3IC7A

Crystal structure of putative transcriptional regulator of gntr family from bacteroides thetaiotaomicron
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
b'IYLQIADRICDDILLGQYEEEGRIPSVREYASIVVNANTVMRSYEYLQSQEVIYNKRGIGFFVASGAKMLIHSLRKEQFLKEEVGSFFRQLYTLGISIKEIEKMYYEFIQRQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 26
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ic7A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ic7A02
1XGOA 4JK1X 3U2RA 3GYHX 5AONA 1KQ8A 1IXCA 2W57A 1UHMA 3DKWA 4U0WA 5IT9K 2P6TA 1I27A 3VODA 1K6OA 4B09A 1J2XA 1FBUA 2V1XA 2VE9A 1DDNA 4LLLA 2QUFA 4L5IA 5H6QA 2P5VA 1U5TB 3M1EA 3KP3A 1FNNA 4KT5C 3N4MA 2D1HA 3PQJA 4BNCA 4AIKA 1BIAA 1DP7P 3BY6A 1RUOA 3RPQA 3HTSB 1IZ1A 2IPQX 2QENA 1BOAA 5D4SA 5D5VB 1WWXA 4S04A 4M72A 3KLOA 2PMHA 2ZKZA 1I1GA 1ZGJA 1L0OC 2GWRA 2EFQA 4ZZDA 1FP1D 1I5ZA 1G3YA 2BE5F 1MD0A 1Y0UA 4UV9A 2L02A 5TJJA 2FEZA 1REPC 3HSRA 4P5OA 3E35A 1XN7A 3ZMUA 2E7XA 1YYVA 3AAFA 1R5GA 1LQ1A 3VEPA 3PQKA 3Q9VA 4CXFA 3VB2A 2QZ8A 2XKPA 2OU2A 1FZPB 4IRHA 4QWQA 2MA3A 1E2XA 2XAGA 4XLPF 1YLFA 2KJBA 2LKPA 3FF5A 1B59A 1BC7C 4OOIA 2XIGA 3NEUA 2PMUA 5HS7A 4LG0A 2O8XA 5HLHA 2IP2A 1IN7A 3HRTA 2QWWA 1QNTA 1YW8A 3TDZC 3E6DA 4JQFA 1USSA 2K7LA 1B9MA 4I09A 2Q2EA 2XAQA 3SQNA 5CVUA 3E5XA 4EJWA 5LLQA 5F6FA 4LFUA 4UXNA 2WAMA 2DBBA 4AVPA 4UHTA 5JVTA 3V8LA 1UHWA 4L5JA 4A5NA 4PCQA 4RAYA 1JGSA 1PDNC 3B73A 3I64A 1GVJA 4U0YA 4ENMA 4ZYGA 1KQ9A 4GXOA 5DDGA 2A5YB 2BYVE 3I59B 3LAPA 2IA0A 4XLNF 2XGXA 2PLYA 3RKWA 3V7RA 3T1BA 1YTFB 1OYYA 3KFWX 3RPUA 3MCZA 5L3EA 3HRMA 4ZYDA 1QBJA 4IRGA 1ON1A 2EB7A 3E5UA 2ZCWA 4U7BA 5A2QK 4HF2A 4UVCA 3ULQB 4RGXA 3WE2A 3W6KB 1K79A 4EJTA 3I4PA 2OAZA 4MQ9F 1LDJA 2FSWA 2VN2A 5J8CA 4ESFA 1YG2A 2JT1A 3FXUA 3K1MA 2BGCA 3G73A 4I7HA 3CO7C 3I71A 2KKOA 5FLXZ 2ZBKA 3WG9A 3E6BA 3BPXA 3BPVA 2L4MA 3KP4A 4HX7A 2QBYB 2ISZA 1W4MA 3R61A 2EA4A 4WX9A 4HW0A 4LMYA 2RDPA 1ZG3A 2FMLA 4EJUA 4WCGA 1SMTA 3K1NA 2M30A 1A04A 1TQPA 4EJVA 3JAMK 2F5FA 2EA2A 1B4AA 3F21A 5CVIA 1JXSA 3V8KA 2WWYA 1O3QA 1RNLA 2XAJA 1BIBA 3P7NA 3TQNA 4LB6B 2NNNA 1UB9A 2VC0A 4YFNF 1NVPB 4UV8A 2K27A 4RGUA 2Z33A 5E8IA 4HYEA 4D0PA 5K5QA 3QU3A 5ICGA 2ZMEB 3L00A 5DD4A 2C6YA 4LGWA 1W7PD 1LDDA 5LHHA 2A6EF 4BHPA 4HV6A 3WTVC 2M1BA 4LJZF 1MJAA 3I5UA 4CDGA 1RZ4A 5L3DA 2P90A 1AWCA 3HSFA 2AS5F 4IXAA 1ZH5A 5EEHA 3FM3A 2F2EA 1O3TA 3ABUA 2ZJ2A 2A3SA 3F3XA 1HW1A 4IHTA 4HQMA 2ESNA 4EM1A 3VFZA 2D45A 2FU4A 1XSDA 2P7VB 4GYIA 1SD4A 3LA7A 2FNAA 4A0YA 2DI3A 2HOEA 3J81K 3SZTA 4KMFA 2PEXA 4L9TA 3I59A 4G6DA 3GEZA 3P9CA 3FXRA 1PUEE 3GFLA 2JPCA 4OMZA 3FMSA 4KDPA 5AIPA 3DF8A 1P2FA 2P5KA 4KN7X 4ESJA 5DV5A 3GFJA 2HYGD 2XRNA 1OR7A 5H20A 2EK5A 3P9IA 1XGSA 3U9GA 4Q48A 1XDUA 2O3FA 4MEYF 2STWA 3WGIA 5D6EA 3C7JA 1MGTA 1TW3A 2J5PA 5HDNA 1FSHA 2XUBA 1HQCA 4BHBA 3S2WA 5CYVA 4P9UA 1R1VA 3KETA 2KRFA 3RI4A 3PFIA 5E17F 2M5WA 1SMYF 5JR3A 1WQ2A 3TOBA 3E97A 3R6SA 2EFWA 2ZXJA 1U2WA 1YW9A 2QBYA 5K5RA 2GAUA 4G6QA 3D5LA 6PAXA 5CJ9A 3QRFF 2CWEA 3QPHA 4G9YA 3E6CC 2AXLA 3HYIA 1FPQA 1R23A 4HBLA 2WTEA 1DPRA 1ZN2A 4N0BA 2HZTA 1XGNA 2OA4A 1BI1A 1H9TA 3ZMDA 1EH8A 2GXGA 1Z05A 2Z3YA 1T2KA 4CZZA 3SXYA 2VBYA 1F9NA 3JTGA 4OIRF 4BQAA 2ZMEA 1T38A 2H09A 2VONA 3EQLF 2YSRA 3L9FA 1G3SA 1ZRDA 3TDUC 2V79A 3GZ6A 1EH7A 1H9GA 1EV7A 3IWFA 2ISYA 3WTTC 1LNWA 4EGZA 4CGZA 2XAFA 3ZMTA 3M8EA 2JRTA 3ELKA 1LB2A 2DU9A 2WV0A 3KP5A 2VOPA 1R00A 1LEAA 3T8RA 5HDKA 2CW0F 2BV6A 4PZJA 3BZ6A 3LWFA 2P4WA 2R3SA 2ZNZA 4YFXF 3BJOA 2L54A 4K2EA 3I53A 3IL2A 2W85A 3ROUA 3H92A 3WGGA 2BEOA 5LRRA 1ONVA 1IN4A 3F8MA 5LEJA 2K02A 1TLHB 1STZA 2XAHA 3KP6A 5DD8A 3HHGA 1HW2A 1F5TA 2P7CB 3R0AA 1SFUA 3P9KA 2Z9OA 1IW7F 1ZARA 4LK0F 3FMQA 5HLGA 1TW2A 3I58A 4GGGA 1RIOH 1OMIA 5CVRA 1G6NA 2HTJA 3ZMVA 3K1PA 2HTSA 3RTRA 4HLXA 5EEGA 3HHHA 4CO8A 4A2UA 2RNJA 2NS0A 2Y0MA 3WTYC 1KU3A 1U78A 4A5MA 1T0FA 2CO5A 4MHGA 3IRQA 3WTUC 1F1ZA 2DO7A 4Y15A 3ZN1A 5E8GA 2DQRA 3RKXA 4ENJA 2VXZA 4Q5SF 1IN5A 3C3WA 5ILSA 2IVMA 4G94A 5LGUA 5J8FA 1B1BA 4OU0A 2YX7A 1Z6RA 2KIFA 2IJLA 1CGPA 1KYWA 3ZPLA 3LQRA 3CTAA 3B02A 1W5SA 3GLXA 1SD5A 1O7LA 1B6AA 2DFIA 2UZKA 5HOOA 3TO6A 1HSJA 4Q4ZF 1PP7U 1I6XA 5LBQA 2EWNA 5FFZA 2DPUA 2EFPA 4HDUA 1FYMA 3KZYA 3Q5FA 2GXBA 4BYYA 3BWGA 3EYIA 1WSUA 3ZP5A 3KZZA 2DT5A 1R58A 4I0AA 2GQQA 4FHTA 3T8TA 1HXDA 3QP6A 4JBAA 1IXSB 4A6EA 3OOPA 3J80Z 5CLSA 3QU6A 2FA5A 3GF2A 3JSOA 2DK8A 2K4BA 1ZAOA 2PN6A 3CUQA 4WXHA 3GO5A 1BC8C 2JSCA 1TBXA 2W24A 2VT3A 5DUKA 2XHKA 3GX4X 4LD5A 1BI3A 2NYXA 1FY7A 3D3IA 2KJCA 4PGGA 2QQAA 2G7UA 3IKTA 1U8RA 2CGPA 4KUMA 2X0LA 4KNYA 2OD5A 3KE2A 3WU1B 4M9SA 1FBQA 2FXAA 2B0LA 4I01A 4YFKF 1XCBA 3K9TA 1U5TA 1FP2A 2P6SA 1JHFA 1GXPA 2XASA 2QQ9A 5K5OA 3KP2A 1S6LA 3TO7A 3T0YA 2VC1A 4ZH4F 4RB1A 2UXXA 1O3RA 1MKMA 4KN4X 1J9IA 3IC7A 1TQIA 2F5CA 1T39A 1Z9CA 3LQQA 1YTYA 3L2CA 2YR2A 2CYYA 2MD5A 1HKSA 3WGHA 2RGVA 4Y17A 4I98B 2LDUA 3H3ZA 4F7ZA 2RV8A 3F8CA 4A12A 1OKRA 3V7SA 2CQKA 2VOOA 2NNYA 2HS5A 1SFXA 2PQ8A 1DPUA 1NH2B 2VE8A 3F23A 1EH6A 2HQNA 2HWVA 3KEQA 1OPCA 2GZWA 2ZO4A 2YPRA 2FMYA 2PJPA 5ILVA 3FXQA 1KU9A 3Q9SA 4RB3C 5E1XA 1TQMA 2HEOA 4EGYA 3FMRA 3ZMSA 3GXOA 2M87A 3LA2A 3F6OA 2CFXA 2ELHA 2TDXA 4R8HA 1IN6A 4EM0B 3FWEA 2EV5A 5FD6A 2UXNA 5F64A 2EV0A 1FSEA 1GXQA 2RKHA 3HOSA 3F8BA 1IRGA 2FNPA 1J75A 2F5DA 4U88A 1W7PB 3DEUA 4IRIA 5DCFA 4M71A 4YIFA 1ZG5A 4ON0A 2F5EA 5LHGA 1YQAA 4UVBA 1R5HA 5DEQA 2XV4S 4EM2A 3GZ5A 1CF7B 2R7FA 1USTA 1BJAA 4M73A 4CYDA 1JE8A 4MTDA 2VBWA 3DP7A 2LF8A 1QO0D 1SAXA 2LNBA 5KK1A 4IJAA 3T5XA 5D8LB 1R1UA 3TOAA 4P96A 3NRVA 1P4WA 2COMA 2L01A 3C1DA 2FBHA 2D1VA 5E1ZB 5ICEA 4LLGF 2OBPA 4Z2YA 1BI2A 1ZGAA 3F72A 4OIQF 4MQVA 1DUXC 2HDCA 4XRFA 1IN8A 1YS6A 3W7UA 1Z91A 1G4DA 1ODDA 1VTNC 2XKOA 4WXDA 5LGNA 4HX8A 4EQQA 1YO5C 5L3CA 2V1UA 1S7OA 1KYZA 3FX3A 1PP8F 3DPTA 1J59A 3CDHA 2RC4A 4BH9A 3W6JB 5FLXK 3EETA 2ZFWA 5FB2A 5IT3A 4ENKA 3COAC 2J5OA 3WU0A 4HDVA 3HIFA 2LF7A 3QP5A 4LK1F 3C18A 4I0BA 2W25A 3SHFA 4KICA 5LEKA 4KIBA 3F8FA 2IW5A 5ICCA 4KFCA 3HSEA 4RB0A 5LHIA 2GIVA 3F22A 2JTVA 3BJAA 4GO1A 1F4KA 4E70A 1QGPA 1HKQA 1K7AA 4GYGA 5BPIA 5E1WA 2IRFG 2GA1A 3IKVA 1T6SA 5FO5A 1FC3A 4GCVA 4RB2C 1J7KA 2K4JA 4IPAA 3FZVA 3CLOA 3HOTA 5GW7A 4ESBA 3TGNA 3QPTA 4M6XA 2ZNYA 3BROA 5D8KB 2YU3A 4ASNA 3BJ6A 2ETHA 5JHUA 3FHZA 4Q47A 1S29A 5HS8A 2FQ3A 1O7FA 1TNTA 1WRJA 3E5QA 1RI7A 5ICFA 3EDPA 2OZ6A 1XCVA 1U6GA 4Y13A 3GVAA 2P8TA 1HSTA 5CVVA 2DK5A 2DW4A 1HBXG 3IWZA 2ADUA 2A61A 3V8JA 2E1CA 1CF7A 2JZYA 4CICA 2G7HA 3JTHA 1ON2A 5L3GA 4HF0A 4I2OA 5CVJA 4UNOA 5HDGA 2STTA 1P6RA 1Q1HA 4MNUA 1FOKA 5HLIA 3KP7A 2PFBA 3MEXA 3E3VA 1FWZA 4PDKA 3LSTA 4L9VA 2QLZA 4AIJA 1R22A 4RGSA 3WTZA 1IF1A 2VODA 2MLGA 5BS6A 3SFZA 3GFMA 3MAJA 4L0ZB 2Y48A 5BQTA 3N97A 3KCCA 1YW7A 3K69A 3GUDA 1LVAA 3I0TA 1RUNA 1V3FA 3ECHA 4N9IA 2O0YA 1YS7A 1UCRA 1AOYA 3KLNA 1KU2A 1H0MA 4O5VA 4L18B 4CHUA 1C0WA 2A68F 1NHAA 5D5WB 4M6YA 3DPLC 4ENNA 4BHCA 5ED4A 2WC2A 3O6BB 3SZPA 5L3FA 2YX4A 4RS8A 4XSZF 5DYMA 3HUGA 1ZLJA 2PG4A 1WKMA 5JFRA 5FFXA 4WXCA 3G3ZA 5A2QZ 1QZYA 5BOXA 2KIMA 4S05A 3RJPA 2P5LC 4XBFA 5D5UB 5LRSA 3OV8A 4IHSA 1S8NA 2Z5UA 3V7CA 3RYPA 1SD6A 4HF1A 4ZYEA 4LB5A 4OMYA 2Q0OA 5CA3A 2Y75A 2UWMA 5F1RA 1KU7A 4XSXF 2G9WA 5D6FA 5JI6A 2H94A 1LEBA 5E20A 3MQ0A 1X3UA 4WWCA 3KEOA 5TRDA 4KA4A 5H6RA 2MH2A 1ZREA 2M45A 4KIGA 4N9HA 1XB4A 4IVNA 1ZG1A 1MJBA 3GW2A 3GWZA 3O2PE 3HRUA 1UFMA 4RAZA 3W7TA 4U7DA 2OZUA 5D4RA 4ETSA 1D5VA 2VT2A 1SFEA 4KMUX 3JAMZ 2DPDA 1HW5A 3K2ZA 3V4GA 4HQEA 4M9ZA 4BXUA 4OIOF 4HV5A 4ZYHA 1TNSA 2HKXA 3RIRA 1GHCA 2EFNA 1BM9A 1MZBA 4A6DA 1ZRFA 2O61A 4HLYA 1J0RA 3LFKA 1P92A 1R1TA 2H6CA 1LJ9A 2EFOA 3I54A 4B8XA 3IRRA 2IA2A 1B9NA 1K78B 1R7JA 1U3EM 2FRHA 5DUIA 3EYYA 1FYLA 3ML6A 3DQVC 1XSVA 2QYOA 5HVQC 1QPMA 3CUQC 1D3YA 4WF2A 2HR3A 2KIUA 3CUOA 2HKOA 1G3TA 1IAWA 1FYKA 2O6GE 3MFKA 2ACJA 3ZN0A 3ECOA 4G7ZF 3F6VA 1ZHFA 3H3UA 2A07F 5AIQA 2JPBA 5D5XB 2O03A 1XD7A 2RQPA 2FF4A 1D8KA 3J7AO 1V4RA 3TKYA 2QM3A 5J6XA 3J81Z 3E6MA 3WTXC 1L3LA 2MLKA 1QQIA 3BOQA 4P55A 4WK8F 4OIPF 2H27A 1BBYA 1G3WA 2D2WA 4DNCA 4QLCU 3CJNA 1I1SA 1U5TC 4ZZLA 2HFHA 2PBIA 2XVCA 5L3BA 4O3MA 1S3JA 2FOKA 1BN5A 2QQBA 3W7WA 4R79A 3QAHA 1Z7UA 1D8JA 4HZFA 2CG4A 1BI0A 3R60A 4DQ2A 3JSPA 2R7DA 4FX4A 3R0JA 1TTYA 2GA2A 1YIOA 3R4KA 3MZHA 3K0LA 2DTRA 3RYRA 1O3SA 3BP8A 3DXJF 2E1NA 4NQWA 4UUVA 2FBKA 5DCMB 4FT8A 3HRSA 3J80K 1XSXA 2IA1A 2OQGA 3ZMZA 2M8EA 3F8NA 5BPDA 1ZLKA 4EVIA 4M74A 4G7OF 5ILUA 1KQ0A 1IRFA 2DLLA 5HS9A 3HTUA 4G7HF 4MTEA 3WTWC 4NB5A 4IF4A 5KVRA 1IXRC 5BMZA 2V6CA 1FBSA 2IT0A 5E18F 3EUHA 4KIFA 1O57A 1T98A 4M9XA 3GFIA 3ISPA 4RGRA 5FD5A 1S7AA 3MWMA 3WODF 1FLIA 1K78A 4L9NA 3ERED 3ABTA 4AWXB 1LDKB 1ULYA 3O3KA 1MDMB 2ESHA 2K86A 4U0VA 4NHJA 2QVOA 4AD9A 2E7WA 2FE3A 3CO6C 1FX7A 2BBYA 3NQOA 3VOEA 1J5YA 3RDIA 4AIHA 2EV6A 4H0EA 4KYWA 4MEXF 2NRAC 1E17A 4UVAA 3FM5A 2EJRA 4HA8A 3LAJA 2LSOA 4HOBA 5FGMA 4YIIA 2VBZA 5IT9Z 4L0YB 3W7XA 2H6BA 2A6HF 1XMAA 1JHHA 4FX0A 3QOPA 4LLNA 1XDSA 4O6JA 3WTSC 4BAYA 2X4HA 2FBIA 3D0SA 1KGSA 3DV8A 3LA3A 2DAOA 3M8FA 2MC3A 3DFGA 2RVCA 1Z6TA 3M7GA 4HAMA 1HKTA 1MJ9A 4EV0A 3MZYA 2VBXA 4G8XA 2MBFA 2OQRA 3TO9A 4PGHA 4R1HA 2XROA 1FT9A 1IUYA 2MH9A 4I02A 2HYFA 2L4AA 2RN7A 4OINF 3W7SA 4TV7A 1XGMA 1QZZA 4A0XA 2V1DA 1OYIA 1SD7A 5DCMA 4YG2F 1ZRCA 2NAZA 5K1YA 1YFHA 2A69F 2PI0A 2Z99A 5ERIA 2HGCA 3L09A 2HQRA 1W7PA 3ZQ7A 1W5TA 2L3DA 5LGTA 1KA8A 1OYWA 1WI9A 2V9VA 3U1DA 4MGRA 1R36A 1P4XA 1ZYRF 3IHUA 2CSOA 3WE3A 2DQLA 3L7WA 4A0ZA 3RKYA 4HX4A 3JW4A 1Z1DA 4LG0B 4P9FA 1RM1C 2Q8KA 4L9JA 4EJOA 1P4AA 3M9AA 1MDMA 4EMSA 3CUQB 1XMKA 3REOA 3BDDA 2W84A
chains in the Genus database with same CATH superfamily
1XGOA 2L7ZA 1MA1A 1SQBH 3ZOBA 4JK1X 3U2RA 5JJNB 1DK1A 3GYHX 4J10A 1ZELA 3FKJA 2PY5A 5LMNB 1Z0XA 1O4XA 3KCYA 1SERA 3FBIB 4JI6B 4G27B 3TW7A 2Z1DA 5AONA 2R93J 1K83J 3A0HZ 4F93B 5CPRB 1KQ8A 3UO2A 1IXCA 3SYQA 4JGSA 2W57A 4DV0O 4IKFA 1UHMA 3DKWA 1QA6A 4U0WA 2JMWA 5KAIC 5M3FJ 2HOTA 1IO2A 2P6TA 3BR0A 5IT9K 3ABMB 1I27A 2A05A 1SQGA 3TP3A 1ENVA 2WLIA 2P4VA 3VODA 1K6OA 4HNVA 1RR8C 5LA6A 4B09A 3ZQIA 1D0XA 1J2XA 1FBUA 2ODMA 2V1XA 3WB0A 2CMPA 2VE9A 1YJWI 1DDNA 2OCCB 2JN6A 2M8GX 1ZR4A 2JS3A 2PF4E 3B8MA 3CB2A 4NDLA 4LLLA 1X4PA 1P7GA 5HNFA 1G8MA 4LF9O 1R5ID 1QLNA 3Q0UA 1VQ8I 2QUFA 4L5IA 4OWRB 4FLUA 1UHSA 2CDYA 5H6QA 2HNHA 4PJMA 2P5VA 5M5XJ 1U5TB 3M1EA 3KP3A 1FNNA 4KT5C 3N4MA 2B9SA 5K1PA 2ZXWH 3GTOJ 4BWAA 4JYYA 2D1HA 2NVQJ 3BG3A 2JIZG 3DC6A 4R6ZA 2DN9A 3PQJA 4BR6A 1DP3A 4F52A 1N75A 2EZKA 4FCYA 4BNCA 4JYCA 5LOVB 4IHJB 4UCVA 2AHZA 1VF6A 4AIKA 5E79Z 2KSDA 1BIAA 3VYUB 3N2GA 4MO7A 2WSSG 1U96A 1DP7P 5C8YA 3BY6A 4IIJB 4MVZA 2BTOA 2X1CA 1DLBA 4DR3B 1RUOA 3OYDA 3RPQA 3HTSB 4D5FA 1IZ1A 2IPQX 1NK2P 4DR1B 4GKKO 3HJEA 3SFIA 2CJJA 2QENA 3CF5F 2PJRB 4PJJA 1JFFA 5GTHC 2ZE7A 3KCXA 4GX0A 1P84F 3FB5C 4LBEC 5E1AC 4OX9O 1BOAA 5H5NA 3EFFK 2IU3A 5D4SA 4NVPA 3K59A 1AILA 5D5VB 1WWXA 4MVRA 1RSOA 3I55I 1YHQV 3A4CA 4DW1A 3PO3J 2ZXWC 3C3SA 3CMEI 1AR4A 1SVLA 1Y56A 4S04A 3HDDA 2DE0X 4M72A 4J19A 4BKXA 3KLOA 3AK3A 2R70A 5IYBJ 2NOGA 2LP0A 2PMHA 2VKDA 2ZKZA 1I1GA 3QODA 1WN7A 1OHHG 3MHSC 3ZBHA 5J2UA 4D7TA 1MMNA 1J5EO 3GTQJ 3LFUA 4U7NA 1ZGJA 5LP6C 1V55B 3CEIA 1JA8A 3E8GA 1L0OC 2GWRA 1FD9A 2IBZH 2EFQA 2IJJA 4B08A 2KPMA 4ZZDA 1FP1D 1I5ZA 1A31A 3CCJV 1G3YA 3M07A 4X0GA 1E3OC 2YXLA 2BE5F 3GTLJ 4I4TA 2P81A 4DR2O 1MD0A 1Y0UA 3JCZA 4DJAA 4IOCF 5B5EZ 3FK7A 4UV9A 4DR1O 2L02A 4BGDA 5TJJA 2FEZA 2F1MA 1REPC 2XHBA 1AROP 2BW3A 1V9PA 1PL0A 4LF8B 3HSRA 4P5OA 3VQXA 3E35A 4G2KA 2KFDA 2ZB9A 4UUTA 3ABLH 1NZ6A 3KG2A 3G71I 4JX5A 1WP8A 3ZHUA 3AG4B 2MFZA 5FRNA 1XN7A 3PUBA 3QQAA 2JA7J 3ZMUA 4N21A 1ZTRA 1ETXA 2E7XA 1YYVA 2AXTC 3AAFA 1R5GA 1YZBA 3VOUA 3WG7B 1LQ1A 4CCKA 5JLWA 3OYFA 2UUZA 3VEPA 3IP4B 2RCVA 1WJEA 2HXOA 2DA4A 3PQKA 4QGPA 2O5RA 3OGCC 3Q9VA 4CXFA 3VB2A 4F92B 4K0KB 1RESA 2LD5A 2F4OB 2QZ8A 2XKPA 4DBQA 1W59A 4XRSG 3DTEA 2YI8A 2OU2A 1FZPB 4IRHA 4QWQA 1OCZB 1ZTEA 4F6RA 1FXKA 2MA3A 3JRFA 1TA8A 5K7HA 2GOXB 5FKKA 5HODA 3LSMA 3S17J 2VQFB 1VQLV 1E2XA 5JHFA 4U3FH 1I08A 4E2LA 4QPKA 2PMZA 4NTYA 2DOFA 3PJRA 2F93B 3ABLC 4D5CA 2JGDB 3W7UA 4DR6O 2XAGA 4XLPF 1YLFA 4H4KC 3BAAA 4NTWA 4KHPB 4GRIA 4JTCB 1OCPA 2ZINA 2KJBA 4ITVA 2LKPA 3FF5A 3S32A 3CWBH 2Y30A 4J7JA 3S1RJ 3M7MX 3O8HA 3JAKA 1B59A 4ABZA 4LF4B 4AI8A 2KQRA 3F5TA 3JATB 2EIJB 1BC7C 2W1OA 4N4OB 4OOIA 1MSFC 2XIGA 2AHYA 2M2EA 3NEUA 5H2FZ 3W3CA 2PMUA 2JDIG 4J41A 5HS7A 4LG0A 3K10A 4J7ZA 4DR7O 2ZKOA 1R3LC 1QZEA 2O8XA 5HLHA 1KQSU 1SVOA 4A3KJ 1IUFA 2IP2A 1IN7A 3LOCA 3HRTA 2QWWA 1QNTA 4F3QA 1YW8A 4HSRA 4A3FJ 2IH1C 4CYCA 3TDZC 1YJ9V 4AVZA 2R5ZB 3TETA 3E6DA 1W36D 5F0HA 4DV6B 2NN4A 4JQFA 3CCUI 5DM7F 2DT7B 3G4SI 3CCEV 1USSA 2K7LA 4Z6YA 4DIQA 4A3GJ 1B9MA 4I09A 2Q68A 3RW0A 2CQNA 1T95A 2Q2EA 1FFXA 2XAQA 3SQNA 2QM4A 2YICA 5CVUA 2EZIA 3E5XA 4EJWA 3OYCA 2D2CB 4TOIA 3K03A 1UG0A 2HHHB 2DA1A 1VQ7V 2VB6A 3OMYA 5M5YJ 1S5HC 2LBFB 5LLQA 5F6FA 4ICGA 2A3QA 2EZPA 4LFUA 4JZ2A 2R7UA 2DMPA 2M4KA 4UXNA 3DLLF 3ETEA 4PA9A 2WAMA 2DBBA 4AVPA 4UHTA 5JVTA 2M3AA 1YOVB 2CQXA 3RZDJ 3V8LA 5EBWC 1UHWA 4DYQA 4MW3A 4L5JA 4A5NA 2OIEA 4PCQA 2EIKH 2W6JG 1DTOA 1TVKB 4RAYA 2F48A 2B1IA 2YEVB 2HVQA 2YIBA 2ZXHA 1JGSA 1VQ5I 5LEKA 3ZQHA 2DOAA 1MOFA 1PDNC 4BBRJ 1XOUA 3B73A 4JTDB 4FISA 3I64A 1GVJA 4BL0B 1UJ8A 3BR6A 4P2ZA 1N32O 3RYHB 3MN2A 4U0YA 2QWQB 1MMSA 4ENMA 4DW0A 4ZYGA 1YIJI 2CV0A 1KQ9A 1X4OA 4GXOA 5KA5A 1OCCB 1XMOO 2VKHA 5EZHA 3PL8A 1HOMA 1M93A 5DDGA 3L9DA 1EM1A 2A5YB 3O65A 2BHZA 2BYVE 3I59B 5LMUO 3LAPA 1H2MA 3CJHB 2YC0A 2IA0A 4XLNF 5A2QN 1HW7A 4F91B 1UPGA 1OCOH 1TWCJ 2XGXA 2PLYA 3QO5A 4HPQA 2EIKC 3RKWA 3V7RA 5LOVA 3T1BA 1YTFB 2O7OA 3DU5A 4JX4A 1JKRC 1BHBA 1OYYA 3KFWX 5EYRA 3RPUA 3MCZA 1SQVH 5L3EA 1VQ8V 3HRMA 1QPIA 1YRNB 2WBMA 1B72B 4HRIA 4U3JB 4LF5O 4ZYDA 1VQNV 1AA7A 1MMMA 2V7FA 1QBJA 3T1CA 1MBHA 1GAXA 4IRGA 3U1KA 2G0EA 1ON1A 2X6AA 2QKMB 2EB7A 1UZCA 3E5UA 1NI8A 2DYRB 2QGNA 1RP3B 4IL6C 2PJRA 1N8RW 2KMUA 4XKCA 2ZCWA 2CQ7A 3TGUH 4U7BA 2BHYA 3FBNB 3DXRB 3OSGA 5A2QK 1WCMJ 1I0HA 2AZ2A 1EA3A 1QCEA 4JI3O 4XLFA 2RNBA 2EX3A 3CC2I 3DTUB 4HF2A 4UVCA 3ULQB 4RGXA 3WE2A 3W6KB 1GT0C 1K79A 4EJTA 2EILH 2GBOA 4FZ1A 3I4PA 3DU6A 3VYSB 4PELA 5KMGB 1M5IA 1OCOC 4E7ZA 4E7IA 2OAZA 4MQ9F 3F7YC 1LDJA 4BE2A 1E1QG 1NR1A 4PI2A 2X48A 2FSWA 3HOYJ 4JI6O 4BUPA 1OFCX 3ESWB 4B7KA 2EIMB 4RQEA 1YJNV 2VN2A 3DBRB 5FKMA 4DYRA 5J8CA 4JOMA 1NH3A 1QHHD 1R49A 3B4SA 4ESFA 3KZIC 2BY2A 2LY2A 3SJQC 1F43A 1YG2A 4XLCA 2JT1A 1XI1A 3FXUA 3K1MA 2BGCA 1K34A 3BVOA 4C3JJ 4I7HA 3G73A 5IYCO 3CMEV 1FIPA 2F4VO 3O9OA 1Y4MA 2NLJC 4CBCA 5B3SB 5CA0B 1HR0B 2W4SA 2UUBB 3CO7C 4PDRA 3I71A 2KKOA 1S76D 2L5QA 3I5DA 4NXNB 4JYAB 3NR7A 4BBSJ 5FLXZ 1GUUA 1LFUP 2ZBKA 3JARB 3H0GJ 4ZJZA 3M8AA 4JI3B 1E0EA 3WG9A 5J4YA 2F43G 3E6BA 5F0FA 3BPXA 3JAMN 4DV7O 2HOSA 3BPVA 2L4MA 3KP4A 3MZ8A 4HX7A 2QBYB 3CJTB 3CC7I 3HKZA 2VS0A 2ISZA 2JS5A 4J9ZB 2QWOB 4GCZA 2X7RB 1W4MA 5GTIZ 4AQYB 3R61A 2EA4A 4WX9A 4HW0A 4LMYA 2PI5A 5KLVH 2RDPA 2LMDA 3K58A 1ZG3A 3EUAA 2FMLA 4EJUA 1MMDA 3PSIA 4WCGA 4RLQA 3HG9A 4LG3A 3BABA 1NU1H 1SMTA 3K1NA 2M30A 1A04A 4CCNA 1S5LC 1TQPA 4EJVA 2VLAA 4MTXA 3DSQA 5D5QA 1H2SB 2WLMA 3K3WA 3QNEA 2VQEB 3JAMK 2F5FA 3CXCU 4DR5B 2EA2A 1B4AA 3F21A 3GTJJ 3ICXA 3RYCA 2GUZB 2DWEC 5CVIA 1JXSA 2ID6A 1MIJA 2CRGA 3V8KA 1MBJA 3TMOA 2WWYA 1O3QA 2P22C 1RNLA 1I3QJ 3ZQGA 4FTHA 2XAJA 1BIBA 3P7NA 2A79B 3JRCA 4DV0B 2KDOA 3TQNA 1TT5B 3QG5A 3T4ZA 1A36A 3IAYA 4LB6B 3E8BA 2NNNA 3F9KA 3KYDB 1UB9A 1WVRA 2VC0A 4YFNF 1NVPB 4XMYA 3JRDA 1XG1A 4RLFA 5CQGA 2Z2SB 4GLXA 2JSPA 2E2HJ 3VWBA 4UV8A 1RPRA 2K27A 4RGUA 2Z33A 5E8IA 2K3PA 4C3IJ 2CTRA 2DMXA 4E7HA 4P9PA 4LF9B 4BE1A 3FYEB 1PUFB 1V5FA 4BIUA 1G59A 2CV2A 1QHTA 4HYEA 4D0PA 5K5QA 1RM1B 2LQTA 1SVMA 1JCHA 2ZD9A 2V4DA 3QU3A 4I99C 2R5ZA 1O9HA 4J7KA 4HEA2 5ICGA 4OXSA 1Q7YW 1TUBB 2ITDC 5EJCA 3HKDB 2ZMEB 3CJRB 3L00A 4V2FA 5DD4A 2C6YA 2V6EA 4CH3A 4LGWA 4P9OA 1W7PD 2Q7HA 2DOEA 3N05A 3JD1A 1LDDA 3HOWJ 5LD2C 1VQ6I 5LHHA 2A6EF 2CU7A 2LG4A 1JKPC 1MABG 4H44B 2ZC2A 2LBFA 2M0CA 2E1OA 1W36C 1AJQA 4GKKB 4BHPA 4KT6A 4HV6A 3A03A 4PSWA 4U87A 3HOZJ 1EF4A 1BMFG 4AU7A 3L72H 3WTVC 3CCUV 2M1BA 4LJZF 1MJAA 3I5UA 1FXHA 4CDGA 1I50J 1RZ4A 3J81N 5L3DA 3BG6A 1RFYA 2P90A 1AWCA 3HSFA 1JUPA 2XB5A 1L1FA 2AS5F 4IXAA 1ZH5A 3G67A 2GXAA 1FOYA 1U8BA 5JLXA 1TVKA 2A0LA 4K0KO 2Z16A 3CCYA 1Z21A 3FM3A 2F2EA 4NNJA 5EEHA 1Y39A 1O3TA 3ABUA 2ZJ2A 2A3SA 3VPRA 3P3PA 3OTFA 3HKCA 5JVDB 1RPWA 3F3XA 1N0JA 1HW1A 4IHTA 2Q1ZB 2VJ4A 4HQMA 1EBOA 1XBLA 2ESNA 4EM1A 4LF6O 1J5EB 3VFZA 2D45A 2MYSA 2FU4A 1XSDA 2P7VB 2L6LA 3JALB 4GYIA 1SD4A 3LA7A 2FNAA 5KUKA 4A0YA 2DI3A 2V1NA 2HOEA 3J81K 4DOZA 2PX9A 1BL0A 4A93J 3SZTA 4KMFA 2R7TA 2PEXA 4L9TA 5IP6A 1A5JA 1KMIZ 2BTQB 3I59A 4HBNA 1HNWO 1VQ5V 4G6DA 2LKSA 5DN6G 2EZOA 3CJHA 3GEZA 4DR2B 2B9ZA 3P9CA 3K2AA 2WB1N 3FXRA 5TISC 2P6JA 3MKWB 4I50B 3RYIB 2ZFUA 3GFLA 1PUEE 4MS2A 3QOEA 2DJNA 3H3VK 4MW8A 1JTYA 5EZYB 2JPCA 3H1KH 4JI5B 1Y8RB 2ZCEA 1IGNA 3QWLA 2L7FP 4QSHA 1TWGJ 4OMZA 5BNGA 4WFFA 2QR4A 1HNZO 2A9HA 3FMSA 2LO1A 3QO8A 1YRNA 4U3JA 5CN0A 1B72A 4KDPA 1U9NA 3BTJA 3FB8C 4I5SA 5AIPA 1XHXA 3DF8A 1P2FA 1Q3EA 1W0JG 3CX5F 2WWWA 2EINH 5KHIA 4EEFG 2P5KA 4KN7X 4ESJA 1BW5A 5DV5A 2WA0A 3DTKA 3GFJA 4DYCA 1SC7A 2HYGD 2XRNA 4DXWA 1OR7A 1R3KC 1DGSA 5H20A 2IS1A 1Y1VJ 2EK5A 3P9IA 4X1IB 3RGBA 4ZI7B 1XGSA 1M9NA 3U9GA 5GAEJ 3VYRB 4Q48A 1YHQI 2MD0A 1XDUA 4XKVA 2Y0PA 5C3EJ 2E75B 2DMUA 2O3FA 4CS3A 5B66C 1SQXH 4RUEA 5KMGA 3JASB 2ZXWB 4MEYF 3CYOA 2STWA 2BY0A 2HXIA 3WGIA 3H1CA 2K9SA 5DEDA 4IQJA 3PSFA 3C7JA 5D6EA 1HWYA 2ZIOA 3IGAC 5F2VO 4LFCO 1MGTA 4BU2A 3CJQB 1TW3A 2JUGA 2KRCA 3F7VC 4XDLA 2TRTA 2BZTA 2J5PA 5HDNA 1N33O 1FSHA 1XL6A 4X1EA 2EULA 2IGOA 2COBA 1HQCA 2F4MB 2XUBA 5LP6B 4BHBA 2D5VA 4X66O 4BY7J 1QU7A 3K4KA 1MBGA 3S2WA 1TAEA 5CYVA 3CCJI 2EINC 2ITCC 3ASNB 4P9UA 1YXBA 3SPCA 2CGNA 1R1VA 3KETA 3OS2A 2JVGA 3CRAA 4I9WA 2KRFA 4XLHA 5CA0A 1UELB 3PFIA 3RI4A 2IEKA 5E17F 1D2DA 3K08A 3CC4V 4DR7B 1NG6A 2M5WA 3OT7A 3RYFB 4JI1O 1SMYF 2IXSA 1WQ2A 3TOBA 5JR3A 2E2JJ 3JARA 2KHMA 3E97A 2R4GA 4OGQB 5FKNA 3R6SA 2EFWA 1IXBA 2ZXJA 3FX7A 1U2WA 1YW9A 1OCRH 2HPMA 2QM8A 4XKWA 1W0KG 2QKCA 2QBYA 3DTIA 5K5RA 1CPYA 2A06H 1NJIW 3H36A 2R7XA 2QWNB 4JI2O 3TP0A 3FXOA 2GAUA 4ZYAA 1V5EA 2BVLA 2BY1A 2VASA 1ETKA 3OS1A 4G6QA 3TEDA 1JUMA 1XTAA 1GN4A 1FOWA 5KX5B 4A3DJ 1JKQC 3D5LA 6PAXA 4V19K 5CJ9A 3QRFF 2CWEA 4X64B 3QPHA 4G9YA 4YELA 1UMQA 4O4IB 5JJJB 1VQOV 2WAFA 3QYEA 4H0LB 5FLMJ 2JRIA 3CC7V 3E6CC 4BY1J 5H9CA 1SRYA 4UCUA 2DDBA 2AXLA 2GUZA 3HYIA 4B3MO 3A0HC 1D1AA 4PFPA 3I4NJ 1R9TJ 2MW2B 2DXIA 3ABLB 1FPQA 3APQA 1OCRC 2QTOA 3QVNA 1EN5A 1R23A 2E71A 1E3PA 4HBLA 1GTOA 2OWOA 5LFAA 4CA0A 2ECCA 1DPRA 2WTEA 1ZN2A 4N0BA 2HZTA 4GX1A 1XGNA 4C9YA 2OA4A 3W6VA 1BI1A 1Y76B 3A2KA 2ZE6A 1XUQA 4J80A 1N0NA 4K3AA 1H9TA 3LSPA 3ZMDA 2IGNA 4FLZA 1EH8A 2GXGA 1YCIA 1XMOB 3T1YO 3WU2Z 1AR5A 4FLTA 2E5LB 2KZVA 1R6RA 1Z05A 2XF7A 2Z3YA 1PUFA 2Y4TA 3BA8A 4X88A 1T2KA 4CZZA 4QIWF 3OR1C 3SXYA 4CC6A 1YJ9I 3H1LH 2VBYA 4NC6A 3JD4A 2E35A 1F9NA 4AYBA 1F23A 3JTGA 4OIRF 3CCEI 4XRMA 4NBQA 5KAFZ 1HR0O 4BQAA 1PNKA 2ZMEA 1T38A 2H09A 2ZSHB 2VONA 1VMGA 4YIPA 3JD0A 3EQLF 4DUYO 2YSRA 1NK3P 4O4HB 4NXNO 5E79C 4JYAO 3L9FA 1G3SA 1R6NA 3H9VA 4AC0A 2F4VB 2IS2A 1ZRDA 4RMNA 2XGCA 3TDUC 3BTLA 2V79A 3S3NA 1G6UA 3GZ6A 1EH7A 1US6A 1Y74A 1H9GA 4K8XA 2QSAA 4CCLA 2CAZC 4XOPA 4AUXA 2LW1A 1EV7A 2K3FA 2W82A 1N77A 3IWFA 4QE9A 2X6OA 2AO9A 5JH7B 2AGAA 2DYSH 2R7SA 3D8CA 1U0JA 2ISYA 2ME0A 2Y69H 3HBLA 3WTTC 3GVMA 4XQFA 1LNWA 3ZRGA 3AKZA 3B6CA 2KKWA 2WLLB 3GB7C 2RMKB 4EGZA 3ZQCA 2JA5J 4CGZA 3MHHC 4PA6A 2XAFA 1WA8B 1AJNA 4X1YB 2WLJA 3GTGJ 3ZMTA 2CW7A 5B1BH 3OYBA 3M8EA 3LSSA 2JRTA 4YRVA 5C4JJ 1HLVA 4I55B 4BQNA 3BR3A 3ELKA 4NC7A 1WJDA 1LB2A 2DU9A 2P4KA 5BXZA 4JI7O 4PJ0Z 2WV0A 5JVDA 3L2WA 1GO3F 1IURA 3KP5A 3VYTB 2VOPA 3S3WA 1R00A 3CCQI 1LEAA 3T8RA 1A32A 1IZ3A 4P30A 3TK1A 2VQEO 4ZC3A 4DR5O 1KUQA 3H5NA 3LSIA 1WHUA 3BZKA 2H8WA 5HDKA 3QTCA 2LP7A 4I0XB 2CW0F 2BV6A 3ZHTA 5IYZB 1VQ9V 4PZJA 1GV5A 3BZ6A 3IH4A 3LWFA 4HNTA 2P4WA 2QCOA 2R7QA 3UNGC 2BTQA 1K8AW 2R3SA 2ZNZA 2XPWA 2DFEA 2FYUH 2LRDA 4UCRA 5LXTB 3FIWA 2N74A 4YFXF 3BJOA 3PIPF 2DYSC 3T2MA 2Y69C 1LVKA 2XPUA 4I50A 3GBGA 2L54A 5B5EC 3BC8A 2AQFA 2ILMA 3PUFA 5EZYA 3RYIA 3FXMA 1NG7A 4K2EA 4JI4O 3I53A 3IL2A 2EIKB 4BACA 5B1BC 4EFEA 2X1DA 2W85A 2YI9A 3ROUA 3H92A 3WGGA 1HCRA 3WHCA 4DV7B 2VKVA 1M4UA 2BEOA 3G80A 2JA8J 1XEQA 1VQNI 3CMAI 5LRRA 5J47A 1ONVA 1IN4A 3F8MA 2QWRB 3V42A 5LEJA 2YIBD 3CE2A 4UFZA 3SYCA 2K02A 2M6YA 1TLHB 2V9PA 4LNUB 1STZA 2HQ5A 1K97A 2O8KA 1BR2A 2KRHA 2XAHA 1MNEA 3H35A 3KP6A 5DD8A 2FB5A 3HHGA 2YXYA 3L70H 4JX6A 4ZI7A 2OCEA 1HW2A 1F5TA 3FYIB 2HYJA 2P7CB 3R0AA 1SFUA 1H2GA 3P9KA 3S3MA 1FS0G 2Z9OA 3TXSA 1IW7F 1DU0A 2XPVA 2IJHA 2XT9A 3JASA 5EG0B 1ZARA 4LK0F 2GDSA 3FMQA 1OCOB 3KEYA 5J1UA 2N8GA 5HLGA 1TW2A 1WH5A 3I58A 3ZXSA 4D7MA 4BJ6C 1X1CA 2ZXIA 4GGGA 1YJNI 1W0UA 3CCSV 4I9QA 2HDWA 1EZVH 3UKGA 3HB3B 1YI2V 3SEQA 4XLAA 3OYHA 1RIOH 4QPOA 1OMIA 5LP6A 3VQWA 5CVRA 1G6NA 1PPJH 2BCCH 1Z3YA 1K4SA 1SS3A 1GK9A 2HTJA 3C2GA 3RPUD 1Q81W 2E19A 1TWFJ 3ZMVA 3K1PA 2LY9A 1JVMA 1RC9A 1YF2A 4F4LA 2HTSA 1HDJA 3LL7A 3RTRA 4HLXA 5EEGA 4PDVA 3HHHA 4CO8A 4XNFA 2F5VA 2RNJA 4A2UA 1FFTB 5H2FC 2NS0A 3Q3SA 2HOAA 1VQ4I 2CUJA 1TUEB 2Y0MA 3QPLA 3WTYC 1KU3A 1U78A 4LP8A 4A5MA 3RYFA 2X6BA 2LKXA 2EILB 1T0FA 1I6HJ 2L0KA 2CO5A 4MHGA 3IRQA 3SPJA 2LFRA 3WTUC 1VF6C 1F1ZA 2DO7A 1ETYA 4J42A 4Y15A 5J3LA 3ZN1A 1G4YB 5CBHA 4O2AB 5E8GA 3J7YJ 2P06A 2NVUB 2DQRA 3RKXA 5LYJB 4B3AA 4ENJA 2XGDA 1N4CA 2VXZA 2LC2A 3U21A 4Q5SF 5EGOA 3UM7A 4JI5O 5KX5A 1IN5A 3C3WA 1SAUA 5IP9J 4OPAA 5ILSA 1LKXA 4DGWB 2IVMA 1T56A 4G94A 3CCVI 1BSMA 1H8HG 3B8NA 4QJFB 3ZQFA 5LGUA 1B1BA 5J8FA 4JF3A 4OU0A 2YX7A 3BQYA 1Z6RA 3CMYA 1ZGWA 4UCOA 4BQQA 1M57C 1WP7A 1XX5A 1T5EA 2KIFA 1EJ9A 2IJLA 1CXZB 1CGPA 1ZUQA 1TZLA 4KP4A 1IBMB 1MH4A 3LSUA 4DV2O 2JK3A 1D0YA 1KYWA 3ZPLA 2IJIA 3LQRA 3CTAA 1F7YA 1T08B 3B02A 3OMNB 2HI3A 1W5SA 4KITB 3AEIA 5EBMC 2HVSA 3GLXA 1SD5A 4NTXA 1O7LA 2UUCB 2GHYA 3Q0WA 1B6AA 2CK3G 3FKSG 2DFIA 2PZSA 2UZKA 3SJAC 2Q73A 5HOOA 3TO6A 1HNXO 1HSJA 1MMGA 5BMVA 4Q4ZF 4XN0A 1PP7U 1I6XA 1ZWIC 4LF6B 1JT6A 5LBQA 2EBIA 1FPOA 3AG1H 2EWNA 2G38A 5JQGB 4I76A 5FFZA 2DPUA 2EFPA 4HDUA 1FYMA 2FKXA 2Q0OC 1WPBA 4FM1A 3KZYA 1JKOC 1HC8A 1SESA 4B3RB 3PNYA 3N27A 3Q5FA 2GXBA 3NARA 4BYYA 1HNWB 3BWGA 1PVEA 3EYIA 1WSUA 5EIBD 3ZP5A 4TV8B 1FOXA 4B3RO 3SEZA 4IQ4A 4IX7A 3H9JA 1FMVA 3KZZA 2DT5A 1R58A 3OYMA 4I0AA 4RUFA 2GQQA 2JA2A 4FHTA 3T8TA 3VQYA 3ZIAG 2OF7A 4O4HA 1HNZB 1HXDA 2L7KA 4XORA 4FETA 3OM3B 4DZJA 2Q69A 2IU0A 2ZIMA 1IDYA 1D1BA 3QP6A 4JBAA 2WB1A 1JT0A 1VARA 3AG1C 1IXSB 4A6EA 4V2GA 3OOPA 4AIDA 5CLSA 3J80Z 3ZHQA 5CA1B 3K9SA 4JAAA 1TGOA 3QU6A 3CLQA 5E3NA 5EDNA 2FA5A 4JYKA 2KZGA 3GF2A 3JSOA 3IV5A 1EN6A 2K9PA 5JH7A 1IBLB 2DK8A 2PN6A 1ZAOA 2K4BA 2WLLA 1ZL8B 2XSDC 3CUQA 1I5XA 1MMAA 4WXHA 3GO5A 1WA8A 4X1YA 1BC8C 2JSCA 3LDEA 1MSEC 1Q6IA 2VQHA 4I55A 4X62O 1TBXA 2VPLA 2DCEA 1ZX3A 3SJCC 2W24A 4X64O 2FOWA 4LFCB 3IFXA 1K73W 2VT3A 5DUKA 4B1RA 2ELKA 2RAEA 2XHKA 2CE4A 4LR3A 1M90W 3GX4X 4LFAB 4LFBB 4LD5A 4DK0A 2Q6AA 1BI3A 4GT1A 4I0XA 2NYXA 1N33B 2HPIA 5IYZA 2LK2A 2ZJQF 3UT5B 4X66B 1FY7A 2L9SA 2KJCA 2C2AA 2H3OA 3A2FA 4PGGA 3D3IA 3L71H 4AHCA 1XNQO 2QQAA 4PJNA 4M3GA 1AP6A 2G7UA 3Q4HB 1PP9H 3GWKC 3IKTA 1U8RA 2CGPA 4B48A 1IDZA 4KUMA 3IC9A 5D5PA 4CC5A 2ADPA 5LXTA 4R7CA 2X0LA 3B6AA 4MIMA 2OD5A 4KNYA 3TBIA 3AG2H 4U7OA 3CCQV 2R0QC 3KE2A 3WU1B 1IJWC 3BEHA 1RKTA 3AFHA 2Y0SA 1M56C 4M9SA 4JI1B 1FBQA 1X1PA 2FXAA 2B0LA 4I01A 2E5LO 1BL8A 1FMWA 1A6IA 4A3EJ 4D1QA 2OCCH 1F4NA 4YFKF 2WAQA 3ZGKA 2GSMB 4MVUA 1UFIA 1XCBA 4JI2B 1AR1B 3K9TA 1U5TA 5GTIC 1FP2A 2XDVA 1WJBA 4JAUA 2P6SA 5F1JA 4J00A 2Q7GA 3IUOA 1JHFA 3KYLA 2FX0A 1IG7A 2R7WA 1GXPA 3GWOA 4N4NB 3U10A 2XASA 3K70D 3S3OA 3JRIA 2QQ9A 4IHJA 2DMQA 4DV3B 5E3OA 1XQ8A 4ZDPA 3KP2A 5K5OA 1F36A 4GKJB 1S6LA 4IIJA 3AG2C 3CMAV 2XF6A 1MNDA 3TO7A 1MG1A 3T0YA 4XL9A 3JRGA 1WJZA 2OTJI 2ATKC 3NWTA 3S16J 1Z7LA 2VC1A 4B3MB 4ZH4F 1OQYA 2BXYA 3OYJA 3BRCA 3KPHA 3OUFA 2ME6A 1S72V 2HU9A 1P7JA 4E7JA 1GM8A 2Q7EA 3QYFA 4RB1A 1JOYA 3L2RA 1KP3A 3JCUZ 2UXXA 3ZRVA 2OCCC 1M1KW 2FQ4A 1F4MA 1O3RA 1MKMA 4KN4X 3TXQA 4NYKA 4C3HJ 1EFRG 2EINB 4PI0A 4II2A 2VQCA 1J9IA 5J9PC 3VBBA 3H9GA 4CSWA 2OT5A 2WLHA 3IC7A 2JGUA 2ZSIB 1TQIA 2F5CA 1T39A 2Q67A 1Z9CA 1IV6A 3LQQA 1HDPA 2OCHA 1IXMA 3CC4I 4A3LJ 1VQKV 1WB7A 2F6CA 4E7KA 3RZOJ 3PN1A 3T1YB 4F55A 1YTYA 1LE8B 3L2CA 2YR2A 3AL0C 2MGQA 2JK5C 5DM6V 3H5RA 4ZDLA 2P0WA 3BG9A 2L9VA 2CYYA 5FLXN 2MD5A 2QJ1A 2DJIA 2CS3A 3EVKA 2IJKA 3P3NA 3RBZA 3T1HO 3HGGA 4IZZA 1HKSA 3WGHA 1R4MB 3LMMA 4O2AA 1MNGA 1W1WE 2RGVA 2X9DA 3PM1A 4I98B 4Y17A 2VL8A 5LYJA 4DUYB 1VQ4V 4OAZA 4LF7O 2FTKA 2X6WA 2LDUA 4J11A 3H3ZA 4F7ZA 2RV8A 3F8CA 4YIRX 3C2BA 4MVQA 4A12A 4ZBMA 1OKRA 3V7SA 4X1KB 2CQKA 2XRLA 4XIDA 1JR9A 2ZNIA 1VQOI 2VOOA 4I6ZA 2LREA 2NNYA 2HS5A 3QPSA 1MW7A 4DV1O 3JYCA 1SFXA 4A3BJ 5ITZB 2PQ8A 4FFBB 2WADA 1DPUA 3HKEB 1NH2B 2VE8A 3F23A 1EH6A 3BTCA 5IJ0B 1KONA 2R7RA 1LPQA 1Y67A 3I9V2 3OL4A 1T33A 2HQNA 2GLOA 2HWVA 3KEQA 1MBKA 1OPCA 1X1DA 1X58A 5E3LA 1XDCA 3GTPJ 2ICWG 1OCRB 2IGKA 2W0FC 1QLEB 3CCVV 1SA0B 2GZWA 2ZO4A 3M4OJ 1PNMA 4JI7B 2YPRA 2FMYA 4ZOLB 3BHPA 5FKOA 2PJPA 2HVKC 3L2UA 1R6TA 3OR6C 5ILVA 3FXQA 1KU9A 2VUMJ 3OYNA 3Q9SA 4RB3C 2KQXA 4MTFA 5E1XA 5KA6A 1TQMA 5JQGA 2VIXA 1D0ZA 1GLNA 1Y66A 5IYBO 4UUSB 3G1LA 2HEOA 3QYBA 5IY5H 2GIZA 3E8HA 1OCZH 3JREA 3LSGA 3ZCOA 2JGDA 4EGYA 3BA9A 3M1CA 3FMRA 1FXVA 3ZMSA 3MKZA 1DU6A 3GXOA 2E1MC 1D1CA 2M87A 3F6OA 3LA2A 3OIOA 2ETNA 2CFXA 4M3EA 2GM4A 3H1IH 2ELHA 2QE7G 1XMQB 2TDXA 2B63J 5GADJ 4X89A 2M7BA 3JATA 4DK1A 4CUGA 2A5WA 3IH3A 1TC3C 4JI4B 1XS9A 1SZTA 4R8HA 1QQCA 1IN6A 1URFA 3N2KB 5JCOC 2KDZA 4EM0B 5GAHJ 2X51A 2Y9YA 3L1PA 3FWEA 3C2HA 2HEPA 2EV5A 5FD6A 2ARHA 3RVZA 3LNMB 4IHYA 1VIBA 3DCFA 4FM2A 1RPOA 2UXNA 5IJ9B 5F64A 2EV0A 1FSEA 1LR1A 1GXQA 3HKBB 4IL6Z 5EIBC 3SGIA 5KHGA 1ROPA 1VQPI 3OY9A 3A8TA 1I39A 2RKHA 2Y4UA 2E5NA 1V5GA 3F8BA 2L2OA 3HOSA 5IY5C 3E8FA 4D7NA 3SDBA 1OCZC 1Z5WA 1IRGA 2FNPA 1J75A 1NVPD 1RETA 1QR8A 2F5DA 2EZHA 2VKEA 4U88A 4A69C 4O4LB 1K4TA 2NOJB 4IHXA 1W7PB 1PNLA 4TSFG 3ZRSA 3DEUA 4IRIA 4MSWC 1FJGO 3FB6C 2UXBO 2XSJC 3OE7G 5DCFA 4M3DA 3JSNA 2VJ5A 4M71A 4YIFA 1ZG5A 4ON0A 2LGWA 2F5EA 5LHGA 1P7BA 2AQEA 1YQAA 4UVBA 4FK5C 1R5HA 5DEQA 3K5MA 1IBMO 2XV4S 4CH6A 3RWRD 1MZEA 2ZDIA 4XM3A 4EM2A 1VQ9I 4WFGA 3GZ5A 1ITYA 2P67A 2VXDA 1CF7B 3UT5A 5B1AH 3L75H 2IAIA 3EUHC 2R7FA 5C4XJ 2UUAO 1USTA 2K1EA 2YEVA 3Q4HA 1XNRO 1VQMI 4HYOA 1BJAA 3DWLE 4M73A 4WBNB 2UUCO 4CCJA 4RQFA 4PK4A 2IM9A 5EC1C 5KHKA 3LSHA 2DYSB 2Y69B 3RSNA 3DBLB 2FL4A 4CYDA 3RYHA 1K5SA 3X2QH 1JE8A 2CV1A 4MTDA 2MG4A 2B1GA 3N2GB 1BJZA 3ETDA 1LUVA 5CMUA 5B1BB 1W0TA 5HNHA 2ZM6B 2X6YA 1I94O 1JJ8C 3O8GA 2VBWA 3DP7A 2LF8A 3OYAA 2NR5A 3IJ4A 3H0DA 1QO0D 1SAXA 2LNBA 5KK1A 4B4CA 2VI6A 4BJTA 2PMZN 4H13B 2XNDG 1H38A 5K7FA 4IJAA 3T5XA 1D5YA 4OPHA 5DECA 2DMTA 5D8LB 5AG2A 1MBEA 1R1UA 1S5LZ 4M6VA 4GYCB 1WI3A 5B1AC 3G1MA 4P96A 3TOAA 3NRVA 3RCOA 3MKLA 1P4WA 4Q20A 2COMA 2L01A 5J40A 3C1DA 4LITA 4E4EA 2FBHA 4B7EA 1YITV 2D1VA 5E1ZB 5ICEA 5FLVA 1YX3A 3OYEA 4LLGF 2OBPA 1GVDA 4XONA 2YSUB 1WPKA 2KISA 2NXNB 3X2QC 5LMUB 3A0BZ 3S14J 4Z2YA 1BI2A 2QKSA 3BCAA 4DV2B 1ZGAA 2X6CA 3F72A 4RAFA 4D9JA 3CCSI 4OIQF 1Q6HA 2JA6J 2NS8A 4MQVA 1P7IA 1DUXC 3CF2A 3NAUA 1YI2I 2HDCA 4XRFA 3DXRA 3K70C 5LA6B 2HG5C 3G6EV 1IBKB 1IBLO 1IN8A 1YS6A 2RREA 3K4NA 4HG2A 2OV7A 1Z91A 2DYRH 5M3MJ 1OCCC 1G4DA 4W4LA 2XB0X 1WJCA 1NT2B 1ODDA 4OAYA 3H1JH 1HNXB 4MTOA 1VTNC 3BR1A 2HFEC 2XKOA 4WXDA 1P4RA 3HXLA 1R3JC 2OTJV 2OPTA 2QDOA 4WFEA 4JV5B 2R5YB 2F23A 1QVGU 2LOOA 1WFXA 5LGNA 4HX8A 4LFAO 5EEAA 4EQQA 1YO5C 1U9OA 3WU2C 4LFBO 1K5QA 1ETOA 4DR4O 1THZA 1XC5A 5L3CA 4TUYB 3ZRWB 1TT0A 1BHAA 2V1UA 1S7OA 1KYZA 4UCSA 3FX3A 4JP0A 1AKHB 1PP8F 5GPCA 1QU3A 3DPTA 4XLEA 2ZJRF 4BE0A 1J59A 2R9IA 3CDHA 2RC4A 4YEJA 4BH9A 4LIUA 2DA7A 3W6JB 5FLXK 1FTTA 1GN6A 1NKDA 1R6KA 3S2HJ 2B5UA 3EETA 3K4BA 2LR8A 2R92J 3B09A 1IC8A 3AK1A 5KAFC 4PHZA 5FNVB 2YS9A 2NS7A 2ZFWA 5FB2A 5IT3A 4ENKA 3S1MJ 4L87A 2GV9A 3ABKH 3HUGB 3LSRA 2DYRC 5EYPB 3COAC 1VF5B 3J7AU 5DM6F 4GX5A 5J4VA 1JFFB 1QHGA 2J5OA 3WU0A 2XGEA 2WA3A 4JI8B 4HDVA 3OSFA 1BCCH 4X1KA 4JI0O 1BR1A 5A9GA 3HIFA 2RN9A 4UB6Z 2LF7A 3FD9A 2IBDA 3QP5A 1SZXA 4YHHO 4LK1F 4Z2WA 3C18A 5J1RA 1M57B 2E3CA 2UXDO 4I0BA 2W25A 1S9HA 4KICA 2VQLA 4KIBA 2E60A 2IW5A 3F8FA 3SHFA 5ICCA 5DS9A 1KP2A 2DQ3A 4FFBA 2DFHA 4KFCA 5IYDO 3HSEA 4DUZO 1UJWB 3CSXA 5K7ZA 4LOCA 4LWSB 2I5UA 4QNHB 4RB0A 4AM3A 1K4CC 5LHIA 1SQFA 2GIVA 3F22A 3CRMA 4DV3O 2JTVA 3BJAA 3ERMA 4GO1A 4MFEA 4E70A 1QGPA 1DQUA 1F4KA 1SA0A 1HKQA 2GBYA 1K61A 1ZLZA 4LCUC 4X62B 1K7AA 1AI6A 4GYGA 4TV9B 4W4KA 4TQDA 5JJEB 1N34O 4GKJO 1FTZA 2UU9O 5BPIA 3ABKC 5E1WA 4TT3G 2IRFG 1I5YA 2GA1A 3RKQA 3IKVA 1WLEA 1T6SA 5FO5A 3DBHB 4UUSA 4EEQA 1GRJA 2PGGA 1FC3A 3K4CA 3OMAB 2JWTA 3OUSA 5CBGA 1XNQB 4GCVA 4IEJA 5IP7J 1L0LH 3BPZA 4RB2C 1J7KA 4X9QA 1BQZA 3THOA 2K4JA 4IPAA 1OJLA 3FZVA 3B77A 1Q86W 1XPXA 3CLOA 2QEXV 2F95B 1JUSA 4J01A 1R3IC 1Z5VA 3BG5A 3BTIA 3IH2A 4ESBA 3HOTA 3TGNA 3QPTA 4M6XA 1JX9A 1NTZH 5GW7A 2GTSA 1LUJB 4A5UB 3BG7A 2WLKA 2CTQA 4A3CJ 2Q0AA 2ZNYA 3N2KA 3K4LA 1JQ0A 3BROA 5D8KB 2YU3A 2L35A 4ASNA 3BJ6A 2ETHA 2VJJA 5JHUA 4RM2A 3FHZA 3L73H 1A35A 1BW6A 5FJ8J 3UCSC 4Q47A 1IDSA 4DW6A 1S29A 5HS8A 3D3QA 2LVSA 2FQ3A 5CB4B 2CH7B 1ZKGA 1AHDP 1O7FA 3OR7C 3F0CA 4LC1A 5B66Z 1TUBA 1TNTA 2K9MA 1DGWY 4BIZA 4PSXA 3HKDA 1WRJA 3E5QA 4YXWG 1IVSA 1RI7A 3JRHA 1FEXA 1Z2GA 3B2EE 3CDIA 1KKDA 5ICFA 4M3BA 3EDPA 2OZ6A 1XCVA 1U6GA 1B04A 4Y13A 3GVAA 4LH7A 1HA8A 4NXMB 2P8TA 1HSTA 2BOCC 1FKAO 3CDLA 5CVVA 1I7FA 3ZQQA 1S77D 5CQEA 2DK5A 2PYJA 2DW4A 1HBXG 1VQPV 3IWZA 1SQQH 2ADUA 1H2KA 2F66C 3SJMA 2QWPB 3FXKA 2UXCB 2A61A 4G12A 3V8JA 4ZTJA 3SPGA 4DV5B 2MW8A 2E1CA 3CCRV 3LSKA 3HKZN 1CF7A 2JZYA 1WH7A 4CICA 3K0GA 2G7HA 3JTHA 2HJDA 1ON2A 5L3GA 3OR2C 4HF0A 4I2OA 1FYJA 5CVJA 4UNOA 3JD3A 4WBNA 2E2IJ 4NKGB 5DTDA 4PDMA 1VF7A 1H2NA 5HDGA 3GZNB 3EHBB 4II3A 2STTA 2WY7Q 1P6RA 2LFBA 1Q1HA 1K3EA 2ELJA 3RN4A 2HQAA 4MNUA 2N04A 1OZ0A 4YY3O 1QNMA 1FOKA 5HLIA 1XREA 3KP7A 5F04A 2BOBC 2ZR2A 2PFBA 3MEXA 5EZGA 3JALA 4LH6A 3RFRA 3E3VA 3SPIA 2CFOA 4UB8Z 1FWZA 4PDKA 2QTSA 3LSTA 3HZJA 2CUEA 4LIVA 1FFXB 3S1NJ 1K4DC 3T1HB 1KZHA 4L9VA 2QLZA 1ZQ3P 1JJOA 4X20B 5BZBA 1VQMV 5FPRA 4AIJA 1V54H 1XMQO 1R22A 1HP8A 4MVSA 1X3ZB 1ZAUA 2X85A 5KCMA 4LF7B 4RGSA 3IAM2 2HZDA 4YJ3B 3HOXJ 5JWPA 1Q82W 4X8AA 3RVYA 4Y52J 3PIOF 3WTZA 1IF1A 1Z67A 4IYIA 3STZC 4C7UA 2KG7B 2VODA 4KFMA 3DKXA 4NR1A 3RT3C 5BY1A 4YIOA 1AB3A 2MLGA 4JAVA 5BS6A 3OS0A 3SFZA 3GFMA 3MAJA 4L0ZB 3NXSA 2DWDC 1X19A 2Y48A 4DV1B 5BQTA 3N97A 3OAAG 1IRXA 3AG2B 3KCCA 1YW7A 3K69A 3GUDA 4R8CA 1LVAA 3L2QA 3I0TA 1S72I 3KIOA 4CCOA 1RUNA 2ZNJA 1K7DA 1SETA 2K9NA 2K9QA 1COWG 1V3FA 4FMTA 4X1IA 3ECHA 4N9IA 4A3JJ 1QR9A 1VF9A 2VWKA 2L9RA 3LSJA 2QSFX 3OYKA 2O0YA 2DA5A 4DBRA 1V54C 4ABMA 1PYVA 1KYOF 2DJVA 3DC5A 3STLC 1G1XB 1YS7A 1UCRA 3SDGA 3E83A 5EBLC 5LL6Y 1XMXA 2BXZA 1AOYA 2YIDA 5IYCJ 1AVMA 1SFOJ 3KLNA 3L74H 1B06A 1KU2A 2X6XA 3VDXA 4XK4A 2R5YA 1VQKI 1WB8A 2R7OA 3I4MJ 4E6KG 2IS6A 1H0MA 1PKXA 4O5VA 4L18B 1DF4A 4PA4A 2CUZA 4TUYA 4CHUA 3ZRWA 1C0WA 5GP9A 1UAAA 1NS1A 2DQ0A 3OIPA 2K5CA 9ANTA 2ZQMA 3AL0B 1AKHA 1DGRM 2A68F 1NHAA 3DLAA 5D5WB 1TWHJ 4M6YA 3DPLC 4ENNA 2LYCA 4B3TB 1W5CC 4BHCA 4RO2A 5ED4A 2CGOA 2HVJC 4BEHB 3APOA 5FNVA 2WC2A 3O6BB 4IYHA 3ASNH 3SZPA 1BR4A 2DDAA 2YX4A 4RS8A 4XSZF 5DYMA 5L3FA 3HUGA 1SQPH 5EYPA 3ZHSA 1ZLJA 3ASOH 1MSWD 2PG4A 1E3HA 4L8JA 1WKMA 2ZM6O 2TCTA 4QPQA 5JFRA 3HGYA 1Z3XA 2DA2A 3K06A 4E7LA 1R73A 3F5WC 4MT8A 2EH3A 5GPAA 1G8XA 1PD3A 5FFXA 4WXCA 3G3ZA 1T8IA 3K4MA 1BOBA 2RQ6A 2JVHA 2IS4A 5C44J 2H8PC 5A2QZ 3A0RA 2CTPA 4CH4A 4ZKIA 4LWSA 3CCMI 1U97A 4JASA 2Y9ZA 2VPRA 3B40A 2KLOA 1QZYA 1JI8A 5BOXA 4TWKA 2KIMA 1KD1W 4S05A 1FJGB 3RJPA 3J7AY 3PJSK 2UXBB 3CHXA 2P5LC 4TV9A 2K40A 4O4IA 3ASNC 3BQZA 4FQGA 4XBFA 5D5UB 2A7WA 5LRSA 3I3LA 2W0XA 4Y7NJ 2Y0IA 3JRAA 3OV8A 4IHSA 1GM9A 3ASOC 1S8NA 2NVTJ 3K0DA 3ZEDA 2Z5UA 5IOYA 5KAIZ 3V7CA 2EPFA 3RYPA 1FJLA 3AK2A 4ASUG 1VFCA 1SD6A 3FXJA 4ZYEA 4HF1A 1S7EA 4LB5A 2OYQA 4IO9F 4OMYA 2VQGA 2Q0OA 5CA3A 1JJ2U 1I3AA 2DA6A 2QA4V 2Y75A 4BXXJ 2UUAB 1XNRB 1T0FC 2RNGA 4A3IJ 2QSGX 2E1MB 5F1RA 4BS9A 5HLTA 4BDYA 1KU7A 2UWMA 1GM7A 4XSXF 2Z0AA 2JVDA 2G9WA 4PUSA 5D6FA 5JI6A 5CKTA 3HPHA 2H94A 1LEBA 3QO7A 1Y76A 2PI4A 5E20A 3KYCB 1X3UA 2CH0A 3MQ0A 4WWCA 3D5RC 5J1YA 1OCTC 3OEEG 4JV5O 3KEOA 4BJ5C 3K4JA 4KA4A 5TRDA 5H6RA 2F4IA 4XRSA 2MH2A 5F27A 2YU9J 2JEXA 1I94B 2OTLV 3VSLA 1ZREA 5BR8B 2JEUA 2M45A 5M5WJ 4KIGA 3T4DA 4NQWB 3H1HH 4N9HA 1XB4A 3CMMA 2ECBA 1MJBA 3GW2A 3GWZA 4IVNA 1ZG1A 2CH7A 3ZX6A 3O2PE 1JTXA 1YX5A 3E22B 3HRUA 5IY5B 4EB6B 1UFMA 5IDJA 4FLVA 4WFBV 2XUMA 1ETWA 3RYCB 4RAZA 3ZQLA 1GV2A 4U7DA 2OZUA 3W7TA 4JI8O 2ZE5A 1SKVA 1S5JA 5D4RA 1K92A 2MK3A 1GKFA 5GTHZ 3ZS8C 4ETSA 1D5VA 2LFSA 2VT2A 3E0JB 1SFEA 2K9LA 4KMUX 3JAMZ 2DT6A 4RWUA 1SEUA 1AI7A 4AILC 2DPDA 1HW5A 1FIAA 3K04A 3I56V 1BA5A 3FISA 2HVRA 1FXKC 3AG3H 1SFKA 3K2ZA 3V4GA 2E34A 4HQEA 2WAEA 3JCUC 4M9ZA 1X59A 4BXUA 1TL8A 4OIOF 4HV5A 2M4GA 1Q43A 2V9KA 4B44A 4ZYHA 3JSLA 1TNSA 2HKXA 1YDXA 3RIRA 3H01A 4EFBA 1ENHA 4NUBA 1GHCA 4G6TB 4IT5A 2ADQB 2YS8A 2EZLA 2JRMA 2EFNA 1UG2A 2I10A 4FE7A 1BM9A 1MZBA 1P9QC 2M0MA 3HPGA 1YSCA 4A6DA 1ZRFA 2O61A 2R9AA 4MTGA 4HLYA 1J0RA 2PTMA 3BT9A 3CCLV 4QTRA 2JJ2G 2CUFA 3LFKA 1P92A 1BS3A 4RDUA 1R1TA 2H6CA 3OIQA 2E76B 1LJ9A 3W2AA 2O9LA 2EFOA 2W7NA 2QM7A 2P5OA 3I54A 4B8XA 2XC7A 3IRRA 2A6TA 2IA2A 1B9NA 2DODA 1K78B 2KL4A 3DEEA 4FVMA 1M1EB 1Q5OA 1R7JA 1U3EM 4X20A 2FRHA 3FB7C 5IPAA 3M99B 4DV4B 5DUIA 3AG3C 1P49A 1NTCA 3EYYA 2HDDA 3ONQA 3W2WA 1FYLA 3CD6I 2K85A 2YUAA 3E2EA 1BZKA 4YJ3A 3ML6A 2JJ1G 5B1AB 2JJ7A 2W00A 3PNVA 3DQVC 4DYLA 1YE9A 3ABMH 2AXTZ 1XSVA 2QYOA 5HVQC 2KG7A 1QPMA 4JI0B 1YITI 3ZJZA 3CUQC 1D3YA 3ZR8X 4YHHB 3UKMA 4WF2A 3MKYB 3ETGA 3WHBA 2HR3A 3DEWA 3MMYB 2XF5A 2UXDB 2V26A 2KIUA 1GDTA 3CUOA 3GCMA 3ZCCA 2HKOA 4KISA 4LNUA 1G3TA 3X2QB 1IAWA 3OD4A 1FYKA 1QBZA 4DUZB 4PD4F 2O6GE 3MFKA 3ZHRA 3RQ4A 4X65O 3K7AJ 2M7AA 3HKCB 2RDCA 3G6EI 1QVTA 2ACJA 3BR5A 1Q90D 3ZN0A 3HEFA 3ECOA 5KUMA 4AYBN 2BOLA 4G7ZF 3F6VA 1MH3A 1ZHFA 3SJBC 3EUKL 3H3UA 2A07F 4BDZA 5AIQA 1N34B 2JPBA 5D5XB 4RAGA 4WFAV 2O03A 2BSKB 2EBOA 1XD7A 5EG0A 2XOKG 2UU9B 4NXMO 2RQPA 3S15J 1W2BU 2KB1A 2FF4A 4H37A 1D8KA 3J7AO 3ABMC 1IBKO 1V4RA 3TKYA 1JJ6C 1MSDA 2QM3A 3P32A 4PV1B 4C2MJ 2UXCO 1Y6IA 5J6XA 1RRJA 3J81Z 5EK0A 4DV5O 3E6MA 3CRRA 1K9MW 2W48A 3WTXC 3OEHG 2JQ7A 1L3LA 2MLKA 3OTOO 1YTFD 1QQIA 1LUWA 3D36A 4YJ2B 1YJWV 5J2TB 3BOQA 3HB9A 4P55A 4WK8F 1VNDA 1B8IB 4OIPF 1SC5B 3WB2A 2H27A 1BBYA 2LY1A 1G3WA 2D2WA 4CH7A 4BEHA 4DNCA 4QLCU 2R7VA 3CJNA 3K5OA 1I1SA 1AI4A 4MVMA 1U5TC 1SANA 4ZZLA 4FM0A 5IYDJ 3OYIA 4FJCC 1X3WB 2IH3C 3HR0A 1O9GA 2HFHA 4Z1VA 3KKYA 2PBIA 2XVCA 1K6YA 4GX2A 5L3BA 4O3MA 1GN2A 1S3JA 2FOKA 5B1NA 1BN5A 2QQBA 2RQQA 2YUSA 2YDEA 5C93A 4IGGA 1N36B 4W1UA 3LUTB 3W7WA 3SZGA 4R79A 1X1AA 2AW9A 1V55H 2YXHA 4BW9A 1B3QA 3CP2A 5HFMA 5KHHA 1HF0A 3MD2A 3QAHA 1Z7UA 1PM9A 1D8JA 1J95A 1L0NH 1BQ0A 5LMNO 4JPRA 3LNNA 1H8AC 4HZFA 2CG4A 2V7QG 5GONB 4HNUA 1WJFA 2O57A 1BI0A 3RQIA 4KJZA 4MFDA 1ZR2A 4N23A 2UV1A 1Y1WJ 3S2DJ 3R60A 1MBFA 4E7SA 4B3XA 4DQ2A 2E36A 2QGUA 4HZ3A 2R7ZJ 1E1RG 3I55V 4Y4RA 4HSTA 1JMKC 5TGTA 1X4TA 3JSPA 3ABKB 2JUCA 2QQ8A 3Q0VA 2R7DA 1D5AA 3MAQA 3SYOA 1MNMC 3M8JA 3FAVB 4FX4A 4FPPA 3AG4H 1WJ5A 1WJAA 1N78A 4BW5A 3R0JA 1MZFA 5CA1A 3CCMV 3TL4X 4ZTFA 1TTYA 3WG7H 4B3SB 2EILC 5K1XA 4BIOA 1ETQA 2ZJPF 2QEXI 1V55C 3PFYA 2GA2A 1EKEA 1J09A 3PNTA 1KB9F 3FXLA 2W6IG 1YIOA 2Q8VA 1WZ2A 3R4KA 2XTAA 3MZHA 3CPWU 3K0LA 4IHVA 3CS5A 3EXAA 2DTRA 3UQ8A 4YY3B 3J80N 2NVXJ 4NC8A 2PUSA 1NH2D 3S1QJ 4B47A 1IV8A 2AHQA 2M34A 3RYRA 4UCTA 1O3SA 3BP8A 3MDSA 5JCOA 3CESA 3DXJF 4O4JB 2E1NA 4ZIBA 4O2BB 5IWAB 4NQWA 1NQTA 4UUVA 3R65A 4F6EA 2EQRA 4TV8A 4R50A 2VJIA 4B3TO 3AG4C 2FBKA 3E22A 3TJTA 3G71V 3EPZA 4EB6A 4ZHQB 5DCMB 2Q5ZA 3HPLC 4FT8A 1VP7A 4DR3O 3WG7C 3CZ6A 3HRSA 1ACIA 1FAFA 3J80K 3OYLA 1XSXA 3SYAA 2DTZA 2EIJH 2IA1A 2OQGA 3OYGA 3IAS2 3ZMZA 1L8DA 4FZ0A 2M8EA 3F8NA 1S0VA 5BPDA 1XILA 1ZLKA 4EVIA 4DRXB 3A01B 4M74A 4PDLA 4G7OF 2OIGA 5ILUA 3A0BC 1KQ0A 1WNSA 4ANJA 1IRFA 4FIPC 2DLLA 5HS9A 4HNAB 3HTUA 5HFLA 2WA4A 4G7HF 4MTEA 3WTWC 3CCRI 2H1LA 1QRYA 4NB5A 5F0CA 3HOVJ 2R72A 1BGYH 4IF4A 2LTPA 1IXRC 5KVRA 2H1KA 2KIQA 1H8EG 5BMZA 1ZL8A 2V6CA 1FBSA 3P5JA 2IT0A 4WFHA 4EATA 5E18F 3OW2U 3EUHA 3C3TA 4KIFA 1NR7A 1O57A 4JZGA 1T98A 4M9XA 3PO2J 3H5AA 4DZPA 1ZSPA 2ID3A 1RR7A 3KZIZ 1XHZA 3GTMJ 3GFIA 2D3OW 5EF6A 1X2MA 4Q6GA 3UR3C 3QF7A 1APLC 3ISPA 1YVWA 3JAWB 4FE4A 4X6AJ 2P7TC 4M3FA 4RGRA 2EIJC 4A3MJ 1DF5A 5FD5A 1S7AA 2WY8Q 3MWMA 3OMIB 4GDFA 3MVPA 3WODF 2DA3A 1FLIA 4QPJA 1A6QA 2DFFA 1K78A 1AI5A 1CQTA 1OISA 3C90A 1Z77A 4CCMA 4L9NA 1OJHA 2CTWA 3E86A 3E89A 4LF8O 3G1OA 2MSYA 1TWAJ 1Y74B 3ERED 3ABTA 3ML0A 4C2UA 4AWXB 1PJRA 1LDKB 4G28B 1QVFU 4UY8I 1ULYA 2OJED 3O3KA 3G4SV 2OC6A 4RAIA 4CS2A 1MDMB 4CS4A 2MC4A 4OX9B 2ESHA 2Y2ZA 5BR8O 5JVGF 2K86A 2FD5A 4U0VA 4UB6C 3OWTA 3TCUA 4NHJA 3BCBA 3U11A 2QVOA 4AD9A 2E7WA 2FE3A 3CO6C 1FX7A 1OCCH 2BBYA 3NQOA 2N05A 3VOEA 4Y3OA 1J5YA 4C2TA 1ORQC 3RDIA 3SDLA 4AIHA 3CD6V 3OOUA 2GOMA 2EV6A 1B6QA 4H0EA 4KYWA 2M7WA 2ZDIC 5B1OA 3OGIB 2VQFO 4FASD 4MEXF 2NRAC 1D5NA 1E17A 3CRCA 1ETVA 1V54B 3K79A 2OUMA 2BSKA 4WF9V 1NBMG 1KC8W 4UVAA 4KHPO 3FM5A 3W2VA 4DR4B 1LFPA 3CQZJ 2EJRA 4D6TH 4HA8A 4CZCA 3LAJA 5FL7G 4RA2A 2LSOA 2WLIB 4LF4O 4QIWN 1ZK8A 4JYBA 3OL3A 4HOBA 5FGMA 3S8PA 4YIIA 2VBZA 5IT9Z 4L0YB 3W7XA 3SYTA 3UO3A 2H6BA 5F08A 4YJ2A 5J2TA 1YIJV 3K5NA 2A6HF 3ZHVA 2L9NA 1B8IA 1JHHA 1XMAA 1JPXA 3SR2C 4IHWA 4W97A 4FX0A 3G6BA 2LGQA 4S0HB 1SF9A 2FJ1A 1PL4A 4FLYA 2BY3A 1F51A 3QOPA 4DV6O 2HP8A 1R1BA 4LLNA 1XDSA 5GAGJ 4MVOA 4O6JA 1WGXA 1LE8A 4XOTA 3AG7A 4PA3A 3S3XA 3WTSC 3GTKJ 3K6GA 3LNQA 4BAYA 1PV0A 2X4HA 2FBIA 2EIMH 3D0SA 2DOSA 2RJZA 1KGSA 4BQOA 3DV8A 4DO2A 4TQFA 4XN3A 3HOUJ 5C8YB 4FLXA 3JD2A 4DV4O 1POGA 3LA3A 1Y6XA 2HHHO 2DAOA 1HDDC 4PA7A 1VEWA 2CW8A 1Q1VA 3K9AA 5IOZA 1GH6A 3M8FA 1X2NA 2XAUA 5KNLA 1K33A 3BCCH 2PYLA 1OR7C 2MC3A 5KHDA 1AJPA 3DFGA 3OFNG 5B3SH 5GONA 2RVCA 2VWJA 4DR6B 4J9YB 3KX2A 4C30A 4IOAF 1Z6TA 2Y0SN 1VZ0A 3M7GA 4HAMA 1HKTA 1OV9A 2ZE8A 2I8DA 5FPOA 1MJ9A 2H8RA 4B43A 4EV0A 1IRZA 1RSOB 5IE9A 3U0ZA 3CC2V 2IGMA 3MZYA 2VBXA 2M9HA 4G8XA 5ITZA 3FK6A 3HKEA 3ASOB 4XDKA 2MBFA 3CP1A 5FROA 1H2LA 2L7MP 4GZRB 3P30A 5IJ0A 2WAQN 3HC7A 4PJLA 2OQRA 2YIAA 5FKLA 3FAVA 2ZT9B 1KKCA 2QA4I 5J2UB 3R66A 2EIMC 1OLTA 1RKWA 3TO9A 3MD0A 1AU7A 4PGHA 3WB1A 1KECA 4R1HA 2XROA 1FT9A 4I7ZB 2KP6A 1EN4A 4FFKA 1ORKA 1IUYA 3CP8A 2QF7A 4PJ0C 2MH9A 2WLNA 4ZOLA 4I02A 4D7SA 2LJ2A 2E74B 2EJ7A 3D36C 2QSHX 2HYFA 3K5LA 3FKIJ 2BE3A 4I4TB 5B3SC 5TISZ 2OTLI 2L4AA 2RN7A 4OINF 3J7ZI 2HJFC 3ZRXA 4UB8C 3W7SA 4FLWA 4TV7A 5EGOB 1NTKH 4O4JA 1N25A 1XGMA 2DN0A 1QZZA 4A0XA 2BW3B 1TP4A 4P1WA 3FFQA 1BE3H 4O2BA 1IX9A 2V1DA 4UUJC 3DKYA 3SPHA 3TW6A 1OYIA 3DGEA 1SD7A 2BVMA 2Q4PA 4JTAB 4ZHQA 2V4JC 5DCMA 1NTMH 2AZ0A 4YG2F 3FDYA 1ZRCA 2CUGA 4H33A 2QKLB 3A1YA 3WFVA 1VQLI 4RM3A 1R71A 2NAZA 5K1YA 3BZCA 1YFHA 2A69F 2PI0A 3LDDA 2QKAA 4DRXA 2Z99A 3A01A 1H88C 5IJ9A 1KBHA 1QLEC 3HKBA 3D1NI 3S93A 3CXHF 3AG1B 3JRBA 1WPXA 4EKWA 3CRQA 3I56I 1N36O 5ERIA 1ERDA 1XL4A 4X65B 3VQVA 1BT8A 4XICA 2HGCA 4HNAA 4F6RB 5BMVB 3L09A 1N32B 2WV1A 1FXKB 4XR6A 4O4LA 4GUNA 4K8ZA 4MLOA 3DPUA 1EZJA 2HQRA 2DMNA 3BR2A 1YEWA 1W7PA 2GTAA 2LH9A 2Y31A 3ZQ7A 2KT0A 1W5TA 2L3DA 1AP5A 5CBFA 2FUG2 5LGTA 3NWSA 1KA8A 1OYWA 1WI9A 2V9VA 3HM5A 3VSKA 5E3MA 3D5SC 3FHNA 1QVUA 3HL2A 2HLDG 2ZR3A 2Q9LA 3U1DA 3BFRA 4L5EA 4MGRA 3CCLI 1R36A 2LW7A 4Y33A 4K35A 3JAWA 3H9QA 3JAKB 1P4XA 4XKBA 4WCEV 1ZYRF 3GMEA 1GN3A 3M3YJ 3SYPA 3IHUA 3A02A 2CSOA 3WE3A 2DQLA 3L7WA 4A0ZA 5FRMA 2VRZA 3L2VA 3OTOB 4PFOA 2UUBO 1X1BA 1R4NB 2B7EA 3BLYA 4HX4A 3RKYA 3JW4A 2R9RB 3ETQA 1Z1DA 4LG0B 1GMGA 1CEZA 4GFBA 4XDJA 4B3SO 4CH5A 4P9FA 1RM1C 4LF5B 2Q8KA 1WAZA 1VQ7I 4CYCB 2MABA 2NVYJ 2WPDG 3AG3B 1Q6UA 4KXRA 4L9JA 4KL1A 4Z1MG 3E7LA 4EJOA 1E79G 3JR9A 1P4AA 2E5ZA 4BXFA 5CB4A 1LFBA 1Y8QB 1JGGA 1M56B 2LLKA 3M9AA 5KHJA 1Q8IA 1CP9A 2ZMEC 1G2HA 1LNQA 4AQYO 1MDMA 1VI0A 4EMSA 4QE7A 5IWAO 4RBOA 4E4HA 3K57A 3G2BA 3CUQB 1XMKA 2X1EA 2Q2EB 3E1SA 2NNUA 5EC2C 3REOA 3BDDA 5IT9N 1H89C 3LDCA 1Y0NA 2W84A 3LSQA 4ZDOA 2CQQA 1VQ6V 3GLLA
chains in the Genus database with same CATH topology
1XGOA 4JK1X 3U2RA 3GYHX 1SERA 4G27B 5AONA 1KQ8A 1IXCA 3SYQA 4JGSA 2W57A 1UHMA 3DKWA 4U0WA 5IT9K 2P6TA 3ABMB 1I27A 2WLIA 1ENVA 3VODA 1K6OA 4B09A 1J2XA 1FBUA 2V1XA 2VE9A 2OCCB 1DDNA 3B8MA 4LLLA 1G8MA 1QLNA 2QUFA 4L5IA 5H6QA 2P5VA 1U5TB 3M1EA 3KP3A 1FNNA 4KT5C 3N4MA 2D1HA 4R6ZA 3PQJA 4JYCA 4BNCA 2AHZA 4AIKA 1BIAA 2WSSG 1DP7P 3BY6A 4MVZA 1DLBA 1RUOA 3RPQA 3HTSB 1IZ1A 2IPQX 1NJIW 2QENA 4GX0A 5E1AC 3FB5C 4LBEC 1BOAA 3EFFK 2IU3A 5D4SA 5D5VB 1WWXA 4MVRA 1YHQV 2ZXWC 4S04A 4M72A 3KLOA 3MHSC 2PMHA 2ZKZA 1I1GA 1OHHG 4U7NA 1ZGJA 1V55B 3E8GA 1L0OC 2GWRA 2IJJA 2EFQA 4ZZDA 1FP1D 1I5ZA 3CCJV 1G3YA 2BE5F 1MD0A 1Y0UA 3JCZA 4UV9A 2L02A 5TJJA 2FEZA 1REPC 1AROP 1PL0A 3HSRA 4P5OA 3E35A 4G2KA 3KG2A 3AG4B 1XN7A 3ZMUA 4N21A 2E7XA 1YYVA 3AAFA