5IYDO

Human core-pic in the initial transcribing state (no iis)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iydO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iydO02
1NH2D 5IYDO 1RM1B 5IYBO 1YTFC 5IYCO 1NVPC 1YTFD 1RM1C 1NVPD 1NH2C
chains in the Genus database with same CATH superfamily
3F7YC 2IH1C 2JIZG 2WLMA 2F95B 3H1IH 1H2LA 2YIBA 2WA4A 3L71H 4CH3A 4ZKIA 5E79Z 3ZMVA 1XL6A 3QVNA 3RYCA 4XDJA 4TOIA 5JCOC 4UB8Z 4ASUG 3SR2C 3CCEV 4O4IA 2AXTZ 2XAFA 3P3NA 1KECA 1HWYA 1JVMA 2XTAA 4QPKA 4P2ZA 3RWRD 3CRQA 1HNZB 2R9IA 1MMMA 3CP1A 4X1IA 1I7FA 2YI8A 1WP8A 3DSQA 4JI2O 5LA6B 4B3TB 4MVRA 4UCVA 1HR0B 5J2UA 4GT1A 4LFBO 4MT8A 3W7TA 2F43G 2DWEC 1SS3A 5HFMA 1KU9A 1YITV 3SPJA 4X65O 3RYIA 1XMOO 2Q7EA 1V54C 3WB1A 1PP9H 2O57A 4LF8O 4LFAB 5LL6Y 4H0LB 2R9AA 4I0XB 2VS0A 4WFHA 2Y48A 1N4CA 2Q6AA 2GUZA 4UVCA 2EZOA 1M5IA 5EZYB 1GAXA 1X59A 3N2GA 1HNWB 1IZ3A 3QTCA 1NR1A 3KKYA 1GRJA 1ZL8B 1XNRO 1SQFA 5LYJA 3WU2Z 1SQQH 4MVMA 4XDKA 3IC7A 2YXLA 1K4CC 3F5TA 4X64B 1QCEA 1YVWA 4X89A 4GX2A 1LR1A 5D5PA 3LNMB 4CBCA 4DR4B 4FPPA 3T1HB 1ZUQA 2CGOA 4PDMA 4PELA 4X1KA 1FJGO 4YY3B 1BE3H 1NQTA 1COWG 2LGWA 1KKDA 4DRXA 4E4EA 3CEIA 2Q7HA 2HR3A 2WPDG 4ZIBA 4DR5B 2UUAO 2QEXV 3T1YO 1B3QA 4EKWA 3P3PA 1BCCH 3OM3B 5K1XA 4JI0B 2B1IA 3PJSK 5IYDO 1NR7A 4I4TB 1EN5A 2KKWA 1FXHA 2E5LO 2B9ZA 4LNUB 5LGNA 1VIBA 3OTFA 1H2NA 3AG2B 3EFFK 2XAGA 1GKFA 3APOA 3M99B 4BR6A 3OGCC 1Q86W 2JS5A 5GW7A 1QNMA 3OAAG 3CPWU 5EBMC 3JAMN 4RWUA 2DOSA 3H1KH 1YIJV 1G1XB 2Q5ZA 3ZMZA 1OCOC 2F1MA 3FB7C 1AI4A 4DR1B 3QO5A 3G4SV 5LGUA 2DQ3A 1VQNV 2VQFB 1PL0A 4JI5B 4IIJB 2QM4A 5TISZ 1KC8W 1A32A 2EINB 5J2TA 2LP7A 3IAYA 4FLYA 4B3TO 1HR0O 5LP6A 1GN3A 3QO8A 1VQ6V 4QIWF 4N23A 3HB3B 4FLVA 1Q82W 4DW1A 1YTFC 2LFRA 2Y0IA 1YJNV 4ZOLB 5DEDA 3TJTA 1OCRB 5DECA 3CCVV 4UV9A 1GM8A 4FM1A 2AHYA 1Z5WA 2HFEC 4O4HB 4BWAA 1M56B 1VQLV 2JRIA 2N04A 2WLJA 4B3RB 2ITCC 3UT5A 3JD4A 1PD3A 2NNUA 4DK1A 4ZI7B 3OUSA 3DXRA 3IFXA 2ITDC 1XEQA 3ASOC 1MZFA 1N33O 4X8AA 1AI7A 1IURA 5JQGA 1NS1A 1G4YB 4GLXA 3CXCU 4LWSA 3K9AA 1Y76A 1TAEA 5IWAO 1OCZB 4W4LA 1M93A 1WA8B 3J80N 3T2MA 1MZEA 1US6A 3AEIA 4JI7B 1DF4A 2BE3A 1NVPB 1S3JA 1JPXA 1PV0A 1QHTA 1YEWA 2HVJC 4KL1A 4F6EA 4YY3O 2F93B 4UB6Z 3UM7A 4HZ3A 2IBZH 4ZBMA 1GMGA 4BW9A 3CMEV 1VQ7V 1I08A 1NTKH 4DR5O 4MVOA 2QSAA 3OFNG 5JH7A 4RAIA 1MG1A 4TT3G 4FJCC 4WFGA 2DN9A 2ZR2A 4MVZA 2OTJV 4O2BB 4LF4B 5JCOA 2ZXWB 2OT5A 4UVBA 3VQVA 2PI5A 4LC1A 4FLUA 2ZNIA 3HKBA 2RDCA 3L74H 4DXWA 3B8MA 5KHHA 3SJQC 2CUGA 1TVKA 4NYKA 3B77A 4GKKO 3W7UA 3AK2A 4JAAA 4PD4F 3RVYA 1YSCA 2UUCO 5GONB 4DR1O 2IH3C 2EULA 4FK5C 2VQFO 4JI5O 1CEZA 2UU9B 1R3LC 1QU7A 2QWNB 1CP9A 2EBOA 4U3JA 4JAVA 3STLC 3OE7G 1NJIW 1M4UA 5LOVA 1MSWD 3E22A 4J80A 4FFKA 5IE9A 3L72H 1FXKA 3D3IA 1V9PA 1R3KC 2C2AA 2Q0OC 5FNVB 4QPJA 5B3SB 4BIOA 4U7OA 5A9GA 1VQKV 3KG2A 4QE9A 3BAAA 4WBNA 2XASA 1AJQA 3ABLB 1IX9A 2YIAA 1G8MA 1NBMG 3MAQA 2JJ1G 1PNMA 3E2EA 1OHHG 3OUFA 4WFBV 4H33A 4UCTA 1GN6A 3A0BZ 4QE7A 1AR1B 4JYAO 3DGEA 2CH7A 3ZN1A 1N36B 4JI7O 1F23A 4KP4A 3TK1A 2ZE7A 2W0FC 2RN9A 4JI3O 4HNAA 3LNNA 4FMTA 3CC2V 1FAFA 5KAIZ 4TQDA 3RYFB 3FB8C 1MNGA 4JTAB 4WF9V 1Y74A 2DYRB 3JASB 4DV0B 3ETEA 2EJ7A 2XNDG 1RSOA 3B4SA 3W7SA 4OPHA 4LF7B 5EC2C 2WLIA 2H8PC 3ZHVA 3RW0A 1SZTA 5KX5B 3ZHUA 4OGQB 2WLHA 5H2FZ 4LF4O 2OCCB 1R73A 2HP8A 4W4KA 3AG3B 5IYZB 1AJPA 2WLKA 4H44B 5BXZA 1RP3B 2Y4UA 2GV9A 4QJFB 3JD1A 5DM6V 2BSKB 2RJZA 3RN4A 3OTOO 2Y69B 2DYSC 1AP6A 3LSUA 2PGGA 5F2VO 1Q5OA 3BY6A 4TV8A 4YXWG 4X65B 2AW9A 1FFXA 4JI6B 1XMOB 3AG4B 4LF8B 2X6BA 4GYCB 3CD6V 4B3SO 3W7WA 4X1YA 5JJJB 5B1OA 4AQYO 2WLNA 2QJ1A 1PKXA 1B6QA 4DV5O 1P4RA 1NVPD 5LP6C 1D5NA 4PI2A 1TUBA 2IJIA 1YHQV 4TV9A 4O4LB 5IJ9B 4FVMA 1BT8A 2CTWA 2PUSA 4DK0A 4G28B 1JCHA 3O9OA 4CH4A 4IHJA 2UXBB 1SC5B 2Q68A 2QE7G 4DV4O 2WLLA 4O4JB 2HLDG 2EIKB 2ZCEA 1Q6HA 2QKCA 2UUBB 1NH2D 2GSMB 3A8TA 4MW8A 2G38A 2BTOA 1OJHA 2RQ6A 4JI4B 1PNKA 3TXQA 4FZ0A 1ZTEA 2XT9A 3FX7A 4GX1A 3SYOA 3U11A 1FJGB 5KUMA 2Q8VA 3GWOA 2HJFC 1BHBA 3CC7V 1N36O 3CRCA 3ZHQA 3OMIB 5CA1A 1GN2A 5LHHA 5H6QA 3NXSA 3QNEA 4DUZO 1N32O 2ZIOA 2A7WA 4Q20A 2E76B 3B40A 4FLTA 4DV0O 4EB6B 3TCUA 1V54B 1M1KW 3ZIAG 4HYOA 1VARA 5E1AC 3ZRWA 4LF7O 4JZGA 2QM7A 2D3OW 5KHIA 3F7VC 3WG7B 2L6LA 3Q4HA 4NTXA 4Z1VA 4PA3A 4J7ZA 4I55A 4KFMA 1IDSA 1UJWB 3G71V 2CK3G 3OGIB 4DV1B 3ZEDA 5C8YB 2AZ2A 3AK1A 2EX3A 1VQMV 4D6TH 1DTOA 1V55C 3E35A 1SA0A 2FB5A 2H94A 4JV5B 1BGYH 4JZ2A 1QVFU 2WAMA 1VMGA 1Q6IA 1QLEC 2P4VA 5IT9N 1FS0G 4H13B 2P22C 3CRAA 3ZRXA 4X20A 1WLEA 5CA3A 4JI6O 2OYQA 3CCJV 1Q6UA 4DYLA 4C7UA 5CA0B 1QVGU 1NZ6A 1Y66A 1WAZA 2UXNA 4YJ2A 5L3EA 3ZMSA 1W0KG 3G67A 4JTCB 1AJNA 1K9MW 3RYHA 2HKOA 3E8HA 4P30A 1YF2A 1R6TA 3JALB 2PYLA 3SYPA 3SPHA 1FXKC 4J7JA 5JVDB 1NTMH 2UXCO 3T4ZA 5BMVA 1N33B 4L87A 2Q7GA 2QTOA 5IJ0B 4DV7B 3EVKA 2ADQB 3IGAC 2UXBO 1OV9A 2OIEA 1MSDA 2D2CB 3CCRV 3HKEB 4AHCA 1VQ9V 5IWAB 4GUNA 1YJWV 2UUBO 1WB8A 3HKCA 2ZDIA 5LXTA 3C90A 3J81N 4WCEV 1L1FA 4JI4O 1PNLA 4IGGA 2W6IG 4B7EA 4DR2O 2E74B 1OCOB 3ZMUA 2PY5A 1K3EA 1CXZB 3LUTB 1CPYA 3CCUV 2CTPA 5IYBO 3CCMV 4KXRA 4QNHB 3CE2A 3LDDA 1SQVH 2WA3A 4YIPA 1M90W 2ZQMA 1KD1W 5GTIZ 1KP3A 1I5XA 1XILA 3NR7A 3ZJZA 1BZKA 3N27A 1BQ0A 2NR5A 2N74A 1FKAO 1DGSA 1X4TA 2YS8A 5JJNB 3B09A 4FLWA 1XHXA 4PA4A 3E8BA 4UCUA 3ZHRA 2KG7B 2Z3YA 4D7SA 1BSMA 4TQFA 4GKKB 1SF9A 3KCYA 3ASOB 4R8CA 3GWKC 3L73H 2UUCB 4DV1O 1RM1C 5ITZB 3BA8A 1SETA 2IU3A 2JGUA 2ADPA 2EILB 3CCSV 2FMLA 4JV5O 4X62B 2EIJB 3N2KA 5KHJA 3FKSG 1H2GA 4PA6A 1I94O 1JQ0A 2XOKG 1MABG 2RCVA 1EFRG 3FAVA 2BTQB 1NI8A 2QWPB 3CRMA 1AROP 3CCLV 1ROPA 5AG2A 4YHHB 5CB4A 4LR3A 4I50B 1BS3A 2A9HA 4XDLA 3VQXA 3HKDB 2ZT9B 4JF3A 5EYPB 3ETDA 1AR5A 4FFBA 3AG2C 4PA7A 4TUYB 1H38A 4DV7O 3APQA 2LQTA 3JAWB 3FFQA 2ZM6O 2ZNJA 3H01A 4R6ZA 4LF9O 3ZRSA 1IXMA 4O2AB 1K4DC 4JYAB 3D36A 2FL4A 1THZA 4JTDB 4TSFG 4ZHQA 3ABMC 4JI3B 2HHHB 4MVQA 3JSNA 3RYCB 1N0JA 1EM1A 2EINC 2RMKB 4O4IB 2A79B 1WNSA 2Y0PA 2QDOA 4J10A 2YICA 4TWKA 1QR8A 2QKAA 4F6RA 2GTSA 2DQ0A 4X1IB 1FPOA 3S3WA 1I0HA 2MW2B 1IVSA 4RO2A 1OCRC 5J2UB 5B66Z 5L3BA 4B08A 4I9QA 2V1DA 3UO3A 2YEVA 1L0NH 3RYIB 1SESA 1Y67A 3ABKB 3JARA 4E2LA 3QG5A 4U7NA 2YXHA 1D5AA 2JGDA 1B04A 4Z2WA 1FYJA 2EIMC 5KUKA 3OTOB 2GUZB 1S77D 4PDRA 2PZSA 4NR1A 1EN4A 1YXBA 2HVKC 1JFFA 2QM8A 2IJKA 3N2GB 5L3GA 1OCZC 3CCQV 1ZWIC 1DK1A 3OMNB 2R70A 5LYJB 1JOYA 3LSSA 3JATA 1S5JA 3SJAC 4X62O 1NVPC 1K92A 4GZRB 5KMGA 2Z5UA 4B3SB 2Y4TA 1WN7A 1M57C 3BPZA 4AQYB 1OZ0A 3SJCC 5B1BC 4MVSA 4DV5B 3WB0A 3FD9A 5IY5B 1AVMA 1XNQB 5EK0A 4BIZA 2HJDA 1JX9A 3JAKA 4YJ3A 4LCUC 1TUEB 4X66B 4PJ0Z 3CJHA 4YHHO 1XBLA 4X1KB 4FM2A 2Q9LA 1K34A 2P5OA 5K1PA 2F23A 1NH2C 4NVPA 1SERA 2F66C 3K08A 4DRXB 1AI6A 3MD0A 4DV4B 5BZBA 3ZHSA 2UXDB 1H2MA 4MTXA 1VQ5V 1W0JG 4MS2A 4X9QA 3VQYA 4DR3B 4DV6O 4EEQA 1T5EA 5LHIA 3K04A 5LA6A 3LDEA 1AILA 3AG1C 2GDSA 1LUWA 2IJJA 2A3QA 4LF6O 2XAJA 2X7RB 1E79G 2ZDIC 2CGNA 3FB6C 3HPLC 2M6YA 1SQPH 1P49A 2HHHO 3JCZA 5LGTA 2DYSB 4DUZB 1N32B 2NN4A 3SDLA 1YJ9V 3VQWA 4I0XA 2VRZA 1R1BA 5EZYA 3W7XA 3JALA 2ATKC 1DLBA 2P6JA 3X2QB 5J2TB 2QWRB 1YI2V 1M9NA 2JEXA 3L70H 1ZL8A 1XI1A 2Q67A 2HEPA 5LP6B 2WSSG 3ZCCA 4K0KO 1OCCB 4RQEA 5B3SC 5BY1A 2OCHA 3K59A 3CC4V 4DV2B 3I56V 2CTQA 2OWOA 3GB7C 1R6NA 3L9DA 4DO2A 5LBQA 3ABLC 1SRYA 1GN4A 4K3AA 3UT5B 2JJ2G 4DR7B 5B1AC 4MSWC 1S5LZ 3DXRB 1EZVH 4DR6B 2IJHA 4RUEA 1JJOA 1UPGA 1QBZA 2BOCC 5JQGB 3OR6C 4LWSB 1Y76B 3RT3C 4I4TA 5LMNB 3KCXA 4N21A 5KAFZ 4LNUA 3SYCA 3CMAV 5FL7G 1XNQO 2DYRC 2JK5C 1IXBA 1HNXO 4LH7A 4MTGA 2DWDC 4X66O 3STZC 3SPCA 3GVMA 2UXCB 1Y4MA 2X6CA 5DN6G 1RPOA 4DUYB 3QF7A 1D2DA 2P90A 4HAMA 3ZRVA 2UXXA 3LDCA 2OCCC 3AG3C 2MK3A 2H3OA 2UXDO 1WB7A 4K8XA 5JH7B 2RNBA 3I5DA 4DR3O 4IIJA 1QQCA 2LO1A 4B7KA 1KMIZ 2AZ0A 4DR2B 5CMUA 2FKXA 2QR4A 1Q81W 2OTLV 1RFYA 2Q0AA 4J41A 3T1CA 1W2BU 2PYJA 4JGSA 2F4VB 2FTKA 3ASNC 3HKBB 4P9OA 2LFSA 4IYHA 2IM9A 4Q6GA 2X0LA 4ZOLA 1TVKB 4JYBA 4G27B 3D36C 1IBKO 4DW0A 1KKCA 1ZAUA 1QLNA 4O4HA 2QA4V 3AG4C 3K5OA 1S72V 1EN6A 4PDLA 1PL4A 1S76D 3JD0A 4ZI7A 3CRRA 4U3JB 3OEHG 5KHKA 1FD9A 1VF7A 2GTAA 5LOVB 3E22B 4XBFA 2OIGA 4LP8A 5D5QA 3RVZA 3OD4A 3H1HH 5EIBD 2E75B 1FXKB 1J95A 1VQPV 1XDCA 2V4DA 1XMQO 4YIOA 1WA8A 4UUJC 4DV2O 5H5NA 2VQEO 1VF5B 2EIKC 1SQGA 3K5NA 1O9HA 3QO7A 3ZHTA 2NLJC 5C93A 1HW7A 4DR7O 2JS3A 2DE0X 4WBNB 2PTMA 4DR6O 1IBLO 1I94B 4R50A 1PPJH 1SQBH 3UO2A 1IBMO 2VWJA 3OEEG 4OX9O 4ICGA 4J9ZB 2ETNA 4O2BA 5LMNO 2ILMA 3K57A 1P7BA 2ZE8A 2LW1A 2CH7B 3E8FA 2B5UA 2CE4A 1R6KA 2Q73A 4WFEA 2EZPA 5LHGA 3A2FA 4HNAB 4DUYO 2K9PA 4FZ1A 4JYCA 2XHBA 4PI0A 3WG7C 1L0LH 2DMXA 1Y74B 2QTSA 2YXYA 3C3SA 3M7MX 3SYQA 1ZX3A 2ZM6B 2QWOB 1RSOB 5GONA 1JJ2U 2WLIB 2IU0A 4LF9B 4NTYA 4FIPC 1YCIA 3BRCA 5JWPA 1J5EB 1F4NA 1K8AW 3S3XA 4L8JA 1S0VA 1RM1B 4B3MB 4NKGB 2F4VO 3A0HZ 5KHGA 1FXVA 2N05A 4I5SA 1ORQC 1VF6C 3RGBA 1XHZA 3JCUZ 2ZE5A 1K97A 1O9GA 2IW5A 5FNVA 1EBOA 3SYAA 3E86A 3CYOA 4J42A 2XUMA 1YTFB 1JMKC 3CB2A 1KBHA 3SGIA 4KHPB 2DJVA 1XREA 3R66A 3DC5A 5L3FA 4TV8B 4CH5A 1Q7YW 1FFXB 3EHBB 2E3CA 1W59A 2ZINA 4PA9A 3UCSC 4X1YB 2YIDA 3C3TA 1BHAA 1GM7A 2M7WA 1Y6XA 3OW2U 4LF5B 1G6UA 2KQXA 4UFZA 2JEUA 3RFRA 2ARHA 1TUBB 3FYEB 4EFEA 2GBOA 1WPBA 5EBLC 5CBGA 4TV9B 4UV8A 1VEWA 3P30A 5CN0A 3ABUA 1N8RW 3BABA 1B06A 1H2KA 2X6AA 3BCCH 1URFA 4IHJB 1H8EG 3WB2A 3JD3A 2WLLB 3RYFA 3D3QA 1EZJA 2CAZC 3JASA 4BIUA 4JASA 3SPGA 3ABMB 1HNZO 1GTOA 5KX5A 1AI5A 2YUAA 1BQZA 3VBBA 4MVUA 2P67A 3DC6A 5IYZA 5IYCO 1BMFG 5J9PC 5CA1B 4LFAO 3B8NA 3TETA 3R65A 4CC6A 1NTZH 5EC1C 2BSKA 4IT5A 4DV6B 1P7GA 3LSQA 1K7DA 5EBWC 3MHSC 1JR9A 3ZRWB 3ICXA 3K5LA 5GTHZ 1XUQA 2LW7A 2ZIMA 2A0LA 1HNWO 4OPAA 3OMAB 2EIMB 3Q4HB 1J5EO 4LF6B 2AHZA 5BR8B 2BCCH 3ZS8C 1HP8A 3MDSA 4MTOA 2Z0AA 4I55B 2P4KA 4B3MO 3PN1A 3CHXA 4X64O 2EILC 1E1QG 2HG5C 5H9CA 4PV1B 1K33A 2EIJC 3CWBH 4DR4O 3T1HO 4NXMB 3OT7A 1DF5A 3AG7A 4LH6A 3K0GA 4O4LA 5IJ9A 3CS5A 3OR7C 1M57B 1SA0B 1XQ8A 4WFFA 5B1BB 1NU1H 3L75H 4K0KB 4KHPO 1M56C 4X20B 3T4DA 4O4JA 3ZN0A 1SQXH 4FM0A 1N0NA 5FPOA 3FB5C 3P32A 4JI0O 1ZSPA 1I5YA 5KLVH 1LNQA 1NH2B 2QGNA 4Z1MG 4YJ2B 3ABTA 3I55V 4LF5O 3M8AA 4RQFA 3RYHB 1GO3F 4JI1B 3AK3A 4R7CA 4U3FH 3K3WA 1F4MA 2KSDA 3BFRA 3E83A 3BHPA 3E89A 5KA5A 1LUVA 5BMVB 1VQ4V 1FFTB 4JPRA 3AG1B 2YDEA 4LFCB 1MOFA 2W0XA 4UVAA 1KUQA 3U0ZA 1U97A 3HKCB 4EB6A 4AI8A 1R3JC 5LXTB 1SKVA 3WFVA 3A0RA 1KYOF 2WWWA 1HNXB 2A06H 1AP5A 1NT2B 4IL6Z 2DW4A 2CTRA 1L8DA 1K5QA 4WFAV 4GKJB 2L35A 1XOUA 5LMUB 1WP7A 3K06A 3K79A 4K8ZA 1P84F 2ZXWC 1MA1A 4NXNB 1QR9A 5C8YA 4BAYA 3E8GA 1N34B 2B1GA 4BW5A 3ABKC 1YTFD 4KUMA 4UCRA 1YDXA 4UCSA 4B3RO 1Q8IA 5CBFA 3D8CA 3JYCA 4GCZA 4CZZA 3TGUH 5JJEB 1VF6A 4JI8B 4PDVA 3CX5F 4HBNA 3H1LH 5BR8O 3K03A 4J9YB 5B1AB 5CA0A 2ZKOA 3TXSA 1XL4A 1U96A 1IBKB 3ETGA 1F51A 2QWQB 2Q69A 1VQ8V 3G80A 1PM9A 4UXNA 1UFIA 2ODMA 3ZX6A 2W6JG 4J7KA 4NXMO 3HR0A 2FYUH 3MHHC 4I7ZB 3RBZA 4DV3B 5JVDA 4CS4A 5EIBC 4MW3A 5IY5C 3N2KB 1VP7A 5IJ0A 3G6EV 3ETQA 3BEHA 4PHZA 4CC5A 4CS3A 5A2QN 1XMQB 3HKEA 3FAVB 2PI4A 2CDYA 1GM9A 2ZD9A 2VQEB 2YC0A 4GX5A 5FPRA 5L3CA 1Q90D 2KB1A 2R9RB 2V7QG 4LBEC 5CB4B 1BL8A 2XAHA 4JI1O 4MTFA 2LJ2A 3G6BA 4QGPA 3FYIB 2XAQA 1Z2GA 5L3DA 1IBLB 4FFBB 3ZBHA 1IBMB 1SZXA 4OX9B 4JYYA 2YSUB 2LGQA 4LFCO 1TGOA 5IDJA 1WPXA 1KP2A 4FLZA 3ASNB 4JI2B 4IYIA 3ZMTA 4LFBB 2UU9O 1S5HC 2ZR3A 3K58A 1ZLZA 3CXHF 2YIBD 3DTUB 3K9SA 3UQ8A 1GH6A 1F7YA 4AILC 1VQOV 4ZHQB 4H37A 1AR4A 4I9WA 4JAUA 4NB5A 4GKJO 1ENVA 1RPRA 3X2QC 3H9VA 2KG7A 2Q4PA 5B5EZ 1K5SA 5LMUO 1HDJA 3K0DA 3UKMA 1H8HG 3BVOA 1KQSU 3CSXA 4NXNO 1R3IC 1OCCC 4NTWA 2BOBC 4F6RB 1Q3EA 1WJZA 5ITZA 1N34O 3H1JH 5HFLA 1Q43A 3JD2A 4P9PA 4EFBA 4K35A 4OXSA 2K1EA 3B2EE 1GK9A 1KB9F 1XNRB 1H2SB 2JVDA 3IC9A 2YEVB 4JI8O 3F5WC 2VWKA 3JARB 4J11A 2Y69C 1AB3A 4UCOA 1V55B 3BA9A 5CBHA 1NKDA 4F4LA 2BTQA 3KZIZ 2JGDB 3THOA 3U10A 5B1NA 3SPIA 2PF4E 3SJBC 4CH6A 4ABMA 1QLEB 3JSLA 3O65A 3K5MA 2ZE6A 1JFFB 2EJRA 4A5UB 4I50A 2P7TC 2QKSA 3EXAA 4X88A 5H6RA 3HKDA 2UUAB 4FLXA 4DV3O 3T1YB 3ML0A 3JATB 5EYPA 1E1RG 3J7AU 4GX0A 4TUYA 4G2KA 5KMGB 1YZBA 3IJ4A 3JAWA 1TA8A 4CS2A 2YI9A 2P06A 2R72A 5FLXN 2JDIG 2E5LB 3VOUA 4D7TA 1JA8A 1Z5VA 4RUFA 5KA6A 3JAKB 2GHYA 2AGAA 4YJ3B 4O2AA 1K73W 3CJHB
chains in the Genus database with same CATH topology
3F7YC 2JEUA 2IH1C 2JIZG 2WLMA 3FYEB 5EBLC 2EIMC 5CBGA 5KUKA 4ZKIA 4QJFB 4UV8A 3P30A 3JD1A 3ZMVA 1XL6A 5CN0A 5DM6V 3ABUA 1S77D 1N8RW 4PDRA 4XDJA 4ASUG 2HVKC 2QM8A 2X6AA 3CCEV 2IJKA 2XAFA 1H8EG 5L3GA 1OCZC 3CCQV 3JD3A 1ZWIC 1KECA 1HWYA 2WLLB 1JVMA 2Y69B 1EZJA 3OMNB 4QPKA 4P2ZA 2DYSC 1JOYA 2R9IA 3LSSA 3CP1A 4BIUA 1NVPC 4JASA 1K92A 3SPGA 3ABMB 2Z5UA 3BY6A 4MVRA 4YXWG 1GTOA 1M57C 4GT1A 3AG4B 4MT8A 1OZ0A 2X6BA 3W7TA 1AI5A 2F43G 2DWEC 5HFMA 5B1BC 4MVSA 3CD6V 3W7WA 5IY5B 1YITV 3SPJA 5EK0A 3VBBA 4MVUA 1JX9A 5B1OA 4BIZA 1V54C 2P67A 2WLNA 4LCUC 1TUEB 1PKXA 5IYCO 1B6QA 1P4RA 1NVPD 1BMFG 5J9PC 1K34A 2IJIA 1YHQV 4WFHA 2Y48A 3B8NA 3TETA 3R65A 1NH2C 2Q6AA 1SERA 3K08A 5EC1C 4UVCA 2EZOA 1AI6A 3MD0A 5BZBA 4G28B 1JCHA 3LSQA 1K7DA 5EBWC 2Q68A 2QE7G 4MTXA 2WLLA 1NR1A 1VQ5V 3MHSC 1W0JG 4MS2A 2HLDG 3ZRWB 2EIKB 4MVMA 2A0LA 4XDKA 3IC7A 1NH2D 3OMAB 2EIMB 5LHIA 2GSMB 4MW8A 1K4CC 2AHZA 3K04A 3LDEA 3AG1C 1QCEA 1PNKA 4X89A 4GX2A 4MTOA 4GX1A 2IJJA 3LNMB 3SYOA 2XAJA 4CBCA 2X7RB 1E79G 2EILC 4FPPA 5KUMA 1E1QG 2ZDIC 3GWOA 2HG5C 2HJFC 5H9CA 3FB6C 1BHBA 1K33A 3HPLC 4PDMA 3CC7V 2EIJC 3JCZA 5LGTA 2DYSB 1YJ9V 4PELA 3OMIB 1NQTA 1DF5A 1COWG 5LHHA 5H6QA 3K0GA 3NXSA 1KKDA 3QNEA 3OR7C 1M57B 2HR3A 2WPDG 4Q20A 2QEXV 4WFFA 3W7XA 5B1BB 2ATKC 1DLBA 4EKWA 3OM3B 2P6JA 3X2QB 3TCUA 1V54B 1M56C 1M1KW 3T4DA 3ZIAG 4HYOA 3ZN0A 1YI2V 1M9NA 5E1AC 2JEXA 3ZRWA 2B1IA 3PJSK 5IYDO 2Q67A 1NR7A 2QM7A 2D3OW 1FXHA 2WSSG 3ZCCA 3FB5C 3F7VC 1OCCB 3P32A 3WG7B 4RQEA 5B3SC 5LGNA 1I5YA 1LNQA 1NH2B 4Z1MG 3AG2B 3ABTA 3EFFK 3I55V 2XAGA 4PA3A 4RQFA 3CC4V 3I56V 1GKFA 3GB7C 3M99B 3OGCC 1R6NA 1Q86W 1GO3F 5GW7A 4R7CA 3K3WA 4DO2A 3OAAG 3CPWU 1F4MA 4KFMA 5LBQA 1UJWB 5EBMC 3ABLC 3G71V 2CK3G 3E83A 1SRYA 3E89A 5KA5A 2JJ2G 1YIJV 1VQ4V 5B1AC 4MSWC 3ZMZA 1OCOC 3FB7C 1VQMV 1AI4A 1FFTB 4JPRA 3AG1B 3QO5A 3G4SV 1MOFA 5LGUA 1DTOA 1V55C 2DQ3A 3E35A 2IJHA 1VQNV 1PL0A 4RUEA 2H94A 1QBZA 1QVFU 2BOCC 4UVAA 2WAMA 1QLEC 1KC8W 3OR6C 2EINB 1FS0G 1R3JC 2LP7A 3ZRXA 3WFVA 1WLEA 3A0RA 5CA3A 2WWWA 3CCJV 3QO8A 1VQ6V 4QIWF 4N23A 2DW4A 4N21A 1QVGU 3HB3B 1Y66A 3SYCA 2UXNA 3CMAV 1Q82W 5FL7G 1K5QA 2DYRC 2JK5C 1YTFC 5L3EA 3ZMSA 4WFAV 2LFRA 4MTGA 1W0KG 4JTCB 2DWDC 1YJNV 1AJNA 3STZC 1K9MW 3SPCA 1OCRB 2HKOA 3CCVV 1Y4MA 4UV9A 3E8HA 1GM8A 4P30A 3K06A 2X6CA 2AHYA 1RPOA 3K79A 5DN6G 2HFEC 2P90A 2ZXWC 1M56B 3SYPA 4HAMA 3SPHA 1FXKC 1VQLV 2WLJA 3ZRVA 1QR9A 2ITCC 3T4ZA 4BAYA 3JD4A 2UXXA 1PD3A 3E8GA 2B1GA 2NNUA 3LDCA 2OCCC 4BW5A 3ABKC 3AG3C 4L87A 2MK3A 3OUSA 2QTOA 1YTFD 4KUMA 3IGAC 3IFXA 2ITDC 5CBFA 3ASOC 3JYCA 3CCRV 4GCZA 4CZZA 4X8AA 1AI7A 1VQ9V 1YJWV 1G4YB 4PDVA 2ZDIA 3CXCU 5CMUA 3K9AA 4WCEV 1L1FA 1PNLA 1Q81W 3K03A 1OCZB 2OTLV 2W6IG 3T1CA 1W2BU 4J9YB 5B1AB 4JGSA 3T2MA 2FTKA 1OCOB 3ASNC 1XL4A 3AEIA 3ZMUA 4P9OA 1DF4A 2LFSA 1K3EA 1F51A 3ETGA 1NVPB 1S3JA 1JPXA 2Q69A 3LUTB 1CPYA 2X0LA 3CCUV 1VQ8V 4UXNA 2HVJC 4JYBA 4G27B 5IYBO 2W6JG 3CCMV 1QLNA 3MHHC 2QA4V 3AG4C 3UM7A 4QNHB 4HZ3A 4ZBMA 1GMGA 1S72V 3RBZA 3CMEV 3LDDA 4PDLA 1VQ7V 4MW3A 5IY5C 1S76D 4MVOA 3JD0A 3G6EV 2ZQMA 3OFNG 1M90W 1KD1W 3OEHG 1KP3A 1I5XA 4RAIA 1MG1A 3BEHA 4TT3G 4FJCC 4WFGA 3ZJZA 4XBFA 2ZR2A 4MVZA 4LP8A 2OTJV 2PI4A 3RVZA 1GM9A 2ZD9A 2ZXWB 2OT5A 4GX5A 1VQPV 1FXKB 1J95A 4PA4A 5L3CA 4UVBA 2KB1A 3E8BA 2R9RB 2V7QG 4LBEC 2PI5A 4UUJC 4LC1A 2Z3YA 1BL8A 2XAHA 2EIKC 4MTFA 4DXWA 3B8MA 3QO7A 3ASOB 4R8CA 3SJQC 2NLJC 1RM1C 3FYIB 3B77A 2XAQA 5L3DA 5C93A 1SETA 3W7UA 2IU3A 3RVYA 1YSCA 2YSUB 2EILB 2IH3C 4FK5C 3CCSV 1CEZA 4R50A 5IDJA 1WPXA 1KP2A 1R3LC 2EIJB 1CP9A 3ASNB 3OEEG 2EBOA 3FKSG 4J9ZB 1H2GA 4JAVA 3STLC 4PA6A 3OE7G 1NJIW 3ZMTA 1JQ0A 1S5HC 2XOKG 1MABG 2ZR3A 1MSWD 1EFRG 3DTUB 1P7BA 1VQOV 4H37A 1AROP 1FXKA 3CCLV 4I9WA 4JAUA 1ROPA 3D3IA 3E8FA 2B5UA 1ENVA 1RPRA 3X2QC 1R3KC 1R6KA 4WFEA 2C2AA 1K5SA 2EZPA 5LHGA 2A9HA 3K0DA 3UKMA 1H8HG 4JYCA 1KQSU 4XDLA 4QPJA 5B3SB 1R3IC 3WG7C 1OCCC 2BOBC 4JF3A 4U7OA 3SYQA 3ETDA 5HFLA 3AG2C 1VQKV 4PA7A 3KG2A 3JD2A 1H38A 4P9PA 4QE9A 4OXSA 1JJ2U 2K1EA 1GK9A 2WLIB 2IU0A 2XASA 4FIPC 1AJQA 3ABLB 3H01A 4R6ZA 2YEVB 1G8MA 1NBMG 1F4NA 1K8AW 3F5WC 2JJ1G 3ZRSA 1IXMA 1PNMA 1S0VA 1K4DC 1OHHG 3E2EA 2Y69C 3OUFA 1RM1B 1V55B 5CBHA 3D36A 1NKDA 4F4LA 4WFBV 4H33A 4QE7A 5B1NA 1AR1B 3SPIA 1THZA 4JTDB 4TSFG 3DGEA 3ABMC 1FXVA 3ZN1A 1QLEB 4I5SA 1F23A 4KP4A 4MVQA 1ORQC 2EINC 3TK1A 2EJRA 2W0FC 1K97A 2P7TC 2A79B 2QKSA 2IW5A 4FMTA 4X88A 3CC2V 4TWKA 1EBOA 3SYAA 5H6RA 3E86A 3CYOA 1QR8A 3FB8C 4WF9V 4JTAB 3ML0A 2DYRB 1YTFB 2DQ0A 3ETEA 1E1RG 2XNDG 4GX0A 4G2KA 3W7SA 5L3FA 4RO2A 1OCRC 2H8PC 2WLIA 5EC2C 1Q7YW 3RW0A 3EHBB 1SZTA 5L3BA 2V1DA 2JDIG 2WLHA 4PA9A 3VOUA 2YEVA 4RUFA 5KA6A 2GHYA 1SESA 2OCCB 1BHAA 1R73A 3AG3B 1GM7A 3ABKB 4E2LA 2M7WA 4U7NA 3OW2U 1K73W 1AJPA 2WLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 D;  5IYD O;  1RM1 B;  5IYB O;  1YTF C;  5IYC O;  1NVP C;  1YTF D;  1RM1 C;  1NVP D;  1NH2 C; 
#chains in the Genus database with same CATH topology
 3F7Y C;  2IH1 C;  2JIZ G;  2WLM A;  2F95 B;  3H1I H;  1H2L A;  2YIB A;  2WA4 A;  3L71 H;  4CH3 A;  4ZKI A;  5E79 Z;  3ZMV A;  1XL6 A;  3QVN A;  3RYC A;  4XDJ A;  4TOI A;  5JCO C;  4UB8 Z;  4ASU G;  3SR2 C;  3CCE V;  4O4I A;  2AXT Z;  2XAF A;  3P3N A;  1KEC A;  1HWY A;  1JVM A;  2XTA A;  4QPK A;  4P2Z A;  3RWR D;  3CRQ A;  1HNZ B;  2R9I A;  1MMM A;  3CP1 A;  4X1I A;  1I7F A;  2YI8 A;  1WP8 A;  3DSQ A;  4JI2 O;  5LA6 B;  4B3T B;  4MVR A;  4UCV A;  1HR0 B;  5J2U A;  4GT1 A;  4LFB O;  4MT8 A;  3W7T A;  2F43 G;  2DWE C;  1SS3 A;  5HFM A;  1KU9 A;  1YIT V;  3SPJ A;  4X65 O;  3RYI A;  1XMO O;  2Q7E A;  1V54 C;  3WB1 A;  1PP9 H;  2O57 A;  4LF8 O;  4LFA B;  5LL6 Y;  4H0L B;  2R9A A;  4I0X B;  2VS0 A;  4WFH A;  2Y48 A;  1N4C A;  2Q6A A;  2GUZ A;  4UVC A;  2EZO A;  1M5I A;  5EZY B;  1GAX A;  1X59 A;  3N2G A;  1HNW B;  1IZ3 A;  3QTC A;  1NR1 A;  3KKY A;  1GRJ A;  1ZL8 B;  1XNR O;  1SQF A;  5LYJ A;  3WU2 Z;  1SQQ H;  4MVM A;  4XDK A;  3IC7 A;  2YXL A;  1K4C C;  3F5T A;  4X64 B;  1QCE A;  1YVW A;  4X89 A;  4GX2 A;  1LR1 A;  5D5P A;  3LNM B;  4CBC A;  4DR4 B;  4FPP A;  3T1H B;  1ZUQ A;  2CGO A;  4PDM A;  4PEL A;  4X1K A;  1FJG O;  4YY3 B;  1BE3 H;  1NQT A;  1COW G;  2LGW A;  1KKD A;  4DRX A;  4E4E A;  3CEI A;  2Q7H A;  2HR3 A;  2WPD G;  4ZIB A;  4DR5 B;  2UUA O;  2QEX V;  3T1Y O;  1B3Q A;  4EKW A;  3P3P A;  1BCC H;  3OM3 B;  5K1X A;  4JI0 B;  2B1I A;  3PJS K;  5IYD O;  1NR7 A;  4I4T B;  1EN5 A;  2KKW A;  1FXH A;  2E5L O;  2B9Z A;  4LNU B;  5LGN A;  1VIB A;  3OTF A;  1H2N A;  3AG2 B;  3EFF K;  2XAG A;  1GKF A;  3APO A;  3M99 B;  4BR6 A;  3OGC C;  1Q86 W;  2JS5 A;  5GW7 A;  1QNM A;  3OAA G;  3CPW U;  5EBM C;  3JAM N;  4RWU A;  2DOS A;  3H1K H;  1YIJ V;  1G1X B;  2Q5Z A;  3ZMZ A;  1OCO C;  2F1M A;  3FB7 C;  1AI4 A;  4DR1 B;  3QO5 A;  3G4S V;  5LGU A;  2DQ3 A;  1VQN V;  2VQF B;  1PL0 A;  4JI5 B;  4IIJ B;  2QM4 A;  5TIS Z;  1KC8 W;  1A32 A;  2EIN B;  5J2T A;  2LP7 A;  3IAY A;  4FLY A;  4B3T O;  1HR0 O;  5LP6 A;  1GN3 A;  3QO8 A;  1VQ6 V;  4QIW F;  4N23 A;  3HB3 B;  4FLV A;  1Q82 W;  4DW1 A;  1YTF C;  2LFR A;  2Y0I A;  1YJN V;  4ZOL B;  5DED A;  3TJT A;  1OCR B;  5DEC A;  3CCV V;  4UV9 A;  1GM8 A;  4FM1 A;  2AHY A;  1Z5W A;  2HFE C;  4O4H B;  4BWA A;  1M56 B;  1VQL V;  2JRI A;  2N04 A;  2WLJ A;  4B3R B;  2ITC C;  3UT5 A;  3JD4 A;  1PD3 A;  2NNU A;  4DK1 A;  4ZI7 B;  3OUS A;  3DXR A;  3IFX A;  2ITD C;  1XEQ A;  3ASO C;  1MZF A;  1N33 O;  4X8A A;  1AI7 A;  1IUR A;  5JQG A;  1NS1 A;  1G4Y B;  4GLX A;  3CXC U;  4LWS A;  3K9A A;  1Y76 A;  1TAE A;  5IWA O;  1OCZ B;  4W4L A;  1M93 A;  1WA8 B;  3J80 N;  3T2M A;  1MZE A;  1US6 A;  3AEI A;  4JI7 B;  1DF4 A;  2BE3 A;  1NVP B;  1S3J A;  1JPX A;  1PV0 A;  1QHT A;  1YEW A;  2HVJ C;  4KL1 A;  4F6E A;  4YY3 O;  2F93 B;  4UB6 Z;  3UM7 A;  4HZ3 A;  2IBZ H;  4ZBM A;  1GMG A;  4BW9 A;  3CME V;  1VQ7 V;  1I08 A;  1NTK H;  4DR5 O;  4MVO A;  2QSA A;  3OFN G;  5JH7 A;  4RAI A;  1MG1 A;  4TT3 G;  4FJC C;  4WFG A;  2DN9 A;  2ZR2 A;  4MVZ A;  2OTJ V;  4O2B B;  4LF4 B;  5JCO A;  2ZXW B;  2OT5 A;  4UVB A;  3VQV A;  2PI5 A;  4LC1 A;  4FLU A;  2ZNI A;  3HKB A;  2RDC A;  3L74 H;  4DXW A;  3B8M A;  5KHH A;  3SJQ C;  2CUG A;  1TVK A;  4NYK A;  3B77 A;  4GKK O;  3W7U A;  3AK2 A;  4JAA A;  4PD4 F;  3RVY A;  1YSC A;  2UUC O;  5GON B;  4DR1 O;  2IH3 C;  2EUL A;  4FK5 C;  2VQF O;  4JI5 O;  1CEZ A;  2UU9 B;  1R3L C;  1QU7 A;  2QWN B;  1CP9 A;  2EBO A;  4U3J A;  4JAV A;  3STL C;  3OE7 G;  1NJI W;  1M4U A;  5LOV A;  1MSW D;  3E22 A;  4J80 A;  4FFK A;  5IE9 A;  3L72 H;  1FXK A;  3D3I A;  1V9P A;  1R3K C;  2C2A A;  2Q0O C;  5FNV B;  4QPJ A;  5B3S B;  4BIO A;  4U7O A;  5A9G A;  1VQK V;  3KG2 A;  4QE9 A;  3BAA A;  4WBN A;  2XAS A;  1AJQ A;  3ABL B;  1IX9 A;  2YIA A;  1G8M A;  1NBM G;  3MAQ A;  2JJ1 G;  1PNM A;  3E2E A;  1OHH G;  3OUF A;  4WFB V;  4H33 A;  4UCT A;  1GN6 A;  3A0B Z;  4QE7 A;  1AR1 B;  4JYA O;  3DGE A;  2CH7 A;  3ZN1 A;  1N36 B;  4JI7 O;  1F23 A;  4KP4 A;  3TK1 A;  2ZE7 A;  2W0F C;  2RN9 A;  4JI3 O;  4HNA A;  3LNN A;  4FMT A;  3CC2 V;  1FAF A;  5KAI Z;  4TQD A;  3RYF B;  3FB8 C;  1MNG A;  4JTA B;  4WF9 V;  1Y74 A;  2DYR B;  3JAS B;  4DV0 B;  3ETE A;  2EJ7 A;  2XND G;  1RSO A;  3B4S A;  3W7S A;  4OPH A;  4LF7 B;  5EC2 C;  2WLI A;  2H8P C;  3ZHV A;  3RW0 A;  1SZT A;  5KX5 B;  3ZHU A;  4OGQ B;  2WLH A;  5H2F Z;  4LF4 O;  2OCC B;  1R73 A;  2HP8 A;  4W4K A;  3AG3 B;  5IYZ B;  1AJP A;  2WLK A;  4H44 B;  5BXZ A;  1RP3 B;  2Y4U A;  2GV9 A;  4QJF B;  3JD1 A;  5DM6 V;  2BSK B;  2RJZ A;  3RN4 A;  3OTO O;  2Y69 B;  2DYS C;  1AP6 A;  3LSU A;  2PGG A;  5F2V O;  1Q5O A;  3BY6 A;  4TV8 A;  4YXW G;  4X65 B;  2AW9 A;  1FFX A;  4JI6 B;  1XMO B;  3AG4 B;  4LF8 B;  2X6B A;  4GYC B;  3CD6 V;  4B3S O;  3W7W A;  4X1Y A;  5JJJ B;  5B1O A;  4AQY O;  2WLN A;  2QJ1 A;  1PKX A;  1B6Q A;  4DV5 O;  1P4R A;  1NVP D;  5LP6 C;  1D5N A;  4PI2 A;  1TUB A;  2IJI A;  1YHQ V;  4TV9 A;  4O4L B;  5IJ9 B;  4FVM A;  1BT8 A;  2CTW A;  2PUS A;  4DK0 A;  4G28 B;  1JCH A;  3O9O A;  4CH4 A;  4IHJ A;  2UXB B;  1SC5 B;  2Q68 A;  2QE7 G;  4DV4 O;  2WLL A;  4O4J B;  2HLD G;  2EIK B;  2ZCE A;  1Q6H A;  2QKC A;  2UUB B;  1NH2 D;  2GSM B;  3A8T A;  4MW8 A;  2G38 A;  2BTO A;  1OJH A;  2RQ6 A;  4JI4 B;  1PNK A;  3TXQ A;  4FZ0 A;  1ZTE A;  2XT9 A;  3FX7 A;  4GX1 A;  3SYO A;  3U11 A;  1FJG B;  5KUM A;  2Q8V A;  3GWO A;  2HJF C;  1BHB A;  3CC7 V;  1N36 O;  3CRC A;  3ZHQ A;  3OMI B;  5CA1 A;  1GN2 A;  5LHH A;  5H6Q A;  3NXS A;  3QNE A;  4DUZ O;  1N32 O;  2ZIO A;  2A7W A;  4Q20 A;  2E76 B;  3B40 A;  4FLT A;  4DV0 O;  4EB6 B;  3TCU A;  1V54 B;  1M1K W;  3ZIA G;  4HYO A;  1VAR A;  5E1A C;  3ZRW A;  4LF7 O;  4JZG A;  2QM7 A;  2D3O W;  5KHI A;  3F7V C;  3WG7 B;  2L6L A;  3Q4H A;  4NTX A;  4Z1V A;  4PA3 A;  4J7Z A;  4I55 A;  4KFM A;  1IDS A;  1UJW B;  3G71 V;  2CK3 G;  3OGI B;  4DV1 B;  3ZED A;  5C8Y B;  2AZ2 A;  3AK1 A;  2EX3 A;  1VQM V;  4D6T H;  1DTO A;  1V55 C;  3E35 A;  1SA0 A;  2FB5 A;  2H94 A;  4JV5 B;  1BGY H;  4JZ2 A;  1QVF U;  2WAM A;  1VMG A;  1Q6I A;  1QLE C;  2P4V A;  5IT9 N;  1FS0 G;  4H13 B;  2P22 C;  3CRA A;  3ZRX A;  4X20 A;  1WLE A;  5CA3 A;  4JI6 O;  2OYQ A;  3CCJ V;  1Q6U A;  4DYL A;  4C7U A;  5CA0 B;  1QVG U;  1NZ6 A;  1Y66 A;  1WAZ A;  2UXN A;  4YJ2 A;  5L3E A;  3ZMS A;  1W0K G;  3G67 A;  4JTC B;  1AJN A;  1K9M W;  3RYH A;  2HKO A;  3E8H A;  4P30 A;  1YF2 A;  1R6T A;  3JAL B;  2PYL A;  3SYP A;  3SPH A;  1FXK C;  4J7J A;  5JVD B;  1NTM H;  2UXC O;  3T4Z A;  5BMV A;  1N33 B;  4L87 A;  2Q7G A;  2QTO A;  5IJ0 B;  4DV7 B;  3EVK A;  2ADQ B;  3IGA C;  2UXB O;  1OV9 A;  2OIE A;  1MSD A;  2D2C B;  3CCR V;  3HKE B;  4AHC A;  1VQ9 V;  5IWA B;  4GUN A;  1YJW V;  2UUB O;  1WB8 A;  3HKC A;  2ZDI A;  5LXT A;  3C90 A;  3J81 N;  4WCE V;  1L1F A;  4JI4 O;  1PNL A;  4IGG A;  2W6I G;  4B7E A;  4DR2 O;  2E74 B;  1OCO B;  3ZMU A;  2PY5 A;  1K3E A;  1CXZ B;  3LUT B;  1CPY A;  3CCU V;  2CTP A;  5IYB O;  3CCM V;  4KXR A;  4QNH B;  3CE2 A;  3LDD A;  1SQV H;  2WA3 A;  4YIP A;  1M90 W;  2ZQM A;  1KD1 W;  5GTI Z;  1KP3 A;  1I5X A;  1XIL A;  3NR7 A;  3ZJZ A;  1BZK A;  3N27 A;  1BQ0 A;  2NR5 A;  2N74 A;  1FKA O;  1DGS A;  1X4T A;  2YS8 A;  5JJN B;  3B09 A;  4FLW A;  1XHX A;  4PA4 A;  3E8B A;  4UCU A;  3ZHR A;  2KG7 B;  2Z3Y A;  4D7S A;  1BSM A;  4TQF A;  4GKK B;  1SF9 A;  3KCY A;  3ASO B;  4R8C A;  3GWK C;  3L73 H;  2UUC B;  4DV1 O;  1RM1 C;  5ITZ B;  3BA8 A;  1SET A;  2IU3 A;  2JGU A;  2ADP A;  2EIL B;  3CCS V;  2FML A;  4JV5 O;  4X62 B;  2EIJ B;  3N2K A;  5KHJ A;  3FKS G;  1H2G A;  4PA6 A;  1I94 O;  1JQ0 A;  2XOK G;  1MAB G;  2RCV A;  1EFR G;  3FAV A;  2BTQ B;  1NI8 A;  2QWP B;  3CRM A;  1ARO P;  3CCL V;  1ROP A;  5AG2 A;  4YHH B;  5CB4 A;  4LR3 A;  4I50 B;  1BS3 A;  2A9H A;  4XDL A;  3VQX A;  3HKD B;  2ZT9 B;  4JF3 A;  5EYP B;  3ETD A;  1AR5 A;  4FFB A;  3AG2 C;  4PA7 A;  4TUY B;  1H38 A;  4DV7 O;  3APQ A;  2LQT A;  3JAW B;  3FFQ A;  2ZM6 O;  2ZNJ A;  3H01 A;  4R6Z A;  4LF9 O;  3ZRS A;  1IXM A;  4O2A B;  1K4D C;  4JYA B;  3D36 A;  2FL4 A;  1THZ A;  4JTD B;  4TSF G;  4ZHQ A;  3ABM C;  4JI3 B;  2HHH B;  4MVQ A;  3JSN A;  3RYC B;  1N0J A;  1EM1 A;  2EIN C;  2RMK B;  4O4I B;  2A79 B;  1WNS A;  2Y0P A;  2QDO A;  4J10 A;  2YIC A;  4TWK A;  1QR8 A;  2QKA A;  4F6R A;  2GTS A;  2DQ0 A;  4X1I B;  1FPO A;  3S3W A;  1I0H A;  2MW2 B;  1IVS A;  4RO2 A;  1OCR C;  5J2U B;  5B66 Z;  5L3B A;  4B08 A;  4I9Q A;  2V1D A;  3UO3 A;  2YEV A;  1L0N H;  3RYI B;  1SES A;  1Y67 A;  3ABK B;  3JAR A;  4E2L A;  3QG5 A;  4U7N A;  2YXH A;  1D5A A;  2JGD A;  1B04 A;  4Z2W A;  1FYJ A;  2EIM C;  5KUK A;  3OTO B;  2GUZ B;  1S77 D;  4PDR A;  2PZS A;  4NR1 A;  1EN4 A;  1YXB A;  2HVK C;  1JFF A;  2QM8 A;  2IJK A;  3N2G B;  5L3G A;  1OCZ C;  3CCQ V;  1ZWI C;  1DK1 A;  3OMN B;  2R70 A;  5LYJ B;  1JOY A;  3LSS A;  3JAT A;  1S5J A;  3SJA C;  4X62 O;  1NVP C;  1K92 A;  4GZR B;  5KMG A;  2Z5U A;  4B3S B;  2Y4T A;  1WN7 A;  1M57 C;  3BPZ A;  4AQY B;  1OZ0 A;  3SJC C;  5B1B C;  4MVS A;  4DV5 B;  3WB0 A;  3FD9 A;  5IY5 B;  1AVM A;  1XNQ B;  5EK0 A;  4BIZ A;  2HJD A;  1JX9 A;  3JAK A;  4YJ3 A;  4LCU C;  1TUE B;  4X66 B;  4PJ0 Z;  3CJH A;  4YHH O;  1XBL A;  4X1K B;  4FM2 A;  2Q9L A;  1K34 A;  2P5O A;  5K1P A;  2F23 A;  1NH2 C;  4NVP A;  1SER A;  2F66 C;  3K08 A;  4DRX B;  1AI6 A;  3MD0 A;  4DV4 B;  5BZB A;  3ZHS A;  2UXD B;  1H2M A;  4MTX A;  1VQ5 V;  1W0J G;  4MS2 A;  4X9Q A;  3VQY A;  4DR3 B;  4DV6 O;  4EEQ A;  1T5E A;  5LHI A;  3K04 A;  5LA6 A;  3LDE A;  1AIL A;  3AG1 C;  2GDS A;  1LUW A;  2IJJ A;  2A3Q A;  4LF6 O;  2XAJ A;  2X7R B;  1E79 G;  2ZDI C;  2CGN A;  3FB6 C;  3HPL C;  2M6Y A;  1SQP H;  1P49 A;  2HHH O;  3JCZ A;  5LGT A;  2DYS B;  4DUZ B;  1N32 B;  2NN4 A;  3SDL A;  1YJ9 V;  3VQW A;  4I0X A;  2VRZ A;  1R1B A;  5EZY A;  3W7X A;  3JAL A;  2ATK C;  1DLB A;  2P6J A;  3X2Q B;  5J2T B;  2QWR B;  1YI2 V;  1M9N A;  2JEX A;  3L70 H;  1ZL8 A;  1XI1 A;  2Q67 A;  2HEP A;  5LP6 B;  2WSS G;  3ZCC A;  4K0K O;  1OCC B;  4RQE A;  5B3S C;  5BY1 A;  2OCH A;  3K59 A;  3CC4 V;  4DV2 B;  3I56 V;  2CTQ A;  2OWO A;  3GB7 C;  1R6N A;  3L9D A;  4DO2 A;  5LBQ A;  3ABL C;  1SRY A;  1GN4 A;  4K3A A;  3UT5 B;  2JJ2 G;  4DR7 B;  5B1A C;  4MSW C;  1S5L Z;  3DXR B;  1EZV H;  4DR6 B;  2IJH A;  4RUE A;  1JJO A;  1UPG A;  1QBZ A;  2BOC C;  5JQG B;  3OR6 C;  4LWS B;  1Y76 B;  3RT3 C;  4I4T A;  5LMN B;  3KCX A;  4N21 A;  5KAF Z;  4LNU A;  3SYC A;  3CMA V;  5FL7 G;  1XNQ O;  2DYR C;  2JK5 C;  1IXB A;  1HNX O;  4LH7 A;  4MTG A;  2DWD C;  4X66 O;  3STZ C;  3SPC A;  3GVM A;  2UXC B;  1Y4M A;  2X6C A;  5DN6 G;  1RPO A;  4DUY B;  3QF7 A;  1D2D A;  2P90 A;  4HAM A;  3ZRV A;  2UXX A;  3LDC A;  2OCC C;  3AG3 C;  2MK3 A;  2H3O A;  2UXD O;  1WB7 A;  4K8X A;  5JH7 B;  2RNB A;  3I5D A;  4DR3 O;  4IIJ A;  1QQC A;  2LO1 A;  4B7K A;  1KMI Z;  2AZ0 A;  4DR2 B;  5CMU A;  2FKX A;  2QR4 A;  1Q81 W;  2OTL V;  1RFY A;  2Q0A A;  4J41 A;  3T1C A;  1W2B U;  2PYJ A;  4JGS A;  2F4V B;  2FTK A;  3ASN C;  3HKB B;  4P9O A;  2LFS A;  4IYH A;  2IM9 A;  4Q6G A;  2X0L A;  4ZOL A;  1TVK B;  4JYB A;  4G27 B;  3D36 C;  1IBK O;  4DW0 A;  1KKC A;  1ZAU A;  1QLN A;  4O4H A;  2QA4 V;  3AG4 C;  3K5O A;  1S72 V;  1EN6 A;  4PDL A;  1PL4 A;  1S76 D;  3JD0 A;  4ZI7 A;  3CRR A;  4U3J B;  3OEH G;  5KHK A;  1FD9 A;  1VF7 A;  2GTA A;  5LOV B;  3E22 B;  4XBF A;  2OIG A;  4LP8 A;  5D5Q A;  3RVZ A;  3OD4 A;  3H1H H;  5EIB D;  2E75 B;  1FXK B;  1J95 A;  1VQP V;  1XDC A;  2V4D A;  1XMQ O;  4YIO A;  1WA8 A;  4UUJ C;  4DV2 O;  5H5N A;  2VQE O;  1VF5 B;  2EIK C;  1SQG A;  3K5N A;  1O9H A;  3QO7 A;  3ZHT A;  2NLJ C;  5C93 A;  1HW7 A;  4DR7 O;  2JS3 A;  2DE0 X;  4WBN B;  2PTM A;  4DR6 O;  1IBL O;  1I94 B;  4R50 A;  1PPJ H;  1SQB H;  3UO2 A;  1IBM O;  2VWJ A;  3OEE G;  4OX9 O;  4ICG A;  4J9Z B;  2ETN A;  4O2B A;  5LMN O;  2ILM A;  3K57 A;  1P7B A;  2ZE8 A;  2LW1 A;  2CH7 B;  3E8F A;  2B5U A;  2CE4 A;  1R6K A;  2Q73 A;  4WFE A;  2EZP A;  5LHG A;  3A2F A;  4HNA B;  4DUY O;  2K9P A;  4FZ1 A;  4JYC A;  2XHB A;  4PI0 A;  3WG7 C;  1L0L H;  2DMX A;  1Y74 B;  2QTS A;  2YXY A;  3C3S A;  3M7M X;  3SYQ A;  1ZX3 A;  2ZM6 B;  2QWO B;  1RSO B;  5GON A;  1JJ2 U;  2WLI B;  2IU0 A;  4LF9 B;  4NTY A;  4FIP C;  1YCI A;  3BRC A;  5JWP A;  1J5E B;  1F4N A;  1K8A W;  3S3X A;  4L8J A;  1S0V A;  1RM1 B;  4B3M B;  4NKG B;  2F4V O;  3A0H Z;  5KHG A;  1FXV A;  2N05 A;  4I5S A;  1ORQ C;  1VF6 C;  3RGB A;  1XHZ A;  3JCU Z;  2ZE5 A;  1K97 A;  1O9G A;  2IW5 A;  5FNV A;  1EBO A;  3SYA A;  3E86 A;  3CYO A;  4J42 A;  2XUM A;  1YTF B;  1JMK C;  3CB2 A;  1KBH A;  3SGI A;  4KHP B;  2DJV A;  1XRE A;  3R66 A;  3DC5 A;  5L3F A;  4TV8 B;  4CH5 A;  1Q7Y W;  1FFX B;  3EHB B;  2E3C A;  1W59 A;  2ZIN A;  4PA9 A;  3UCS C;  4X1Y B;  2YID A;  3C3T A;  1BHA A;  1GM7 A;  2M7W A;  1Y6X A;  3OW2 U;  4LF5 B;  1G6U A;  2KQX A;  4UFZ A;  2JEU A;  3RFR A;  2ARH A;  1TUB B;  3FYE B;  4EFE A;  2GBO A;  1WPB A;  5EBL C;  5CBG A;  4TV9 B;  4UV8 A;  1VEW A;  3P30 A;  5CN0 A;  3ABU A;  1N8R W;  3BAB A;  1B06 A;  1H2K A;  2X6A A;  3BCC H;  1URF A;  4IHJ B;  1H8E G;  3WB2 A;  3JD3 A;  2WLL B;  3RYF A;  3D3Q A;  1EZJ A;  2CAZ C;  3JAS A;  4BIU A;  4JAS A;  3SPG A;  3ABM B;  1HNZ O;  1GTO A;  5KX5 A;  1AI5 A;  2YUA A;  1BQZ A;  3VBB A;  4MVU A;  2P67 A;  3DC6 A;  5IYZ A;  5IYC O;  1BMF G;  5J9P C;  5CA1 B;  4LFA O;  3B8N A;  3TET A;  3R65 A;  4CC6 A;  1NTZ H;  5EC1 C;  2BSK A;  4IT5 A;  4DV6 B;  1P7G A;  3LSQ A;  1K7D A;  5EBW C;  3MHS C;  1JR9 A;  3ZRW B;  3ICX A;  3K5L A;  5GTH Z;  1XUQ A;  2LW7 A;  2ZIM A;  2A0L A;  1HNW O;  4OPA A;  3OMA B;  2EIM B;  3Q4H B;  1J5E O;  4LF6 B;  2AHZ A;  5BR8 B;  2BCC H;  3ZS8 C;  1HP8 A;  3MDS A;  4MTO A;  2Z0A A;  4I55 B;  2P4K A;  4B3M O;  3PN1 A;  3CHX A;  4X64 O;  2EIL C;  1E1Q G;  2HG5 C;  5H9C A;  4PV1 B;  1K33 A;  2EIJ C;  3CWB H;  4DR4 O;  3T1H O;  4NXM B;  3OT7 A;  1DF5 A;  3AG7 A;  4LH6 A;  3K0G A;  4O4L A;  5IJ9 A;  3CS5 A;  3OR7 C;  1M57 B;  1SA0 B;  1XQ8 A;  4WFF A;  5B1B B;  1NU1 H;  3L75 H;  4K0K B;  4KHP O;  1M56 C;  4X20 B;  3T4D A;  4O4J A;  3ZN0 A;  1SQX H;  4FM0 A;  1N0N A;  5FPO A;  3FB5 C;  3P32 A;  4JI0 O;  1ZSP A;  1I5Y A;  5KLV H;  1LNQ A;  1NH2 B;  2QGN A;  4Z1M G;  4YJ2 B;  3ABT A;  3I55 V;  4LF5 O;  3M8A A;  4RQF A;  3RYH B;  1GO3 F;  4JI1 B;  3AK3 A;  4R7C A;  4U3F H;  3K3W A;  1F4M A;  2KSD A;  3BFR A;  3E83 A;  3BHP A;  3E89 A;  5KA5 A;  1LUV A;  5BMV B;  1VQ4 V;  1FFT B;  4JPR A;  3AG1 B;  2YDE A;  4LFC B;  1MOF A;  2W0X A;  4UVA A;  1KUQ A;  3U0Z A;  1U97 A;  3HKC B;  4EB6 A;  4AI8 A;  1R3J C;  5LXT B;  1SKV A;  3WFV A;  3A0R A;  1KYO F;  2WWW A;  1HNX B;  2A06 H;  1AP5 A;  1NT2 B;  4IL6 Z;  2DW4 A;  2CTR A;  1L8D A;  1K5Q A;  4WFA V;  4GKJ B;  2L35 A;  1XOU A;  5LMU B;  1WP7 A;  3K06 A;  3K79 A;  4K8Z A;  1P84 F;  2ZXW C;  1MA1 A;  4NXN B;  1QR9 A;  5C8Y A;  4BAY A;  3E8G A;  1N34 B;  2B1G A;  4BW5 A;  3ABK C;  1YTF D;  4KUM A;  4UCR A;  1YDX A;  4UCS A;  4B3R O;  1Q8I A;  5CBF A;  3D8C A;  3JYC A;  4GCZ A;  4CZZ A;  3TGU H;  5JJE B;  1VF6 A;  4JI8 B;  4PDV A;  3CX5 F;  4HBN A;  3H1L H;  5BR8 O;  3K03 A;  4J9Y B;  5B1A B;  5CA0 A;  2ZKO A;  3TXS A;  1XL4 A;  1U96 A;  1IBK B;  3ETG A;  1F51 A;  2QWQ B;  2Q69 A;  1VQ8 V;  3G80 A;  1PM9 A;  4UXN A;  1UFI A;  2ODM A;  3ZX6 A;  2W6J G;  4J7K A;  4NXM O;  3HR0 A;  2FYU H;  3MHH C;  4I7Z B;  3RBZ A;  4DV3 B;  5JVD A;  4CS4 A;  5EIB C;  4MW3 A;  5IY5 C;  3N2K B;  1VP7 A;  5IJ0 A;  3G6E V;  3ETQ A;  3BEH A;  4PHZ A;  4CC5 A;  4CS3 A;  5A2Q N;  1XMQ B;  3HKE A;  3FAV B;  2PI4 A;  2CDY A;  1GM9 A;  2ZD9 A;  2VQE B;  2YC0 A;  4GX5 A;  5FPR A;  5L3C A;  1Q90 D;  2KB1 A;  2R9R B;  2V7Q G;  4LBE C;  5CB4 B;  1BL8 A;  2XAH A;  4JI1 O;  4MTF A;  2LJ2 A;  3G6B A;  4QGP A;  3FYI B;  2XAQ A;  1Z2G A;  5L3D A;  1IBL B;  4FFB B;  3ZBH A;  1IBM B;  1SZX A;  4OX9 B;  4JYY A;  2YSU B;  2LGQ A;  4LFC O;  1TGO A;  5IDJ A;  1WPX A;  1KP2 A;  4FLZ A;  3ASN B;  4JI2 B;  4IYI A;  3ZMT A;  4LFB B;  2UU9 O;  1S5H C;  2ZR3 A;  3K58 A;  1ZLZ A;  3CXH F;  2YIB D;  3DTU B;  3K9S A;  3UQ8 A;  1GH6 A;  1F7Y A;  4AIL C;  1VQO V;  4ZHQ B;  4H37 A;  1AR4 A;  4I9W A;  4JAU A;  4NB5 A;  4GKJ O;  1ENV A;  1RPR A;  3X2Q C;  3H9V A;  2KG7 A;  2Q4P A;  5B5E Z;  1K5S A;  5LMU O;  1HDJ A;  3K0D A;  3UKM A;  1H8H G;  3BVO A;  1KQS U;  3CSX A;  4NXN O;  1R3I C;  1OCC C;  4NTW A;  2BOB C;  4F6R B;  1Q3E A;  1WJZ A;  5ITZ A;  1N34 O;  3H1J H;  5HFL A;  1Q43 A;  3JD2 A;  4P9P A;  4EFB A;  4K35 A;  4OXS A;  2K1E A;  3B2E E;  1GK9 A;  1KB9 F;  1XNR B;  1H2S B;  2JVD A;  3IC9 A;  2YEV B;  4JI8 O;  3F5W C;  2VWK A;  3JAR B;  4J11 A;  2Y69 C;  1AB3 A;  4UCO A;  1V55 B;  3BA9 A;  5CBH A;  1NKD A;  4F4L A;  2BTQ A;  3KZI Z;  2JGD B;  3THO A;  3U10 A;  5B1N A;  3SPI A;  2PF4 E;  3SJB C;  4CH6 A;  4ABM A;  1QLE B;  3JSL A;  3O65 A;  3K5M A;  2ZE6 A;  1JFF B;  2EJR A;  4A5U B;  4I50 A;  2P7T C;  2QKS A;  3EXA A;  4X88 A;  5H6R A;  3HKD A;  2UUA B;  4FLX A;  4DV3 O;  3T1Y B;  3ML0 A;  3JAT B;  5EYP A;  1E1R G;  3J7A U;  4GX0 A;  4TUY A;  4G2K A;  5KMG B;  1YZB A;  3IJ4 A;  3JAW A;  1TA8 A;  4CS2 A;  2YI9 A;  2P06 A;  2R72 A;  5FLX N;  2JDI G;  2E5L B;  3VOU A;  4D7T A;  1JA8 A;  1Z5V A;  4RUF A;  5KA6 A;  3JAK B;  2GHY A;  2AGA A;  4YJ3 B;  4O2A A;  1K73 W;  3CJH B; 
#chains in the Genus database with same CATH homology
 3F7Y C;  2JEU A;  2IH1 C;  2JIZ G;  2WLM A;  3FYE B;  5EBL C;  2EIM C;  5CBG A;  5KUK A;  4ZKI A;  4QJF B;  4UV8 A;  3P30 A;  3JD1 A;  3ZMV A;  1XL6 A;  5CN0 A;  5DM6 V;  3ABU A;  1S77 D;  1N8R W;  4PDR A;  4XDJ A;  4ASU G;  2HVK C;  2QM8 A;  2X6A A;  3CCE V;  2IJK A;  2XAF A;  1H8E G;  5L3G A;  1OCZ C;  3CCQ V;  3JD3 A;  1ZWI C;  1KEC A;  1HWY A;  2WLL B;  1JVM A;  2Y69 B;  1EZJ A;  3OMN B;  4QPK A;  4P2Z A;  2DYS C;  1JOY A;  2R9I A;  3LSS A;  3CP1 A;  4BIU A;  1NVP C;  4JAS A;  1K92 A;  3SPG A;  3ABM B;  2Z5U A;  3BY6 A;  4MVR A;  4YXW G;  1GTO A;  1M57 C;  4GT1 A;  3AG4 B;  4MT8 A;  1OZ0 A;  2X6B A;  3W7T A;  1AI5 A;  2F43 G;  2DWE C;  5HFM A;  5B1B C;  4MVS A;  3CD6 V;  3W7W A;  5IY5 B;  1YIT V;  3SPJ A;  5EK0 A;  3VBB A;  4MVU A;  1JX9 A;  5B1O A;  4BIZ A;  1V54 C;  2P67 A;  2WLN A;  4LCU C;  1TUE B;  1PKX A;  5IYC O;  1B6Q A;  1P4R A;  1NVP D;  1BMF G;  5J9P C;  1K34 A;  2IJI A;  1YHQ V;  4WFH A;  2Y48 A;  3B8N A;  3TET A;  3R65 A;  1NH2 C;  2Q6A A;  1SER A;  3K08 A;  5EC1 C;  4UVC A;  2EZO A;  1AI6 A;  3MD0 A;  5BZB A;  4G28 B;  1JCH A;  3LSQ A;  1K7D A;  5EBW C;  2Q68 A;  2QE7 G;  4MTX A;  2WLL A;  1NR1 A;  1VQ5 V;  3MHS C;  1W0J G;  4MS2 A;  2HLD G;  3ZRW B;  2EIK B;  4MVM A;  2A0L A;  4XDK A;  3IC7 A;  1NH2 D;  3OMA B;  2EIM B;  5LHI A;  2GSM B;  4MW8 A;  1K4C C;  2AHZ A;  3K04 A;  3LDE A;  3AG1 C;  1QCE A;  1PNK A;  4X89 A;  4GX2 A;  4MTO A;  4GX1 A;  2IJJ A;  3LNM B;  3SYO A;  2XAJ A;  4CBC A;  2X7R B;  1E79 G;  2EIL C;  4FPP A;  5KUM A;  1E1Q G;  2ZDI C;  3GWO A;  2HG5 C;  2HJF C;  5H9C A;  3FB6 C;  1BHB A;  1K33 A;  3HPL C;  4PDM A;  3CC7 V;  2EIJ C;  3JCZ A;  5LGT A;  2DYS B;  1YJ9 V;  4PEL A;  3OMI B;  1NQT A;  1DF5 A;  1COW G;  5LHH A;  5H6Q A;  3K0G A;  3NXS A;  1KKD A;  3QNE A;  3OR7 C;  1M57 B;  2HR3 A;  2WPD G;  4Q20 A;  2QEX V;  4WFF A;  3W7X A;  5B1B B;  2ATK C;  1DLB A;  4EKW A;  3OM3 B;  2P6J A;  3X2Q B;  3TCU A;  1V54 B;  1M56 C;  1M1K W;  3T4D A;  3ZIA G;  4HYO A;  3ZN0 A;  1YI2 V;  1M9N A;  5E1A C;  2JEX A;  3ZRW A;  2B1I A;  3PJS K;  5IYD O;  2Q67 A;  1NR7 A;  2QM7 A;  2D3O W;  1FXH A;  2WSS G;  3ZCC A;  3FB5 C;  3F7V C;  1OCC B;  3P32 A;  3WG7 B;  4RQE A;  5B3S C;  5LGN A;  1I5Y A;  1LNQ A;  1NH2 B;  4Z1M G;  3AG2 B;  3ABT A;  3EFF K;  3I55 V;  2XAG A;  4PA3 A;  4RQF A;  3CC4 V;  3I56 V;  1GKF A;  3GB7 C;  3M99 B;  3OGC C;  1R6N A;  1Q86 W;  1GO3 F;  5GW7 A;  4R7C A;  3K3W A;  4DO2 A;  3OAA G;  3CPW U;  1F4M A;  4KFM A;  5LBQ A;  1UJW B;  5EBM C;  3ABL C;  3G71 V;  2CK3 G;  3E83 A;  1SRY A;  3E89 A;  5KA5 A;  2JJ2 G;  1YIJ V;  1VQ4 V;  5B1A C;  4MSW C;  3ZMZ A;  1OCO C;  3FB7 C;  1VQM V;  1AI4 A;  1FFT B;  4JPR A;  3AG1 B;  3QO5 A;  3G4S V;  1MOF A;  5LGU A;  1DTO A;  1V55 C;  2DQ3 A;  3E35 A;  2IJH A;  1VQN V;  1PL0 A;  4RUE A;  2H94 A;  1QBZ A;  1QVF U;  2BOC C;  4UVA A;  2WAM A;  1QLE C;  1KC8 W;  3OR6 C;  2EIN B;  1FS0 G;  1R3J C;  2LP7 A;  3ZRX A;  3WFV A;  1WLE A;  3A0R A;  5CA3 A;  2WWW A;  3CCJ V;  3QO8 A;  1VQ6 V;  4QIW F;  4N23 A;  2DW4 A;  4N21 A;  1QVG U;  3HB3 B;  1Y66 A;  3SYC A;  2UXN A;  3CMA V;  1Q82 W;  5FL7 G;  1K5Q A;  2DYR C;  2JK5 C;  1YTF C;  5L3E A;  3ZMS A;  4WFA V;  2LFR A;  4MTG A;  1W0K G;  4JTC B;  2DWD C;  1YJN V;  1AJN A;  3STZ C;  1K9M W;  3SPC A;  1OCR B;  2HKO A;  3CCV V;  1Y4M A;  4UV9 A;  3E8H A;  1GM8 A;  4P30 A;  3K06 A;  2X6C A;  2AHY A;  1RPO A;  3K79 A;  5DN6 G;  2HFE C;  2P90 A;  2ZXW C;  1M56 B;  3SYP A;  4HAM A;  3SPH A;  1FXK C;  1VQL V;  2WLJ A;  3ZRV A;  1QR9 A;  2ITC C;  3T4Z A;  4BAY A;  3JD4 A;  2UXX A;  1PD3 A;  3E8G A;  2B1G A;  2NNU A;  3LDC A;  2OCC C;  4BW5 A;  3ABK C;  3AG3 C;  4L87 A;  2MK3 A;  3OUS A;  2QTO A;  1YTF D;  4KUM A;  3IGA C;  3IFX A;  2ITD C;  5CBF A;  3ASO C;  3JYC A;  3CCR V;  4GCZ A;  4CZZ A;  4X8A A;  1AI7 A;  1VQ9 V;  1YJW V;  1G4Y B;  4PDV A;  2ZDI A;  3CXC U;  5CMU A;  3K9A A;  4WCE V;  1L1F A;  1PNL A;  1Q81 W;  3K03 A;  1OCZ B;  2OTL V;  2W6I G;  3T1C A;  1W2B U;  4J9Y B;  5B1A B;  4JGS A;  3T2M A;  2FTK A;  1OCO B;  3ASN C;  1XL4 A;  3AEI A;  3ZMU A;  4P9O A;  1DF4 A;  2LFS A;  1K3E A;  1F51 A;  3ETG A;  1NVP B;  1S3J A;  1JPX A;  2Q69 A;  3LUT B;  1CPY A;  2X0L A;  3CCU V;  1VQ8 V;  4UXN A;  2HVJ C;  4JYB A;  4G27 B;  5IYB O;  2W6J G;  3CCM V;  1QLN A;  3MHH C;  2QA4 V;  3AG4 C;  3UM7 A;  4QNH B;  4HZ3 A;  4ZBM A;  1GMG A;  1S72 V;  3RBZ A;  3CME V;  3LDD A;  4PDL A;  1VQ7 V;  4MW3 A;  5IY5 C;  1S76 D;  4MVO A;  3JD0 A;  3G6E V;  2ZQM A;  3OFN G;  1M90 W;  1KD1 W;  3OEH G;  1KP3 A;  1I5X A;  4RAI A;  1MG1 A;  3BEH A;  4TT3 G;  4FJC C;  4WFG A;  3ZJZ A;  4XBF A;  2ZR2 A;  4MVZ A;  4LP8 A;  2OTJ V;  2PI4 A;  3RVZ A;  1GM9 A;  2ZD9 A;  2ZXW B;  2OT5 A;  4GX5 A;  1VQP V;  1FXK B;  1J95 A;  4PA4 A;  5L3C A;  4UVB A;  2KB1 A;  3E8B A;  2R9R B;  2V7Q G;  4LBE C;  2PI5 A;  4UUJ C;  4LC1 A;  2Z3Y A;  1BL8 A;  2XAH A;  2EIK C;  4MTF A;  4DXW A;  3B8M A;  3QO7 A;  3ASO B;  4R8C A;  3SJQ C;  2NLJ C;  1RM1 C;  3FYI B;  3B77 A;  2XAQ A;  5L3D A;  5C93 A;  1SET A;  3W7U A;  2IU3 A;  3RVY A;  1YSC A;  2YSU B;  2EIL B;  2IH3 C;  4FK5 C;  3CCS V;  1CEZ A;  4R50 A;  5IDJ A;  1WPX A;  1KP2 A;  1R3L C;  2EIJ B;  1CP9 A;  3ASN B;  3OEE G;  2EBO A;  3FKS G;  4J9Z B;  1H2G A;  4JAV A;  3STL C;  4PA6 A;  3OE7 G;  1NJI W;  3ZMT A;  1JQ0 A;  1S5H C;  2XOK G;  1MAB G;  2ZR3 A;  1MSW D;  1EFR G;  3DTU B;  1P7B A;  1VQO V;  4H37 A;  1ARO P;  1FXK A;  3CCL V;  4I9W A;  4JAU A;  1ROP A;  3D3I A;  3E8F A;  2B5U A;  1ENV A;  1RPR A;  3X2Q C;  1R3K C;  1R6K A;  4WFE A;  2C2A A;  1K5S A;  2EZP A;  5LHG A;  2A9H A;  3K0D A;  3UKM A;  1H8H G;  4JYC A;  1KQS U;  4XDL A;  4QPJ A;  5B3S B;  1R3I C;  3WG7 C;  1OCC C;  2BOB C;  4JF3 A;  4U7O A;  3SYQ A;  3ETD A;  5HFL A;  3AG2 C;  1VQK V;  4PA7 A;  3KG2 A;  3JD2 A;  1H38 A;  4P9P A;  4QE9 A;  4OXS A;  1JJ2 U;  2K1E A;  1GK9 A;  2WLI B;  2IU0 A;  2XAS A;  4FIP C;  1AJQ A;  3ABL B;  3H01 A;  4R6Z A;  2YEV B;  1G8M A;  1NBM G;  1F4N A;  1K8A W;  3F5W C;  2JJ1 G;  3ZRS A;  1IXM A;  1PNM A;  1S0V A;  1K4D C;  1OHH G;  3E2E A;  2Y69 C;  3OUF A;  1RM1 B;  1V55 B;  5CBH A;  3D36 A;  1NKD A;  4F4L A;  4WFB V;  4H33 A;  4QE7 A;  5B1N A;  1AR1 B;  3SPI A;  1THZ A;  4JTD B;  4TSF G;  3DGE A;  3ABM C;  1FXV A;  3ZN1 A;  1QLE B;  4I5S A;  1F23 A;  4KP4 A;  4MVQ A;  1ORQ C;  2EIN C;  3TK1 A;  2EJR A;  2W0F C;  1K97 A;  2P7T C;  2A79 B;  2QKS A;  2IW5 A;  4FMT A;  4X88 A;  3CC2 V;  4TWK A;  1EBO A;  3SYA A;  5H6R A;  3E86 A;  3CYO A;  1QR8 A;  3FB8 C;  4WF9 V;  4JTA B;  3ML0 A;  2DYR B;  1YTF B;  2DQ0 A;  3ETE A;  1E1R G;  2XND G;  4GX0 A;  4G2K A;  3W7S A;  5L3F A;  4RO2 A;  1OCR C;  2H8P C;  2WLI A;  5EC2 C;  1Q7Y W;  3RW0 A;  3EHB B;  1SZT A;  5L3B A;  2V1D A;  2JDI G;  2WLH A;  4PA9 A;  3VOU A;  2YEV A;  4RUF A;  5KA6 A;  2GHY A;  1SES A;  2OCC B;  1BHA A;  1R73 A;  3AG3 B;  1GM7 A;  3ABK B;  4E2L A;  2M7W A;  4U7N A;  3OW2 U;  1K73 W;  1AJP A;  2WLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...