA 1CP9A 3QF7A 1URFA 1KC8W 1BGYH 2XHBA 2PGGA 1EN5A 3P3NA 4MVQA 2QKSA 4NKGB 4LH7A 2JIZG 1FXKB 4LC1A 3APOA 1BQZA 3K9SA 4TUYA 2EIJB 3ABTA 4DV7B 1AR4A 2WLKA 1SQFA 4PDVA 2HJFC 3N2GA 1XNQB 4NXNB 1K5SA 5C8YB 3ZMUA 2QWPB 4Q6GA 4X64B 2IH1C 1FJGB 3K5OA 3CB2A 2BOCC 2WA4A 1R3KC 3CC2V 3T1HB 4YJ2A 1WLEA 4UVBA 1AI7A 3ZMSA 1ZL8A 1M4UA 3BCCH 4RO2A 2X6AA 3CCLV 2F95B 2YC0A 1V9PA 1H8HG 3LDEA 2GUZA 3JD2A 4DV0O 5LP6A 4UCTA 2MK3A 2PTMA 3FB6C 2Z0AA 2ZM6B 3QO8A 2YEVA 1IBKB 1Q6HA 4CZZA 4B3MO 3OE7G 3UO3A 1L0NH 1R3IC 4JI8O 2Q0AA 2YI9A 4JYAO 4NXMO 3VQYA 1NVPD 2AZ0A 3FD9A 4CS2A 4ZI7B 2UXCB 2GTSA 5B1BB 1Y6XA 2PUSA 4PDMA 1I5XA 3HB3B 4GLXA 4ZHQA 4MTXA 1SKVA 2CK3G 1QLEC 3RFRA 3F7VC 1N4CA 2R72A 3K06A 1S77D 3P3PA 4X65O 1R1BA 1GO3F 4UCOA 1N8RW 3PN1A 4LFCO 2JRIA 2Q9LA 2YICA 1NTZH 1AI5A 2EIMC 2W0XA 2GSMB 4IHJB 1XMQB 2GDSA 4BWAA 4B7KA 4JI5B 2E3CA 1TUBA 1WPXA 2CUGA 4YY3B 5IY5B 1GK9A 3CRCA 4UCVA 1R6TA 4RQFA 2WPDG 1GM9A 1PM9A 4GUNA 3LSUA 3ZS8C 1MG1A 1YIJV 2JEXA 4OGQB 4MSWC 4D6TH 2OCCC 1S3JA 2Y4TA 5J2UA 4WCEV 3OGIB 3SPJA 4JI4B 1YITV 3HKCB 3ZIAG 2DYSC 2JS5A 3C90A 2XTAA 2QM8A 2DW4A 4XBFA 2IW5A 2BOBC 1PL4A 3R65A 3JCUZ 1JJOA 5LL6Y 4PDRA 3K57A 1SA0B 4PHZA 1KP3A 1KD1W 4DRXB 4AHCA 4U3FH 4NTWA 1BQ0A 1E1RG 5LXTB 4BIZA 3K0DA 4LF8B 2UU9O 3T1YO 3ZCCA 4DV3O 2JGUA 2ZNIA 3QG5A 3VOUA 2AGAA 3J7AU 2Q7HA 1BZKA 2NNUA 3E22A 1OCCB 4OX9O 2EINC 3FAVB 3TK1A 5J9PC 5J2TB 5JH7A 4E2LA 3ZRSA 2L6LA 2FB5A 3OMNB 2XT9A 4LR3A 4DR5B 3QO5A 4UXNA 1JQ0A 3JAWB 1JFFA 3P32A 1YXBA 3CS5A 1MSDA 2VRZA 3F5TA 2R70A 5EK0A 2YIBD 1QR9A 5ITZA 4DO2A 1HR0O 5A9GA 1S5LZ 2E5LB 4K8XA 2EILB 5KA5A 2Y69C 4LF4B 4J80A 1PNKA 4K0KB 3G6BA 5CA3A 1XILA 1Y74B 2ODMA 2XOKG 4EB6B 5C8YA 2YIBA 5FPOA 2EIKC 1OZ0A 2ZIMA 4TQFA 4JI1O 1F7YA 4FFBB 2P90A 3DC5A 4IGGA 4IT5A 2AW9A
chains in the Genus database with same CATH topology
1F23A 4U7OA 2V7QG 4BIUA 2XAFA 3E8GA 2ITDC 4PELA 5B1AC 1DLBA 3BEHA 2XNDG 5LHGA 3SJQC 5CBFA 3I55V 4LP8A 3MHSC 1PNMA 1K3EA 1R6KA 4MVUA 4FPPA 1Q86W 2Y69B 2WLJA 2X6CA 3OM3B 2YSUB 3GB7C 2W6JG 2K1EA 2WLMA 2YEVB 5IYDO 1KQSU 2WWWA 1ORQC 3AG4C 1RM1C 2R9IA 1W0KG 1Q7YW 1LNQA 3AEIA 1QBZA 3EHBB 2EIKB 4X8AA 4FJCC 2C2AA 1M56B 2ZQMA 4P9OA 2DQ0A 3ZRXA 3CCMV 1AJQA 3LSSA 3D3IA 5L3BA 2B5UA 3BY6A 3UM7A 1QVFU 2ZDIC 1J95A 2Z5UA 3OAAG 4P2ZA 2QA4V 2QEXV 2PI4A 2WLIB 5LGTA 5B1AB 1YI2V 1DF5A 1F4MA 3AG3C 1E1QG 5EC1C 5H6RA 3CC4V 3OEEG 1EFRG 3W7WA 1VQ5V 1OCRC 2ITCC 2A9HA 2Q69A 5E1AC 2OT5A 3IFXA 3AG4B 2DQ3A 1RM1B 1NBMG 3FYEB 2QE7G 3GWOA 3K03A 2X7RB 1NVPB 4RQEA 2FTKA 2JDIG 3CCVV 2X6BA 1G8MA 1YJ9V 4UVCA 1F51A 4Z1MG 2ZR2A 1R6NA 3ETEA 1ROPA 1S72V 5LHIA 2WLLB 1RPRA 1IXMA 1SRYA 5H6QA 3IGAC 3AG3B 4WFAV 1K33A 3ZN1A 1E79G 3LSQA 4KP4A 5L3DA 3ASNC 4QE7A 5KA6A 3CCRV 4JAUA 1VQ8V 1QVGU 2XAGA 5CMUA 1BHAA 3T4DA 5IDJA 3CCSV 3X2QC 1KECA 2UXXA 3ZMTA 3JD1A 2R9RB 4UVAA 1K73W 1NKDA 1YJNV 3K9AA 3JYCA 2LP7A 4ZBMA 4XDKA 1H8EG 5B1NA 4LCUC 1KKDA 2Q68A 3MD0A 3MHHC 4WF9V 3ABKC 2X0LA 2OTLV 1JJ2U 2QM7A 1PL0A 1FXKA 4WFGA 4MTGA 4QNHB 1THZA 4XDJA 3ASOC 2DYRC 3LDDA 4JTDB 4OXSA 4PA4A 4R50A 3ZN0A 4L87A 3ZMVA 1S76D 1QR8A 3D36A 4QPJA 3CD6V 1JOYA 2QTOA 4I9WA 3JCZA 2P7TC 4R7CA 4GCZA 4G28B 5LBQA 1K8AW 3X2QB 4QIWF 3KG2A 1I5YA 1SERA 4KUMA 1AI6A 1M56C 1GM8A 2AHYA 2B1IA 3OMIB 3CPWU 5IYCO 3CMAV 3STZC 4PA9A 3OW2U 2Q67A 3TETA 4HYOA 1R3JC 1V54C 1K4CC 3WG7C 5CBHA 3ZRWB 5LHHA 2DYRB 3ASOB 1QLNA 4KFMA 4MW3A 1RPOA 3DTUB 2W0FC 1JVMA 1MABG 4TSFG 3E89A 1FXKC 2V1DA 3SPCA 1B6QA 3E2EA 3VBBA 5HFMA 5FL7G 4EKWA 4QJFB 2EIJC 2HVKC 3CMEV 1H38A 4JYBA 3CCJV 2OTJV 2ATKC 4R6ZA 1OCOB 2EZOA 3ABUA 3OR6C 3FB5C 2LFRA 1V55C 1M9NA 4LBEC 3M99B 3OMAB 3OGCC 2XAQA 5EC2C 2HVJC 1F4NA 1SETA 1CP9A 3B8NA 3QNEA 1KC8W 1Q81W 2EZPA 1QLEB 1M1KW 1V54B 1COWG 1SZTA 3WG7B 4G27B 4P30A 1PD3A 3FKSG 4GT1A 4MVQA 1K34A 2QKSA 4JF3A 4RUFA 1NH2D 2JIZG 1FXKB 4LC1A 5HFLA 5B3SC 5L3FA 1NQTA 2EIJB 3ABTA 1YTFB 3STLC 2EIMB 2W6IG 2ZXWC 3RVZA 1NR1A 3JD0A 1K5QA 4JAVA 4ZKIA 2JJ1G 5L3EA 2WLKA 5C93A 1YJWV 1MOFA 3G4SV 4PDVA 1YSCA 2HJFC 1VQOV 5CBGA 4RAIA 5KUMA 1V55B 2HR3A 3QO7A 2ZD9A 3CXCU 4G2KA 4MT8A 3WFVA 1ENVA 1K5SA 1R73A 4I5SA 3ZMUA 1G4YB 4ASUG 2EBOA 2IH1C 4GX1A 2BOCC 3E8HA 1R3KC 5IYBO 5L3GA 2DWDC 3CC2V 1P4RA 3ABMC 1JCHA 3CCQV 1M57C 5B3SB 3RVYA 5KUKA 1WLEA 5LGNA 1Q82W 3W7XA 4WFEA 3AG1C 1GMGA 2ZXWB 1K92A 3EFFK 4FIPC 4PDLA 4UVBA 4X89A 1JX9A 3IC7A 1AI7A 3ZMSA 1UJWB 4RO2A 3CCLV 2X6AA 2IU3A 2P6JA 1H8HG 3LDEA 5B1BC 3I56V 2WLHA 3JD2A 1OCZC 4BAYA 5GW7A 2MK3A 1Y4MA 3FB6C 3HPLC 3ABLC 2IJIA 3UKMA 3QO8A 2YEVA 4JGSA 3OUSA 3SYQA 2A0LA 4CZZA 2KB1A 1AROP 3K0GA 4PA6A 4JASA 1VQKV 1AR1B 3F7YC 2GHYA 3OE7G 1ZWIC 3ABMB 4XDLA 1CEZA 1R3IC 2JJ2G 2A79B 2Q6AA 4JTAB 3ZRVA 3JD3A 5BZBA 4UV8A 1M57B 2WSSG 3H01A 3SPHA 2XAHA 3AG1B 1NVPD 5DN6G 2IJJA 4H33A 3B8MA 4UV9A 3A0RA 4PA3A 2IJKA 3E8BA 1OCOC 4JYCA 4Q20A 1W0JG 4GX0A 5B1BB 3CYOA 2HKOA 1OCZB 1OHHG 4U7NA 4PDMA 2HG5C 3ABLB 1I5XA 5IY5C 3HB3B 4MTXA 4N21A 1K7DA 2CK3G 4MW8A 3LDCA 3E83A 1DF4A 3RBZA 4J9ZB 1QLEC 1S5HC 3F5WC 4F4LA 3F7VC 1BL8A 1GM7A 1AJPA 2P67A 2HFEC 3K06A 1S77D 3ETDA 1GO3F 3JD4A 1N8RW 2AHZA 3E86A 3FB7C 3W7UA 2WLLA 1FXHA 1AI5A 2EIMC 2LFSA 3K79A 4BW5A 1NR7A 2GSMB 4MVRA 1DTOA 1Y66A 4DXWA 3P30A 3SYAA 2F43G 2WAMA 1EBOA 3DGEA 2H94A 4YXWG 3SPIA 1WPXA 5IY5B 3T4ZA 1FXVA 3LNMB 1GK9A 4UUJC 3W7SA 3E35A 1JPXA 4RQFA 3W7TA 2WPDG 3CCUV 1GM9A 3G71V 1QCEA 3K04A 4TWKA 1FFTB 3SYOA 1K97A 5CN0A 3FYIB 1MG1A 1YIJV 1VQ4V 2JEXA 2UXNA 3CC7V 4TT3G 4GX2A 4MSWC 4GX5A 2IU0A 2OCCC 1S3JA 4P9PA 3CCEV 3AG2B 4WCEV 3SPJA 1W2BU 1VQPV 1YITV 2D3OW 3CP1A 1CPYA 2JEUA 2DYSC 3ZIAG 2JK5C 4PA7A 4QE9A 5EBLC 5LGUA 4HZ3A 1YHQV 2QM8A 2DW4A 4XBFA 2DWEC 4QPKA 1XL4A 2IW5A 3SYCA 1VQMV 3NXSA 1OCCC 2Y48A 1PNLA 2BOBC 4MS2A 3OR7C 1AI4A 3PJSK 3SPGA 4CBCA 3R65A 1XL6A 4MTFA 3ETGA 4RUEA 3T2MA 2WLNA 2M7WA 1GTOA 4WFFA 1VQNV 4PDRA 2Z3YA 2IJHA 2ZR3A 3TCUA 5EBWC 2H8PC 4H37A 1AJNA 1NJIW 3ML0A 1KP3A 4MVSA 2OCCB 1KD1W 4JPRA 3E8FA 3OFNG 1GKFA 1E1RG 3ZRWA 3SYPA 4BIZA 3K0DA 5H9CA 3OEHG 1BMFG 3ZCCA 2DYSB 4WFBV 3OUFA 4FMTA 2IH3C 3VOUA 1VQ7V 3K3WA 2PI5A 2HLDG 1FS0G 1M90W 1EZJA 3G6EV 2NNUA 1OCCB 1K4DC 1K9MW 2EILC 1KP2A 2EINC 4JTCB 3TK1A 1OCRB 5J9PC 2NLJC 1YTFD 1P7BA 1S0VA 4E2LA 5B1OA 3RW0A 3ZRSA 4N23A 3OMNB 1VQLV 3B77A 2EJRA 3QO5A 4UXNA 1JQ0A 1TUEB 3P32A 2B1GA 1PKXA 2WLIA 4MVMA 3T1CA 5EK0A 3K08A 4HAMA 1HWYA 5L3CA 1VQ9V 4MVOA 1QR9A 4X88A 1R3LC 4DO2A 1H2GA 3ZMZA 3LUTB 4R8CA 1L1FA 4FK5C 1VQ6V 4MTOA 1SESA 2EILB 2EINB 5KA5A 2Y69C 3ASNB 4J9YB 4WFHA 1PNKA 2XAJA 1NH2B 5CA3A 5DM6V 2XOKG 2XASA 3FB8C 2ZDIA 2EIKC 1OZ0A 4MVZA 3ZJZA 3AG2C 2P90A 1BHBA 5EBMC 3ABKB 1MSWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVY A;  5KUK A;  3SPJ A;  4OXS A;  4PA4 A;  4R50 A;  4WFE A;  3AG1 C;  4PDL A;  3E8G A;  2ITD C;  3EFF K;  4X89 A;  5B1A C;  3BEH A;  2DYS C;  3SJQ C;  5CBF A;  2QTO A;  4I9W A;  4LP8 A;  4RO2 A;  2JK5 C;  2P7T C;  2X6A A;  4PA7 A;  4QE9 A;  4R7C A;  4MVU A;  5EBL C;  4HZ3 A;  4G28 B;  5B1B C;  3LDE A;  2WLJ A;  2X6C A;  2WLH A;  2DWE C;  1OCZ C;  1XL4 A;  3GB7 C;  3SYC A;  3UKM A;  3HPL C;  1OCC C;  2K1E A;  2WLM A;  3ABL C;  3FB6 C;  3KG2 A;  2BOB C;  4MS2 A;  1ORQ C;  2YEV A;  3AG4 C;  3OR7 C;  3PJS K;  1M56 C;  3OUS A;  3R65 A;  1XL6 A;  2AHY A;  3SPG A;  4MTF A;  1LNQ A;  3SYQ A;  4RUE A;  4CBC A;  2A0L A;  3T2M A;  2KB1 A;  2WLN A;  4X8A A;  3STZ C;  4PA9 A;  3K0G A;  4WFF A;  4P9O A;  4PDR A;  4PA6 A;  3TCU A;  2Q67 A;  5EBW C;  2H8P C;  4H37 A;  3F7Y C;  3TET A;  1ZWI C;  4MVS A;  4HYO A;  4XDL A;  1R3J C;  1R3I C;  1K4C C;  1V54 C;  2A79 B;  2Q6A A;  4JTA B;  3UM7 A;  3E8F A;  3WG7 C;  5BZB A;  1J95 A;  5CBH A;  4KFM A;  4MW3 A;  4P2Z A;  3SPH A;  3SYP A;  3K0D A;  2WLI B;  2W0F C;  1JVM A;  3E89 A;  3SPC A;  4EKW A;  3AG3 C;  3OUF A;  2EIJ C;  2HVK C;  4H33 A;  5EC1 C;  2IH3 C;  3VOU A;  4PA3 A;  3E8B A;  1OCO C;  4GX0 A;  1OCR C;  2ITC C;  2A9H A;  2ATK C;  4PDM A;  2HG5 C;  4R6Z A;  1K4D C;  5IY5 C;  2Q69 A;  2EIL C;  2EIN C;  3OR6 C;  3FB5 C;  3IFX A;  4JTC B;  5E1A C;  1V55 C;  3ASO C;  2NLJ C;  5J9P C;  4MW8 A;  1P7B A;  3LDC A;  4LBE C;  3E83 A;  3RBZ A;  3K03 A;  3OGC C;  4J9Z B;  1QLE C;  1S5H C;  3RW0 A;  3F5W C;  5EC2 C;  3ZRS A;  2HVJ C;  1BL8 A;  3F7V C;  4F4L A;  2X6B A;  2HFE C;  3K06 A;  4G27 B;  4P30 A;  2WLI A;  4MVM A;  2AHZ A;  2WLL B;  4MVQ A;  3T1C A;  3E86 A;  3FB7 C;  2QKS A;  4RUF A;  2WLL A;  5EK0 A;  3K08 A;  3IGA C;  2EIM C;  4MVO A;  4BW5 A;  4X88 A;  5B3S C;  1R3L C;  4MVR A;  4DXW A;  3STL C;  3RVZ A;  3SYA A;  2ZXW C;  3LUT B;  4R8C A;  3ASN C;  2WLK A;  4QE7 A;  3SPI A;  4PDV A;  2HJF C;  3T4Z A;  4MTO A;  5CBG A;  3LNM B;  4RAI A;  4UUJ C;  2Y69 C;  5KUM A;  3T4D A;  3X2Q C;  4J9Y B;  4WFH A;  2R9R B;  2ZD9 A;  1G4Y B;  3K04 A;  3JYC A;  4TWK A;  4ZBM A;  4XDK A;  3SYO A;  3FB8 C;  2EIK C;  2IH1 C;  4GX1 A;  4LCU C;  4MVZ A;  1KKD A;  2Q68 A;  2BOC C;  3E8H A;  1R3K C;  3ZJZ A;  2DWD C;  3ABK C;  3AG2 C;  4GX2 A;  4MSW C;  4GX5 A;  3ABM C;  4MTG A;  4WFG A;  4QNH B;  2OCC C;  4P9P A;  4XDJ A;  5EBM C;  1M57 C;  2DYR C;  4JTD B;  3LDD A; 
#chains in the Genus database with same CATH topology
 3CRQ A;  1IBM B;  1N32 B;  1XHX A;  2BSK B;  3E8G A;  5B1A C;  1DLB A;  4CH6 A;  4LP8 A;  3ETQ A;  4MVU A;  1SQQ H;  1Q86 W;  2WLJ A;  4I50 A;  1XNR O;  1GH6 A;  3BHP A;  2K1E A;  1KQS U;  1ORQ C;  2RDC A;  1B04 A;  4X1Y A;  3EHB B;  3OTO O;  4X8A A;  2Q7E A;  4UCS A;  2C2A A;  3D3I A;  2E75 B;  3H9V A;  3UM7 A;  1Q6I A;  4JI7 B;  2WLI B;  2ZE8 A;  5LGT A;  1ZUQ A;  5KX5 A;  4PI0 A;  5GTI Z;  5AG2 A;  3AG3 C;  1P49 A;  5A2Q N;  3OEE G;  3W7W A;  2KSD A;  2ITC C;  4D7S A;  2FML A;  4DUZ B;  3AG4 B;  1N33 B;  3O9O A;  1XBL A;  2QE7 G;  4I55 B;  3ZHT A;  3A2F A;  1D5A A;  5JCO C;  4RQE A;  2FTK A;  1G8M A;  1F51 A;  4AI8 A;  2ZR2 A;  4O4J A;  4Z2W A;  4JI0 O;  1AP6 A;  1IXM A;  1SRY A;  5H6Q A;  2UXB O;  3L9D A;  4IHJ A;  4UB8 Z;  3B09 A;  3ZN1 A;  1E79 G;  3LSQ A;  1S5J A;  4QE7 A;  3U11 A;  5KA6 A;  1VQ8 V;  2UUC B;  1VF7 A;  3CCS V;  2UXX A;  2VQF B;  3WB2 A;  2R9R B;  2JGD B;  1H8E G;  5B1N A;  4DUY O;  2Q68 A;  5B5E Z;  3MHH C;  5LMU O;  4WF9 V;  1P7G A;  1PL0 A;  1H2M A;  1P84 F;  4QNH B;  1THZ A;  1Y76 B;  1Q43 A;  3ASO C;  4JTD B;  3LDD A;  1D5N A;  4R50 A;  3ZN0 A;  3J81 N;  3GWK C;  4R7C A;  2HJD A;  5LBQ A;  4HNA A;  1DGS A;  3G67 A;  1I5Y A;  2HHH O;  3L73 H;  3OMI B;  5CB4 B;  4IYH A;  4PA9 A;  4X20 B;  3TET A;  1SA0 A;  1HNZ O;  3WG7 C;  4MW3 A;  1RPO A;  4IIJ A;  5LXT A;  3RN4 A;  3E89 A;  2V1D A;  3SPC A;  1W59 A;  3FX7 A;  2OCH A;  1M93 A;  4QJF B;  2G38 A;  5BXZ A;  4DV0 B;  1Q8I A;  4DK0 A;  1H38 A;  2ZCE A;  4R6Z A;  1I94 O;  4X66 B;  4LF9 O;  3FAV A;  5J2T A;  3OMA B;  4I0X B;  2P22 C;  4JI8 B;  2QSA A;  3Q4H B;  1QLE B;  4O2A B;  1M1K W;  1V54 B;  1COW G;  4G27 B;  4NXM B;  4B3R O;  3CRM A;  3FKS G;  4GT1 A;  1MMM A;  4RUF A;  4LH6 A;  5IWA O;  3N27 A;  4LF7 O;  3K5M A;  2BTQ B;  4FZ0 A;  5L3F A;  2QTS A;  1Q90 D;  3ZHU A;  4BIO A;  1NQT A;  2EIM B;  1HNW O;  4ZKI A;  1YJW V;  1YSC A;  5LOV B;  1VQO V;  5IJ0 A;  5KUM A;  4TOI A;  1V55 B;  4J11 A;  4G2K A;  4LF6 O;  1ENV A;  4X65 B;  1Y74 A;  1KU9 A;  4GX1 A;  3L74 H;  5FPR A;  5IYB O;  4TV9 B;  5L3G A;  2DWD C;  1XEQ A;  1P4R A;  4LWS B;  1M57 C;  5B3S B;  3RVY A;  5KUK A;  3AG1 C;  1GMG A;  2ZXW B;  4FIP C;  4X89 A;  3IC7 A;  5E79 Z;  4I4T A;  3DXR B;  3I56 V;  1IX9 A;  1OCZ C;  3UKM A;  5GON A;  3ABL C;  1D2D A;  1GN6 A;  3H1L H;  2KB1 A;  3SJC C;  3RWR D;  1QU7 A;  4JAS A;  4PA6 A;  4DYL A;  1AR1 B;  2GTA A;  3F7Y C;  4WBN B;  3ABM B;  5K1X A;  5JQG A;  1DK1 A;  1CEZ A;  2JJ2 G;  4JTA B;  2A79 B;  3ZRV A;  1MA1 A;  3JD3 A;  3HKD B;  4UV8 A;  2MW2 B;  1FKA O;  2UUA O;  1SQB H;  5DN6 G;  2IJJ A;  1IXB A;  4OPA A;  3B8M A;  2IJK A;  3E8B A;  1SQP H;  2OIG A;  1H2N A;  2PYL A;  4GX0 A;  5B66 Z;  3CYO A;  2HKO A;  4ZIB A;  4YIP A;  1OHH G;  4GKK O;  1K7D A;  3LDC A;  2UXD O;  1DF4 A;  3IAY A;  3RBZ A;  5IE9 A;  4F4L A;  1BL8 A;  1GM7 A;  4UB6 Z;  3S3W A;  2P67 A;  1PV0 A;  1Z5W A;  4B3S O;  4IYI A;  3E86 A;  2UU9 B;  1GAX A;  3T1Y B;  4DV3 B;  4CH5 A;  4DR2 O;  1XMO O;  3K79 A;  4BW5 A;  3P30 A;  2F43 G;  3UCS C;  3BA8 A;  1BS3 A;  4OX9 B;  3SPI A;  1FXV A;  3CSX A;  2ZE7 A;  2N04 A;  4AQY O;  4IL6 Z;  3HR0 A;  1SF9 A;  4CH3 A;  3CCU V;  3G71 V;  2JGD A;  1FFT B;  4JYY A;  5D5Q A;  1VQ4 V;  2UXN A;  2ZNJ A;  5KHK A;  4GX5 A;  1GN4 A;  1Y76 A;  1HR0 B;  3AK1 A;  4B3T O;  5KAI Z;  3UT5 B;  1RP3 B;  4KHP B;  3RYH B;  2YIA A;  4LFB O;  2JEU A;  4DR6 O;  3TGU H;  5EBL C;  4PV1 B;  2RN9 A;  4J7J A;  2CGO A;  2KG7 B;  2DWE C;  1VQM V;  3NXS A;  2ADP A;  4O4L A;  3PJS K;  1AI4 A;  4CBC A;  4RUE A;  2WLN A;  2M7W A;  5CB4 A;  1I0H A;  1VQN V;  1QQC A;  2ZR3 A;  3TCU A;  4KXR A;  5EBW C;  3ZX6 A;  1AJN A;  1NJI W;  3ML0 A;  4X20 A;  3U0Z A;  2ADQ B;  3SYP A;  2YXL A;  3N2K B;  4WFB V;  3OUF A;  3NR7 A;  2IH3 C;  2PI5 A;  1FS0 G;  1EZJ A;  1EZV H;  2F66 C;  1K4D C;  4JTC B;  1T5E A;  1UFI A;  3BA9 A;  1P7B A;  3MAQ A;  2YI8 A;  4JZG A;  5B1O A;  4DR3 B;  3RW0 A;  4N23 A;  3J80 N;  3B77 A;  4PD4 F;  2EJR A;  4FM1 A;  1TUE B;  1AR5 A;  4X1I B;  1VQ9 V;  4MVO A;  4X88 A;  1Q6U A;  1IBL B;  1VF5 B;  5JJE B;  2FYU H;  1H2K A;  1L1F A;  4FK5 C;  3RYI B;  1FFX B;  1SES A;  5LP6 C;  1NZ6 A;  5LOV A;  3SJA C;  3CRA A;  5KMG A;  4WFH A;  1VP7 A;  5IT9 N;  1NH2 B;  2XAS A;  4MVZ A;  2VS0 A;  4FLX A;  5CA0 A;  3AG2 C;  4PJ0 Z;  2UXB B;  4GZR B;  1BHB A;  1AIL A;  3K5N A;  4NYK A;  4CH4 A;  4JI2 B;  4QGP A;  1F23 A;  4U7O A;  2V7Q G;  4O2B B;  2ITD C;  2XND G;  5LHG A;  2RJZ A;  2LO1 A;  1K3E A;  4FPP A;  4HBN A;  5JJN B;  3OM3 B;  3DSQ A;  1XUQ A;  3DXR A;  2W6J G;  2NN4 A;  2UUB B;  2ZIN A;  4DV5 B;  4DUY B;  2R9I A;  1Q7Y W;  4LFA O;  4NVP A;  1QBZ A;  4BR6 A;  2F1M A;  5LMU B;  4DR1 B;  4F6R B;  4P9O A;  1YF2 A;  3CCM V;  2O57 A;  4WBN A;  1FAF A;  2F23 A;  3HKD A;  5LYJ B;  2QEX V;  3RYF B;  3ZED A;  1YI2 V;  4JI3 O;  1J5E B;  1L8D A;  5EC1 C;  1X59 A;  2DE0 X;  2HHH B;  2FKX A;  1VF6 A;  1PP9 H;  3JAL B;  4X1K B;  2Q69 A;  3L71 H;  2OT5 A;  3BPZ A;  4J41 A;  2DQ3 A;  1RM1 B;  3FYE B;  1SC5 B;  2H3O A;  3K03 A;  3L72 H;  1HNZ B;  3CCV V;  4JAA A;  1R6N A;  5BMV B;  4GYC B;  5LHI A;  2WLL B;  1RPR A;  4K3A A;  1YCI A;  4LF5 O;  3ZBH A;  3JSL A;  4O4I A;  3CX5 F;  4KP4 A;  4JAU A;  1QVG U;  2ETN A;  2XAG A;  3T4D A;  3X2Q C;  1KEC A;  5KHH A;  5D5P A;  3JD1 A;  2QDO A;  2PZS A;  3K9A A;  4DV6 O;  3JAT B;  1VMG A;  3ABK C;  5EZY B;  5IWA B;  2OTL V;  1N36 O;  1FXK A;  4MTG A;  1US6 A;  3BAA A;  2QM4 A;  1GRJ A;  1H2L A;  1WP7 A;  4PA4 A;  1HNW B;  2ARH A;  3ZMV A;  3D36 A;  3JCZ A;  1OV9 A;  2LGW A;  4I9Q A;  5EYP B;  2VQE O;  3A0B Z;  4LF6 B;  4QIW F;  2KG7 A;  5FNV B;  2ZKO A;  4KUM A;  2AHY A;  3CPW U;  1BCC H;  2B9Z A;  4FFK A;  3CMA V;  2BE3 A;  1SQX H;  4HYO A;  1R3J C;  3O65 A;  4NXN O;  3ZRW B;  2DYR B;  2OWO A;  2ZIO A;  4W4L A;  3DTU B;  4TSF G;  1FXK C;  3B2E E;  1N34 B;  3E2E A;  1FJG O;  2EIJ C;  5EIB D;  4DW1 A;  1XI1 A;  1I08 A;  5GTH Z;  2P4V A;  2ATK C;  3AG7 A;  3FB5 C;  1M9N A;  1JA8 A;  3OGC C;  2XAQ A;  5EC2 C;  2HVJ C;  3B8N A;  2DOS A;  1Q81 W;  2EZP A;  2YXY A;  1PD3 A;  2ZM6 O;  2UUA B;  1K34 A;  1NH2 D;  1WN7 A;  4ZI7 A;  4X62 B;  2QWR B;  1YTF B;  3STL C;  2W6I G;  3RVZ A;  3M8A A;  3JD0 A;  1K5Q A;  5H5N A;  4JAV A;  2JJ1 G;  5L3E A;  4GKK B;  3RYI A;  4RAI A;  2UXD B;  2HR3 A;  3M7M X;  3QO7 A;  3CXC U;  4YJ3 B;  2E74 B;  3WFV A;  1R73 A;  4I5S A;  2UXC O;  1G4Y B;  3HKE B;  4B3S B;  1YEW A;  4ASU G;  2LW7 A;  2EBO A;  2K9P A;  1FYJ A;  5KHG A;  1WA8 B;  4DR2 B;  2LJ2 A;  3BVO A;  5LGN A;  3W7X A;  4GKJ B;  2YUA A;  4PDL A;  1K92 A;  3EFF K;  1IDS A;  1UJW B;  2ZE5 A;  1QHT A;  4AQY B;  4BW9 A;  1U96 A;  2ILM A;  4DW0 A;  5B1B C;  4BAY A;  2Q73 A;  5GW7 A;  3HPL C;  2IJI A;  4JGS A;  2LW1 A;  4O4H B;  3SYQ A;  4JI5 O;  2EUL A;  1ARO P;  3K0G A;  4YY3 O;  1VQK V;  1EN4 A;  3U10 A;  4XDL A;  1BE3 H;  4DV1 O;  4B3T B;  2GV9 A;  4J7Z A;  3SPH A;  2XAH A;  4LFB B;  3HKC A;  3BAB A;  4DR6 B;  1X4T A;  4UV9 A;  1CXZ B;  1OCO C;  4Q20 A;  1W0J G;  2HG5 C;  5IY5 C;  2QWN B;  1PPJ H;  4N21 A;  4MW8 A;  3E83 A;  3BRC A;  4J9Z B;  1S5H C;  3F5W C;  1XDC A;  4DRX A;  3D8C A;  3KCX A;  1WAZ A;  3TXS A;  1YVW A;  3JD4 A;  1Y67 A;  3RGB A;  3FB7 C;  3W7U A;  2WLL A;  1FXH A;  1BSM A;  2LFS A;  4DV2 O;  4MVR A;  1DTO A;  1Y66 A;  4DXW A;  4YJ2 B;  3SYA A;  2WAM A;  5KLV H;  3HKB B;  2A7W A;  2H94 A;  2RCV A;  3RT3 C;  4B3M B;  4UUJ C;  3W7S A;  1HNX O;  1JPX A;  2QKA A;  2WA3 A;  3UQ8 A;  2GUZ B;  3W7T A;  5LP6 B;  4JYA B;  1QCE A;  3K04 A;  3MDS A;  3KCY A;  5FLX N;  3JAW A;  3SYO A;  4J7K A;  5CN0 A;  1JR9 A;  3JAT A;  4FVM A;  4TT3 G;  4GX2 A;  1WNS A;  5EZY A;  3OT7 A;  2JS3 A;  3AG2 B;  4DR7 O;  4JV5 O;  1B06 A;  4JI6 O;  1CPY A;  4NTX A;  4PA7 A;  4QE9 A;  5JVD B;  2CE4 A;  3GVM A;  5EYP A;  5F2V O;  4QPK A;  1XL4 A;  1OCC C;  4EB6 A;  4YHH O;  1PNL A;  4LFC B;  2Q8V A;  5FNV A;  3SPG A;  3G80 A;  3ETG A;  4I7Z B;  3OTF A;  4FFB A;  4ABM A;  2E5L O;  3AK3 A;  2E76 B;  2Z3Y A;  4H37 A;  5JJJ B;  2OCC B;  3OFN G;  3SDL A;  4B7E A;  1EM1 A;  3ZRW A;  2BSK A;  3DC6 A;  2RMK B;  4RWU A;  3K5L A;  3IC9 A;  2DYS B;  1KMI Z;  4FMT A;  3K3W A;  3L70 H;  1HW7 A;  1M90 W;  5BR8 O;  1K9M W;  1XRE A;  4LFA B;  2EIL C;  1KP2 A;  1TUB B;  1MNG A;  2NLJ C;  1YTF D;  2QR4 A;  1RSO B;  2YDE A;  1N0N A;  2R9A A;  2L35 A;  2B1G A;  1PKX A;  2QWQ B;  2WLI A;  2CTP A;  2Y4U A;  4MVM A;  4HAM A;  4H44 B;  5J2U B;  3ZMZ A;  1ZX3 A;  3LUT B;  4R8C A;  2M6Y A;  1VQ6 V;  4J42 A;  1IZ3 A;  2EIN B;  4I55 A;  2OYQ A;  1AB3 A;  2XAJ A;  4YJ3 A;  5DM6 V;  3HKE A;  2ZDI A;  5KHI A;  3ZJZ A;  1N33 O;  3CWB H;  5EBM C;  1WA8 A;  3ABK B;  1MSW D;  3JAS B;  4H13 B;  3C3S A;  4BIU A;  2XAF A;  3RYC B;  2CH7 B;  3SJQ C;  5CBF A;  2JVD A;  4DV4 O;  1B3Q A;  1NTK H;  2Y69 B;  3ZHS A;  3GB7 C;  2WLM A;  3E22 B;  2WWW A;  3AG4 C;  1W0K G;  1LNQ A;  3AEI A;  2P5O A;  4PI2 A;  2EIK B;  4FJC C;  2D2C B;  1N36 B;  2CGN A;  1SS3 A;  3LSS A;  2B5U A;  2Q4P A;  2ZDI C;  1J95 A;  4CS3 A;  2Z5U A;  4P2Z A;  1JFF B;  2QA4 V;  5B1A B;  1DF5 A;  1GN3 A;  2VQE B;  4B08 A;  4CS4 A;  3CC4 V;  5JWP A;  5ITZ B;  4FLT A;  1OCR C;  2DJV A;  4JI1 B;  2BTO A;  5E1A C;  3IFX A;  4TV8 B;  2EX3 A;  2YS8 A;  2X6B A;  4UVC A;  3L75 H;  3ETE A;  1ROP A;  1S72 V;  1G1X B;  4U3J B;  2QKC A;  3IGA C;  1XNR B;  3AG3 B;  3WB0 A;  2PF4 E;  2P06 A;  2CTR A;  3WU2 Z;  3OTO B;  3ASN C;  5CA1 B;  5IYZ B;  3HKB A;  3CCR V;  1AP5 A;  2YID A;  3ZMT A;  3H1H H;  4I50 B;  4I0X A;  1NI8 A;  4UVA A;  5BY1 A;  1FD9 A;  1NKD A;  3Q4H A;  3JYC A;  4O2A A;  4XDK A;  4LCU C;  4X1Y B;  3MD0 A;  2X0L A;  4X66 O;  1WP8 A;  2BTQ A;  3CJH B;  4XDJ A;  1TVK B;  2RNB A;  4OXS A;  1LUW A;  1QR8 A;  4YIO A;  3CD6 V;  1JOY A;  5KX5 B;  2QTO A;  4I9W A;  2Y0P A;  4NR1 A;  1WJZ A;  4GCZ A;  4G28 B;  1NS1 A;  5TIS Z;  5JVD A;  4CC5 A;  2EJ7 A;  4AIL C;  1KUQ A;  4JI0 B;  1AI6 A;  1M56 C;  5IYC O;  1WB7 A;  4TV9 A;  3STZ C;  3OW2 U;  4LWS A;  4ZOL B;  1HP8 A;  5LMN O;  1V54 C;  1K4C C;  5LHH A;  3ASO B;  4O4J B;  4KFM A;  4Z1V A;  1NTM H;  3FFQ A;  4ICG A;  1B6Q A;  3KKY A;  3A8T A;  4EKW A;  2XUM A;  2QJ1 A;  1AVM A;  4C7U A;  3CCJ V;  2OTJ V;  2N05 A;  1OCO B;  2EZO A;  2QGN A;  3OR6 C;  1ZAU A;  4TQD A;  4DR4 O;  1V55 C;  2ZE6 A;  4LBE C;  2DN9 A;  1F4N A;  3QNE A;  1SZX A;  4DV1 B;  1RSO A;  2CAZ C;  1SZT A;  5DED A;  3WG7 B;  4P30 A;  4JF3 A;  3VQW A;  5HFL A;  5B3S C;  2ZXW C;  1NR1 A;  5IJ9 B;  3SR2 C;  3K58 A;  2A06 H;  5C93 A;  1MOF A;  3G4S V;  3VQV A;  5CBG A;  1XOU A;  4HNA B;  1ZTE A;  2KKW A;  2ZD9 A;  4MT8 A;  3E8H A;  2DMX A;  1KKC A;  3ABM C;  1JCH A;  4DV2 B;  3CCQ V;  2IM9 A;  1Q82 W;  1I94 B;  3BFR A;  4WFE A;  4LF9 B;  3JAS A;  2F4V O;  1JX9 A;  4IIJ B;  3ZHQ A;  3RYC A;  2CH7 A;  2IU3 A;  2P6J A;  4E4E A;  1HNX B;  1VF6 C;  2WLH A;  1Y4M A;  4B3R B;  3QVN A;  2CTQ A;  1A32 A;  3OUS A;  2A0L A;  1KYO F;  4LF7 B;  2GHY A;  1ZWI C;  4DR7 B;  2Q6A A;  4JV5 B;  5BZB A;  4EFB A;  1M57 B;  2WSS G;  3H01 A;  4JI6 B;  3UT5 A;  2GBO A;  3RYH A;  3AG1 B;  4FZ1 A;  4H33 A;  2QWO B;  3A0R A;  4PA3 A;  4JYC A;  4DV7 O;  4YHH B;  1OCZ B;  1LUV A;  1EN6 A;  4U7N A;  3ABL B;  2LGQ A;  4KHP O;  5IJ0 B;  4TV8 A;  4KL1 A;  1XNQ O;  1MZF A;  1AJP A;  4FM2 A;  2HFE C;  1GN2 A;  1JMK C;  3B40 A;  1VEW A;  3ETD A;  4X64 O;  4D7T A;  2AHZ A;  3N2K A;  2Q0O C;  2Q5Z A;  1G6U A;  2N74 A;  3JAK B;  3T1H O;  4U3J A;  1NR7 A;  4CC6 A;  3CE2 A;  3D36 C;  5BR8 B;  3B4S A;  1EBO A;  3DGE A;  4YXW G;  5CA1 A;  3T4Z A;  5IYZ A;  3LNM B;  3VQX A;  3A0H Z;  4I4T B;  3E35 A;  4K8Z A;  3H1I H;  4F6E A;  5GON B;  3SJB C;  4FLV A;  5JCO A;  3OD4 A;  2P4K A;  4TWK A;  1K97 A;  1IBK O;  3FYI B;  4OPH A;  3CC7 V;  4X1I A;  1IUR A;  4UCR A;  2IU0 A;  4P9P A;  3CCE V;  4J10 A;  3CJH A;  1Z5V A;  5JQG B;  4DR3 O;  5K1P A;  1TVK A;  3THO A;  1W2B U;  1VQP V;  3JAM N;  2D3O W;  3JAR B;  3CP1 A;  3LNN A;  3IJ4 A;  1FFX A;  2JK5 C;  5LGU A;  1UPG A;  4HZ3 A;  1FPO A;  3H1K H;  1YHQ V;  5H2F Z;  3SYC A;  2Y48 A;  1U97 A;  1IBL O;  4MS2 A;  3OR7 C;  1XL6 A;  4MTF A;  3T2M A;  1WPB A;  1XMO B;  1GTO A;  4WFF A;  2IJH A;  2H8P C;  2RQ6 A;  4MVS A;  1RFY A;  4ZOL A;  5EIB C;  4NTY A;  3I5D A;  4JPR A;  3E8F A;  2CTW A;  4O2B A;  1GKF A;  1NU1 H;  4FM0 A;  3QTC A;  5H9C A;  4LNU B;  4NB5 A;  3OEH G;  4DV4 B;  1VAR A;  1BMF G;  2VWK A;  1VQ7 V;  2HLD G;  5LA6 B;  1XMQ O;  3G6E V;  1Q5O A;  3D3Q A;  3EVK A;  4JI2 O;  3UO2 A;  3CHX A;  2V4D A;  1OCR B;  2NR5 A;  1S0V A;  4F6R A;  3ICX A;  3CRR A;  1VIB A;  1L0L H;  1VQL V;  3EXA A;  4L8J A;  1XHZ A;  5LYJ A;  1YZB A;  1TAE A;  2UUB O;  4DV5 O;  4X9Q A;  3T1C A;  1Q3E A;  3RYF A;  3K08 A;  3ZHV A;  5KAF Z;  1HWY A;  1SQV H;  4TUY B;  5L3C A;  4DR1 O;  1R3L C;  1H2G A;  1M5I A;  4JI4 O;  3JAL A;  4X1K A;  5IJ9 A;  2YXH A;  3N2G B;  1OJH A;  4MTO A;  4FLZ A;  3ASN B;  4J9Y B;  1J5E O;  1BT8 A;  4O4L B;  3FB8 C;  5BMV A;  2PYJ A;  1SQG A;  2CDY A;  2Y0I A;  1TA8 A;  3H1J H;  4K35 A;  3CEI A;  4JZ2 A;  1I7F A;  4PEL A;  1ZL8 B;  3BEH A;  3I55 V;  4LF8 O;  3MHS C;  2ZT9 B;  1PNM A;  1R6K A;  2HP8 A;  5DEC A;  2X6C A;  1XQ8 A;  2YSU B;  1LR1 A;  2YEV B;  5IYD O;  4UFZ A;  1RM1 C;  1M56 B;  2ZQM A;  2DQ0 A;  1O9H A;  3ZRX A;  3K59 A;  1AJQ A;  5L3B A;  2FL4 A;  3BY6 A;  3KZI Z;  1QVF U;  3OAA G;  4DR5 O;  2PI4 A;  1MZE A;  2PY5 A;  4A5U B;  3ZHR A;  1F4M A;  4FLW A;  1E1Q G;  1IVS A;  1ZLZ A;  5H6R A;  1TGO A;  1EFR G;  1VQ5 V;  3WB1 A;  2A9H A;  4ZHQ B;  1NBM G;  4EFE A;  3S3X A;  3GWO A;  4LF4 O;  1Z2G A;  5KMG B;  2X7R B;  5LMN B;  1NVP B;  2JDI G;  4K0K O;  1YJ9 V;  4Z1M G;  5KHJ A;  5CA0 B;  2HEP A;  4FLY A;  3JAK A;  4WFA V;  1IBM O;  1K33 A;  1N32 O;  5L3D A;  4DR4 B;  1NT2 B;  2VWJ A;  5CMU A;  1BHA A;  5IDJ A;  1N34 O;  1KBH A;  1K73 W;  1YJN V;  4H0L B;  3R66 A;  2LP7 A;  4ZBM A;  2LQT A;  1KKD A;  2AZ2 A;  4JI3 B;  1HDJ A;  3AK2 A;  2F93 B;  1JJ2 U;  2QM7 A;  1H2S B;  4WFG A;  3CXH F;  2DYR C;  4L87 A;  4JI7 O;  3TJT A;  1S76 D;  1WB8 A;  4QPJ A;  3JAR A;  3C3T A;  2P7T C;  1K8A W;  3X2Q B;  3KG2 A;  1SER A;  4X62 O;  1GM8 A;  2B1I A;  2AXT Z;  4DUZ O;  4LF5 B;  1KB9 F;  2Q67 A;  1ZSP A;  3TXQ A;  4W4K A;  2OIE A;  1N0J A;  2Q7G A;  5CBH A;  1QLN A;  2BCC H;  2F4V B;  2W0F C;  4DK1 A;  1JVM A;  1MAB G;  4LNU A;  4FLU A;  3VBB A;  5HFM A;  5FL7 G;  1QNM A;  1O9G A;  4UCU A;  2HVK C;  4O4I B;  3CME V;  2IBZ H;  4DV6 B;  3JSN A;  5LA6 A;  4EEQ A;  4JYB A;  4GKJ O;  3ABU A;  4O4H A;  1YDX A;  2A3Q A;  2LFR A;  5JH7 B;  2UUC O;  3APQ A;  3M99 B;  2KQX A;  2VQF O;  1SET A;  3SGI A;  1CP9 A;  3QF7 A;  1URF A;  1KC8 W;  1BGY H;  2XHB A;  2PGG A;  1EN5 A;  3P3N A;  4MVQ A;  2QKS A;  4NKG B;  4LH7 A;  2JIZ G;  1FXK B;  4LC1 A;  3APO A;  1BQZ A;  3K9S A;  4TUY A;  2EIJ B;  3ABT A;  4DV7 B;  1AR4 A;  2WLK A;  1SQF A;  4PDV A;  2HJF C;  3N2G A;  1XNQ B;  4NXN B;  1K5S A;  5C8Y B;  3ZMU A;  2QWP B;  4Q6G A;  4X64 B;  2IH1 C;  1FJG B;  3K5O A;  3CB2 A;  2BOC C;  2WA4 A;  1R3K C;  3CC2 V;  3T1H B;  4YJ2 A;  1WLE A;  4UVB A;  1AI7 A;  3ZMS A;  1ZL8 A;  1M4U A;  3BCC H;  4RO2 A;  2X6A A;  3CCL V;  2F95 B;  2YC0 A;  1V9P A;  1H8H G;  3LDE A;  2GUZ A;  3JD2 A;  4DV0 O;  5LP6 A;  4UCT A;  2MK3 A;  2PTM A;  3FB6 C;  2Z0A A;  2ZM6 B;  3QO8 A;  2YEV A;  1IBK B;  1Q6H A;  4CZZ A;  4B3M O;  3OE7 G;  3UO3 A;  1L0N H;  1R3I C;  4JI8 O;  2Q0A A;  2YI9 A;  4JYA O;  4NXM O;  3VQY A;  1NVP D;  2AZ0 A;  3FD9 A;  4CS2 A;  4ZI7 B;  2UXC B;  2GTS A;  5B1B B;  1Y6X A;  2PUS A;  4PDM A;  1I5X A;  3HB3 B;  4GLX A;  4ZHQ A;  4MTX A;  1SKV A;  2CK3 G;  1QLE C;  3RFR A;  3F7V C;  1N4C A;  2R72 A;  3K06 A;  1S77 D;  3P3P A;  4X65 O;  1R1B A;  1GO3 F;  4UCO A;  1N8R W;  3PN1 A;  4LFC O;  2JRI A;  2Q9L A;  2YIC A;  1NTZ H;  1AI5 A;  2EIM C;  2W0X A;  2GSM B;  4IHJ B;  1XMQ B;  2GDS A;  4BWA A;  4B7K A;  4JI5 B;  2E3C A;  1TUB A;  1WPX A;  2CUG A;  4YY3 B;  5IY5 B;  1GK9 A;  3CRC A;  4UCV A;  1R6T A;  4RQF A;  2WPD G;  1GM9 A;  1PM9 A;  4GUN A;  3LSU A;  3ZS8 C;  1MG1 A;  1YIJ V;  2JEX A;  4OGQ B;  4MSW C;  4D6T H;  2OCC C;  1S3J A;  2Y4T A;  5J2U A;  4WCE V;  3OGI B;  3SPJ A;  4JI4 B;  1YIT V;  3HKC B;  3ZIA G;  2DYS C;  2JS5 A;  3C90 A;  2XTA A;  2QM8 A;  2DW4 A;  4XBF A;  2IW5 A;  2BOB C;  1PL4 A;  3R65 A;  3JCU Z;  1JJO A;  5LL6 Y;  4PDR A;  3K57 A;  1SA0 B;  4PHZ A;  1KP3 A;  1KD1 W;  4DRX B;  4AHC A;  4U3F H;  4NTW A;  1BQ0 A;  1E1R G;  5LXT B;  4BIZ A;  3K0D A;  4LF8 B;  2UU9 O;  3T1Y O;  3ZCC A;  4DV3 O;  2JGU A;  2ZNI A;  3QG5 A;  3VOU A;  2AGA A;  3J7A U;  2Q7H A;  1BZK A;  2NNU A;  3E22 A;  1OCC B;  4OX9 O;  2EIN C;  3FAV B;  3TK1 A;  5J9P C;  5J2T B;  5JH7 A;  4E2L A;  3ZRS A;  2L6L A;  2FB5 A;  3OMN B;  2XT9 A;  4LR3 A;  4DR5 B;  3QO5 A;  4UXN A;  1JQ0 A;  3JAW B;  1JFF A;  3P32 A;  1YXB A;  3CS5 A;  1MSD A;  2VRZ A;  3F5T A;  2R70 A;  5EK0 A;  2YIB D;  1QR9 A;  5ITZ A;  4DO2 A;  1HR0 O;  5A9G A;  1S5L Z;  2E5L B;  4K8X A;  2EIL B;  5KA5 A;  2Y69 C;  4LF4 B;  4J80 A;  1PNK A;  4K0K B;  3G6B A;  5CA3 A;  1XIL A;  1Y74 B;  2ODM A;  2XOK G;  4EB6 B;  5C8Y A;  2YIB A;  5FPO A;  2EIK C;  1OZ0 A;  2ZIM A;  4TQF A;  4JI1 O;  1F7Y A;  4FFB B;  2P90 A;  3DC5 A;  4IGG A;  4IT5 A;  2AW9 A; 
#chains in the Genus database with same CATH homology
 1F23 A;  4U7O A;  2V7Q G;  4BIU A;  2XAF A;  3E8G A;  2ITD C;  4PEL A;  5B1A C;  1DLB A;  3BEH A;  2XND G;  5LHG A;  3SJQ C;  5CBF A;  3I55 V;  4LP8 A;  3MHS C;  1PNM A;  1K3E A;  1R6K A;  4MVU A;  4FPP A;  1Q86 W;  2Y69 B;  2WLJ A;  2X6C A;  3OM3 B;  2YSU B;  3GB7 C;  2W6J G;  2K1E A;  2WLM A;  2YEV B;  5IYD O;  1KQS U;  2WWW A;  1ORQ C;  3AG4 C;  1RM1 C;  2R9I A;  1W0K G;  1Q7Y W;  1LNQ A;  3AEI A;  1QBZ A;  3EHB B;  2EIK B;  4X8A A;  4FJC C;  2C2A A;  1M56 B;  2ZQM A;  4P9O A;  2DQ0 A;  3ZRX A;  3CCM V;  1AJQ A;  3LSS A;  3D3I A;  5L3B A;  2B5U A;  3BY6 A;  3UM7 A;  1QVF U;  2ZDI C;  1J95 A;  2Z5U A;  3OAA G;  4P2Z A;  2QA4 V;  2QEX V;  2PI4 A;  2WLI B;  5LGT A;  5B1A B;  1YI2 V;  1DF5 A;  1F4M A;  3AG3 C;  1E1Q G;  5EC1 C;  5H6R A;  3CC4 V;  3OEE G;  1EFR G;  3W7W A;  1VQ5 V;  1OCR C;  2ITC C;  2A9H A;  2Q69 A;  5E1A C;  2OT5 A;  3IFX A;  3AG4 B;  2DQ3 A;  1RM1 B;  1NBM G;  3FYE B;  2QE7 G;  3GWO A;  3K03 A;  2X7R B;  1NVP B;  4RQE A;  2FTK A;  2JDI G;  3CCV V;  2X6B A;  1G8M A;  1YJ9 V;  4UVC A;  1F51 A;  4Z1M G;  2ZR2 A;  1R6N A;  3ETE A;  1ROP A;  1S72 V;  5LHI A;  2WLL B;  1RPR A;  1IXM A;  1SRY A;  5H6Q A;  3IGA C;  3AG3 B;  4WFA V;  1K33 A;  3ZN1 A;  1E79 G;  3LSQ A;  4KP4 A;  5L3D A;  3ASN C;  4QE7 A;  5KA6 A;  3CCR V;  4JAU A;  1VQ8 V;  1QVG U;  2XAG A;  5CMU A;  1BHA A;  3T4D A;  5IDJ A;  3CCS V;  3X2Q C;  1KEC A;  2UXX A;  3ZMT A;  3JD1 A;  2R9R B;  4UVA A;  1K73 W;  1NKD A;  1YJN V;  3K9A A;  3JYC A;  2LP7 A;  4ZBM A;  4XDK A;  1H8E G;  5B1N A;  4LCU C;  1KKD A;  2Q68 A;  3MD0 A;  3MHH C;  4WF9 V;  3ABK C;  2X0L A;  2OTL V;  1JJ2 U;  2QM7 A;  1PL0 A;  1FXK A;  4WFG A;  4MTG A;  4QNH B;  1THZ A;  4XDJ A;  3ASO C;  2DYR C;  3LDD A;  4JTD B;  4OXS A;  4PA4 A;  4R50 A;  3ZN0 A;  4L87 A;  3ZMV A;  1S76 D;  1QR8 A;  3D36 A;  4QPJ A;  3CD6 V;  1JOY A;  2QTO A;  4I9W A;  3JCZ A;  2P7T C;  4R7C A;  4GCZ A;  4G28 B;  5LBQ A;  1K8A W;  3X2Q B;  4QIW F;  3KG2 A;  1I5Y A;  1SER A;  4KUM A;  1AI6 A;  1M56 C;  1GM8 A;  2AHY A;  2B1I A;  3OMI B;  3CPW U;  5IYC O;  3CMA V;  3STZ C;  4PA9 A;  3OW2 U;  2Q67 A;  3TET A;  4HYO A;  1R3J C;  1V54 C;  1K4C C;  3WG7 C;  5CBH A;  3ZRW B;  5LHH A;  2DYR B;  3ASO B;  1QLN A;  4KFM A;  4MW3 A;  1RPO A;  3DTU B;  2W0F C;  1JVM A;  1MAB G;  4TSF G;  3E89 A;  1FXK C;  2V1D A;  3SPC A;  1B6Q A;  3E2E A;  3VBB A;  5HFM A;  5FL7 G;  4EKW A;  4QJF B;  2EIJ C;  2HVK C;  3CME V;  1H38 A;  4JYB A;  3CCJ V;  2OTJ V;  2ATK C;  4R6Z A;  1OCO B;  2EZO A;  3ABU A;  3OR6 C;  3FB5 C;  2LFR A;  1V55 C;  1M9N A;  4LBE C;  3M99 B;  3OMA B;  3OGC C;  2XAQ A;  5EC2 C;  2HVJ C;  1F4N A;  1SET A;  1CP9 A;  3B8N A;  3QNE A;  1KC8 W;  1Q81 W;  2EZP A;  1QLE B;  1M1K W;  1V54 B;  1COW G;  1SZT A;  3WG7 B;  4G27 B;  4P30 A;  1PD3 A;  3FKS G;  4GT1 A;  4MVQ A;  1K34 A;  2QKS A;  4JF3 A;  4RUF A;  1NH2 D;  2JIZ G;  1FXK B;  4LC1 A;  5HFL A;  5B3S C;  5L3F A;  1NQT A;  2EIJ B;  3ABT A;  1YTF B;  3STL C;  2EIM B;  2W6I G;  2ZXW C;  3RVZ A;  1NR1 A;  3JD0 A;  1K5Q A;  4JAV A;  4ZKI A;  2JJ1 G;  5L3E A;  2WLK A;  5C93 A;  1YJW V;  1MOF A;  3G4S V;  4PDV A;  1YSC A;  2HJF C;  1VQO V;  5CBG A;  4RAI A;  5KUM A;  1V55 B;  2HR3 A;  3QO7 A;  2ZD9 A;  3CXC U;  4G2K A;  4MT8 A;  3WFV A;  1ENV A;  1K5S A;  1R73 A;  4I5S A;  3ZMU A;  1G4Y B;  4ASU G;  2EBO A;  2IH1 C;  4GX1 A;  2BOC C;  3E8H A;  1R3K C;  5IYB O;  5L3G A;  2DWD C;  3CC2 V;  1P4R A;  3ABM C;  1JCH A;  3CCQ V;  1M57 C;  5B3S B;  3RVY A;  5KUK A;  1WLE A;  5LGN A;  1Q82 W;  3W7X A;  4WFE A;  3AG1 C;  1GMG A;  2ZXW B;  1K92 A;  3EFF K;  4FIP C;  4PDL A;  4UVB A;  4X89 A;  1JX9 A;  3IC7 A;  1AI7 A;  3ZMS A;  1UJW B;  4RO2 A;  3CCL V;  2X6A A;  2IU3 A;  2P6J A;  1H8H G;  3LDE A;  5B1B C;  3I56 V;  2WLH A;  3JD2 A;  1OCZ C;  4BAY A;  5GW7 A;  2MK3 A;  1Y4M A;  3FB6 C;  3HPL C;  3ABL C;  2IJI A;  3UKM A;  3QO8 A;  2YEV A;  4JGS A;  3OUS A;  3SYQ A;  2A0L A;  4CZZ A;  2KB1 A;  1ARO P;  3K0G A;  4PA6 A;  4JAS A;  1VQK V;  1AR1 B;  3F7Y C;  2GHY A;  3OE7 G;  1ZWI C;  3ABM B;  4XDL A;  1CEZ A;  1R3I C;  2JJ2 G;  2A79 B;  2Q6A A;  4JTA B;  3ZRV A;  3JD3 A;  5BZB A;  4UV8 A;  1M57 B;  2WSS G;  3H01 A;  3SPH A;  2XAH A;  3AG1 B;  1NVP D;  5DN6 G;  2IJJ A;  4H33 A;  3B8M A;  4UV9 A;  3A0R A;  4PA3 A;  2IJK A;  3E8B A;  1OCO C;  4JYC A;  4Q20 A;  1W0J G;  4GX0 A;  5B1B B;  3CYO A;  2HKO A;  1OCZ B;  1OHH G;  4U7N A;  4PDM A;  2HG5 C;  3ABL B;  1I5X A;  5IY5 C;  3HB3 B;  4MTX A;  4N21 A;  1K7D A;  2CK3 G;  4MW8 A;  3LDC A;  3E83 A;  1DF4 A;  3RBZ A;  4J9Z B;  1QLE C;  1S5H C;  3F5W C;  4F4L A;  3F7V C;  1BL8 A;  1GM7 A;  1AJP A;  2P67 A;  2HFE C;  3K06 A;  1S77 D;  3ETD A;  1GO3 F;  3JD4 A;  1N8R W;  2AHZ A;  3E86 A;  3FB7 C;  3W7U A;  2WLL A;  1FXH A;  1AI5 A;  2EIM C;  2LFS A;  3K79 A;  4BW5 A;  1NR7 A;  2GSM B;  4MVR A;  1DTO A;  1Y66 A;  4DXW A;  3P30 A;  3SYA A;  2F43 G;  2WAM A;  1EBO A;  3DGE A;  2H94 A;  4YXW G;  3SPI A;  1WPX A;  5IY5 B;  3T4Z A;  1FXV A;  3LNM B;  1GK9 A;  4UUJ C;  3W7S A;  3E35 A;  1JPX A;  4RQF A;  3W7T A;  2WPD G;  3CCU V;  1GM9 A;  3G71 V;  1QCE A;  3K04 A;  4TWK A;  1FFT B;  3SYO A;  1K97 A;  5CN0 A;  3FYI B;  1MG1 A;  1YIJ V;  1VQ4 V;  2JEX A;  2UXN A;  3CC7 V;  4TT3 G;  4GX2 A;  4MSW C;  4GX5 A;  2IU0 A;  2OCC C;  1S3J A;  4P9P A;  3CCE V;  3AG2 B;  4WCE V;  3SPJ A;  1W2B U;  1VQP V;  1YIT V;  2D3O W;  3CP1 A;  1CPY A;  2JEU A;  2DYS C;  3ZIA G;  2JK5 C;  4PA7 A;  4QE9 A;  5EBL C;  5LGU A;  4HZ3 A;  1YHQ V;  2QM8 A;  2DW4 A;  4XBF A;  2DWE C;  4QPK A;  1XL4 A;  2IW5 A;  3SYC A;  1VQM V;  3NXS A;  1OCC C;  2Y48 A;  1PNL A;  2BOB C;  4MS2 A;  3OR7 C;  1AI4 A;  3PJS K;  3SPG A;  4CBC A;  3R65 A;  1XL6 A;  4MTF A;  3ETG A;  4RUE A;  3T2M A;  2WLN A;  2M7W A;  1GTO A;  4WFF A;  1VQN V;  4PDR A;  2Z3Y A;  2IJH A;  2ZR3 A;  3TCU A;  5EBW C;  2H8P C;  4H37 A;  1AJN A;  1NJI W;  3ML0 A;  1KP3 A;  4MVS A;  2OCC B;  1KD1 W;  4JPR A;  3E8F A;  3OFN G;  1GKF A;  1E1R G;  3ZRW A;  3SYP A;  4BIZ A;  3K0D A;  5H9C A;  3OEH G;  1BMF G;  3ZCC A;  2DYS B;  4WFB V;  3OUF A;  4FMT A;  2IH3 C;  3VOU A;  1VQ7 V;  3K3W A;  2PI5 A;  2HLD G;  1FS0 G;  1M90 W;  1EZJ A;  3G6E V;  2NNU A;  1OCC B;  1K4D C;  1K9M W;  2EIL C;  1KP2 A;  2EIN C;  4JTC B;  3TK1 A;  1OCR B;  5J9P C;  2NLJ C;  1YTF D;  1P7B A;  1S0V A;  4E2L A;  5B1O A;  3RW0 A;  3ZRS A;  4N23 A;  3OMN B;  1VQL V;  3B77 A;  2EJR A;  3QO5 A;  4UXN A;  1JQ0 A;  1TUE B;  3P32 A;  2B1G A;  1PKX A;  2WLI A;  4MVM A;  3T1C A;  5EK0 A;  3K08 A;  4HAM A;  1HWY A;  5L3C A;  1VQ9 V;  4MVO A;  1QR9 A;  4X88 A;  1R3L C;  4DO2 A;  1H2G A;  3ZMZ A;  3LUT B;  4R8C A;  1L1F A;  4FK5 C;  1VQ6 V;  4MTO A;  1SES A;  2EIL B;  2EIN B;  5KA5 A;  2Y69 C;  3ASN B;  4J9Y B;  4WFH A;  1PNK A;  2XAJ A;  1NH2 B;  5CA3 A;  5DM6 V;  2XOK G;  2XAS A;  3FB8 C;  2ZDI A;  2EIK C;  1OZ0 A;  4MVZ A;  3ZJZ A;  3AG2 C;  2P90 A;  1BHB A;  5EBM C;  3ABK B;  1MSW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...