3IC7A

Crystal structure of putative transcriptional regulator of gntr family from bacteroides thetaiotaomicron
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
IYLQIADRICDDILLGQYEEEGRIPSVREYASIVVNANTVMRSYEYLQSQEVIYNKRGIGFFVASGAKMLIHSLRKEQFLKEEVGSFFRQLYTLGISIKEIEKMYYEFIQRQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 26
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ic7A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ic7A02
2WTEA 5DEQA 4ZYHA 3TDUC 2LDUA 5J8FA 1S29A 4IHSA 4OOIA 2EFWA 3BPVA 4LD5A 2Z3YA 2QYOA 3Q9SA 4MQVA 4YG2F 5DD4A 3E6MA 1B1BA 3PQKA 2PMHA 1D5VA 4HYEA 4A5MA 2ISYA 2P90A 5E8IA 1W5SA 2ZFWA 5F6FA 2P6TA 1D3YA 2DT5A 4RGSA 1O3SA 3WODF 5CVJA 1SFXA 2KIMA 3FM3A 5K5RA 4F7ZA 4UVBA 1FOKA 2DLLA 1ZRFA 1HKTA 3LQRA 3CLOA 2CQKA 3E5XA 4EMSA 1TNTA 2EV6A 5CVUA 4LLNA 3BP8A 3K2ZA 3QU3A 1TW2A 3ROUA 3FXRA 2LSOA 2KJCA 4PZJA 4GCVA 3CUQC 1YS6A 3WU0A 3CDHA 4CO8A 2DAOA 2K86A 1QZZA 1K78A 1WWXA 1TQMA 3ECOA 1FYMA 2HQRA 1K6OA 5FLXK 2EV5A 1B59A 1J7KA 1HW1A 4EJUA 1XDSA 1WKMA 2MH2A 4HDUA 5D4RA 3HRSA 3R6SA 5HDNA 3WTVC 2YX4A 3B73A 3J81Z 4WXDA 4KN4X 5ICCA 5BS6A 2EWNA 3ZN1A 2GA1A 3I59B 2HOEA 5CVRA 4EGYA 4RGXA 2Z5UA 4JBAA 4U88A 2VONA 4AIKA 2P6SA 4HX7A 1HQCA 4DNCA 1OYWA 1MZBA 3U1DA 3W6JB 5A2QK 1LJ9A 1ON1A 2RQPA 4L9TA 4G9YA 3KETA 2NYXA 4OINF 5FGMA 3IWZA 1P2FA 2XKPA 2CWEA 2M87A 3JAMZ 5D6FA 1H9GA 3WTSC 2XRNA 4EGZA 1USSA 3FHZA 4HQEA 2PBIA 3IC7A 4BAYA 4A5NA 1J75A 3CO7C 4EM2A 1V3FA 1BC7C 1XMAA 1ZRDA 3RJPA 4ENMA 2VT3A 1OPCA 4QLCU 2FA5A 5HLHA 1J59A 2UXNA 4QWQA 2FE3A 1T98A 3ZMZA 1FSHA 2OQGA 3KE2A 4S05A 4UUVA 3SXYA 1XSDA 3HIFA 3ZMVA 1BIAA 2GZWA 1IW7F 2J5PA 3TOBA 2ADUA 2MH9A 2HKOA 5K5OA 2UWMA 5IT9Z 5GW7A 1V4RA 1SD4A 1Y0UA 1T6SA 1FPQA 3KP5A 4XRFA 2F5FA 3GF2A 4L5IA 2E1NA 1TLHB 2MA3A 1XSXA 1XGMA 2K4BA 4I01A 1XB4A 2RNJA 1R22A 1Z9CA 1O7LA 1U6GA 3WTZA 5FD5A 4UV8A 4EJVA 2A61A 2IW5A 1ULYA 1K7AA 2YSRA 4OMZA 4ENJA 3P9KA 1FBUA 2KRFA 4KIFA 1REPC 1YIOA 1G3YA 3HTUA 3ECHA 1S3JA 4HBLA 1TQIA 5ILUA 3RPUA 4A6EA 3HHGA 1QPMA 1OYYA 3W7SA 4YIFA 4LG0A 1U78A 3GX4X 2H6CA 2FOKA 1EH6A 1FT9A 2F5EA 1R00A 4LMYA 1RIOH 2GAUA 2HDCA 4EJWA 2RKHA 3J7AO 3I64A 3ELKA 1FNNA 1YQAA 1EV7A 5LRSA 1FYKA 4I98B 5L3BA 4ESFA 1PP8F 4A0XA 3FM5A 2COMA 2NS0A 2QBYB 2QENA 2L54A 2V9VA 3CUQB 1MDMA 3CJNA 1I1SA 2ZNZA 1IXCA 3MFKA 1W7PB 3RI4A 1WI9A 4HOBA 5LGUA 4OIPF 1G6NA 5F64A 2C6YA 3HRMA 3PFIA 1E17A 2X0LA 3NEUA 1STZA 3LFKA 2EFOA 1R36A 2GXBA 2Y75A 3JTGA 4I2OA 2OD5A 3JW4A 1A04A 1P4XA 1FX7A 3FXQA 3W7TA 1R5HA 4WK8F 3V4GA 1KU2A 1UCRA 1S8NA 4IHTA 3ABUA 5HDKA 2JPCA 3GWZA 3GFLA 3HSRA 3F22A 2G7HA 1JGSA 1YW9A 3JSOA 3AAFA 2OU2A 1Z05A 3KZZA 1IAWA 4HF2A 5KVRA 3F6VA 1D8JA 3V7CA 2ZKZA 3N97A 4XLPF 1TQPA 2QVOA 2E1CA 2P7VB 1BOAA 4M9SA 2Q0OA 4P9FA 3QOPA 2VN2A 1WSUA 3DP7A 1P4WA 4M9XA 2YR2A 4KNYA 2Q8KA 1AWCA 2JT1A 1KQ9A 3ML6A 4OU0A 3LWFA 1GXQA 1SD5A 3IRRA 2XASA 2O6GE 2V1UA 5KK1A 2VT2A 5J8CA 1U5TA 3BOQA 4KN7X 5EEGA 2E7XA 1ZRCA 1YS7A 4HLYA 1IXRC 1P6RA 1ZN2A 2YU3A 4GYGA 3TO7A 1QZYA 1ZARA 2TDXA 1B4AA 3C7JA 1W7PD 1YW8A 1LB2A 1WQ2A 3BJ6A 1CF7A 4P9UA 3C1DA 3T5XA 3K1NA 1BI0A 4I02A 3R0AA 1KU7A 4U0WA 1I27A 4ZH4F 2BGCA 2O0YA 3IL2A 4LLLA 3E6DA 4KMUX 1DPRA 5JFRA 3GO5A 2PEXA 1XD7A 3LAPA 3GXOA 1W4MA 1ZLJA 2KIUA 4LGWA 4JQFA 4L18B 2CSOA 2QQAA 4HQMA 1S6LA 1K79A 4KFCA 1R23A 1E2XA 4GYIA 4MHGA 1KQ0A 4LK0F 4O6JA 4EJTA 2HQNA 5JHUA 2JRTA 2EV0A 3M8FA 2PFBA 3O2PE 1GVJA 1TNSA 3R60A 1R1UA 3GLXA 2A3SA 1RUOA 1EH7A 2JPBA 1HW5A 3T8RA 3BY6A 2XROA 4AIHA 3NQOA 3RYPA 2VE8A 1KU9A 2GA2A 1BM9A 1TW3A 1R7JA 2OBPA 3TO9A 1IN6A 5FD6A 2FMLA 1KA8A 3FMSA 4ZYEA 5DUKA 3H3ZA 4K2EA 3L7WA 3I0TA 3BZ6A 4KMFA 3WGGA 3WE3A 2VODA 3T8TA 2V6CA 4I7HA 2CYYA 2IA1A 5ILVA 5LBQA 3R0JA 3SHFA 2ISZA 4UVCA 4IRGA 1LDDA 5D6EA 4CGZA 1KGSA 5BOXA 5DYMA 1AOYA 4MGRA 3RPQA 4BXUA 4U7BA 3ISPA 2XIGA 3G73A 1BIBA 3KP6A 3H92A 1YTYA 1U3EM 2XVCA 3TKYA 3FZVA 4M71A 2HYGD 3J81K 1UB9A 1RUNA 4D0PA 2QM3A 3L2CA 2FF4A 4RB3C 2P4WA 1MGTA 3ZMUA 2VBWA 1FWZA 3SZPA 4TV7A 2DO7A 3REOA 3J80Z 4LLGF 1B9NA 2W85A 1XN7A 1OMIA 4L0YB 4MTEA 5TRDA 1YO5C 3LA7A 4UV9A 1O3RA 1XGOA 4IRIA 3FX3A 1R58A 5L3FA 5ERIA 5D5XB 4BQAA 1Z1DA 4LB6B 1TTYA 5CYVA 4ON0A 2IA0A 3IKVA 2W84A 1NHAA 4FT8A 1ZGJA 1KQ8A 3E97A 3JAMK 2RN7A 2HZTA 3EDPA 3B02A 3SQNA 1PUEE 1ZG5A 2H94A 4FX0A 5D4SA 1T0FA 2UXXA 3O6BB 2DW4A 2YX7A 1UFMA 4ESBA 3C18A 3V8JA 3OOPA 4HV5A 5HS9A 2F5DA 1JHFA 1KU3A 2DI3A 2A68F 4M74A 4O3MA 1SAXA 3K69A 3HRTA 3MCZA 4N0BA 3KCCA 4G7HF 3C3WA 3E6BA 2QLZA 3QAHA 2K27A 5BPDA 4KIGA 3Q5FA 4HAMA 2ZO4A 2EFQA 4LK1F 3HOSA 3P9CA 5E1XA 2L01A 2DK5A 3F23A 3DV8A 4R79A 4MQ9F 4FX4A 5FO5A 3RKYA 2G7UA 1G3TA 3SZTA 3ZPLA 3GFMA 5AIQA 2V1DA 5IT9K 2Y48A 4EM0B 3EQLF 1ZHFA 5LGTA 3I59A 2ESNA 1OKRA 5HLIA 2WC2A 2XAGA 1SFEA 2GWRA 4HLXA 2XAHA 1H9TA 3D0SA 4A0ZA 2OAZA 2QZ8A 2EFNA 3GW2A 5ED4A 1BN5A 3K9TA 4R8HA 1ZYRF 3F3XA 3MEXA 3DF8A 1BI1A 1H0MA 1SD6A 4A0YA 3BROA 4ENKA 5ILSA 3W7WA 3GYHX 4I0AA 1QQIA 1FP1D 2ZJ2A 1R1TA 3QU6A 1IN7A 6PAXA 3KLNA 3ABTA 2D2WA 1JHHA 2K02A 5LEKA 1NH2B 3WGHA 1S7OA 4U0VA 2M30A 4LG0B 1WRJA 2AS5F 3T0YA 2CO5A 4S04A 2IA2A 2VOOA 1HKSA 3VOEA 5AONA 1XDUA 2GIVA 4ETSA 4AVPA 2STWA 3JTHA 2IT0A 1IRFA 3H3UA 3I58A 3WTUC 3R61A 2A6EF 4A12A 3E6CC 4KA4A 2P5LC 1SFUA 2A07F 4WCGA 1F9NA 1MDMB 3WE2A 1PP7U 1FY7A 2ETHA 5H20A 1IN5A 2Z99A 2B0LA 4YFNF 4DQ2A 1NVPB 2IPQX 5J6XA 4AIJA 3LAJA 1FBQA 1PDNC 4L9JA 3ZMDA 3EYYA 2CW0F 4ENNA 4NB5A 4PCQA 1YW7A 5D5UB 3WTYC 2EFPA 2R7DA 3FXUA 1LEBA 5HS8A 1HW2A 2WWYA 2FQ3A 2HKXA 2VBZA 1JE8A 4KUMA 3DEUA 4CDGA 4IPAA 2VC1A 5E8GA 3KFWX 3MZHA 2O8XA 5BQTA 1DDNA 2H6BA 4Q5SF 4E70A 1I6XA 5E1WA 3GFIA 2EB7A 2ZCWA 4MEYF 1XGNA 4RS8A 1Z6RA 5EEHA 3GFJA 3FF5A 1J5YA 2FMYA 4CHUA 2G9WA 1FZPB 4HW0A 4HV6A 1J2XA 2BEOA 2ZMEB 2ZXJA 2OQRA 2PJPA 2QWWA 4Y17A 4Q47A 1FLIA 1G3SA 4KYWA 2M8EA 2CFXA 2RVCA 1U5TB 3CUQA 1SMTA 1F4KA 1P92A 3L00A 2PMUA 4KDPA 1W7PA 5LEJA 2IP2A 3IWFA 2D1VA 4U0YA 1LVAA 4WWCA 1VTNC 4KIBA 2FBKA 2MBFA 3QPHA 1LQ1A 3KEOA 2KJBA 2PQ8A 1CF7B 2VBYA 2Q2EA 3GEZA 2MD5A 3PQJA 4RAYA 1OR7A 2NAZA 5FB2A 5BPIA 5CJ9A 1FC3A 4A6DA 1Z91A 1Z7UA 1L3LA 1HXDA 4BHCA 3IRQA 2W57A 1RNLA 1L0OC 2F5CA 2M45A 2XGXA 4M72A 2V1XA 2NRAC 3VB2A 2VBXA 2Z33A 4AD9A 3V8LA 4G6QA 2XV4S 5LLQA 3I54A 3BJAA 1ZG1A 2K7LA 2A69F 4ASNA 5DCMA 3D3IA 1F5TA 4BHPA 3HOTA 2P8TA 2DQRA 1ONVA 4EV0A 1O3QA 4H0EA 1GXPA 2LNBA 3DFGA 1MJ9A 3TGNA 3I5UA 4M73A 1HKQA 1LDKB 4OMYA 3ERED 1XGSA 3P9IA 3WTTC 3F8FA 5HS7A 4PGGA 2FSWA 2W25A 1XSVA 3M1EA 3RKWA 1X3UA 3FWEA 4RB0A 2VE9A 5HVQC 2DQLA 3SFZA 3FMRA 3IHUA 5D8LB 3FMQA 2HTJA 1MJBA 1XMKA 1XCVA 4YFKF 2A5YB 2WV0A 4B8XA 4IF4A 3ZQ7A 2FU4A 4UHTA 5AIPA 2HYFA 4CZZA 2ESHA 3K1MA 5CVVA 3F8BA 3K1PA 3F6OA 5D5WB 3BJOA 5K5QA 2FEZA 2HFHA 1J0RA 2K4JA 4ZYDA 3HSEA 5DD8A 3KEQA 4P5OA 4RGUA 3WTXC 1UHMA 4LJZF 4BH9A 3HHHA 5BMZA 3LQQA 5K1YA 4BHBA 3JSPA 3WTWC 3MQ0A 1K78B 4P96A 3GVAA 2X4HA 3LA2A 1C0WA 5E1ZB 2KKOA 2DBBA 2DPDA 3D5LA 3J80K 1ON2A 5LRRA 3VEPA 1Z6TA 2H27A 3Q9VA 2M5WA 1FSEA 1SMYF 3U9GA 3DPLC 5DV5A 2VXZA 1LNWA 2DFIA 2MC3A 2P7CB 1KYZA 3CTAA 2NNYA 1QGPA 4PDKA 2RV8A 2V79A 4CYDA 5FFXA 3DKWA 3E35A 3DXJF 4Q4ZF 3HTSB 4GXOA 2QQ9A 2RGVA 5JR3A 2QQBA 4HX8A 1R5GA 1IF1A 4IRHA 5HOOA 3V7SA 5E18F 3EYIA 2LF8A 2O3FA 1O3TA 1DP7P 5HDGA 2CGPA 5CVIA 4NHJA 2PLYA 1FBSA 2XAJA 3MZYA 1UHWA 1ZREA 1T38A 1T2KA 3RIRA 2VC0A 1YYVA 5FFZA 1QNTA 5L3CA 1FP2A 2DPUA 1KYWA 1U5TC 3HYIA 3F72A 4HF0A 1T39A 2XKOA 5FLXZ 1FYLA 2IJLA 5E20A 2L4MA 4GGGA 2ACJA 1OYIA 4XBFA 2HEOA 1USTA 4MNUA 1R1VA 2JTVA 3W6KB 2OZ6A 4HA8A 4N9HA 2LF7A 4ZYGA 2R3SA 4EJOA 3DQVC 2O61A 1DUXC 2HR3A 1ZG3A 4HF1A 4M6XA 2BE5F 4Z2YA 3RYRA 1I1GA 1CGPA 2F2EA 5A2QZ 1P4AA 3P7NA 4RB2C 4HZFA 2Z9OA 2GQQA 3OV8A 1IN8A 3K0LA 4O5VA 1IZ1A 4B09A 3NRVA 4G7OF 3RDIA 3U2RA 2QUFA 4YFXF 3IKTA 3KP4A 1IN4A 5H6RA 4EM1A 5ICEA 4RB1A 2DTRA 3QP6A 3RTRA 1BC8C 3MAJA 4IVNA 5LHIA 4EVIA 3W7XA 4KT5C 3HRUA 1QO0D 3EUHA 2STTA 2FBIA 4P55A 4Y13A 4U7DA 2L4AA 5F1RA 1D8KA 3RKXA 1W5TA 2UZKA 1HBXG 3MWMA 1TBXA 3F8NA 4ZZDA 2L02A 4XSXF 2WAMA 3LSTA 4IJAA 4LFUA 4Y15A 4XLNF 3E3VA 2BV6A 3T1BA 4BYYA 4UNOA 2Y0MA 1YTFB 4AWXB 2H09A 2CG4A 2HTSA 1YLFA 4BNCA 2XAQA 3S2WA 4XSZF 2EJRA 3F21A 4WXHA 5ICGA 1G3WA 5L3DA 4ZZLA 3CO6C 3HSFA 4L5JA 1G4DA 4KICA 1Q1HA 1DPUA 2FNPA 2IVMA 4L9NA 4G94A 3TDZC 2DK8A 4Q48A 2LKPA 1B6AA 3VODA 2PI0A 3V8KA 5LHGA 3GZ5A 3ULQB 3QPTA 2W24A 1ZAOA 3BDDA 4M9ZA 1IRGA 2ZNYA 5L3GA 2AXLA 2BBYA 3I4PA 4CICA 3M7GA 2JZYA 1BI2A 2R7FA 2D45A 3KP2A 3E5QA 1U8RA 2YPRA 3N4MA 4WX9A 4OIRF 4YIIA 3GZ6A 4M6YA 3GUDA 4UVAA 4RGRA 4MEXF 3DPTA 5L3EA 3HUGA 4N9IA 3WGIA 3EETA 3KLOA 4L9VA 2HS5A 4WF2A 1IXSB 1RZ4A 3I53A 2PN6A 1GHCA 1MJAA 1MKMA 3ZN0A 5D8KB 1ODDA 2M1BA 3F8MA 3TOAA 1SD7A 2P5KA 4JK1X 3ZMSA 2FRHA 1RM1C 4EQQA 1J9IA 2HWVA 4G6DA 4G8XA 1ZGAA 1B9MA 2QBYA 2P5VA 5JI6A 4IXAA 1BJAA 3R4KA 3WU1B 2A6HF 2OZUA 3G3ZA 1RI7A 2OA4A 5D5VB 4RAZA 2D1HA 5CA3A 2HGCA 5DCMB 4PGHA 1LEAA 2VOPA 4GO1A 1ZLKA 2FXAA 1XCBA 2NNNA 3I71A 2FNAA 3TQNA 5E17F 5LHHA 3ZP5A 2E7WA 5DCFA 1S7AA 2RC4A 2XUBA 2J5OA 2RDPA 3ZMTA 1YG2A 4OIQF 3KZYA 2DU9A 2O03A 2ZMEA 5DDGA 4FHTA 3F8CA 1F1ZA 4I09A 2IRFG 1ZH5A 4UXNA 2XAFA 1U2WA 3WG9A 3O3KA 1IUYA 4HX4A 2EA4A 4L0ZB 4OIOF 4ESJA 1YFHA 2ELHA 2GXGA 3W7UA 1BI3A 3L09A 3LA3A 4LB5A 3COAC 3E5UA 5LGNA 4CXFA 3KP7A 2ZBKA 2BYVE 3QRFF 2JSCA 3VFZA 1QBJA 1EH8A 2EA2A 1HSTA 2L3DA 5ICFA 3TO6A 3QP5A 2KIFA 5IT3A 4WXCA 1HSJA 1O57A 1BBYA 3BPXA 4A2UA 4G7ZF 3KP3A 2MLGA 4HDVA 5CLSA 3M9AA 2MLKA 3CUOA 4MTDA 5JVTA 4I0BA 4NQWA 5TJJA 5H6QA 5HLGA 4R1HA 1MD0A 5DUIA 1LDJA 3M8EA 2FBHA 1O7FA 3L9FA 3BWGA 3V7RA 2EK5A 1JXSA 2PG4A 2XHKA 1I5ZA
chains in the Genus database with same CATH superfamily
2WTEA 2HI3A 4JYCA 3SJCC 1R73A 3TCUA 3VQVA 2KQXA 3DKYA 2X6XA 5DEQA 1N0JA 4ZYHA 3TDUC 2LDUA 3KCXA 1HNXO 4GKJO 1IDYA 2L2OA 5J8FA 3Q0UA 3U0ZA 1ETWA 4JI3O 4DIQA 2QKCA 4D1QA 4FE4A 1SC5B 1BR1A 4ABMA 5CKTA 2ME6A 1S29A 4IHSA 1ITYA 1IURA 2E76B 4OOIA 4XKCA 2EFWA 3C2BA 1MMNA 5EZYA 3BPVA 4LD5A 3CCQV 1FYJA 3TMOA 4M3BA 2EZPA 4ICGA 2Z3YA 3JARA 2QYOA 1D0ZA 4D9JA 3Q9SA 5K7HA 4BQQA 4A3CJ 4MQVA 4F4LA 4YG2F 4OAYA 2Y0PA 5CMUA 5DD4A 3E6MA 2NVTJ 2CQQA 3HKEA 1VQ7V 3CP2A 1QR9A 1B1BA 4Z1VA 3PQKA 2PMHA 4PA7A 4QNHB 4FLWA 1D5VA 3SDBA 3HKCB 4LF9O 2HDDA 2PF4E 4P9OA 1RETA 4HYEA 2JVDA 4DR3O 4A5MA 4U3JB 2ISYA 2XC7A 2P90A 4RAIA 5KX5B 5E8IA 3S2DJ 4LFBB 3DTKA 3G1MA 1W5SA 1WB8A 2ZFWA 1OFCX 3CC2V 5F6FA 1Z2GA 2P6TA 4Y7NJ 2KG7B 2X6CA 3FISA 1YITV 2JA7J 1D3YA 2DT5A 4C30A 4RGSA 1O3SA 1WJFA 3WODF 4E2LA 2A06H 2JS5A 2VWJA 5CVJA 1SFXA 2KIMA 3FM3A 4YEJA 4B4CA 5K5RA 2E1MC 2LR8A 1EZVH 4F7ZA 1Q6UA 4UVBA 4XKWA 1MABG 3K0DA 1FOKA 2JVGA 1DLBA 1FOYA 2DLLA 3DTIA 2V9KA 4JX4A 1ZRFA 1HKTA 4A3FJ 2O57A 4GX5A 3LQRA 1Y67A 2CH7A 3CLOA 2R70A 4B7EA 2CQKA 3OFNG 3QQAA 3NXSA 1K83J 3E5XA 4EMSA 2UUBB 4CH4A 1TNTA 2Z2SB 3L72H 1AI5A 2EV6A 1CQTA 1F51A 4HNUA 1IC8A 2ZE8A 3LDCA 2JA8J 4RQEA 3OTFA 2RQ6A 3RKQA 4YJ3A 2JIZG 1IUFA 1EKEA 5CVUA 4LLNA 3CDLA 3VQYA 2WY7Q 4LG3A 2DTZA 3BP8A 3K2ZA 3QU3A 1HWYA 3LFUA 1TW2A 1ETVA 1WPXA 3OTOB 4GYCB 1ETYA 5KMGA 5F1JA 3QG5A 3ROUA 2HLDG 4TWKA 2IXSA 1WJZA 3H1LH 5EIBD 4LBEC 3FXRA 2JA2A 2OC6A 5KHJA 2LSOA 1N4CA 3B8NA 1BQ0A 2KJCA 5CBHA 4PZJA 1APLC 3Q0VA 4GCVA 4DR2O 1VQLI 3CUQC 1YS6A 4H44B 3WU0A 1DGRM 1R4MB 1S7EA 4PJNA 1VFCA 3CDHA 4E7ZA 4JI6B 1FIPA 5KHGA 4DV2O 2JMWA 2M0MA 1EBOA 4ABZA 4CO8A 2DAOA 1MH3A 4XN3A 2K86A 4L5EA 1QZZA 1K78A 1WWXA 4DRXA 1TQMA 3UO2A 4JI0B 3ECOA 1FYMA 2VKDA 5FJ8J 2HQRA 2Z16A 1MSDA 2B5UA 3ZJZA 4B1RA 1K6OA 3UO3A 3GBGA 1R6RA 5J1RA 5FLXK 5JCOC 2KQRA 1NTMH 1MBEA 2B1IA 1U8BA 1NG6A 1K9MW 2EV5A 3JRHA 3UKGA 5J2TB 1B59A 2ZC2A 3K5MA 1J7KA 2G0EA 1HW1A 3PNVA 4EJUA 3A0HZ 1N34O 4PJMA 1XDSA 1WJ5A 4IHWA 4PSWA 4A3BJ 2DFFA 3JD3A 1QCEA 1WKMA 1F36A 1NR7A 4GUNA 2MH2A 1R6NA 1OR7C 3SEZA 4HDUA 2RNBA 5D4RA 3LNMB 3HRSA 2R9AA 2QKLB 3R6SA 5H2FZ 3OAAG 4QE9A 2XGEA 4U7OA 5HDNA 2EH3A 5E3OA 3G4SV 4GLXA 1QLNA 1LVKA 4AIDA 1B8IB 5IWAB 3NAUA 3WTVC 2YX4A 2AHYA 2RCVA 4E4EA 3B73A 3J81Z 3IAYA 4WXDA 4KN4X 4DR7O 1FEXA 5ICCA 5HODA 5BS6A 2EWNA 3S3MA 3JASB 3ZN1A 3B8MA 1HLVA 5FNVA 4WFAV 2F4IA 1SQFA 5LP6C 4X0GA 2YUAA 1RFYA 1MNEA 2GA1A 3I59B 1BL8A 2HOEA 3D5SC 5CVRA 4EGYA 4RGXA 1OCTC 2L6LA 4IL6Z 4PA4A 2OTJV 4LNUB 3HKBA 3H35A 2Z5UA 4JBAA 4U88A 2VONA 2R7ZJ 2ITCC 4E7JA 2E71A 4AIKA 1FMWA 3BCAA 2JWTA 3GTKJ 2CMPA 2P6SA 3JAKB 2PYLA 1OCPA 1GN3A 4HX7A 1HQCA 2VQLA 2JGDA 4N21A 4DNCA 1D0YA 4ZTJA 1P84F 2L7MP 3T1HB 1OYWA 3ZQIA 2ZXWC 3CXHF 3ABMB 1MZBA 3U1DA 3W6JB 1GV2A 4PFPA 5A2QK 1VF9A 1U96A 3S16J 1LJ9A 4TSFG 2H8PC 2QM4A 3JD4A 3FKJA 4FPPA 2QM8A 2KHMA 4DV7O 1ON1A 2RQPA 4L9TA 2M34A 2ZNJA 4G9YA 3KETA 3RW0A 2NYXA 4OINF 1MA1A 1X1DA 1ZTEA 2B9ZA 4MSWC 3U10A 4DUYB 1H8EG 1OCZB 1Z77A 2GBYA 3TJTA 5C8YB 5FGMA 3FB6C 4A3KJ 1JOYA 3IWZA 3CHXA 2F4VB 2EIKC 1X58A 2YC0A 4HBNA 1P2FA 3CEIA 1AI7A 4ZI7B 2PJRA 2XKPA 2CWEA 4IYHA 1VQ5V 2A05A 2VPLA 3BTJA 2M87A 3BTIA 4ZDPA 3G71V 1PM9A 3JAMZ 5D6FA 3IUOA 1H9GA 1Y8QB 2EINH 3WTSC 1GO3F 4CC5A 1K5QA 4JGSA 2XRNA 5LMNO 4EGZA 1USSA 2G38A 5KHIA 1MBJA 1QLEC 2R72A 1GAXA 1N25A 2E35A 2QWPB 3RFRA 1PP9H 3LSKA 4GX1A 3TL4X 1ENHA 1TC3C 3FHZA 4HQEA 1BA5A 2DA3A 2PBIA 3O8HA 3IC7A 2ZR2A 2R7UA 2JEXA 3K9SA 4CC6A 2ZXHA 4BAYA 2CV1A 3P32A 5E1AC 2M2EA 2QKMB 4A5NA 3G1LA 3CCSI 3DEEA 1J75A 2E75B 4AI8A 3CO7C 2E2IJ 1NU1H 4EM2A 1V3FA 2Y30A 1BC7C 2K3PA 1XMAA 1ZRDA 3MZ8A 1PUFA 3FB7C 2DMTA 5K7ZA 3ABKB 3FIWA 3CC4V 1R4NB 5KAFC 2XOKG 1NKDA 3HG9A 2DYRC 3RJPA 3BR2A 3LSHA 4OXSA 5FPOA 1S9HA 4ENMA 2VT3A 1OPCA 1FPOA 2QCOA 4MTFA 4QLCU 1V54H 2CTPA 2ZT9B 1SESA 3AG2B 2FA5A 1CEZA 5HLHA 3K70D 2KSDA 3L74H 4NTYA 1J59A 2UXNA 4N23A 4QWQA 1ETKA 4XL9A 4DZPA 2DOEA 2FE3A 1T98A 3P5JA 4JYKA 1RSOA 3ZMZA 1VQNI 2IEKA 2F1MA 1JUMA 4XDLA 1FSHA 2VJJA 2WLJA 1HDPA 3K6GA 2HJFC 2OQGA 3S1RJ 1YJNI 3AG4C 2DMPA 3FXOA 3KE2A 4S05A 2QEXI 2HVSA 3MMYB 2OCEA 4RMNA 3SEQA 4IHYA 4UUVA 1PL4A 2HFEC 5B5EZ 3SXYA 1XSDA 3HIFA 3IP4B 3ZMVA 2HDWA 2YU9J 5LFAA 2H3OA 4HPQA 2ZINA 2EZOA 1TA8A 3KKYA 1BIAA 2XHBA 2GZWA 5LXTB 4LF5O 1IW7F 1TWHJ 2WB1N 4XOTA 3OT7A 2J5PA 3TOBA 1FJLA 1MMSA 3OR1C 5DM6F 4FLUA 2ADUA 2MH9A 4FZ0A 2HKOA 5LOVB 4NKGB 3SGIA 3CJQB 3OMAB 4J00A 3LSMA 2HOSA 1U0JA 5K5OA 3TEDA 2UWMA 5IT9Z 4DYLA 5GW7A 1V4RA 2D5VA 1CXZB 4ZIBA 1SD4A 1N33O 2LGWA 1Y0UA 4NXNO 1T6SA 1FPQA 3KP5A 1XREA 4XRFA 3X2QB 2OYQA 1XMOO 4K35A 1WPKA 2F5FA 3A1YA 2PMZN 3GF2A 4L5IA 1ETXA 2NXNB 2E1NA 1BSMA 4F6RB 1TLHB 2MA3A 1V55C 1VP7A 1VI0A 2QDOA 1XSXA 5EC1C 3CYOA 1UZCA 1XGMA 4QSHA 1E1RG 1M56B 1T5EA 1YI2V 1Q90D 2K4BA 2W6JG 2BSKB 2DA5A 2L7KA 2WLMA 1YE9A 1E1QG 3ZRXA 4X6AJ 5J1UA 4I01A 2R7SA 4YY3B 1XB4A 2RNJA 1R22A 1Z9CA 1O7LA 4P1WA 2CDYA 1U6GA 1I08A 3J81N 4NC8A 3WTZA 4TUYB 2EZIA 3HPHA 5FD5A 1VQOI 4BY1J 2MGQA 1XOUA 3OR6C 1UG2A 4ZHQA 4JASA 1ORKA 1TVKB 3CCJV 1YEWA 4M3GA 1TUBA 3ESWB 4UV8A 4EJVA 3ZQLA 2A61A 2AXTC 2LBFB 1QPIA 2IW5A 1ULYA 3K58A 3CD6V 3U1KA 3W2VA 3QYBA 4A93J 1U97A 1YF2A 2E5NA 5KHKA 1K7AA 3HOWJ 2YSRA 4MLOA 4E6KG 3AK3A 5IYBO 4FCYA 4OMZA 4ENJA 3P9KA 3HKZA 4YJ2B 5F04A 1FBUA 5FKMA 2B7EA 2KRFA 4LFBO 1Z5WA 2MD0A 2NOGA 3BC8A 4BKXA 3AKZA 1QU3A 2LW1A 4KIFA 2CUGA 3RYHA 3L2RA 3P3PA 1BGYH 1REPC 1YIOA 2R5ZB 1K4TA 4K8XA 1AU7A 3WB0A 1G3YA 3HTUA 5B1BH 3ECHA 4DV0B 3PNTA 1H2NA 1S3JA 4WFGA 1DK1A 1Y56A 3H1HH 4HBLA 5CA0A 1TQIA 4M3EA 1X1CA 2B63J 5ILUA 4EFBA 3RPUA 4A6EA 3HHGA 2W00A 1QPMA 1OYYA 3ABMH 1QNMA 1OISA 4YIFA 2N74A 2Q73A 3JAMN 3HUGB 3W7SA 4LH6A 4LG0A 1YJ9I 3KG2A 5J2UA 1U78A 3GX4X 1RR8C 3STLC 2H6CA 1JQ0A 2UUBO 2ZXIA 2FOKA 4QPKA 3OUFA 5CA1B 3CMAI 4J7JA 1EH6A 3ZHQA 3KZIZ 3E8HA 4XNFA 1FT9A 4D5CA 2F5EA 3CC7V 1Z3YA 1R00A 3TGUH 4PV1B 4LMYA 2XF6A 4XLFA 1RIOH 1G8XA 2GAUA 2HDCA 5FRMA 4EJWA 2RKHA 3PUFA 2GTSA 3J7AO 3I64A 4O4IB 1V5FA 2UXDB 3ELKA 1FNNA 3GLLA 3KYLA 3Q3SA 2X6BA 1YQAA 1EV7A 5LRSA 4K3AA 1FYKA 4I98B 4B3AA 1FOXA 1L8DA 3JAWB 2X6WA 5L3BA 5B3SC 2VQEB 1A31A 3S1NJ 4ESFA 3BA8A 1PP8F 4UB6Z 5CPRB 2M4KA 1H8HG 2N04A 4A0XA 2F5VA 2IJIA 2YXHA 3CP1A 3FM5A 2COMA 4JI6O 3CQZJ 2RQQA 5FRNA 2NS0A 3BPZA 1N32O 2BTQB 3GTJJ 2QBYB 2QENA 3CCEI 2L54A 2V9VA 3CUQB 1MDMA 2VXDA 3CJNA 2HVJC 3CMYA 4J7KA 1I1SA 4PSXA 3CMEV 2ZNZA 1Y74A 3SYQA 1IXCA 4EEFG 3MFKA 4CH6A 1W7PB 3RI4A 1WI9A 4IL6C 4V2GA 4HOBA 3TW6A 5LGUA 1WI3A 1F4MA 5KNLA 1D5NA 4DOZA 1OV9A 3QVNA 4OIPF 3OL4A 1QHTA 3ZHVA 1SQGA 3ABKH 1G6NA 4O4HA 3R65A 3SJAC 1T08B 3K4KA 5F64A 5FKLA 1AVMA 5GPAA 1Q5OA 3PO3J 4Z1MG 3D36A 3SZGA 3CCLV 3J7AY 5IYBJ 2MW2B 1P7BA 4IEJA 2C6YA 1SA0B 3K2AA 3HRMA 2K9PA 3VBBA 1SKVA 3PFIA 2Y31A 4BXFA 1P7JA 2TCTA 4FISA 3ZQGA 1E17A 1FXVA 2X0LA 4MS2A 2QSGX 4G28B 2NS7A 3NEUA 4NDLA 4I50A 2HNHA 3RT3C 3ZRVA 2M7WA 5C93A 4QIWN 5KUKA 3OEHG 2WLIA 2Q2EB 3EHBB 4PI0A 1STZA 5IWAO 3LFKA 3CCRV 1Q43A 2EFOA 1R36A 2GXBA 2Y75A 2OJED 3JTGA 2OD5A 3JW4A 2CJJA 1VQKI 4I2OA 1SQQH 1A04A 1XL6A 3C90A 1B6QA 1P4XA 2VI6A 4NUBA 3VYRB 1NZ6A 3L75H 4FK5C 5EK0A 2VJ5A 1VQ4V 3K57A 1FX7A 3FXQA 1RPRA 2VJ4A 2QE7G 4X1YB 1W5CC 3CJHB 3IAS2 3W7TA 1R5HA 1PV0A 4H33A 2L9SA 3VSLA 4WK8F 3FXMA 4AM3A 1BQZA 3OS0A 3DLLF 3V4GA 1M9NA 2H8WA 1KU2A 1UCRA 1VQMI 2YUSA 1WFXA 1FS0G 4HYOA 4B3XA 3L2UA 1S8NA 3E8BA 4IIJA 4IHTA 3KYDB 4G6TB 3ABUA 2L5QA 5HDKA 1B72A 2HHHB 1IZ3A 2JPCA 3GWZA 1SQBH 1W0TA 3HZJA 4CCKA 3P30A 2M7BA 5IYZA 2ME0A 3GFLA 3HSRA 5TGTA 3DCFA 3F22A 3E8GA 4UUTA 2JUCA 3Q4HB 3STZC 2G7HA 3FBNB 1JGSA 1YW9A 3BR1A 5E79C 2BY0A 3JSOA 3AAFA 1IGNA 2OU2A 1SQPH 4DUYO 1BW6A 1S0VA 1Z05A 3KZZA 3H1KH 2F4VO 1T95A 1IAWA 1YX5A 3W2WA 4HF2A 4ZTFA 1UAAA 5KVRA 3CRAA 3F6VA 1D8JA 3T1CA 1GV5A 3V7CA 3DSQA 3OUSA 2ZKZA 3N97A 4XLPF 2EIKB 3A03A 3PUBA 4MVMA 1ZL8A 3FAVA 1TQPA 2QR4A 1IBLO 4DR7B 3OYNA 4LITA 4FTHA 1GVDA 2QVOA 1E79G 2E1CA 2P7VB 2F93B 2DE0X 1FOWA 4ANJA 4XDKA 4JV5B 3HGGA 2F66C 1BOAA 4M9SA 5FKNA 2Q0OA 2IGOA 4P9FA 2ADPA 1QLEB 3QOPA 1G2HA 1HNWB 3CC2I 2DT7B 4ZOLA 2VN2A 3DKXA 1WSUA 2Y2ZA 3CZ6A 2R7XA 2MC4A 3DP7A 1HOMA 1P4WA 4XDJA 4MVQA 4M9XA 2K9QA 1MSWD 1Y6XA 4PD4F 2YR2A 4KNYA 2YICA 2Q8KA 1AWCA 3RZOJ 2JT1A 2UU9O 1VIBA 2W0XA 3QO5A 2Y69B 4I4TB 1WHUA 1KQ9A 3A01A 5KA6A 3ML6A 4OU0A 3LWFA 2A0LA 2BOCC 1GXQA 1SD5A 3IRRA 2XASA 4DUZB 1OCZC 4DV5B 4BL0B 3T1YB 5B1AC 3MAQA 5LYJB 2O6GE 4HSTA 5BXZA 5C44J 1YVWA 2XB0X 2XSJC 4F92B 2DYRB 2V1UA 3MVPA 3HPLC 5KK1A 3HBLA 4W97A 3JATA 2F95B 4XRSG 1O9GA 4NTWA 4X9QA 3GTQJ 2CQNA 1A36A 1BMFG 2FYUH 2VT2A 3SPHA 4X64O 2GV9A 5J8CA 1Q3EA 1U5TA 1POGA 2LG4A 4KFMA 2Q5ZA 5J3LA 3HKDA 4A5UB 2CFOA 2ZJRF 3BOQA 4KN7X 5EEGA 2PZSA 2E7XA 1ZRCA 4RBOA 3WHBA 3CJTB 1YS7A 3LOCA 4HLYA 1QU7A 1IXRC 1QHGA 1KKDA 2Q7HA 1P6RA 1WVRA 1ZN2A 2YU3A 3AG4B 1Q6HA 1AILA 3K7AJ 3S1MJ 3JRIA 4GYGA 2YIBD 3HPGA 4BE1A 1JJ2U 2V9PA 3NWSA 4Y4RA 1QZYA 3TO7A 1ZARA 2TDXA 1B4AA 3C7JA 1W7PD 1YW8A 2L7FP 1LB2A 2R7VA 4J9YB 5GAEJ 1WQ2A 1WCMJ 5IOYA 3BJ6A 1EN5A 3BAAA 3JRAA 1CF7A 4P9UA 3C1DA 3T5XA 2Y4UA 3GB7C 3K1NA 1BI0A 1S5JA 4I02A 3ETGA 3DU6A 3R0AA 5H9CA 1KU7A 4U0WA 1K8AW 5IYDO 3AG2C 1I27A 3BG6A 4ZH4F 5BMVB 1UHSA 1GKFA 2BGCA 2O0YA 3M1CA 4UFZA 3IL2A 3D8CA 4LLLA 2EIMB 4QJFB 3E6DA 4KMUX 2BY2A 5LL6Y 1I3QJ 5M3MJ 1GLNA 1DPRA 5F0FA 4OPAA 1R71A 2ZDIC 5JFRA 3GO5A 2IH1C 4KP4A 5H5NA 1Y1VJ 3ASOC 1VQ8V 1HR0B 1MBFA 3G4SI 3LSPA 3EUKL 1FTTA 3X2QC 1GTOA 4N4OB 2PEXA 1XD7A 3LAPA 4YY3O 1SANA 3L70H 2HQ5A 3GXOA 3RYCB 1IBMB 1W4MA 2IGKA 1SEUA 5EZYB 3OYGA 4UUSA 1ZLJA 3S1QJ 4RWUA 2KIUA 2WY8Q 5IYCO 1YOVB 4LGWA 4JQFA 3RBZA 4YELA 4L18B 4NC7A 2X1EA 2OTJI 5IP9J 2FKXA 3S15J 2YXYA 2CSOA 2Y0IA 2QQAA 4HQMA 3ZRGA 4GDFA 3HKEB 1S6LA 1K79A 4KFCA 1R23A 4MW8A 3IH2A 1E2XA 3LSGA 4GYIA 4MHGA 4H37A 1QQCA 5KAFZ 1KQ0A 2BXZA 1VF6C 2WAQN 4DR1B 1AROP 1OCRC 4LK0F 2KPMA 4O6JA 3FXLA 3H0GJ 4EJTA 2EBOA 3A02A 4KISA 2HQNA 5JHUA 2JRTA 2OIEA 5EC2C 2ZIMA 3N2KA 4MVUA 2HVQA 3B4SA 4DV0O 3AG7A 2EV0A 1DQUA 4DV4B 2A3QA 5M3FJ 3M8FA 4UB6C 3V42A 2PFBA 3O2PE 4J42A 2OCHA 1GVJA 1TNSA 3R60A 1R1UA 2CH7B 1I6HJ 2A7WA 1MG1A 3GLXA 2A3SA 3G71I 4WBNA 1RUOA 1VF5B 1EH7A 4A3EJ 4EB6B 3CJRB 1KYOF 2JPBA 1ORQC 1HW5A 2ZXWH 4HG2A 3T8RA 4YJ3B 2MSYA 1XNRB 3BY6A 5JJJB 2XROA 2QKSA 4AIHA 5B66C 3LSSA 4G27B 3NQOA 1PNMA 1BOBA 2OT5A 2DT6A 4BY7J 5IYDJ 5F27A 3RYPA 3JALB 2VE8A 2NN4A 2QTSA 2UXDO 4X1KB 3RVZA 1KU9A 4XKBA 1KECA 3ZQCA 2ECBA 4F52A 2EIKH 2GA2A 3AG1C 1BM9A 1TW3A 2V4JC 1R7JA 2OBPA 3TO9A 3GWOA 1L0LH 3I5DA 2VQEO 2WADA 1IN6A 5FD6A 3OYEA 3CC4I 2FMLA 1KA8A 3FMSA 4ZYEA 5B3SB 2JN6A 3OL3A 1EZJA 5JJEB 1FXKA 4DRXB 1QVTA 3BG3A 2WAEA 5DUKA 2GM4A 3H3ZA 5CQGA 3RQ4A 1W0UA 4K2EA 4L87A 3L7WA 5IYCJ 1S5HC 3I0TA 4BE0A 2DODA 3BZ6A 4N4NB 3WGGA 3ZGKA 4OAZA 4KMFA 4X1IA 4CH5A 4J01A 3WE3A 3IH3A 1Q1VA 2VODA 3T8TA 3CCVI 3B40A 2V6CA 3CCYA 1A5JA 5GADJ 2QJ1A 4LR3A 3CCMV 4DR4B 2KRCA 4I7HA 2CYYA 5FKOA 3L71H 2IA1A 5ILVA 3HR0A 1W0KG 4OWRB 4XORA 3DC6A 3FKIJ 5LBQA 2AXTZ 3R0JA 3SHFA 4CH3A 1YHQV 4TV8B 4F93B 1YHQI 2ISZA 4UVCA 4X20B 4IRGA 3O9OA 4X88A 1LDDA 3B77A 4RUFA 5D6EA 4CGZA 3B6CA 4QPJA 3ZBHA 2DYRH 5FKKA 2IBZH 4H0LB 2M0CA 3K08A 2DXIA 4Y3OA 2ZSIB 1I39A 1KGSA 5BOXA 5DYMA 2DQ3A 4R50A 1XS9A 1DF4A 3RYFA 1AOYA 3BVOA 4MGRA 2L9NA 3RPQA 5LA6A 3UKMA 4BXUA 4U7BA 3E2EA 2OCCC 1K3EA 3ISPA 2V7QG 2NLJC 1ZELA 2XIGA 4FVMA 3G73A 1BIBA 3KP6A 4I0XB 4LH7A 5FNVB 3H92A 5DEDA 1YTYA 2V4DA 4RLQA 1U3EM 2XVCA 3TKYA 3FZVA 2VS0A 1GT0C 4M71A 3C3SA 2MK3A 3LSUA 4RDUA 2HYGD 3J81K 3HKBB 4UCUA 1D0XA 3UQ8A 1UB9A 2WA0A 3AG4H 2CW7A 1RUNA 1N32B 4D0PA 2A5WA 2QM3A 1W2BU 3L2CA 2FF4A 4RB3C 2FB5A 2JGDB 2P4WA 3WFVA 5E3NA 4RAFA 1MGTA 3ZMUA 2VBWA 3OR2C 1FWZA 2JSPA 3KX2A 3SZPA 4FLZA 4TV7A 2DO7A 1YI2I 3OYIA 1EJ9A 1OJHA 3REOA 3J80Z 2IBDA 2VASA 4E7KA 2P5OA 4LLGF 4F91B 1B9NA 2W85A 1PPJH 1XN7A 2WWWA 1OMIA 2QF7A 4MTEA 4L0YB 5TRDA 3OYLA 2WLLB 1YO5C 1Y76A 2NR5A 3OYBA 3LA7A 4I55A 4JYAB 3MD2A 4UV9A 4LWSB 4BIOA 2PMZA 2XDVA 1O3RA 3IC9A 1XGOA 4IRIA 3FX3A 1R58A 2QA4I 3ABLB 5IJ0B 5L3FA 1UJWB 5ERIA 2VRZA 2R7WA 1N0NA 3BEHA 1H89C 1XHXA 1IV8A 1UFIA 5D5XB 3MN2A 9ANTA 3DGEA 4BIZA 1IV6A 1TGOA 4BQAA 3GWKC 4BW9A 1Z1DA 4LB6B 1TTYA 3ERMA 1V55H 5CYVA 2Y0SN 4ON0A 4F55A 4OGQB 2IA0A 3IKVA 2F6CA 2W84A 4XRSA 1NHAA 4FT8A 1I5YA 1ZGJA 3K4LA 1KQ8A 2LTPA 3BQYA 3E97A 3HB9A 3RSNA 5HNHA 3JAMK 2RN7A 1ZR2A 4WCEV 2DA2A 2HZTA 3EDPA 4JV5O 4CH7A 3B02A 1HNWO 4XOPA 3SQNA 1I7FA 3UCSC 1PUEE 2CUZA 2ZMEC 4PUSA 1ZG5A 1IG7A 1FFTB 4C9YA 1IX9A 2H94A 4FX0A 1YIJV 4K0KB 2JK5C 3OD4A 4YIRX 5D4SA 4X65B 2ZE5A 1T0FA 2UXXA 4BJ6C 1PUFB 5CB4A 1T33A 3ETEA 3O6BB 2ID6A 3JYCA 5EG0A 2DW4A 2YX7A 3AK2A 4ZDOA 3PJSK 1UFMA 4ESBA 1L1FA 4DO2A 3C18A 3A0RA 1ZUQA 4HNVA 3MKYB 3V8JA 1WA8A 1BW5A 1YX3A 1OCCB 4DUZO 3J7AU 2K85A 5IJ9B 4J9ZB 3OOPA 4HV5A 5KHHA 5HS9A 4DV5O 3T1YO 2F5DA 1JGGA 1JHFA 1PVEA 2QSFX 1KU3A 3RCOA 4J80A 1R6TA 2DI3A 3S3WA 2A68F 4MIMA 4M74A 4O3MA 1SAXA 3E22B 2AQFA 3K69A 1MBHA 5B1AB 3WG7C 4M6VA 4D5FA 5HFLA 1IBKB 2LO1A 3GTMJ 3I55V 3HRTA 1OZ0A 4XQFA 4MFDA 5GP9A 1AJNA 2JA5J 3MCZA 4N0BA 1O9HA 2ARHA 2HVKC 3KCCA 1WP7A 1Y6IA 4PFOA 4G7HF 2Y4TA 4WBNB 2OPTA 3C3WA 3E6BA 3PFYA 2YIAA 2EX3A 2QLZA 5IY5C 3BR3A 3QAHA 4A3GJ 2Q69A 2B9SA 3F7VC 1DGWY 1ZTRA 3RVYA 5KLVH 1I3AA 3HM5A 2R7RA 1Y1WJ 3H9VA 2X6AA 5EZHA 2AQEA 2M7AA 4I5SA 2K27A 3DXRB 3WG7H 5BPDA 5JLXA 3JCUC 4KIGA 3I4NJ 3Q5FA 2YDEA 2ICWG 2ZO4A 4HAMA 5F0CA 2Z0AA 4JYYA 2EFQA 1JA8A 4TQFA 4LK1F 2ETNA 3HOSA 3G6EV 3P9CA 5E1XA 2L01A 5IP6A 2Y69C 3CMEI 2IU0A 2PX9A 2DK5A 5DECA 3F23A 4UCSA 3K3WA 1Z0XA 5E79Z 3DV8A 4B44A 4MQ9F 4D7MA 4R79A 4FX4A 4DV6O 2IGNA 2ID3A 5JQGA 5FO5A 3RKYA 1VQ9I 1NTKH 2G7UA 1G3TA 3SZTA 4S0HB 3ZQHA 4BJ5C 2XSDC 1B8IA 3ZPLA 4MO7A 3S3OA 3GFMA 4ZBMA 3SYTA 5AIQA 2V1DA 5IT9K 2Y48A 5B3SH 3SDLA 4EM0B 2QGUA 3EQLF 1ZHFA 2W82A 3OIOA 5E3LA 3H5RA 3TW7A 3JASA 2JQ7A 2W0FC 4JI2B 4H4KC 5LGTA 1GN2A 4LF4B 2PTMA 4JAUA 3I59A 2ESNA 1F4NA 3M8AA 4DR5B 1OKRA 1B3QA 3K06A 2P7TC 1HNZB 4J41A 5HLIA 3MD0A 2WC2A 2XAGA 1SFEA 2GWRA 4HEA2 1HR0O 2K3FA 2XAHA 3DBRB 4HLXA 1H9TA 3K5NA 4X64B 2JRIA 4IX7A 3ZHUA 1CP9A 3D0SA 3CCRI 4A0ZA 1XMQB 2OAZA 3PJRA 1XQ8A 2ZFUA 2QZ8A 1TT0A 4PK4A 1IBMO 2EFNA 3HL2A 3ASOB 3GW2A 5ED4A 1BN5A 3K9TA 4LC1A 4ZHQB 1Q82W 4R8HA 1ZYRF 4FLXA 3F3XA 3MEXA 1HC8A 3DF8A 1BI1A 1Z21A 1D1CA 1X3WB 2X7RB 4ZDLA 3HOVJ 3OW2U 1QZEA 1H0MA 4LFAB 1SD6A 4A0YA 1VEWA 3BROA 1IRXA 4B7KA 4ENKA 2E34A 3HGYA 5C8YA 2GXAA 5ILSA 1Y66A 3GYHX 4PA3A 3W7WA 4JI7B 4DR1O 1TAEA 3OMNB 3S8PA 4ZI7A 5J40A 2CTWA 1W36C 4I0AA 1Z67A 4DJAA 1QQIA 2CUFA 2OUMA 4CS2A 2ITDC 1FP1D 3J80N 3SPGA 3DBLB 3BLYA 3EPZA 2VPRA 2LP7A 1JPXA 2TRTA 4RM2A 4LFCB 3RYHB 2ATKC 2EIMC 2AHZA 1OCRB 1YJWV 1PNLA 2ZJ2A 1R1TA 5F0HA 4NNJA 3JRFA 4O4JA 3QU6A 1IN7A 3E86A 3JSNA 4D7TA 4LF4O 6PAXA 3KLNA 3LNNA 3ABTA 2D2WA 5CA0B 1M90W 1JHHA 5FL7G 3IH4A 2K02A 4KT6A 2ODMA 4FETA 5LEKA 3CCUV 1NH2B 3WGHA 1S7OA 2BVMA 3GZNB 3B2EE 3CP8A 4U0VA 2M30A 4LG0B 1WRJA 2AS5F 5BNGA 1JFFA 3T0YA 1ENVA 5EYPA 2YSUB 5LMUB 3BRCA 2CO5A 5EJCA 4S04A 1Y4MA 4CS4A 3ZRWA 4MVRA 2IA2A 3TXSA 2VOOA 4HNAA 3ZHSA 1VQLV 4B3RB 3OYCA 1XL4A 3JR9A 2LRDA 1HKSA 4DBRA 1K61A 3S17J 1E0EA 2E1OA 5AONA 3VOEA 1BE3H 1XDUA 2IJJA 4EKWA 4BDZA 2GIVA 4ETSA 1K5SA 1FKAO 4AVPA 1AJPA 2CQXA 2STWA 3JTHA 2P22C 1VQPV 2IT0A 1IRFA 3H01A 3H3UA 3M8JA 2EILB 2WAFA 3I58A 2Y9YA 3WTUC 2OIGA 2DA4A 2DYSC 3R61A 2ZIOA 1P49A 2A6EF 4A12A 4AVZA 3E6CC 3OY9A 4KA4A 3OMYA 1RP3B 2P5LC 2L9VA 4HRIA 4O2AA 5JVDA 4PDVA 1SFUA 2CW8A 2A07F 1WJCA 4JYBA 4WCGA 1ZGWA 3AG1B 1F9NA 2KLOA 1JKOC 1MDMB 1QR8A 1ZAUA 3WE2A 1PP7U 2QWOB 3FD9A 1FY7A 2ETHA 1Y74B 5H20A 4GX0A 3BZCA 2I5UA 1IN5A 4J11A 3SJMA 1XUQA 3EVKA 5J9PC 2Z99A 2DWDC 2B0LA 2E5LB 1X19A 5LXTA 4YFNF 4DQ2A 1H2LA 1S5LC 4O4HB 2XPUA 1NVPB 2X1CA 4GT1A 3LSIA 2P6JA 4DR4O 1BS3A 2IPQX 2HXOA 5J6XA 3LSQA 3HOYJ 5GONB 5EGOA 2P4VA 5LOVA 2R5YA 4AIJA 2ZJQF 3OIQA 1BCCH 1JT0A 3LAJA 1FBQA 3B6AA 2DMNA 1PDNC 4L9JA 2YI9A 3VOUA 3ZMDA 3EYYA 2CW0F 2LVSA 2ZD9A 4ENNA 1RC9A 3C2HA 1OCZH 4CCMA 1MMMA 2WLIB 2Q67A 4OPHA 5B1AH 1KBHA 2QWRB 3I56V 4NB5A 4PCQA 2M9HA 1YW7A 3RYIB 4O2BA 5D5UB 3WTYC 1IDZA 1M1KW 2EINC 2EFPA 2R7DA 2DJNA 1JTYA 1K92A 2N8GA 1ZX3A 3T1HO 2L9RA 4AHCA 3QWLA 3FXUA 3QYEA 1LEBA 1GRJA 1LUWA 1M57B 1H2GA 5HS8A 1HW2A 2WWYA 1K4DC 2FQ3A 1VQ6I 4BDYA 2BSKA 2K9SA 3BG5A 2HKXA 2OCCB 4A3LJ 4CUGA 1US6A 3FB8C 1WH5A 3K04A 3Q0WA 2VBZA 1JE8A 2KDOA 1JX9A 3L73H 2CAZC 4KUMA 2QM7A 3BABA 3DEUA 3OIPA 4DW1A 4CDGA 4IIJB 4IPAA 1ZKGA 1P4RA 5CQEA 1B72B 3QOEA 1TVKA 2VC1A 1URFA 5E8GA 2LW7A 3DEWA 3LSRA 3KFWX 2BHZA 3MZHA 4PJJA 1ZK8A 5EZGA 5B66Z 5A2QN 3FDYA 2O8XA 2AZ0A 4C2MJ 3CE2A 4JYAO 3JD1A 1PD3A 2XF5A 5BQTA 3MKLA 1S72I 2H6BA 1DDNA 1AP6A 3ZHTA 3HJEA 1RRJA 3THOA 4YJ2A 2QSHX 2XPWA 2E60A 4I6ZA 1LE8A 2IS4A 2R7OA 4Q5SF 2XT9A 4KHPB 4E70A 3K4MA 4ASUG 1G59A 1XNQB 1I6XA 3AG2H 2IU3A 4K8ZA 2UUAB 2JDIG 4JI4B 5E1WA 3GFIA 3LMMA 2DMXA 1XG1A 2EB7A 4JI5B 3CCSV 2LKXA 4A3IJ 2ZCWA 3LSJA 4MEYF 1ZL8B 3BR5A 2CK3G 3FAVB 3CLQA 3T4DA 1E3PA 1YRNA 2HXIA 1NTZH 2GUZB 2DFEA 1QBZA 2QWNB 3OM3B 5DTDA 5IE9A 3X2QH 1OCOC 4DK1A 1XGNA 3E83A 1MIJA 3H0DA 4RS8A 1LFBA 1Z6RA 2ILMA 4ZOLB 1T0FC 4UB8Z 5EEHA 3GFJA 4B08A 2HPIA 3FF5A 1J5YA 1NI8A 2FMYA 1SC7A 4CHUA 2G9WA 5CA1A 3UT5B 3N05A 1ZWIC 1FZPB 4HW0A 3IV5A 2QKAA 4K0KO 4XONA 4HV6A 4DZJA 4CCOA 4FM0A 2UXBB 2HJDA 3RPUD 4X65O 1J2XA 2BEOA 2ZMEB 2ZXJA 2N05A 3CSXA 3ZRSA 1NH2D 2LC2A 1IXBA 1JR9A 1VQNV 2BW3B 4JF3A 1AR1B 2OQRA 4M3FA 2PJPA 2CTQA 2GHYA 3UM7A 5F08A 1OCRH 5EYRA 2L35A 4QTRA 2QWWA 3ABLC 4Y17A 3N2GA 3T4ZA 1E3OC 2JK3A 4Q47A 2HEPA 1FLIA 1G3SA 3BG7A 2K9MA 4BJTA 1JKQC 4LF8B 2Q4PA 2BXYA 3CDIA 4KYWA 2RN9A 2M8EA 3CCQI 1LFUP 2CFXA 2CUEA 3PSIA 1IBKO 4CBCA 2HP8A 2YXLA 3PIPF 2RVCA 4I9WA 1U5TB 4JP0A 2ZSHB 5J4VA 2Q7GA 3OYAA 1KQSU 3CUQA 1SMTA 3A8TA 1F4KA 1D5YA 5KUMA 3FX7A 1WH7A 3E89A 3QNEA 1P92A 3WG7B 3ASNB 1VQ7I 3L00A 2PMUA 4KDPA 3CF5F 1W7PA 1IBLB 5LEJA 2IP2A 3IWFA 2D1VA 1TT5B 4U0YA 5M5WJ 1LVAA 5K7FA 1BJZA 4WWCA 1VTNC 4DYRA 4KIBA 2RMKB 2R7QA 4XLAA 3FBIB 1R49A 3RN4A 2FBKA 2MBFA 3QPHA 1LQ1A 2IJHA 3JD2A 5IY5B 5JCOA 1SA0A 1GN4A 4A69C 2D2CB 5GPCA 1YITI 2LGQA 1H2KA 2DDAA 3KEOA 2KJBA 2PQ8A 1CF7B 2IS2A 3FYIB 1OCCC 1ZLZA 2VBYA 4YRVA 3SYAA 2DMUA 1NVPD 2Q2EA 3GEZA 2MD5A 3PQJA 3DTUB 4RAYA 4NVPA 4WF9V 4LF6O 3SJQC 4BBSJ 1OR7A 1FIAA 3BHPA 2IM9A 2DDBA 3AG1H 1VQOV 1WJDA 4GX2A 4LP8A 4AYBN 4IKFA 4JI2O 3FK7A 1SQXH 3LNQA 2NAZA 4AQYB 5FB2A 4X1YA 4BGDA 2AGAA 5JH7A 5BPIA 1AR4A 2LLKA 5CJ9A 3CJHA 3CX5F 4DR5O 4CYCA 2M6YA 1FC3A 1HNZO 4A6DA 1Z91A 1Z7UA 1L3LA 1AKHA 1HXDA 4BHCA 3IRQA 2LD5A 2W57A 5LP6A 1RNLA 1FFXB 2XTAA 4ZJZA 1F43A 1L0OC 4Z2WA 2F5CA 2I8DA 4AILC 1XMQO 1XX5A 2M45A 2XGXA 4M72A 2R93J 1JJOA 4AU7A 4UUSB 2V1XA 2NRAC 3OMIB 2QWQB 3VB2A 1H2MA 1BHBA 3S2HJ 4CCLA 2VBXA 3S14J 2Z33A 2GTAA 2P81A 3V8LA 4AD9A 4DBQA 1DTOA 4JI8B 4G6QA 2XV4S 5LLQA 3JD0A 2WV1A 2E5ZA 2LP0A 3Q4HA 4B3SB 2QQ8A 3I54A 3BJAA 1FTZA 3BR6A 1ZG1A 5J1YA 1NBMG 4LFAO 2QTOA 2VWKA 2LY1A 4NQWB 2K7LA 2GOXB 2DA6A 2A69F 2E74B 4ASNA 3I9V2 3DBHB 5DCMA 4BBRJ 5ITZA 5EEAA 3K9AA 5JJNB 1TZLA 2V6EA 4I7ZB 1U9OA 5TISC 1AJQA 1JCHA 5D5PA 2QGNA 3D3IA 3SJBC 1YJ9V 1F5TA 4FM2A 4DV6B 2OCCH 4LFCO 4HSRA 4BHPA 3A4CA 3HOTA 1S76D 2P8TA 2DQRA 3S93A 4PHZA 4J19A 3W3CA 1ONVA 4PJ0C 2WLHA 3HOZJ 2ZR3A 4EV0A 1O3QA 4H0EA 2K1EA 4U3FH 1GXPA 4P30A 3CRRA 3ETQA 2LNBA 3DFGA 2EIJC 1MJ9A 3SR2C 2F48A 2O9LA 1PYVA 3TGNA 2M4GA 5KA5A 4IYIA 3I5UA 2JRMA 4M73A 1IO2A 4TV9A 1VNDA 1HKQA 2BY3A 3K4NA 1MZEA 1LDKB 2EPFA 2NVXJ 4OMYA 4L8JA 1XBLA 4B3RO 3ERED 1XGSA 4MT8A 3K4CA 2BE3A 4IQ4A 3P9IA 3OS1A 2KB1A 3JCUZ 3F8FA 3WTTC 2EQRA 4PGGA 5HS7A 2FSWA 2EZKA 1XSVA 2W25A 4XLCA 1GUUA 3M1EA 1DU6A 2HU9A 1ROPA 3JARB 1JJ6C 2FTKA 3CCEV 3RKWA 1X3UA 4H13B 3FWEA 2FD5A 4RB0A 5IP7J 3CESA 3DU5A 2VE9A 4DYCA 5HVQC 3H36A 1MNMC 3VDXA 4LF7B 2DQLA 3SFZA 1NT2B 3FMRA 1W59A 4IHJA 1QVFU 4DR6B 3J7ZI 3IJ4A 2Z1DA 3IHUA 3K59A 5D8LB 3FMQA 2HTJA 1KD1W 1R9TJ 1D1BA 1MJBA 3SFIA 1MNGA 4GKKB 2DYSB 2NNUA 4GZRB 1Q8IA 2X9DA 4DV3O 1SVOA 2KISA 5CBGA 2WBMA 5KAIC 1EFRG 4IQJA 3P3NA 3ZIAG 4BQOA 1TUEB 1NH3A 1XMKA 1XCVA 4YFKF 3HOXJ 3IFXA 1P7IA 3SYCA 2A5YB 2WV0A 2LMDA 5FPRA 2O5RA 2E2HJ 4B8XA 1DGSA 3HC7A 4IF4A 2GDSA 4FLVA 2E5LO 3PSFA 3ZQ7A 2ECCA 4BQNA 2FU4A 3H5NA 4UHTA 4XKVA 1X4OA 5AIPA 1VQ5I 1FD9A 2YEVA 1Z5VA 2XGDA 1N75A 1HW7A 4YIOA 5DS9A 2HYFA 1MW7A 2H1LA 2M8GX 4ZYAA 4CZZA 1BT8A 1QRYA 4W1UA 2ESHA 5JVGF 1ZQ3P 1P7GA 3K1MA 5CVVA 2L0KA 4ZKIA 3KYCB 4FZ1A 5J47A 2NS8A 3F8BA 3M3YJ 2W4SA 3K1PA 2EILC 1X4PA 3F6OA 3E7LA 1FAFA 1SZTA 5D5WB 3BJOA 4O4LA 3RYFB 5K5QA 4PDRA 1VQMV 2CU7A 2FEZA 4B48A 1X1PA 3T2MA 2HFHA 1J0RA 3ML0A 5KMGB 1AI6A 2K4JA 4BW5A 3VSKA 4ZYDA 5IDJA 5EBMC 2LK2A 3HSEA 2BVLA 5DD8A 1TL8A 3O65A 3KEQA 4JX6A 4P5OA 1XC5A 4RGUA 1V9PA 3MHSC 5HFMA 2HOAA 2BHYA 1UHMA 4LJZF 4BS9A 3WTXC 1WAZA 2KKWA 2EINB 4FFBA 2F4MB 4BH9A 3HHHA 5BMZA 3ETDA 2OTLV 3LQQA 1OLTA 3BR0A 5K1YA 3I4MJ 1SETA 2P4KA 1WJBA 4BHBA 3AG3C 1J5EB 3JSPA 2JUGA 2WLNA 4GCZA 3RYCA 3WTWC 5IY5H 2CV2A 2W6IG 3MQ0A 1K78B 1N77A 1SERA 3SPCA 4P96A 3JRCA 1SF9A 4EFEA 3GVAA 3G6BA 1AA7A 2X4HA 3LA2A 3CS5A 1KZHA 3PL8A 1C0WA 2JA6J 3D36C 3FYEB 4UB8C 4UUJC 5E1ZB 1WLEA 2CQ7A 2KKOA 2DBBA 1Y76B 3E1SA 2Y69H 4I55B 4JI1B 2RREA 4R8CA 2DPDA 3D5LA 1QHHD 1ZSPA 1SRYA 2RNGA 4CCNA 3J80K 4FFKA 5C4XJ 3JCZA 4KHPO 4PA6A 5KHDA 4PI2A 1ON2A 1K73W 5LRRA 4EEQA 3O8GA 4BEHA 2LY2A 3S3NA 2UUAO 3VEPA 3OEEG 2V26A 1V54B 4WFEA 1YJWI 1SFKA 2B1GA 1Z6TA 3NARA 2H27A 2EULA 2IJKA 4JI4O 4JI5O 2O7OA 2LKSA 3Q9VA 4XMYA 1M57C 4GRIA 2VJIA 5EDNA 1TWAJ 1FSEA 1X3ZB 2COBA 2M5WA 2WPDG 4MVOA 3CPWU 1HDJA 4DXWA 1SMYF 3VPRA 5AG2A 2LJ2A 3RZDJ 4MVZA 3U9GA 4X62O 3D3QA 3DPLC 3FXJA 5DV5A 1M4UA 4XR6A 3GVMA 1W36D 4FIPC 2VXZA 4E7IA 3DPUA 2WB1A 1LNWA 4EB6A 2DFIA 2K9NA 2MC3A 4B3TB 2MW8A 2P7CB 1OCOB 1KYZA 1S5LZ 3CTAA 4IHVA 2NNYA 1AHDP 1QGPA 3OYKA 3PM1A 2VQGA 5CB4B 2UXBO 1KMIZ 4PDKA 5EG0B 3CCUI 2FJ1A 3PO2J 3SYOA 2PUSA 3ICXA 3JALA 2RV8A 3QF7A 2V79A 3C3TA 4CYDA 1WA8B 4X1KA 1Q7YW 2RDCA 1A6QA 3DKWA 5FFXA 3E35A 3ZQQA 2WA4A 2P06A 1FJGB 3DXJF 1X1AA 2EZHA 3CRQA 4LF6B 1WJAA 3HKCA 3S3XA 4WFBV 4XLHA 4Q4ZF 3ONQA 1ZR4A 1MOFA 2ZJPF 3HTSB 4U3JA 2BTOA 4GXOA 4BACA 2EIMH 2QQ9A 3H9QA 5KX5A 4LF8O 2GSMB 5F2VO 3MKZA 2PJRB 3AK1A 4JTDB 3CCJI 4X66B 1EA3A 1G6UA 1RM1B 3OOUA 2RAEA 2RGVA 2ELKA 2QQBA 5JR3A 1VQPI 1YXBA 2KG7A 2R9IA 3CXCU 4XRMA 2VKHA 4HX8A 1X1BA 3OWTA 1R5GA 1IF1A 4IRHA 3CD6I 3ZCCA 5HOOA 3V7SA 5E18F 1UPGA 3KIOA 3EYIA 2A79B 2LF8A 2O3FA 3L2WA 3ZXSA 1O3TA 1JT6A 2Q0OC 2VQFB 1Q81W 1DP7P 5HDGA 2IH3C 1BHAA 1R3LC 3CB2A 2HVRA 1H8AC 5CVIA 2CGPA 4NHJA 2PLYA 1NK3P 1FBSA 2KT0A 2R0QC 2XRLA 4X8AA 3LDEA 2XAJA 1JUSA 2OWOA 3MZYA 4I99C 1UHWA 1OQYA 2P0WA 1PL0A 3N27A 4EATA 3VQXA 1ZREA 1RR7A 2UV1A 2W1OA 4TV8A 4X20A 1R5ID 1HA8A 2DWEC 1T38A 5LMUO 3UNGC 1T2KA 4DV1O 3RIRA 5IOZA 2PY5A 1G8MA 2VC0A 2R9RB 4OX9B 4C3IJ 5JLWA 3R66A 1YYVA 2LY9A 2X6YA 5FFZA 2GBOA 4TT3G 4YXWG 5GTIC 5JQGB 2XUMA 1T56A 2CGOA 1AR5A 4X1EA 2DYSH 4BU2A 5HLTA 4I9QA 1QNTA 1AI4A 4I0XA 3U21A 5L3CA 2LFBA 1FP2A 3TBIA 3OSFA 1SS3A 3SPIA 5BR8O 1YSCA 1F23A 3WB1A 4AQYO 2FX0A 1UJ8A 2DPUA 4DK0A 1KYWA 3C2GA 1U5TC 4LIVA 2AO9A 4Q20A 3HYIA 3CC7I 2Q8VA 5J4YA 3F72A 4HF0A 3D5RC 2JJ2G 5B1BB 1T39A 3ASNC 2XKOA 4XIDA 1RSOB 3I56I 5FLXZ 2VKVA 2Q68A 3MHHC 4D7NA 4RO2A 1FYLA 3GTOJ 3A0BZ 2JJ1G 2NVUB 5GAHJ 2IJLA 1EN6A 4MW3A 5E20A 2L4MA 4GGGA 1Y8RB 2ACJA 1XHZA 2MFZA 3FHNA 4UY8I 1PNKA 4C2TA 1OYIA 4XBFA 4JX5A 4JI8O 2LOOA 3AEIA 2BOBC 5JHFA 3ZEDA 2HEOA 1SVLA 3QODA 3OYMA 2WLLA 2KRHA 4B3SO 1USTA 4MNUA 1R1VA 2JTVA 2BZTA 5J2TA 4LWSA 3W6KB 2FL4A 2OZ6A 2HPMA 4HA8A 1H38A 4NC6A 1LUVA 1XEQA 4N9HA 2LF7A 5IJ0A 1BR4A 2QSAA 4X89A 4ZYGA 2ZKOA 3K03A 3B09A 2R3SA 3MKWB 4C7UA 4EJOA 1D2DA 2ZM6B 3DWLE 2A6TA 1RKTA 4B3MB 4O4JB 3OGIB 3M99B 3DQVC 2O61A 4JOMA 4WFFA 1DUXC 2HR3A 1ZG3A 3OYDA 3CCLI 1T8IA 4HF1A 3A2FA 2KIQA 4M6XA 1MBKA 2YS8A 4JI7O 1K97A 2BE5F 4I76A 2PYJA 4Z2YA 3RYRA 2PI5A 1WGXA 5M5XJ 1S77D 4UCRA 1I1GA 4FM1A 1JFFB 4LNUA 1ETQA 1ERDA 5EYPB 1CGPA 2DN9A 2F2EA 4C3HJ 2HQAA 1JVMA 5A2QZ 3ZRWB 1P4AA 4D7SA 5A9GA 4HNAB 5JWPA 3P7NA 2EIJB 3JAKA 4RB2C 3G80A 4HZFA 2Z9OA 4WFHA 2GQQA 3PNYA 3OV8A 2D3OW 4MVSA 1EF4A 1TWGJ 2VLAA 1IN8A 1LKXA 4PDMA 3ZHRA 1VQ4I 4CS3A 3K0LA 4O5VA 1IZ1A 4B09A 2HHHO 1JTXA 2VB6A 1VZ0A 1TUBB 3L2QA 4DGWB 3E8FA 1K34A 5IJ9A 3UR3C 3NRVA 4YHHB 3EUAA 5EF6A 2DA7A 4G7OF 3RDIA 3U2RA 1GM7A 1UMQA 1KONA 2QUFA 4YFXF 4Z6YA 2HYJA 3IKTA 1PKXA 4O2AB 4LF7O 5JVDB 3WHCA 4DR6O 2GLOA 1NJIW 3E22A 3CCVV 2R4GA 3KP4A 1MNDA 2FUG2 1IN4A 3LL7A 2DMQA 5H6RA 4EM1A 5ICEA 3H1IH 3NR7A 1N36B 4GKKO 4LOCA 3FB5C 3WU2C 5GTHC 4RB1A 3ZX6A 2DTRA 3QP6A 3RTRA 1K4CC 1BZKA 1IXMA 3RWRD 1D5AA 3IAM2 1R1BA 5DM6V 3JREA 1BC8C 4M3DA 4XK4A 3MAJA 1OCOH 1XTAA 1P9QC 2LFSA 1X2NA 4IVNA 1JKRC 4FMTA 4IT5A 1I94B 5LHIA 3QPSA 3JRGA 4EVIA 3W7XA 2RJZA 2X6OA 3H1CA 1G1XB 4KT5C 5EIBC 2EBIA 3HRUA 5EBWC 1QO0D 3EUHA 2STTA 2HZDA 2YI8A 3DXRA 4G12A 3OYHA 3KCYA 3CRCA 2FBIA 5EGOB 3JSLA 5J2UB 4P55A 2O8KA 1CPYA 2R5YB 4Y13A 4XICA 4U7DA 4V19K 2IS6A 4LCUC 2L4AA 5F1RA 1JKPC 1D8KA 2MG4A 3RKXA 4DV4O 1W5TA 1SFOJ 1GM9A 2LQTA 2UZKA 3VYTB 4HZ3A 2VUMJ 3GTLJ 3ABLH 1HBXG 4ZC3A 4DYQA 3GTPJ 3BCCH 4O2BB 2R7TA 3ZCOA 5TISZ 2PI4A 1UG0A 1M5IA 3MWMA 2JGUA 4KXRA 4QE7A 1TBXA 3F8NA 4RLFA 4ZZDA 3AL0B 1MMDA 1U9NA 2L02A 2XNDG 4XSXF 2WAMA 2K9LA 3U11A 2X48A 3F0CA 3LSTA 4IJAA 4LFUA 3BFRA 2UXCB 4Y15A 4XLNF 5K1PA 1RESA 3E3VA 1FXKC 4W4LA 2BV6A 2A9HA 2M3AA 3T1BA 4BYYA 4PJ0Z 1JJ8C 3CMMA 4R7CA 1DU0A 4DV3B 3KEYA 2YS9A 4UNOA 4A3DJ 2ZDIA 1J5EO 2Q1ZB 1YZBA 2Y0MA 2QA4V 4NXMB 1HF0A 5HNFA 2UUCB 2X85A 2PGGA 2GUZA 3AG3B 4J10A 2FOWA 4FLTA 1Z7LA 1YTFB 1JUPA 4C2UA 4AWXB 2H09A 1A6IA 2CG4A 2HTSA 2H8RA 1SQVH 1GDTA 4PELA 5FLXN 2VIXA 4JI1O 1YLFA 1AB3A 4BNCA 2XAQA 1R3KC 1MSFC 5C3EJ 3S2WA 3CRMA 4AYBA 4XSZF 2R92J 5IYZB 1LE8B 1OCCH 2EJRA 3GTGJ 1W1WE 3F21A 4WXHA 5ICGA 2BCCH 3W6VA 2KZVA 2CRGA 4MTOA 1G3WA 5L3DA 2W7NA 3F5WC 3OE7G 3OGCC 4PA9A 1VF6A 3BTCA 5FLMJ 4ZZLA 4I50B 1X2MA 2K40A 4DW0A 2HOTA 1M1EB 3DLAA 1QA6A 4IHXA 3M4OJ 3CO6C 3HSFA 3J7YJ 4L5JA 1XILA 4E7LA 1G4DA 3SPJA 2MABA 1WP8A 1UELB 1Q1HA 4KICA 4DW6A 1D1AA 2F4OB 1YRNB 2FNPA 1DPUA 1K33A 5KAIZ 4F6RA 2IVMA 4L9NA 1WJEA 3LUTB 4G94A 4MFEA 3TDZC 2DK8A 2E1MB 3F9KA 4Q48A 4U87A 4JZ2A 1HNXB 1K4SA 4GKJB 5D5QA 4ITVA 4F3QA 3VYUB 3OYFA 4BUPA 4Y52J 1XMXA 2LKPA 2VQCA 3JRBA 4JI3B 1B6AA 3VODA 4XLEA 2PI0A 1A32A 4YIPA 4KITB 4B3TO 4NBQA 3V8KA 2KDZA 4P9PA 5LHGA 1V5GA 3GZ5A 3W2AA 3L9DA 4QIWF 1GMGA 4P2ZA 3ULQB 3QPTA 1K6YA 1ZAOA 2VL8A 2W24A 1XPXA 1B04A 3QTCA 4UCVA 2H1KA 1WB7A 3BDDA 2CH0A 4QPOA 4M9ZA 1IRGA 3M7MX 2ZNYA 3BCBA 3OTOO 3A0HC 5L3GA 2AXLA 2WA3A 1GH6A 2AHQA 2BBYA 2LBFA 2LREA 4B43A 4U7NA 2KL4A 3I4PA 4CICA 3M7GA 2JZYA 4E4HA 3OS2A 1BI2A 1GK9A 1GN6A 1VQ8I 3N2GB 2ZE7A 4LF9B 4AUXA 1DF5A 3WB2A 1FJGO 2R7FA 2D45A 3KP2A 4DR3B 5H2FC 3HB3B 2X51A 3RQIA 1E3HA 4A3MJ 1X4TA 4Q6GA 3L2VA 3E5QA 1V54C 2CE4A 1U8RA 2XPVA 3BTLA 2YPRA 3N4MA 3CWBH 3F7YC 4V2FA 2XB5A 4MTGA 2JJ7A 1OHHG 1LNQA 2NVQJ 4X66O 1RPWA 4FE7A 1ACIA 4WX9A 4OIRF 2R5ZA 4JI0O 1IDSA 3QYFA 1I5XA 4YIIA 3GZ6A 3TK1A 2DFHA 1Q6IA 1KP2A 4BWAA 3SDGA 2GOMA 2EIJH 4M6YA 2VQFO 4JAAA 2C2AA 3TP0A 1VQ9V 3M07A 1B06A 3GUDA 4UVAA 3ASOH 4X62B 1QVUA 5BZBA 4RGRA 2JEUA 4MEXF 3DPTA 4HNTA 5GONA 3A0BC 3HUGA 4N9IA 5L3EA 3WGIA 3K70C 3EETA 5EBLC 4AC0A 3A2KA 2MYSA 1NR1A 1NG7A 3KLOA 3I3LA 2HS5A 4L9VA 4WF2A 4IO9F 2AW9A 4OX9O 5CBFA 4FLYA 2WAQA 2X1DA 1FMVA 2KMUA 1IXSB 1RZ4A 3I53A 1IJWC 2PN6A 1GHCA 2DJIA 4B47A 4NR1A 3A01B 4O4IA 1MJAA 1MKMA 2DA1A 3DTEA 4RM3A 4BE2A 1X59A 3RYIA 3ZN0A 5D8KB 1ODDA 3K4JA 4BIUA 2DOAA 2M1BA 1YJNV 1VF7A 2AZ2A 2QEXV 1HP8A 3F8MA 3K5LA 2KFDA 3TOAA 1SD7A 2P5KA 2IS1A 4F6EA 3JAWA 3OSGA 4JK1X 3VWBA 5JH7B 4DR2B 4CYCB 3ZMSA 2FRHA 1G4YB 1RM1C 2IGMA 4EQQA 1AKHB 1J9IA 3HDDA 2HG5C 2ZE6A 3JATB 4BR6A 5LP6B 2L7ZA 2HWVA 4G6DA 4G8XA 1LFPA 1ZGAA 3EFFK 3H9JA 4FASD 4DV2B 1R6KA 4XM3A 3D1NI 4TUYA 1Q86W 1MBGA 1VMGA 2BTQA 1B9MA 2QBYA 2P5VA 2Q9LA 5JI6A 3MDSA 2IAIA 2YIBA 1WZ2A 4IXAA 1BJAA 3R4KA 1PJRA 1J09A 3WU1B 4RAGA 1MZFA 2WLKA 2A6HF 2KZGA 3HKDB 2EJ7A 3DC5A 2Q0AA 2OZUA 3G3ZA 1WPBA 1QVGU 1RI7A 2OA4A 1BR2A 3L1PA 1MH4A 5FROA 3G67A 4FQGA 3AFHA 3SYPA 5D5VB 2OTLI 4RAZA 2ZXWB 1M93A 2CUJA 2D1HA 4QPQA 2OF7A 4IOAF 1AP5A 1N34B 5CA3A 5FLVA 2E36A 2HGCA 5B1OA 5DCMB 1NK2P 4PGHA 5ITZB 1YTFD 2EILH 1LEAA 2VOPA 2XF7A 4GO1A 4DV1B 1RKWA 3E0JB 4KL1A 1ZLKA 2FXAA 4FJCC 4RA2A 3OYJA 2DOFA 2ZCEA 4XN0A 2LH9A 1H88C 5B1NA 2ZM6O 2VQHA 3FK6A 3IGAC 1OJLA 1XCBA 4B3MO 2NNNA 1LR1A 3K5OA 3I71A 5DM7F 2FNAA 5M5YJ 1TWFJ 3TQNA 1NQTA 4TQDA 4JPRA 3BG9A 5E17F 3LDDA 2DJVA 1XNQO 2BY1A 2GIZA 3HKZN 2JVHA 2E7WA 5LHHA 3ZP5A 5BR8B 5B1BC 5KCMA 5DCFA 2K5CA 3K4BA 3AG3H 1BL0A 1S7AA 2JS3A 2E2JJ 2KP6A 1WN7A 3APQA 4NTXA 1KB9F 2RC4A 2XUBA 4Y33A 2J5OA 3G1OA 1FXHA 1KP3A 2F23A 3OR7C 2RDPA 2NOJB 3ZMTA 5B5EC 2Q6AA 4TV9B 2Q7EA 1YG2A 4OIQF 3KZYA 4NYKA 3ABMC 4E7SA 3UT5A 5IT9N 4JAVA 2DU9A 3BQZA 1SVMA 2O03A 2LYCA 2ZMEA 3VQWA 4JTCB 1I0HA 5DDGA 1EN4A 2E3CA 4PJLA 4FHTA 1H2SB 2YIDA 2BW3A 2EZLA 2OV7A 3F8CA 3H9GA 3FFQA 4DV7B 1IRZA 4II3A 1F1ZA 4I09A 3JRDA 2IRFG 4YHHO 1ZH5A 3TP3A 5GTIZ 4UXNA 3APOA 2XAFA 4W4KA 4IHJB 2CS3A 3BZKA 1XI1A 1HDDC 1NS1A 3VYSB 5C4JJ 1U2WA 3CF2A 3H3VK 3WG9A 4CSWA 3O3KA 4KJZA 4HX4A 1Z3XA 1IUYA 4UCTA 1COWG 1N36O 5LD2C 2EA4A 1MMAA 4E7HA 4L0ZB 3N2KB 2ZB9A 3EXAA 5LMNB 4C3JJ 2P67A 1SZXA 3EUHC 3FXKA 3CMAV 4OIOF 2ELJA 5BY1A 4IOCF 4ESJA 3HOUJ 3ZS8C 2ZQMA 1I94O 3H5AA 1YFHA 4PDLA 4TOIA 1I50J 4RUEA 1XDCA 2ELHA 2YEVB 3TETA 2GXGA 3QPLA 3NWTA 2E19A 3GMEA 1YDXA 1BI3A 4R6ZA 1TP4A 3W7UA 1N8RW 1JI8A 2ZNIA 3L09A 2LFRA 5GAGJ 2WSSG 3RGBA 3LA3A 1F7YA 3ABKC 4LB5A 1N78A 1R3JC 3COAC 3PIOF 4GFBA 1LUJB 3H1JH 3E5UA 3KPHA 5LGNA 3ZOBA 4IZZA 3ZR8X 2NVYJ 1VQ6V 1RPOA 4CXFA 4LIUA 3KP7A 2I10A 2ZBKA 3BA9A 2BYVE 1TWCJ 1GM8A 4I4TA 4O4LB 4CA0A 4UCOA 3QRFF 1XNRO 2CTRA 3HXLA 1YCIA 2JSCA 4BXXJ 3VFZA 1JMKC 1QBJA 3HEFA 5IPAA 5CN0A 1EH8A 2EA2A 3FKSG 3TXQA 5LYJA 4A3JJ 4JZGA 1HSTA 2Y0SA 2L3DA 5E3MA 2V7FA 5ICFA 1THZA 3TO6A 3QO7A 4RQFA 1KUQA 2F43G 1YIJI 2W48A 2UXCO 4FFBB 2BOLA 3QP5A 4MTXA 2KIFA 5IT3A 2Y9ZA 4WXCA 1V55B 1HSJA 1O57A 1FFXA 2XGCA 4J7ZA 1S72V 3ZQFA 1V5EA 1A35A 3QO8A 1R3IC 1BBYA 3BPXA 3S32A 4A2UA 3CCMI 2CV0A 4G7ZF 3KP3A 1ETOA 4NXMO 1FXKB 2MLGA 4HDVA 5CLSA 2UUCO 1W0JG 3M9AA 2MLKA 1J95A 2ADQB 1KC8W 3CUOA 3BT9A 4CZCA 2FQ4A 4X1IB 4CCJA 1SAUA 4JTAB 4IGGA 1KKCA 1Y0NA 3K79A 4MTDA 4LF5B 5JVTA 2DN0A 3KZIC 4I0BA 2CGNA 1VARA 4D6TH 1MMGA 3G2BA 3I55I 4NQWA 2DQ0A 1LPQA 2VKEA 5TJJA 5DN6G 1VQKV 4G2KA 5H6QA 1NTCA 1MSEC 1IVSA 1Y39A 3GCMA 4BEHB 5HLGA 4R1HA 3PN1A 2DCEA 4QGPA 1MD0A 5DUIA 1N33B 1EM1A 1LDJA 3M8EA 4NXNB 3K0GA 2XAUA 1O4XA 2FBHA 1O7FA 1L0NH 2UU9B 3L9FA 3AL0C 1XMOB 3BWGA 3V7RA 2DOSA 1M56C 5BMVA 1K7DA 1DP3A 5K1XA 5LA6B 1WNSA 1HCRA 2V1NA 2EK5A 4II2A 1JXSA 5GTHZ 2UUZA 3WU2Z 3G6EI 3F5TA 2PG4A 2XHKA 3K10A 3ASNH 1I5ZA
chains in the Genus database with same CATH topology
2WTEA 4JYCA 1R73A 3TCUA 5DEQA 4ZYHA 3TDUC 2LDUA 5J8FA 1S29A 4IHSA 4OOIA 2EFWA 3CCQV 3BPVA 4LD5A 2EZPA 2Z3YA 2QYOA 3Q9SA 4MQVA 4F4LA 4YG2F 5CMUA 5DD4A 3E6MA 1VQ7V 1QR9A 1B1BA 3PQKA 2PMHA 4PA7A 4QNHB 1D5VA 4P9OA 4HYEA 4A5MA 2ISYA 4RAIA 2P90A 5E8IA 1W5SA 2ZFWA 3CC2V 5F6FA 2X6CA 2P6TA 1YITV 1D3YA 2DT5A 4RGSA 1O3SA 3WODF 4E2LA 5CVJA 1SFXA 2KIMA 3FM3A 5K5RA 4F7ZA 4UVBA 1MABG 3K0DA 1FOKA 1DLBA 2DLLA 1ZRFA 1HKTA 4GX5A 3LQRA 3CLOA 2CQKA 3OFNG 3NXSA 3E5XA 4EMSA 1TNTA 1AI5A 2EV6A 1F51A 3LDCA 4RQEA 2JIZG 5CVUA 4LLNA 3BP8A 3K2ZA 3QU3A 1HWYA 1WPXA 1TW2A 3ROUA 2HLDG 4TWKA 4LBEC 3FXRA 2LSOA 3B8NA 2KJCA 5CBHA 4PZJA 4GCVA 3CUQC 1YS6A 3WU0A 3CDHA 4CO8A 2DAOA 2K86A 1QZZA 1K78A 1WWXA 1TQMA 3ECOA 1FYMA 2HQRA 2B5UA 1K6OA 5FLXK 2B1IA 1K9MW