3IC7A

Crystal structure of putative transcriptional regulator of gntr family from bacteroides thetaiotaomicron
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
IYLQIADRICDDILLGQYEEEGRIPSVREYASIVVNANTVMRSYEYLQSQEVIYNKRGIGFFVASGAKMLIHSLRKEQFLKEEVGSFFRQLYTLGISIKEIEKMYYEFIQRQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Putative transcriptional regulator
total genus 26
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ic7A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ic7A02
4HDUA 4FX0A 4M9SA 1DDNA 3R61A 3EUHA 3GWZA 1BI1A 2V79A 1XGMA 5D5VB 1DPRA 1YIOA 4ENJA 5ILVA 5ICFA 1YS6A 2COMA 5EEGA 5D4SA 3F8NA 1I27A 1IXCA 1JXSA 4K2EA 3GO5A 3F6OA 4ESJA 3V8KA 2ETHA 4LMYA 3CJNA 3HHHA 3ZN1A 3ECHA 3R0JA 2FMLA 3ZQ7A 4Q5SF 4FHTA 5D6FA 1ZH5A 3L2CA 2V1UA 4EM1A 2X0LA 1KU2A 2MC3A 1O3TA 2BYVE 1ZYRF 3W7TA 3R0AA 1WWXA 2EV6A 4QLCU 4A5NA 2HR3A 3NRVA 2HQNA 1DP7P 1REPC 3FXQA 3JAMK 3OOPA 4BHCA 3ZMTA 1U6GA 4EVIA 1G3YA 3CO7C 2A07F 4MTEA 4RB1A 1V4RA 1D5VA 2MD5A 4GO1A 4R8HA 2HTSA 4L5JA 1BC7C 1T2KA 1ZLKA 4LJZF 1NVPB 1ZAOA 1OYIA 1HSJA 2P6TA 3KFWX 3GFMA 4L18B 4EM2A 2QUFA 2TDXA 2FRHA 2XKOA 1FX7A 4GYIA 3LFKA 2JZYA 4KN4X 5D8LB 3VB2A 1W7PD 1AOYA 1XB4A 2WC2A 3L09A 1JGSA 5D5XB 2YR2A 4KIGA 2FA5A 2OBPA 3RPUA 4UVAA 1ZLJA 1EH7A 1FPQA 4G7ZF 5DCMA 4I2OA 5HDGA 1Q1HA 1JHFA 4ETSA 3F23A 3GFIA 1R1VA 5A2QZ 1FOKA 2MLKA 1DPUA 3I0TA 1J5YA 2STWA 1LEBA 4GGGA 1QQIA 2CQKA 4Q47A 2HKOA 5AONA 2W84A 3I59A 3W7UA 3EDPA 4XSZF 1UHWA 3V8LA 5JI6A 1LEAA 2OQGA 1LB2A 1WRJA 1I1GA 3GZ5A 4IRHA 1RZ4A 5E20A 5KK1A 5FGMA 2WWYA 4EV0A 4KMUX 4HX7A 2ESNA 1U3EM 4LLLA 1G3TA 2EFOA 4U0YA 2IJLA 1HBXG 4CZZA 5EEHA 1KQ9A 3M8EA 2LSOA 1B59A 4OMZA 3E5UA 1I1SA 2A68F 1BN5A 2F5CA 3I4PA 3E6DA 1TTYA 4KNYA 1W7PB 2QQBA 3FHZA 3LA3A 3DPTA 2DQRA 2KKOA 3TOBA 1WQ2A 3SHFA 3KEQA 4IF4A 2LNBA 4OINF 4I09A 5D6EA 4KIBA 2QBYB 2MH9A 2VE9A 4LFUA 3PFIA 2UXXA 1P2FA 3ELKA 2VBXA 1YYVA 1TNSA 2UZKA 2XIGA 3JSPA 1ZRDA 3LQQA 3I5UA 3VFZA 4P9FA 2XVCA 4NB5A 2DPDA 2PLYA 1JE8A 2LF7A 4BQAA 3L9FA 3CLOA 2EJRA 1IRFA 4BYYA 4KICA 4I0BA 4ZZLA 3JTGA 5IT9K 1FNNA 3Q5FA 2E7WA 3BJ6A 3WTYC 4S04A 2EFWA 1EH8A 4LLNA 3MWMA 3WTZA 3ZMUA 4M73A 1G3SA 4I0AA 3B73A 3BPVA 3W6KB 2QZ8A 3QAHA 1P4AA 3WGGA 5IT3A 3O2PE 3DQVC 1USSA 2M30A 2Z5UA 4I7HA 1NHAA 3R4KA 5A2QK 4H0EA 2BV6A 4OOIA 1KYZA 2VN2A 3MCZA 3WGIA 3L00A 3C1DA 2DTRA 2UXNA 2A6HF 1QZZA 3V7RA 2V1XA 2FBIA 4HQEA 2GIVA 3T1BA 3ZMDA 5BMZA 2PG4A 2QBYA 4PDKA 4FT8A 1BI0A 1RUOA 3F21A 3RKWA 1KQ0A 2HGCA 2Q0OA 1YG2A 3LSTA 4L0YB 1BI3A 2LDUA 4RGSA 4WWCA 1BIAA 4PGGA 3N4MA 3ERED 3V7CA 3HSRA 3BP8A 1G4DA 2EFNA 4DQ2A 3BPXA 1MD0A 4IRIA 2CSOA 4RS8A 2NNNA 3G73A 4LB5A 1FSEA 4BAYA 3U2RA 2OD5A 5HS8A 3HOTA 3D5LA 1W5TA 2XAQA 1XGOA 5FLXK 5LGNA 4HX4A 1FP1D 1HKSA 2VOPA 4EMSA 4HLYA 3FZVA 5FD6A 2P8TA 1R1UA 1S7OA 2DK8A 2BGCA 4O3MA 3P9CA 5JR3A 3KZZA 1IAWA 2ZJ2A 4ESBA 1G3WA 5K5OA 3RYPA 1B9MA 4KA4A 3QP6A 4OIRF 1XSDA 5ED4A 3HRSA 3J80K 4KDPA 2VBYA 2JPCA 4XRFA 1P92A 3BOQA 3GXOA 1XMAA 2F5EA 5LHIA 1TW3A 1WI9A 3PQKA 4M6XA 3E5QA 3HSEA 3SZTA 1QZYA 1Z6RA 4JBAA 3I64A 2M8EA 1B6AA 2FBHA 5E8GA 5AIQA 1SD7A 3IRRA 4OIOF 1XCBA 2VONA 1T38A 2XASA 1RUNA 1G6NA 1KYWA 1LJ9A 3KP3A 1L0OC 1FBUA 1ZARA 2PN6A 1BBYA 5TJJA 2Y75A 4PZJA 3FMRA 3WTVC 5HLIA 1PP7U 1TBXA 4BHPA 4L9TA 2VT3A 2NAZA 3OV8A 2VC1A 4PCQA 4EJOA 5FLXZ 5HDNA 5TRDA 2GA2A 2IA0A 3L7WA 4O6JA 4B09A 3RKXA 5L3GA 2Q8KA 5J8FA 1BIBA 1L3LA 3TKYA 2IA1A 2HEOA 4BH9A 5CJ9A 5CLSA 1SFXA 2MH2A 2P7CB 1YFHA 3SQNA 2QQAA 2WAMA 1U8RA 1PP8F 1WKMA 4I98B 5ERIA 1IN7A 1KQ8A 1OYYA 1XDSA 4LD5A 1EH6A 1HKQA 4A0XA 1P4WA 2Z99A 4EGYA 2HOEA 1TQMA 1SMTA 3RYRA 2KJBA 4M9ZA 2ADUA 4G7HF 4QWQA 3RPQA 4KT5C 5H6QA 3GVAA 1U5TB 2Z9OA 3F8CA 4U88A 2IT0A 3WGHA 4ZYDA 1LVAA 3D0SA 2F2EA 4ZYEA 4HF0A 1XD7A 3KE2A 2HZTA 2H09A 3K69A 1LDJA 2D2WA 1D8JA 2XHKA 4IHSA 3E97A 4CGZA 3P7NA 2CO5A 2D1HA 4MTDA 2QLZA 4P5OA 5DEQA 3IKTA 2B0LA 2P90A 2FQ3A 3DPLC 4MGRA 4HDVA 2QVOA 3BJAA 5E18F 3GW2A 3B02A 2CW0F 4ESFA 2E7XA 2IA2A 4HV5A 4EJVA 2H6CA 2ZXJA 3CUQB 3RIRA 1HXDA 3GZ6A 2FEZA 2V1DA 4WXHA 2L54A 2NS0A 4G9YA 3W7SA 4DNCA 5BQTA 4ZZDA 3T0YA 1I6XA 1T98A 5J8CA 1P4XA 2GXBA 5CA3A 2DU9A 1B1BA 2W57A 3BWGA 1FWZA 1IN4A 4IPAA 2QQ9A 1QNTA 2XAFA 3MZHA 5HS9A 4P55A 3HYIA 3JTHA 3ABUA 4IVNA 1D8KA 2CFXA 2G7HA 1TNTA 4M74A 1S6LA 3JW4A 4KMFA 2IP2A 1J0RA 2HTJA 5D5WB 3LA2A 2K02A 3RJPA 4N9HA 2P6SA 4HBLA 2C6YA 3I59B 2RN7A 5ICCA 3RI4A 4CHUA 4A0YA 1CF7A 4M9XA 1YQAA 2YX7A 4EQQA 3IWZA 1O3SA 1O7FA 1R5GA 1CGPA 5J6XA 3VODA 2A61A 2M45A 2M5WA 2L3DA 4HA8A 2O61A 3G3ZA 3Q9SA 2P4WA 2NRAC 1YS7A 3TO9A 3FXRA 2FXAA 5E1WA 3GF2A 5E1XA 2RVCA 2JTVA 3R60A 1OYWA 1F5TA 1IUYA 3QU3A 2DLLA 2K86A 3GYHX 2D1VA 2BE5F 4ON0A 5LEKA 1F1ZA 4WXDA 2PI0A 2KIUA 5JVTA 2WTEA 2DBBA 5IT9Z 3NEUA 2GA1A 1IW7F 1J7KA 2JT1A 5L3FA 3HTUA 4R1HA 5E1ZB 2JRTA 4UXNA 2O3FA 4M6YA 3T8RA 1SD6A 3W6JB 3J7AO 1Z9CA 3F8MA 4YG2F 1IXSB 1BC8C 2ZFWA 5DUKA 2OU2A 1RNLA 4OIPF 1O3QA 1U2WA 2VODA 3EETA 3EYYA 3J81Z 3M8FA 3IC7A 5LHGA 1DUXC 1PUEE 1FZPB 2VXZA 2HDCA 5LHHA 1UCRA 3FMQA 3V4GA 1K6OA 2EA4A 3HRTA 1B9NA 5GW7A 4Q48A 3O6BB 5CVUA 1FC3A 1NH2B 2D45A 2ZNZA 2DW4A 2KIFA 5BOXA 3RTRA 5HLGA 1R1TA 3WTTC 2XROA 1S29A 1KU3A 3REOA 5HDKA 4HF2A 4OMYA 5ICGA 3KLNA 5KVRA 1OR7A 4D0PA 4RGUA 5FO5A 4EJTA 4YFXF 3WU0A 5CVJA 1Z91A 4O5VA 3PQJA 4XSXF 3J80Z 2OQRA 5LRRA 2EV0A 3WG9A 3BY6A 2DK5A 4L9NA 4ENNA 1LNWA 3WTSC 2CG4A 4MHGA 2E1NA 4RAZA 2HKXA 1RI7A 1S7AA 3I54A 3SZPA 2HYGD 4WCGA 3V8JA 4U7DA 3FF5A 2L4AA 4A6EA 3E5XA 2H6BA 2NNYA 2P5KA 1UB9A 4LB6B 1TQIA 2BEOA 1MZBA 1EV7A 5FD5A 4ZYGA 1QBJA 3QOPA 1K78B 3T8TA 2M87A 3Q9VA 3TDZC 1ZRCA 2L02A 2QWWA 1B4AA 4I01A 1FYKA 5CYVA 1Y0UA 4L9JA 1R7JA 4HQMA 1FLIA 1BM9A 2HWVA 2PMHA 3TGNA 4EJUA 3HHGA 3W7XA 4RB3C 3P9IA 4JQFA 3IL2A 5DUIA 3KEOA 1MDMB 1FBQA 5LEJA 5ILSA 1HW5A 3ZMSA 3JAMZ 1SMYF 2K4BA 3R6SA 3O3KA 5DD4A 5L3BA 4G94A 2L01A 1MJBA 1UHMA 3SXYA 1KGSA 3U1DA 3ZMZA 4ASNA 6PAXA 1A04A 4N0BA 4AIJA 3TO6A 3GLXA 4UV9A 2VOOA 4CYDA 3QPHA 4GYGA 3CUOA 3QU6A 1GHCA 1ON2A 2O0YA 5DCMB 4L5IA 2FNPA 4P96A 2FU4A 4HAMA 1FYMA 4A12A 5JHUA 1MJ9A 1U5TA 2FBKA 2XAJA 2HQRA 4HV6A 5AIPA 1R23A 4MEYF 2VC0A 3F3XA 2ACJA 5BS6A 3TQNA 4ZH4F 4EM0B 1BI2A 4JK1X 4LGWA 2K27A 2QENA 5L3EA 4A2UA 5LLQA 2CGPA 2FF4A 5FFXA 1SAXA 2Z3YA 4EJWA 4KIFA 1QGPA 1R00A 2CWEA 3ZP5A 2QYOA 4HOBA 3BZ6A 3KP6A 4F7ZA 3COAC 5CVVA 1S8NA 2L4MA 2XUBA 2HFHA 4Y17A 1YO5C 3P9KA 2MLGA 2RQPA 5DCFA 3DFGA 4LG0A 1H9TA 3M9AA 2A69F 4ENKA 4IJAA 2DI3A 1SFEA 3W7WA 4HLXA 3DXJF 3HSFA 4WF2A 1J2XA 4RGXA 1T0FA 2OZUA 3I58A 3WODF 1USTA 3KCCA 1HQCA 3ABTA 2O03A 2ZO4A 5H20A 1ZG1A 3CDHA 3DP7A 3D3IA 2EV5A 3K1MA 1GXQA 4UNOA 4L0ZB 2LKPA 2V6CA 3E3VA 3KP4A 3WU1B 2XV4S 3ZPLA 1X3UA 3K1PA 3HUGA 1J75A 5F1RA 2PJPA 1XMKA 1F9NA 4A5MA 4AWXB 2GXGA 1RM1C 1D3YA 5DDGA 5LBQA 5K5RA 2ZMEB 3SFZA 2VE8A 4L9VA 3KP7A 5HVQC 2KIMA 2Y48A 1XN7A 1S3JA 3K0LA 3GFLA 1ZRFA 5DV5A 2IW5A 2ELHA 1R36A 3TOAA 4AVPA 2YU3A 2KRFA 1U5TC 3KP5A 1FT9A 1XGNA 1ONVA 5HLHA 3JSOA 2VT2A 5E8IA 3MEXA 4GXOA 5HS7A 2PMUA 3FM5A 3WTXC 4RAYA 5DD8A 2DO7A 2DFIA 2MBFA 3F22A 3E6CC 4MQVA 1FYLA 1IN8A 3F6VA 3WE2A 3ZMVA 4CICA 1ZREA 4HZFA 1J9IA 1IN6A 1JHHA 4AD9A 3LWFA 5K1YA 1FP2A 1ODDA 5F6FA 2ZNYA 5K5QA 5L3DA 2QM3A 3TDUC 1H9GA 2HYFA 3ML6A 1W7PA 1ULYA 3H3ZA 2OA4A 3J81K 3IKVA 2Z33A 3I71A 3LQRA 2J5OA 1YTYA 1SD5A 3IRQA 1YLFA 5L3CA 3QRFF 1HSTA 2NYXA 2EWNA 4Q4ZF 1VTNC 3FWEA 5D8KB 2DQLA 4G6DA 2K4JA 4CXFA 1KU9A 1BJAA 1K7AA 3WTWC 3KETA 3C3WA 2K7LA 3U9GA 1LQ1A 4XBFA 2W25A 5FB2A 4XLPF 4HW0A 5E17F 2PBIA 4U0VA 2X4HA 1XSVA 2AS5F 3CO6C 1HW1A 2PFBA 5D4RA 2RC4A 2RNJA 2OZ6A 3IWFA 4ZYHA 1K78A 4IXAA 4N9IA 1OMIA 2VBZA 3HRMA 2XAHA 3DV8A 2VBWA 1R58A 2FOKA 3QPTA 2EFPA 2AXLA 4WXCA 3QP5A 3EYIA 2YX4A 2E1CA 4G8XA 4I02A 4MNUA 2ISYA 1PDNC 4G7OF 3GFJA 2J5PA 1R5HA 2A3SA 4KFCA 3BROA 3KZYA 4WX9A 3KLOA 4B8XA 2FNAA 3FXUA 3DF8A 1YTFB 2XRNA 4YFKF 1Z05A 2GQQA 4A0ZA 1RIOH 3C7JA 2JSCA 5BPIA 2DPUA 3HOSA 3GUDA 1E17A 2R7FA 4OU0A 3HRUA 3T5XA 4MQ9F 5CVRA 3F8FA 2FE3A 2RKHA 3LAJA 4PGHA 1OKRA 4LLGF 3FX3A 4UHTA 1MDMA 1C0WA 4CDGA 2FSWA 3K9TA 2F5FA 4FX4A 5DYMA 1AWCA 4KUMA 2IRFG 4G6QA 1R22A 1QPMA 3M1EA 2A5YB 4BHBA 2KJCA 2ZBKA 5CVIA 4RB0A 3E35A 1ON1A 3VOEA 4U7BA 2RV8A 4Z2YA 3K2ZA 2ZKZA 4UUVA 2G7UA 3E6MA 1IF1A 1GXPA 3F8BA 4LK1F 1MKMA 4Y15A 1KU7A 1H0MA 1T6SA 1OPCA 5LRSA 3FMSA 2CYYA 1MGTA 1IZ1A 1F4KA 1STZA 3LAPA 2RDPA 3GX4X 3DEUA 5FFZA 5HOOA 3S2WA 2P5LC 4M71A 1Z6TA 1V3FA 3HTSB 4MEXF 1IXRC 2BBYA 4YIFA 2EK5A 4UVBA 1XGSA 3MZYA 2STTA 3EQLF 1XCVA 4BNCA 4U0WA 4WK8F 4XLNF 3MQ0A 5D5UB 2P7VB 4BXUA 3M7GA 1LDKB 4HYEA 4TV7A 2MA3A 2PQ8A 1IN5A 2RGVA 3ROUA 3H3UA 4RGRA 1Z7UA 2ISZA 2O8XA 3RKYA 2R7DA 1LDDA 2A6EF 4GCVA 1YW8A 4YFNF 3CTAA 4OIQF 3HIFA 2GZWA 5F64A 2YSRA 2IPQX 2W24A 1HKTA 1UFMA 2OAZA 1U78A 3NQOA 4KYWA 2EB7A 2WV0A 5LGTA 3F72A 3BJOA 2DT5A 1O7LA 4LG0B 4CO8A 2H27A 1KA8A 2YPRA 5ICEA 2XAGA 1ZGAA 3RDIA 1W5SA 2IVMA 3FM3A 3K1NA 1ZHFA 2EFQA 3E6BA 4NQWA 4UV8A 2XKPA 4YIIA 2PEXA 1P6RA 1T39A 1XSXA 3V7SA 1O57A 1E2XA 4IRGA 2GAUA 3TO7A 4RB2C 3BDDA 1O3RA 2Y0MA 5H6RA 3C18A 5LGUA 4A6DA 5JFRA 1CF7B 4KN7X 4S05A 1ZG3A 1FY7A 3N97A 1I5ZA 4ENMA 3LA7A 2UWMA 2DAOA 1TW2A 1J59A 4UVCA 2JPBA 4EGZA 4M72A 1ZG5A 4P9UA 3WE3A 2ZMEA 3AAFA 2EA2A 1XDUA 2O6GE 3KP2A 3GEZA 1K79A 2W85A 1HW2A 4LK0F 2V9VA 1TQPA 2HS5A 2XGXA 1BOAA 1W4MA 1QO0D 4HX8A 2FMYA 3ISPA 1MJAA 1Z1DA 1GVJA 2Q2EA 2GWRA 2LF8A 3IHUA 2ESHA 5BPDA 1IRGA 3CUQC 3MFKA 1SD4A 4IHTA 4R79A 1FSHA 2F5DA 1TLHB 3ULQB 1SFUA 3I53A 4AIKA 1WSUA 2R3SA 2ZCWA 2G9WA 1YW9A 3CUQA 2P5VA 3DKWA 3H92A 3ZN0A 1YW7A 2H94A 3VEPA 4HF1A 3ECOA 4AIHA 4NHJA 3WTUC 5ILUA 2M1BA 1ZN2A 4E70A 3MAJA 1FBSA 1ZGJA 4Y13A
chains in the Genus database with same CATH superfamily
2O7OA 4FX0A 4HDUA 4M9SA 5EYPA 1DDNA 1JPXA 2ZM6O 3ABMH 3R61A 4YIPA 4DV5B 3EUHA 3CRRA 4MS2A 3GWZA 3FXMA 1BI1A 2HU9A 1XGMA 2V79A 3LSGA 1IG7A 3OFNG 5CBHA 5FRMA 5D5VB 1DPRA 1YIOA 4GKJB 1GLNA 2VKVA 3WB1A 3P32A 4ENJA 4XN3A 5ILVA 5ICFA 1YS6A 2COMA 1JJ6C 3NR7A 2I10A 2GUZB 2AQFA 5EEGA 4FISA 3LNQA 5D4SA 3F8NA 4DV4O 5E3OA 1W59A 1R5ID 5KHIA 4H44B 1I27A 4F6EA 1IXCA 3E89A 1AU7A 1JXSA 2ZE8A 4K2EA 3GO5A 3F6OA 4PI0A 3X2QC 1WZ2A 4ESJA 3V8KA 5LOVB 4MW3A 2ETHA 3ZR8X 3IAS2 3K4LA 4LMYA 4KL1A 2K9QA 3PJSK 3CJNA 3HHHA 3AG4H 3VQXA 3CCJV 4YRVA 3KYDB 5BR8B 1BSMA 3ZN1A 2Y4TA 4JX5A 2CQNA 1MG1A 4HZ3A 1DQUA 4GX5A 4NBQA 2VQEO 3DSQA 3J81N 3ECHA 3R0JA 4QE9A 2UXDB 1XEQA 2FMLA 3ZQ7A 3DKXA 3HXLA 3LSUA 3CCQI 1OCOB 4Q5SF 3AK1A 4FHTA 5D6FA 3E2EA 1RRJA 1Z77A 5M5XJ 1ZH5A 3L2CA 1S5LC 5CPRB 2V1UA 4EM1A 4M3EA 3ZEDA 3HZJA 1X1BA 4O2AB 3HBLA 1FMWA 2X0LA 3ZQFA 2BOBC 1KU2A 2MC3A 3PIOF 1O3TA 2G38A 2BYVE 1ZYRF 3W7TA 2R7WA 3K10A 3R0AA 2IS4A 2JQ7A 2X1CA 1WWXA 2EV6A 4QLCU 4DV6B 1Z21A 1N36B 4A5NA 2HR3A 2DYSB 3CCVI 3PJRA 2NLJC 2IJIA 1EFRG 3NRVA 1WJFA 2HQNA 1DP7P 1MBKA 2PI4A 2Y2ZA 3N05A 1TC3C 4UUTA 1REPC 3L2QA 3FFQA 4DR6B 3FXQA 3JAMK 1OCCB 3CCLI 5B1OA 3ZHVA 1OLTA 5LOVA 1PNKA 3OOPA 1R6KA 4BHCA 3A0HC 3APOA 5E79C 2BZTA 5FKKA 3ZMTA 1NR1A 4B44A 1ETQA 5GPCA 1PD3A 3RN4A 2WAEA 1U6GA 4EVIA 2UUBO 3ZCOA 1G3YA 3LMMA 3ETDA 3CO7C 2A07F 1Z3YA 2JJ7A 3ASOH 3JCUC 4MTEA 1NTZH 4PD4F 4RB1A 1SAUA 1V4RA 3JRGA 2UUCB 1FS0G 1D5VA 2ZE6A 2MD5A 3PFYA 5F0HA 4IHXA 3CMEV 4B3SB 1TT0A 4GO1A 3JD1A 4R8HA 2NVUB 3LSQA 2HTSA 4L5JA 1F7YA 2QSFX 2F1MA 1ETVA 1YE9A 1BC7C 1T2KA 1ZLKA 4JI3O 3E83A 5F04A 2LBFB 3RYHB 1Q81W 4LJZF 2DYSH 1HNXB 4FM1A 1NVPB 3QYEA 3J7AU 1AP5A 2VQHA 1VQOI 1VQOV 1ZAOA 2XGEA 1OYIA 1HSJA 3TBIA 1Y76B 5IY5H 2P6TA 3RT3C 2R7TA 3KFWX 4DR7B 1MABG 2HPMA 3GFMA 3MHSC 5IYZA 1XMXA 3KKYA 4L18B 3CP8A 5JHFA 2DOAA 4EM2A 2QUFA 5B1BC 2P6JA 4L8JA 4TV9A 2ZDIC 3RYFA 2TDXA 2GSMB 1WJ5A 1I94O 4GUNA 3LDEA 4XLEA 3CMEI 2ZM6B 2FRHA 5FJ8J 2XKOA 4AC0A 5TGTA 1FX7A 2KLOA 4HNUA 2LP7A 4GYIA 5CA0A 3LFKA 1FJGO 4XONA 4BU2A 4XDKA 2JZYA 4KN4X 3SDGA 3BTIA 5D8LB 3VB2A 1W7PD 2ITDC 3P3NA 1AOYA 4JI5O 2CV1A 1XB4A 1X4TA 5B3SC 2WC2A 3L09A 3OYBA 4A3DJ 5B1AH 1JGSA 5D5XB 2YR2A 2FKXA 2JEUA 3DXRA 3UO3A 4D7MA 4KIGA 1NTKH 3FXLA 5K1PA 1QVUA 1GVDA 2FA5A 5GADJ 2OBPA 3RPUA 1GT0C 4UVAA 3DC5A 4WFBV 4K0KO 4FLXA 1M1KW 2ZC2A 1ZLJA 3CCRI 2H3OA 2YXYA 1EH7A 3VPRA 3LSMA 1FPQA 4G7ZF 4B3TB 4DO2A 5DCMA 4I2OA 5HDGA 4CC6A 5GTIC 4WBNB 1Q1HA 4IYHA 1JHFA 5KX5B 1B06A 1FPOA 2WLMA 2MW2B 4ETSA 3S3OA 3F23A 1IDZA 3GFIA 5FKOA 4D7SA 1R1VA 3FXJA 4DZJA 5A2QZ 1FOKA 2MLKA 1SERA 2PMZN 3JAWA 1DPUA 3I0TA 1J5YA 2DYSC 2RCVA 3I5DA 3M07A 4BJTA 4RAGA 5D5QA 2STWA 1LEBA 4GGGA 4G12A 1QQIA 3ZQCA 2CQKA 4Q47A 2HKOA 1JVMA 5AONA 2W84A 3I59A 2EIJB 3RFRA 3E86A 3W7UA 3JD3A 3EDPA 4NC6A 4XSZF 5B1NA 3AG1B 5EGOB 2NS8A 1DTOA 1UHWA 4ZIBA 3R65A 3V8LA 3CX5F 5JI6A 2DDBA 1LEAA 2OQGA 1LB2A 1GAXA 1WRJA 1I1GA 3GZ5A 3DXRB 1E3PA 2DA6A 2VI6A 3CC7I 2EILH 2KT0A 1RZ4A 4IRHA 4MVUA 5E20A 2D3OW 1IBLB 5KK1A 5FGMA 3S17J 5E1AC 5DEDA 2WWYA 4EV0A 4KMUX 5B1AC 1YXBA 4HX7A 3DTIA 4JI0O 2ESNA 4AUXA 1U3EM 3ZRSA 2A3QA 2M4KA 4PFPA 4LLLA 1G3TA 2XRLA 2EFOA 4UB8C 3L2UA 1JGGA 2CTPA 2CE4A 2M8GX 4U0YA 2IJLA 5J2UA 1HBXG 4CZZA 3VYTB 2LW1A 4A3CJ 2UXCO 1RP3B 5EEHA 1K5QA 1M4UA 3WG7C 1KQ9A 2BXZA 2LSOA 2DOEA 3A0BC 3M8EA 1B59A 4OMZA 3CRCA 3E5UA 1YX3A 4M6VA 4W97A 2F93B 3CLQA 2JVHA 1W2BU 1GM8A 2M7BA 4QTRA 2IJJA 4IL6Z 1I1SA 1DGRM 2A68F 3WB2A 1CQTA 4TUYB 1BN5A 3OW2U 2QM4A 2F5CA 3I4PA 3E6DA 2HJDA 4FMTA 4E6KG 2VJ4A 4LIVA 5J1YA 1VQ4I 1I50J 3UR3C 1N8RW 1SA0B 3DEWA 1TTYA 1ZSPA 4KNYA 4X1YB 1KC8W 1SESA 3EXAA 1W7PB 2QQBA 3STLC 1UELB 1Y6XA 4Y3OA 3FHZA 1R71A 2P67A 5EIBC 3LA3A 1GMGA 3DPTA 3BTCA 2DQRA 2WA0A 4QSHA 1OCOC 2KKOA 2JN6A 1WN7A 5KUKA 3TOBA 1YTFD 2R7OA 3NWSA 1S5LZ 1WQ2A 3GTGJ 4UCSA 3VWBA 3RZDJ 3AG4B 3CE2A 4NTWA 1YIJV 4W4KA 2OIEA 3SHFA 3KEQA 4NQWB 1BR1A 5JVGF 4IF4A 2LNBA 1X2NA 4PJNA 4XRSA 5KA6A 4BY1J 5TISC 4BR6A 2L7MP 2YI8A 4OINF 4OX9O 4I09A 5D6EA 1E3OC 4IQ4A 2GHYA 1Q90D 2R7VA 4KIBA 4MIMA 2QBYB 2CUGA 3J7AY 2MH9A 2VE9A 4LFUA 2QGNA 2KRCA 3PFIA 4LR3A 2UXXA 1P2FA 3ELKA 3TMOA 4EKWA 2VBXA 4I9WA 5K1XA 2V9PA 2IM9A 4DK1A 1YYVA 1TNSA 2LK2A 2UZKA 3ZQLA 1F43A 5HNFA 3L71H 5IY5C 1HNZO 1BHAA 2IU0A 4DV5O 2XIGA 5C4XJ 3JSPA 2HJFC 3H1LH 1K4TA 2AO9A 4O4JB 1ZRDA 4BXXJ 3LQQA 3I5UA 3VFZA 4BDYA 4P9FA 2DN9A 2PJRB 2XVCA 9ANTA 2LYCA 1K6YA 1ETXA 2KMUA 5DM7F 4BE2A 3GTLJ 2LREA 1M56C 4NB5A 2V4DA 4UCOA 2UU9B 1V55C 3GTKJ 2QTSA 4JAVA 1VF6A 5EF6A 2DPDA 4RM2A 4X1IB 1FMVA 2BW3A 4DUYO 3H9JA 3CSXA 3QO5A 2DOFA 2PLYA 1N34B 2YUSA 4X1YA 1JE8A 2LF7A 4BQAA 3CJRB 2TRTA 1XX5A 5LL6Y 2JEXA 3L9FA 3G6EI 1U97A 1OCCH 4CH4A 4XKVA 2KP6A 4LP8A 1VQ6V 3CLOA 2OCHA 4RBOA 4GFBA 2NXNB 5KHGA 1MBEA 3E8BA 4DYQA 2EJRA 2F4MB 4TWKA 3DBLB 3HB3B 2ZE7A 1IRFA 3FKIJ 3LSJA 3G80A 3CJHA 3L72H 1XI1A 5B66Z 2MW8A 5EGOA 2LP0A 4BYYA 1TGOA 4PA6A 2Y0PA 4KICA 2E1MB 4NNJA 3U21A 2BTQA 4I0BA 4ZZLA 5J47A 3W3CA 2ZIMA 2L6LA 5IWAB 2F66C 3EUKL 3W2VA 4DV4B 3JTGA 5IT9K 2KFDA 4C7UA 1FNNA 2WAQN 4KITB 3H3VK 4LFAB 3Q5FA 3S93A 1WJCA 2E2IJ 5FLVA 3HKDB 3TCUA 3RYIB 1DF5A 3RYCB 2Q7HA 3ZQGA 3JRCA 2E7WA 3BJ6A 4IQJA 3T4ZA 3WTYC 2F4VO 4S04A 3HOUJ 5BMVA 2ZXIA 1D2DA 2EFWA 4A3MJ 1EH8A 1XBLA 3EVKA 1KMIZ 2DMPA 4LLNA 3MWMA 3WTZA 3ZMUA 4JI4O 2GBOA 4M73A 3ZHQA 1G3SA 2WB1N 4E4EA 4I0AA 4A3GJ 1AJQA 3B73A 1EN6A 3BPVA 3W6KB 1ENHA 4YELA 1T95A 2QE7G 4K8XA 4P1WA 4TOIA 2EQRA 2QZ8A 3QAHA 2KKWA 1P4AA 1BQ0A 1FFXA 1M56B 1IV6A 2HQAA 5C4JJ 5DN6G 2P06A 5KHHA 3WGGA 5IT3A 3H0GJ 3DQVC 3O2PE 4FLVA 1N75A 2IS1A 1USSA 2M30A 2WB1A 2Z5UA 4HEA2 3EFFK 4I7HA 2E5LB 1XMOB 4CSWA 4YIOA 2OF7A 1NHAA 2X48A 3R4KA 1JUSA 5A2QK 1JT0A 1P84F 2O57A 2VB6A 5IE9A 1K5SA 1K97A 3T1CA 2M0CA 3L1PA 4H0EA 2WY7Q 2BV6A 4OOIA 4Q20A 3QQAA 1KYZA 3I55V 3AK2A 2VN2A 1D0XA 3MCZA 1KQSU 2Z0AA 5FKMA 1ZR2A 2CGOA 3WGIA 2QKCA 3L00A 5CA1B 3SPHA 3C1DA 2DTRA 2DMUA 2KL4A 2UXNA 2R0QC 4RMNA 1TA8A 2A6HF 1CP9A 3CCSV 2P0WA 1QZZA 1W36D 3ERMA 1VQ8V 3V7RA 4P2ZA 2V1XA 1IDYA 1Q1VA 2FBIA 4HQEA 3THOA 1APLC 2GIVA 5JVDB 4ZI7A 1Y8RB 3T1BA 3ZMDA 1S5HC 2PG4A 4XRSG 5BMZA 3JASA 4J10A 3G2BA 4BKXA 4C3IJ 1DU0A 5LMUO 4QPQA 3DBRB 1RESA 3ASNB 1QR8A 2GLOA 2QBYA 4GKKO 4M3FA 2ZJRF 4PDKA 2K9NA 1D0ZA 3L70H 2CMPA 4PJ0C 4FT8A 4XLFA 3OYHA 1A5JA 4XOPA 3ONQA 1BI0A 4C3JJ 1RUOA 3HKBB 3F21A 3RKWA 1KQ0A 2HGCA 3AG2H 2JRMA 5J1RA 5FKLA 2Q0OA 1YG2A 3LSTA 3HGYA 4L0YB 2EZLA 4J7JA 2PJRA 4OWRB 3ICXA 1FYJA 1BI3A 2LDUA 1SZXA 4RGSA 4WWCA 4O4IA 3C3TA 1BIAA 4PGGA 3F5WC 2A5WA 3PM1A 1R6TA 3TJTA 3N4MA 3ERED 3G1LA 3I4MJ 3VQVA 2ZD9A 4XDLA 5CB4A 3V7CA 3HSRA 2HG5C 5EYRA 3BP8A 1HWYA 4YJ3B 3S3WA 2VQEB 2E2JJ 1G4DA 2EFNA 2L5QA 3CP2A 4DQ2A 3BPXA 3QODA 4DBRA 5CA1A 1MD0A 4IRIA 1YOVB 2CSOA 4RS8A 4BIZA 2NNNA 1BE3H 3G73A 1YDXA 4EFBA 4NTXA 1FOYA 3LSRA 4A3JJ 4BIOA 4LB5A 3S15J 1ZL8A 4UB6C 1FSEA 4BAYA 3L2WA 4PDVA 3SYPA 5IWAO 3BRCA 3U2RA 1VQ5I 4IYIA 2OD5A 3JASB 3E8FA 1K33A 5HS8A 2GUZA 3BEHA 4DXWA 4J7ZA 3HOTA 3IFXA 3D5LA 1W5TA 2LOOA 2XAQA 1XGOA 4F91B 5FLXK 1N33O 4JYAO 5EG0B 2O5RA 4FE7A 5LGNA 4HX4A 2JJ1G 4XKCA 2D2CB 1FP1D 1NK3P 4KHPO 1V55H 4X88A 1HKSA 1AI7A 2A79B 2VOPA 2OIGA 4EMSA 4HLYA 3FXOA 2YXHA 3FZVA 5FD6A 3MAQA 5FROA 2OYQA 2P8TA 2QQ8A 4YHHB 4EEFG 1R1UA 1S7OA 2X1EA 1YITI 4A3FJ 3NXSA 4IHVA 4V19K 1OCCC 3CCMV 2DK8A 2BGCA 4O3MA 3GB7C 4XIDA 3P9CA 5JR3A 3KZZA 1NZ6A 1IAWA 2KDZA 2ZJ2A 1ZGJA 3UM7A 3FAVB 4ESBA 1G3WA 3FK7A 1WAZA 5K5OA 3RYPA 2A0LA 2XPVA 1B9MA 1MA1A 4CH5A 4KA4A 4UUSB 4LFBO 3BA8A 3QP6A 4W1UA 4OIRF 3CRAA 3N2GB 1XSDA 1FJGB 2DMXA 2OTJV 2DA5A 1X4OA 4YJ3A 4AIDA 3AG7A 3DLAA 5ED4A 3HRSA 1YJWV 3J80K 2Y9YA 4BE1A 2R7UA 1TWAJ 3J80N 4KDPA 2NNUA 2VBYA 1W0JG 1L8DA 3JCZA 3CF2A 5KHDA 3UO2A 4WCEV 4YHHO 1POGA 4XLCA 3PNVA 2JPCA 3Q3SA 4XRFA 5J3LA 4CCJA 3QWLA 2Y30A 1PVEA 4CA0A 4DV0O 4PJMA 2B9ZA 2XAUA 1P92A 2F48A 4XRMA 3BOQA 4QGPA 3GXOA 4HPQA 1XMAA 3BR0A 5E3MA 1Y66A 2F5EA 5LHIA 4FFBB 4PSXA 1TW3A 4XKBA 2XPWA 3AG2C 4AQYO 2ATKC 1WI9A 1KECA 4JI7B 1D1AA 1P7IA 2FJ1A 3HKZN 3NARA 3PQKA 4M6XA 2DFFA 5KMGA 1BQZA 4F6RB 3BABA 1TWGJ 3E5QA 3HSEA 3W2WA 3SZTA 4HYOA 4DUZB 1WH7A 1D5YA 3A01A 2HXIA 4JI5B 4QJFB 1NH2D 5IP6A 1QZYA 1Z6RA 1V54C 4JBAA 4LF6O 5ITZB 2QSAA 4DV1B 2OCEA 3I64A 2M8EA 1PNMA 2EIMH 1B6AA 3BTLA 2FBHA 5E8GA 5AIQA 1F4MA 1SD7A 3B4SA 3IRRA 4OIOF 2Q4PA 4FLWA 4KP4A 4R50A 1XCBA 2VONA 1XL6A 1T38A 2XASA 5GPAA 1RUNA 1S0VA 2KRHA 4S0HB 4EB6B 1ZTEA 4OAZA 3N2GA 2COBA 1G6NA 1KYWA 3DTUB 1LJ9A 3KP3A 1FIPA 4GDFA 5J4YA 3E1SA 1NI8A 2CTRA 2BVMA 2RQQA 1SFKA 1L0OC 3FXKA 1Y74A 1FBUA 2LY2A 3HM5A 1ZARA 3WHBA 5LFAA 4HNAB 5J2TB 2PN6A 1BBYA 2AHYA 4PJ0Z 5TJJA 2Y75A 3BR6A 4PZJA 4IKFA 3FMRA 3WTVC 4MVZA 5HLIA 1ZR4A 1PP7U 3BLYA 3LDDA 3DKYA 1TBXA 4BHPA 1W0UA 3GTMJ 2Y0SN 4FZ0A 1ETWA 5IOZA 4L9TA 1EF4A 1EZVH 2YIAA 3CB2A 4TV9B 5E79Z 2VT3A 1Z5WA 4DYLA 3C2GA 3IP4B 5A2QN 1VQLV 2NAZA 2KIQA 3IH4A 1VQLI 2ZE5A 3I56V 2EIMB 3OV8A 3KG2A 2VC1A 3BZCA 3C2BA 4PCQA 4EJOA 3ZHSA 2VRZA 5FLXZ 1X4PA 2HVJC 3E8GA 4U3JA 5HDNA 3S3NA 1V5FA 3SZGA 3CCUV 3PNTA 2Q67A 4IOAF 1WHUA 5TRDA 2R93J 4Y7NJ 2BXYA 1US6A 2LW7A 2GA2A 2IA0A 3L7WA 4O6JA 4B09A 2HVSA 1NG6A 3RKXA 4X64B 5L3GA 2Q8KA 4JTAB 5F0FA 2R7QA 2Z16A 2MG4A 2NS7A 5EBLC 3I4NJ 3K5NA 3IJ4A 2HOAA 1T56A 4RO2A 1YSCA 5J8FA 4ZDOA 4X20B 2B1GA 2WWWA 1VI0A 3DLLF 3KYLA 1JKQC 1BIBA 4WBNA 3BCBA 2HDDA 3S2HJ 1N25A 1ZWIC 1L3LA 1MMGA 2A6TA 2IXSA 3ZXSA 3G6BA 3FYIB 3TKYA 2DDAA 1X59A 2V7FA 2IA1A 3OYFA 4BH9A 2HEOA 5CJ9A 5CLSA 3OYJA 1SFXA 4G6TB 1YJWI 4MLOA 2MH2A 2Q69A 1W1WE 2P7CB 2ZQMA 2WLLA 3BR1A 2JA8J 2KG7B 3QNEA 1S77D 1YFHA 3N2KB 4G2KA 2AHQA 3SQNA 1BT8A 1Y6IA 1T8IA 2QQAA 1EZJA 3GMEA 2WAMA 4MW8A 3CCEV 2QA4V 5BY1A 1M57C 1U8RA 1K8AW 1PP8F 1VQMV 4MO7A 2E5ZA 1WKMA 4E7KA 2JGDA 4A3LJ 4LFAO 2B9SA 4I98B 5ERIA 3RW0A 1IN7A 1KQ8A 1OYYA 1WJZA 2UXBO 3WU2Z 4BEHB 4D7NA 4TQDA 1JUMA 2DWEC 4JI8O 1XDSA 4LD5A 1EH6A 3OIQA 1FXKA 3ZRVA 2BHZA 1HKQA 2GIZA 4A0XA 2B1IA 2H8PC 1P4WA 2MD0A 2Z99A 3TL4X 3FIWA 4EGYA 2EILC 2P4KA 2K9SA 2Q0AA 1ZLZA 2ZFUA 1UAAA 2BE3A 2R72A 3LNMB 2HOEA 1TQMA 4Z1VA 1SMTA 1DGWY 2KJBA 4M9ZA 1OFCX 3RYRA 2XSDC 1JR9A 1HDDC 4C2MJ 2ADUA 4M3GA 5KCMA 3OYIA 4QWQA 3K70D 4G7HF 1D5NA 3RPQA 3ABKC 3SJQC 4KT5C 4TV8A 1PUFB 2HHHB 3ZQHA 1B04A 4K0KB 1BHBA 5H6QA 1JA8A 3G67A 3SYAA 3GVAA 1SZTA 4KHPB 1B72A 4U7OA 4X62B 2X6XA 3IUOA 2ZR2A 3AL0B 3Q4HB 1U5TB 3GZNB 1K4CC 5FNVA 3WG7H 2Z9OA 4UB8Z 3F8CA 4U88A 2IT0A 1AA7A 3L74H 3WGHA 4ZYDA 2L9RA 3NWTA 2R5ZB 1B8IB 3HOZJ 1YHQI 3OMNB 1ZELA 1LVAA 3D0SA 2F2EA 5FPOA 5F27A 2RN9A 4ZYEA 1W36C 2LQTA 3RBZA 4X62O 2YS8A 4HF0A 1HNZB 1XD7A 1GM9A 1I7FA 4R7CA 4UCVA 3KE2A 2KHMA 4JTCB 4X64O 5EEAA 2DYRB 3SYOA 1TWFJ 1V55B 2HZTA 4R6ZA 2H09A 1AVMA 1FXVA 4BW5A 3K69A 4C2TA 3E22B 1LDJA 5LP6B 1IDSA 2D2WA 2KISA 5IYBO 1D8JA 2XHKA 2ODMA 4IHSA 4IHYA 2DQ0A 1OCZH 2UV1A 3CESA 3E97A 3TP3A 4CGZA 3P7NA 3AG4C 3BHPA 4DR6O 2Y31A 2CO5A 4FK5C 2HLDG 3MDSA 4ZKIA 4FASD 2D1HA 1QPIA 3GTPJ 4MTDA 2UUAB 3QPSA 4TV8B 2QLZA 2DA7A 4HSRA 2DXIA 2X85A 4P5OA 2VQFO 4DR2B 5DEQA 3IKTA 3ZCCA 5DM6V 2B0LA 1PPJH 4JYCA 4GX1A 2P90A 2FQ3A 1R73A 3DPLC 2ZINA 4MGRA 1BW5A 1ACIA 1A6IA 3OYNA 4HDVA 2EINB 4R8CA 2QVOA 2BSKA 4X8AA 3BJAA 5E18F 3SPIA 3GW2A 2A05A 2D5VA 1A6QA 1NQTA 3B02A 3OSGA 2X1DA 3CD6V 2HEPA 2Z1DA 1N33B 2CW0F 2K9LA 2KZVA 4GRIA 4ESFA 3LDCA 4J80A 4PA7A 2I5UA 2E7XA 2IA2A 3U10A 2VIXA 3BG6A 4HV5A 4EJVA 2ETNA 4RAIA 2H6CA 3T1YO 4I55B 3K57A 2EX3A 2ZXJA 3CUQB 3RIRA 4DV7O 1U0JA 1OCZB 1HXDA 1H8HG 3OTOO 2OCCB 3K7AJ 2OTLV 3H1IH 3GZ6A 3ZRWB 3IV5A 2EZIA 2FEZA 4ICGA 2V1DA 2DWDC 4WXHA 3BZKA 5TISZ 3OYGA 2L54A 3SJAC 2ICWG 2NS0A 2UUCO 3K08A 1XUQA 3K59A 2QKMB 1I39A 4G9YA 3W7SA 4LITA 4DNCA 4ZZDA 5BQTA 3O65A 4D6TH 3T0YA 1PL4A 1I6XA 5IT9N 1T98A 4BQOA 5J8CA 2EIKB 4RUFA 3C2HA 4X1EA 1UPGA 1OCPA 1P4XA 4LNUB 4JI4B 2DOSA 2ZXWC 1MNMC 2GXBA 4O4LA 2DU9A 5CA3A 1B1BA 1V5GA 1WI3A 1JTXA 2W57A 3BWGA 4IHJA 1FWZA 1IN4A 2BTQB 4IPAA 3JREA 4A3BJ 4E7LA 2QQ9A 1U96A 1QNTA 1U9OA 3ZJZA 2GTSA 2XAFA 2FUG2 3MZHA 5HS9A 1RETA 4P55A 1GTOA 1SKVA 3HYIA 4A5UB 3EUHC 3JTHA 4FJCC 1VQKV 2IGKA 2MABA 1EBOA 4RQEA 3ABUA 1H89C 1KP3A 3FD9A 4IVNA 1SRYA 1D8KA 1Q6IA 2CFXA 2ME6A 3JARB 1AROP 2BOLA 4BJ6C 3RCOA 2G7HA 1R4MB 4P9PA 2VJ5A 2MC4A 5IP9J 1TNTA 4FZ1A 1NG7A 4M74A 3A03A 5IYCJ 3OYEA 2DT7B 5BMVB 4LCUC 1MBGA 2V26A 2PZSA 1VZ0A 1S6LA 1GH6A 3M8AA 2QM8A 3JW4A 3VQYA 3AKZA 1VQ9I 2X6BA 1AI5A 1R3IC 5H9CA 3ZRWA 3C90A 4KMFA 3A0HZ 2EIKH 5B3SB 2JK5C 5LYJA 1B8IA 2IP2A 1XNRO 4BBSJ 1J0RA 2HTJA 3QO8A 4KXRA 2H8WA 2M0MA 4HNVA 5D5WB 3LA2A 2UXDO 2K02A 4NVPA 2LFRA 4D5FA 2LJ2A 3RJPA 4N9HA 4BGDA 2P6SA 3KCYA 1OQYA 3QF7A 4P30A 4HBLA 2C6YA 4X1IA 3I59B 1NKDA 2YIDA 1M90W 2XUMA 2R5YA 4IIJB 2LKSA 2RN7A 4OGQB 5ICCA 3RI4A 1ZGWA 4JTDB 1VQNV 4CHUA 4A0YA 1GN2A 3GTQJ 1M5IA 4LH7A 1Y56A 1LKXA 3FHNA 2ZR3A 1CF7A 2P4VA 4M9XA 5IYBJ 4IZZA 1YQAA 3OY9A 1QVTA 1WA8A 2YX7A 4EQQA 2VJIA 3IWZA 1O3SA 1QU3A 1O7FA 2OT5A 3RYFB 1WCMJ 1HR0O 1R5GA 3H1JH 1VNDA 1CGPA 3AFHA 5J6XA 5LXTA 1GV5A 3VODA 1HF0A 5CBFA 2A61A 1OZ0A 4DYRA 1VF6C 3LSSA 2M45A 5GONB 2JA6J 2M7WA 3H36A 4J9YB 2M5WA 2L3DA 3FISA 4HA8A 5FRNA 2IBZH 4N4NB 5KA5A 4LF9O 3CMMA 4QIWN 2O61A 3G3ZA 3Q9SA 4DV0B 1IXMA 1XHXA 3OD4A 1Q6UA 2P4WA 4RLQA 4JPRA 1JX9A 3CDIA 2NRAC 1YS7A 3TO9A 3FXRA 5JLWA 2FXAA 3MKLA 4E7IA 2M4GA 2V6EA 5D5PA 1ORKA 1TL8A 3BCAA 3BG5A 5E1WA 1GK9A 3GF2A 5E1XA 4LF5O 2RVCA 4JV5B 1OJHA 2JTVA 3KEYA 1VQNI 3R60A 1OYWA 4X9QA 1F5TA 3ABKB 1IUYA 1L1FA 2HP8A 3QU3A 3O9OA 1X1AA 2DLLA 2K86A 3GYHX 1VQ7V 4B3RO 4NDLA 3JCUZ 5B1AB 2D1VA 2BE5F 4ON0A 5LEKA 4XDJA 2ID3A 2EBIA 1F1ZA 4WXDA 4NC7A 2PI0A 4I55A 1XHZA 4JI2O 2KIUA 4ABZA 1TWCJ 5JVTA 2WTEA 2EIKC 3H5AA 4G27B 2X6YA 2XGCA 3R66A 5C93A 2DBBA 1DP3A 5IT9Z 3GBGA 3NEUA 4PI2A 4EFEA 2GA1A 1X58A 2N05A 2ZCEA 1IW7F 3F0CA 4BY7J 1BL0A 1EM1A 1RFYA 1IXBA 3JRHA 1J7KA 2JT1A 3K9AA 3TETA 1O4XA 3H0DA 4MTGA 5L3FA 2AGAA 3HTUA 3MKWB 2TCTA 1A35A 4R1HA 4DW1A 4GYCB 4MSWC 2BOCC 1T0FC 5E1ZB 1AR1B 2R70A 1J5EO 4OX9B 4MVOA 2JRTA 3APQA 1TWHJ 1U9NA 3IAM2 4UXNA 2O3FA 4M6YA 1XS9A 3T8RA 1ERDA 1D1CA 3D5RC 4A3KJ 4AI8A 2FX0A 1SD6A 2L9NA 3CHXA 3W6JB 1O9GA 3H9VA 3J7AO 2K9MA 1Z9CA 4FQGA 1RSOA 2L9SA 3Q0UA 3K9SA 3F8MA 4YG2F 3SPCA 1IXSB 4NYKA 1BC8C 4X89A 2PYLA 2FD5A 2ZFWA 5DUKA 1AJNA 3U0ZA 2OU2A 5HFMA 1NVPD 1T33A 1RNLA 4OIPF 1N0NA 2I8DA 3ZS8C 3JARA 1BCCH 1O3QA 1U2WA 2VODA 5JH7B 2JVDA 1OJLA 2H1LA 3KZIC 4LIUA 5GAGJ 4FPPA 5JQGB 5IYCO 2GTAA 4AQYB 5J40A 5M3MJ 5IOYA 1YF2A 3HG9A 5KUMA 3EETA 3EYYA 5JJJB 1GUUA 2XNDG 1ZAUA 4JGSA 2JSPA 4OPAA 2RQ6A 3J81Z 2EZKA 3OR7C 2JK3A 5IDJA 2O9LA 3EHBB 4DV6O 1FOWA 2ZXWH 1H8AC 3C3SA 1TVKA 2ZNIA 4WFEA 5CMUA 3M8FA 3IC7A 5LHGA 1DUXC 2AZ2A 2A9HA 2W48A 1R3KC 4ZTJA 2P22C 3IH2A 5DM6F 5B1BB 4F4LA 3RVZA 5J9PC 1J95A 4B3MO 3HOWJ 2HHHO 1MNEA 2BY2A 2V1NA 1XPXA 1FZPB 1PUEE 2YU9J 2CH0A 2VXZA 2ME0A 3DPUA 2HDCA 1P4RA 5LA6A 5IJ9A 3QYBA 2DYRC 4K35A 4DR5B 2A06H 1LE8B 1K4DC 4FFBA 4KFMA 3ZQQA 1MZFA 1A36A 5LHHA 3SGIA 1UCRA 2P5OA 1K7DA 3FMQA 3V4GA 3HPLC 2DA3A 4CH6A 1IBKB 1K6OA 3HRTA 1J09A 1B9NA 2EA4A 1ROPA 1WA8B 5GW7A 4GKJO 3HPGA 2QKAA 2NR5A 1G59A 2RMKB 2ZDIA 4H37A 4Q48A 3O6BB 4J9ZB 1SQBH 1Z3XA 4FLUA 1GKFA 5CVUA 1SVLA 5B66C 4CCNA 2K40A 3CC4I 1H2MA 2B5UA 3D8CA 1FC3A 4ITVA 1NH2B 1VP7A 1WFXA 3B6AA 1Z5VA 1XOUA 2JWTA 4FM0A 4IOCF 2D45A 4BUPA 5GAHJ 2ZNZA 2DW4A 2KIFA 2WADA 3RTRA 3S8PA 1R1TA 5HLGA 3WTTC 5BOXA 2DE0X 2JS5A 4WFGA 1BR2A 3FDYA 1S29A 2XROA 2ZIOA 1H2LA 2LFSA 4DR3O 1B6QA 1KU3A 4IT5A 1Z7LA 3REOA 5HDKA 2IGMA 3CD6I 4HF2A 2Q6AA 2UU9O 4OMYA 1YI2V 4B48A 2E1OA 5ICGA 2Q5ZA 3KLNA 4J42A 4BIUA 1D0YA 5KVRA 1ZQ3P 2ILMA 1OR7A 1VQ5V 1UHSA 1K9MW 4NUBA 4D0PA 2X6OA 1BR4A 4RGUA 1K92A 2E60A 1QR9A 1UFIA 2X6CA 4AYBN 1WNSA 5FO5A 3CMAI 2Q9LA 5FLMJ 1GRJA 2FTKA 4MFDA 1Z67A 4EJTA 1SQGA 4YFXF 4MVSA 4DR7O 3BC8A 1QA6A 3MMYB 3TK1A 4ZBMA 4X1KB 2NN4A 3WU0A 1H2SB 5CVJA 3FB5C 1Z91A 5EYPB 4G28B 3SPGA 1VQKI 4FETA 4O5VA 2PF4E 2R9IA 2QKSA 1R9TJ 3JAKB 1X2MA 3PQJA 4XSXF 3OYLA 1Y1VJ 3ML0A 1Y0NA 3J80Z 3RQIA 4GT1A 1Q43A 2OQRA 5LRRA 2XHBA 4DR3B 2EV0A 3CS5A 4XORA 4UY8I 3L73H 5KAIC 3WG9A 1G8XA 4GX0A 4B3SO 3A0RA 1VMGA 4QPOA 4XN0A 3BY6A 2XC7A 2DK5A 2L7ZA 5LMUB 4L9NA 2Q8VA 4ENNA 4DV7B 5K7HA 1LNWA 3WTSC 2CG4A 5KMGB 4MHGA 1MZEA 1I08A 4F6RA 2KQXA 2E1NA 3A8TA 4J00A 1WJAA 4ZC3A 1UZCA 4RAZA 4X20A 4XNFA 1SVOA 4PJLA 3B40A 2HQ5A 2HKXA 1RI7A 2ZJPF 1TUBA 1HNWB 1S7AA 3I54A 3QTCA 3RKQA 4BWAA 3RYCA 4NR1A 3SZPA 4JYKA 3UNGC 3ETEA 2HYGD 4DV2O 3PO2J 4A93J 2AW9A 3DWLE 4WCGA 2BY3A 3V8JA 4U7DA 2WAFA 3FF5A 4O4IB 2L4AA 1JKRC 4A6EA 2UXBB 2ADPA 3CCSI 2YEVB 4EEQA 3E5XA 3OIOA 2H6BA 2NNYA 2P5KA 3SJMA 1UB9A 2G0EA 4LB6B 1WPKA 1M1EB 4Q6GA 2UUAO 1TVKB 2LG4A 1TQIA 4X66O 2QWOB 5GTIZ 2BEOA 4JV5O 1MZBA 2JGDB 1EV7A 3ZGKA 1CEZA 5GTHZ 2HNHA 3VDXA 3GCMA 1S72V 3ZHTA 5FD5A 1HOMA 4ZYGA 1QBJA 4OAYA 2NVQJ 2MK3A 3T2MA 1LUWA 4FLZA 1ZL8B 4B47A 3QOPA 5IJ9B 2YDEA 1K78B 3T8TA 3VQWA 2M87A 3Q9VA 3TDZC 1ZRCA 3OAAG 2L02A 2QWWA 3CMYA 2BW3B 2LLKA 4TT3G 3OR1C 1FIAA 1B4AA 4D5CA 3BR5A 3M1CA 4I01A 1FYKA 1ZX3A 3P5JA 3HEFA 5CYVA 1Y0UA 4OXSA 4L9JA 2VQCA 1ENVA 5H2FC 1H2KA 5E3NA 2ZSIB 2EBOA 4YEJA 1VIBA 3CCQV 4DUZO 1R7JA 4DR4B 4BQQA 3K03A 5HNHA 4HQMA 3CC7V 1NTCA 1B72B 1FLIA 1BM9A 4LOCA 4DV2B 2JDIG 3MKZA 4H13B 2HWVA 2PMHA 3CYOA 3JALA 4LC1A 4IGGA 2DMNA 2PMZA 4KISA 3TGNA 4EJUA 1URFA 3ZIAG 3EUAA 3HHGA 1YRNA 1FXHA 3OR6C 3W7XA 5IYDO 4LF7B 2QSGX 4RB3C 4MFEA 1WVRA 1SVMA 2GOMA 2YUAA 3OMAB 3P9IA 2LD5A 1E1QG 5GAEJ 4PELA 4JQFA 2LC2A 4LF9B 2DA4A 3IL2A 4X66B 3TXSA 5DUIA 2FB5A 3SR2C 3K0GA 3KEOA 2ADQB 2R7XA 2LBFA 5IP7J 4U3FH 1MDMB 1E1RG 1VQPI 3UT5B 1FBQA 5LEJA 3ASNC 5ILSA 3HKEB 1HW5A 3HKDA 2E76B 1N32B 4DOZA 1Y76A 2EZPA 3DCFA 4E7ZA 4JI1O 3RWRD 1ETYA 5F2VO 1R6NA 2Y9ZA 3ZMSA 3CP1A 4JI0B 3J7ZI 2E71A 3JAMZ 1SMYF 2K4BA 3H1CA 1FTZA 4JI8B 3R6SA 3O3KA 5DD4A 1Q7YW 3AG2B 4YJ2A 2IS6A 4HSTA 2BY0A 3HKCA 4JI6O 5CKTA 5L3BA 3JAKA 3I56I 4G94A 2L01A 1VF7A 1MJBA 3ZX6A 1UHMA 3SXYA 1KGSA 3U1DA 1WP8A 3ZMZA 4ASNA 3A01B 1MSDA 2EINC 1Y8QB 3RQ4A 3BR3A 2R7RA 4NXMO 6PAXA 3L2VA 4MTOA 1NU1H 3DBHB 2OJED 1A04A 4N0BA 5EZYA 4RAFA 2JJ2G 4AIJA 1VQPV 3TO6A 1ITYA 2F4OB 3AK3A 3FB7C 4CC5A 3CC2V 3DC6A 3GLXA 3AG3B 3SYCA 1XG1A 3VYUB 3W2AA 4UV9A 2VOOA 4CYDA 3X2QB 3BQYA 3QPHA 4I99C 1P49A 2ZB9A 2M3AA 4GYGA 3FX7A 1RKWA 3PN1A 1K73W 3CUOA 2BSKB 3QU6A 3MKYB 4JZGA 1YJ9I 1GHCA 1BMFG 1F36A 1ON2A 3K4CA 4NC8A 1L0NH 2O0YA 1S76D 1PUFA 4IO9F 3M99B 5DCMB 3OGIB 4B3XA 4L5IA 2QR4A 4XQFA 4PA4A 4AU7A 2PGGA 3CRMA 4HG2A 3ETQA 3OT7A 4ZOLB 2FNPA 3UT5A 4P96A 3OYAA 1SC7A 2FU4A 1RPRA 2PI5A 4HAMA 1FYMA 5C8YA 1BW6A 2OPTA 4KJZA 4A12A 3Q4HA 5JHUA 2CDYA 1MJ9A 1U5TA 2IH1C 4LBEC 5FNVB 2FBKA 2XAJA 4U7NA 2HQRA 4HV6A 5EIBD 1QHHD 2HZDA 2Q68A 5E3LA 2R5ZA 1OV9A 5AIPA 2EIJC 1R23A 5J2UB 5H2FZ 4MEYF 2VC0A 2DTZA 2OUMA 1JT6A 3F3XA 3LSPA 5BS6A 2ACJA 4ZHQA 3TQNA 4ZH4F 2VPLA 5KNLA 1SFOJ 4EM0B 1FEXA 1YITV 1BI2A 1MH3A 3FKSG 2IBDA 4DR5O 1PNLA 2W6IG 4JK1X 4LGWA 1AJPA 1ORQC 2K27A 2CK3G 3CJTB 3F5TA 1XNQB 3ESWB 3CF5F 2CUFA 2CTWA 2DJNA 2QENA 3LFUA 4F92B 1Y67A 2ZXHA 5L3EA 4U3JB 3WG7B 5BXZA 5FKNA 5JWPA 5B5EZ 2QTOA 2K1EA 1MMNA 4A2UA 2LGWA 4JX6A 3E0JB 5LLQA 1AR5A 1PJRA 3OYMA 1SA0A 3K2AA 2CGPA 4RDUA 1A32A 3OUFA 3STZC 1KUQA 2FF4A 1JCHA 5FFXA 2OCCC 1SAXA 3B8NA 2Z3YA 4AVZA 3CQZJ 2X6WA 1K83J 4EJWA 4KIFA 1IJWC 1J5EB 4DV3B 2DMTA 4MT8A 2W00A 1R00A 1QGPA 2VKHA 2E19A 1PKXA 5H5NA 4JP0A 2CWEA 3ZP5A 1SQPH 1DLBA 3W6VA 4RA2A 1JJ2U 3CCVV 5EDNA 4DV3O 1Q86W 3JSNA 1W0TA 1AKHA 2GBYA 2QYOA 1UJ8A 4HOBA 4RWUA 3ASOC 3BZ6A 2VJJA 2M7AA 2HOSA 4DGWB 4I0XA 3KP6A 4I4TA 4F7ZA 3CCLV 4H4KC 5CVVA 3COAC 3HL2A 1S8NA 1RR7A 1R3JC 4II3A 1LFUP 4B3RB 2CUZA 3PL8A 1NT2B 4ZHQB 2CFOA 3VYRB 1YIJI 2ELJA 3O8GA 1N77A 2L4MA 1S72I 4LF5B 2XUBA 1N4CA 3HKEA 1L0LH 2HFHA 1I6HJ 2XB0X 3GVMA 4Y17A 1YO5C 1TZLA 4O4JA 4IIJA 2M2EA 4RLFA 3P9KA 4PK4A 1JKOC 3FB6C 2MLGA 1PYVA 2MYSA 2RQPA 5DCFA 2H1KA 3DFGA 2XOKG 3AEIA 3OM3B 2NVTJ 1SC5B 2MFZA 4LG0A 3CCJI 2CQXA 1IRZA 1Y39A 4JAUA 3K79A 2DODA 1H9TA 4E7JA 1HDPA 1NTMH 3M9AA 2QDOA 3OEEG 1F23A 2A69F 2RREA 5J1UA 1QLEB 2JIZG 4J41A 4PJJA 1ZTRA 1WLEA 3CPWU 3OWTA 4ENKA 4IJAA 2QGUA 3S1NJ 4I50B 2OCCH 3PNYA 2DI3A 1SFEA 3Q0WA 4HLXA 4IHJB 3SYQA 3W7WA 3DXJF 4NXNB 3HSFA 2ARHA 4PSWA 3DU5A 2ZT9B 1MBJA 3BR2A 4WF2A 4N23A 1J2XA 4RGXA 3I3LA 1AKHB 1EN4A 5DS9A 1H2GA 1U8BA 2CTQA 4FE4A 4QPJA 3CDLA 1HW7A 1T0FA 2OZUA 3I58A 5F0CA 3WODF 5C44J 3E7LA 4UFZA 1R1BA 4I4TB 1USTA 5IJ0B 2R4GA 3KCCA 1HQCA 3G6EV 2XGDA 4JF3A 3ABTA 1RM1B 3CZ6A 1OCOH 2DN0A 2O03A 2WV1A 3SDBA 3JD0A 1I3QJ 3M3YJ 3JD4A 3MHHC 2ZO4A 3QPLA 1YZBA 1VEWA 3MVPA 5FL7G 1SQXH 4OPHA 3RYHA 2K3PA 5H20A 5K7FA 1ZG1A 3Q0VA 5BR8O 3CDHA 1YEWA 3DP7A 3D3IA 3SYTA 3K06A 5LMNB 1KZHA 2EV5A 2X9DA 3K1MA 3S16J 2HI3A 1GXQA 4CYCA 4UNOA 3SFIA 3KIOA 4L0ZB 3N2KA 2LKPA 1K34A 4LF4B 3H1HH 5EC1C 2V6CA 2QWQB 2V7QG 1NS1A 1Q3EA 3CMAV 3E3VA 4ABMA 1KBHA 2XSJC 4ZJZA 1WP7A 2CGNA 2PTMA 2ZXWB 3KP4A 2E1MC 3CXHF 3QVNA 3WU1B 3UCSC 5CA0B 4O2AA 2VWJA 4DR1B 2XV4S 2R5YB 3OS2A 4ZTFA 3ZPLA 1QVFU 1X3UA 1P7JA 2Y69H 3HC7A 3K1PA 2R9RB 3HUGA 2F4VB 2VKDA 1J75A 2WLJA 5F1RA 1BJZA 2PJPA 1I5XA 3S3MA 4E7HA 1ETKA 2AHZA 4P9OA 1XMKA 1F9NA 4A5MA 4X1KA 1SEUA 4LWSA 3S1QJ 4AWXB 2GXGA 1QLEC 3TGUH 1D3YA 5DDGA 1AP6A 1RM1C 2Y0SA 4PUSA 5LBQA 2IGNA 2ZMEB 5K5RA 3H5RA 3U11A 3FB8C 4MVMA 5KAFZ 2N8GA 3MD0A 4GX2A 3SFZA 1RKTA 2VE8A 3VSLA 1QQCA 1I3AA 1T08B 4L9VA 3K4BA 1QVGU 3OL3A 1VQ6I 2YC0A 2HFEC 2OWOA 3KP7A 3B09A 5HVQC 2O8KA 3TW7A 2Q7GA 3OTOB 2MGQA 2KIMA 2Y4UA 2BVLA 2Y48A 4XLAA 1PV0A 1XN7A 1S3JA 3U1KA 3OS1A 3K0LA 3GFLA 1ZRFA 4CBCA 4X6AJ 2RNGA 1K4SA 1ZUQA 5DV5A 5IY5B 1HNWO 2DFEA 4BS9A 5HFLA 1DK1A 2IW5A 3LSKA 2ELHA 1R36A 2DT6A 3KCXA 3TOAA 2CW7A 3ZHRA 1WJDA 3CWBH 4C30A 2EH3A 1LVKA 2YU3A 2JA2A 4AVPA 2KRFA 4J01A 4LF7O 1EN5A 2K9PA 1U5TC 1THZA 3GWKC 3KP5A 3O8HA 4F55A 4EATA 4LNUA 4XK4A 1HNXO 1FT9A 3MN2A 3PIPF 1EA3A 2IS2A 3E22A 1YX5A 1JQ0A 1XGNA 3KZIZ 4IEJA 1SETA 5CBGA 1ONVA 1OCTC 1LFPA 1JOYA 1XMOO 5HLHA 3JSOA 2VT2A 1OHHG 2Y69C 3GLLA 3ZRXA 3A02A 5E8IA 2ECBA 2ZNJA 3MEXA 5GTHC 4C2UA 4GXOA 5HS7A 2PMUA 3FM5A 3UQ8A 2PUSA 3G4SI 1VF9A 4RAYA 5DD8A 3WTXC 2DO7A 2DYRH 2DFIA 5JLXA 2UUBB 5IPAA 3HJEA 2MBFA 3NAUA 3F22A 3E6CC 4LH6A 4MQVA 1FYLA 1IV8A 4B3AA 2OTJI 2WAQA 1TUEB 1QU7A 1IN8A 3F6VA 3ABLH 2L7KA 3WE2A 3ZMVA 4E7SA 2BCCH 5JCOA 3ETGA 2JA7J 4FLYA 4CICA 1YVWA 2CQ7A 2P7TC 3HKBA 4F3QA 2W4SA 1ZREA 2W0FC 4JZ2A 4HZFA 1J9IA 1MSWD 3K6GA 1IN6A 5LYJB 1G4YB 1JHHA 3OL4A 4AD9A 3LWFA 5K1YA 3CCMI 1FP2A 1ODDA 1ZKGA 2QCOA 5F6FA 3HOVJ 1AR4A 1DF4A 2N04A 1IX9A 2ZNYA 5K5QA 1SQQH 5L3DA 2CUJA 4PA9A 1BGYH 1HR0B 4N4OB 1IZ3A 1HP8A 2QM3A 3TDUC 3HGGA 1FAFA 1H9GA 2HYFA 3ML6A 2LMDA 1W7PA 4LF8B 1ULYA 2E36A 1E3HA 3H3ZA 2OA4A 3J81K 2EINH 1MMSA 2JA5J 2L0KA 3IKVA 2Z33A 1M9NA 3FAVA 4BW9A 2L7FP 2EZHA 2LY1A 3I71A 3LQRA 5EC2C 5KAFC 3SEZA 3JAMN 2J5OA 2RJZA 4W4LA 5JCOC 3RPUD 1YTYA 1SD5A 2CH7B 5LXTB 3IRQA 2Q2EB 3JAWB 1YLFA 5L3CA 3SJBC 2IJHA 4AHCA 2OV7A 2X51A 3QRFF 1VQMI 4QNHB 4JI6B 1HSTA 2NYXA 2EWNA 4HRIA 4Q4ZF 1VTNC 1IURA 4LFCB 2ZMEC 3FWEA 5A9GA 2E5LO 3KX2A 5D8KB 1S9HA 1IRXA 2DQLA 5EG0A 3B2EE 1BL8A 2HXOA 2QF7A 2BHYA 4G6DA 2K4JA 4CXFA 1KU9A 1KKDA 1BJAA 2WSSG 2GV9A 3S2DJ 1K7AA 2XPUA 5JJEB 2JMWA 1QHTA 4QPKA 3BVOA 3WTWC 2GXAA 3V42A 3T1HB 4XKWA 3KETA 1FTTA 2ZJQF 3BFRA 1TUBB 5LD2C 1XQ8A 4E2LA 1QRYA 3C3WA 2K7LA 3U9GA 1LQ1A 4XBFA 2HOTA 2W25A 2GOXB 5FB2A 3OMIB 3HB9A 1FJLA 4NXMB 4XLPF 4HW0A 5E17F 3K4KA 1IBKO 4BL0B 4ANJA 2OC6A 2QM7A 1TP4A 2PBIA 1WJBA 2WLHA 3CRQA 2W7NA 4U0VA 2X4HA 3S1MJ 3VYSB 1XSVA 3D1NI 2WLIA 4V2FA 3A2KA 5IYDJ 3T1HO 2AS5F 3CO6C 4DR4O 1HW1A 1MBFA 1IC8A 3L2RA 4EB6A 1JFFB 2PFBA 3D5SC 4J7KA 5D4RA 1CPYA 2RC4A 2RNJA 1D1BA 3WU2C 4D1QA 2AQEA 1VF5B 2OZ6A 3IWFA 4ZYHA 1LNQA 1MMMA 1K78A 2QKLB 1XDCA 4BJ5C 4IXAA 1YJNI 1N78A 2JGUA 3UKMA 4N9IA 1OMIA 2VBZA 3A2FA 4HNAA 4NTYA 3HRMA 5KX5A 2XAHA 5J2TA 4FTHA 1X1DA 1X1PA 4CCOA 2LKXA 1YJ9V 1IBMO 3DV8A 1VQ9V 3LL7A 4AYBA 4A3IJ 1VQ7I 3BG7A 4NKGB 1V5EA 5AG2A 4E4HA 1XTAA 1COWG 1OR7C 2VBWA 1R58A 3OGCC 2FOKA 2XTAA 3QPTA 3ASOB 2FQ4A 2BY1A 3TW6A 3ZRGA 5ITZA 3JRIA 1VQ4V 1HA8A 4I7ZB 2KZGA 3TP0A 2EFPA 3OYCA 2AXLA 2NOGA 2CV2A 1G6UA 5B5EC 1XILA 3K3WA 4UCTA 3WFVA 2IJKA 4B43A 3DGEA 4O4LB 3P30A 1N32O 2N74A 1I5YA 3KPHA 3QOEA 4WXCA 3QP5A 4F93B 3K70C 3EYIA 2YX4A 2XDVA 2E1CA 4CCKA 2EZOA 3A0BZ 4G8XA 1H88C 1W0KG 4I02A 4MNUA 2ISYA 3S1RJ 1PDNC 1GO3F 2H8RA 2IEKA 4G7OF 1N0JA 2QWNB 3GFJA 4B1RA 4A3EJ 1QCEA 1AI4A 4DBQA 5DECA 1FFXB 2J5PA 1R5HA 2A3SA 4XMYA 3F7YC 4KFCA 5BNGA 3BROA 2Y69B 3IC9A 4JAAA 2PY5A 1JFFA 3KZYA 2K5CA 4WX9A 2AXTZ 1HDJA 5LA6B 3KLOA 1NBMG 3B6CA 4B8XA 2YEVA 2XB5A 2FNAA 4F52A 1PP9H 3BAAA 2HDWA 2VQLA 2V4JC 1MBHA 3FXUA 3DF8A 1WGXA 2XRNA 1YTFB 3JD2A 2ZKOA 1UG2A 3AG3C 4YFKF 4DJAA 3G71V 2LGQA 1Z05A 3OMYA 2GQQA 3ABKH 5IYZB 5CN0A 1EJ9A 3BPZA 2IGOA 4A0ZA 5EZGA 1RIOH 3C7JA 3D3QA 1MMAA 2JSCA 2EJ7A 4J11A 1XL4A 4TUYA 5BPIA 5JJNB 4GKKB 1UG0A 5GP9A 2YI9A 2CU7A 1Q82W 2VWKA 4DK0A 3VBBA 3BG9A 3BQZA 2CUEA 3J7YJ 3OS0A 3B8MA 3DU6A 2DPUA 1K3EA 4BQNA 1RSOB 4BEHA 3HOSA 3GUDA 3IGAC 1E17A 3QO7A 2R7FA 1O9HA 3S32A 4OU0A 4D7TA 2CRGA 1G2HA 3H01A 3PSIA 2LR8A 3HRUA 1GM7A 2KB1A 4MTXA 1X3ZB 4CS3A 2EULA 3T5XA 1P7BA 3GTOJ 1WPXA 3FK6A 4MQ9F 3OIPA 1TAEA 4II2A 3PO3J 3JRBA 3FBIB 3QYFA 1JMKC 1OCRC 3K4JA 5CVRA 3K4NA 3OYDA 5M5WJ 3JATA 2FYUH 3F8FA 3SEQA 4UUJC 1BOBA 1Q8IA 4PDRA 2FE3A 3JRFA 1EKEA 2RKHA 3LAJA 4CUGA 3ZBHA 1FFTB 4PGHA 1OKRA 3CCRV 4WFHA 2W0XA 4NXNO 1X1CA 4Y52J 3B77A 5CB4B 4LLGF 2F95B 5LMNO 2EIJH 2NOJB 2QEXI 1XMQO 4JI7O 3FX3A 3OEHG 1NK2P 1RPOA 4UHTA 4JX4A 1MDMA 5HODA 1WB8A 4HBNA 1MNDA 1VFCA 1C0WA 2LO1A 2FSWA 2KQRA 4CDGA 1IUFA 3K9TA 3OYKA 2F5FA 1R6RA 2QSHX 2A7WA 3OUSA 2OTLI 4FX4A 1KONA 5DYMA 1AWCA 1G8MA 2QJ1A 4KUMA 2E34A 4Z2WA 2IRFG 4G6QA 1R22A 1QPMA 3M1EA 1HC8A 2VUMJ 1A31A 4DR1O 1M57B 2VKEA 4LF8O 1V9PA 2A5YB 1WPBA 4BHBA 2HVRA 1D5AA 2KJCA 3RZOJ 2ZBKA 4MTFA 3F9KA 5C3EJ 3ASNH 3VSKA 3OSFA 5EK0A 5KAIZ 3CC4V 5CVIA 5B1BH 2RDCA 4B3MB 4QIWF 4RB0A 1OCRB 3E35A 4XL9A 1ON1A 2RNBA 3VOEA 2HYJA 4U7BA 2XF7A 3JRAA 4MVRA 4JYYA 4DW0A 4RM3A 1LFBA 1BA5A 2IH3C 2RV8A 1JKPC 2FOWA 5FPRA 5LP6C 3CJHB 3IAYA 4Z2YA 3K2ZA 2ZKZA 2ITCC 2QWPB 4UUVA 4I0XB 4TQFA 2VLAA 4LF4O 2VXDA 1ZK8A 1GN4A 2JS3A 4Y4RA 3E6MA 2G7UA 2KPMA 4B7EA 4QE7A 2RAEA 2VS0A 1IF1A 3JRDA 3F8BA 1HLVA 1GXPA 4LK1F 1MKMA 3I9V2 1AB3A 4FM2A 3OR2C 4Y15A 5EBMC 2R9AA 2AZ0A 4RUEA 4CS4A 1KYOF 3BG3A 3WHCA 2JUGA 1PM9A 4B08A 1BZKA 1KU7A 1H0MA 3X2QH 2X6AA 4X65O 5JQGA 2HVQA 1T6SA 3HOXJ 4L5EA 4PHZA 1OPCA 5J4VA 4LFCO 4IHWA 3MZ8A 5EBWC 5LP6A 5LRSA 3FMSA 2C2AA 4U87A 1OCRH 2CYYA 1MGTA 1SS3A 2XT9A 4X65B 1I94B 3ZHUA 1JJ8C 4DW6A 1IZ1A 1F4KA 3LSIA 1STZA 2DA1A 3LAPA 3BA9A 3SJCC 4WFAV 4BDZA 2Q1ZB 5K7ZA 2RDPA 4YIRX 3D36A 3GX4X 3P3PA 2VPRA 3DEUA 1QZEA 1MH4A 5FFZA 3S2WA 4M71A 5HOOA 1Z6TA 2P5LC 1XREA 2L35A 1V3FA 2P81A 5DTDA 1R49A 3HTSB 4MEXF 1WH5A 4WFFA 1Y4MA 1MIJA 2VASA 1Z0XA 2E5NA 1IXRC 2CW8A 3CC2I 2BBYA 3JALB 4YIFA 1MMDA 2EK5A 4UVBA 3A1YA 2ELKA 1XGSA 3MZYA 2EPFA 2STTA 2K85A 2QWRB 3PUBA 3EQLF 1XCVA 1YRNB 4BNCA 1MOFA 1IBMB 2E74B 3H9GA 4U0WA 4WK8F 2CV0A 3TEDA 4XLNF 3MQ0A 5D5UB 3T4DA 2W82A 2P7VB 1X3WB 3BT9A 4BXUA 1NR7A 3M7GA 1LDKB 4HYEA 4TV7A 4DR2O 2MA3A 2PQ8A 1LPQA 1IN5A 2Q73A 2RGVA 2F5VA 3ROUA 3H3UA 5M5YJ 4RGRA 3LSHA 5KHJA 2M9HA 4ZI7B 2WA4A 5JVDA 1Z7UA 2ISZA 2O8XA 3JATB 3ABMB 5EZHA 5EJCA 3RKYA 1YCIA 4FVMA 2R7DA 1LDDA 2A6EF 4GCVA 1YW8A 4YFNF 1VARA 2GDSA 2KSDA 2ECCA 2CQQA 4KT6A 3CTAA 3AL0C 1WJEA 3G1MA 4OIQF 1ETOA 1E79G 3HIFA 2GZWA 1FKAO 5F64A 1F4NA 2R7ZJ 2YSRA 2IPQX 3MD2A 2W24A 4O2BA 2V9KA 2YS9A 2QA4I 4FCYA 4I6ZA 3CCEI 1HKTA 3WB0A 1UFMA 4BXFA 2OAZA 3L75H 1U78A 4CZCA 3NQOA 4X0GA 2EB7A 4KYWA 2WV0A 1GN3A 1OCZC 3ZOBA 4H33A 5LGTA 1SQVH 3F72A 3BJOA 2B63J 2F43G 2DT5A 2E75B 2JUCA 1OISA 2LTPA 3HUGB 3AG1C 2WLKA 3FYEB 3K5OA 2WA3A 3N27A 2W1OA 2WY8Q 1FXKC 1YJNV 1XNQO 1O7LA 4LG0B 4JI1B 4CO8A 1RR8C 1K61A 1LR1A 3H1KH 1AI6A 2H27A 3DEEA 1KA8A 2QEXV 2UUZA 2YPRA 4XM3A 5ICEA 2XAGA 1ZGAA 3LOCA 2YIBA 2YSUB 3RDIA 1Q6HA 1W5SA 5F08A 2IVMA 2L2OA 3M4OJ 4ZYAA 4CCMA 4I50A 1N36O 3FM3A 3K1NA 3RVYA 4B3TO 1ZHFA 3OE7G 2E35A 2EFQA 3E6BA 4WF9V 2DJIA 4FFKA 2AXTC 4NQWA 3UKGA 1Q5OA 3SDLA 4UV8A 1V54H 2XKPA 3H35A 4Y33A 4YIIA 2JVGA 3L9DA 4DRXB 5C8YB 4GLXA 3S14J 3K0DA 1XMQB 2CJJA 2PEXA 1DGSA 3RYIA 2WLNA 2WPDG 3TXQA 4YY3B 4C3HJ 1P6RA 4JYAB 1T39A 5IJ0A 4FIPC 1XSXA 3ZQIA 3V7SA 3HPHA 2E3CA 1O57A 4Z1MG 1IO2A 2PX9A 2NVXJ 4PA3A 1E2XA 4IRGA 4ASUG 2GAUA 3TO7A 2MSYA 3RGBA 4RB2C 3BDDA 1O3RA 4YXWG 3CJQB 2Q0OC 2Y0MA 3K5MA 1LUVA 5H6RA 2F4IA 4CH3A 3S3XA 2VL8A 3C18A 5LGUA 1Y74B 2YIBD 4M3DA 4A6DA 4Z6YA 4GZRB 4DYCA 4N21A 4K8ZA 2HPIA 1YI2I 1FXKB 2HVKC 5JFRA 3A4CA 4PFOA 3PUFA 4BE0A 1R4NB 1CF7B 1XNRB 4KN7X 4AM3A 4S05A 3PSFA 1FOXA 1S7EA 2L9VA 2DMQA 3FKJA 1ZG3A 4B4CA 1FY7A 1Y1WJ 1FD9A 3HKCB 4O4HB 4K3AA 1NJIW 1SF9A 1B3QA 3K04A 3N97A 1I5ZA 4BBRJ 2GM4A 3HR0A 1V54B 5GONA 5KHKA 1JUPA 4LFBB 3QG5A 4JI3B 2F6CA 1MSEC 1KD1W 4ENMA 1JI8A 3JSLA 1QLNA 4V2GA 1KB9F 4XR6A 3LA7A 2UWMA 4I5SA 5EZYB 2DAOA 1QNMA 1TW2A 1SQFA 3SPJA 1J59A 4I76A 1H2NA 4H0LB 4UVCA 2JPBA 4EGZA 1WB7A 4M72A 1H8EG 4IL6C 1ZG5A 1BS3A 1JJOA 4LWSB 3T1YB 3H5NA 4P9UA 2YICA 2DA2A 3WE3A 5FLXN 4IX7A 3GTJJ 3EPZA 2ZMEA 3KYCB 3AAFA 1G1XB 1QBZA 2LVSA 4BACA 2EA2A 1XDUA 2O6GE 4A69C 2Y0IA 2VQGA 2LRDA 3KP2A 1XC5A 3M8JA 1RC9A 4LG3A 3GEZA 1K79A 4ZOLA 3K5LA 1KP2A 2W85A 1HW2A 4CH7A 4LK0F 1DU6A 2V9VA 3FBNB 1TQPA 3AG3H 2HS5A 3ABLC 1P9QC 4TSFG 1MW7A 2UXCB 2R7SA 3ABMC 4JASA 2M34A 2XGXA 1BOAA 1W4MA 1QO0D 4HX8A 1AHDP 1VQ8I 2XF6A 2FMYA 3ISPA 1MJAA 3HOYJ 2K3FA 1NH3A 4UB6Z 3G4SV 1GN6A 4DV1O 1Z1DA 1H38A 1LUJB 3K4MA 2WLLB 4O2BB 3GWOA 2BTOA 3IH3A 4PV1B 1MSFC 2CH7A 4L87A 1GVJA 2Q2EA 2GWRA 4XICA 2LF8A 4O4HA 1IVSA 3IHUA 2ZSHB 2ESHA 5KLVH 2CS3A 1CXZB 5BPDA 1R3LC 2JRIA 1IRGA 5M3FJ 3G1OA 2Q7EA 1IGNA 2LY9A 3CUQC 3MFKA 1I0HA 1PL0A 1SD4A 3LUTB 3K58A 1IBLO 2LFBA 3G71I 4CCLA 3H9QA 2R92J 1E0EA 1M93A 1Z2GA 1HCRA 4IHTA 1W5CC 4R79A 3BCCH 4DZPA 1FSHA 3CEIA 2X7RB 2F5DA 1TLHB 3CCYA 4RQFA 3ULQB 4JI2B 2XF5A 3I53A 1SFUA 2F23A 1TT5B 5F1JA 3D36C 4YJ2B 4UCRA 2IU3A 2W6JG 4AIKA 1WSUA 1S5JA 2M6YA 5JH7A 4LF6B 3HDDA 4PDMA 4XLHA 2YXLA 1YHQV 2R3SA 4XOTA 3CCUI 2VQFB 1KKCA 3E8HA 4D9JA 1SANA 3M7MX 2ZCWA 3DTKA 2G9WA 3OTFA 2KDOA 4UCUA 4DIQA 2WBMA 4DRXA 4I9QA 1YW9A 1RPWA 3CUQA 3JYCA 3DTEA 4YY3O 2P5VA 3I55I 2DJVA 5CQGA 2WLIB 4ZDLA 4M3BA 4CYCB 1X19A 3AG1H 4JOMA 1GDTA 1T5EA 3DKWA 1AILA 2FL4A 1UJWB 3RSNA 4C9YA 4UUSA 2E2HJ 3H92A 3ZN0A 4CS2A 3CXCU 1YW7A 2H94A 2LH9A 2IAIA 1UMQA 3BTJA 3VEPA 4HNTA 2EILB 2CAZC 4GCZA 2B7EA 4JYBA 3VOUA 1F51A 4B7KA 3ABLB 4HF1A 3ECOA 4AIHA 1P7GA 5B3SH 3HKZA 5HLTA 3JR9A 1QHGA 2DQ3A 1LE8A 3WTUC 2DCEA 4ZDPA 4NHJA 4PDLA 2PYJA 4AILC 2Z2SB 3OOUA 4J19A 4MVQA 1GV2A 1JTYA 5ILUA 5CQEA 2ID6A 2M1BA 4FLTA 1N34O 2DFHA 1ZN2A 4E70A 1MNGA 3MAJA 3LNNA 5BZBA 3F7VC 4DUYB 1FBSA 2NVYJ 2KG7A 2EIMC 4Y13A
chains in the Genus database with same CATH topology
4HDUA 4FX0A 4M9SA 1DDNA 1JPXA 3R61A 3EUHA 4MS2A 3GWZA 1BI1A 2V79A 1XGMA 5CBHA 3OFNG 5D5VB 1DPRA 1YIOA 3P32A 4ENJA 5ILVA 5ICFA 1YS6A 2COMA 5EEGA 5D4SA 3F8NA 1I27A 1IXCA 3E89A 1JXSA 4K2EA 3GO5A 3F6OA 3X2QC 4ESJA 3V8KA 4MW3A 2ETHA 4LMYA 3PJSK 3CJNA 3HHHA 3CCJV 3ZN1A 1MG1A 4HZ3A 4GX5A 3ECHA 3R0JA 4QE9A 2FMLA 3ZQ7A 1OCOB 4Q5SF 4FHTA 5D6FA 3E2EA 1ZH5A 3L2CA 2V1UA 4EM1A 2X0LA 2BOBC 1KU2A 2MC3A 1O3TA 2BYVE 1ZYRF 3W7TA 3R0AA 1WWXA 2EV6A 4QLCU 4A5NA 2HR3A 2DYSB 2NLJC 2IJIA 1EFRG 3NRVA 2HQNA 1DP7P 2PI4A 1REPC 3FXQA 3JAMK 1OCCB 5B1OA 1PNKA 3OOPA 1R6KA 4BHCA 1NR1A 1PD3A 3ZMTA 1U6GA 4EVIA 1G3YA 3ETDA 3CO7C 2A07F 4MTEA 4RB1A 1V4RA 1FS0G 1D5VA 2MD5A 3CMEV 4GO1A 3JD1A 4R8HA 3LSQA 2HTSA 4L5JA 1BC7C 1T2KA 1ZLKA 1Q81W 3E83A 4LJZF 1NVPB