3IC7A

Crystal structure of putative transcriptional regulator of gntr family from bacteroides thetaiotaomicron
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
IYLQIADRICDDILLGQYEEEGRIPSVREYASIVVNANTVMRSYEYLQSQEVIYNKRGIGFFVASGAKMLIHSLRKEQFLKEEVGSFFRQLYTLGISIKEIEKMYYEFIQRQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 26
structure length 113
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ic7A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ic7A02
3DXJF 1R7JA 3IC7A 3V4GA 2QYOA 4I01A 2KIMA 5E17F 5FFXA 3K2ZA 1LNWA 1BI0A 2A69F 4WXDA 2FF4A 4LFUA 4Z2YA 1MGTA 3RI4A 4HV5A 2RQPA 3ZP5A 1BIAA 4KIBA 4MQVA 2VODA 5EEHA 1O7LA 2RV8A 2GXBA 2FXAA 4ESJA 4M71A 4YFXF 4CO8A 4MGRA 1R22A 4BAYA 2QZ8A 3ERED 2LF7A 2P6SA 4OIPF 4RGSA 5LRSA 2MLGA 1XGMA 5TJJA 4OINF 3FXQA 4Q5SF 1U78A 2XUBA 3E6MA 1FP2A 4EJWA 3BWGA 5H6RA 4ZH4F 1ZG1A 2HKOA 4ESFA 1W5SA 2Z33A 2XAGA 4U0WA 2ZCWA 1V3FA 2QQ9A 3I0TA 1JGSA 4AIHA 3ZMVA 2AS5F 1T0FA 4LLLA 2LKPA 1ZN2A 4PGHA 3MZHA 3HSFA 2MD5A 3QAHA 4MQ9F 1FYKA 1YYVA 5KK1A 1MZBA 2D1HA 3CLOA 5A2QK 4CDGA 2ZFWA 1I1SA 1FOKA 1G3TA 5LGUA 2XAJA 4UNOA 5D5VB 4EGZA 1D8JA 4WXCA 1WRJA 1IN4A 2A6EF 4I0BA 2VOPA 4ON0A 3PQJA 5ILUA 3BROA 3RYRA 2EFWA 3ABTA 3ZMSA 3M7GA 4MEXF 4U0YA 5HDGA 1AWCA 1YW8A 4CZZA 2DPDA 2FNAA 2A61A 5GW7A 2NYXA 2BV6A 1XD7A 1U2WA 4R8HA 1SFXA 2RDPA 5E18F 5CVUA 4OMYA 1S6LA 2F5DA 2UXXA 1ZRCA 1YLFA 3GW2A 2PG4A 3DQVC 4HOBA 2V1XA 1SMYF 3D3IA 5LHIA 2MBFA 4CHUA 2CYYA 3JSPA 5LBQA 5E1WA 4EJOA 3O2PE 1CGPA 1PDNC 1KA8A 2JPCA 3ZMDA 4IPAA 2ETHA 4UHTA 5FLXZ 4Q4ZF 4HV6A 5JI6A 5LRRA 1W5TA 4CYDA 3Q9SA 2VE9A 5CLSA 1K78A 1Z05A 3T5XA 1TW3A 4HBLA 3EETA 5DYMA 4IRHA 3GLXA 3KLOA 2V6CA 1I27A 1V4RA 1P92A 3M8EA 3QRFF 3FMQA 4PGGA 5L3EA 1AOYA 3EYYA 3K0LA 3REOA 5LGNA 1IN5A 1XMAA 1K78B 3GWZA 4M9ZA 2STWA 2NS0A 1LQ1A 2ADUA 3I53A 5BOXA 4L9NA 1FWZA 2HQRA 3VODA 3M1EA 3B73A 2DW4A 1DPUA 2M1BA 4BYYA 2DU9A 1IZ1A 4B8XA 4FX4A 4UVCA 4O6JA 3JAMZ 1IXSB 1S3JA 2H09A 5E1XA 5JVTA 1J75A 1LDKB 1IXCA 3VB2A 4U88A 3BJ6A 3HOSA 5BS6A 2DT5A 2JTVA 5D4RA 3SFZA 2HOEA 2F5EA 3QPTA 2CO5A 2KIFA 3DF8A 5LEJA 1XSVA 5H20A 4BQAA 2YSRA 4KMUX 3IWZA 3GFMA 2VE8A 2QWWA 3F8FA 4HLXA 1K6OA 3SQNA 2ISZA 3HRMA 1P4AA 2HS5A 2STTA 3TO6A 4M9XA 3I59B 2HTSA 3GFJA 2MH2A 1B1BA 2XKPA 3DP7A 5E1ZB 2IT0A 2HKXA 2LSOA 2D45A 1R58A 2L3DA 2Q2EA 1T39A 5HLHA 4KIFA 5LLQA 4GO1A 1F9NA 4S04A 2K27A 1FSHA 3HUGA 5ED4A 1OYIA 1JHHA 4FHTA 4Y13A 2H94A 1MDMA 1OR7A 3Q5FA 4ZZLA 2PEXA 1LDDA 1ZLJA 1G3YA 4L9JA 4H0EA 4OIRF 2OQGA 4IRGA 4R1HA 2OAZA 2BEOA 2FSWA 2P4WA 2QVOA 3ZMTA 2VBYA 3D0SA 5HOOA 4KT5C 3CDHA 2OA4A 1A04A 3I71A 5D6FA 5ICEA 1MDMB 3WTXC 2A6HF 3NQOA 5FO5A 4BHPA 2BGCA 1U5TB 5HDNA 4LD5A 4M6XA 4AIJA 4HF0A 2JZYA 1S8NA 2PI0A 1QPMA 2P7CB 1FNNA 2GXGA 3F6VA 1ULYA 2JT1A 2CGPA 2XAHA 4HQEA 4M72A 1HKQA 3M9AA 1C0WA 2GZWA 5D8LB 4D0PA 2M87A 3BPVA 2HEOA 4R79A 3I5UA 2ZNZA 5HLGA 1BOAA 5FFZA 4GYIA 1ZHFA 2H6BA 2W57A 1ODDA 1Z7UA 3LA3A 3ULQB 2DBBA 2XASA 1B6AA 1W7PB 3H3UA 1YTYA 3B02A 1IRGA 4Y17A 2QBYA 5DUIA 2ELHA 2CQKA 1I6XA 3FZVA 4G94A 3F6OA 1IAWA 3T8TA 5D5UB 4YIFA 3K1NA 2M45A 1JXSA 1ZRFA 5LHHA 3HHGA 2PN6A 4RGRA 5ICGA 4HW0A 3MCZA 1HQCA 1X3UA 5CVRA 4U7BA 1RZ4A 3EDPA 1FBQA 3QP5A 5K5QA 1RI7A 3HRUA 2O61A 2FBKA 2IRFG 4GCVA 1TLHB 3RPUA 4G9YA 4XSXF 4Q47A 5J8FA 2MA3A 3I4PA 2W24A 3H3ZA 5FD6A 2IA2A 2CG4A 4LLNA 1TW2A 4XBFA 4RB2C 1LJ9A 4O3MA 1LVAA 3HSEA 1OPCA 2ACJA 3F23A 4EJTA 4MEYF 2FOKA 1FBSA 1XCBA 1W4MA 1J5YA 1R36A 2NNNA 4XSZF 3GYHX 2MC3A 1DUXC 4LJZF 3H92A 2GWRA 4FX0A 3FXUA 1R1TA 2ZJ2A 2QENA 1OKRA 4KDPA 3WU1B 2DLLA 5DD4A 1BM9A 2PMUA 1BN5A 4RAYA 4U0VA 1J9IA 5JHUA 5LGTA 1EH6A 2KRFA 2ZBKA 5BPIA 1D5VA 3FHZA 1CF7A 2NAZA 4L5IA 1K79A 5KVRA 4KMFA 3E6CC 5CVIA 2VN2A 4EGYA 3JTHA 1MJAA 1TNTA 2GA2A 5DV5A 4YFNF 1H9GA 1KU7A 1QQIA 1EH7A 2IA0A 1CF7B 3RTRA 3VFZA 4EM1A 2LDUA 4A0XA 2FMLA 4A6DA 3KP2A 2QM3A 3PFIA 3EUHA 3CO6C 2VBXA 1HXDA 3FM5A 2XHKA 3RDIA 1LEAA 2IJLA 2XROA 3QPHA 2A68F 4A0ZA 3T8RA 4LGWA 5J8CA 2G9WA 3V7RA 3RYPA 2P7VB 3LAJA 2E7WA 1ZARA 3BJOA 3WODF 1XDSA 1R5HA 3WTTC 3P9KA 3RJPA 2Y48A 2OZ6A 3MQ0A 2VXZA 3DKWA 4KIGA 3M8FA 4IJAA 2Z9OA 3ZN1A 3F8MA 3FMSA 1R5GA 1Y0UA 3TDUC 1VTNC 4A6EA 1IF1A 4KUMA 1UHWA 1T38A 3V8KA 3L2CA 3K9TA 3Q9VA 2RGVA 3N4MA 3W7SA 3V8LA 1KQ9A 3E35A 4JK1X 4HF2A 5AIQA 1D8KA 3QP6A 2PMHA 2WTEA 2FU4A 5HS7A 5D5WB 3T0YA 4HAMA 2ESNA 2V9VA 3DPLC 3GUDA 1IW7F 1ONVA 5IT9Z 1Z6RA 4HDUA 1F1ZA 3CUQC 4UUVA 1KGSA 2EK5A 1J59A 4ENNA 4QWQA 1G4DA 1F4KA 2L4MA 1B9MA 4WF2A 3ZQ7A 3KZZA 3KE2A 1U3EM 3KP3A 3LQRA 1I5ZA 1FC3A 1TQIA 4WK8F 2X4HA 1HW1A 3HRTA 3E5QA 3JAMK 1LEBA 2VONA 1TQMA 3NRVA 3BOQA 3HHHA 3KCCA 1YQAA 5AIPA 2HYFA 5JFRA 2L54A 3I58A 4P55A 4A12A 4BH9A 4IHTA 1H0MA 1XSDA 1Z6TA 1P4XA 3GZ6A 4N9IA 4CICA 1MJBA 1BIBA 2IA1A 3F8BA 2DPUA 2XVCA 2GA1A 5CVJA 5D4SA 1I1GA 1O57A 5L3DA 4FT8A 1USTA 2VC1A 2G7HA 3T1BA 2TDXA 4HA8A 3FWEA 5ICCA 4L9TA 4N9HA 5FB2A 2E1CA 4ZZDA 2KJCA 1NH2B 2H27A 4P5OA 3W7UA 1PP7U 2OZUA 1DPRA 4KNYA 1QZYA 1HKTA 1YIOA 3NEUA 5DD8A 2OBPA 1U6GA 3BPXA 3F3XA 3HIFA 3HSRA 2BYVE 2FBHA 3E97A 1BBYA 4IF4A 3V8JA 2EA4A 5HDKA 4LK0F 3KP4A 3CO7C 2QLZA 2O6GE 3I59A 2NRAC 4CXFA 4NHJA 3IL2A 3MFKA 2CWEA 4B09A 2GQQA 1DP7P 1IN7A 2XAQA 3TKYA 3R60A 2XRNA 3J80Z 4EJVA 3KLNA 1GVJA 2HYGD 5DCMB 2W25A 3FM3A 3ZN0A 4RAZA 4M6YA 4G7OF 4ZYDA 1SAXA 1HW2A 1BI1A 4HDVA 1Q1HA 1D3YA 1ZGJA 5DCFA 4OOIA 3WGIA 2O03A 1B4AA 2FEZA 4HX7A 3RPQA 2B0LA 5ICFA 1SFUA 5BMZA 3FXRA 2L02A 4I02A 2PLYA 2FMYA 1R00A 4L0YB 4LLGF 2JSCA 1YO5C 2XV4S 5FGMA 4LK1F 3CUOA 2EV5A 3C18A 3RKXA 1J7KA 1ZLKA 1YW7A 2E1NA 1USSA 2J5PA 3I64A 1U5TA 3AAFA 1YS6A 3V7CA 2RKHA 2VBWA 3FF5A 2DK5A 4KN4X 1S7AA 4K2EA 1QO0D 2DQLA 1NVPB 2XKOA 1E2XA 3EYIA 4G6DA 2HQNA 2WWYA 3MZYA 4ENJA 3TOBA 1FP1D 3KP5A 5HS8A 1KU3A 2R7FA 1FT9A 1S29A 1YW9A 2PBIA 1IUYA 4LMYA 1ZREA 3J7AO 3ZMZA 4HX8A 4MTEA 4GXOA 5JR3A 4WWCA 1W7PA 2DTRA 2RC4A 3KP7A 4BXUA 5E8GA 1REPC 5CA3A 3IRRA 5H6QA 4EV0A 2ZMEA 2DI3A 4RB0A 3WU0A 4OU0A 2CSOA 4AD9A 4I7HA 4OMZA 1RM1C 3O6BB 4A2UA 1BC8C 1UHMA 2K02A 5DEQA 3BZ6A 3ABUA 3QU3A 1T6SA 2M8EA 1ZGAA 2XIGA 3D5LA 2P8TA 1R1VA 2DFIA 2ZMEB 4HYEA 1MKMA 3LA2A 4F7ZA 1UFMA 2FE3A 3LSTA 1NHAA 2O8XA 3E5XA 3IKVA 1IRFA 1EV7A 1GXQA 3GXOA 2FA5A 3W7TA 3R61A 4AVPA 2EFNA 5ERIA 3P7NA 4LG0A 1ON1A 3C1DA 4WX9A 4EM2A 5L3BA 2FBIA 4IHSA 4E70A 1K7AA 1FSEA 3DEUA 2EWNA 3J81Z 2VT2A 3QU6A 3WTVC 2A3SA 1R1UA 1OYWA 5D5XB 3RIRA 2D1VA 4LG0B 3KP6A 3OOPA 3KEQA 1H9TA 4LB6B 1XN7A 3HTUA 4WXHA 2P5VA 2Q8KA 2W84A 1HSJA 2HR3A 5D8KB 4UVAA 4EMSA 5K5OA 2HZTA 3GEZA 3IKTA 3S2WA 5DDGA 4M74A 2RNJA 4ENMA 3TO9A 3KFWX 1FY7A 3WGGA 5LHGA 2ZKZA 2V1UA 2K86A 1SD7A 1ZH5A 4IXAA 4PCQA 1T98A 1DDNA 3TDZC 1B9NA 4DQ2A 2YX4A 4IVNA 3TGNA 4TV7A 3DPTA 4I2OA 2D2WA 1XMKA 5ILSA 3HOTA 1BI2A 2M5WA 3F72A 1YS7A 1RNLA 4QLCU 3CJNA 1TNSA 4AIKA 3ML6A 3R0JA 2CW0F 2EJRA 5LEKA 2KKOA 3R6SA 1WKMA 4L18B 1B59A 4G6QA 3C7JA 2EFOA 4RGUA 2YR2A 4ETSA 1KQ0A 2VC0A 2Y0MA 4L0ZB 2C6YA 5CJ9A 1O3TA 1SD4A 2DAOA 2PJPA 2BE5F 3IHUA 2NNYA 1S7OA 4PDKA 2GAUA 4MHGA 3W6JB 4RGXA 4GGGA 4A5MA 3K69A 3COAC 5F1RA 1G3WA 1YTFB 3IRQA 2K4BA 3JW4A 3WE2A 1HKSA 4I98B 3BJAA 3R4KA 3TOAA 5L3CA 4Q48A 1JHFA 4IRIA 4JBAA 3GZ5A 2IW5A 1ZRDA 3HYIA 5L3FA 3DFGA 4PZJA 2EA2A 2JPBA 1UB9A 2X0LA 2UWMA 3R0AA 2M30A 2JRTA 4DNCA 1IN6A 5IT9K 1TQPA 4P9FA 5EEGA 2EFPA 5F64A 4KYWA 1Z9CA 2IPQX 5E8IA 2DK8A 2FNPA 1FYMA 5HVQC 4KFCA 2G7UA 1T2KA 4NB5A 1YFHA 4I09A 3OV8A 3F8NA 4KA4A 5FLXK 2V1DA 4RS8A 1E17A 2R3SA 3WE3A 2KIUA 3GO5A 4HZFA 3G3ZA 4OIQF 3GF2A 3E6DA 3BDDA 2ESHA 3WTZA 3KETA 2UZKA 1BI3A 4G7ZF 1OYYA 1U8RA 4OIOF 1UCRA 1KQ8A 2CFXA 3E3VA 1RIOH 1XGSA 3ZMUA 5A2QZ 2RN7A 4KICA 3L09A 5TRDA 3JTGA 3VOEA 2E7XA 3IWFA 2HWVA 3CTAA 2R7DA 3C3WA 1XCVA 1QBJA 3FX3A 4EM0B 1OMIA 1KU2A 4XLPF 3FMRA 5HS9A 1WI9A 2A5YB 3E5UA 4ASNA 2DQRA 4A5NA 2UXNA 1XGOA 2W85A 1O7FA 4YIIA 1RUNA 4EQQA 2FQ3A 3W7XA 1ZAOA 5BQTA 1P6RA 1R23A 3U2RA 1LDJA 2OU2A 3GFLA 3ISPA 2KJBA 4O5VA 2PFBA 3WTUC 1PP8F 2ZNYA 4P9UA 3L00A 4N0BA 5AONA 2Z3YA 3SZTA 3LWFA 2YX7A 3LA7A 4BHBA 1U5TC 2P6TA 1XGNA 2P5KA 3VEPA 1SD6A 3QOPA 4S05A 1HSTA 2LF8A 4YG2F 1FPQA 3SZPA 5E20A 1O3RA 3HRSA 1EH8A 1STZA 4XRFA 2OD5A 1WWXA 1W7PD 3ECOA 2VT3A 1BC7C 3J80K 2MLKA 5FD5A 5IT3A 3W6KB 1IN8A 4ZYEA 3G73A 2O0YA 1GXPA 3KEOA 2QQBA 1SD5A 3F22A 3LAPA 1BJAA 3L9FA 4L5JA 1YG2A 2VBZA 3WGHA 5DCMA 3K1PA 2ISYA 2YPRA 3I54A 5BPDA 5K1YA 1QZZA 2F2EA 2P90A 2WAMA 2O3FA 2RVCA 2PQ8A 4YFKF 1XSXA 2QQAA 3ROUA 1F5TA 3KZYA 1XDUA 3W7WA 3GVAA 4HF1A 4ZYHA 2HDCA 3DV8A 3CUQA 1QGPA 1LB2A 2DO7A 4UV8A 2ZXJA 3MWMA 4UVBA 1ZG5A 1PUEE 3LFKA 5HLIA 2IVMA 3N97A 2A07F 1FYLA 4ENKA 1KU9A 3F8CA 4Y15A 1P4WA 4HX4A 3CUQB 4I0AA 1ZG3A 4RB1A 2HGCA 1FX7A 2FRHA 4G8XA 4CGZA 1RUOA 3BY6A 2QUFA 4NQWA 2EV0A 1SFEA 3E6BA 1J0RA 2F5CA 4JQFA 5ILVA 1HBXG 4KN7X 3WTYC 1SMTA 4BNCA 2HFHA 2COMA 3F21A 4UXNA 3RKYA 2YU3A 2MH9A 4P96A 3TQNA 3U9GA 2GIVA 1KYWA 1WSUA 1FLIA 3P9IA 3BP8A 5J6XA 3P9CA 3HTSB 1J2XA 3MAJA 2EFQA 4RB3C 2BBYA 2L01A 3ELKA 2H6CA 2K4JA 1Z91A 4GYGA 2K7LA 2OQRA 3WTWC 4L9VA 4WCGA 3ECHA 1ZYRF 3EQLF 4U7DA 3PQKA 6PAXA 1O3SA 4HLYA 3WTSC 2EB7A 3J81K 5F6FA 1FBUA 5CYVA 1L0OC 3SHFA 3ZPLA 3LQQA 5CVVA 3SXYA 4HQMA 3TO7A 1G6NA 2Q0OA 1JE8A 2LNBA 3WG9A 2VOOA 3MEXA 4EJUA 4MTDA 3GFIA 2XAFA 2L4AA 1MD0A 2IP2A 2WV0A 4AWXB 1XB4A 4EVIA 1Z1DA 2J5OA 2V79A 4M9SA 2EV6A 2Y75A 4XLNF 4M73A 2XGXA 4BHCA 4ESBA 1O3QA 3O3KA 2P5LC 4MNUA 1IXRC 1KYZA 3L7WA 2WC2A 3V7SA 2QBYB 4LB5A 1G3SA 1TTYA 1WQ2A 4UV9A 3K1MA 1MJ9A 3GX4X 1FZPB 4G7HF 2Z99A 5K5RA 2ZO4A 5L3GA 5D6EA 4A0YA 2AXLA 1HW5A 3JSOA 3U1DA 1TBXA 1L3LA 1P2FA 3RKWA 1GHCA 2Z5UA 1ON2A 1QNTA 5DUKA 2F5FA 2HTJA 4ZYGA
chains in the Genus database with same CATH superfamily
3HOYJ 4H44B 2VJIA 2A0LA 3DXJF 2R7XA 1R7JA 3IC7A 1NQTA 5KAIC 1XTAA 4ZYAA 2QYOA 3V4GA 4I9WA 2XGCA 2ME6A 3PNYA 5JJNB 2ZJPF 4I01A 4R8CA 2BTQA 2KIMA 3BTIA 2CUZA 5E17F 1OCCB 4B3SB 2FQ4A 5FFXA 3K2ZA 1DLBA 1K34A 1LNWA 1BI0A 2A69F 4L5EA 2V1NA 4L8JA 3CJHB 5EJCA 1PVEA 1R6TA 2Q73A 4WXDA 2FF4A 2NS8A 4LFUA 2QM8A 3RYIB 1DGSA 4QE9A 1TA8A 3U10A 3QO7A 4LNUA 4Z2YA 1MGTA 4DR6O 3RI4A 4PA7A 2HOAA 3S93A 4I0XB 4HV5A 4FLYA 2RQPA 3B77A 1HR0B 3ZP5A 3C3SA 3CRRA 1BIAA 4KIBA 1VQKI 1IDSA 4UCSA 4MQVA 4XMYA 4FPPA 4A69C 1NTKH 2VODA 5LMUB 3ZQHA 1MG1A 5EYRA 5EEHA 4U87A 1D2DA 3HKZN 3QOEA 3CCJI 5EDNA 1VQMV 1O7LA 2RV8A 1R6KA 2EIMH 4IL6Z 4XDLA 4NTYA 1HNZO 4XL9A 3DKXA 1D5YA 2BTQB 2A6TA 2GXBA 3RGBA 3CCLV 1WP8A 2FXAA 4ESJA 2YS8A 2DCEA 1JTYA 4M71A 4TWKA 1JJOA 4BE2A 4YFXF 1D0ZA 2LK2A 4CO8A 1I5XA 4MGRA 3S16J 2HYJA 1R22A 3APOA 4TV8B 4W4KA 4JX5A 4LNUB 4BAYA 3OMAB 1AJNA 2VWJA 5H2FC 1TWGJ 1GLNA 2JJ7A 3IH3A 2QZ8A 1U96A 3TW7A 3CCQV 1KONA 1IURA 2L9SA 2LF7A 3ERED 1TZLA 1XNQO 2ZR2A 5BR8O 3UO2A 1XHZA 2P6SA 4OIPF 1FFTB 4HPQA 4RGSA 2ILMA 4J42A 3AG2C 5LRSA 2MLGA 3S15J 1FEXA 4PUSA 2GDSA 4TQFA 1XGMA 5FKNA 1JJ6C 3CEIA 5TJJA 3DEEA 4UCUA 3A0RA 5IJ9A 3MVPA 2DYRH 3ZGKA 4OINF 3FXQA 3OMIB 4Q5SF 2BHZA 1U78A 1GH6A 2XUBA 2O5RA 5JCOC 3E6MA 1PV0A 1MA1A 3J81N 2UXCO 1FP2A 4EJWA 4YIOA 4BJTA 2VKDA 3BWGA 1SRYA 1RM1B 5H6RA 4ZH4F 4DW1A 4LF6B 5J1UA 2LY2A 5BXZA 5KUMA 1ZG1A 2R72A 2HNHA 5CA0A 4R50A 2HKOA 4CC5A 2D3OW 2QEXV 4ESFA 3S1RJ 2JK3A 2KISA 4P9OA 2B7EA 2DJIA 2WLHA 1VQ6V 2JQ7A 1W5SA 2CQXA 2Z33A 2XAGA 4U0WA 1VI0A 2ZCWA 3F0CA 2JEXA 2W6JG 3G1OA 1V3FA 4RQFA 2UV1A 4FM1A 4C7UA 3HPHA 1MABG 2E5NA 1V54B 1D5AA 4DUYB 1YJNV 3CF2A 2XUMA 1Y39A 2EILH 3X2QC 2DFEA 2QQ9A 3AG1B 3ZQGA 3I0TA 4Q20A 5M5YJ 4IL6C 3KKYA 4LF5O 3B6CA 3RZOJ 1K97A 2Q8VA 2YI8A 2LP7A 4X1YA 1JGSA 4P2ZA 3IP4B 4AIHA 4WF9V 1WVRA 3OOUA 3ZMVA 1R3IC 2AS5F 2BE3A 1T0FA 2ELJA 4X6AJ 1BJZA 4LLLA 1Z0XA 2M0MA 1B8IA 1SFKA 4JI7O 3ONQA 2LKPA 3ZR8X 5AG2A 1ZN2A 4MSWC 4PGHA 1IBMO 2A5WA 3MZHA 3HSFA 1RPWA 4XQFA 5C4JJ 2MD5A 3BR6A 3QAHA 4MQ9F 1XMXA 1FYKA 1YYVA 2H8RA 5KK1A 2R7ZJ 4XN0A 3CRMA 1MZBA 2D1HA 3CLOA 4O4IA 2YICA 1VARA 4X66B 5KMGA 5A2QK 3GLLA 4CDGA 2Z2SB 2ZFWA 1I1SA 1FOKA 1G3TA 1Y67A 3DTIA 1VF5B 5LGUA 1G2HA 3I55I 3OR7C 5IP6A 2XAJA 4UNOA 1BW6A 2EIJC 3VDXA 2XHBA 5D5VB 4V2FA 4EGZA 2KT0A 2IAIA 1D8JA 1AI4A 1B04A 4TT3G 3K58A 3M8JA 5JVGF 1N77A 3F5TA 5ITZB 3MAQA 4WXCA 5C8YA 4NXNB 2YS9A 1UG0A 1WRJA 3ZQCA 1B8IB 2DN9A 1IN4A 2A6EF 4I0BA 4DV6O 2VOPA 1VQPI 1EF4A 4FASD 3U1KA 3VWBA 1H8HG 3CMAV 2MYSA 4ON0A 3PQJA 2WLJA 4HBNA 4ZDPA 1OCZC 5ILUA 3BROA 4XKCA 1QVUA 3UQ8A 1U9NA 3RYRA 2EFWA 2Z0AA 1RPRA 3ABMB 2R9RB 4E7HA 1I3AA 3ABTA 3CPWU 4O2AB 4UUTA 3ZMSA 4XICA 3C2BA 1TAEA 2XB5A 3M7GA 3ETQA 4MEXF 1I3QJ 4U0YA 5KMGB 1MNGA 1ETYA 1JI8A 5HDGA 2ZCEA 4QJFB 1AWCA 1YW8A 4CZZA 3EPZA 3P30A 4NUBA 4I4TB 3E8GA 2AHZA 3M7MX 1IG7A 3AK3A 4CH5A 1FJGB 4UCOA 2DPDA 1BQ0A 1GUUA 2NVTJ 2FNAA 4K8ZA 4M3FA 4IX7A 5DECA 2A61A 1WA8B 2GLOA 5C8YB 2IGOA 4HNUA 3FB8C 5GW7A 1NU1H 2NYXA 1OLTA 2F4OB 4OWRB 1RESA 2BV6A 4MW8A 3AG3B 4XLFA 2P67A 4V19K 2IH3C 4NKGB 4N23A 1XD7A 1E3HA 3C2HA 2E75B 1U2WA 4Q6GA 1M56C 4F6RB 4R8HA 1SFXA 2RDPA 2ZFUA 5E18F 4TUYA 2L7ZA 3ETEA 4WFAV 4XOPA 5CVUA 2L9NA 4OMYA 5A9GA 1S6LA 2F5DA 5LMNB 2WY7Q 4DR4B 2H8WA 2X6YA 2UXXA 4CYCA 3DWLE 1ZRCA 1YLFA 3GW2A 2PG4A 3H9GA 4J9YB 4AQYB 2P06A 1VQOV 3DQVC 1APLC 1J5EB 1DU0A 4FCYA 4HOBA 2LMDA 4LF7B 3CCEI 2LH9A 3T1YB 2V1XA 3K5OA 1SMYF 1ZLZA 1VQKV 3D3IA 5GTHZ 5JHFA 5LHIA 2MBFA 2R7TA 2IH1C 3SGIA 4CHUA 3A03A 4YJ3A 2CYYA 2VWKA 1R73A 1U9OA 4U3FH 4JI8B 3CSXA 2DOSA 3JSPA 1QLEB 4H33A 1RRJA 4MTXA 3SYOA 1V55H 1Z5VA 5LBQA 4YIPA 2P4KA 5E1WA 4EJOA 3B40A 1N8RW 3OR6C 3A0BZ 3CLQA 3O2PE 1CGPA 1PDNC 1KA8A 3MKLA 1Y4MA 2ZXIA 3ICXA 4TUYB 2JPCA 3ZMDA 4IPAA 1VEWA 2ETHA 4GRIA 1JUMA 4QPQA 4LFAB 3GBGA 4UHTA 5FLXZ 4Q4ZF 2CDYA 4HV6A 4JYYA 2A3QA 2UXBO 5JI6A 1X1PA 3FXOA 5LRRA 4D7MA 1W5TA 4CYCB 4CYDA 3K7AJ 3Q9SA 2VE9A 2HJFC 5CLSA 4HNTA 1K78A 5B1AB 1Z05A 2YXLA 4DV4B 3CCYA 3T5XA 5HLTA 1TW3A 3D8CA 4HBLA 1ROPA 3EETA 4J41A 4IEJA 5DYMA 2VPLA 4QPKA 2HG5C 4C3JJ 4IRHA 2ADPA 1MMNA 1H2GA 1G8MA 1BR2A 3GLXA 3KLOA 4N4NB 3AKZA 3H0GJ 2LO1A 4X20A 1P7IA 5E3MA 3ABKC 2AHYA 3Q4HB 4DV5O 2V6CA 2LP0A 1I27A 1V4RA 4ABZA 1P92A 4F52A 4ZJZA 3M8EA 3QRFF 3BPZA 3FMQA 1G59A 4B3SO 3L2UA 1M93A 4PGGA 3RYCA 2BVMA 1U8BA 2VQEO 5L3EA 2LD5A 1AOYA 1VQ5I 2JJ2G 3EYYA 3K0LA 2HVKC 3HPGA 4A93J 2D2CB 2HI3A 3D36C 3REOA 5LGNA 1IN5A 3MKYB 3KYLA 1XMAA 2V7FA 2GV9A 1LFPA 3GWZA 1K78B 1THZA 1OCCH 3LSHA 4M9ZA 1IV8A 1SQQH 2YDEA 2B1IA 4LH6A 4AIDA 2STWA 4ZI7A 3VQXA 2NS0A 1LQ1A 3LSMA 1BHAA 2O8KA 2ADUA 1CPYA 3I53A 5BOXA 4L9NA 3FKSG 3TP3A 5GTHC 4OXSA 1FWZA 2HQRA 3HEFA 1GN4A 4LF4B 3VODA 3M1EA 1IBKO 1GT0C 3B73A 2DW4A 2AO9A 3OT7A 2Q7HA 1DPUA 5IPAA 1XL6A 2M1BA 4BYYA 2DU9A 4B3MO 4OX9B 4GZRB 3A0BC 1OCOC 1N78A 3CCSI 5BMVA 1IZ1A 4C2MJ 1QR9A 4B43A 4NTXA 4B8XA 4W4LA 3RYCB 4XDKA 4FX4A 4UVCA 4O6JA 3BTCA 3JAMZ 5DM7F 3MN2A 4G12A 2JA7J 1UHSA 1VF6A 1IXSB 4BJ5C 2OCCC 3PUFA 1GK9A 3B8MA 1S3JA 2H09A 3J7ZI 4A3KJ 3JD4A 5E1XA 2ZIMA 3O9OA 2X1CA 5JVTA 4LF9B 4IIJA 1J75A 3M99B 5B3SB 1LDKB 1IXCA 1Q8IA 3VB2A 3JRBA 1IRXA 2DMTA 4U88A 2QTOA 2ZSHB 2OTJI 4X0GA 3PL8A 4MO7A 3BJ6A 3CC2I 3HOSA 1EN4A 2ZMEC 2Y69B 3CJRB 1DP3A 1AROP 5KHJA 2EZHA 1AVMA 3ABLC 1YX3A 5BS6A 3CESA 1IXMA 2DT5A 2NOGA 1N32B 1ZKGA 1K7DA 2EBOA 2JTVA 5D4RA 1SZTA 3SFZA 2IS4A 2P81A 4RO2A 4A3LJ 1H8EG 2GM4A 5BMVB 1GRJA 2K40A 2HOEA 2F5EA 3QPTA 4WBNB 1VQPV 2CO5A 1NKDA 2KIFA 2CUGA 3DF8A 5LEJA 4MT8A 4AVZA 2OC6A 2HQ5A 1XSVA 5H20A 3G71I 1ZL8A 5J2UA 4BQAA 2YSRA 1Y74A 4Z1MG 1RSOA 1H2KA 3G2BA 4JASA 3ASNC 4EFEA 1H2MA 4PFPA 4KMUX 4I50A 2UUAO 3IWZA 3H5NA 3GFMA 2KB1A 2VE8A 3E83A 2R92J 2QWWA 1MBFA 3F8FA 3LOCA 4HLXA 1DU6A 2H3OA 2ICWG 1K6OA 3SQNA 4DGWB 1VQNI 3H01A 2ISZA 4Y52J 3HRMA 2BY3A 2FB5A 2EINC 2HP8A 3SPCA 1QHHD 2M4KA 1O4XA 4KXRA 1WJAA 1P4AA 1NR1A 3RWRD 2HS5A 2STTA 3GTPJ 2OIEA 3S17J 2A05A 3STLC 3LSRA 3TO6A 2FD5A 2G38A 4K35A 2UXDO 1XX5A 2HPMA 4H0LB 5EC1C 5JWPA 1JTXA 1PL0A 4M9XA 4TQDA 2R70A 3ZQLA 3I59B 4F55A 2HTSA 3AG1H 3GFJA 3JRHA 2CQQA 2MH2A 4M3EA 1B1BA 2WAQN 4Y4RA 2QSAA 5J2UB 2XKPA 1Y74B 3G80A 2DA4A 3DP7A 4IHXA 5E1ZB 1MBJA 1VQOI 2ZT9B 1AP5A 1BW5A 2X1EA 2IT0A 2TRTA 4I50B 2XC7A 4XORA 2HKXA 2IGNA 5H9CA 2LSOA 2D45A 1K3EA 4ZOLA 4M3GA 3CC4I 2EIMB 3ZBHA 1T95A 1G4YB 1R58A 3FXMA 2L3DA 4LP8A 2Q2EA 5KCMA 1HCRA 1K5QA 1T39A 5HLHA 4ZBMA 1F23A 1XS9A 4KIFA 5LLQA 1L0NH 1GKFA 2DFHA 3CCRV 1E0EA 4GO1A 2GUZB 3CCEV 1WB8A 1W36D 2L9RA 5KHIA 1F9NA 3TCUA 4S04A 3OUSA 5CQEA 4NC6A 4RDUA 4BUPA 1RFYA 2K27A 4FZ1A 3K4JA 4H37A 3CXCU 1FSHA 5H5NA 1N75A 2QSFX 1MBHA 2XGDA 3HUGA 5IOYA 5ED4A 4RUFA 1OYIA 1Y8QB 1JHHA 1Y1WJ 4FHTA 3TJTA 2P7TC 2DA1A 4Y13A 4MVSA 5C4XJ 2H94A 2KPMA 1MDMA 3HKEB 1OR7A 1RR8C 4I6ZA 1MBEA 3MKWB 3BG7A 4FFBB 3Q5FA 4ZZLA 2PEXA 1IGNA 1LDDA 1OCRC 4D9JA 3F5WC 4UFZA 1ETOA 1ZLJA 1G3YA 1ZQ3P 2Q6AA 4L9JA 3JRAA 4H0EA 3CRCA 4GT1A 4OIRF 2OQGA 3C3TA 4IRGA 4R1HA 4WBNA 2OAZA 4Y33A 4AUXA 2BEOA 2FSWA 2P4WA 1MZFA 2QVOA 1Q6HA 4IT5A 3ZMTA 1K5SA 4MVQA 2HFEC 3CCVV 2BHYA 2VBYA 3D0SA 2HXIA 3ABMH 2P22C 4F6EA 4DV7O 2KRCA 1W36C 3H5RA 5HOOA 1R3LC 2F23A 1XI1A 2VPRA 2Y0PA 3MMYB 1JKQC 1UPGA 3BAAA 3LSSA 4KT5C 3CDHA 2H8PC 4X65O 2YEVA 4HRIA 2EH3A 2OA4A 3JD0A 4JOMA 4KL1A 4UY8I 3SYCA 2K9NA 1P4RA 2LY1A 1A04A 3I71A 5D6FA 1VQLV 5ICEA 1MDMB 3WTXC 2A6HF 2GHYA 1ETQA 4DR5B 3NQOA 2E19A 4RMNA 2B9ZA 5FO5A 4LWSA 3RYHA 4NXMB 2IJKA 1LKXA 4ZHQA 4RAIA 4BXFA 2PZSA 3HDDA 3NR7A 4BHPA 3HOVJ 4LBEC 2BGCA 1U5TB 3AG3H 4BGDA 4YIRX 3JSNA 2CS3A 4DOZA 5HDNA 1IJWC 1ZX3A 1MIJA 4LD5A 2DWDC 2JEUA 2QGUA 1I08A 4NVPA 4M6XA 3GTJJ 3SDLA 4AIJA 4HF0A 4B7EA 2R7OA 2JZYA 1S8NA 1M4UA 4GKKO 3IAS2 2PI0A 3N2KA 3B09A 3T4DA 1QPMA 2P7CB 3OTOB 3JRIA 1VQMI 2JVGA 1FNNA 4DV3O 2YEVB 2GXGA 3F6VA 5F0CA 1ZGWA 3WB1A 4E4EA 1XOUA 2VKVA 2QTSA 1ULYA 2JT1A 4A5UB 2WAQA 2CGPA 2ZNJA 2XAHA 1YI2I 2JRIA 4HQEA 3CCSV 4M72A 1A6QA 1HKQA 5HNHA 4JI1B 3BLYA 4RBOA 3ZEDA 4LWSB 3RYHB 5EYPB 4ITVA 4C2UA 3M9AA 2WADA 1RKWA 2GZWA 5D8LB 1C0WA 2IBDA 1YOVB 4HEA2 2M87A 3BPVA 4D0PA 4I7ZB 2Q7GA 5LP6C 5JVDA 2HEOA 3CCQI 5E1AC 4R79A 1AB3A 3E2EA 3JAKA 5J40A 3I5UA 3DKYA 4J80A 2MG4A 2UU9O 1S0VA 2ZNZA 5HLGA 1BOAA 5FFZA 2RCVA 4L87A 1UJ8A 4QGPA 5KHGA 4DV4O 1SC5B 3N2KB 2QWNB 3L2WA 4GYIA 4X1KA 1ZHFA 2H6BA 4ASUG 1UG2A 3JD3A 5EIBD 3J7AY 3DSQA 3JSLA 3MKZA 1WP7A 1K4SA 2CE4A 4JI0O 2W57A 3FD9A 2ZM6O 1ODDA 3OYAA 3BQZA 1Z7UA 2F1MA 2MD0A 3LA3A 3ULQB 2Q7EA 2DBBA 3GCMA 2CH0A 4BJ6C 1BGYH 2XT9A 1R1BA 2JA2A 2XASA 4B08A 4XLCA 2DWEC 3BA8A 1B6AA 3OD4A 4X64O 4PI2A 3BA9A 1W7PB 4ZKIA 1NJIW 4LC1A 2X85A 3H3UA 2GXAA 4I5SA 2W0XA 3WG7B 1WH5A 4ZDLA 4YHHB 4DR1B 1N36O 4DRXA 3KYCB 5FNVA 3JAKB 1YTYA 5EBWC 3B02A 2GOMA 1IRGA 1IX9A 1XC5A 1PNKA 3HJEA 2R9IA 4Y17A 5EEAA 4FLUA 4ZTFA 3U21A 4DIQA 2Y9ZA 2QBYA 5DUIA 4DR3O 2ELHA 2AGAA 2EIKB 3AG4B 4F4LA 4X1KB 2B9SA 2CQKA 1I6XA 1FD9A 1VQNV 4JI3O 3QG5A 3FZVA 5EK0A 4G94A 5IYBO 2UUCO 4B3TB 1OFCX 1ETXA 1U97A 3A8TA 4GKJB 3F6OA 1IAWA 1VQ4I 3TP0A 1LR1A 3T8TA 5D5UB 3DGEA 4YIFA 3DBLB 4DRXB 4E7KA 4KISA 1BR4A 1BZKA 3K1NA 2M45A 3CJQB 1JXSA 1W2BU 1WFXA 4B3RB 1ZRFA 1CP9A 1NBMG 1K9MW 3DBRB 5LHHA 3N27A 4B1RA 2NLJC 2ECBA 3SDGA 3HHGA 2PN6A 4RGRA 3TGUH 5ICGA 4HW0A 3JRDA 2W82A 3MCZA 1HQCA 4FZ0A 4BDYA 4RAGA 1X3UA 5FNVB 2EZOA 5CVRA 5DS9A 4U7BA 1RZ4A 2MC4A 1YITI 4LG3A 1Z5WA 4JTAB 4O4JA 2M3AA 3EDPA 4JGSA 3JCZA 1YIJV 3P32A 3DTEA 4YJ2A 3BR0A 2JGDA 3OMYA 2B1GA 1CQTA 1URFA 1FBQA 3OYLA 3PNTA 2IJJA 3QP5A 5K5QA 1RI7A 4PELA 4CH3A 2KFDA 3HRUA 2O61A 2Y4TA 2FBKA 1T0FC 1LUJB 2CUJA 2XPUA 2IRFG 4GCVA 5B3SH 1KKCA 2ITDC 2M4GA 1TLHB 1SQGA 1MSDA 1J95A 3RPUA 3OYEA 4DR6B 1IDZA 4G9YA 2ZNIA 4XSXF 1AHDP 5IYZA 3RYFA 4I99C 4Q47A 3CC7I 1HP8A 3CS5A 5J8FA 4DV2O 2Y69H 1JKRC 1BE3H 4MVZA 2MA3A 2F48A 1A31A 1HWYA 2NVQJ 4FM0A 3I4PA 2W24A 3K70D 4MVOA 3H3ZA 4B47A 3OS1A 1Y76B 4Z6YA 3CJHA 4O4JB 2ID3A 1AR1B 3JAWA 3RYIA 2HOTA 4DYRA 1ORQC 2WLMA 1JT6A 3WU2Z 3CCUV 3PN1A 2K3PA 3Q0VA 4WCEV 1Q90D 2NXNB 2QKSA 5FD6A 3FYIB 1H2LA 2KDOA 5F0HA 2JGDB 2IA2A 1IXBA 4ZIBA 4X62O 4OAZA 2CG4A 3PIOF 4LLNA 2IBZH 3WB2A 2XTAA 1FOYA 1TW2A 2DA3A 4XBFA 4RB2C 1LJ9A 2EZIA 4A3BJ 4O3MA 1WJ5A 3K4MA 1PUFA 3P3NA 4E7ZA 1LVAA 3HSEA 4BIUA 5BZBA 1OPCA 2ACJA 3ASOB 4OAYA 3TBIA 2ZXHA 3JRGA 3F23A 4EJTA 4RQEA 1YCIA 4MEYF 3K5LA 5JQGB 2FOKA 1FBSA 4EB6A 1XCBA 1W4MA 3BG9A 1J5YA 3ZQIA 3IGAC 1R36A 2NNNA 3RYFB 5IYZB 3QNEA 1G6UA 3NARA 4XSZF 3GYHX 2K9PA 5KHHA 3BZCA 2MC3A 1F36A 1DUXC 4LJZF 4I55A 2FL4A 3JAWB 3H92A 3CRQA 2GWRA 4TV8A 4FX0A 3FXUA 1FMVA 1R1TA 2ZJ2A 2DYSB 4XRMA 1PP9H 3S1NJ 2JK5C 1AILA 3CB2A 4QIWN 2QENA 4BDZA 1OKRA 5FLVA 4HNAB 4KDPA 2A7WA 4C3IJ 2Z1DA 3WU1B 4ZI7B 1A6IA 3ML0A 3BT9A 1PUFB 2DLLA 4Z2WA 3ZIAG 5DD4A 5DM6V 1BM9A 3VQYA 2PMUA 1KBHA 4PJJA 1BN5A 4RAYA 4U0VA 4RM3A 1J9IA 5JHUA 5LGTA 4JTCB 2V9PA 3CD6I 4EB6B 3T1HB 1EH6A 2KRFA 2F66C 1FYJA 2ZBKA 5BPIA 2Y0IA 1X59A 1D5VA 4LFBB 4FLZA 2GBOA 4LF8B 3FHZA 1E3PA 3L2VA 2NAZA 2ZJRF 1CF7A 1YI2V 4L5IA 1K79A 2KP6A 5KVRA 4JX4A 4C2TA 1QU7A 4I55B 3HOXJ 3H1LH 3WU2C 3LNMB 1J09A 4KMFA 5KX5A 4AM3A 3E6CC 1ENVA 4E4HA 4EEFG 5CVIA 1RC9A 3W3CA 2VN2A 3OY9A 3JTHA 4EGYA 1Q6UA 1T8IA 3BG5A 3HKDA 3H1CA 1MJAA 1QRYA 1TNTA 1JJ8C 1GN2A 4MVRA 1IVSA 2R7VA 1XNRO 4DUZO 2GA2A 5DV5A 5EZGA 1N34O 4YFNF 2OCHA 4A3EJ 2CTWA 1H9GA 4PJMA 1KU7A 4IYIA 3AL0B 1DTOA 1OQYA 3KG2A 1GM8A 2WAEA 2CFOA 5F0FA 1FPOA 1RSOB 5CBFA 3D1NI 1XMQO 3D3QA 1QQIA 1H89C 1EH7A 1V5GA 2IA0A 2Q1ZB 1CF7B 3RTRA 1ETVA 3VFZA 2DJVA 4EM1A 1SQPH 3K08A 1JJ2U 4PJLA 2LDUA 2HVRA 4A0XA 2XF7A 2DT7B 1AI6A 5KX5B 2LGQA 3BG6A 3F7YC 2FMLA 4A6DA 5IP7J 2ATKC 2DA6A 3WHBA 4DR7B 3KP2A 4NC7A 5IYBJ 3HKDB 1XREA 4U3JB 5F08A 3TL4X 5B1BC 4J7ZA 2QM3A 3PFIA 3EUHA 2VI6A 3CO6C 2VBXA 3IFXA 2YUAA 1HXDA 2IM9A 5IDJA 3CZ6A 2BOBC 3FM5A 1SQBH 2KKWA 2XHKA 3RDIA 2YUSA 1LEAA 1GM7A 2IJLA 1I6HJ 2IJHA 4DO2A 2XROA 5B66Z 1QVGU 1EZJA 1Y6IA 3ZCCA 3QPHA 2A68F 4A0ZA 2AXTZ 5EBMC 3T8RA 1VQ4V 3N05A 4LGWA 3T1CA 5J8CA 5ITZA 5KHKA 2G9WA 3V7RA 1VNDA 2GTSA 3RYPA 2CU7A 4NBQA 2P7VB 4MTGA 2AQEA 3VSKA 1JKOC 2VJJA 3LAJA 1Q82W 2ZDIA 4E7JA 4DV0B 1X3ZB 4JI1O 2E7WA 1W0JG 4X8AA 5BNGA 4D7TA 4XLAA 2A79B 4JV5B 3KZIZ 4O2AA 1YITV 1ZARA 3BJOA 3WODF 1XDSA 3SYTA 1MBKA 1R5HA 2ZXWC 2R4GA 3WTTC 1HDPA 3P9KA 4X88A 3RJPA 1G1XB 2Y48A 4BR6A 2OZ6A 3MQ0A 1PPJH 4BEHB 1EJ9A 4I4TA 3HKZA 3VBBA 2FX0A 3PSFA 3LSPA 2GIZA 2R7SA 2CK3G 3E86A 3THOA 2H1KA 2VXZA 4LFCB 4DYLA 1UJWB 4JYBA 3DKWA 4KIGA 3PNVA 1SQFA 2AZ2A 3M8FA 4MFDA 2E5LO 4JI2B 2UXBB 4IJAA 2UUBO 1TT0A 2E1MB 2Y9YA 1YJ9I 2Z9OA 3AG2B 3ZN1A 4DJAA 3F8MA 3AG7A 3FMSA 4GLXA 3IAYA 1KC8W 1M57B 2F4VO 1R5GA 4GUNA 2X51A 1SS3A 1YE9A 3PSIA 1Y0UA 2HLDG 3TDUC 1VTNC 2RDCA 3JATA 3MD0A 2MSYA 2VRZA 4F6RA 3B8NA 4A6EA 1LNQA 3W2AA 2DOFA 3OL4A 2QA4I 1IF1A 2UUZA 1W0UA 3TK1A 3A02A 3DBHB 5IY5B 2KMUA 1HNWO 4KUMA 1GO3F 4ANJA 3C90A 3OYHA 1XUQA 1UHWA 2QWPB 1T38A 3V8KA 3M8AA 3U11A 1EFRG 3ZRWA 1R9TJ 3L2CA 3K9TA 5B66C 3Q9VA 1XHXA 2RGVA 4IHJB 5IYCO 3N4MA 3WG7H 3FBNB 3K6GA 3W7SA 2AXTC 4BWAA 3V8LA 2KLOA 3ZXSA 1KQ9A 2VQCA 3E35A 3O65A 4JK1X 3OEHG 4HF2A 2V7QG 4CCOA 5AIQA 4UCTA 4K8XA 3ABLH 3MHHC 2EIKH 3AG4H 4KJZA 2QSHX 1D8KA 3QP6A 2PMHA 2WTEA 3HKCA 1WI3A 2FU4A 1P7JA 3HG9A 5HS7A 5D5WB 2L7FP 3JATB 4TV9A 3T0YA 1R6NA 3ZHQA 4HAMA 4YXWG 3QPSA 2ESNA 2PX9A 2V9VA 3DPLC 3GUDA 3KZIC 1ZWIC 4CS2A 1QVFU 1HC8A 1IW7F 1IC8A 1PNMA 2L5QA 1ONVA 3FXKA 1FXHA 5IT9Z 1JPXA 3OYBA 1R6RA 1Z6RA 1R49A 3OE7G 4QIWF 2HHHO 1PD3A 3KPHA 2IU3A 2QKMB 1FS0G 2BOCC 4HDUA 1F1ZA 3ZRWB 2LY9A 3CUQC 4PJNA 1MNDA 4UUVA 2IGMA 3ASNH 4J19A 4A3DJ 4II2A 2ZR3A 1KUQA 4UCRA 2QDOA 3CCRI 5LYJA 2IS1A 4JYAO 4CCKA 1KGSA 2DOEA 3GWKC 2N74A 2EK5A 2Y31A 3HXLA 4XRSG 1J59A 3G67A 4ENNA 4E2LA 4QWQA 3PIPF 1F4KA 1G4DA 1XILA 2GTAA 2KQXA 2LTPA 3HKCB 3LDEA 3CD6V 2L4MA 4BE1A 3CYOA 1BR1A 1B9MA 2VQGA 2I8DA 3H5AA 4WF2A 3Q4HA 3ZQ7A 4TV9B 3KZZA 4ZDOA 3HL2A 3KE2A 4MFEA 1U3EM 4LIVA 2LJ2A 2VB6A 3KP3A 1VQ7V 3RVZA 3S3WA 3LQRA 1LFBA 4UB8Z 1I5ZA 4I76A 2ZQMA 1OHHG 3OR1C 3I56I 1FC3A 1BMFG 2ZE5A 1TQIA 3APQA 4II3A 4WK8F 2DYRC 3J7AU 4I9QA 1H2NA 1LUWA 1XBLA 2LYCA 2R5YB 1Y66A 1QU3A 9ANTA 5JJJB 3CDLA 2X1DA 4DR2O 2X4HA 1HW1A 4P30A 3CCVI 3E8HA 3HRTA 3E5QA 2E5ZA 2P6JA 1NS1A 5LYJB 3CHXA 3JAMK 4X89A 5F2VO 3HGGA 1LEBA 2VONA 1TQMA 3NRVA 3BOQA 3HHHA 4CBCA 1QNMA 3KCCA 1YQAA 5AIPA 2HYFA 1T5EA 5GAGJ 2DODA 4CA0A 5JFRA 1Y8RB 3I4NJ 5JCOA 2CQ7A 3HKBB 2L54A 2HEPA 3I58A 4P55A 4YELA 3OYKA 3OYFA 3HOZJ 1VP7A 3E89A 5LL6Y 1Z67A 4A12A 4YY3B 4BH9A 5K7HA 2EPFA 1VQLI 4IHTA 1H0MA 4BXXJ 2OUMA 1U0JA 2EILC 1K4TA 2YSUB 1XSDA 1TWCJ 1Z6TA 1P4XA 2ZE6A 4FLWA 1BHBA 3CP8A 3ASOH 3QPLA 4N9IA 4CICA 3GZ6A 3JARB 4AI8A 2DOAA 3FYEB 4P1WA 4LR3A 4DK0A 1MJBA 3ETDA 4X9QA 1BIBA 2IA1A 1FIPA 2XOKG 5TISC 3F8BA 3A2KA 2LG4A 2XVCA 2DPUA 1GTOA 1ORKA 3JCUZ 2M8GX 2GA1A 3PJSK 3U0ZA 5CVJA 2VJ4A 4C3HJ 2Q68A 3QQAA 1X4OA 5D4SA 2DA7A 1I1GA 1O57A 3K2AA 5L3DA 4J9ZB 1ACIA 4RLQA 4FM2A 4FT8A 1HR0O 1USTA 1QVTA 2G7HA 2IEKA 2VC1A 5JLXA 3T1BA 2TDXA 1US6A 1JFFB 5B1OA 4HA8A 5EZYA 1P9QC 3FWEA 2DYSH 5ICCA 1ENHA 3HGYA 4RA2A 4L9TA 4N9HA 1Q3EA 5FB2A 3PJRA 4FLTA 3B6AA 5LMUO 2IU0A 3UR3C 3S8PA 1JQ0A 3K5MA 2E1CA 2HVQA 4ZZDA 2KJCA 4UUJC 2VL8A 2R0QC 3ZRSA 4CCJA 1NH2B 2H27A 2LKXA 4UB8C 4P5OA 5C3EJ 1MH3A 1AKHB 1X19A 1AR4A 2F5VA 2P4VA 3W7UA 1PP7U 1GVDA 2DQ0A 3ZOBA 2OZUA 1DPRA 4KNYA 1QZYA 5IWAB 1HKTA 1YIOA 3ZQQA 2E74B 2EZLA 3NEUA 5DD8A 2NS7A 4A3FJ 1P49A 2ZIOA 2OBPA 1I5YA 1PM9A 4XNFA 1K33A 2FJ1A 2WB1N 3A4CA 1U6GA 3BEHA 3X2QB 3BPXA 4CZCA 1Q81W 4QPJA 5B1NA 4PA3A 1N25A 3F3XA 3HIFA 1Z3XA 5EZYB 3D5SC 4BU2A 4DV1B 4AILC 3HSRA 1ZTEA 2BYVE 2FBHA 2F6CA 3E97A 5E3OA 2O9LA 1TWHJ 5A2QN 4KHPB 4KFMA 3DC5A 1BBYA 5EF6A 2OT5A 4XIDA 3FBIB 2CGOA 4IF4A 3V8JA 2EA4A 5HDKA 4LK0F 2YIAA 3LSIA 3KP4A 3CO7C 4WFHA 3ZHSA 1HDDC 1YJ9V 1Q43A 2IS6A 1TT5B 2QLZA 2O6GE 3I59A 2NRAC 3H9QA 1W5CC 2WY8Q 4MIMA 4CXFA 3GTMJ 4PDRA 2DMPA 2YIDA 3N2GA 3K57A 1HNZB 4JI6B 3ETGA 3JALA 1POGA 4NHJA 3IL2A 4NYKA 4JZ2A 4CCNA 4D5CA 3JCUC 1UFIA 3MFKA 2QA4V 4LF6O 1X4TA 2QKAA 2CWEA 4B09A 1D0XA 2HU9A 2GQQA 2E35A 1DP7P 2EIJB 1IN7A 1UELB 5FKMA 2CV0A 4DR7O 1VIBA 2XAQA 3TKYA 1EA3A 1F43A 3R60A 1HOMA 2X6AA 2QF7A 1JMKC 3F9KA 2XRNA 3UKMA 2D5VA 3J80Z 1W59A 4DUYO 2V26A 1UMQA 3IAM2 3Q0WA 4C30A 4F91B 5FRNA 1YXBA 4LITA 2GUZA 3QTCA 4MVMA 4PA4A 1JOYA 4EJVA 2QR4A 2Q0OC 3KLNA 1GVJA 1OCZB 3DU6A 1OV9A 2HYGD 1BQZA 5DCMB 2M7BA 2W25A 4PFOA 3FM3A 4FE7A 3ZN0A 1F7YA 4RAZA 4M6YA 4G7OF 3HPLC 1N33B 5J4VA 5FLMJ 3N2GB 4ZYDA 1SAXA 1HW2A 3JALB 3FAVA 5C93A 1BI1A 3HKEA 1RETA 3L9DA 4HDVA 1AR5A 1I39A 1Q1HA 4XONA 3IC9A 1L1FA 4FFBA 3RVYA 2X6CA 1D3YA 5CBGA 1YIJI 5KA6A 5KA5A 2PI4A 1ZGJA 3RCOA 3OYGA 4JV5O 1V55C 3CP1A 5DCFA 2OIGA 4OOIA 3WGIA 2CAZC 2ZINA 3L70H 2EULA 4O4LB 2O03A 1B4AA 2FEZA 4X66O 3IUOA 4HX7A 3RPQA 1X4PA 2B0LA 3M1CA 4XK4A 5ICFA 1ITYA 5KUKA 1W0KG 2GSMB 5IYDO 3E8BA 1SFUA 2XRLA 3WB0A 3G1MA 3RPUD 2NR5A 5BMZA 3FXRA 1NR7A 2RNBA 4A3IJ 2X6XA 2L35A 1FIAA 2L02A 4I02A 2ZB9A 2FMYA 2PLYA 1R00A 4L0YB 1M56B 3SJBC 4LLGF 4XKBA 5K7ZA 3KX2A 1LFUP 1EN5A 2WLNA 2JSCA 3CX5F 5CPRB 4NXNO 2ZKOA 1YO5C 4GYCB 2XV4S 5FGMA 3SPIA 1M1KW 4XM3A 1MSFC 4LK1F 3CUOA 2EV5A 3FAVB 3C18A 4E7IA 2R7QA 3RKXA 1JKPC 2LW1A 1J7KA 1ZLKA 3OFNG 2HPIA 1YW7A 2E1NA 3RBZA 3CCUI 2WB1A 3I56V 4IHVA 1S72I 1USSA 2J5PA 3I64A 3AG2H 2L7KA 3S32A 5GONA 1U5TA 3AAFA 2VKHA 2PMZN 2AHQA 4DW0A 2VUMJ 1IBLB 1YS6A 2O7OA 2FKXA 4JYKA 4AU7A 4IHYA 3V7CA 2RKHA 2CJJA 2NNUA 4CS3A 2NOJB 2RN9A 2VBWA 1FKAO 1FJGO 4E6KG 5IY5H 3K0DA 4V2GA 3RQ4A 3FF5A 5KNLA 5LA6A 3L2RA 1MH4A 2DK5A 1WPBA 3P5JA 4KN4X 1OCCC 1S7AA 4K2EA 4XRSA 1JR9A 4BACA 5JJEB 3DCFA 1QO0D 2DQLA 3BCAA 4EATA 3SR2C 1P84F 1NVPB 2XKOA 2QM7A 3H9JA 3IH4A 1JVMA 3K9AA 1E2XA 3JAMN 5BR8B 4JP0A 1FTZA 4MTOA 3EYIA 3NXSA 1O9GA 3M4OJ 1YRNB 3D36A 5CMUA 4G6DA 2M2EA 2ME0A 2HQNA 5EYPA 4AHCA 2WWYA 3MDSA 2EQRA 3FKIJ 1CEZA 3MZYA 3T4ZA 4ENJA 3TOBA 4A3JJ 1FP1D 3QO5A 1NG7A 5B5EZ 5GONB 5E3LA 3KP5A 3SEQA 4BBRJ 3HOWJ 1KYOF 2O57A 5HS8A 4FLXA 1KU3A 1WPKA 2LOOA 2R7FA 1HF0A 1FT9A 5LMNO 4GX0A 1S29A 4DR4O 1YW9A 2UXCB 2PBIA 4B7KA 1IUYA 4LMYA 4N21A 4AQYO 1J5EO 1M9NA 4TSFG 3ABKB 1B3QA 2QM4A 2B63J 1AJPA 4LF7O 1R4NB 3T1YO 1L8DA 2R7WA 2I5UA 1Y0NA 1MBGA 2HDWA 5JH7A 4KP4A 3K59A 1ZREA 4CCLA 3J7AO 1DQUA 1S77D 3ZMZA 1XPXA 2V6EA 4HX8A 3H9VA 4NTWA 4JI8O 3OUFA 4MTEA 4F92B 2WLIA 4GXOA 5JR3A 1F4MA 3ZHUA 4WWCA 2KZGA 1W7PA 2DTRA 3H1KH 1SVOA 2F4IA 2K9QA 2DE0X 5LXTA 2DQ3A 2YIBA 4LF5B 2RC4A 3KP7A 4BXUA 5E8GA 1REPC 2YC0A 4ICGA 3GTGJ 3HBLA 5CA3A 3IRRA 4LFAO 1DF4A 2P5OA 2AZ0A 5H6QA 2BOLA 4EV0A 2Y4UA 2ZMEA 1MOFA 2HVJC 2DI3A 4RB0A 2M6YA 4JI7B 3WU0A 2CUFA 1M1EB 2IGKA 3FIWA 4OU0A 2PYJA 2CSOA 4AD9A 1IBMB 4LCUC 4I7HA 4PDLA 4WFGA 4UCVA 1VQ9I 5GADJ 1OCOB 2BSKB 3VSLA 3ZJZA 3HOUJ 5JH7B 2QQ8A 3SJMA 2BY2A 4B4CA 1BT8A 3BFRA 5TGTA 4DYCA 1V5EA 2VQLA 2OCCB 4OMZA 1RM1C 3O6BB 4A2UA 3SFIA 2WLIB 1BC8C 3HR0A 4OPHA 3TW6A 1SVMA 1LPQA 1UHMA 1ZTRA 2K02A 5DEQA 3J7YJ 3BZ6A 3ABUA 3QU3A 1P7GA 1CXZB 4EFBA 1T6SA 2M8EA 5CB4A 5LXTB 5B5EC 1TL8A 3ZQFA 1ZGAA 4O4HA 2XIGA 1GMGA 5HNFA 1B06A 3K10A 5K1PA 2PMZA 5FKOA 4C9YA 1KB9F 3D5LA 2OV7A 2P8TA 2ZE7A 3QF7A 4EEQA 1R1VA 2DFIA 2ZMEB 4HYEA 1V54C 1MKMA 4K0KB 3K9SA 3ZRGA 3ABLB 3LA2A 3AG1C 1JUSA 4DV6B 3EUAA 4F7ZA 1UFMA 2CW7A 1QA6A 4RLFA 5HODA 5EIBC 1Z7LA 2M34A 3E1SA 2FE3A 3HC7A 2MABA 3LSTA 3CMEV 2A06H 1NHAA 2O8XA 2QWRB 4LF4O 1MZEA 4B48A 1YX5A 3E5XA 3S1MJ 3IKVA 1ZR2A 3BRCA 3TEDA 2DJNA 1IRFA 2PYLA 4JI5B 1EV7A 2W1OA 4OX9O 2M7AA 2VQFB 3K4BA 1GXQA 2GOXB 1K61A 2E1OA 1T33A 3GXOA 4NC8A 3VPRA 5CB4B 2FA5A 3PUBA 3W7TA 2MW2B 3ASNB 3R61A 4AVPA 2XGEA 4U7NA 3SYQA 2EFNA 4O4HB 5ERIA 2LLKA 3FB5C 4JTDB 5IYDJ 2R93J 2FOWA 3P7NA 1Y76A 3EUHC 3VOUA 5IWAO 4LG0A 4PHZA 1ZELA 1RKTA 2CTPA 1ON1A 3C1DA 1SZXA 1O9HA 1V5FA 4X1IA 4LF9O 1TWFJ 2EINB 4QPOA 3H3VK 4WX9A 2JS3A 2LFRA 4EM2A 4J11A 5L3BA 2FBIA 4IYHA 3CCMV 3SEZA 4PJ0Z 3EUKL 4IHSA 2JVDA 4E70A 1K7AA 4MVUA 1FSEA 5FL7G 3UNGC 2KHMA 2EWNA 3DEUA 3J81Z 3WFVA 1XMOO 4KT6A 3VQVA 3SPGA 3OGIB 1N32O 3X2QH 4AC0A 1SETA 2VT2A 3QU6A 4F93B 1NT2B 5JQGA 2ZDIC 1ETWA 3WTVC 2P0WA 4DBQA 2A3SA 2X6BA 3E8FA 1R1UA 3ABMC 2VIXA 1IUFA 1OYWA 2MK3A 5D5XB 3G1LA 2LREA 1MNEA 5J47A 4BY7J 3K79A 3RIRA 5FRMA 3SYAA 2D1VA 1A36A 4LG0B 2A9HA 2W6IG 3KP6A 3B2EE 4UUSB 3TXQA 3OS2A 3OOPA 3KEQA 4YRVA 1S5LZ 3S3OA 1Y1VJ 4R7CA 4X1IB 1H9TA 4LB6B 1S72V 1NTCA 5KHDA 1XN7A 3HTUA 3I9V2 2P5VA 1IO2A 4WXHA 2W84A 2Q8KA 1HSJA 2HR3A 3LNQA 4BW5A 3JASA 1HNXB 1DGWY 3QODA 4IO9F 1KQSU 4HNAA 4TOIA 1K8AW 5D8KB 3KIOA 2E2JJ 3P3PA 4CCMA 2HXOA 4UVAA 4EMSA 3QO8A 5K5OA 3A01B 1BS3A 1YDXA 4JZGA 2OJED 3NWSA 5D5QA 2HZTA 5J1YA 2EIJH 3AG3C 3GEZA 1WJFA 3S2WA 3IKTA 5DDGA 3CRAA 3MD2A 1I94B 4M74A 3L74H 2RNJA 3WHCA 2XNDG 2DMXA 1WJCA 2LQTA 4ENMA 1VFCA 1X1BA 1T08B 1OCRB 3TO9A 3K70C 1NK2P 2FYUH 3KFWX 2F95B 3CWBH 4DZPA 1X1AA 1Y56A 3BR2A 4S0HB 2JDIG 2ZJQF 1FY7A 3G4SV 3E0JB 3WGGA 1YJWI 1ZR4A 1AJQA 2BCCH 1OCZH 5LHGA 2OWOA 2X48A 2RAEA 2ZKZA 2V1UA 4LH7A 3JASB 4M6VA 5DM6F 2K86A 3OMNB 1MSWD 1SD7A 4IZZA 4PJ0C 2XSDC 1ZH5A 1BSMA 1Y6XA 2E3CA 4IXAA 4G2KA 4Z1VA 4GCZA 2K85A 2BXZA 4PCQA 1T98A 1DDNA 3TDZC 4FK5C 1S7EA 1B9NA 2W0FC 1HA8A 1N0JA 2AW9A 2VQEB 2ZSIB 4DQ2A 2YX4A 4IVNA 3BVOA 1QLEC 3TGNA 1NZ6A 3NAUA 4TV7A 3DPTA 4I2OA 2WA4A 3KCXA 2D2WA 2L0KA 3FXLA 1XMKA 5ILSA 3VYRB 3BZKA 2BXYA 1VQ7I 1RR7A 3HOTA 1BI2A 4OPAA 5LP6A 3BTJA 5C44J 3GTOJ 3K04A 2M5WA 3F72A 1YS7A 1RNLA 1S5LC 2VKEA 1X2MA 1KZHA 4G27B 4QLCU 3CJNA 1TNSA 4Y7NJ 3A1YA 3LNNA 1IBKB 5B1AC 1M5IA 1I7FA 4AIKA 5DEDA 4HSTA 2WA0A 3ML6A 2LVSA 3R0JA 4U7OA 2CW0F 2EJRA 4U3JA 5LEKA 2KKOA 4B3MB 3R6SA 1WKMA 2R5ZA 3S2DJ 5F04A 2QGNA 5KLVH 4L18B 1AI5A 1AP6A 1XQ8A 2DMUA 1B59A 4G6QA 3OEEG 1IBLO 5EC2C 3C7JA 5CN0A 2EFOA 3DC6A 1VQ8I 3RFRA 4RGUA 1VQ9V 4NR1A 1NH2D 4FFKA 3UM7A 2HZDA 2YR2A 1KP3A 2DDBA 2WAFA 5IOZA 1MMSA 2YXHA 1GV5A 5LP6B 4ETSA 2IJIA 1KQ0A 1DGRM 3JREA 1YSCA 2L9VA 3HB3B 1X3WB 2VC0A 2ARHA 4PV1B 3IJ4A 2Y0MA 1NG6A 4L0ZB 2C6YA 5CJ9A 3HM5A 1O3TA 1SD4A 4DR5O 2KG7A 3R66A 2DAOA 2PJPA 3GTKJ 2CTQA 2BE5F 5M3MJ 5DTDA 3SJAC 4NXMO 3IHUA 3LMMA 2NNYA 1S7OA 4PDKA 2R5ZB 2GAUA 4MHGA 2LKSA 4BIOA 3EXAA 3W6JB 2HVSA 4MW3A 2CTRA 4RGXA 2KRHA 1KD1W 1AU7A 4GGGA 4A5MA 4BEHA 4AYBN 4JAUA 3K69A 1HW7A 1XEQA 3CJTB 3VYUB 3COAC 2Q67A 2WLLA 3DTKA 1FOXA 1FMWA 5F1RA 3L71H 3OTOO 1G3WA 1QR8A 3UKGA 2B5UA 1YTFB 3IRQA 2K4BA 4D7NA 3JW4A 3DTUB 3WE2A 4PSXA 1HKSA 2NVXJ 3I3LA 3BJAA 4I98B 1NH3A 3ZX6A 3R4KA 3VQWA 2UUAB 3Q0UA 5GPAA 4GX1A 3TOAA 1Z2GA 1SERA 2AQFA 3MZ8A 5L3CA 1OJLA 2VQHA 3DPUA 3ABKH 1L0LH 4Q48A 1JHFA 4IRIA 1I0HA 4JBAA 1HLVA 3GZ5A 2IW5A 1ZRDA 1NI8A 3HYIA 2KG7B 5B3SC 3DFGA 4PZJA 5L3FA 2PGGA 2EA2A 2JPBA 1UB9A 1PKXA 2RNGA 2X0LA 2UWMA 5IJ9B 4A3GJ 1K6YA 2UXDB 3M07A 2JS5A 2Y69C 3R0AA 2JA8J 4IQ4A 1WZ2A 2M30A 3UO3A 1SKVA 4IHJA 2WLLB 2JRTA 3GWOA 4DNCA 1IN6A 2TCTA 5IT9K 5CA0B 3CC7V 2JIZG 2GBYA 1YZBA 3FISA 2CGNA 2VS0A 1TQPA 3GTLJ 1FXKA 1VF6C 4P9FA 1BA5A 1I50J 5EEGA 2WV1A 1K92A 2EFPA 2K9LA 5F64A 5FROA 1EKEA 3RT3C 4KYWA 3H1HH 2XB0X 3OW2U 2LBFA 1FXVA 3H1IH 4CC6A 2KIQA 2VJ5A 4FISA 4XR6A 1Z9CA 3JRCA 1OCOH 2IPQX 5E8IA 2DK8A 3K4LA 2FNPA 1AI7A 1H2SB 1LVKA 3BHPA 1FYMA 1BL8A 3LSQA 5HVQC 4KFCA 4YHHO 4DR1O 4D6TH 2OCCH 3PO2J 3JD2A 4X1YB 4R6ZA 1V9PA 2G7UA 1WJZA 4FLVA 4P9PA 1T2KA 2M9HA 4NB5A 3K5NA 1DK1A 1YFHA 1SAUA 4I09A 4K0KO 2CQNA 4CH6A 3S3NA 4G6TB 3OV8A 1SQXH 4IGGA 3T2MA 3F8NA 4CS4A 1MNMC 2OPTA 4KA4A 5FLXK 3K3WA 4B3TO 4GKJO 3S1QJ 2V1DA 2JMWA 1FXKB 3RSNA 2YU9J 5EZHA 3AK1A 4RS8A 4KITB 1E17A 4GX5A 3SDBA 1GV2A 4O4IB 2DMNA 4HZ3A 3FHNA 2CMPA 2JRMA 2R3SA 3ERMA 4RM2A 2LBFB 2KIUA 4W97A 2E36A 3GO5A 3WE3A 4HZFA 2E2HJ 2HDDA 3G3ZA 5LOVA 4JI5O 2VQFO 1K4DC 4OIQF 4B3RO 3GF2A 1ZSPA 4HYOA 4QNHB 4DV7B 3KEYA 3E6DA 3PO3J 2E34A 3BDDA 2ESHA 2EIMC 3WTZA 3OYMA 1YJWV 2CUEA 5J2TA 3KETA 1G8XA 2G0EA 2UZKA 1FOWA 1WH7A 1QQCA 1BI3A 4G7ZF 1OYYA 2R5YA 4DW6A 3PM1A 1U8RA 4OIOF 1UCRA 4A3CJ 3SJQC 5TISZ 1KQ8A 2CFXA 1IDYA 3E3VA 4RAFA 1YF2A 1WLEA 4AYBA 1RIOH 1ZK8A 1XGSA 2E60A 3ZMUA 5A2QZ 2Q9LA 3OSGA 3MHSC 4JPRA 1R5ID 2RN7A 3HZJA 3G6EI 4KICA 3QVNA 3ESWB 3L09A 5TRDA 2ITCC 2W48A 4M3BA 3LDDA 3JTGA 2DFFA 3VOEA 4B3XA 2EINH 2E7XA 3IWFA 4ZC3A 2QWQB 4XLEA 3HKBA 4DV1O 3K4KA 1NVPD 4X65B 2HWVA 4XOTA 3DLAA 3CTAA 2R7DA 5HFMA 2RQ6A 3C3WA 1XCVA 1QBJA 1SA0A 3RQIA 1WB7A 3FX3A 3K4CA 5LOVB 4EM0B 2JA5J 2QCOA 1GDTA 1OMIA 1KU2A 2WA3A 4XLPF 4NDLA 4GKKB 4DBRA 3W6VA 1S9HA 3JARA 3FMRA 2OCEA 3OAAG 5HS9A 1RPOA 3A0HZ 1WI9A 5J2TB 2A5YB 3E5UA 4ASNA 1SQVH 2DQRA 4A5NA 2QKCA 3ZRVA 2UXNA 1XGOA 2W85A 1O7FA 4YIIA 4DV3B 1RUNA 1UAAA 1GM9A 1PL4A 1IRZA 4EQQA 2Z16A 2FQ3A 3OIQA 5K1XA 2IS2A 3CCJV 3OGCC 1ZAOA 1W1WE 3W7XA 1HNXO 5BQTA 2JUGA 1S76D 1P6RA 1R23A 3U2RA 1TUBA 1JFFA 4DV5B 1PNLA 1D1CA 4HG2A 1LDJA 3BTLA 1VQ8V 2OU2A 5GTIZ 3GFLA 2MW8A 3ISPA 1YVWA 3OIOA 2DA5A 2KJBA 2PFBA 4N4OB 4O5VA 2ZNYA 4P9UA 3WTUC 1PP8F 5DN6G 5M5XJ 3L00A 1OR7C 1SA0B 2UU9B 4D7SA 1M90W 4FMTA 3L1PA 2KL4A 4N0BA 1QCEA 2DA2A 2ZC2A 4FTHA 3H1JH 5AONA 3CF5F 1AKHA 2Z3YA 5EGOA 3CXHF 4H13B 3SZTA 5J4YA 2JJ1G 5E3NA 2KZVA 3LWFA 2YX7A 3LA7A 4BHBA 2JUCA 1U5TC 5GAHJ 2P6TA 3LFUA 3FX7A 4JYCA 1XDCA 5J3LA 4JI0B 2ZM6B 1XGNA 4H4KC 2PTMA 3G6BA 1T56A 1A35A 3FK6A 2EJ7A 4YJ3B 2P5KA 3VEPA 4OGQB 1OCRH 1GAXA 1SD6A 1X1DA 2XPVA 3QOPA 1BL0A 2QSGX 4BW9A 4S05A 1HSTA 3EFFK 1SESA 2LF8A 5FJ8J 2MFZA 1TUBB 2ADQB 4X64B 4YG2F 1FPQA 2FTKA 2R9AA 4PDMA 2LRDA 3SZPA 5E20A 4FVMA 2RREA 3SPHA 4W1UA 1RP3B 5FKLA 1N36B 2L7MP 3CMMA 1O3RA 3HRSA 1OZ0A 1Q5OA 1EH8A 3T1HO 3TETA 1STZA 4XRFA 2X6OA 2OD5A 1WWXA 1W7PD 5EGOB 3ECOA 4DR3B 2JN6A 2VT3A 2LW7A 1BC7C 4LFBO 2YIBD 3A0HC 2PJRA 4LF8O 3J80K 2K5CA 2MLKA 4CSWA 5B1BB 5FD5A 3L2QA 1IV6A 4XN3A 3RKQA 2X7RB 5IT3A 4JI3B 4CH4A 1R4MB 3W6KB 3I5DA 1IN8A 1P7BA 2UUCB 2IXSA 4ZYEA 5GPCA 3G73A 2O0YA 1GXPA 3KEOA 2CW8A 1ERDA 2QQBA 4QE7A 1SFOJ 4X20B 2EZPA 2JA6J 3R65A 3BR3A 5GAEJ 1SD5A 3OWTA 4LIUA 1TGOA 2WSSG 4J7KA 2MGQA 3F22A 4E7LA 2DDAA 2PUSA 3F7VC 5GTIC 3KCYA 3OYIA 4O2BA 3LAPA 4GX2A 1BJAA 3DXRA 3L9FA 5M5WJ 4MS2A 4MLOA 4L5JA 3SYPA 1YG2A 2VBZA 3WGHA 5IJ0A 1LE8A 3KYDB 2V9KA 5DCMA 3K1PA 2ISYA 2YPRA 2PJRB 3WG7C 2LFBA 2ZD9A 3S3XA 2Q69A 5IT9N 2ZXWB 3VYTB 2ODMA 5IYCJ 3I55V 1DF5A 3D5RC 3I54A 1MSEC 4WFFA 1JX9A 2EIKC 2K3FA 3AG4C 2NVYJ 4BKXA 5BPDA 3JR9A 1E3OC 1EM1A 2LR8A 2E71A 1Q86W 2WLKA 4O4LA 3EVKA 5K1YA 4FJCC 1QZEA 1QZZA 1Q1VA 2K9MA 5FPRA 2F2EA 2QE7G 4DV2B 2P90A 1H38A 2WAMA 3CMEI 2O3FA 4O2BB 3OS0A 1YHQI 2XF5A 4MTFA 2RVCA 3DXRB 2VASA 2PQ8A 3K0GA 1XMOB 1B72A 4YFKF 1XSXA 1R3KC 3TMOA 1VF7A 2QQAA 5IJ0B 1LE8B 3ROUA 4IIJB 2KDZA 3KZYA 1F5TA 1XDUA 2Q5ZA 5IE9A 4JI4B 4Y3OA 3CE2A 1WHUA 3JYCA 4X62B 2L2OA 3LSKA 4G28B 4JF3A 3E22A 3O8GA 3PFYA 1NTMH 3W7WA 5FLXN 3GVAA 4HF1A 3ZHVA 1XMQB 4ZYHA 4DV0O 3FB6C 1JCHA 4FIPC 1D0YA 5GP9A 3OL3A 2HDCA 3S14J 3DV8A 1EN6A 1FJLA 4ZTJA 3CUQA 1QGPA 1LB2A 3H35A 4RWUA 3CCMI 2DO7A 3W2VA 4UV8A 4X1EA 2W00A 1BCCH 2ZXJA 3QYBA 3SJCC 1V54H 3MWMA 4FETA 4UVBA 2PI5A 1I94O 3C2GA 5IP9J 1TP4A 2R7UA 1B72B 3BABA 4J7JA 1QHGA 1ZL8B 3FK7A 3G6EV 4LFCO 1K4CC 4JAAA 5LFAA 4LOCA 3E7LA 1ZG5A 3LFKA 1PUEE 3V42A 1OJHA 1AA7A 2WBMA 2IVMA 5HLIA 5E79Z 5HFLA 3GTQJ 4JI2O 2YI9A 3N97A 2KSDA 3E22B 2A07F 2OTLI 1XL4A 1ZUQA 1KMIZ 1FYLA 4ENKA 1YRNA 1KU9A 3F8CA 1HDJA 1H88C 4Y15A 4XKVA 3S3MA 1YEWA 1P4WA 4HX4A 2Q4PA 1FAFA 1MMDA 3CUQB 2BY1A 4I0AA 3UCSC 4QSHA 1ZG3A 3I4MJ 2BY0A 3RN4A 1SC7A 4RB1A 2OF7A 3GZNB 3LL7A 2M7WA 2HGCA 3ZRXA 1FX7A 2ECCA 3ASOC 2FRHA 4G8XA 1E1RG 4K3AA 1N4CA 2Y0SN 1FTTA 4CGZA 1RUOA 3CQZJ 3BY6A 4IHWA 1SF9A 3L75H 1WJBA 3UT5A 2QUFA 4B44A 4PA6A 5EBLC 2M0CA 1E79G 3FDYA 4M3DA 4NQWA 2EV0A 1JGGA 3SPJA 1SFEA 3E6BA 1QLNA 1J0RA 4J10A 4ZOLB 1KP2A 5FPOA 1XNQB 2F5CA 1SEUA 2R7RA 2DYRB 2ETNA 4JQFA 4PSWA 3OYDA 2BW3A 1B6QA 5ILVA 2E2IJ 2Q2EB 3ZCOA 4KN7X 3WTYC 3G4SI 1HBXG 1SMTA 2DYSC 4DUZB 1XNRB 1N34B 4BNCA 1COWG 1E1QG 4PA9A 2HFHA 2COMA 4B3AA 1JT0A 3OTFA 4DZJA 1A32A 1S5JA 1WJDA 3F21A 1TVKA 3DEWA 3GMEA 2K1EA 3TXSA 5CKTA 4UXNA 3OSFA 4BQQA 2JWTA 3DU5A 2YU3A 3HUGB 4XLHA 3RKYA 2MH9A 4P96A 2JGUA 3NWTA 4BQOA 3TQNA 4D5FA 2V4DA 4ABMA 3U9GA 3W2WA 3UT5B 1X1CA 3BCCH 2GIVA 3OYJA 1KYWA 5E79C 1VZ0A 1WSUA 2BSKA 4NQWB 2EILB 1VQ5V 1R71A 3K06A 4A3MJ 3BC8A 4IQJA 5CA1A 2DXIA 1FLIA 5JVDB 3P9IA 3GB7C 2F4MB 3BP8A 5J6XA 3STZC 2BW3B 3P9CA 2CH7A 4XKWA 3EHBB 3HTSB 1WNSA 1J2XA 3MAJA 2EFQA 1LUVA 2HJDA 3B4SA 4RB3C 1F51A 2PF4E 5J9PC 3QYEA 4IOCF 4DYQA 2BBYA 3QYFA 1TVKB 1NK3P 2L01A 3AK2A 4JAVA 3ELKA 2H6CA 1MMAA 3BG3A 2HOSA 3CCLI 2V4JC 2YXYA 3J80N 3HB9A 2CV1A 1D5NA 1PYVA 4F3QA 3AL0C 2ELKA 1Q7YW 5KAFZ 2K4JA 2XSJC 2JSPA 2I10A 1Z91A 2W4SA 3SZGA 2QKLB 3Q3SA 3S2HJ 4GYGA 2K7LA 2OQRA 2QWOB 3WTWC 1YTFD 2N05A 1N0NA 1H8AC 4L9VA 4WCGA 4HNVA 2WWWA 3ECHA 3FFQA 4ZHQB 5CA1B 3K4NA 2Y2ZA 3L73H 1ZYRF 3EQLF 3DLLF 1TC3C 1Z21A 1Z3YA 2CH7B 4U7DA 4NNJA 1Z77A 3PQKA 2HQAA 2XF6A 4YY3O 3L72H 3BR5A 6PAXA 1R3JC 3BQYA 4PK4A 3AFHA 1O3SA 3LUTB 2PY5A 2RJZA 2OTJV 1WCMJ 2N8GA 4HLYA 3WTSC 2EB7A 3J81K 5F6FA 1FBUA 5CYVA 4RUEA 3CC2V 1ZAUA 1L0OC 2N04A 2DMQA 1QPIA 3LDCA 2E5LB 4BL0B 3OM3B 5BY1A 4WFBV 3FXJA 4UB6Z 2UUBB 1MMMA 2Y0SA 1VF9A 5M3FJ 5B1AH 3H0DA 4J00A 2LFSA 3SHFA 3ZPLA 1EBOA 3LQQA 5CVVA 1WAZA 2F4VB 3SXYA 4CUGA 3LSUA 4HQMA 2E76B 3TO7A 1SVLA 1Q6IA 1G6NA 1WN7A 2WPDG 1YHQV 2Q0OA 1KKDA 1JE8A 2LNBA 4DXWA 3WG9A 3FKJA 2QEXI 2VOOA 1WA8A 3MEXA 4EJUA 1X2NA 1HNWB 3G71V 1OCTC 2ZE8A 1D1AA 4MTDA 1VQ6I 1BOBA 4YEJA 3GFIA 3OYCA 2JVHA 2XAFA 2L4AA 1WPXA 1MD0A 3A2FA 2IP2A 1ETKA 2L6LA 4CH7A 2WV0A 1EZVH 2ID6A 2X9DA 4AWXB 3OYNA 1YJNI 2BTOA 4DK1A 1XB4A 2Y30A 2K9SA 5CQGA 3ZHRA 1S5HC 4EVIA 4UUSA 1Z1DA 2FUG2 1A5JA 2J5OA 5D5PA 3AEIA 2W7NA 2V79A 4E7SA 5KAFC 5FKKA 2CRGA 3IH2A 4M9SA 2NVUB 4FQGA 5K7FA 3GVMA 4GDFA 2EV6A 4PDVA 5B1BH 2Y75A 5KAIZ 3VYSB 2BVLA 1IZ3A 4EKWA 1K73W 1PJRA 3OIPA 2XGXA 2X6WA 3BR1A 2E1MC 4M73A 4XLNF 4BHCA 3A01A 4JX6A 3RZDJ 1MMGA 2VXDA 5EG0A 4GFBA 3LSGA 4ESBA 2NN4A 3JD1A 1O3QA 3O3KA 4IKFA 2P5LC 1KECA 1M57C 2RMKB 4XDJA 3H36A 2VLAA 4MNUA 2DTZA 1FFXA 3BCBA 4KHPO 2CV2A 1WGXA 2HHHB 1IXRC 1KYZA 3L7WA 2WC2A 5CBHA 3V7SA 3K03A 1QHTA 5LD2C 1K83J 2QBYB 4LB5A 2Q0AA 1G3SA 3ZHTA 4BQNA 2OYQA 1TTYA 2COBA 1F4NA 2OTLV 3CC4V 4BIZA 2RQQA 4BY1J 1WQ2A 1XG1A 1WJEA 4UV9A 3CMYA 1V55B 5IY5C 4JYAB 2EX3A 3OR2C 2DN0A 3K1MA 4HSRA 1TUEB 1MJ9A 4JI6O 1JA8A 3GX4X 4UB6C 3LSJA 1FZPB 3QWLA 4G7HF 1X58A 4BBSJ 5J1RA 1TWAJ 2Z99A 5K5RA 2LC2A 1SANA 2KQRA 3IV5A 4PD4F 2ZO4A 4QTRA 4J01A 1QBZA 3CMAI 2ZXWH 3ZS8C 4WFEA 2F43G 5L3GA 5LA6B 5D6EA 1MW7A 4A0YA 1FXKC 2AXLA 2XDVA 4D1QA 1VMGA 1HW5A 5F1JA 5EG0B 3JSOA 1W0TA 1GN3A 1GN6A 4BE0A 4PI0A 1FFXB 3U1DA 1D1BA 1UZCA 5JLWA 1NTZH 3FB7C 3O8HA 3CDIA 1TBXA 2XPWA 1L3LA 2C2AA 4BS9A 1P2FA 2F93B 2BZTA 4FE4A 4DR2B 3RKWA 1GHCA 2H1LA 2Z5UA 5H2FZ 1ON2A 2EZKA 2XAUA 4YJ2B 4IOAF 4JI4O 5F27A 4I0XA 2EBIA 1N33O 2QJ1A 1JUPA 1QNTA 1OISA 5DUKA 2LGWA 2F5FA 3JRFA 3CP2A 2HTJA 3RW0A 2DT6A 3M3YJ 4ZYGA 1OCPA
chains in the Genus database with same CATH topology
2A0LA 3DXJF 1R7JA 3IC7A 1NQTA 3V4GA 2QYOA 4I9WA 4I01A 4R8CA 2KIMA 5E17F 1OCCB 5FFXA 3K2ZA 1DLBA 1K34A 1LNWA 1BI0A 2A69F 2QM8A 4WXDA 2FF4A 4LFUA 4QE9A 3QO7A 4Z2YA 1MGTA 3RI4A 4PA7A 4HV5A 2RQPA 3B77A 3ZP5A 1BIAA 4KIBA 4MQVA 4FPPA 2VODA 1MG1A 5EEHA 1VQMV 1O7LA 2RV8A 1R6KA 4XDLA 2GXBA 3CCLV 2FXAA 4ESJA 4M71A 4TWKA 4YFXF 1I5XA 4CO8A 4MGRA 1R22A 4BAYA 3OMAB 1AJNA 2QZ8A 3CCQV 3ERED 2LF7A 2ZR2A 2P6SA 4OIPF 1FFTB 4RGSA 5LRSA 2MLGA 1XGMA 5TJJA 3A0RA 4OINF 3FXQA 3OMIB 4Q5SF 1U78A 2XUBA 3E6MA 1FP2A 4EJWA 1SRYA 3BWGA 1RM1B 5H6RA 4ZH4F 5KUMA 1ZG1A 2D3OW 4R50A 2HKOA 2QEXV 4ESFA 4P9OA 1VQ6V 2WLHA 1W5SA 2Z33A 2XAGA 4U0WA 2ZCWA 2JEXA 2W6JG 1V3FA 4RQFA 1YJNV 1V54B 1MABG 3X2QC 3AG1B 2QQ9A 4Q20A 3I0TA 1K97A 2LP7A 1JGSA 4P2ZA 4AIHA 4WF9V