3IC7A

Crystal structure of putative transcriptional regulator of gntr family from bacteroides thetaiotaomicron
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
IYLQIADRICDDILLGQYEEEGRIPSVREYASIVVNANTVMRSYEYLQSQEVIYNKRGIGFFVASGAKMLIHSLRKEQFLKEEVGSFFRQLYTLGISIKEIEKMYYEFIQRQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative transcriptional regulator
publication title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 26
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ic7A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ic7A02
1YYVA 2QLZA 4BNCA 3EDPA 1IAWA 4P96A 3E35A 5EEHA 2FA5A 3SFZA 4GYGA 3N4MA 4ZH4F 2EV6A 2L54A 4RB2C 4L5JA 2IPQX 5LBQA 1DDNA 2IVMA 3TO7A 4MQVA 2X4HA 4IHTA 1LEAA 2QQAA 2VOOA 3BJ6A 3TO9A 1UB9A 1KU3A 1WRJA 1DP7P 4BAYA 5DUKA 3ISPA 5LRSA 2DQLA 3GUDA 3FZVA 1LB2A 1Z6TA 3GO5A 4HLXA 4KDPA 1NH2B 4MEYF 5D8LB 1WWXA 4EV0A 4G7ZF 2H6CA 2DTRA 1L0OC 4LJZF 1R7JA 3MCZA 4H0EA 1A04A 3HRTA 4UV8A 1KU9A 6PAXA 2L4MA 1XCVA 1REPC 3HSRA 5L3GA 3ZMUA 3ZN0A 4OINF 1RM1C 1G4DA 1E17A 1TW3A 3VOEA 2P6SA 2H09A 2RGVA 2CW0F 2V1DA 1I5ZA 2V79A 3FM5A 4MEXF 1YW8A 3P9IA 4M9ZA 2F2EA 4HQMA 1UCRA 2R7DA 4WX9A 3EQLF 2ESNA 2ZBKA 2BE5F 3F8BA 2D45A 3BPXA 5J8CA 2DK5A 4UV9A 3HHGA 2PQ8A 1ZLJA 3RJPA 3KEOA 1I1SA 1BJAA 3F8CA 3LWFA 3KFWX 4NB5A 2EFOA 3TOBA 1MGTA 3ERED 3IL2A 2JPCA 2FRHA 3FMRA 3C3WA 4LLLA 2XAJA 1ZH5A 3KZZA 3EYYA 5FD5A 5HLIA 2GIVA 1XSDA 3J81Z 4ENJA 1O7FA 2UWMA 1J9IA 4OOIA 2ZJ2A 4LLNA 4A0ZA 4O5VA 1YW9A 1HSTA 5LEJA 1BI1A 1ZHFA 4B8XA 3GXOA 3BZ6A 1XMAA 3HHHA 4HF1A 4Q4ZF 1TQPA 4F7ZA 1P4XA 4Q48A 2DT5A 5FD6A 4MTDA 1P6RA 3T8TA 1FSHA 3JTHA 3HSFA 2MLGA 2VBXA 4ETSA 2HR3A 5FO5A 2MC3A 1W5SA 4HW0A 3B02A 4L9VA 1OMIA 4P55A 1U8RA 2ADUA 2KJBA 1JHHA 2Z33A 4FT8A 3PQKA 1XGOA 3W7UA 3GFIA 2YX4A 3K2ZA 2EFPA 1G3WA 5AONA 1O3TA 4I98B 2NRAC 5D4SA 3K0LA 2ISZA 2FNAA 2ZMEB 1T98A 5HLGA 1O57A 3GLXA 1CGPA 2VE8A 3DP7A 4LMYA 1KGSA 2HFHA 3R0JA 2ACJA 2VBZA 1DPUA 4RB3C 2RVCA 3BY6A 3F6VA 2EV5A 1SAXA 1Z05A 2J5OA 4EJTA 3CUQB 1L3LA 2V9VA 5KK1A 4XBFA 1QO0D 1TQMA 5BOXA 1YLFA 3V4GA 2EFWA 2KKOA 1ZGJA 3F8NA 1R5HA 1W4MA 3GW2A 4HDVA 4U0WA 3W7WA 4ESJA 5FFXA 4KYWA 4N9IA 2PLYA 5ILVA 3Q9SA 1YTYA 3W7TA 1NHAA 1HKQA 2YPRA 2W24A 2W25A 3FMQA 2XASA 4CHUA 4UUVA 1S6LA 3L00A 1XSXA 2H6BA 3KETA 1ONVA 2OU2A 3FWEA 4A6EA 4KT5C 3TKYA 1VTNC 4IRGA 1MDMB 3OV8A 4M74A 3CJNA 4ZYHA 2HYFA 5DV5A 1QGPA 1R5GA 1S8NA 2LSOA 3BJOA 2YU3A 2CFXA 4ESBA 1R22A 4LK0F 3N97A 2HEOA 2L01A 4HX7A 1LJ9A 2Q0OA 1B9MA 4G94A 2K86A 1S7OA 5HVQC 3KLNA 4EJOA 2O8XA 1JGSA 3JSPA 2LNBA 4RGRA 1H9TA 3DEUA 3I0TA 4EMSA 3SZTA 2PEXA 2LDUA 2CYYA 3C18A 2AXLA 3TGNA 4HF2A 1QQIA 2VC1A 1SFUA 1W7PD 5KVRA 3G3ZA 3ABUA 2JRTA 1H0MA 2FBIA 4PCQA 2RKHA 2F5EA 1PP8F 3NRVA 1G3TA 4S04A 2MH2A 2HTSA 2P7VB 2V1XA 1K7AA 2E7WA 2FOKA 2O3FA 3TOAA 2VBYA 2XAGA 4ESFA 2L4AA 2X0LA 3W6KB 1CF7B 3J81K 2VONA 4MHGA 2IJLA 2PJPA 1FX7A 2MD5A 3KP4A 4UNOA 4EM2A 4MQ9F 2A6HF 3KP2A 5AIQA 1ODDA 4KUMA 5DCMB 4CO8A 4CDGA 1R1TA 2FU4A 4UVCA 2CG4A 3F8FA 1G3SA 1V4RA 2ZNZA 4RGSA 1RI7A 2JZYA 3T1BA 2QWWA 1B6AA 1W5TA 2ISYA 4A6DA 3WU1B 1BC8C 4BHCA 1FBQA 3M1EA 4U7DA 2OA4A 2M87A 5D5WB 4ENMA 3DPLC 3MZHA 3KE2A 2FSWA 4IVNA 4A5MA 3WGIA 3NEUA 5FGMA 1D5VA 3I4PA 4IJAA 5IT9Z 2BGCA 5D6FA 2IT0A 3P9KA 1YFHA 1IRGA 3GWZA 2EB7A 3L09A 4I01A 2E7XA 4I7HA 1S7AA 3GX4X 3LA3A 5BQTA 4GXOA 2XKOA 1AOYA 1WQ2A 4HAMA 4HV5A 4DQ2A 1RUNA 3V8LA 1OYYA 4GCVA 4P5OA 2UXXA 3LSTA 4P9FA 3GVAA 1SFXA 4LFUA 1BBYA 3O3KA 1SFEA 1GHCA 4EGYA 1BM9A 2HKXA 4N0BA 2D1HA 2K4BA 2PI0A 2O0YA 2Z3YA 3WTWC 3IWZA 3EETA 4P9UA 2DU9A 2HQNA 5H20A 4RS8A 2KRFA 4RB1A 2BYVE 4HA8A 4CXFA 2NAZA 1MKMA 4AD9A 4K2EA 1G3YA 3ZP5A 3Q5FA 2P5LC 2VE9A 5LGUA 3GF2A 3V7CA 5ILSA 3H3UA 3HTSB 4MNUA 3I59B 4LLGF 2W84A 1FBUA 1IXCA 2A5YB 1K6OA 2VOPA 1ZRDA 3RI4A 1F5TA 4M9SA 3HUGA 4WK8F 2ZO4A 3TDUC 1D8JA 5E8GA 3E6DA 2DLLA 1YS6A 3AAFA 1DPRA 2ETHA 2P90A 5ED4A 2DPUA 1K78B 2M1BA 3KP3A 4ZZLA 1FZPB 2EFNA 1R58A 3HIFA 2OZUA 2EA4A 2DFIA 5CYVA 2M30A 3ECOA 2P4WA 1STZA 3ZQ7A 1FWZA 2Y0MA 1T0FA 3HOTA 4G8XA 3FM3A 2FEZA 1R00A 2P5VA 1YIOA 1ON2A 4M71A 3RIRA 1MJBA 1U5TA 4I2OA 3ABTA 1FC3A 1FYMA 2E1NA 4GGGA 4B09A 3ZMTA 1R36A 3H92A 3WTSC 4KIGA 1Y0UA 1H9GA 5GW7A 1TBXA 2XKPA 5CVIA 1PDNC 3KP6A 2EK5A 1KQ8A 1BIAA 3B73A 3BPVA 5JVTA 1ZAOA 1LQ1A 1E2XA 3NQOA 5CVUA 4QLCU 3QU6A 2VXZA 2PMHA 3FX3A 1Q1HA 3P9CA 2A6EF 1XSVA 3I64A 2G7HA 3PQJA 5LHHA 3WTUC 2A69F 1YO5C 1HQCA 2YSRA 3RYRA 1YTFB 3RKXA 3T8RA 3DPTA 3WU0A 2OQGA 1D8KA 4KMFA 3IC7A 1UFMA 2GXGA 1UHWA 2EV0A 3JAMK 5JFRA 4ZZDA 2F5FA 2XGXA 1LVAA 2WAMA 3ZMDA 2VBWA 2ELHA 5L3CA 1NVPB 3R4KA 4A12A 3TQNA 2O61A 4OU0A 4U88A 3QOPA 4AIKA 1EH8A 3E5XA 3SXYA 4AWXB 2V6CA 3V7SA 5IT9K 3M8EA 3T5XA 2RDPA 2UZKA 3OOPA 1F1ZA 2HZTA 2R3SA 4JQFA 3ZPLA 3GFLA 3KEQA 1TLHB 2K27A 1RUOA 2XAFA 1W7PA 1Z6RA 4Q5SF 1OKRA 2QUFA 4YFXF 4XRFA 3IHUA 4A0YA 4IPAA 3IWFA 1IN7A 1P4AA 4M6XA 2IA2A 2DO7A 4NQWA 4R1HA 1EH7A 2F5DA 2GQQA 5E1XA 1WKMA 3P7NA 3HTUA 1K79A 2NNYA 2M8EA 1XDSA 3QAHA 3LAPA 2XROA 2QBYB 2J5PA 2JSCA 4OMZA 4RGXA 3ZMSA 2H27A 3E5QA 1SD6A 2M45A 2MH9A 2WTEA 1ZREA 3GFJA 1BC7C 1F9NA 3U2RA 5JI6A 3WTVC 4M73A 1TW2A 4E70A 1PUEE 4CZZA 4YIIA 3CTAA 4M6YA 2CSOA 1ZRCA 4OMYA 1J7KA 1YQAA 3TO6A 3WTZA 1MJ9A 2MBFA 3BP8A 4KICA 4CYDA 1SD4A 2CO5A 2E1CA 2LF7A 5LEKA 3GZ5A 1ULYA 4N9HA 3DV8A 4PGHA 1YW7A 1K78A 3CUOA 5HS8A 1P4WA 3BROA 1QNTA 1Z7UA 3MWMA 2Z99A 3L7WA 2DPDA 5DCFA 4M9XA 2FBHA 4I09A 2XVCA 1GXPA 3L9FA 5F1RA 4R79A 2GXBA 4BYYA 2QENA 3QP6A 2PBIA 3KZYA 2O6GE 1RNLA 4LD5A 5E17F 4WWCA 1J0RA 1XN7A 3LQRA 3I54A 5TRDA 2P8TA 3RKYA 2K4JA 4BH9A 3R60A 2ZNYA 5JR3A 2NYXA 1KQ0A 2KJCA 2A3SA 5DD4A 5E1ZB 4ZYGA 2RC4A 1D3YA 2STTA 3DKWA 5DUIA 1PP7U 4O3MA 2JT1A 2IW5A 2D1VA 5H6QA 3I5UA 1S29A 5E1WA 1G6NA 3FMSA 1J2XA 2QVOA 2VN2A 4CICA 4OIQF 4ON0A 5ICGA 2G7UA 5E20A 1MZBA 5D6EA 4UVAA 5CVVA 1GXQA 4U0VA 1FP2A 1XDUA 4G7HF 5J8FA 1FT9A 1ZG5A 2P5KA 1MD0A 2XIGA 3IKVA 3J80Z 4LGWA 2VODA 4DNCA 1O3QA 1LEBA 4EGZA 3GFMA 2PN6A 1Z1DA 5D5VB 2MA3A 2O03A 3W7SA 2OZ6A 2FQ3A 2Q8KA 4YG2F 3WE3A 4G6QA 3JAMZ 5DDGA 1U5TC 3JTGA 2RN7A 3L2CA 2Y75A 2NNNA 4AIJA 1ZYRF 3VEPA 1T39A 3U1DA 4MGRA 5L3FA 4LB6B 3SHFA 2B0LA 4U7BA 3HSEA 2HTJA 4L5IA 2PG4A 3ECHA 2V1UA 2IRFG 3IRQA 2EJRA 3D3IA 2A61A 2HKOA 4PGGA 2H94A 2ZMEA 3V8KA 3O6BB 3SQNA 3MZYA 4YIFA 1OYWA 2JPBA 2A07F 2QYOA 1J5YA 5EEGA 5BPIA 3ZMVA 1ZRFA 2MLKA 5CA3A 4Y15A 2M5WA 1IXRC 4Y13A 4OIPF 1U3EM 1Z91A 3K69A 1OYIA 3KCCA 3RKWA 1HBXG 3CUQA 2FF4A 1TTYA 1SD5A 1LDJA 1USSA 4G9YA 1RZ4A 3D0SA 4IF4A 1YG2A 4L9TA 2BBYA 3LFKA 2HYGD 2XRNA 2YR2A 3O2PE 4FX0A 3F23A 4IXAA 2GA2A 4RAZA 5JHUA 2WWYA 1IN4A 2ZKZA 4L9NA 3FXUA 5L3DA 4I0AA 3F6OA 4HYEA 1USTA 2Z9OA 2DI3A 3CLOA 5A2QK 1B59A 3COAC 1HW5A 3LQQA 2WV0A 2PMUA 3QPTA 4XSZF 2A68F 1U2WA 5CJ9A 1MDMA 4HF0A 3F8MA 1C0WA 1IN8A 4XLNF 3M9AA 2RV8A 1I27A 1ZLKA 3G73A 1OR7A 2COMA 3I58A 2L02A 5HLHA 3K1NA 1B1BA 4GO1A 3E97A 3ULQB 2XAHA 2QM3A 3ELKA 3W7XA 1I1GA 1BOAA 5LRRA 4NHJA 2EFQA 1KYZA 3E6CC 3GEZA 3MEXA 5L3EA 3HRSA 2HQRA 2Y48A 5TJJA 3T0YA 3E6MA 2VT3A 3VB2A 2OBPA 2YX7A 4KNYA 1IUYA 3IRRA 1HW1A 1GVJA 1JHFA 4YFKF 4U0YA 4Y17A 3Q9VA 1HW2A 1UHMA 1ZN2A 2DBBA 4A2UA 4BQAA 1QZYA 5HS7A 4KFCA 4EM0B 3F3XA 2RNJA 3LA7A 4RGUA 1XGMA 1MJAA 5LLQA 2CGPA 1IRFA 5LGTA 3QRFF 3WODF 3E6BA 4Q47A 5K5RA 5HDGA 3VFZA 3WGGA 5ICEA 2XAQA 2IA0A 3J7AO 3D5LA 1T38A 3M7GA 3K9TA 4IRHA 1XB4A 4HDUA 4WXHA 1HSJA 2LKPA 1ZGAA 1CF7A 3GYHX 1FPQA 1SMYF 1O3RA 3V8JA 3LA2A 1R1UA 2BEOA 4AIHA 5BMZA 1ON1A 1IN5A 1HKSA 2G9WA 1O3SA 3J80K 4ZYDA 1U6GA 2TDXA 5LHGA 4YFNF 1J75A 5DCMA 5FLXZ 4EM1A 1V3FA 4KA4A 5H6RA 3K1MA 1T2KA 2BV6A 1FBSA 1XGSA 1WSUA 1HXDA 4EVIA 1KU7A 4R8HA 3PFIA 2HDCA 5ICCA 4UHTA 2STWA 1BN5A 3BJAA 2GZWA 1R1VA 3WGHA 2FE3A 4IRIA 2OQRA 4S05A 1IN6A 3R0AA 5D5XB 1BI3A 2HGCA 1J59A 5D8KB 3JSOA 3RPQA 3FF5A 4M72A 3M8FA 2ZXJA 4A0XA 2K02A 3WTTC 3I53A 3DFGA 5K5QA 4HLYA 3K1PA 2FBKA 4UVBA 2F5CA 4WF2A 5CLSA 3R6SA 4FX4A 3HYIA 4I0BA 1ZG3A 2EA2A 4LG0B 1FYLA 4L0YB 5ERIA 5BS6A 5K5OA 2Z5UA 4ENKA 1IF1A 3ZN1A 1ZARA 1BI2A 3C7JA 3ROUA 2W85A 4OIOF 3ML6A 5BPDA 4RAYA 1FOKA 2W57A 3R61A 4KN7X 2K7LA 4PZJA 2FMLA 3CO7C 3RYPA 2GA1A 2CQKA 3HRMA 2FNPA 3ZMZA 3QP5A 3QPHA 1HKTA 2NS0A 4HV6A 1FP1D 2KIFA 2QZ8A 2JTVA 3KP5A 3JW4A 3TDZC 3KLOA 1DUXC 1FY7A 5A2QZ 1TNTA 2ZFWA 2L3DA 1QPMA 4L9JA 3I59A 4GYIA 3BDDA 1TNSA 4AVPA 3KP7A 5AIPA 4A5NA 4ZYEA 3WTXC 4O6JA 4KIBA 3CUQC 4HZFA 2XHKA 2FXAA 3RDIA 4TV7A 3WTYC 2RQPA 4Z2YA 2KIMA 1S3JA 3W6JB 3C1DA 4LB5A 4XLPF 4EJUA 2IA1A 2OAZA 5IT3A 2D2WA 2FMYA 5E18F 3EYIA 3WE2A 1RIOH 2QQBA 2VT2A 3WG9A 4WXCA 1B9NA 4G7OF 3GZ6A 3REOA 3CDHA 1BIBA 2DK8A 2HWVA 2WC2A 3DXJF 5DD8A 4G6DA 4ENNA 4WCGA 3SZPA 1KA8A 4UXNA 4I02A 4L18B 1JE8A 5LHIA 2CWEA 3F72A 3RTRA 3QU3A 2ZCWA 1OPCA 4L0ZB 3V7RA 1QBJA 5HOOA 1U78A 1LDDA 2DQRA 3HOSA 4OIRF 4RB0A 1TQIA 1KYWA 3MQ0A 3E3VA 2XUBA 1XGNA 3EUHA 3IKTA 1XCBA 2DW4A 5K1YA 4JBAA 4D0PA 1QZZA 4WXDA 3F21A 4CGZA 1T6SA 4BHBA 1U5TB 5D4RA 5HS9A 1XMKA 4KN4X 2QQ9A 3CO6C 1B4AA 2Q2EA 1P2FA 2UXNA 5D5UB 1IZ1A 5FLXK 5F64A 3DQVC 3H3ZA 5DEQA 3FXRA 1X3UA 1ZG1A 1LDKB 5CVRA 2PFBA 4QWQA 2C6YA 3S2WA 4IHSA 1XD7A 5HDNA 3HRUA 5FB2A 3F22A 1FLIA 4JK1X 2VC0A 3FHZA 3U9GA 3BWGA 1IW7F 5E8IA 1YS7A 1FYKA 1EH6A 4LK1F 4PDKA 4BHPA 5HDKA 3LAJA 4ASNA 5F6FA 4KMUX 4EQQA 4EJWA 4LG0A 3FXQA 2EWNA 2IP2A 4EJVA 5J6XA 1LNWA 4MTEA 4FHTA 1FNNA 2KIUA 3VODA 1SD7A 3MFKA 2HS5A 3I71A 5CVJA 1JXSA 5L3BA 4HX4A 1AWCA 4HOBA 3BOQA 2AS5F 2ESHA 2P7CB 1Z9CA 2GWRA 4XSXF 2QBYA 1BI0A 3E5UA 2R7FA 1P92A 2GAUA 1W7PB 5DYMA 5LGNA 3MAJA 1SMTA 1F4KA 4HQEA 1IXSB 1I6XA 5ICFA 2HOEA 2XV4S 2LF8A 3DF8A 1O7LA 5ILUA 5FFZA 1KU2A 4KIFA 3RPUA 1FSEA 2P6TA 1KQ9A 2DAOA 4BXUA 2OD5A 1EV7A 1R23A 1WI9A 4HBLA 4HX8A
chains in the Genus database with same CATH superfamily
1K92A 1HW7A 3GTPJ 3UO3A 4JZ2A 1IRXA 1YYVA 2Q67A 2E5NA 2XGDA 4TWKA 2UUBO 2QLZA 2JGDB 2HG5C 1SVOA 1QQCA 4AIDA 3ZCOA 4BNCA 1W2BU 4DR3O 3EDPA 2HOAA 4RQFA 5A2QN 3G1OA 2DFFA 1IAWA 2JEUA 4P96A 3E35A 2QA4I 5EEHA 2FA5A 3BG3A 2DMXA 3SFZA 1K4DC 4GYGA 1Q5OA 3N4MA 4ZH4F 4CH4A 2QWQB 4NTXA 3CWBH 1X58A 2EV6A 4J7JA 2K85A 2QGUA 1G8XA 4OAYA 2L54A 4RB2C 2Q1ZB 4L5JA 4TV8A 1R71A 2XUMA 1FJGO 1YRNA 4XRMA 2IPQX 3VPRA 4DV7O 3F5TA 2A6TA 3ASNH 2CAZC 3M7MX 4LFBO 2E74B 4NC7A 5LBQA 4A3EJ 2Y0SA 1DDNA 1N25A 2IVMA 4J7KA 1EZVH 3TO7A 3CP8A 2BSKB 4MQVA 5LD2C 1T8IA 2M6YA 2DODA 2X4HA 4DW1A 3I56V 4IHTA 3B09A 1N0JA 3AL0C 4AI8A 1LEAA 2QQAA 2VOOA 3OD4A 3BJ6A 3TO9A 1UB9A 5IJ0A 1KU3A 1WRJA 4NC6A 1DP7P 4BAYA 1R6KA 5DUKA 3ISPA 3VYTB 1GV2A 1J5EB 5LRSA 4DK0A 3JCZA 2G38A 2K5CA 2BVMA 3J7YJ 3H1KH 2JEXA 2EIJH 2OCEA 4ZHQA 1K73W 2DQLA 3GUDA 1R4NB 1D5NA 1WJFA 3LNQA 1XS9A 1SQPH 4I7ZB 4OWRB 1LE8B 3FZVA 1LB2A 2A0LA 4JGSA 4PDMA 1IO2A 4DYRA 1Z6TA 3GO5A 3Q0UA 4PJMA 2GTSA 3BABA 3ZHUA 2UXCO 4E6KG 4HLXA 2Y4UA 4KDPA 2F5VA 2IGNA 2ZFUA 4I4TA 3AG1C 2E2HJ 3KCXA 2VQFB 1NH2B 5C3EJ 4UFZA 5KHIA 2HU9A 4MEYF 5D8LB 1WWXA 4EV0A 3HKBA 2JSPA 4G7ZF 2H6CA 2DTRA 4BU2A 1L0OC 4LJZF 3K9SA 5LMNO 1R7JA 3D1NI 2PYLA 3HB9A 1MABG 3FHNA 3MCZA 4H0EA 2BCCH 2IJHA 3APOA 5EZYB 1A04A 2QE7G 3GTGJ 1HDJA 3HRTA 4UV8A 2WY7Q 2LH9A 1KU9A 6PAXA 4WF9V 2L4MA 1XCVA 3CRRA 1ZK8A 5JWPA 1R49A 1REPC 3JR9A 1XG1A 3HSRA 5L3GA 4G12A 3ZMUA 1NBMG 5EGOA 2R7RA 3ZN0A 4LF6B 4OINF 1E0EA 1RM1C 1G4DA 4RM3A 4RLQA 2WLIA 2EBOA 2WB1N 1E17A 1TW3A 1YOVB 3W6VA 3VOEA 1PKXA 3LDDA 3S3NA 3GTMJ 1H2SB 4F6EA 1IBLO 2M0MA 1JT0A 2YC0A 1QVGU 2P6SA 2H09A 2RGVA 2CW0F 4HG2A 2V1DA 1AA7A 1MMMA 3B2EE 5LOVB 1I5ZA 2V79A 4E7JA 1HNWO 3FM5A 4MEXF 1XMOO 1YW8A 3BG5A 3P9IA 3OMYA 4M9ZA 4CCNA 1CXZB 4HEA2 4J9YB 5EIBC 5H2FC 4B4CA 2F2EA 4F92B 5BY1A 4IHJA 4HQMA 4RM2A 1ZUQA 3KX2A 1UCRA 4AQYB 4LF4O 2R7DA 4F91B 4WX9A 3EQLF 1S5LC 2ESNA 3JD0A 2ZBKA 4X65O 3AG3C 2BW3A 4IHYA 2BE5F 1DLBA 4JAAA 3F8BA 3H1CA 3HOUJ 2ZD9A 2D45A 2EZPA 3BPXA 5J8CA 1H89C 2QEXI 2DK5A 1L1FA 4UV9A 3HHGA 3S3XA 5CBGA 2PQ8A 4KISA 2DMNA 1ZLJA 3S3WA 3RJPA 3DU6A 1D1BA 4N23A 5F27A 1N32O 3KEOA 5IPAA 4WFGA 1I1SA 5JVDB 2E5ZA 1V54B 3Q4HA 1G2HA 2Z2SB 2LVSA 3C2HA 2HPIA 1BJAA 2R4GA 3F8CA 1GN4A 5LP6C 4B43A 1ZSPA 3JSNA 5K7HA 3LWFA 3JATB 2ZM6B 1POGA 3KFWX 4ZI7A 2UXBO 3G1LA 1DP3A 2N8GA 4NB5A 2R7QA 2EFOA 3ZRGA 1OCZC 3E89A 1WFXA 3TOBA 4M3DA 1Y66A 4FPPA 4IGGA 1MGTA 5B3SH 3ERED 5C4XJ 3IL2A 2LFRA 3FDYA 3T1HO 2JPCA 2VWJA 3F0CA 2FRHA 3FMRA 1FXKB 3C3WA 4LLLA 2XAJA 1Q6UA 3SPHA 1ZH5A 3J80N 3KZZA 3EYYA 4DV5O 5FD5A 1IGNA 4JI3B 5HLIA 2GIVA 2WBMA 3S15J 1XSDA 3J81Z 1R6TA 1SZTA 4ENJA 3HKCB 3BZKA 4PFOA 1O7FA 2UWMA 1J9IA 4OOIA 3X2QH 1PNMA 2KQXA 1QCEA 2ZJ2A 5TGTA 3BT9A 3H9GA 4LLNA 1R3IC 3OR1C 2OC6A 4XL9A 4QNHB 4A0ZA 4O5VA 4BBSJ 5FRNA 2ZSIB 2AHQA 1Y74A 4E7SA 3K5OA 5JCOA 4JI2B 4Y3OA 3ZRSA 1ZTRA 1YW9A 1HSTA 5LEJA 2IU3A 3A8TA 1BI1A 1ZHFA 3KPHA 1NR7A 4KT6A 1RP3B 1XHXA 2DWEC 3H35A 3AK2A 4MW8A 4A5UB 2CH7A 4FM2A 4B8XA 1MBFA 3I56I 2HFEC 3TJTA 3C2GA 2VJIA 1GUUA 2VPLA 3GXOA 3BZ6A 4GDFA 1XMAA 3HHHA 2X6XA 3OE7G 4PHZA 3SEQA 2HOTA 3BG7A 4HF1A 5E3LA 4Q4ZF 2IAIA 1X4PA 1SKVA 2QWPB 1AU7A 2BXYA 1TQPA 4LIUA 3IUOA 4DJAA 4F7ZA 2LGQA 1BHBA 1WPBA 3JRIA 3MVPA 1P4XA 4Q48A 1R1BA 5IYCO 4J41A 2DT5A 1T5EA 4K0KO 5FD6A 4XKVA 3OMNB 4I50A 4MTDA 2X1CA 1P6RA 3T8TA 1FSHA 9ANTA 1UELB 3JTHA 4J01A 2X48A 3HSFA 1XILA 1Z5WA 2MLGA 2XOKG 3CF2A 1M5IA 2GUZA 3BTIA 2VBXA 4IL6C 3S16J 3ABKH 1LUWA 4N21A 4FFBB 4U7NA 1UG0A 4X0GA 2D5VA 3CCSV 4ETSA 4E7IA 2GV9A 2HR3A 1XL4A 3ASNC 4AU7A 2R93J 2DA3A 5J2UA 4DYQA 5FO5A 4FLZA 2MC3A 1W5SA 1W36C 1Y67A 5KHKA 4HW0A 1QBZA 2ZIMA 2EH3A 1ZELA 2K9NA 3JARB 1YJ9I 3B02A 4L9VA 2YI9A 1SANA 1OMIA 1Y0NA 4P55A 3CPWU 3P30A 3TEDA 3DPUA 2GBOA 2Q0AA 2JA6J 4B47A 3ASOB 1MBKA 1D5YA 1U8RA 2ADUA 3BA9A 5KUKA 1MG1A 3CMMA 1N34O 2KJBA 1JHHA 4QGPA 2Z33A 4X1YB 4FT8A 2B9SA 1BL0A 4FE7A 2BTQB 3RWRD 3PQKA 3WG7H 1XGOA 3I55V 1JKRC 4LFAB 3W7UA 3GFIA 2NVYJ 2YX4A 3OYMA 1E3PA 3K2ZA 2EIJC 2EFPA 1G3WA 5AONA 4ABZA 1O3TA 2OIEA 4I98B 3FYIB 2NRAC 3A1YA 3OYCA 3EVKA 5D4SA 4LF9B 4NXMO 4OX9O 2M4GA 3K0LA 2ISZA 4HPQA 4MVRA 5IYZA 2VQEO 2L9VA 2FNAA 3L72H 2ZMEB 4O4IA 3OS1A 1T98A 5HLGA 2DMTA 4I55B 2OT5A 4K35A 1O57A 1ACIA 2WLLB 2HHHO 3GLXA 1NH3A 3A01B 1CGPA 2Q5ZA 2VE8A 2GLOA 3DP7A 2M9HA 3HKZN 3UNGC 4C3HJ 2V4DA 5KAFZ 2L7MP 1XBLA 4MVOA 3OL4A 3N27A 4LMYA 1ETYA 1MMGA 1KGSA 2HFHA 3AG4B 3R0JA 3IH3A 2VBZA 2ACJA 2DFHA 4ANJA 5M5YJ 1Q1VA 1DPUA 4RB3C 2RVCA 4EEQA 1K6YA 3HPGA 1I7FA 3BY6A 1VFCA 1DU0A 1Z0XA 3CRCA 2JA7J 2JJ1G 3F6VA 1WPXA 4UB6C 2FKXA 4JX6A 2CS3A 5JHFA 3MZ8A 2EV5A 4ZDPA 1D5AA 5HNHA 2DMPA 2DOAA 1SAXA 3ML0A 1M56C 5BMVA 1Z05A 2J5OA 1VQ4V 4EJTA 3OEEG 5HFMA 1FOWA 3CUQB 1L3LA 4WBNB 2CQ7A 2E75B 4KITB 4G6TB 4ZBMA 2V9VA 5KK1A 4B48A 4X89A 3RYIA 4DK1A 2NVUB 3U0ZA 4XBFA 1QO0D 1TQMA 2AO9A 3FXOA 3PJRA 5BOXA 1YLFA 1IDSA 1DU6A 1M57C 3V4GA 1WP7A 2KKOA 1ZGJA 2EFWA 2JGDA 4JI6B 3F8NA 2F48A 1R5HA 1W4MA 4J19A 4IT5A 3GW2A 4HDVA 4U0WA 3ZQHA 3W7WA 3DCFA 4ESJA 3HXLA 1SS3A 5C8YB 2E5LO 5FFXA 4KYWA 2IBZH 4JV5B 1XTAA 2E34A 3E7LA 3HZJA 2DWDC 2QJ1A 4N9IA 1JPXA 2BHZA 1D1AA 3OL3A 3BR0A 3FIWA 2AQEA 2PLYA 5DM6V 5ILVA 3Q9SA 1YTYA 1Q43A 3W7TA 1QR9A 1NHAA 2CV1A 1N36B 1HKQA 2YPRA 2W24A 2FB5A 2W25A 2JS3A 4Y4RA 4NDLA 4B3SO 1Y4MA 3FMQA 2XASA 4A3IJ 3H3VK 4MFDA 2CUGA 4FVMA 4LCUC 4QPKA 1EJ9A 4X1KB 5FJ8J 4CHUA 1O9GA 1OCCB 3QYBA 4X88A 4UUVA 1S5HC 1WB7A 1MSWD 4MTGA 1S6LA 3L00A 3HOZJ 2DT7B 3THOA 2EZOA 1XSXA 2H6BA 3SYTA 2Y0SN 2Y9ZA 1T08B 1QLEC 4JI7O 3KETA 5EZHA 1ONVA 1X4OA 2FUG2 2OU2A 3FWEA 4A6EA 3BG6A 1SA0A 3TW6A 4KT5C 5B3SC 4D7MA 3TKYA 1XHZA 1VTNC 4IRGA 2HZDA 3HC7A 2WAEA 3CMEI 2Y9YA 1MDMB 3OV8A 3DSQA 2ID3A 4DV1B 2KT0A 5F0FA 3OY9A 5KMGB 1QVFU 1MW7A 2OF7A 4LOCA 1LE8A 1MNDA 4M74A 3QYFA 3CJNA 4ZYHA 1S5LZ 2HYFA 3W2VA 4CUGA 3L2QA 3CCSI 5DV5A 3S14J 1IXMA 1Z5VA 1WNSA 1QGPA 4XRSG 2EX3A 1R5GA 2ZXWB 4YJ2A 1HR0B 2A79B 2WY8Q 1S8NA 2K3FA 1NZ6A 2LSOA 3BJOA 2LYCA 2V9PA 1X19A 1ZGWA 2YU3A 1GT0C 2GSMB 3RYHB 4GLXA 2CFXA 4ESBA 1R22A 3RFRA 1NK3P 2DXIA 4LK0F 3DBHB 3N97A 4I9WA 1VQ8V 1AP6A 2KG7B 2CTWA 5EF6A 4JYBA 2HEOA 3PJSK 2L01A 3DXRA 1B8IA 4CC5A 3OT7A 1WA8A 4HX7A 1LJ9A 5EBMC 3CC2V 2QM4A 4X62B 5GP9A 3S32A 2ZE8A 2Q0OA 4G27B 1LFPA 3I55I 1WH5A 1B9MA 3WU2C 2Y69H 2IGKA 4G94A 3OTFA 1QPIA 2K86A 1RESA 1S7OA 1EN5A 5HVQC 5K1XA 3WHBA 4C2UA 3KLNA 2RQ6A 2Y0PA 5HODA 1I50J 2EINC 4EJOA 2O8XA 1OR7C 1X1BA 1Y6XA 1JGSA 2H8PC 3JSPA 4UCRA 2LNBA 4RGRA 1H9TA 1IDZA 4B7KA 5EYRA 3DEUA 3I0TA 4EMSA 5LOVA 3SZTA 2LKSA 2PEXA 2LDUA 2N05A 2CYYA 2TRTA 5F04A 2MABA 5LMUB 5B1BB 4EB6B 4O2AB 3C18A 2R5ZA 2AXLA 3TGNA 4TT3G 2WB1A 4HF2A 4YHHO 1QQIA 2YUAA 1TP4A 1GO3F 2JUGA 2VC1A 3PUBA 4KHPO 2VXDA 1SFUA 5IE9A 1W7PD 5KVRA 4UUJC 2ZR3A 3KG2A 3ZHRA 2LTPA 2CW8A 1ETVA 3G3ZA 4BIUA 2MSYA 5IOYA 3ABUA 3SJAC 3ZRWA 4B3RB 2RNGA 5KA5A 4FZ0A 2FOWA 3OEHG 2JRTA 1THZA 3IGAC 3L73H 3VQYA 5E3NA 1JR9A 3EXAA 4DO2A 2XPWA 1VQ4I 4BJTA 3AFHA 4ZDLA 2YXYA 3LDCA 3SYQA 2ICWG 2V7FA 5EDNA 4RAGA 1H0MA 1VQLI 4XKBA 4JTAB 2FBIA 4PCQA 1YI2I 2RKHA 3JATA 3TGUH 3C2BA 2F5EA 4B1RA 1PP8F 4B3MO 3RBZA 2JN6A 3NRVA 1K9MW 5FLMJ 1G3TA 4S04A 2MH2A 1W5CC 2HTSA 4IL6Z 2LQTA 3O8HA 4Z1MG 2P7VB 2V1XA 3F9KA 4H37A 1GN3A 1K7AA 1VF5B 4J10A 2RAEA 2E7WA 2EIMB 3L2UA 2CK3G 2B1IA 3HKCA 2FOKA 2O3FA 1I3AA 4CCOA 1KKDA 3PNYA 2LBFB 2K9PA 3TOAA 5JQGB 2VBYA 1JJ6C 1Z21A 1GDTA 2XAGA 4X1EA 2M8GX 4ESFA 2L4AA 4YIOA 1BE3H 2X0LA 2VIXA 5GPCA 1ERDA 4BIZA 3W6KB 1ETKA 1CF7B 3J81K 4PD4F 4JTCB 3QO5A 2OCCB 1GM8A 4MW3A 1ZR2A 3K9AA 4H33A 4TUYA 1ETWA 1SFKA 2PTMA 1SQFA 1FAFA 2QSHX 5FLXN 3QNEA 2VONA 2HEPA 4MHGA 1Q3EA 2IJLA 2PJPA 3OGIB 1LFBA 1FX7A 2MD5A 3GWOA 5LL6Y 3KP4A 4C7UA 1MZFA 5B1AB 2ZIOA 2JDIG 1KB9F 5KHDA 4UNOA 4NVPA 1AILA 2R7VA 1I08A 4NR1A 2ILMA 4CCJA 4EM2A 4MQ9F 2A6HF 1VNDA 3HGYA 3KP2A 5AIQA 4F52A 3CHXA 4XK4A 3L1PA 1I0HA 5FROA 3BR3A 1ODDA 1TVKA 2WLJA 4JI8O 3T4DA 4KUMA 4P9PA 1JUPA 3M99B 4LNUB 5DCMB 4CO8A 4CDGA 1XREA 4O2BB 4RUFA 3K4NA 3VOUA 1RR7A 2FD5A 5GAHJ 2MW2B 3D8CA 1R1TA 3J7AY 2EJ7A 2Y0IA 4B3TO 2FU4A 2R7XA 4UVCA 4JP0A 2CG4A 3F8FA 5A9GA 1G3SA 2IGOA 4CA0A 1V4RA 1BGYH 2CRGA 3MD0A 1NG6A 5FKOA 2ZNZA 4RGSA 3VYUB 1RI7A 2JZYA 3T1BA 2QWWA 1B6AA 1W5TA 1Z3XA 4BEHA 1QVTA 3I4MJ 4QE7A 4C2MJ 4X64O 3G71I 2HLDG 3RGBA 3H9JA 4UB6Z 4A3BJ 1RPRA 1ENHA 1WCMJ 2ISYA 2OIGA 4JPRA 1GM7A 1MSFC 4A6DA 3RVYA 3K4JA 1VQ8I 4X20B 4FE4A 3WU1B 3CCMI 1BC8C 2O57A 3K08A 4C3JJ 4BHCA 1NH2D 3AG2B 3CMAV 4JI5B 3CC2I 1FBQA 3BTLA 3M1EA 4U7DA 2OA4A 4G2KA 2M87A 5D5WB 4ENMA 4ABMA 2VQCA 1VEWA 3DPLC 5F08A 3MZHA 3KE2A 4GKJO 2FSWA 2LLKA 4IVNA 4A5MA 1K4SA 4X1YA 3WGIA 2BTQA 4A3LJ 3NEUA 5FGMA 3OSFA 5EBLC 2VQFO 4DV0O 5FNVA 1D5VA 3LSSA 3HG9A 3G2BA 1RSOA 3I4PA 4IJAA 1WGXA 1ZL8A 3ZIAG 3VQVA 4PA7A 3J7AU 5LYJB 1PYVA 4LBEC 2CJJA 2JRIA 3BR6A 4CYCB 5IT9Z 1SQGA 4FLYA 2BGCA 5D6FA 1OLTA 1AJPA 2IT0A 3JAKB 1AB3A 5GTHC 1JUMA 3P9KA 1YFHA 3F7VC 2F6CA 2DA2A 1APLC 4F4LA 4N4NB 1G8MA 2Z1DA 2DN9A 1IRGA 3GWZA 2EB7A 4FM1A 2P4VA 2YXLA 2V26A 3HBLA 5BR8O 2KZGA 4LH7A 1V55C 2RNBA 1V5EA 4CBCA 3L09A 2HQ5A 4I01A 2C2AA 4A3FJ 2E7XA 4I7HA 1ENVA 1S7AA 4PDRA 4IQJA 1XI1A 3GX4X 3LA3A 1I5YA 5BQTA 1XC5A 4GXOA 4PK4A 3VQWA 3HKZA 2JA8J 1OJHA 1QVUA 1KONA 2XKOA 2P81A 1WQ2A 4HSTA 4UUTA 1FMVA 1AOYA 2QGNA 2Y69C 4MTXA 3SJBC 2L9NA 1HNZB 3OAAG 1N0NA 2LD5A 4LF7B 1WJDA 3CCQI 3SGIA 2O8KA 5CA0A 4HAMA 4E7ZA 4HV5A 4DQ2A 1LUJB 1RUNA 1I6HJ 3QPLA 3IH4A 1Q90D 3V8LA 1JTXA 2KISA 1OYYA 5JJJB 3KZIZ 4GCVA 3OMIB 4P5OA 1LFUP 3CESA 2UXXA 1HDDC 2PF4E 5DECA 1PNLA 3CS5A 4PV1B 5IWAO 3PNTA 4E7LA 1IBKO 3LSTA 4P9FA 3GB7C 3UT5B 4O4HB 1GN2A 2L7ZA 3LSPA 2KRCA 3GVAA 4NQWB 2NN4A 1SFXA 4IHXA 3OYEA 4MT8A 4LFUA 1AI7A 3I3LA 4I99C 2F43G 5CKTA 1BBYA 3O3KA 2XSDC 1Q6HA 2ME0A 4JI4B 4II3A 2HXOA 4MFEA 1SFEA 1GHCA 3AK3A 2Q7GA 2CGNA 3ICXA 5CB4A 4EGYA 1BM9A 5LA6A 1PPJH 2K9QA 2N74A 1PJRA 3AL0B 1BT8A 2OTJV 1GAXA 2HKXA 4N0BA 3CCEI 2D1HA 2K4BA 4PJLA 2PI0A 1AR1B 4X1KA 2B9ZA 1RETA 4XR6A 2O0YA 1QLNA 1DK1A 2Z3YA 3BCCH 3N2KB 2IXSA 1BR1A 1M1EB 5E3MA 4BXFA 3WTWC 3IWZA 4S0HB 3PO2J 3HKDB 1YTFD 4LF5O 2AHZA 2K9MA 2M0CA 1WN7A 3EETA 2QM8A 2X7RB 4P9UA 2DU9A 2HQNA 5H20A 1HDPA 2KRFA 4RS8A 4RB1A 2BYVE 4QTRA 5C4JJ 1W36D 4HA8A 1KYOF 1D0XA 1TA8A 4U3JB 3SFIA 2DOEA 1XNRO 2GBYA 1EM1A 3P5JA 2ECBA 2L7KA 4D9JA 4CXFA 3JASB 2NAZA 1MKMA 4AD9A 3L2VA 4K2EA 2JA5J 2DQ0A 2CTPA 1G3YA 3ZP5A 3Q5FA 2LJ2A 2P5LC 2R5YB 3JRHA 3LSMA 2VE9A 5LGUA 3GF2A 4FQGA 2BXZA 5ILSA 3V7CA 2EIKC 1SVMA 3ETDA 4X1IB 3FBNB 1FIPA 2R7OA 3H3UA 2WLMA 3E86A 3H9QA 4DUYO 4NXNB 3C90A 3HTSB 1VQKV 5CA1A 1Z67A 2XF7A 4MNUA 4Z2WA 3I59B 5HLTA 3JCUZ 3JREA 4LLGF 2W84A 4XN3A 4A3MJ 1FFTB 3RYHA 4EFEA 1FBUA 3OYGA 2KIQA 1IXCA 3TL4X 1H2GA 1W1WE 3CCVV 2IEKA 3CJQB 1NVPD 1U97A 2A5YB 3CMAI 1K6OA 3MKLA 1UPGA 2VOPA 3B6AA 5E3OA 3WFVA 5IP6A 1ZRDA 2DA5A 5J40A 3HEFA 3RI4A 1BSMA 4DR1B 1F5TA 3ZQCA 1JFFB 5J4YA 3CDIA 4M9SA 3T2MA 3SYPA 3HUGA 2ZQMA 4WK8F 2ZO4A 3TDUC 1ORKA 1D8JA 3M8AA 4WFHA 5E8GA 5GPAA 3L74H 1N33O 3PNVA 2O5RA 4XMYA 5DEDA 3E6DA 2DLLA 1YS6A 1B04A 3AAFA 1X2NA 4XM3A 1DPRA 2ETHA 4BDYA 3P32A 5HFLA 2P90A 5ED4A 1NTKH 4MIMA 2DPUA 1K78B 1XDCA 1LKXA 2M1BA 3KP3A 4B44A 4LFCO 3CRMA 5GTIC 4H44B 1LNQA 4ZZLA 5KLVH 1YJ9V 5TISC 4D7NA 1FZPB 3CJRB 3I9V2 4RUEA 3AG3B 3CLQA 1N75A 2EFNA 2I10A 1R58A 3OIOA 1ZKGA 3HIFA 2OZUA 3ABLH 2KSDA 4YY3B 2EA4A 2Y31A 4QPOA 3SJMA 2DFIA 5CYVA 3G4SI 2M30A 4TQDA 4FETA 4DUZB 1YJWV 3ECOA 1FPOA 2F4IA 4HZ3A 3SR2C 1NTCA 2P4WA 2DMUA 2UXDB 1STZA 1UZCA 3T1YB 3ZQ7A 1GMGA 1FWZA 4MVZA 2Y0MA 2EBIA 2PJRA 3OYNA 1IRZA 4LF8O 1H2MA 1T0FA 4DV2B 4LC1A 3HOTA 5J2TA 1AJQA 4G8XA 1K5QA 3SPCA 1XNQB 4JI1O 5EZGA 3FM3A 2XGEA 3ASOH 1FXHA 4HNVA 2FEZA 3A0BC 1IBMB 1NKDA 4XOPA 1R00A 2P5VA 1YIOA 1ON2A 4M71A 1Y1WJ 1MJBA 3A03A 1U5TA 2HVQA 3RIRA 1HLVA 4I2OA 1H2KA 2ITDC 1QHHD 3ABTA 1FC3A 2QWNB 4U3FH 2P7TC 1BOBA 1FYMA 2E1NA 2LFSA 3OYFA 2WA4A 3K0GA 4GGGA 3H0DA 2VRZA 4B09A 3ZMTA 1R36A 3H92A 4AYBN 2Y4TA 5K7FA 1OCOH 3OTOB 2W1OA 4PSXA 1PUFA 1L0LH 2F23A 3L2RA 3ZHQA 4DR5O 4GX0A 4GKJB 3WTSC 2XAUA 3LSQA 4HNTA 1X4TA 2VQLA 2YEVA 4KIGA 3PO3J 5EYPA 1UMQA 5FPOA 2E1MC 1Y0UA 1H9GA 3E22A 1KP3A 4PI2A 1YJNV 1WJAA 1FEXA 1YCIA 5GW7A 2E3CA 2ZCEA 3GMEA 1TBXA 4IHVA 3GBGA 2XKPA 5CVIA 1PDNC 5DM6F 2YS8A 3KP6A 2EK5A 2JJ7A 2HOSA 3LSKA 1KQ8A 1VF6C 2KL4A 1BIAA 3D3QA 2NOGA 1AROP 4RQEA 2OTJI 3B73A 3BPVA 1H8EG 4WFBV 5JVTA 1VIBA 4DV6O 1ZAOA 2LGWA 2UUAB 1LQ1A 1TUBB 1E2XA 3NQOA 5CVUA 4QLCU 3QU6A 1YXBA 4XDKA 2VXZA 2PMHA 3CCRV 4DR6B 2Q0OC 2UUCO 3FX3A 1UHSA 4FZ1A 4LWSB 3ZHTA 2LC2A 2OYQA 1Q1HA 3H0GJ 3P9CA 1S5JA 3FYEB 2A6EF 4MTFA 2Z16A 1XSVA 1WHUA 3I64A 3ZHSA 4BQQA 4J00A 3LL7A 2YICA 2NLJC 4IIJB 5JH7B 2G7HA 3PQJA 2PY5A 1TT0A 4DR7B 4FK5C 3NARA 1I94B 1WJBA 2CUEA 4C3IJ 5LHHA 3WTUC 3O8GA 2A69F 2DA6A 4JYKA 1YO5C 4K8XA 2FL4A 1M93A 1HQCA 2YSRA 3ZQGA 1VP7A 3RYRA 2X6AA 3RKXA 1PVEA 2YIBD 3HKEB 3S3OA 3ASNB 3T8RA 1WVRA 1E1RG 2DYSC 3A0RA 3QF7A 4KFMA 3D5SC 3DPTA 2Q2EB 3WU0A 2OQGA 2WA3A 1D8KA 2QSFX 5KCMA 4KMFA 2HJFC 3IC7A 4JF3A 4JASA 1UFMA 2XF5A 4NBQA 2BHYA 1KZHA 4JZGA 4JYAO 2BTOA 1GKFA 1VQKI 1XPXA 2ECCA 4H13B 2GXGA 3SPIA 1UHWA 2EV0A 4BGDA 3JAMK 2RMKB 3EUHC 5JFRA 4ZZDA 1MZEA 1U0JA 3CCVI 1Y8RB 4GKKB 1VZ0A 2F5FA 1HNXO 4EATA 2CDYA 4X20A 2ZKOA 3QG5A 3ZOBA 2DTZA 5H5NA 3CMEV 3BR2A 3D5RC 2EIJB 1TWGJ 2XGXA 2R7WA 1LVAA 1QZEA 2ZNJA 1VQNI 5GONA 2WAMA 1OCCH 2DT6A 2L7FP 3ZMDA 4A3KJ 3A2KA 3JRFA 2KDOA 2ELHA 2MG4A 2VBWA 3D36C 4YJ3B 3RCOA 1K83J 3PM1A 5L3CA 1NVPB 4XLHA 3BG9A 5CPRB 2QKSA 3R4KA 2ELKA 4A12A 2W48A 2LMDA 2UU9B 3H5AA 3CDLA 3TQNA 3PIPF 2O61A 3DTIA 4OU0A 4U88A 1HP8A 3QOPA 1MH3A 4DV3B 3CJHB 4AIKA 5LYJA 3OYLA 2P4KA 5DM7F 2F4OB 4CYCA 4LG3A 1EH8A 1XL6A 3E5XA 3SXYA 1EN4A 1U8BA 1BCCH 3JAKA 4RA2A 4V2FA 2WLKA 3AK1A 1B72B 4AWXB 1Q8IA 2RDCA 1F23A 1L8DA 3K5NA 2CUFA 4DZPA 2V6CA 3V7SA 1K97A 1YJWI 2F4VO 5IT9K 4M3EA 3M8EA 2RQQA 3JAWB 1HNWB 3T5XA 3ETGA 2DYRB 4PDLA 2RDPA 1M56B 2UZKA 3OOPA 1A5JA 2X85A 1OQYA 4M3GA 1MBEA 1F1ZA 2HZTA 2R3SA 5F1JA 1W59A 4AILC 2M4KA 4JQFA 1NS1A 4RWUA 3ZPLA 4YXWG 3VYSB 3RQIA 3GFLA 3KEQA 4U87A 1TLHB 2KQRA 5M3MJ 1M57B 2K27A 2P67A 1RUOA 2XAFA 1W7PA 2UUBB 1GLNA 3UCSC 3UM7A 1MBGA 1PD3A 3S1RJ 4OAZA 1Z6RA 3V42A 4Q5SF 4BW9A 2DA7A 4DR3B 3S2DJ 1AI4A 5BXZA 1OKRA 2QUFA 4YFXF 4XRFA 2A9HA 4YEJA 4UCTA 4FM0A 3IHUA 1V5GA 4A0YA 1WH7A 1FYJA 2PZSA 1FS0G 3K03A 4IPAA 1ITYA 3ABLC 3IWFA 1IN7A 3CC4I 2XGCA 3MKWB 1P4AA 4O4HA 4M6XA 1GH6A 1G1XB 1YX3A 2IA2A 5FPRA 2P6JA 2XHBA 2ZDIA 2DO7A 4NQWA 4R1HA 1YJNI 5IP7J 1EH7A 4DV7B 4PJJA 3BCBA 1A36A 2F5DA 2GM4A 2GQQA 5E1XA 4DRXA 1CEZA 1G59A 4LFBB 3K5MA 1WKMA 3W2WA 3P7NA 3HTUA 4IEJA 3FB7C 1K79A 2LKXA 1VQLV 1NR1A 4E4HA 2PGGA 3QO7A 2Z0AA 1YI2V 3RKQA 1JUSA 2NNYA 1VQ5V 4ZOLB 3SJCC 1TWAJ 2M8EA 2QQ8A 2XB5A 1QLEB 1XDSA 3QAHA 3CCRI 3LAPA 2XROA 2QBYB 2D3OW 1J95A 2J5PA 2LREA 2JSCA 4OMZA 5LFAA 4RGXA 4JI0O 3CZ6A 3ZMSA 3OIQA 3K06A 2H27A 3MDSA 5CBHA 2V4JC 3TBIA 2MC4A 3DTKA 3E5QA 1VMGA 2LW7A 2OCHA 3RQ4A 3PIOF 2IH1C 1NK2P 3HKDA 1SD6A 2M45A 2MH9A 3LSJA 1G4YB 3L75H 5JJNB 4CZCA 2WTEA 1ZREA 4J42A 4D7TA 3GFJA 1BC7C 2AW9A 3SEZA 1OCOC 2X1DA 1F9NA 4LH6A 3SZGA 4MTOA 3BAAA 3U2RA 1SC7A 4OPAA 5JI6A 3WTVC 3KKYA 1V5FA 4M73A 5EC1C 5TISZ 3K7AJ 4FJCC 4O4LB 1Q86W 1A6QA 1TW2A 4E70A 3PFYA 3PUFA 4Y7NJ 1U9NA 5J4VA 1PUEE 3JASA 2FX0A 2JK3A 2UXCB 3HPLC 2ATKC 3ZGKA 4OPHA 4CZZA 4YIIA 3CTAA 4M6YA 1K33A 2R5YA 1WI3A 2CSOA 2EIMH 2L2OA 3RZDJ 1ZRCA 2BSKA 4QIWF 1XMQO 1OZ0A 1RRJA 4OMYA 4J7ZA 5LMNB 1T95A 3OWTA 3E1SA 1J7KA 1YQAA 3TO6A 3WTZA 1MJ9A 2AXTC 2MBFA 3BP8A 3N2GB 4KICA 3TXQA 1SERA 2E2IJ 2NOJB 4CYDA 1SD4A 3S1NJ 2CO5A 4X66O 2E1CA 2VL8A 4DBQA 2DA4A 2OCCH 3IAYA 3A0BZ 5GAGJ 3PSIA 5H2FZ 1X59A 2MK3A 4PI0A 4UUSB 2YU9J 2Q69A 2LF7A 5LEKA 2UUZA 3GZ5A 1IX9A 3X2QC 1ULYA 2EINB 4QPQA 1SFOJ 2JRMA 2LG4A 1P9QC 5B1AH 1IBLB 4N9HA 4DR4O 4BXXJ 2JUCA 3U10A 4GCZA 3DV8A 1S76D 2OTLV 3OR7C 2P0WA 4RMNA 4PGHA 1XMOB 2W82A 1YW7A 1TUEB 3E8HA 1K78A 5KUMA 3G71V 1Y56A 1YRNB 3CUOA 5HS8A 3S3MA 1H8HG 2LY2A 1P4WA 3BROA 1QNTA 3WB1A 3CCMV 1U9OA 4XN0A 5FLVA 5EZYA 2KRHA 5M5WJ 1XQ8A 4LF4B 1S7EA 4X65B 1Z7UA 2CQQA 4QPJA 3EPZA 4JOMA 3MWMA 3Q0VA 1EA3A 4A69C 2Z99A 3IJ4A 5J1YA 3L7WA 4J80A 1SEUA 2DPDA 5DCFA 4M9XA 2FBHA 3QPSA 4I09A 5IY5H 2XVCA 2NR5A 1KP2A 2YSUB 2LRDA 2MYSA 2WV1A 3L9FA 1GXPA 5F1RA 1AI6A 4R79A 2GXBA 4BE2A 4BYYA 1LUVA 5ITZB 2BY1A 2V9KA 2QENA 3QP6A 2PBIA 3KZYA 3S17J 1N32B 2K3PA 1KBHA 2O6GE 2VJJA 3TXSA 1RNLA 3K70C 4FTHA 4LD5A 4V19K 1N78A 5E17F 3FISA 3BR5A 4WWCA 3AG2H 3ABKC 3ETQA 1J0RA 1XN7A 3ZRXA 1HCRA 3LQRA 5DN6G 2UXBB 3I54A 1CQTA 2ZXHA 5TRDA 4BR6A 2P8TA 2GHYA 2YIAA 1X3WB 3CX5F 3RKYA 2K4JA 2OUMA 4BH9A 3K04A 3R60A 2R92J 2ZNYA 3OS2A 5JR3A 2NYXA 1EZJA 1KQ0A 4CH5A 3T1HB 4DV5B 4FISA 4MVSA 2KJCA 3S93A 5B5EC 2A3SA 3SYCA 5DD4A 5E1ZB 3JD4A 3Q0WA 4BBRJ 3HKBB 4J11A 4ZYGA 4M3FA 3B40A 3GVMA 2RC4A 1D3YA 3L9DA 4XIDA 4JX5A 3LSIA 3CSXA 2STTA 4BQNA 3BHPA 1Y39A 3DKWA 2Q4PA 5DUIA 1PP7U 3WG7C 2I5UA 4O3MA 2NS8A 1SZXA 1JJOA 2JT1A 3CCQV 2KPMA 4W4KA 1JT6A 4AYBA 5JVDA 1ZX3A 1J5EO 2IW5A 1X1CA 2D1VA 2CUZA 2WA0A 3NWSA 5H6QA 5EGOB 3M07A 1VQ5I 3I5UA 2ADPA 5CN0A 3SDLA 1S29A 5E1WA 1G6NA 1IG7A 1CP9A 2WLIB 3FMSA 1TUBA 2IH3C 1J2XA 2QVOA 4HNAB 2VN2A 1BR2A 5FKMA 4CICA 4OIQF 4ON0A 2B63J 2LK2A 5JLXA 3MD2A 1DGSA 1E79G 1OCPA 5ICGA 3O65A 1FXKA 4UCSA 2G7UA 4LWSA 4EFBA 5E20A 1AHDP 1MZBA 1FTTA 2EQRA 2Y30A 5D6EA 3OYDA 2X6CA 4IO9F 2QCOA 2JWTA 1IV8A 4UVAA 2XC7A 2ZXIA 2DCEA 5CVVA 1GXQA 4YRVA 2IS6A 1BW5A 4IIJA 5JH7A 4K0KB 4U0VA 1FP2A 3UKMA 1K4CC 1TZLA 3IV5A 2Q8VA 1XDUA 4G7HF 5J8FA 1FT9A 1VARA 4MO7A 3H1LH 4IHJB 4BJ5C 4MLOA 2RCVA 3LDEA 5JJEB 3U1KA 1ZG5A 1QU7A 4MVQA 2P5KA 3JD2A 1MD0A 2ZNIA 1KKCA 2XIGA 1S77D 4YIRX 3MHHC 3IKVA 3FXMA 3J80Z 3CCEV 4H4KC 4LGWA 4XLCA 3DBRB 3FKJA 4IZZA 2YXHA 5D5PA 3ABMH 4LF6O 2VODA 4DNCA 4JAUA 1O3QA 1LEBA 1IXBA 1OCRB 2DJVA 2VPRA 4EGZA 2H8WA 3GFMA 3CCYA 2JJ2G 1A6IA 2PN6A 3J81N 4UCOA 1Z1DA 3Q4HB 2DJIA 5D5VB 2KB1A 3QVNA 2E1OA 1KD1W 2GIZA 2MA3A 2O03A 1T0FC 1ORQC 4Q20A 3CCLV 1N34B 2QM7A 1F51A 1YVWA 2OZ6A 3W7SA 1YZBA 2FQ3A 4JYAB 4NC8A 2Q8KA 2E2JJ 4YG2F 3DLLF 3WE3A 3LSRA 4G6QA 3JAMZ 3ZXSA 1WJEA 3OS0A 1OJLA 1W0TA 4IKFA 5DDGA 3B77A 3TW7A 1U5TC 4YJ3A 2QTOA 3JTGA 4MS2A 2FQ4A 2RN7A 4AQYO 2BVLA 4NXMB 4OX9B 3L2CA 4FFBA 4V2GA 2Y75A 3BC8A 2NNNA 3J7ZI 4AIJA 1R6RA 2VQEB 5LMUO 4BIOA 2OTLI 3L70H 3CRQA 1ZYRF 2I8DA 4IYIA 2HHHB 1SQBH 3EUKL 3VEPA 4DOZA 1T39A 3BA8A 1EFRG 5CBFA 1JVMA 2EILB 3U1DA 1V55B 4Q6GA 4MGRA 5L3FA 3JARA 4LB6B 1WLEA 1G6UA 5FKNA 1X2MA 2DDAA 2NVTJ 3SHFA 4R50A 4FMTA 3F7YC 5F2VO 2R9RB 1QR8A 2VKDA 3ETEA 5EIBD 1X1DA 2B0LA 3MAQA 1B72A 1P84F 2CH7B 4U7BA 2ZM6O 2CTRA 3ONQA 3HSEA 2WWWA 1PL4A 2HTJA 1S9HA 1JMKC 2Y69B 4QE9A 4L5IA 2PG4A 3DC6A 1VQ7I 4IOCF 1BL8A 3K4KA 4IX7A 4DR6O 1AI5A 4DW6A 2NVXJ 4PA3A 1SRYA 1XMXA 3ECHA 2V1UA 2IRFG 4JI3O 3IRQA 3VSLA 2EJRA 1UAAA 3D3IA 2A61A 2HKOA 4PGGA 2H94A 2ZMEA 3V8KA 3O6BB 4I50B 1BR4A 2LP7A 4I55A 1LVKA 1VQ9I 2LR8A 3SQNA 1NTMH 4DR7O 3MZYA 2DOSA 1GVDA 1OYWA 2JPBA 4YIFA 3A01A 2WLLA 4P9OA 3JSLA 4R8CA 2K9SA 3MHSC 2A07F 3UKGA 4F3QA 4A3JJ 4JI2O 3FX7A 1N8RW 2E5LB 3G4SV 2QYOA 5B1NA 1J5YA 5EEGA 5BPIA 5JCOC 3CP2A 4PSWA 1P7BA 3IH2A 3ZMVA 5J2UB 3JRBA 1M1KW 5M5XJ 4II2A 2L5QA 1IV6A 3KIOA 1ZRFA 2MLKA 4DZJA 2B1GA 3IP4B 2JVDA 5CA3A 4Y15A 4ZC3A 4Y52J 3QWLA 2M5WA 4GX1A 1K8AW 1IXRC 1D1CA 3A2FA 3SPGA 3AG3H 4Y13A 1BS3A 3OYAA 4OIPF 4B3SB 1U3EM 2L6LA 1D2DA 1BA5A 1Z91A 3K69A 1E3HA 2AHYA 2ME6A 1OCTC 1OYIA 2KFDA 3KCCA 3RKWA 2LFBA 1HBXG 4IYHA 4NNJA 3CUQA 3FKIJ 4TSFG 2FF4A 4F6RB 1MBJA 4WBNA 1TTYA 2YUSA 4PELA 2E60A 2BY2A 1U96A 1WJCA 5J1RA 3BPZA 4MSWC 2R70A 4JI7B 3FB6C 2HVKC 3K2AA 3P3NA 1Y8QB 1UJ8A 3BZCA 1SD5A 3QO8A 4O4JB 1GN6A 1LDJA 1USSA 4G9YA 4OGQB 1FJGB 2BOLA 1RZ4A 3D0SA 3AG7A 5C8YA 4IF4A 1YG2A 2DE0X 4O4IB 4E2LA 2IS1A 4L9TA 2BBYA 2V1NA 1N77A 3LFKA 3PSFA 3ZQLA 1R3JC 3S1MJ 4F93B 4X8AA 2HYGD 2XRNA 2YR2A 3O2PE 4FX0A 3F23A 2EZKA 2EPFA 4IXAA 1RKWA 2BOBC 1YDXA 2EIKB 2GA2A 2WLNA 2DFEA 1KMIZ 1Y76B 1SVLA 2BY0A 4RAZA 4K8ZA 2XNDG 3EFFK 1NTZH 5JHUA 2WLHA 2YI8A 2WWYA 1IN4A 3WU2Z 1VQPV 5EG0B 2ZKZA 4L9NA 3FXUA 1R9TJ 5L3DA 2ZE7A 4PDVA 4DV4B 1YE9A 1KUQA 3KYLA 2LY1A 4I0AA 4LFAO 4XQFA 3CQZJ 1E1QG 3F6OA 3GTJJ 2ZB9A 4HYEA 1USTA 2Z9OA 2DI3A 2YS9A 1ZWIC 4P2ZA 3CLOA 2YIBA 2QKLB 1V54H 5A2QK 1WB8A 3CXCU 1B59A 3COAC 1HW5A 2IJIA 3FXJA 4LF9O 3NAUA 2QKAA 3LQQA 3CCLI 1KC8W 2WV0A 3O9OA 2M2EA 2PMUA 3A02A 3RYIB 3QPTA 4XSZF 2A68F 1U2WA 5CJ9A 2BOCC 4ZTJA 1MDMA 1EN6A 3AG1B 2VJ4A 4HF0A 3F8MA 1C0WA 1Z77A 2JVGA 1IN8A 4XLNF 4UUSA 1EBOA 1RFYA 3M9AA 2RV8A 1I27A 3F5WC 2QWRB 5KMGA 1ZLKA 3G73A 3STLC 5B5EZ 1RC9A 4DW0A 5E79C 1OR7A 2COMA 1HC8A 4PA4A 2O7OA 3I58A 4Z1VA 2YDEA 2L02A 2KHMA 2GOXB 2F93B 5HLHA 4HRIA 1PNKA 2KKWA 3K1NA 3M3YJ 1B1BA 5F0HA 3IAS2 2OJED 4GO1A 4BQOA 1R3KC 1M4UA 4WFAV 3OR2C 3E97A 3ULQB 2XAHA 3GLLA 3HM5A 3OYKA 2P06A 3C3SA 5KAFC 2ZSHB 4NKGB 5K1PA 3ABMC 2QM3A 1T33A 2ZDIC 4YHHB 3ELKA 2IS2A 3W7XA 1FMWA 1I1GA 1BOAA 5EC2C 5LRRA 2KG7A 3D36A 1RM1B 4LR3A 4KHPB 4NHJA 3CYOA 2BE3A 2WAQN 1P7JA 4EEFG 1R4MB 2EFQA 1KYZA 1VQNV 4I6ZA 3CD6I 3E6CC 4UY8I 2BZTA 3GEZA 1OV9A 3JRGA 3MEXA 1Y1VJ 5J9PC 5L3EA 2GXAA 4RAIA 2ZC2A 3HRSA 4AM3A 1AVMA 3BEHA 3NR7A 3DTEA 4JI6O 2HQRA 4DBRA 3Q3SA 1I5XA 3SJQC 5ITZA 1SA0B 2Y48A 4HBNA 1JJ2U 5TJJA 3T0YA 5C44J 1QA6A 4A3GJ 1F4MA 3E6MA 2GOMA 1S72I 3JD1A 4GX2A 4NTYA 2VT3A 3CC7V 3VB2A 4YELA 2OBPA 2YX7A 4KNYA 1IUYA 4JV5O 3IRRA 2X1EA 1HW1A 4GRIA 2EZIA 5JVGF 3OUFA 4B3MB 3OYHA 4CSWA 4JTDB 1GVJA 1JHFA 3FBIB 4JYCA 3LOCA 4YFKF 4I9QA 3I4NJ 3RVZA 1SQXH 2QWOB 4EB6A 4U0YA 4E7HA 2KMUA 2MFZA 4Y17A 4O2AA 1N36O 3Q9VA 1HW2A 4I0XB 1UHMA 1FOYA 5J1UA 2E1MB 4YJ2B 1ZN2A 2DBBA 1FTZA 3BTJA 4CH6A 3RZOJ 4PA9A 2GDSA 2RN9A 3HJEA 2CUJA 4A2UA 4BQAA 2AGAA 2F4MB 1GK9A 5LP6B 1QZYA 1SAUA 2ZJRF 5KHJA 5HS7A 4C9YA 5EEAA 3KCYA 4KFCA 4EM0B 3DBLB 3F3XA 2RNJA 4KL1A 3RYCB 1OCZB 3DXRB 3LA7A 3CCJI 1B8IB 4RGUA 1WA8B 3BFRA 1Q82W 1XGMA 2IGMA 2K40A 2ADQB 3IC9A 1BHAA 2VKEA 2L0KA 5B1OA 4R6ZA 2FYUH 3VDXA 1MJAA 4B7EA 5LLQA 2VASA 2CGPA 4DV1O 1IRFA 2DYRH 4HNUA 5FNVB 4P1WA 1WJZA 5LGTA 3QRFF 2V7QG 4HNAA 4H0LB 3WODF 3E6BA 4Q47A 5K5RA 1UJWB 3EUAA 3ZR8X 2HVJC 4CS3A 5HDGA 1R3LC 3OYJA 3VFZA 3RYFB 3TETA 2M34A 3WGGA 1F36A 5ICEA 4BE1A 2QDOA 3CC4V 4JI8B 1HR0O 2XAQA 2IA0A 2FTKA 2LO1A 3K0DA 2HJDA 3J7AO 3D5LA 1T38A 2DYSB 2P22C 2LBFA 3M7GA 1CPYA 4W4LA 2EZHA 3K9TA 5JQGA 3CXHF 5FKKA 2DJNA 2RREA 2R5ZB 3G6EV 4IRHA 1XB4A 4HDUA 2JA2A 4B3TB 3AEIA 3QTCA 4HYOA 1VQ6V 3FXLA 4DIQA 3HB3B 2XDVA 4WXHA 1HSJA 2LKPA 1ZGAA 4BKXA 1JKPC 1CF7A 3AG4H 1DF4A 2VS0A 5DS9A 3GYHX 1FPQA 4XLFA 3GTOJ 3ZS8C 1VQPI 1SMYF 1O3RA 4X62O 5GADJ 1B3QA 2L9RA 1MSDA 2HNHA 3V8JA 3LA2A 3C3TA 2N04A 4X64B 1R1UA 2BEOA 2CMPA 1RPWA 2VJ5A 4AIHA 5BMZA 1N4CA 2P5OA 1MNMC 2DDBA 1ON1A 2ITCC 2W7NA 4IHWA 3ZRWB 1IN5A 2K9LA 1HKSA 2G9WA 2DMQA 3S1QJ 1D0ZA 1RR8C 1DF5A 1AJNA 3GTKJ 1O3SA 1I3QJ 1DGWY 3FK7A 3J80K 5IYDJ 4XNFA 2WSSG 2AZ0A 4ZYDA 1U6GA 1V9PA 3LSHA 3HOVJ 3RPUD 4XRSA 1MH4A 2TDXA 5LHGA 1JA8A 3GTQJ 1MSEC 2Y2ZA 4YFNF 4LNUA 5GTHZ 4CS2A 1J75A 5DCMA 4O2BA 4I76A 3K10A 2A05A 5FLXZ 4EM1A 3G80A 4TV9B 3K59A 3NWTA 1V3FA 2M7BA 2OV7A 4D5CA 5IYCJ 5H6RA 4KA4A 2CE4A 3K1MA 2E36A 4QSHA 4RO2A 5BZBA 4NTWA 3K4MA 1BW6A 2PYJA 4N4OB 1BQZA 1T2KA 3R65A 3DWLE 1P7GA 1XX5A 2BV6A 3HOXJ 1FBSA 1XGSA 2Q9LA 5CMUA 3SDBA 4DV0B 1WSUA 1HXDA 4X6AJ 1B06A 1NQTA 2E35A 4XDJA 3RN4A 4EVIA 3K70D 1KU7A 4R8HA 4B3RO 2W00A 3PFIA 2HDCA 5ICCA 1US6A 2AZ2A 3FK6A 3B6CA 2X6YA 4XOTA 4UHTA 1MMDA 1BN5A 2STWA 2L35A 3BJAA 3LNMB 4TUYB 5KA6A 5BR8B 2GZWA 2D2CB 1R1VA 1ZAUA 4ZYAA 3WGHA 3T1CA 2FE3A 2ID6A 3LSGA 2FJ1A 3M1CA 4XLEA 1FOXA 1V54C 3T4ZA 2ODMA 3JAMN 1TWCJ 1X1PA 4JX4A 3H5RA 2CH0A 4IRIA 4DV4O 2VQGA 3KYCB 2KDZA 5IYDO 2OQRA 4S05A 1AR4A 3H1IH 4MVUA 1M90W 1IN6A 4XDLA 3A0HC 3R0AA 4ITVA 5D5XB 1MOFA 1BI3A 1VQMV 4RAFA 3CC7I 1FXKC 1TVKB 2Q73A 2HGCA 3OSGA 2HVRA 1YF2A 4FIPC 1J59A 5D8KB 4B08A 3JSOA 3RPQA 1YEWA 5KX5B 3ZQQA 2IU0A 2R9AA 2BY3A 1AKHB 4XKCA 3FF5A 4FLXA 4M72A 3LMMA 3M8FA 1TAEA 3K5LA 3DTUB 4ZKIA 5IWAB 3BQZA 2XTAA 2EINH 2ZXJA 4A0XA 2QR4A 1IBKB 3HGGA 2K02A 3WTTC 3I53A 3ABLB 4NYKA 2XPVA 3NXSA 2R7UA 1DQUA 3DFGA 5K5QA 4HLYA 1GRJA 3B8MA 3K1PA 1ETQA 2FBKA 2PMZN 4BEHB 3CRAA 4UVBA 3FAVB 3HR0A 2HI3A 2ZXWH 2IBDA 4D5FA 3I5DA 1MNGA 2F5CA 4WF2A 3SPJA 3IAM2 2R7ZJ 2X6OA 3BR1A 5CLSA 3R6SA 3JRCA 1H2NA 4GYCB 3EHBB 4FX4A 4NUBA 3HYIA 4I0BA 4KJZA 1ZG3A 1JTYA 2EA2A 2HP8A 4LG0B 3H36A 2R9IA 3E0JB 3GCMA 1FYLA 4FLWA 5IT9N 5IYBJ 4FLUA 3L2WA 3KYDB 2IJJA 1PP9H 3JALB 1Y6IA 3DEWA 2VQHA 4L0YB 5ERIA 1QU3A 4CH7A 3BCAA 4M6VA 1YIJV 2O9LA 5IJ9B 3VSKA 4F6RA 2VB6A 4CCKA 5BS6A 5K5OA 2Z5UA 4ENKA 1IF1A 4KP4A 4TOIA 1K3EA 1HWYA 5E79Z 4FLTA 3ZN1A 1RSOB 4LF5B 1ZARA 1R6NA 1OCOB 1BI2A 1FD9A 1ZL8B 2B5UA 4O4JA 4AHCA 4DR2B 3C7JA 3ROUA 3CF5F 3K4LA 3UT5A 3JYCA 2X6BA 3H9VA 4UCVA 2Q68A 1XNRB 3BLYA 2Q6AA 2JQ7A 5EJCA 3BTCA 2CQNA 3AKZA 1BMFG 1QNMA 3G6EI 3FD9A 2W85A 2EZLA 5B1BH 4BDZA 3G1MA 1VQ6I 3K79A 3FFQA 1MMAA 4OIOF 3OW2U 2XB0X 1AP5A 1NI8A 1QHTA 3ML6A 3UQ8A 4UB8C 5F0CA 5BPDA 4RAYA 1PM9A 1Y76A 1IURA 3GZNB 1A31A 1FOKA 2OWOA 3OUSA 3S8PA 4PJ0C 4D7SA 4JI5O 2M3AA 2MW8A 1VF7A 4DUYB 1TT5B 2W57A 3R61A 4KN7X 2F1MA 4FLVA 4U3JA 2K7LA 4PZJA 4IQ4A 2QSAA 3ASOC 2FMLA 5EG0A 3ZX6A 2NVQJ 4DYLA 5B3SB 3CO7C 3RYPA 1F7YA 2GA1A 2CQXA 3OIPA 1OHHG 5AG2A 1UG2A 3N05A 2CQKA 5IYBO 4LITA 3RW0A 3HRMA 2FNPA 3ZMZA 4C30A 3N2KA 3DGEA 3ZRVA 3QP5A 1FFXB 3STZC 3VQXA 2DYRC 2DQ3A 3QPHA 3IFXA 4R7CA 4M3BA 5CA0B 1HKTA 4AC0A 2NS0A 1R73A 2M7AA 5GTIZ 4HV6A 3X2QB 4LP8A 1FIAA 1FP1D 2KIFA 3JRAA 2QZ8A 5M3FJ 2JTVA 3KP5A 2W6JG 3JW4A 1N33B 1JX9A 2LW1A 3TDZC 2ZMEC 3H5NA 2WAFA 3KLOA 1DUXC 2F66C 3OM3B 1YHQV 4D6TH 1URFA 5GAEJ 5J47A 2KZVA 2Q7HA 1FY7A 2ARHA 5JLWA 5A2QZ 1TWFJ 1ROPA 1TNTA 3MKZA 2ZFWA 4X1IA 2HPMA 1DGRM 3OGCC 3APQA 2NS7A 1A32A 2JIZG 2L3DA 4LFCB 3E8BA 1QPMA 3AG4C 1JI8A 1QRYA 4B3XA 5LXTB 1S0VA 1UFIA 4L9JA 3I59A 4L8JA 1TWHJ 1SF9A 2R72A 1HF0A 4GYIA 2X51A 3BDDA 3VBBA 5CB4B 1HNZO 2PUSA 1TNSA 4AVPA 5LA6B 3KP7A 5AIPA 1H88C 4BY1J 2W6IG 2JS5A 4A5NA 3S2HJ 4K3AA 4LF7O 2A5WA 4ZYEA 1AR5A 1A35A 4BE0A 3WTXC 4O6JA 4KIBA 3CP1A 1MMSA 1JFFA 1K5SA 1FJLA 3CUQC 4HZFA 1K4TA 1OCRH 2XHKA 1DTOA 1PV0A 5KAIC 2FXAA 3ABKB 2QF7A 4DXWA 4LF8B 3RDIA 3ZQFA 1WZ2A 4TV7A 5B66C 3ZBHA 3WTYC 4CCLA 4CH3A 1VQMI 1Q81W 4JI1B 2RQPA 3PL8A 3MMYB 1MMNA 4Z2YA 1SESA 4WFEA 2KIMA 2JMWA 1MIJA 1S3JA 3C1DA 2PX9A 3W6JB 1H38A 1COWG 4LB5A 2A7WA 3HOWJ 3FKSG 2WAQA 4TV8B 4XLPF 5H9CA 4EJUA 2IA1A 3PN1A 1RPOA 4IOAF 3LFUA 2GTAA 2OAZA 1JKQC 1FXVA 2VWKA 2G0EA 3KZIC 5IT3A 2D2WA 4MVMA 4JI4O 2FMYA 3GWKC 5E18F 4BWAA 3LSUA 3EYIA 3WE2A 1RIOH 1TC3C 4FCYA 3E8FA 2QQBA 2OPTA 2LP0A 4DR5B 2DOFA 3QYEA 1JJ8C 2VT2A 1Z2GA 3WG9A 4XKWA 4WXCA 1B9NA 4I0XA 3WG7B 5CA1B 1XOUA 1VQ7V 1NG7A 5IJ0B 4G7OF 1ZTEA 2E76B 4GZRB 1BZKA 3GZ6A 5KHGA 3REOA 1H8AC 1OCCC 2HVSA 2EILH 4AVZA 1V55H 3CDHA 2CTQA 5LP6A 1VF6A 1BIBA 1RKTA 2DK8A 2MGQA 2HWVA 2Q7EA 2WC2A 2ZE6A 2NNUA 4QJFB 4ZHQB 3RYCA 1O4XA 3H01A 3DXJF 5DD8A 3SYOA 1WAZA 3UO2A 4DV6B 2ZJQF 4G6DA 3HDDA 1VQ9V 3HUGB 3R66A 4ENNA 4L5EA 1K7DA 2CV2A 2UUCB 1YIJI 1H2LA 4WCGA 5EK0A 3SZPA 3BQYA 1KA8A 3VYRB 3LNNA 4UXNA 4A3CJ 4I02A 4I4TB 5D5QA 4L18B 1P7IA 1JE8A 1F43A 2WADA 3K4BA 1MA1A 2L9SA 1XEQA 2YIDA 1LPQA 5LHIA 3ERMA 3K3WA 3SYAA 2H3OA 2W0FC 2CWEA 3F72A 3K6GA 3RTRA 3RYFA 3QU3A 2ZCWA 4PJNA 4NXNO 1IUFA 1OPCA 3CJTB 4P30A 3CCUV 1M9NA 4CS4A 2ZXWC 4L0ZB 1Q7YW 3V7RA 1QBJA 1NJIW 5HOOA 1U78A 5C93A 3DC5A 3B8NA 1NU1H 1LDDA 3UR3C 2DQRA 3HOSA 3CEIA 4OIRF 4RB0A 4WCEV 1TQIA 1KYWA 1SC5B 2HDWA 3MQ0A 4DR1O 3E3VA 3FXKA 4CCMA 2XSJC 4A93J 1BJZA 2XUBA 3OOUA 3QODA 3TP0A 1XGNA 3EUHA 5HNFA 1XCBA 3IKTA 1TL8A 1ZLZA 3E83A 2RJZA 3CB2A 4I5SA 2PJRB 2DW4A 3A0HZ 5K1YA 3JCUC 4JBAA 4D0PA 5IP9J 3G67A 3VWBA 4G28B 5J2TB 1HNXB 4FASD 1BQ0A 4PFPA 1QZZA 2HQAA 4WXDA 3F21A 3TK1A 2QKMB 1ZQ3P 3ESWB 5CQEA 4CGZA 1T6SA 4BHBA 2ZT9B 1JQ0A 2XRLA 3K4CA 1U5TB 5D4RA 1W0KG 3DLAA 2HDDA 5HS9A 3TCUA 1XMKA 2H1LA 3ZQIA 4KN4X 1YHQI 3DU5A 3HKEA 2BW3B 2QQ9A 2XT9A 1KECA 3CO6C 1PUFB 4TV9A 3K58A 4YY3O 3CMYA 1B4AA 2Q2EA 1K34A 1P2FA 5B1BC 4EKWA 2UXNA 5DTDA 1YITV 5D5UB 1TGOA 4DUZO 4GUNA 2YEVB 4WFFA 5EYPB 4FFKA 3TMOA 1IZ1A 3E22B 2UXDO 4X9QA 5FLXK 2IS4A 5F64A 1GV5A 3T1YO 1VQOV 4HSRA 3DQVC 3H3ZA 5DEQA 2EIKH 3BRCA 1Q6IA 1OISA 3P3PA 4DV2O 3FXRA 3HOYJ 4RDUA 1P49A 4Z6YA 2B7EA 5BNGA 4A3DJ 1XNQO 4ZI7B 2UV1A 4XORA 1X3UA 3QOEA 2F4VB 3ZCCA 1KQSU 1ETOA 1ZG1A 1IBMO 4B3AA 1LDKB 4F55A 2E19A 2HYJA 2KP6A 5CVRA 1EKEA 4XLAA 2A3QA 1WP8A 3W2AA 2IJKA 5EBWC 2PFBA 4QWQA 2C6YA 4ZDOA 2PI5A 1WPKA 3S2WA 1IJWC 1E3OC 2QA4V 3HL2A 2EULA 3OMAB 4IHSA 3OTOO 1YX5A 1Z3YA 4RLFA 4GFBA 1XD7A 2W4SA 5HDNA 4ZTFA 2JK5C 1ZR4A 3HRUA 5FB2A 2CW7A 3F22A 1FLIA 3FAVA 4U7OA 2DN0A 4BL0B 4JK1X 2M7WA 2EIMC 2JVHA 2VC0A 3CJHA 3KEYA 4OXSA 3AG1H 5KX5A 3FHZA 1Y74B 3K57A 3U9GA 2H1KA 4YIPA 1AKHA 1P4RA 3BWGA 4KXRA 3E2EA 2E71A 1IW7F 1GTOA 5E8IA 4UB8Z 4DYCA 1YS7A 5FKLA 1FYKA 5J3LA 3FB8C 3WB2A 1EH6A 2V6EA 2F95B 2VI6A 1VF9A 2ETNA 4PJ0Z 2CU7A 3M4OJ 1OFCX 1JKOC 4XONA 1W0JG 3CD6V 1Z7LA 2UUAO 3HPHA 4LK1F 3MN2A 4PDKA 2H8RA 3FB5C 2OCCC 2ELJA 3JAWA 4BHPA 4UCUA 5KNLA 5HDKA 3LAJA 4BACA 4ASNA 1XUQA 5F6FA 4KMUX 1IZ3A 4EQQA 1I39A 4EJWA 3JD3A 2R7SA 1B6QA 5K7ZA 1S72V 5FRMA 1OCRC 4LG0A 3FXQA 4PUSA 5B1AC 2EWNA 2IP2A 3WHCA 4LIVA 3DEEA 4EJVA 2PMZA 2VUMJ 3GTLJ 1SQVH 3B4SA 1ETXA 5GONB 2LOOA 3SDGA 3JALA 4BUPA 1I94O 1EF4A 2GUZB 3W3CA 4JAVA 5J6XA 3MKYB 3LUTB 1LNWA 4MTEA 4JI0B 4FHTA 5IOZA 1HA8A 5IJ9A 1FNNA 2KIUA 2JGUA 2COBA 3VODA 4J9ZB 4TQFA 2VLAA 2IM9A 4ZJZA 4BW5A 1SD7A 3MFKA 3BVOA 2HS5A 3I71A 2ZE5A 4DGWB 1QHGA 5CVJA 4W1UA 2A06H 2QSGX 3CCUI 4GT1A 3DKYA 4XICA 2X6WA 1K61A 2AXTZ 3H1HH 3L71H 1SETA 4Y33A 1W0UA 4D1QA 2R7TA 1JXSA 5L3BA 1YSCA 5IY5C 4L87A 3OR6C 2W0XA 5IY5B 3JRDA 2DA1A 3DKXA 4GKKO 3ZEDA 3CCJV 3TP3A 1PL0A 3ZHVA 1D0YA 3U21A 3WB0A 2WPDG 1X1AA 4HX4A 1AWCA 2EILC 1XMQB 4HOBA 3OFNG 3BOQA 3E8GA 4ICGA 3QQAA 2PI4A 2AS5F 4QIWN 2ESHA 4PA6A 3AG2C 1WJ5A 2P7CB 4ZOLA 1YTFB 2QKCA 1Z9CA 2GWRA 1T56A 3RSNA 5KAIZ 4XSXF 2QBYA 3A4CA 4C2TA 1BI0A 4GX5A 5B66Z 1HOMA 3E5UA 1FKAO 2R7FA 3U11A 3OYIA 4E4EA 4AUXA 5IYZB 4X66B 1OCZH 2UU9O 1P92A 2GAUA 4BY7J 2VKVA 1FFXA 1W7PB 5DYMA 3H1JH 1F4NA 1O9HA 5LGNA 3MAJA 4W97A 1SMTA 1IDYA 1F4KA 4HQEA 4DV3O 1LR1A 2QTSA 1IXSB 2R0QC 5IDJA 3CE2A 1L0NH 4ASUG 1I6XA 2X9DA 4E7KA 4ZIBA 2KLOA 4O4LA 5ICFA 2HOEA 2XV4S 1MNEA 2NXNB 4BJ6C 1JGGA 2LF8A 3DF8A 4DR4B 2HXIA 2MD0A 1O7LA 2ZINA 5ILUA 4DR2O 1VI0A 2TCTA 2XF6A 5FFZA 1YITI 5KHHA 3ZJZA 1JOYA 2XPUA 1KU2A 3G6BA 4JYYA 2VKHA 4KIFA 3RPUA 2CGOA 1J09A 3ABMB 4CC6A 1FSEA 2P6TA 1KQ9A 2CV0A 2DAOA 4BXUA 3M8JA 1GM9A 1JCHA 1X3ZB 2DYSH 2OD5A 2ZJPF 1VQOI 2LY9A 5LXTA 1EV7A 4DRXB 5BMVB 5FL7G 2K1EA 2AQFA 1R23A 1R5ID 1WI9A 4HBLA 4RBOA 3N2GA 1IVSA 1MBHA 4HX8A 1SQQH 2CFOA 2ZR2A 1IC8A 3OYBA 5E1AC 2QEXV 1NT2B 5CQGA 4BS9A 3RT3C
chains in the Genus database with same CATH topology
1K92A 1YYVA 2Q67A 4TWKA 2QLZA 2HG5C 4BNCA 1W2BU 3EDPA 4RQFA 1IAWA 2JEUA 4P96A 3E35A 5EEHA 2FA5A 3SFZA 1K4DC 4GYGA 3N4MA 4ZH4F 2EV6A 2L54A 4RB2C 4L5JA 2IPQX 5LBQA 1DDNA 2IVMA 3TO7A 4MQVA 2X4HA 3I56V 4IHTA 1LEAA 2QQAA 2VOOA 3BJ6A 3TO9A 1UB9A 1KU3A 1WRJA 1DP7P 4BAYA 1R6KA 5DUKA 3ISPA 5LRSA 3JCZA 2JEXA 1K73W 2DQLA 3GUDA 4JGSA 3FZVA 1LB2A 2A0LA 4PDMA 1Z6TA 3GO5A 4HLXA 4KDPA 1NH2B 3AG1C 4MEYF 5D8LB 1WWXA 4EV0A 4G7ZF 2H6CA 2DTRA 1L0OC 4LJZF 1R7JA 1MABG 3MCZA 4H0EA 2IJHA 1A04A 2QE7G 3HRTA 4UV8A 1KU9A 6PAXA 4WF9V 2L4MA 1XCVA 1REPC 3HSRA 5L3GA 3ZMUA 1NBMG 3ZN0A 4OINF 1RM1C 1G4DA 2WLIA 2EBOA 1E17A 1TW3A 3VOEA 1PKXA 3LDDA 1QVGU 2P6SA 2H09A 2RGVA 2CW0F 2V1DA 1I5ZA 2V79A 3FM5A 4MEXF 1YW8A 3P9IA 4J9YB 4M9ZA 4BW5A 2F2EA 4HQMA 1UCRA