1K4CC

Potassium channel kcsa-fab complex in high concentration of k+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4cC00
3SYAA 3ZRSA 3JYCA 4X8AA 5CBGA 1K4DC 1ORQC 2HVKC 2X6BA 3LDDA 1R3LC 3LUTB 4MSWC 4MTFA 1R3IC 2EIJC 4MVUA 4PDMA 1BL8A 2IH1C 3R65A 4QE9A 4ZBMA 4PDLA 4EKWA 4HYOA 4RUEA 3LDCA 4MW8A 3E8FA 3EFFK 2KB1A 4DXWA 4LBEC 2BOBC 3ABMC 3FB7C 3OGCC 2WLHA 2WLKA 3K08A 2HFEC 2OCCC 4PA6A 3T1CA 4P30A 1V55C 2IH3C 3SYCA 2Q68A 4HZ3A 4WFHA 2ATKC 1V54C 4GX1A 3K0GA 3F7VC 3OUSA 4QE7A 5EC2C 3FB6C 3LDEA 3OUFA 4PA7A 4GX5A 4MVOA 4P9PA 4PDVA 5IY5C 3WG7C 1OCRC 5E1AC 3SPCA 3T4DA 2DYRC 3T2MA 4H33A 1OCZC 3K0DA 3SPIA 4LCUC 2WLJA 3K03A 4I9WA 1G4YB 3F5WC 4PA4A 2Q69A 3STZC 3SPJA 2W0FC 3X2QC 2P7TC 4WFGA 4J9ZB 3SPGA 4WFEA 5EBWC 2X6CA 2K1EA 4PDRA 3GB7C 3FB8C 2DWEC 2AHZA 4MS2A 4MTOA 3IGAC 3ABLC 3E8BA 4P2ZA 4PA9A 4GX2A 4MVSA 2YEVA 4XDJA 5EBMC 5EBLC 3SJQC 1XL4A 3TETA 4LP8A 3ASOC 4XDLA 2WLIA 2X6AA 4J9YB 4P9OA 4RO2A 4BW5A 3K04A 2HJFC 1JVMA 2WLMA 3AG1C 4MVRA 2EILC 2WLLA 1ZWIC 4GX0A 1R3KC 2AHYA 3SYPA 3IFXA 4KFMA 4R8CA 3TCUA 3RVYA 2HG5C 3LNMB 3AG3C 5B3SC 3AG2C 2Q6AA 5BZBA 4X88A 3OR6C 2DYSC 1M57C 3UM7A 4QNHB 2EIKC 2JK5C 2WLIB 3KG2A 4H37A 3STLC 3T4ZA 3AG4C 2QKSA 3E83A 4PA3A 1LNQA 2H8PC 3FB5C 2ITCC 2Q67A 2WLLB 4X89A 3F7YC 1S5HC 1P7BA 2EINC 4F4LA 3E8HA 3E8GA 1OCCC 4JTAB 2HVJC 4XDKA 4MW3A 4UUJC 3VOUA 4MVMA 5EK0A 2A79B 1KKDA 3ASNC 3BEHA 2NLJC 4R6ZA 3K06A 1M56C 2ITDC 4CBCA 4TWKA 4R7CA 2A0LA 2ZXWC 3RW0A 5CBHA 4G28B 5B1AC 3RBZA 3SPHA 4WFFA 2ZD9A 1R3JC 2WLNA 3E86A 4OXSA 5B1BC 4JTCB 3UKMA 5CBFA 4MVZA 3OR7C 1XL6A 2EIMC 5J9PC 4MTGA 1OCOC 5KUKA 2DWDC 3ABKC 3SYQA 3ZJZA 4RUFA 3RVZA 2A9HA 5KUMA 1K4CC 2QTOA 1QLEC 1J95A 2BOCC 2Y69C 3E89A 2R9RB 4R50A 3SYOA 4MVQA 4JTDB 5EC1C 3PJSK 3HPLC 4G27B 4RAIA
chains in the Genus database with same CATH superfamily
3JYCA 3RYHA 3OFNG 4I55A 1R3IC 1Q7YW 1H2NA 4JI0B 4ZBMA 4IGGA 4WBNB 5EZYB 4L8JA 1M4UA 2QJ1A 3K59A 5KHIA 3RYHB 4GKJO 4X66O 4ZI7A 2JJ1G 4I55B 1ENVA 2IH3C 1YXBA 2D3OW 1AJQA 5B66Z 1YDXA 1FFTB 3H1JH 1QCEA 3WG7C 1Y76A 3AK2A 4ZI7B 4K3AA 2OYQA 2V7QG 1W59A 5KHJA 4DW0A 1VF7A 5C8YA 2K1EA 1Y76B 2OCHA 1VQ9V 2BTQA 1Q86W 1WP8A 3APQA 5KHGA 3JARB 3FYEB 1Q43A 5C8YB 4KFMA 4W4KA 3HB3B 4X88A 1XMOB 2BTQB 1S0VA 2Q73A 2AGAA 3CE2A 3ETEA 1SQGA 3WB0A 3L71H 1PD3A 1AILA 3BY6A 2EULA 1UFIA 5L3EA 2A79B 2P90A 4JI6B 4UCVA 2AZ0A 1D5NA 4OX9B 2F4VB 3B2EE 4TV9A 3SPHA 2OTJV 3E86A 4OXSA 3A0HZ 2YXHA 3B8MA 4K35A 3DTUB 2IU0A 2Q7EA 3L70H 1QNMA 2EILB 1IVSA 4TV9B 1AP5A 1X4TA 1GH6A 3BA8A 2HEPA 4KXRA 2JDIG 2XT9A 3SYAA 5IDJA 5JCOA 1P7GA 2EZPA 2JS3A 3LDDA 1VQ4V 3ZHRA 4JGSA 3H01A 5L3GA 4NYKA 4CH4A 5LGNA 4LBEC 2KG7A 4GKKO 2LGQA 2HLDG 5CA0A 1KUQA 3ZS8C 2YICA 5LYJA 4PDVA 1WB7A 2KG7B 1H38A 3JD3A 1CPYA 1CP9A 3MDSA 5EIBC 4KUMA 3ML0A 4JI6O 4LF8O 1TUBA 4MTOA 5LHIA 2YEVA 4LP8A 3OGIB 3JAWA 1SQVH 1Y74A 1GK9A 4O4HB 3K9SA 3SYPA 3RVYA 1YZBA 4DUYO 2ZDIC 2IW5A 5KHHA 3QO7A 1PNKA 2JK5C 2XNDG 3T4ZA 3JAWB 4PJ0Z 3E83A 1Y74B 1ZL8B 3ABUA 4EFBA 5LHGA 2ZNJA 1VP7A 4LF9B 1I0HA 1SQXH 4FLTA 4DUZO 3CC2V 5B1AC 1CEZA 1H8HG 3ABLB 2ILMA 1VQ5V 1QBZA 5DM6V 1OCOC 1YJWV 1NU1H 4FMTA 2YXLA 1K3EA 1K4CC 2C2AA 4TUYA 5EC1C 4NB5A 5CBGA 3EVKA 1K5SA 4UVBA 2Y4UA 3ZEDA 4QE9A 2PUSA 1SZXA 5IJ0A 1FXKC 1IBLB 4TUYB 2Q0OC 1A32A 1I94B 5E79Z 4BIZA 4I0XA 2HFEC 4ZOLA 1YITV 2O57A 1K73W 1MMMA 2W6IG 5DECA 5IJ0B 1KU9A 4DV5O 5EC2C 3OMNB 1B6QA 3CSXA 3SPIA 2VWJA 2ZIOA 2H3OA 1H2SB 1VMGA 4ZOLB 2W0FC 4FM0A 4H0LB 1P84F 4K8ZA 1HWYA 1N33B 1R6KA 3I55V 1GM8A 4IT5A 1SRYA 4X20A 2YIBA 2Q0AA 1XHXA 3WFVA 2UUCO 1RPOA 2DJVA 3H1HH 5CN0A 1CXZB 5CA1B 3U10A 4H37A 4X20B 1SF9A 1FJGB 2YDEA 1SERA 1Y6XA 2IM9A 3MD0A 2JGUA 4TSFG 1M56C 1Y66A 4R7CA 4JZGA 2VQEB 1N0JA 2P4KA 3DXRB 4JPRA 3G4SV 1ZX3A 4JYAB 3SYQA 4J41A 4RUFA 1Z5WA 1FKAO 2BOCC 1WB8A 3K3WA 4HBNA 4JI7O 3ZX6A 1K4DC 2RQ6A 1M57B 3LUTB 4MTXA 4NR1A 1SS3A 4PI2A 3Q4HB 1N33O 4DR4O 4LWSA 4RUEA 3E8FA 1FXKA 4GZRB 3BCCH 3MHHC 5KMGB 4ABMA 3ABMC 4GCZA 2OCCC 4WFBV 2PYJA 1R1BA 2XTAA 4LWSB 3D36C 5C93A 3OUSA 4I4TA 3RWRD 3LDEA 3VBBA 5E1AC 3SPCA 4JI1B 1S72V 1PNMA 1FJGO 1JPXA 1QLEB 1PL4A 2ETNA 4X1KA 5IYZA 3CC7V 4LF5B 1SQBH 2DQ0A 5LOVA 2VQEO 4XDJA 3SJQC 1GN2A 4QPJA 1BQ0A 3P32A 3C3TA 3JCUZ 2WLMA 2WLLA 5IYZB 3ZMSA 1MSWD 4B3MO 2CTWA 4J11A 1MZFA 4CC6A 2VQFB 2DW4A 1HP8A 2P22C 3OAAG 4PA3A 5LGUA 2WLLB 3E8GA 3JD0A 4N21A 4GLXA 1NTZH 2P5OA 3VOUA 3HKBA 2WPDG 1THZA 2ZINA 3GWOA 4YJ2B 2UXCO 1YVWA 3BA9A 3VQWA 2HJDA 1EZJA 2XAFA 3UKMA 1JJ2U 3U11A 1XL6A 3AK1A 2M7WA 3D3QA 4X1IA 2UXDO 3HKBB 4D6TH 4DR3B 2Y69C 2AXTZ 2P4VA 1BSMA 2BE3A 3H1LH 2F66C 1M9NA 4U3FH 4X1IB 1AI6A 4MSWC 4LF5O 3ZMVA 3ZN0A 4HYOA 1XREA 5K1PA 3JAMN 4UV9A 4OPAA 4UVAA 3DC5A 1WPXA 2Q68A 4HZ3A 2OIGA 4WFHA 1F23A 2VQFO 4UV8A 4P9PA 3K9AA 1Q6IA 3ZCCA 2BCCH 3CRCA 5H6QA 2CUGA 1VQLV 3KKYA 1N32O 1GN3A 1US6A 1M5IA 4YIPA 1RM1C 3T1YO 4DV3O 2DMXA 2YUAA 3G80A 1XL4A 1SQFA 2R72A 3P3PA 1GKFA 3K5LA 1Q6HA 5HFLA 1NVPB 4JI3B 1FAFA 3ZHTA 1XHZA 4JI8O 1O9GA 1KC8W 2HR3A 1B06A 1W0KG 1YTFD 4LF4B 4GT1A 4LFBO 1MG1A 3JASB 2H8PC 2HHHO 3CCMV 4BR6A 4DR1O 5D5QA 1DK1A 1F7YA 4NTWA 2ZT9B 1Q81W 1U97A 1NBMG 4JV5B 3KCYA 4CBCA 1FPOA 5KA5A 4IIJA 1AJPA 3M7MX 5IWAB 2V4DA 3FFQA 2GTSA 2FMLA 1BT8A 1GN6A 1S77D 4CC5A 1H2LA 1KKCA 3DC6A 1V9PA 4DW1A 4IIJB 3HPLC 5B3SB 2F23A 2CK3G 1HR0B 1AI4A 3OM3B 2EIJC 3B09A 4X65O 4EKWA 3UQ8A 3C90A 3CEIA 3GVMA 2EINB 3JD4A 3CCUV 1OCCB 2QKCA 4JI3O 1S76D 1LUWA 3W7SA 2ZM6B 2ZQMA 2WLHA 5IJ9A 4PA6A 3HKDB 2CAZC 1K5QA 3SYCA 4LF4O 4OGQB 4PA7A 3GWKC 1OV9A 2DQ3A 1VQ6V 4H33A 2OWOA 1NZ6A 2CTPA 3CRMA 3VQXA 1GTOA 4NXMO 5IJ9B 2WLJA 2H94A 2JVDA 2Z5UA 1F4MA 3SPJA 4LFCO 4D7TA 3SPGA 1BE3H 1ZSPA 1JA8A 1KD1W 4F6RA 3W7UA 2AW9A 5EYPA 5EBLC 4Z1VA 3HKCA 5J2UA 3N2KA 4I50A 4BW5A 4JI5O 4CH5A 2HJFC 5KA6A 2CGOA 4GX0A 1RSOA 3IFXA 2EBOA 1Q90D 4F6RB 2QM4A 3B40A 3ZRWA 2DYSC 2EJRA 3HKCB 5J2UB 2EIKC 2YIDA 5LA6A 4LF6O 4DR6O 5IYDO 1HNZB 2X0LA 3ZRWB 5L3CA 3OD4A 3TGUH 1M90W 4TWKA 3X2QB 1KP3A 2ZM6O 2QWNB 3CCVV 3H9VA 1Q6UA 1WPBA 1XILA 3AG7A 1QVFU 1QR9A 2EIMC 4MTGA 5LL6Y 5BMVA 3OEHG 4OPHA 2QTOA 3E89A 4JI0O 4YY3B 3ZHSA 3JATA 4TT3G 3FD9A 4MTFA 4PDMA 1NJIW 5BMVB 1Q3EA 2OTLV 4E2LA 3SDLA 3JATB 4X64B 4JZ2A 5H5NA 1PL0A 2IU3A 2ZNIA 2YI8A 2CTRA 3TJTA 5FPOA 5LXTA 1V55C 3CWBH 2FYUH 2EIJB 2LJ2A 4NKGB 2ATKC 3CXHF 5JJJB 1IBKB 4PELA 4WCEV 2A06H 1OCRC 3B8NA 5IE9A 2ZCEA 3OT7A 1P49A 5LXTB 4JAUA 2BSKA 3ZHQA 1O9HA 5TISZ 2JRIA 4B7KA 4PDRA 3EXAA 4A5UB 2RJZA 4NVPA 4UCSA 4MVSA 4JI4B 1GAXA 4YHHB 3ASOC 4XDLA 3DGEA 4B08A 2CGNA 1XMOO 2BSKB 4NTXA 3ICXA 1ZWIC 1I7FA 3K5NA 1N0NA 2YIAA 5BZBA 4NTYA 2K9PA 3O9OA 3KG2A 5CA0B 1K8AW 4K0KB 1BGYH 2HKOA 4X9QA 5LYJB 1KQSU 3WG7B 4OX9O 2YIBD 2F4VO 4JTAB 4UUJC 1SC5B 4B7EA 4MVMA 2DYSB 4KL1A 1DF4A 2MW2B 2E76B 2EIKB 4X64O 2WWWA 2ZXWC 2ARHA 1YEWA 4O4IA 4B3RB 2R70A 1SQPH 1TUBB 3JCZA 4XBFA 1ZAUA 1R73A 4DV4B 1JCHA 1B04A 3RGBA 2YEVB 1HNWB 1IBKO 2GBOA 4HNAA 1TVKA 1URFA 3ZMZA 2IJJA 5BY1A 3JAKA 2NN4A 2R9RB 4O4IB 1TGOA 3PJSK 4QJFB 3OMIB 1Z5VA 2EIMB 4PI0A 5LMUB 4ZIBA 3A0RA 4JI4O 1VQPV 3EFFK 1K9MW 3IC9A 2GSMB 4B3TB 3FB7C 3PN1A 4AI8A 2QWPB 2UUBB 3LSSA 1NH2B 1V54C 2GDSA 3ZBHA 1FXHA 3B77A 3N2GA 1NTMH 2ADQB 4CS4A 4AILC 3APOA 4D7SA 4DR5B 3AEIA 1GM9A 4K0KO 3WB1A 3K03A 3CMAV 1V55B 4J10A 1Z2GA 3N2GB 1EFRG 3O65A 2Q5ZA 1PV0A 2N74A 2LP7A 2DWEC 3IGAC 1OCRB 2NR5A 4B3RO 3NR7A 1N4CA 2Q7GA 2AZ2A 4J9YB 4DV4O 4CZZA 3TCUA 2PI5A 4J7KA 4X1YA 4I0XB 1K97A 3BABA 1TAEA 1WA8A 5H9CA 2E3CA 4LF9O 1L0NH 1BQZA 1SQQH 2YXYA 4FK5C 3CCLV 1KP2A 3ETQA 1E1QG 1EN4A 1SKVA 1VF5B 4X1YB 5BR8B 3P30A 3RN4A 1KKDA 2KSDA 4R6ZA 1VQKV 1WA8B 4FLZA 2Y0PA 1K33A 2QDOA 2N05A 4GYCB 1R3JC 2WLNA 2UUBO 2ZDIA 1BS3A 2UU9B 1G6UA 1QHTA 3ZHUA 4I5SA 4R50A 4FPPA 2ZXWB 3RFRA 1IXBA 3BAAA 4B3SB 3A2FA 3L75H 3K57A 1IBLO 2XAHA 2DOSA 1I94O 2IH1C 2QWRB 3D3IA 1L8DA 3UO3A 2ZR3A 3CCJV 2CDYA 3OGCC 2A7WA 3K08A 4DV1B 4ICGA 1OHHG 3T1CA 2CTQA 3CRRA 3K0GA 4QE7A 5B1AB 2UUAB 3EHBB 4MVOA 1OCZC 2VS0A 1QR8A 5LHHA 1OCOB 1ROPA 3JSNA 3STZC 5L3BA 2JGDA 3W7TA 1V54B 2F93B 3P3NA 1N36B 1MZEA 2XASA 4FM2A 2Q4PA 3QG5A 2GTAA 4MS2A 4KHPB 2LW7A 3ZRXA 5B5EZ 4NXNB 4PA9A 1AR4A 2CH7A 1YCIA 5LBQA 4WFAV 2JGDB 2UU9O 4MVRA 1FXKB 3AG1C 2PI4A 1PM9A 1NVPD 2PY5A 2HG5C 2BTOA 1IBMB 1KMIZ 1T5EA 2CH7B 1HW7A 2QE7G 4QNHB 4FVMA 4WF9V 4B3SO 4I4TB 1HNXB 3FB5C 4X89A 1WNSA 4DV7B 3E8HA 2IJIA 1NS1A 1VQ8V 1VQMV 4X1KB 4J7JA 4JYAO 2IJKA 1M93A 4DV1O 1PKXA 2WA4A 5LOVB 4MT8A 4GUNA 3QNEA 1LUVA 1AVMA 3ZJZA 4LH6A 4PD4F 2LQTA 1J95A 2B9ZA 3BHPA 3S3WA 3ZRSA 3RVZA 3HKEA 2UXNA 1N36O 3CB2A 4FZ0A 5LP6C 4KHPO 1U96A 2A3QA 3VQVA 2WA3A 1K92A 2Y0IA 2RDCA 2LO1A 2BOBC 1EBOA 2WLKA 3HKEB 2R9IA 4JI1O 1M56B 1IBMO 1Q8IA 3BFRA 3H1KH 1VF6C 1JFFA 2JIZG 4U3JA 4DV7O 4EFEA 3F5TA 2P7TC 2XAGA 4J9ZB 4UVCA 5KHKA 1AR5A 1J5EB 2AHZA 1JFFB 1OCZB 4U3JB 1XDCA 1JQ0A 2WLIA 3D36A 3K04A 3KCXA 4LR3A 1XUQA 1BZKA 3JALA 4FIPC 4AQYB 3AG2C 3ABMB 1YHQV 1R6TA 2OCCB 4FJCC 3B4SA 5FPRA 2MK3A 1AI5A 4IYHA 2WLIB 1GMGA 3AK3A 1S5HC 3AG1B 1PP9H 3JALB 1NR1A 4XDKA 1AP6A 3UO2A 1W0JG 1SA0A 3CHXA 1YSCA 2QGNA 2RN9A 2Z3YA 2ITDC 4Q6GA 5B1NA 4DR3O 5FLXN 4JTCB 1QVGU 5J9PC 2DWDC 4LH7A 4HAMA 4TV8A 4IL6Z 1VIBA 1DF5A 4G27B 4CH6A 4DR2B 3BRCA 2X6BA 1ORQC 1IXMA 1H8EG 1XI1A 4TV8B 3TK1A 4G2KA 5LP6A 5KX5A 4N23A 4QGPA 1JJOA 2YC0A 4DV0B 2YSUB 1R6NA 1NKDA 3OTFA 4BAYA 5LP6B 3E22A 5KX5B 3N27A 5B1OA 2X7RB 3T2MA 2ZIMA 3K0DA 3G71V 1VF6A 1I5YA 2FKXA 3CS5A 4LC1A 4DK1A 4FLVA 2GV9A 3HR0A 2Y69B 5A2QN 3CC4V 2QKAA 3K5OA 3RT3C 2P6JA 5EBMC 5FNVA 2X6AA 2ZKOA 2EILC 3MHSC 2LFSA 4JAAA 2QM7A 1KBHA 3JSLA 5FNVB 1MOFA 4U7OA 4JV5O 3K79A 2ZE8A 4KP4A 1GRJA 1HDJA 4JI2B 3AG2B 3LSQA 3IAYA 1BHAA 2RCVA 5JCOC 4CH3A 2YI9A 5IWAO 1B3QA 3ASNC 1MA1A 3TXQA 3K06A 4DV0O 1RM1B 2PTMA 1SETA 3TXSA 2XUMA 4TQFA 5CBHA 1QLNA 1FYJA 5CBFA 5EYPB 1YJ9V 3OR7C 3UCSC 3N2KB 4I50B 3CP1A 1VQNV 1HR0O 4FLXA 1RSOB 1F4NA 3RYIA 4UCUA 2ZE5A 3CCRV 2EX3A 4J80A 1AJNA 5JQGA 3FX7A 3S3XA 3TETA 5DN6G 4MVUA 3CCEV 5LA6B 4F6EA 3K58A 4DO2A 3K5MA 5H6RA 2QEXV 3JARA 3RYIB 1ZUQA 5LGTA 3LNNA 5JQGB 1FS0G 2JS5A 3JD2A 1P4RA 4LNUA 4GX1A 3I56V 2ZE7A 4GKKB 1YTFB 1NH2D 2DYRC 3OEEG 2KKWA 3J7AU 1FD9A 4EEQA 5IYCO 1H2GA 4TQDA 4JI2O 4LNUB 2GHYA 1XEQA 1K34A 2OIEA 3FB8C 1OZ0A 3ABLC 2W6JG 1XOUA 1UJWB 3D8CA 4I7ZB 4LF8B 3CX5F 1R3KC 5GTIZ 3FKSG 3SJBC 3M8AA 5J2TA 4I9QA 3SR2C 3A0BZ 2E75B 1HNZO 2P67A 3UM7A 1SESA 3AG4C 5DEDA 4Z1MG 3FAVA 1JX9A 1EN6A 3U0ZA 4DUYB 4F4LA 1P7BA 2XHBA 2EJ7A 2DN9A 3SGIA 5J2TB 4DV6B 5LMNB 3J80N 5K1XA 5EK0A 4JYBA 3FAVB 4AHCA 4BIUA 3QO8A 4H44B 4WFFA 2ZD9A 2UXXA 5B1BC 1DTOA 5EIBD 1SZTA 4YY3O 5AG2A 4DUZB 4LF7B 1K7DA 1S5JA 3ASNB 2Q9LA 4RQFA 4MVQA 5A9GA 4X62B 2N04A 1XNQB 4X8AA 5CA3A 4DR7B 1WP7A 2JEUA 4JASA 1NTKH 1IURA 2YS8A 4MW8A 4O4HA 2IJHA 3W7WA 3MAQA 1MABG 5ITZA 2RNBA 5JJEB 2XAJA 3QVNA 1EM1A 1YF2A 3ETDA 5GW7A 3FB6C 1ZL8A 1AR1B 2XAQA 1MSDA 4PHZA 4DK0A 5ITZB 2M6YA 2P06A 3T1HB 3H1IH 4HNAB 1TVKB 3F5WC 4DV5B 2E5LB 1I08A 1QU7A 3JAKB 1JMKC 4RWUA 4DV6O 5LMNO 4YHHO 1N8RW 2QWQB 4P2ZA 2DYRB 4PV1B 4GX2A 1VEWA 3VQYA 3R66A 4FM1A 2LFRA 5D5PA 4LF7O 3AG3C 1AROP 4X62O 2LW1A 1M57C 1XNQO 2UUCB 1JR9A 2ITCC 4DR7O 1IZ3A 3ETGA 2F1MA 3FYIB 5L3FA 1RP3B 1M1KW 4UCTA 2NLJC 5FL7G 1HNWO 3C3SA 3AG4B 1Q5OA 3QO5A 3RW0A 1TUEB 1WJZA 1KYOF 5GONA 4UXNA 4YJ3A 4BIOA 3ASOB 3OTOB 5KUKA 4FLWA 4L87A 1EZVH 1F51A 2B5UA 4BW9A 4DYLA 3G6BA 3T1HO 3L73H 1QLEC 1KECA 5LMUO 2B1GA 4RAIA 2E5LO 2ODMA 1H2KA 3ZMTA 5GONB 5B1BB 3SJCC 4YJ3B 2FL4A 2HVKC 1LR1A 1BL8A 1I5XA 3R65A 4B3TO 4FZ1A 1VQOV 4JI7B 2QWOB 2PGGA 3CRQA 4IHJA 4DR4B 3E2EA 2EZOA 4DR5O 5CA1A 1DGSA 2JEXA 1WLEA 1GO3F 3OUFA 4GX5A 3CCQV 1S3JA 4IHJB 4LCUC 4I9WA 4ASUG 2L35A 5KLVH 3RYFA 5EBWC 1Y67A 3GB7C 2HP8A 3CD6V 3E8BA 4JAVA 5H2FZ 3DXRA 4UCRA 3OE7G 2F43G 4DRXA 1EN5A 3CYOA 3RYFB 2VWKA 3OTOO 1D5AA 3ABTA 2Q8VA 3LNMB 2XOKG 4CS3A 1ZLZA 3OR6C 3JD1A 2D2CB 3WU2Z 5BR8O 4CS2A 3Q4HA 5KAIZ 4DRXB 4B3MB 1PNLA 4JYYA 3CMEV 2NNUA 1NQTA 2E74B 3AG3B 5KMGA 2HVJC 4MW3A 4QIWF 3J81N 3CJHA 3QF7A 4J7ZA 4Q20A 3RBZA 4UB8Z 5F2VO 2KQXA 3L9DA 3DSQA 2UXCB 3ABKC 2QM8A 3CJHB 1RFYA 3IJ4A 1BCCH 5KUMA 3SYOA 1NR7A 5GTHZ 1G8MA 5HFMA 1VARA 2UXDB 3LSUA 1AB3A 3UT5A 4FFKA 3RYCA 1R3LC 1PPJH 2ADPA 1OJHA 4PDLA 5CB4A 1UPGA 3LDCA 2KB1A 4DXWA 1NI8A 2ZR2A 2UUAO 3UT5B 1S5LZ 3RYCB 4FFBA 3ZRVA 5JH7A 2Q7HA 5CB4B 3ZIAG 2IBZH 5KAFZ 5IY5C 1D2DA 3L72H 4UFZA 1X59A 2F95B 4FFBB 2W0XA 4PA4A 4NXNO 4W4LA 5JH7B 4WFGA 4YJ2A 2FB5A 4WFEA 1YI2V 1GM7A 1XNRB 1N32B 1Y4MA 3BPZA 1BHBA 3T1YB 2PF4E 4P9OA 1FFXA 4RO2A 2QA4V 4H13B 1N34B 4DV3B 2Y48A 4RQEA 2G38A 1ZTEA 5B3SC 1HNXO 1IX9A 2Q6AA 1MNGA 4U7NA 1FFXB 3STLC 4JI8B 2QSAA 4JYCA 1RPRA 3ZMUA 1AI7A 3NXSA 4BWAA 3F7YC 2EINC 4LFBB 2UXBB 2ZE6A 1OCCC 4DV2B 3OW2U 2HHHB 3M99B 3BEHA 4DR1B 4QPKA 2A0LA 4O4JA 2PZSA 4LFAB 2CE4A 4C7UA 4FLUA 1COWG 3BVOA 1FXVA 1E1RG 2GUZA 4O4JB 3G6EV 5IT9N 5JWPA 4IYIA 4TOIA 1TA8A 2QTSA 3CPWU 1XNRO 2L6LA 3CCSV 3ABKB 2GUZB 1NT2B 4ZHQA 2VRZA 3OMAB 3ZN1A 2LGWA 3WB2A 1N34O 1SA0B 4X65B 1GN4A 1KB9F 3THOA 3W7XA 3QTCA 4P30A 2B1IA 4UB6Z 3JASA 5BXZA 2V1DA 3KZIZ 4ZHQB 4JF3A 1QQCA 4YIOA 3F7VC 2WAMA 3T4DA 1W2BU 1E79G 1J5EO 1XMQB 3ZHVA 2UXBO 1G4YB 1WAZA 2Q69A 3X2QC 1H2MA 3SJAC 4DV2O 1VQ7V 2X6CA 3E35A 4NXMB 1YIJV 4O2BA 5L3DA 1G1XB 5IY5B 1WN7A 1XQ8A 4LFCB 4AQYO 4LFAO 4FLYA 3L74H 1IDSA 4O4LA 1JVMA 4GKJB 4X66B 2AHYA 4R8CA 4O2BB 4JI5B 1Q82W 3CXCU 1BMFG 4K8XA 2Y4TA 3E22B 2R9AA 2QKSA 1LNQA 4O4LB 2Q67A 2OT5A 5JVDA 4J42A 2PYLA 4YXWG 1L0LH 4E4EA 1YJNV 2QR4A 5IYBO 4LF6B 4DR6B 4EB6A 3HKDA 4O2AA 4UCOA 2FTKA 1XBLA 3IC7A 5JJNB 5CMUA 3G67A 4G28B 5JVDB 2DE0X 3CRAA 4MVZA 2RMKB 4DR2O 4EB6B 2Z0AA 1DLBA 4O2AB 1JOYA 2A9HA 4WBNA 2JJ2G 1XMQO 2WSSG 4JTDB 4ZKIA 3I5DA 1L1FA 5EZYA 3A8TA 4Z2WA
chains in the Genus database with same CATH topology
3JYCA 4X8AA 2XAHA 1AI6A 4MSWC 5CA3A 3OFNG 3ZMVA 1R3IC 2IH1C 1Q7YW 2JEUA 4JASA 4ZBMA 3ZN0A 4HYOA 3D3IA 4MW8A 2IJHA 2ZR3A 3W7WA 3CCJV 1MABG 4UV9A 4UVAA 3OGCC 3K08A 1WPXA 2JJ1G 1OHHG 3T1CA 1ENVA 2XAJA 2IH3C 2D3OW 1AJQA 2Q68A 4HZ3A 4WFHA 3ETDA 1F23A 3K0GA 4QE7A 5B1AB 5GW7A 3FB6C 1FFTB 3EHBB 4UV8A 4MVOA 1QCEA 4P9PA 1AR1B 3K9AA 2XAQA 3WG7C 1OCZC 3ZCCA 5H6QA 1QR8A 5LHHA 1OCOB 1VQLV 1ROPA 3F5WC 3STZC 2V7QG 5L3BA 3W7TA 1RM1C 1V54B 2K1EA 2XASA 1N8RW 4MS2A 4P2ZA 3ZRXA 1VQ9V 2DYRB 4PA9A 4GX2A 1XL4A 1Q86W 5LBQA 1GKFA 5HFLA 4WFAV 1NVPB 2LFRA 4MVRA 1FXKB 3AG1C 3FYEB 2PI4A 4KFMA 1NVPD 2HG5C 3HB3B 3AG3C 1KC8W 1AROP 1W0KG 2HR3A 4X88A 1YTFD 4GT1A 1MG1A 1M57C 2QE7G 1S0VA 4QNHB 4WF9V 3ETEA 2H8PC 3FB5C 3CCMV 2ITCC 4X89A 3E8HA 2IJIA 3ETGA 1PD3A 3FYIB 3BY6A 1Q81W 1VQ8V 1NBMG 5L3FA 1VQMV 1M1KW 5L3EA 2A79B 2NLJC 2P90A 5FL7G 4CBCA 5KA5A 3AG4B 3QO5A 2IJKA 3RW0A 3SPHA 1TUEB 1PKXA 2OTJV 3E86A 4OXSA 1AJPA 4MT8A 3B8MA 4UXNA 3QNEA 3ASOB 3DTUB 2IU0A 5KUKA 3ZJZA 4L87A 1F51A 2B5UA 2EILB 1S77D 1QLEC 1J95A 1KECA 2B1GA 3HPLC 4RAIA 5B3SB 3ZMTA 5B1BB 2CK3G 3SYAA 2JDIG 3ZRSA 5IDJA 2EZPA 2HVKC 1AI4A 3RVZA 3LDDA 3OM3B 2UXNA 2EIJC 1VQ4V 1BL8A 1I5XA 3R65A 4JGSA 4EKWA 3H01A 1VQOV 2EINB 3JD4A 3CCUV 1OCCB 1K92A 5L3GA 1S76D 5LGNA 4LBEC 3W7SA 2BOBC 1EBOA 2ZQMA 2EZOA 2WLHA 2WLKA 4PA6A 3E2EA 2R9IA 1M56B 1K5QA 3SYCA 2JEXA 1WLEA 2HLDG 1GO3F 3OUFA 4PA7A 4GX5A 2DQ3A 4PDVA 3CCQV 1VQ6V 1S3JA 4H33A 4LCUC 1GTOA 1H38A 2JIZG 2WLJA 3JD3A 4I9WA 4ASUG 2H94A 2Z5UA 1CPYA 1CP9A 1F4MA 3SPJA 2P7TC 2XAGA 4J9ZB 3SPGA 4UVCA 4KUMA 5EBWC 3ML0A 1KD1W 3GB7C 3W7UA 2AHZA 4MTOA 3CD6V 3E8BA 4JAVA 5LHIA 1OCZB 2YEVA 5EBLC 4LP8A 1JQ0A 2WLIA 3OE7G 4BW5A 2F43G 3D36A 3K04A 2HJFC 1GK9A 5KA6A 3CYOA 4GX0A 3SYPA 3IFXA 4FIPC 3ABTA 2EBOA 3RVYA 3LNMB 2XOKG 3AG2C 2ZDIC 3ABMB 1YHQV 3OR6C 2IW5A 3JD1A 3ZRWA 2OCCB 2DYSC 2EJRA 3QO7A 4FJCC 2MK3A 1AI5A 1PNKA 2EIKC 2JK5C 2WLIB 2XNDG 3T4ZA 1GMGA 3E83A 5IYDO 1PNLA 1S5HC 3AG1B 3ABUA 3CMEV 2NNUA 1NQTA 1NR1A 5LHGA 3AG3B 2HVJC 4XDKA 4MW3A 2X0LA 1W0JG 3ZRWB 4QIWF 5L3CA 1YSCA 2Z3YA 1M90W 2ITDC 4TWKA 3X2QB 1KP3A 3CCVV 5B1NA 3CC2V 4Q20A 5B1AC 3RBZA 1CEZA 1QVFU 1H8HG 3ABLB 4JTCB 1QR9A 1QVGU 1VQ5V 1QBZA 5J9PC 2EIMC 5DM6V 4MTGA 1OCOC 2DWDC 3ABKC 4HAMA 2QM8A 3OEHG 1YJWV 4FMTA 5KUMA 2QTOA 1K3EA 1K4CC 3E89A 2C2AA 3SYOA 1NR7A 1G8MA 1DF5A 5EC1C 4G27B 5HFMA 4TT3G 5CBGA 1K5SA 2X6BA 1ORQC 4UVBA 4MTFA 1R3LC 1IXMA 4PDMA 1NJIW 4QE9A 1H8EG 4PDLA 3TK1A 2OTLV 4G2KA 4E2LA 1FXKC 3LDCA 4N23A 2KB1A 4DXWA 2ZR2A 2YSUB 4BIZA 1PL0A 1R6NA 1NKDA 2HFEC 2IU3A 1YITV 1V55C 3ZRVA 2EIJB 4BAYA 1K73W 2ATKC 2W6IG 5EC2C 5B1OA 3ZIAG 4PELA 2X7RB 4WCEV 5IY5C 1OCRC 3B8NA 3OMNB 1B6QA 3T2MA 3SPIA 3K0DA 3G71V 1I5YA 4PA4A 4JAUA 4LC1A 2W0FC 2Y69B 4WFGA 3CC4V 4WFEA 1YI2V 1GM7A 4PDRA 1HWYA 2P6JA 1R6KA 3I55V 1Y4MA 4MVSA 5EBMC 1GM8A 1BHBA 3ASOC 4XDLA 3DGEA 2X6AA 4P9OA 4RO2A 2QA4V 1SRYA 2Y48A 2EILC 3MHSC 1ZWIC 3WFVA 4RQEA 2LFSA 1RPOA 2QM7A 5B3SC 5CN0A 2Q6AA 5BZBA 4U7NA 1MOFA 3KG2A 3STLC 4H37A 4JYCA 1RPRA 4U7OA 3ZMUA 1AI7A 1K8AW 3NXSA 3K79A 2HKOA 3F7YC 2EINC 4KP4A 1KQSU 3WG7B 1OCCC 4JTAB 3AG2B 3LSQA 1BHAA 4UUJC 3OW2U 4MVMA 1SERA 2DYSB 3ASNC 3BEHA 3M99B 3MD0A 1DF4A 3K06A 4TSFG 1M56C 1Y66A 2EIKB 4QPKA 4R7CA 1RM1B 1SETA 2A0LA 2WWWA 2ZXWC 5CBHA 3JCZA 4XBFA 1QLNA 1R73A 1JCHA 1COWG 2YEVB 5CBFA 1YJ9V 4JPRA 3OR7C 3G4SV 1FXVA 1E1RG 3CP1A 3SYQA 1VQNV 4RUFA 3ZMZA 2IJJA 2BOCC 2R9RB 3G6EV 1F4NA 3K3WA 3PJSK 4QJFB 3OMIB 3CCRV 1AJNA 1K4DC 4MTXA 1M57B 3LUTB 2EIMB 3TETA 5DN6G 3CPWU 4MVUA 3CCSV 3CCEV 3ABKB 3OMAB 3ZN1A 4DO2A 3A0RA 4RUEA 1VQPV 5H6RA 2QEXV 3E8FA 3EFFK 1FXKA 1K9MW 3MHHC 5LGTA 2GSMB 3ABMC 3FB7C 4GCZA 1FS0G 3JD2A 3W7XA 2OCCC 4WFBV 4P30A 2B1IA 3LSSA 1P4RA 2V1DA 4GX1A 1V54C 1NH2B 4JF3A 5C93A 1FXHA 3B77A 2WAMA 3F7VC 3OUSA 3I56V 3LDEA 3VBBA 1YTFB 1NH2D 5E1AC 3T4DA 3SPCA 1W2BU 2DYRC 3OEEG 1E79G 1S72V 3AEIA 1GM9A 1PNMA 3K03A 1G4YB 3CMAV 5IYCO 1H2GA 1JPXA 2Q69A 1V55B 3X2QC 1QLEB 1EFRG 3CC7V 1VQ7V 2GHYA 2X6CA 3E35A 1YIJV 1K34A 5L3DA 2LP7A 2DWEC 1OZ0A 3FB8C 2DQ0A 3IGAC 3ABLC 5IY5B 1OCRB 2W6JG 4XDJA 3SJQC 4QPJA 1UJWB 3P32A 4J9YB 1JVMA 2WLMA 4CZZA 2WLLA 3TCUA 1R3KC 2AHYA 3ZMSA 1MSWD 4R8CA 2PI5A 3FKSG 1Q82W 3CXCU 1K97A 2DW4A 1BMFG 2P67A 3UM7A 5H9CA 1SESA 3AG4C 3OAAG 2QKSA 4PA3A 4Z1MG 1LNQA 1JX9A 5LGUA 2Q67A 4FK5C 2WLLB 3CCLV 4F4LA 2OT5A 1P7BA 1KP2A 1E1QG 3E8GA 3JD0A 4N21A 4YXWG 1YJNV 3VOUA 5IYBO 3P30A 5EK0A 2WPDG 1KKDA 4R6ZA 1THZA 3GWOA 1VQKV 4JYBA 2FTKA 3IC7A 5CMUA 4BIUA 3QO8A 1K33A 4G28B 4WFFA 2ZD9A 1EZJA 1R3JC 2WLNA 2UXXA 2XAFA 5B1BC 2ZDIA 3UKMA 1DTOA 1JJ2U 1SZTA 4MVZA 1XL6A 2M7WA 1K7DA 3ASNB 4I5SA 1DLBA 1JOYA 2A9HA 4R50A 2Y69C 2JJ2G 2ZXWB 4FPPA 2WSSG 4MVQA 4RQFA 4JTDB 4ZKIA 1L1FA 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYA A;  3ZRS A;  3JYC A;  4X8A A;  5CBG A;  1K4D C;  1ORQ C;  2HVK C;  2X6B A;  3LDD A;  1R3L C;  3LUT B;  4MSW C;  4MTF A;  1R3I C;  2EIJ C;  4MVU A;  4PDM A;  1BL8 A;  2IH1 C;  3R65 A;  4QE9 A;  4ZBM A;  4PDL A;  4EKW A;  4HYO A;  4RUE A;  3LDC A;  4MW8 A;  3E8F A;  3EFF K;  2KB1 A;  4DXW A;  4LBE C;  2BOB C;  3ABM C;  3FB7 C;  3OGC C;  2WLH A;  2WLK A;  3K08 A;  2HFE C;  2OCC C;  4PA6 A;  3T1C A;  4P30 A;  1V55 C;  2IH3 C;  3SYC A;  2Q68 A;  4HZ3 A;  4WFH A;  2ATK C;  1V54 C;  4GX1 A;  3K0G A;  3F7V C;  3OUS A;  4QE7 A;  5EC2 C;  3FB6 C;  3LDE A;  3OUF A;  4PA7 A;  4GX5 A;  4MVO A;  4P9P A;  4PDV A;  5IY5 C;  3WG7 C;  1OCR C;  5E1A C;  3SPC A;  3T4D A;  2DYR C;  3T2M A;  4H33 A;  1OCZ C;  3K0D A;  3SPI A;  4LCU C;  2WLJ A;  3K03 A;  4I9W A;  1G4Y B;  3F5W C;  4PA4 A;  2Q69 A;  3STZ C;  3SPJ A;  2W0F C;  3X2Q C;  2P7T C;  4WFG A;  4J9Z B;  3SPG A;  4WFE A;  5EBW C;  2X6C A;  2K1E A;  4PDR A;  3GB7 C;  3FB8 C;  2DWE C;  2AHZ A;  4MS2 A;  4MTO A;  3IGA C;  3ABL C;  3E8B A;  4P2Z A;  4PA9 A;  4GX2 A;  4MVS A;  2YEV A;  4XDJ A;  5EBM C;  5EBL C;  3SJQ C;  1XL4 A;  3TET A;  4LP8 A;  3ASO C;  4XDL A;  2WLI A;  2X6A A;  4J9Y B;  4P9O A;  4RO2 A;  4BW5 A;  3K04 A;  2HJF C;  1JVM A;  2WLM A;  3AG1 C;  4MVR A;  2EIL C;  2WLL A;  1ZWI C;  4GX0 A;  1R3K C;  2AHY A;  3SYP A;  3IFX A;  4KFM A;  4R8C A;  3TCU A;  3RVY A;  2HG5 C;  3LNM B;  3AG3 C;  5B3S C;  3AG2 C;  2Q6A A;  5BZB A;  4X88 A;  3OR6 C;  2DYS C;  1M57 C;  3UM7 A;  4QNH B;  2EIK C;  2JK5 C;  2WLI B;  3KG2 A;  4H37 A;  3STL C;  3T4Z A;  3AG4 C;  2QKS A;  3E83 A;  4PA3 A;  1LNQ A;  2H8P C;  3FB5 C;  2ITC C;  2Q67 A;  2WLL B;  4X89 A;  3F7Y C;  1S5H C;  1P7B A;  2EIN C;  4F4L A;  3E8H A;  3E8G A;  1OCC C;  4JTA B;  2HVJ C;  4XDK A;  4MW3 A;  4UUJ C;  3VOU A;  4MVM A;  5EK0 A;  2A79 B;  1KKD A;  3ASN C;  3BEH A;  2NLJ C;  4R6Z A;  3K06 A;  1M56 C;  2ITD C;  4CBC A;  4TWK A;  4R7C A;  2A0L A;  2ZXW C;  3RW0 A;  5CBH A;  4G28 B;  5B1A C;  3RBZ A;  3SPH A;  4WFF A;  2ZD9 A;  1R3J C;  2WLN A;  3E86 A;  4OXS A;  5B1B C;  4JTC B;  3UKM A;  5CBF A;  4MVZ A;  3OR7 C;  1XL6 A;  2EIM C;  5J9P C;  4MTG A;  1OCO C;  5KUK A;  2DWD C;  3ABK C;  3SYQ A;  3ZJZ A;  4RUF A;  3RVZ A;  2A9H A;  5KUM A;  1K4C C;  2QTO A;  1QLE C;  1J95 A;  2BOC C;  2Y69 C;  3E89 A;  2R9R B;  4R50 A;  3SYO A;  4MVQ A;  4JTD B;  5EC1 C;  3PJS K;  3HPL C;  4G27 B;  4RAI A; 
#chains in the Genus database with same CATH topology
 3JYC A;  3RYH A;  3OFN G;  4I55 A;  1R3I C;  1Q7Y W;  1H2N A;  4JI0 B;  4ZBM A;  4IGG A;  4WBN B;  5EZY B;  4L8J A;  1M4U A;  2QJ1 A;  3K59 A;  5KHI A;  3RYH B;  4GKJ O;  4X66 O;  4ZI7 A;  2JJ1 G;  4I55 B;  1ENV A;  2IH3 C;  1YXB A;  2D3O W;  1AJQ A;  5B66 Z;  1YDX A;  1FFT B;  3H1J H;  1QCE A;  3WG7 C;  1Y76 A;  3AK2 A;  4ZI7 B;  4K3A A;  2OYQ A;  2V7Q G;  1W59 A;  5KHJ A;  4DW0 A;  1VF7 A;  5C8Y A;  2K1E A;  1Y76 B;  2OCH A;  1VQ9 V;  2BTQ A;  1Q86 W;  1WP8 A;  3APQ A;  5KHG A;  3JAR B;  3FYE B;  1Q43 A;  5C8Y B;  4KFM A;  4W4K A;  3HB3 B;  4X88 A;  1XMO B;  2BTQ B;  1S0V A;  2Q73 A;  2AGA A;  3CE2 A;  3ETE A;  1SQG A;  3WB0 A;  3L71 H;  1PD3 A;  1AIL A;  3BY6 A;  2EUL A;  1UFI A;  5L3E A;  2A79 B;  2P90 A;  4JI6 B;  4UCV A;  2AZ0 A;  1D5N A;  4OX9 B;  2F4V B;  3B2E E;  4TV9 A;  3SPH A;  2OTJ V;  3E86 A;  4OXS A;  3A0H Z;  2YXH A;  3B8M A;  4K35 A;  3DTU B;  2IU0 A;  2Q7E A;  3L70 H;  1QNM A;  2EIL B;  1IVS A;  4TV9 B;  1AP5 A;  1X4T A;  1GH6 A;  3BA8 A;  2HEP A;  4KXR A;  2JDI G;  2XT9 A;  3SYA A;  5IDJ A;  5JCO A;  1P7G A;  2EZP A;  2JS3 A;  3LDD A;  1VQ4 V;  3ZHR A;  4JGS A;  3H01 A;  5L3G A;  4NYK A;  4CH4 A;  5LGN A;  4LBE C;  2KG7 A;  4GKK O;  2LGQ A;  2HLD G;  5CA0 A;  1KUQ A;  3ZS8 C;  2YIC A;  5LYJ A;  4PDV A;  1WB7 A;  2KG7 B;  1H38 A;  3JD3 A;  1CPY A;  1CP9 A;  3MDS A;  5EIB C;  4KUM A;  3ML0 A;  4JI6 O;  4LF8 O;  1TUB A;  4MTO A;  5LHI A;  2YEV A;  4LP8 A;  3OGI B;  3JAW A;  1SQV H;  1Y74 A;  1GK9 A;  4O4H B;  3K9S A;  3SYP A;  3RVY A;  1YZB A;  4DUY O;  2ZDI C;  2IW5 A;  5KHH A;  3QO7 A;  1PNK A;  2JK5 C;  2XND G;  3T4Z A;  3JAW B;  4PJ0 Z;  3E83 A;  1Y74 B;  1ZL8 B;  3ABU A;  4EFB A;  5LHG A;  2ZNJ A;  1VP7 A;  4LF9 B;  1I0H A;  1SQX H;  4FLT A;  4DUZ O;  3CC2 V;  5B1A C;  1CEZ A;  1H8H G;  3ABL B;  2ILM A;  1VQ5 V;  1QBZ A;  5DM6 V;  1OCO C;  1YJW V;  1NU1 H;  4FMT A;  2YXL A;  1K3E A;  1K4C C;  2C2A A;  4TUY A;  5EC1 C;  4NB5 A;  5CBG A;  3EVK A;  1K5S A;  4UVB A;  2Y4U A;  3ZED A;  4QE9 A;  2PUS A;  1SZX A;  5IJ0 A;  1FXK C;  1IBL B;  4TUY B;  2Q0O C;  1A32 A;  1I94 B;  5E79 Z;  4BIZ A;  4I0X A;  2HFE C;  4ZOL A;  1YIT V;  2O57 A;  1K73 W;  1MMM A;  2W6I G;  5DEC A;  5IJ0 B;  1KU9 A;  4DV5 O;  5EC2 C;  3OMN B;  1B6Q A;  3CSX A;  3SPI A;  2VWJ A;  2ZIO A;  2H3O A;  1H2S B;  1VMG A;  4ZOL B;  2W0F C;  4FM0 A;  4H0L B;  1P84 F;  4K8Z A;  1HWY A;  1N33 B;  1R6K A;  3I55 V;  1GM8 A;  4IT5 A;  1SRY A;  4X20 A;  2YIB A;  2Q0A A;  1XHX A;  3WFV A;  2UUC O;  1RPO A;  2DJV A;  3H1H H;  5CN0 A;  1CXZ B;  5CA1 B;  3U10 A;  4H37 A;  4X20 B;  1SF9 A;  1FJG B;  2YDE A;  1SER A;  1Y6X A;  2IM9 A;  3MD0 A;  2JGU A;  4TSF G;  1M56 C;  1Y66 A;  4R7C A;  4JZG A;  2VQE B;  1N0J A;  2P4K A;  3DXR B;  4JPR A;  3G4S V;  1ZX3 A;  4JYA B;  3SYQ A;  4J41 A;  4RUF A;  1Z5W A;  1FKA O;  2BOC C;  1WB8 A;  3K3W A;  4HBN A;  4JI7 O;  3ZX6 A;  1K4D C;  2RQ6 A;  1M57 B;  3LUT B;  4MTX A;  4NR1 A;  1SS3 A;  4PI2 A;  3Q4H B;  1N33 O;  4DR4 O;  4LWS A;  4RUE A;  3E8F A;  1FXK A;  4GZR B;  3BCC H;  3MHH C;  5KMG B;  4ABM A;  3ABM C;  4GCZ A;  2OCC C;  4WFB V;  2PYJ A;  1R1B A;  2XTA A;  4LWS B;  3D36 C;  5C93 A;  3OUS A;  4I4T A;  3RWR D;  3LDE A;  3VBB A;  5E1A C;  3SPC A;  4JI1 B;  1S72 V;  1PNM A;  1FJG O;  1JPX A;  1QLE B;  1PL4 A;  2ETN A;  4X1K A;  5IYZ A;  3CC7 V;  4LF5 B;  1SQB H;  2DQ0 A;  5LOV A;  2VQE O;  4XDJ A;  3SJQ C;  1GN2 A;  4QPJ A;  1BQ0 A;  3P32 A;  3C3T A;  3JCU Z;  2WLM A;  2WLL A;  5IYZ B;  3ZMS A;  1MSW D;  4B3M O;  2CTW A;  4J11 A;  1MZF A;  4CC6 A;  2VQF B;  2DW4 A;  1HP8 A;  2P22 C;  3OAA G;  4PA3 A;  5LGU A;  2WLL B;  3E8G A;  3JD0 A;  4N21 A;  4GLX A;  1NTZ H;  2P5O A;  3VOU A;  3HKB A;  2WPD G;  1THZ A;  2ZIN A;  3GWO A;  4YJ2 B;  2UXC O;  1YVW A;  3BA9 A;  3VQW A;  2HJD A;  1EZJ A;  2XAF A;  3UKM A;  1JJ2 U;  3U11 A;  1XL6 A;  3AK1 A;  2M7W A;  3D3Q A;  4X1I A;  2UXD O;  3HKB B;  4D6T H;  4DR3 B;  2Y69 C;  2AXT Z;  2P4V A;  1BSM A;  2BE3 A;  3H1L H;  2F66 C;  1M9N A;  4U3F H;  4X1I B;  1AI6 A;  4MSW C;  4LF5 O;  3ZMV A;  3ZN0 A;  4HYO A;  1XRE A;  5K1P A;  3JAM N;  4UV9 A;  4OPA A;  4UVA A;  3DC5 A;  1WPX A;  2Q68 A;  4HZ3 A;  2OIG A;  4WFH A;  1F23 A;  2VQF O;  4UV8 A;  4P9P A;  3K9A A;  1Q6I A;  3ZCC A;  2BCC H;  3CRC A;  5H6Q A;  2CUG A;  1VQL V;  3KKY A;  1N32 O;  1GN3 A;  1US6 A;  1M5I A;  4YIP A;  1RM1 C;  3T1Y O;  4DV3 O;  2DMX A;  2YUA A;  3G80 A;  1XL4 A;  1SQF A;  2R72 A;  3P3P A;  1GKF A;  3K5L A;  1Q6H A;  5HFL A;  1NVP B;  4JI3 B;  1FAF A;  3ZHT A;  1XHZ A;  4JI8 O;  1O9G A;  1KC8 W;  2HR3 A;  1B06 A;  1W0K G;  1YTF D;  4LF4 B;  4GT1 A;  4LFB O;  1MG1 A;  3JAS B;  2H8P C;  2HHH O;  3CCM V;  4BR6 A;  4DR1 O;  5D5Q A;  1DK1 A;  1F7Y A;  4NTW A;  2ZT9 B;  1Q81 W;  1U97 A;  1NBM G;  4JV5 B;  3KCY A;  4CBC A;  1FPO A;  5KA5 A;  4IIJ A;  1AJP A;  3M7M X;  5IWA B;  2V4D A;  3FFQ A;  2GTS A;  2FML A;  1BT8 A;  1GN6 A;  1S77 D;  4CC5 A;  1H2L A;  1KKC A;  3DC6 A;  1V9P A;  4DW1 A;  4IIJ B;  3HPL C;  5B3S B;  2F23 A;  2CK3 G;  1HR0 B;  1AI4 A;  3OM3 B;  2EIJ C;  3B09 A;  4X65 O;  4EKW A;  3UQ8 A;  3C90 A;  3CEI A;  3GVM A;  2EIN B;  3JD4 A;  3CCU V;  1OCC B;  2QKC A;  4JI3 O;  1S76 D;  1LUW A;  3W7S A;  2ZM6 B;  2ZQM A;  2WLH A;  5IJ9 A;  4PA6 A;  3HKD B;  2CAZ C;  1K5Q A;  3SYC A;  4LF4 O;  4OGQ B;  4PA7 A;  3GWK C;  1OV9 A;  2DQ3 A;  1VQ6 V;  4H33 A;  2OWO A;  1NZ6 A;  2CTP A;  3CRM A;  3VQX A;  1GTO A;  4NXM O;  5IJ9 B;  2WLJ A;  2H94 A;  2JVD A;  2Z5U A;  1F4M A;  3SPJ A;  4LFC O;  4D7T A;  3SPG A;  1BE3 H;  1ZSP A;  1JA8 A;  1KD1 W;  4F6R A;  3W7U A;  2AW9 A;  5EYP A;  5EBL C;  4Z1V A;  3HKC A;  5J2U A;  3N2K A;  4I50 A;  4BW5 A;  4JI5 O;  4CH5 A;  2HJF C;  5KA6 A;  2CGO A;  4GX0 A;  1RSO A;  3IFX A;  2EBO A;  1Q90 D;  4F6R B;  2QM4 A;  3B40 A;  3ZRW A;  2DYS C;  2EJR A;  3HKC B;  5J2U B;  2EIK C;  2YID A;  5LA6 A;  4LF6 O;  4DR6 O;  5IYD O;  1HNZ B;  2X0L A;  3ZRW B;  5L3C A;  3OD4 A;  3TGU H;  1M90 W;  4TWK A;  3X2Q B;  1KP3 A;  2ZM6 O;  2QWN B;  3CCV V;  3H9V A;  1Q6U A;  1WPB A;  1XIL A;  3AG7 A;  1QVF U;  1QR9 A;  2EIM C;  4MTG A;  5LL6 Y;  5BMV A;  3OEH G;  4OPH A;  2QTO A;  3E89 A;  4JI0 O;  4YY3 B;  3ZHS A;  3JAT A;  4TT3 G;  3FD9 A;  4MTF A;  4PDM A;  1NJI W;  5BMV B;  1Q3E A;  2OTL V;  4E2L A;  3SDL A;  3JAT B;  4X64 B;  4JZ2 A;  5H5N A;  1PL0 A;  2IU3 A;  2ZNI A;  2YI8 A;  2CTR A;  3TJT A;  5FPO A;  5LXT A;  1V55 C;  3CWB H;  2FYU H;  2EIJ B;  2LJ2 A;  4NKG B;  2ATK C;  3CXH F;  5JJJ B;  1IBK B;  4PEL A;  4WCE V;  2A06 H;  1OCR C;  3B8N A;  5IE9 A;  2ZCE A;  3OT7 A;  1P49 A;  5LXT B;  4JAU A;  2BSK A;  3ZHQ A;  1O9H A;  5TIS Z;  2JRI A;  4B7K A;  4PDR A;  3EXA A;  4A5U B;  2RJZ A;  4NVP A;  4UCS A;  4MVS A;  4JI4 B;  1GAX A;  4YHH B;  3ASO C;  4XDL A;  3DGE A;  4B08 A;  2CGN A;  1XMO O;  2BSK B;  4NTX A;  3ICX A;  1ZWI C;  1I7F A;  3K5N A;  1N0N A;  2YIA A;  5BZB A;  4NTY A;  2K9P A;  3O9O A;  3KG2 A;  5CA0 B;  1K8A W;  4K0K B;  1BGY H;  2HKO A;  4X9Q A;  5LYJ B;  1KQS U;  3WG7 B;  4OX9 O;  2YIB D;  2F4V O;  4JTA B;  4UUJ C;  1SC5 B;  4B7E A;  4MVM A;  2DYS B;  4KL1 A;  1DF4 A;  2MW2 B;  2E76 B;  2EIK B;  4X64 O;  2WWW A;  2ZXW C;  2ARH A;  1YEW A;  4O4I A;  4B3R B;  2R70 A;  1SQP H;  1TUB B;  3JCZ A;  4XBF A;  1ZAU A;  1R73 A;  4DV4 B;  1JCH A;  1B04 A;  3RGB A;  2YEV B;  1HNW B;  1IBK O;  2GBO A;  4HNA A;  1TVK A;  1URF A;  3ZMZ A;  2IJJ A;  5BY1 A;  3JAK A;  2NN4 A;  2R9R B;  4O4I B;  1TGO A;  3PJS K;  4QJF B;  3OMI B;  1Z5V A;  2EIM B;  4PI0 A;  5LMU B;  4ZIB A;  3A0R A;  4JI4 O;  1VQP V;  3EFF K;  1K9M W;  3IC9 A;  2GSM B;  4B3T B;  3FB7 C;  3PN1 A;  4AI8 A;  2QWP B;  2UUB B;  3LSS A;  1NH2 B;  1V54 C;  2GDS A;  3ZBH A;  1FXH A;  3B77 A;  3N2G A;  1NTM H;  2ADQ B;  4CS4 A;  4AIL C;  3APO A;  4D7S A;  4DR5 B;  3AEI A;  1GM9 A;  4K0K O;  3WB1 A;  3K03 A;  3CMA V;  1V55 B;  4J10 A;  1Z2G A;  3N2G B;  1EFR G;  3O65 A;  2Q5Z A;  1PV0 A;  2N74 A;  2LP7 A;  2DWE C;  3IGA C;  1OCR B;  2NR5 A;  4B3R O;  3NR7 A;  1N4C A;  2Q7G A;  2AZ2 A;  4J9Y B;  4DV4 O;  4CZZ A;  3TCU A;  2PI5 A;  4J7K A;  4X1Y A;  4I0X B;  1K97 A;  3BAB A;  1TAE A;  1WA8 A;  5H9C A;  2E3C A;  4LF9 O;  1L0N H;  1BQZ A;  1SQQ H;  2YXY A;  4FK5 C;  3CCL V;  1KP2 A;  3ETQ A;  1E1Q G;  1EN4 A;  1SKV A;  1VF5 B;  4X1Y B;  5BR8 B;  3P30 A;  3RN4 A;  1KKD A;  2KSD A;  4R6Z A;  1VQK V;  1WA8 B;  4FLZ A;  2Y0P A;  1K33 A;  2QDO A;  2N05 A;  4GYC B;  1R3J C;  2WLN A;  2UUB O;  2ZDI A;  1BS3 A;  2UU9 B;  1G6U A;  1QHT A;  3ZHU A;  4I5S A;  4R50 A;  4FPP A;  2ZXW B;  3RFR A;  1IXB A;  3BAA A;  4B3S B;  3A2F A;  3L75 H;  3K57 A;  1IBL O;  2XAH A;  2DOS A;  1I94 O;  2IH1 C;  2QWR B;  3D3I A;  1L8D A;  3UO3 A;  2ZR3 A;  3CCJ V;  2CDY A;  3OGC C;  2A7W A;  3K08 A;  4DV1 B;  4ICG A;  1OHH G;  3T1C A;  2CTQ A;  3CRR A;  3K0G A;  4QE7 A;  5B1A B;  2UUA B;  3EHB B;  4MVO A;  1OCZ C;  2VS0 A;  1QR8 A;  5LHH A;  1OCO B;  1ROP A;  3JSN A;  3STZ C;  5L3B A;  2JGD A;  3W7T A;  1V54 B;  2F93 B;  3P3N A;  1N36 B;  1MZE A;  2XAS A;  4FM2 A;  2Q4P A;  3QG5 A;  2GTA A;  4MS2 A;  4KHP B;  2LW7 A;  3ZRX A;  5B5E Z;  4NXN B;  4PA9 A;  1AR4 A;  2CH7 A;  1YCI A;  5LBQ A;  4WFA V;  2JGD B;  2UU9 O;  4MVR A;  1FXK B;  3AG1 C;  2PI4 A;  1PM9 A;  1NVP D;  2PY5 A;  2HG5 C;  2BTO A;  1IBM B;  1KMI Z;  1T5E A;  2CH7 B;  1HW7 A;  2QE7 G;  4QNH B;  4FVM A;  4WF9 V;  4B3S O;  4I4T B;  1HNX B;  3FB5 C;  4X89 A;  1WNS A;  4DV7 B;  3E8H A;  2IJI A;  1NS1 A;  1VQ8 V;  1VQM V;  4X1K B;  4J7J A;  4JYA O;  2IJK A;  1M93 A;  4DV1 O;  1PKX A;  2WA4 A;  5LOV B;  4MT8 A;  4GUN A;  3QNE A;  1LUV A;  1AVM A;  3ZJZ A;  4LH6 A;  4PD4 F;  2LQT A;  1J95 A;  2B9Z A;  3BHP A;  3S3W A;  3ZRS A;  3RVZ A;  3HKE A;  2UXN A;  1N36 O;  3CB2 A;  4FZ0 A;  5LP6 C;  4KHP O;  1U96 A;  2A3Q A;  3VQV A;  2WA3 A;  1K92 A;  2Y0I A;  2RDC A;  2LO1 A;  2BOB C;  1EBO A;  2WLK A;  3HKE B;  2R9I A;  4JI1 O;  1M56 B;  1IBM O;  1Q8I A;  3BFR A;  3H1K H;  1VF6 C;  1JFF A;  2JIZ G;  4U3J A;  4DV7 O;  4EFE A;  3F5T A;  2P7T C;  2XAG A;  4J9Z B;  4UVC A;  5KHK A;  1AR5 A;  1J5E B;  2AHZ A;  1JFF B;  1OCZ B;  4U3J B;  1XDC A;  1JQ0 A;  2WLI A;  3D36 A;  3K04 A;  3KCX A;  4LR3 A;  1XUQ A;  1BZK A;  3JAL A;  4FIP C;  4AQY B;  3AG2 C;  3ABM B;  1YHQ V;  1R6T A;  2OCC B;  4FJC C;  3B4S A;  5FPR A;  2MK3 A;  1AI5 A;  4IYH A;  2WLI B;  1GMG A;  3AK3 A;  1S5H C;  3AG1 B;  1PP9 H;  3JAL B;  1NR1 A;  4XDK A;  1AP6 A;  3UO2 A;  1W0J G;  1SA0 A;  3CHX A;  1YSC A;  2QGN A;  2RN9 A;  2Z3Y A;  2ITD C;  4Q6G A;  5B1N A;  4DR3 O;  5FLX N;  4JTC B;  1QVG U;  5J9P C;  2DWD C;  4LH7 A;  4HAM A;  4TV8 A;  4IL6 Z;  1VIB A;  1DF5 A;  4G27 B;  4CH6 A;  4DR2 B;  3BRC A;  2X6B A;  1ORQ C;  1IXM A;  1H8E G;  1XI1 A;  4TV8 B;  3TK1 A;  4G2K A;  5LP6 A;  5KX5 A;  4N23 A;  4QGP A;  1JJO A;  2YC0 A;  4DV0 B;  2YSU B;  1R6N A;  1NKD A;  3OTF A;  4BAY A;  5LP6 B;  3E22 A;  5KX5 B;  3N27 A;  5B1O A;  2X7R B;  3T2M A;  2ZIM A;  3K0D A;  3G71 V;  1VF6 A;  1I5Y A;  2FKX A;  3CS5 A;  4LC1 A;  4DK1 A;  4FLV A;  2GV9 A;  3HR0 A;  2Y69 B;  5A2Q N;  3CC4 V;  2QKA A;  3K5O A;  3RT3 C;  2P6J A;  5EBM C;  5FNV A;  2X6A A;  2ZKO A;  2EIL C;  3MHS C;  2LFS A;  4JAA A;  2QM7 A;  1KBH A;  3JSL A;  5FNV B;  1MOF A;  4U7O A;  4JV5 O;  3K79 A;  2ZE8 A;  4KP4 A;  1GRJ A;  1HDJ A;  4JI2 B;  3AG2 B;  3LSQ A;  3IAY A;  1BHA A;  2RCV A;  5JCO C;  4CH3 A;  2YI9 A;  5IWA O;  1B3Q A;  3ASN C;  1MA1 A;  3TXQ A;  3K06 A;  4DV0 O;  1RM1 B;  2PTM A;  1SET A;  3TXS A;  2XUM A;  4TQF A;  5CBH A;  1QLN A;  1FYJ A;  5CBF A;  5EYP B;  1YJ9 V;  3OR7 C;  3UCS C;  3N2K B;  4I50 B;  3CP1 A;  1VQN V;  1HR0 O;  4FLX A;  1RSO B;  1F4N A;  3RYI A;  4UCU A;  2ZE5 A;  3CCR V;  2EX3 A;  4J80 A;  1AJN A;  5JQG A;  3FX7 A;  3S3X A;  3TET A;  5DN6 G;  4MVU A;  3CCE V;  5LA6 B;  4F6E A;  3K58 A;  4DO2 A;  3K5M A;  5H6R A;  2QEX V;  3JAR A;  3RYI B;  1ZUQ A;  5LGT A;  3LNN A;  5JQG B;  1FS0 G;  2JS5 A;  3JD2 A;  1P4R A;  4LNU A;  4GX1 A;  3I56 V;  2ZE7 A;  4GKK B;  1YTF B;  1NH2 D;  2DYR C;  3OEE G;  2KKW A;  3J7A U;  1FD9 A;  4EEQ A;  5IYC O;  1H2G A;  4TQD A;  4JI2 O;  4LNU B;  2GHY A;  1XEQ A;  1K34 A;  2OIE A;  3FB8 C;  1OZ0 A;  3ABL C;  2W6J G;  1XOU A;  1UJW B;  3D8C A;  4I7Z B;  4LF8 B;  3CX5 F;  1R3K C;  5GTI Z;  3FKS G;  3SJB C;  3M8A A;  5J2T A;  4I9Q A;  3SR2 C;  3A0B Z;  2E75 B;  1HNZ O;  2P67 A;  3UM7 A;  1SES A;  3AG4 C;  5DED A;  4Z1M G;  3FAV A;  1JX9 A;  1EN6 A;  3U0Z A;  4DUY B;  4F4L A;  1P7B A;  2XHB A;  2EJ7 A;  2DN9 A;  3SGI A;  5J2T B;  4DV6 B;  5LMN B;  3J80 N;  5K1X A;  5EK0 A;  4JYB A;  3FAV B;  4AHC A;  4BIU A;  3QO8 A;  4H44 B;  4WFF A;  2ZD9 A;  2UXX A;  5B1B C;  1DTO A;  5EIB D;  1SZT A;  4YY3 O;  5AG2 A;  4DUZ B;  4LF7 B;  1K7D A;  1S5J A;  3ASN B;  2Q9L A;  4RQF A;  4MVQ A;  5A9G A;  4X62 B;  2N04 A;  1XNQ B;  4X8A A;  5CA3 A;  4DR7 B;  1WP7 A;  2JEU A;  4JAS A;  1NTK H;  1IUR A;  2YS8 A;  4MW8 A;  4O4H A;  2IJH A;  3W7W A;  3MAQ A;  1MAB G;  5ITZ A;  2RNB A;  5JJE B;  2XAJ A;  3QVN A;  1EM1 A;  1YF2 A;  3ETD A;  5GW7 A;  3FB6 C;  1ZL8 A;  1AR1 B;  2XAQ A;  1MSD A;  4PHZ A;  4DK0 A;  5ITZ B;  2M6Y A;  2P06 A;  3T1H B;  3H1I H;  4HNA B;  1TVK B;  3F5W C;  4DV5 B;  2E5L B;  1I08 A;  1QU7 A;  3JAK B;  1JMK C;  4RWU A;  4DV6 O;  5LMN O;  4YHH O;  1N8R W;  2QWQ B;  4P2Z A;  2DYR B;  4PV1 B;  4GX2 A;  1VEW A;  3VQY A;  3R66 A;  4FM1 A;  2LFR A;  5D5P A;  4LF7 O;  3AG3 C;  1ARO P;  4X62 O;  2LW1 A;  1M57 C;  1XNQ O;  2UUC B;  1JR9 A;  2ITC C;  4DR7 O;  1IZ3 A;  3ETG A;  2F1M A;  3FYI B;  5L3F A;  1RP3 B;  1M1K W;  4UCT A;  2NLJ C;  5FL7 G;  1HNW O;  3C3S A;  3AG4 B;  1Q5O A;  3QO5 A;  3RW0 A;  1TUE B;  1WJZ A;  1KYO F;  5GON A;  4UXN A;  4YJ3 A;  4BIO A;  3ASO B;  3OTO B;  5KUK A;  4FLW A;  4L87 A;  1EZV H;  1F51 A;  2B5U A;  4BW9 A;  4DYL A;  3G6B A;  3T1H O;  3L73 H;  1QLE C;  1KEC A;  5LMU O;  2B1G A;  4RAI A;  2E5L O;  2ODM A;  1H2K A;  3ZMT A;  5GON B;  5B1B B;  3SJC C;  4YJ3 B;  2FL4 A;  2HVK C;  1LR1 A;  1BL8 A;  1I5X A;  3R65 A;  4B3T O;  4FZ1 A;  1VQO V;  4JI7 B;  2QWO B;  2PGG A;  3CRQ A;  4IHJ A;  4DR4 B;  3E2E A;  2EZO A;  4DR5 O;  5CA1 A;  1DGS A;  2JEX A;  1WLE A;  1GO3 F;  3OUF A;  4GX5 A;  3CCQ V;  1S3J A;  4IHJ B;  4LCU C;  4I9W A;  4ASU G;  2L35 A;  5KLV H;  3RYF A;  5EBW C;  1Y67 A;  3GB7 C;  2HP8 A;  3CD6 V;  3E8B A;  4JAV A;  5H2F Z;  3DXR A;  4UCR A;  3OE7 G;  2F43 G;  4DRX A;  1EN5 A;  3CYO A;  3RYF B;  2VWK A;  3OTO O;  1D5A A;  3ABT A;  2Q8V A;  3LNM B;  2XOK G;  4CS3 A;  1ZLZ A;  3OR6 C;  3JD1 A;  2D2C B;  3WU2 Z;  5BR8 O;  4CS2 A;  3Q4H A;  5KAI Z;  4DRX B;  4B3M B;  1PNL A;  4JYY A;  3CME V;  2NNU A;  1NQT A;  2E74 B;  3AG3 B;  5KMG A;  2HVJ C;  4MW3 A;  4QIW F;  3J81 N;  3CJH A;  3QF7 A;  4J7Z A;  4Q20 A;  3RBZ A;  4UB8 Z;  5F2V O;  2KQX A;  3L9D A;  3DSQ A;  2UXC B;  3ABK C;  2QM8 A;  3CJH B;  1RFY A;  3IJ4 A;  1BCC H;  5KUM A;  3SYO A;  1NR7 A;  5GTH Z;  1G8M A;  5HFM A;  1VAR A;  2UXD B;  3LSU A;  1AB3 A;  3UT5 A;  4FFK A;  3RYC A;  1R3L C;  1PPJ H;  2ADP A;  1OJH A;  4PDL A;  5CB4 A;  1UPG A;  3LDC A;  2KB1 A;  4DXW A;  1NI8 A;  2ZR2 A;  2UUA O;  3UT5 B;  1S5L Z;  3RYC B;  4FFB A;  3ZRV A;  5JH7 A;  2Q7H A;  5CB4 B;  3ZIA G;  2IBZ H;  5KAF Z;  5IY5 C;  1D2D A;  3L72 H;  4UFZ A;  1X59 A;  2F95 B;  4FFB B;  2W0X A;  4PA4 A;  4NXN O;  4W4L A;  5JH7 B;  4WFG A;  4YJ2 A;  2FB5 A;  4WFE A;  1YI2 V;  1GM7 A;  1XNR B;  1N32 B;  1Y4M A;  3BPZ A;  1BHB A;  3T1Y B;  2PF4 E;  4P9O A;  1FFX A;  4RO2 A;  2QA4 V;  4H13 B;  1N34 B;  4DV3 B;  2Y48 A;  4RQE A;  2G38 A;  1ZTE A;  5B3S C;  1HNX O;  1IX9 A;  2Q6A A;  1MNG A;  4U7N A;  1FFX B;  3STL C;  4JI8 B;  2QSA A;  4JYC A;  1RPR A;  3ZMU A;  1AI7 A;  3NXS A;  4BWA A;  3F7Y C;  2EIN C;  4LFB B;  2UXB B;  2ZE6 A;  1OCC C;  4DV2 B;  3OW2 U;  2HHH B;  3M99 B;  3BEH A;  4DR1 B;  4QPK A;  2A0L A;  4O4J A;  2PZS A;  4LFA B;  2CE4 A;  4C7U A;  4FLU A;  1COW G;  3BVO A;  1FXV A;  1E1R G;  2GUZ A;  4O4J B;  3G6E V;  5IT9 N;  5JWP A;  4IYI A;  4TOI A;  1TA8 A;  2QTS A;  3CPW U;  1XNR O;  2L6L A;  3CCS V;  3ABK B;  2GUZ B;  1NT2 B;  4ZHQ A;  2VRZ A;  3OMA B;  3ZN1 A;  2LGW A;  3WB2 A;  1N34 O;  1SA0 B;  4X65 B;  1GN4 A;  1KB9 F;  3THO A;  3W7X A;  3QTC A;  4P30 A;  2B1I A;  4UB6 Z;  3JAS A;  5BXZ A;  2V1D A;  3KZI Z;  4ZHQ B;  4JF3 A;  1QQC A;  4YIO A;  3F7V C;  2WAM A;  3T4D A;  1W2B U;  1E79 G;  1J5E O;  1XMQ B;  3ZHV A;  2UXB O;  1G4Y B;  1WAZ A;  2Q69 A;  3X2Q C;  1H2M A;  3SJA C;  4DV2 O;  1VQ7 V;  2X6C A;  3E35 A;  4NXM B;  1YIJ V;  4O2B A;  5L3D A;  1G1X B;  5IY5 B;  1WN7 A;  1XQ8 A;  4LFC B;  4AQY O;  4LFA O;  4FLY A;  3L74 H;  1IDS A;  4O4L A;  1JVM A;  4GKJ B;  4X66 B;  2AHY A;  4R8C A;  4O2B B;  4JI5 B;  1Q82 W;  3CXC U;  1BMF G;  4K8X A;  2Y4T A;  3E22 B;  2R9A A;  2QKS A;  1LNQ A;  4O4L B;  2Q67 A;  2OT5 A;  5JVD A;  4J42 A;  2PYL A;  4YXW G;  1L0L H;  4E4E A;  1YJN V;  2QR4 A;  5IYB O;  4LF6 B;  4DR6 B;  4EB6 A;  3HKD A;  4O2A A;  4UCO A;  2FTK A;  1XBL A;  3IC7 A;  5JJN B;  5CMU A;  3G67 A;  4G28 B;  5JVD B;  2DE0 X;  3CRA A;  4MVZ A;  2RMK B;  4DR2 O;  4EB6 B;  2Z0A A;  1DLB A;  4O2A B;  1JOY A;  2A9H A;  4WBN A;  2JJ2 G;  1XMQ O;  2WSS G;  4JTD B;  4ZKI A;  3I5D A;  1L1F A;  5EZY A;  3A8T A;  4Z2W A; 
#chains in the Genus database with same CATH homology
 3JYC A;  4X8A A;  2XAH A;  1AI6 A;  4MSW C;  5CA3 A;  3OFN G;  3ZMV A;  1R3I C;  2IH1 C;  1Q7Y W;  2JEU A;  4JAS A;  4ZBM A;  3ZN0 A;  4HYO A;  3D3I A;  4MW8 A;  2IJH A;  2ZR3 A;  3W7W A;  3CCJ V;  1MAB G;  4UV9 A;  4UVA A;  3OGC C;  3K08 A;  1WPX A;  2JJ1 G;  1OHH G;  3T1C A;  1ENV A;  2XAJ A;  2IH3 C;  2D3O W;  1AJQ A;  2Q68 A;  4HZ3 A;  4WFH A;  3ETD A;  1F23 A;  3K0G A;  4QE7 A;  5B1A B;  5GW7 A;  3FB6 C;  1FFT B;  3EHB B;  4UV8 A;  4MVO A;  1QCE A;  4P9P A;  1AR1 B;  3K9A A;  2XAQ A;  3WG7 C;  1OCZ C;  3ZCC A;  5H6Q A;  1QR8 A;  5LHH A;  1OCO B;  1VQL V;  1ROP A;  3F5W C;  3STZ C;  2V7Q G;  5L3B A;  3W7T A;  1RM1 C;  1V54 B;  2K1E A;  2XAS A;  1N8R W;  4MS2 A;  4P2Z A;  3ZRX A;  1VQ9 V;  2DYR B;  4PA9 A;  4GX2 A;  1XL4 A;  1Q86 W;  5LBQ A;  1GKF A;  5HFL A;  4WFA V;  1NVP B;  2LFR A;  4MVR A;  1FXK B;  3AG1 C;  3FYE B;  2PI4 A;  4KFM A;  1NVP D;  2HG5 C;  3HB3 B;  3AG3 C;  1KC8 W;  1ARO P;  1W0K G;  2HR3 A;  4X88 A;  1YTF D;  4GT1 A;  1MG1 A;  1M57 C;  2QE7 G;  1S0V A;  4QNH B;  4WF9 V;  3ETE A;  2H8P C;  3FB5 C;  3CCM V;  2ITC C;  4X89 A;  3E8H A;  2IJI A;  3ETG A;  1PD3 A;  3FYI B;  3BY6 A;  1Q81 W;  1VQ8 V;  1NBM G;  5L3F A;  1VQM V;  1M1K W;  5L3E A;  2A79 B;  2NLJ C;  2P90 A;  5FL7 G;  4CBC A;  5KA5 A;  3AG4 B;  3QO5 A;  2IJK A;  3RW0 A;  3SPH A;  1TUE B;  1PKX A;  2OTJ V;  3E86 A;  4OXS A;  1AJP A;  4MT8 A;  3B8M A;  4UXN A;  3QNE A;  3ASO B;  3DTU B;  2IU0 A;  5KUK A;  3ZJZ A;  4L87 A;  1F51 A;  2B5U A;  2EIL B;  1S77 D;  1QLE C;  1J95 A;  1KEC A;  2B1G A;  3HPL C;  4RAI A;  5B3S B;  3ZMT A;  5B1B B;  2CK3 G;  3SYA A;  2JDI G;  3ZRS A;  5IDJ A;  2EZP A;  2HVK C;  1AI4 A;  3RVZ A;  3LDD A;  3OM3 B;  2UXN A;  2EIJ C;  1VQ4 V;  1BL8 A;  1I5X A;  3R65 A;  4JGS A;  4EKW A;  3H01 A;  1VQO V;  2EIN B;  3JD4 A;  3CCU V;  1OCC B;  1K92 A;  5L3G A;  1S76 D;  5LGN A;  4LBE C;  3W7S A;  2BOB C;  1EBO A;  2ZQM A;  2EZO A;  2WLH A;  2WLK A;  4PA6 A;  3E2E A;  2R9I A;  1M56 B;  1K5Q A;  3SYC A;  2JEX A;  1WLE A;  2HLD G;  1GO3 F;  3OUF A;  4PA7 A;  4GX5 A;  2DQ3 A;  4PDV A;  3CCQ V;  1VQ6 V;  1S3J A;  4H33 A;  4LCU C;  1GTO A;  1H38 A;  2JIZ G;  2WLJ A;  3JD3 A;  4I9W A;  4ASU G;  2H94 A;  2Z5U A;  1CPY A;  1CP9 A;  1F4M A;  3SPJ A;  2P7T C;  2XAG A;  4J9Z B;  3SPG A;  4UVC A;  4KUM A;  5EBW C;  3ML0 A;  1KD1 W;  3GB7 C;  3W7U A;  2AHZ A;  4MTO A;  3CD6 V;  3E8B A;  4JAV A;  5LHI A;  1OCZ B;  2YEV A;  5EBL C;  4LP8 A;  1JQ0 A;  2WLI A;  3OE7 G;  4BW5 A;  2F43 G;  3D36 A;  3K04 A;  2HJF C;  1GK9 A;  5KA6 A;  3CYO A;  4GX0 A;  3SYP A;  3IFX A;  4FIP C;  3ABT A;  2EBO A;  3RVY A;  3LNM B;  2XOK G;  3AG2 C;  2ZDI C;  3ABM B;  1YHQ V;  3OR6 C;  2IW5 A;  3JD1 A;  3ZRW A;  2OCC B;  2DYS C;  2EJR A;  3QO7 A;  4FJC C;  2MK3 A;  1AI5 A;  1PNK A;  2EIK C;  2JK5 C;  2WLI B;  2XND G;  3T4Z A;  1GMG A;  3E83 A;  5IYD O;  1PNL A;  1S5H C;  3AG1 B;  3ABU A;  3CME V;  2NNU A;  1NQT A;  1NR1 A;  5LHG A;  3AG3 B;  2HVJ C;  4XDK A;  4MW3 A;  2X0L A;  1W0J G;  3ZRW B;  4QIW F;  5L3C A;  1YSC A;  2Z3Y A;  1M90 W;  2ITD C;  4TWK A;  3X2Q B;  1KP3 A;  3CCV V;  5B1N A;  3CC2 V;  4Q20 A;  5B1A C;  3RBZ A;  1CEZ A;  1QVF U;  1H8H G;  3ABL B;  4JTC B;  1QR9 A;  1QVG U;  1VQ5 V;  1QBZ A;  5J9P C;  2EIM C;  5DM6 V;  4MTG A;  1OCO C;  2DWD C;  3ABK C;  4HAM A;  2QM8 A;  3OEH G;  1YJW V;  4FMT A;  5KUM A;  2QTO A;  1K3E A;  1K4C C;  3E89 A;  2C2A A;  3SYO A;  1NR7 A;  1G8M A;  1DF5 A;  5EC1 C;  4G27 B;  5HFM A;  4TT3 G;  5CBG A;  1K5S A;  2X6B A;  1ORQ C;  4UVB A;  4MTF A;  1R3L C;  1IXM A;  4PDM A;  1NJI W;  4QE9 A;  1H8E G;  4PDL A;  3TK1 A;  2OTL V;  4G2K A;  4E2L A;  1FXK C;  3LDC A;  4N23 A;  2KB1 A;  4DXW A;  2ZR2 A;  2YSU B;  4BIZ A;  1PL0 A;  1R6N A;  1NKD A;  2HFE C;  2IU3 A;  1YIT V;  1V55 C;  3ZRV A;  2EIJ B;  4BAY A;  1K73 W;  2ATK C;  2W6I G;  5EC2 C;  5B1O A;  3ZIA G;  4PEL A;  2X7R B;  4WCE V;  5IY5 C;  1OCR C;  3B8N A;  3OMN B;  1B6Q A;  3T2M A;  3SPI A;  3K0D A;  3G71 V;  1I5Y A;  4PA4 A;  4JAU A;  4LC1 A;  2W0F C;  2Y69 B;  4WFG A;  3CC4 V;  4WFE A;  1YI2 V;  1GM7 A;  4PDR A;  1HWY A;  2P6J A;  1R6K A;  3I55 V;  1Y4M A;  4MVS A;  5EBM C;  1GM8 A;  1BHB A;  3ASO C;  4XDL A;  3DGE A;  2X6A A;  4P9O A;  4RO2 A;  2QA4 V;  1SRY A;  2Y48 A;  2EIL C;  3MHS C;  1ZWI C;  3WFV A;  4RQE A;  2LFS A;  1RPO A;  2QM7 A;  5B3S C;  5CN0 A;  2Q6A A;  5BZB A;  4U7N A;  1MOF A;  3KG2 A;  3STL C;  4H37 A;  4JYC A;  1RPR A;  4U7O A;  3ZMU A;  1AI7 A;  1K8A W;  3NXS A;  3K79 A;  2HKO A;  3F7Y C;  2EIN C;  4KP4 A;  1KQS U;  3WG7 B;  1OCC C;  4JTA B;  3AG2 B;  3LSQ A;  1BHA A;  4UUJ C;  3OW2 U;  4MVM A;  1SER A;  2DYS B;  3ASN C;  3BEH A;  3M99 B;  3MD0 A;  1DF4 A;  3K06 A;  4TSF G;  1M56 C;  1Y66 A;  2EIK B;  4QPK A;  4R7C A;  1RM1 B;  1SET A;  2A0L A;  2WWW A;  2ZXW C;  5CBH A;  3JCZ A;  4XBF A;  1QLN A;  1R73 A;  1JCH A;  1COW G;  2YEV B;  5CBF A;  1YJ9 V;  4JPR A;  3OR7 C;  3G4S V;  1FXV A;  1E1R G;  3CP1 A;  3SYQ A;  1VQN V;  4RUF A;  3ZMZ A;  2IJJ A;  2BOC C;  2R9R B;  3G6E V;  1F4N A;  3K3W A;  3PJS K;  4QJF B;  3OMI B;  3CCR V;  1AJN A;  1K4D C;  4MTX A;  1M57 B;  3LUT B;  2EIM B;  3TET A;  5DN6 G;  3CPW U;  4MVU A;  3CCS V;  3CCE V;  3ABK B;  3OMA B;  3ZN1 A;  4DO2 A;  3A0R A;  4RUE A;  1VQP V;  5H6R A;  2QEX V;  3E8F A;  3EFF K;  1FXK A;  1K9M W;  3MHH C;  5LGT A;  2GSM B;  3ABM C;  3FB7 C;  4GCZ A;  1FS0 G;  3JD2 A;  3W7X A;  2OCC C;  4WFB V;  4P30 A;  2B1I A;  3LSS A;  1P4R A;  2V1D A;  4GX1 A;  1V54 C;  1NH2 B;  4JF3 A;  5C93 A;  1FXH A;  3B77 A;  2WAM A;  3F7V C;  3OUS A;  3I56 V;  3LDE A;  3VBB A;  1YTF B;  1NH2 D;  5E1A C;  3T4D A;  3SPC A;  1W2B U;  2DYR C;  3OEE G;  1E79 G;  1S72 V;  3AEI A;  1GM9 A;  1PNM A;  3K03 A;  1G4Y B;  3CMA V;  5IYC O;  1H2G A;  1JPX A;  2Q69 A;  1V55 B;  3X2Q C;  1QLE B;  1EFR G;  3CC7 V;  1VQ7 V;  2GHY A;  2X6C A;  3E35 A;  1YIJ V;  1K34 A;  5L3D A;  2LP7 A;  2DWE C;  1OZ0 A;  3FB8 C;  2DQ0 A;  3IGA C;  3ABL C;  5IY5 B;  1OCR B;  2W6J G;  4XDJ A;  3SJQ C;  4QPJ A;  1UJW B;  3P32 A;  4J9Y B;  1JVM A;  2WLM A;  4CZZ A;  2WLL A;  3TCU A;  1R3K C;  2AHY A;  3ZMS A;  1MSW D;  4R8C A;  2PI5 A;  3FKS G;  1Q82 W;  3CXC U;  1K97 A;  2DW4 A;  1BMF G;  2P67 A;  3UM7 A;  5H9C A;  1SES A;  3AG4 C;  3OAA G;  2QKS A;  4PA3 A;  4Z1M G;  1LNQ A;  1JX9 A;  5LGU A;  2Q67 A;  4FK5 C;  2WLL B;  3CCL V;  4F4L A;  2OT5 A;  1P7B A;  1KP2 A;  1E1Q G;  3E8G A;  3JD0 A;  4N21 A;  4YXW G;  1YJN V;  3VOU A;  5IYB O;  3P30 A;  5EK0 A;  2WPD G;  1KKD A;  4R6Z A;  1THZ A;  3GWO A;  1VQK V;  4JYB A;  2FTK A;  3IC7 A;  5CMU A;  4BIU A;  3QO8 A;  1K33 A;  4G28 B;  4WFF A;  2ZD9 A;  1EZJ A;  1R3J C;  2WLN A;  2UXX A;  2XAF A;  5B1B C;  2ZDI A;  3UKM A;  1DTO A;  1JJ2 U;  1SZT A;  4MVZ A;  1XL6 A;  2M7W A;  1K7D A;  3ASN B;  4I5S A;  1DLB A;  1JOY A;  2A9H A;  4R50 A;  2Y69 C;  2JJ2 G;  2ZXW B;  4FPP A;  2WSS G;  4MVQ A;  4RQF A;  4JTD B;  4ZKI A;  1L1F A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...