5IYDO

Human core-pic in the initial transcribing state (no iis)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iydO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iydO02
1RM1C 5IYBO 1NVPC 1NH2D 5IYDO 1NH2C 1YTFD 1YTFC 1RM1B 5IYCO 1NVPD
chains in the Genus database with same CATH superfamily
4LF7B 2M6YA 4MVOA 2LP7A 1D2DA 1BL8A 4JYAB 2P22C 4UVAA 4PA4A 1KB9F 4LFAB 5CA0B 2Q7EA 3LSQA 4K3AA 1K8AW 4RQFA 1NH2C 3OEHG 2PGGA 1N34B 1L8DA 4OX9O 1B06A 3ASNC 2YI9A 1KBHA 4LP8A 2EZPA 5FPRA 2WLIB 4O4LB 3VQWA 3ZHQA 5JVDA 2WSSG 4H37A 1GM9A 1PL0A 4KL1A 3CC4V 5KHJA 1AI4A 1ORQC 4XBFA 2V1DA 1VQOV 1XMQO 4IYIA 3JAKB 3ZHSA 3ZN0A 1XILA 1IBLB 5EYPB 4UXNA 1T5EA 3JSLA 1K92A 2UXDB 3CCRV 4AQYO 5KA6A 5IWAB 2UXCO 5B1BB 3FB8C 4BIUA 2X6AA 2K1EA 2PI4A 1VMGA 2Q0AA 1RP3B 1R6TA 1K4CC 2CAZC 4UV9A 1JA8A 1FPOA 3OTOO 4NR1A 4LF7O 1QVGU 5FL7G 3I5DA 3ZHRA 4PELA 3JD1A 3ZHVA 1SETA 1XNQO 2AW9A 1S5JA 4PDLA 1IXMA 5IT9N 4H44B 3DSQA 1ROPA 1U96A 4ZKIA 2WPDG 2B5UA 4B3MB 5ITZA 3RGBA 1OZ0A 4DW0A 2ZE7A 1RPRA 3E22B 2ATKC 4LF8O 2XTAA 3VBBA 1R1BA 1W2BU 3DXRA 3ZMSA 5B5EZ 2WLHA 1AJPA 5KMGA 4TV8A 2MK3A 4JTAB 3B77A 3T4DA 3CB2A 2X0LA 2F23A 3LSUA 5LMUO 1Q5OA 2R72A 1JR9A 4Z1VA 1BHBA 5IJ9A 2G38A 5LMNB 2UXBO 4B3TB 2A3QA 3OMAB 4DV2B 5IYZB 3Q4HB 3RYFA 4QGPA 5K1XA 3CP1A 1PD3A 1EN5A 2Y69C 5KLVH 2DYRB 1YEWA 4ZOLB 4FVMA 4JI0O 3CCSV 1KUQA 2L6LA 4UCUA 2ZR3A 3RVYA 5EIBC 4LFCO 4X66O 2Y4UA 1BCCH 3SGIA 3IC9A 1AJNA 3U11A 1KP2A 3A8TA 5JH7A 3SYPA 4X89A 3RN4A 1QR8A 2YS8A 5B1OA 1XNRB 4ZI7B 2F95B 1XHXA 4NTWA 5AG2A 4RO2A 3W7XA 3RYCB 4LFBB 5IY5C 3D36A 3CCJV 1Z2GA 5LP6B 3OW2U 2WLKA 1AJQA 2ZDIA 2LJ2A 1GTOA 3ZRSA 4B3SO 4DV5O 4NXMO 1K73W 4WBNA 1BS3A 3UT5A 2QR4A 4FIPC 4MT8A 4LR3A 3W7WA 4DR7B 4GKKB 2P67A 4PDVA 1J5EB 1DF5A 1BE3H 2HEPA 4LF9O 3D8CA 1S5HC 1R73A 2E76B 3AK3A 1XNRO 3JCUZ 1IBMO 1XNQB 1JFFB 5LXTB 3L9DA 2Q8VA 3HPLC 4MVUA 4ZHQA 1YSCA 3M7MX 2DMXA 4LCUC 3SYCA 4DR1O 3SPJA 2UUAB 2YIDA 1HNWO 4IHJB 3HKDB 4JYBA 5B1NA 1WPXA 3K79A 4I0XA 4GKJO 1NH2D 3CSXA 2VQFO 1Y4MA 2GBOA 1K5QA 1RM1B 4LH7A 4LF5B 2A06H 1NI8A 4YIPA 2ZE5A 1XQ8A 3JSNA 2Q7GA 4O2BB 2V4DA 1G1XB 1JMKC 3CWBH 1FJGB 1IVSA 4DRXA 3ASNB 2F4VO 3IGAC 4DV4O 3CCMV 1HR0B 3ZJZA 1B6QA 2YXLA 2ZXWC 1F4NA 2LO1A 3MHHC 5IYCO 1FS0G 3ABKC 1S76D 2N74A 3CEIA 5CA1B 5BR8B 1Q7YW 2XAJA 2L35A 2XAGA 2EULA 1MOFA 3SDLA 1DGSA 4LNUB 5BMVB 2PF4E 4GKJB 4JYCA 4FLUA 1OCZC 2RN9A 1K4DC 3JAWB 3TGUH 4IHJA 2OTLV 4MTFA 1TUBB 1SQFA 2HP8A 4EFEA 3AK2A 4FM0A 2DYRC 2WLLA 1VQ5V 3LNNA 4I9WA 2R9AA 3KZIZ 2HR3A 1S72V 2YC0A 4JAVA 5C8YB 1H2LA 2UUBB 1SA0A 3ZMZA 4KP4A 1Q82W 4DV6O 5LMNO 1NVPC 3CRRA 2B1GA 5CA0A 5B66Z 2YICA 4I55B 3N2KB 1MNGA 2CH7B 3ABLB 3N2GA 3JASB 4X1KA 2XT9A 3AG3B 5CBFA 4FLZA 3QO8A 5LHIA 5LA6B 2WWWA 1JPXA 2ZT9B 2QE7G 4RUFA 4JI1O 4X64O 3JD2A 4PDRA 1KYOF 1LR1A 1AR1B 3L72H 1I08A 1KC8W 3AG2C 3K06A 4RUEA 4MVSA 1MG1A 3OAAG 1P84F 3IC7A 2IU0A 1V9PA 1SQXH 2ADQB 3CC7V 2DOSA 4UVCA 5KA5A 5J2TB 5CB4B 2QWOB 2IU3A 2ZCEA 1JOYA 4LF6B 1URFA 5D5PA 1GM8A 2PYJA 2Q69A 1SQGA 3RVZA 3CCLV 1IBKB 2R9RB 1PPJH 3S3WA 1YJWV 3ZHTA 2JIZG 4Q6GA 3B4SA 3KG2A 2ZDIC 2QM8A 4GYCB 1R6KA 2VQEO 2B1IA 2JK5C 2QWQB 1K9MW 2QM4A 4O4IA 1M5IA 4FLTA 4YXWG 5CBHA 2XAFA 2QWPB 3Q4HA 3RYFB 1YHQV 5J2UA 4CC6A 1FXKB 4DV2O 3CCQV 3AG4C 4KHPB 5IY5B 3K9AA 1MZFA 3BEHA 3ZMVA 3C90A 2XUMA 2YXHA 2Q68A 4FJCC 4BAYA 1WLEA 4AQYB 4YY3O 4JASA 3SJBC 4WFHA 1HW7A 3ZCCA 1FFTB 1OCRC 4FM1A 2UU9B 4JI7B 1IDSA 1WP7A 2RQ6A 3KCXA 3RT3C 3QTCA 2BCCH 2Q7HA 1IXBA 5LHHA 2GSMB 1P7GA 2ZE6A 1GH6A 1FFXA 1TVKA 2UXBB 5H2FZ 1G6UA 4FFKA 2ARHA 3I56V 4JI1B 4X64B 3ZRXA 3HKEA 2R9IA 2M7WA 3IFXA 1L0LH 2EX3A 4MS2A 1YTFB 2PTMA 1XMOB 2YIBA 3ZBHA 4MTOA 5GTHZ 3BHPA 1N34O 4L8JA 4NXNO 4R7CA 2CGNA 1OCOC 4DUZO 1ZL8A 3FFQA 5FPOA 1LUVA 2X6BA 1M9NA 5EK0A 4FLYA 1FFXB 4J10A 1M57C 4LF8B 4CC5A 5IDJA 4H13B 4JI4B 3H01A 3ETDA 1MZEA 3LDEA 1HNXO 4IL6Z 4BW5A 4G27B 1AROP 1SF9A 2OT5A 2E5LO 3K0GA 1M4UA 3VOUA 1JX9A 2PI5A 1ZWIC 1YF2A 3IJ4A 4O4HA 4CS2A 1I94B 2P6JA 1AB3A 4X8AA 1RSOA 1LUWA 2FB5A 1Y66A 4NKGB 1THZA 3TETA 2HHHO 3ML0A 2MW2B 4ZIBA 4CS3A 2FTKA 1KECA 2EINC 4PA9A 3K57A 5GTIZ 1P49A 2XAQA 4JI6B 3EHBB 1YJNV 2ZM6O 4TV9B 1VF7A 4X1IB 1XREA 2VS0A 4O4JA 1X4TA 4LF9B 5KAFZ 1QQCA 4O2AA 1V54C 2BE3A 2VQEB 4OXSA 4RQEA 2LW1A 2ODMA 3SYQA 1NVPB 5HFLA 1YDXA 2Y0PA 3QO5A 2OYQA 2QEXV 3UM7A 3ZHUA 2CUGA 3DGEA 4X65B 4DR6O 1G8MA 3JD0A 1Y76B 1UJWB 4DR4O 1IX9A 1F4MA 1NTKH 4UCTA 3F7YC 1V55B 4JI3B 4J7JA 4DW1A 3BY6A 3QVNA 3X2QB 5EBMC 1N33B 4QIWF 4I7ZB 3FKSG 5LA6A 1NVPD 3A0HZ 4PI2A 2QM7A 1VQ4V 3CYOA 2Y0IA 4MTGA 1Y67A 3M8AA 2CTWA 4CH5A 3IAYA 3L71H 1GN6A 2ZIMA 1I94O 1O9GA 1NBMG 4Q20A 2ZNIA 3BABA 3CCEV 2DYSB 1SA0B 1Y74A 5H6QA 1N32O 5IJ9B 1SQPH 5KUMA 4X1YB 1H38A 1QCEA 3A0RA 1HNZO 4J41A 3F5TA 2BSKA 2LFSA 2P4KA 2FMLA 3OMIB 4YHHO 4EKWA 1DTOA 3FX7A 1YTFC 1W0JG 4HAMA 5JJJB 2C2AA 3RYIB 3TJTA 3CHXA 3K0DA 2RCVA 1HNZB 5TISZ 5DM6V 1VQKV 5L3EA 5L3CA 5L3FA 1XHZA 4B3TO 1NQTA 2LW7A 3K59A 5JVDB 2F1MA 3ETGA 2ZM6B 1Q8IA 1M57B 5EZYB 4K8XA 5J2TA 3U0ZA 5IJ0B 1N36B 1Q6UA 4DV7O 4DK1A 4Z1MG 2A0LA 1KQSU 1YXBA 2UUCB 1BQ0A 3CCVV 4YIOA 2EIKB 3LSSA 3T1YB 3GWKC 4DR2O 3ZS8C 3H1LH 3JAKA 1MMMA 4DR3B 1OJHA 4P9PA 3DC5A 3K5OA 1EN6A 3R66A 2GDSA 3E8BA 4OPHA 2Q5ZA 1XMQB 2RNBA 1N4CA 1F7YA 3T1CA 3CRAA 4I55A 3KKYA 2BOCC 4GX1A 1K7DA 5FNVA 3CD6V 1B04A 4LFCB 1PM9A 1GM7A 2A79B 3PN1A 1J95A 1ZUQA 2GUZA 4NXNB 1I5YA 4JI3O 4LF6O 1JJ2U 2DW4A 1UFIA 2JJ2G 4PA3A 4UVBA 2ZXWB 2HLDG 4ICGA 1SKVA 4B3RB 5LGUA 1AR4A 1D5AA 4HNAA 3H1HH 1D5NA 3T4ZA 2D3OW 1MSDA 1SZXA 2QSAA 4G28B 5C93A 2ZE8A 4DUZB 4B3SB 2ZR2A 2CTPA 1WPBA 1NKDA 3SPIA 2F66C 3FAVB 3OEEG 1XL4A 3BPZA 2DJVA 3JALB 4JF3A 2YI8A 4QE9A 1NT2B 2CTRA 4OX9B 3K03A 3L73H 4UUJC 2EINB 1S77D 3UO3A 4XDJA 1Q81W 3JATA 3CXCU 3X2QC 5CB4A 4XDLA 4ZI7A 3T1HO 1SRYA 3BA8A 4AHCA 1FYJA 4PA7A 2P4VA 2XOKG 1FD9A 1AP5A 1R3IC 2EIMB 1V54B 4AI8A 3STZC 1OV9A 4X66B 1XOUA 1XBLA 2DYSC 2NN4A 3R65A 1DF4A 4EB6B 1E1QG 1BMFG 4ZOLA 3N27A 2JVDA 3D3IA 4K35A 4YY3B 1PP9H 1PNLA 3ABMC 4TOIA 4DR3O 3ETQA 2Q9LA 1ENVA 3OD4A 3T1YO 1NTZH 3B2EE 4YJ2A 4JI4O 2XNDG 2GHYA 3WB2A 4MSWC 2OWOA 3SJCC 2BTOA 1I7FA 2EJRA 2UUAO 1LNQA 4CH4A 3SR2C 1KKCA 1I5XA 4TV8B 4HZ3A 3O9OA 5JWPA 3OR6C 4KHPO 2Q0OC 3G80A 5EC2C 1IBKO 3DXRB 1EFRG 2W6JG 5H9CA 5GONB 5EBWC 2NLJC 3B8NA 1Q90D 1FXKA 3HKCB 3HKBA 1VQ6V 1R6NA 4WBNB 3QF7A 5H5NA 3CJHB 3WFVA 4LWSA 5L3GA 4B08A 2PUSA 4ABMA 3SPGA 1JJOA 4X1YA 5LP6A 4JYAO 2AHZA 2EIKC 2IJHA 4LNUA 2HJDA 3FYIB 1F23A 1HP8A 2DN9A 4YJ3A 4X62O 3TXQA 5B3SC 1XEQA 2JEXA 2ILMA 4TUYA 4N23A 1YTFD 1N36O 5B1AB 3DTUB 4LFBO 4J9YB 3JALA 3LDDA 5KHGA 1VP7A 1AVMA 3K08A 3CS5A 3EXAA 3AEIA 3E83A 3LDCA 4W4KA 2Q6AA 3G67A 2V7QG 1SZTA 4N21A 3BFRA 2UXCB 2Y48A 3ZN1A 5KHIA 3B8MA 4I0XB 2ZINA 2PY5A 3AG7A 2F43G 3N2GB 5H6RA 3OMNB 4DYLA 3MAQA 2DE0X 2QKSA 2HG5C 2KB1A 1E1RG 3ABTA 2ETNA 2DQ0A 3L74H 2N04A 3TK1A 4TT3G 1IBMB 2BTQA 1WAZA 5KMGB 1WA8A 2F93B 2ZIOA 4DR4B 2WLLB 2DQ3A 4WFEA 2CTQA 1PKXA 2VWKA 1XI1A 2FKXA 5CN0A 1TUBA 4I50A 1EZVH 3ZIAG 3STLC 2N05A 3G6EV 2XHBA 2AHYA 4NVPA 1VQPV 1MA1A 3CRCA 1WP8A 2KG7A 1NU1H 2HVJC 5KHHA 1QLNA 1H2SB 4E4EA 1Q6IA 1H2KA 2JS5A 3G4SV 2HFEC 3ASOC 5L3BA 3J7AU 5CMUA 4J7KA 4O4HB 1NTMH 3S3XA 4I4TA 2Y4TA 3WB1A 1WA8B 5IYBO 1CXZB 4MTXA 4DUYB 3L70H 3E35A 3RYHA 4MVMA 5JJNB 4G2KA 1FJGO 2QKAA 3GB7C 1VEWA 4C7UA 2IJKA 1PNKA 3ZMUA 5FLXN 2ZD9A 5D5QA 2VQFB 1KKDA 5E1AC 3CPWU 5LL6Y 3A2FA 1NR1A 1SESA 1JQ0A 4LF4O 2WLIA 3E8GA 3GWOA 2Z0AA 4WFAV 1Q6HA 3HB3B 2F4VB 1FXVA 1YZBA 2YEVB 4D6TH 4UCVA 4IT5A 3LUTB 3FB7C 3BVOA 4KFMA 3UCSC 5KX5B 1GN2A 1DLBA 2DWEC 1QLEB 2LGQA 2NNUA 3BA9A 3LNMB 1K5SA 4JI7O 4K0KO 4EFBA 2EJ7A 3JARB 5K1PA 4GKKO 4QJFB 4QPKA 4QE7A 4TSFG 4CZZA 2HVKC 2EBOA 2OCCC 1BHAA 4J80A 2RMKB 1TAEA 1OCCB 4XDKA 5DECA 4KUMA 3UT5B 1H2NA 4U7NA 4LWSB 5A9GA 2EILB 5B1AC 1QR9A 4P2ZA 4I50B 2IH1C 3CX5F 5LOVA 3B09A 3HKBB 1VQLV 5HFMA 2VRZA 4PHZA 4DR1B 2HHHB 4UCRA 4JI5B 3U10A 1R3LC 1N8RW 4JZGA 1GKFA 4FMTA 3EFFK 3HR0A 3CMAV 2LFRA 3PJSK 1TUEB 4UCSA 4X65O 2OCHA 3AK1A 4YJ3B 1H8HG 1AI7A 1QBZA 5JQGB 3G71V 4QPJA 5LHGA 1ZLZA 3NXSA 1FAFA 2GV9A 4ZBMA 1RPOA 5EC1C 3CRMA 5JH7B 3UKMA 4O4IB 4J9ZB 2BOBC 3K9SA 1M1KW 4MVZA 1UPGA 3UQ8A 3CJHA 4B3RO 2HJFC 4NTYA 3CC2V 4BIZA 4HNAB 5B3SB 4P30A 4RAIA 3UO2A 5GONA 4DK0A 4J7ZA 4F6EA 2D2CB 1VQNV 3SJQC 1DK1A 2JEUA 5A2QN 5LGTA 4IYHA 1VARA 4JV5O 2WLJA 1N0NA 3JASA 2IJIA 5JCOA 3A0BZ 2DWDC 4X9QA 5KAIZ 2JRIA 1CP9A 2PYLA 5C8YA 2UXNA 1RSOB 3TCUA 5CBGA 2XAHA 5KUKA 2P5OA 1M93A 3T1HB 4EB6A 3ASOB 4DV3O 3JD4A 3ZRWB 4P9OA 2EIJB 1PV0A 3ABUA 3H1KH 3JARA 4JI5O 4JI6O 3ZX6A 3VQVA 3QG5A 1J5EO 2W0FC 3OE7G 1WJZA 1Q86W 3E8HA 5IE9A 1QVFU 1U97A 1NR7A 5J9PC 4J42A 4LFAO 1S3JA 3BRCA 3WG7C 3E89A 2P7TC 5CA1A 1VQ7V 4JV5B 3H1JH 3APQA 1S0VA 4GX2A 3WU2Z 3RBZA 2FL4A 1OHHG 2X6CA 5FNVB 4B7KA 2JGDB 3M99B 3J80N 1A32A 2YXYA 4DRXB 4NTXA 3H1IH 1KU9A 1JVMA 2H3OA 3EVKA 1NS1A 1NZ6A 4DV5B 4R8CA 5IYDO 4IGGA 4HBNA 4IIJA 3OUSA 3G6BA 1AI5A 1WN7A 1PL4A 1SQQH 2JGDA 2Z3YA 3HKDA 4WFGA 1AI6A 2JS3A 3ABLC 4UCOA 1OCRB 1L0NH 2ITDC 4DUYO 1M56C 1SC5B 1TA8A 2BSKB 4DV0B 2FYUH 1EN4A 2H94A 4NB5A 2ADPA 3SYOA 3L75H 3RFRA 3AG1C 1OCCC 3F5WC 4DR6B 3AG2B 3FAVA 5CA3A 4WFBV 1K34A 4JI2B 2EILC 3CMEV 3CCUV 1SS3A 4X20A 2GTSA 2QDOA 3VQXA 2WLNA 1W59A 3K3WA 2QWNB 1HNWB 4DV1B 1BZKA 4DV0O 4TQFA 2HKOA 4D7TA 3OTOB 5JCOC 4DV4B 4X88A 4DV7B 3DC6A 5LMUB 2LGWA 2P90A 1YVWA 3OFNG 3C3SA 3RYIA 2GTAA 4OPAA 4PV1B 2WA4A 1KP3A 1P7BA 1GN3A 4H33A 4PJ0Z 1US6A 1GRJA 1H2MA 4GX5A 1XMOO 3ZRWA 2Z5UA 1IBLO 1N0JA 1QLEC 4ZHQB 1O9HA 2LQTA 4F6RA 1VQ9V 5EIBD 3MD0A 2QTOA 1YI2V 3FD9A 1JFFA 5LXTA 2IJJA 2OIEA 2YIAA 1XUQA 1ZSPA 3THOA 3ABMB 1FXKC 3K58A 1BGYH 3JD3A 4KXRA 3RW0A 1I0HA 2A9HA 1COWG 1HDJA 2UXDO 5LYJB 3K5MA 1EBOA 3CE2A 5EBLC 1BT8A 1HNXB 4TV9A 4X1IA 5LYJA 4LF5O 4LH6A 3BAAA 2Q73A 4QNHB 3FB6C 2QJ1A 4MW8A 1VF5B 1WNSA 2W6IG 2X7RB 3RYCA 3QNEA 4L87A 1KMIZ 1Y74B 3OTFA 5IJ0A 3CXHF 5EZYA 4UV8A 2EIJC 1E79G 2UUCO 2JJ1G 3D3QA 3SPHA 2Q4PA 1H2GA 4JYYA 4LF4B 5ITZB 4RWUA 1X59A 4JI8B 5JJEB 2WAMA 1N32B 1BQZA 2E5LB 5DEDA 3W7TA 4I5SA 2AXTZ 3WB0A 4PI0A 3E22A 1VQ8V 2IW5A 1YIJV 2OIGA 1OCOB 2E3CA 2YSUB 4FLVA 1AP6A 4TQDA 4GZRB 4ASUG 4X62B 2K9PA 1NJIW 1QU7A 2R70A 4PD4F 5BR8O 4R50A 5LP6C 2YEVA 3OGCC 3ZRVA 4Z2WA 1B3QA 2UUBO 2WLMA 4GX0A 2IM9A 1GAXA 3E86A 3C3TA 2P06A 2RDCA 4BW9A 3VQYA 4I4TB 1JCHA 3HKEB 3MHSC 4WFFA 1M56B 4FLWA 1R3KC 2E75B 4YHHB 4O4JB 3OR7C 1YCIA 1H8EG 1TGOA 4A5UB 3OM3B 4HYOA 3B40A 4BR6A 1ZTEA 3FYEB 5LGNA 1N33O 4J11A 1GMGA 3AG1B 1Z5WA 1KD1W 4W4LA 3JATB 2KG7B 4JI0B 5KHKA 3E2EA 4DV6B 1IURA 1Y76A 1S5LZ 3SJAC 1QNMA 4FPPA 4UFZA 4F4LA 4O4LA 2AZ2A 3W7UA 2QWRB 4DV3B 2Q67A 3O65A 2CE4A 4UB6Z 3BCCH 3P3PA 1Z5VA 3RYHB 1BSMA 2JDIG 1CPYA 1NH2B 3JCZA 1RM1C 3D36C 3FB5C 3JAMN 2CK3G 3KCYA 4GLXA 3P32A 3RWRD 1F51A 2W0XA 2H8PC 5J2UB 4AILC 4FK5C 2ZNJA 5F2VO 4CH3A 3F7VC 4LC1A 1EM1A 2WA3A 4DR5B 2UXXA 3ICXA 3W7SA 4X20B 4U3JA 1Q43A 4JAAA 1XDCA 2QKCA 3K5LA 2QA4V 1V55C 3ABKB 5LBQA 4JTCB 4DXWA 3E8FA 4CH6A 2OTJV 1Y6XA 5IWAO 1HWYA 4MVRA 1MSWD 1QHTA 2BTQB 1FKAO 3APOA 4FLXA 2YUAA 4K0KB 5L3DA 1OCZB 2ZQMA 2KKWA 4U7OA 5B1BC 4FZ1A 4NYKA 3T2MA 2PZSA 2IH3C 2NR5A 4B7EA 1VF6A 3OGIB 4WCEV 4NXMB 1R3JC 1PNMA 5BXZA 1P4RA 2AGAA 4H0LB 2OCCB 3JYCA 4WF9V 3ETEA 4E2LA 1AILA 1ZL8B 4I9QA 4B3MO 5E79Z 4FFBB 4X1KB 3CRQA 5JQGA 2EZOA 1ZX3A 3NR7A 4OGQB 3AG3C 5IYZA 5BY1A 4DR7O 4JGSA 2YIBD 4JI8O 2YDEA 1GK9A 2IBZH 1YJ9V 3J81N 4TUYB 1ZAUA 1K3EA 1IZ3A 1W0KG 4PDMA 4LBEC 3K5NA 3K04A 1TVKB 4U3FH 4DR2B 2ITCC 3SYAA 4PA6A 4CS4A 1AR5A 2QTSA 1HR0O 1GO3F 2A7WA 4JTDB 5GW7A 4UB8Z 3SPCA 2QGNA 1SERA 1Q3EA 3GVMA 5DN6G 1G4YB 3OUFA 3TXSA 1WB8A 3HKCA 2AZ0A 1MABG 3P30A 4MW3A 2CH7A 3N2KA 4FM2A 2EIMC 3OT7A 4JAUA 4BIOA 5KX5A 1SQVH 4GUNA 3QO7A 1K97A 3I55V 4JZ2A 2CDYA 2XASA 4YJ2B 3MDSA 4MVQA 4JPRA 5EYPA 3H9VA 4DV1O 1RFYA 4DR5O 1M90W 3P3NA 3AG4B 3JAWA 1FXHA 2JGUA 4TWKA 1VQMV 4K8ZA 4FZ0A 4JI2O 4IIJB 5BMVA 1L1FA 2ZKOA 5BZBA 1GN4A 2Y69B 4EEQA 2E74B 1CEZA 2CGOA 4GCZA 1K33A 2KSDA 4DO2A 4FFBA 4D7SA 1YITV 4U3JB 4CBCA 4R6ZA 1XL6A 3ZMTA 3ZEDA 4BWAA 1WB7A 3WG7B 2B9ZA 4O2AB 4F6RB 2UU9O 2GUZB 2O57A 2VWJA 5LOVB 1VF6C 2RJZA 1VIBA 4GT1A 4O2BA 1EZJA 2KQXA 1SQBH
chains in the Genus database with same CATH topology
2XNDG 2GHYA 5IY5B 4MSWC 3K9AA 2EJRA 2HKOA 1LNQA 1I5XA 4X88A 4MVOA 3BEHA 3ZMVA 4HZ3A 2LP7A 3OR6C 2P90A 1BL8A 5EC2C 3OFNG 2Q68A 1EFRG 2W6JG 4FJCC 4PA4A 4UVAA 2NLJC 5EBWC 5H9CA 4BAYA 3B8NA 3LSQA 1WLEA 1FXKA 4JASA 1K8AW 1KP3A 1P7BA 4WFHA 3ZCCA 4RQFA 1VQ6V 1R6NA 4H33A 1NH2C 1FFTB 1OCRC 3OEHG 4GX5A 3ZRWA 2Z5UA 3WFVA 5L3GA 1QLEC 3ASNC 1VQ9V 3MD0A 2QTOA 3SPGA 1YI2V 4LP8A 2EZPA 2AHZA 2WLIB 2EIKC 2IJHA 2IJJA 3FYIB 1F23A 5LHHA 2GSMB 3ABMB 1FXKC 5B3SC 2JEXA 2WSSG 4N23A 1YTFD 4H37A 1GM9A 3I56V 1PL0A 3ZRXA 5B1AB 3JD3A 3RW0A 2R9IA 2M7WA 3DTUB 3CC4V 3IFXA 2A9HA 1AI4A 1ORQC 4XBFA 1COWG 2V1DA 4J9YB 4MS2A 1VQOV 1YTFB 1EBOA 5EBLC 3LDDA 4MTOA 3ZN0A 3K08A 4QNHB 4UXNA 3FB6C 4R7CA 1K92A 1OCOC 3CCRV 3AEIA 3E83A 4MW8A 2W6IG 3LDCA 5KA6A 2Q6AA 2X7RB 2X6BA 5B1BB 3QNEA 2V7QG 1SZTA 3FB8C 4L87A 4N21A 1M9NA 4BIUA 5EK0A 2X6AA 2Y48A 1M57C 2K1EA 2PI4A 3ZN1A 3B8MA 5IDJA 1K4CC 4UV8A 4UV9A 3H01A 2EIJC 1E79G 2F43G 3ETDA 2JJ1G 5H6RA 3OMNB 3LDEA 3SPHA 4BW5A 2QKSA 2HG5C 1QVGU 2KB1A 1E1RG 5FL7G 3ABTA 1H2GA 4G27B 1AROP 2OT5A 2DQ0A 4PELA 3JD1A 3TK1A 1SETA 3K0GA 4TT3G 3VOUA 2WAMA 4PDLA 1IXMA 1JX9A 3W7TA 2PI5A 1ZWIC 4I5SA 1ROPA 2WLLB 2DQ3A 2WPDG 4WFEA 4ZKIA 2B5UA 2P6JA 1OZ0A 1RPRA 4X8AA 1PKXA 2ATKC 3VBBA 1W2BU 5CN0A 1VQ8V 3ZMSA 2WLHA 1AJPA 1Y66A 3ZIAG 3STLC 2IW5A 1THZA 3TETA 3G6EV 1YIJV 3ML0A 2AHYA 1OCOB 2MK3A 2YSUB 4JTAB 1VQPV 3B77A 3T4DA 2X0LA 2FTKA 4ASUG 2HVJC 1BHBA 1KECA 1NJIW 1QLNA 2EINC 4PA9A 3OMAB 4R50A 2XAQA 3EHBB 1YJNV 2YEVA 3CP1A 3G4SV 3OGCC 3ZRVA 2HFEC 1PD3A 2Y69C 2DYRB 2WLMA 4GX0A 3ASOC 5L3BA 3CCSV 5CMUA 3E86A 1JCHA 1V54C 3MHSC 2ZR3A 4WFFA 3RVYA 1M56B 4OXSA 4RQEA 1R3KC 3SYQA 1NVPB 5HFLA 5IYBO 3OR7C 4MTXA 3QO5A 3E35A 1H8EG 4MVMA 1AJNA 3OM3B 4G2KA 4HYOA 1KP2A 3GB7C 5LGNA 3FYEB 3SYPA 4X89A 1GMGA 3AG1B 2QEXV 1QR8A 1KD1W 5B1OA 3UM7A 3DGEA 2IJKA 1PNKA 3ZMUA 1G8MA 3JD0A 1UJWB 3E2EA 2ZD9A 1KKDA 4RO2A 3W7XA 5E1AC 5IY5C 3D36A 1F4MA 3CPWU 3CCJV 4FPPA 1NR1A 1SESA 4F4LA 3F7YC 1JQ0A 1V55B 3W7UA 2WLIA 3E8GA 2Q67A 3GWOA 3OW2U 2WLKA 1AJQA 3BY6A 4WFAV 3HB3B 2ZDIA 1FXVA 2JDIG 1GTOA 2YEVB 3ZRSA 3X2QB 1K73W 5EBMC 1CPYA 4QIWF 3LUTB 3FB7C 1NH2B 3FKSG 4KFMA 1NVPD 4FIPC 3JCZA 1RM1C 2QM7A 1DLBA 2DWEC 3CYOA 1VQ4V 4MT8A 4MTGA 1QLEB 3FB5C 3W7WA 2NNUA 2CK3G 3LNMB 3P32A 1F51A 1K5SA 2P67A 2H8PC 1NBMG 4Q20A 4PDVA 4FK5C 1DF5A 3CCEV 2DYSB 1S5HC 4QJFB 1R73A 4QPKA 4QE7A 4TSFG 5H6QA 3F7VC 4CZZA 2HVKC 2EBOA 2OCCC 5KUMA 4LC1A 1BHAA 1H38A 1QCEA 3A0RA 1OCCB 4XDKA 3HPLC 4MVUA 4KUMA 2LFSA 2UXXA 3W7SA 4U7NA 1YSCA 3OMIB 2EILB 5B1AC 1QR9A 4LCUC 3SYCA 4EKWA 4P2ZA 3SPJA 2QA4V 1V55C 2IH1C 1DTOA 1VQLV 3ABKB 5HFMA 4JYBA 1YTFC 1W0JG 5LBQA 5B1NA 1WPXA 4HAMA 4JTCB 4DXWA 3E8FA 2OTJV 2C2AA 3K79A 1R3LC 1N8RW 3K0DA 1HWYA 1GKFA 4MVRA 4FMTA 5DM6V 1MSWD 3EFFK 3CMAV 2LFRA 1VQKV 1NH2D 3PJSK 1TUEB 1Y4MA 5L3EA 5L3CA 5L3FA 1K5QA 1RM1B 5L3DA 1NQTA 1OCZB 2ZQMA 4U7OA 5B1BC 1H8HG 1AI7A 3ETGA 3T2MA 1QBZA 3G71V 4QPJA 2IH3C 5LHGA 1M57B 3NXSA 4ZBMA 1RPOA 5EC1C 4WCEV 1R3JC 3UKMA 1PNMA 3ASNB 4J9ZB 3IGAC 1P4RA 2A0LA 4Z1MG 1KQSU 2BOBC 2OCCB 3CCMV 3JYCA 4WF9V 1M1KW 4MVZA 3CCVV 3ETEA 2EIKB 3LSSA 3ZJZA 4E2LA 1B6QA 2HJFC 3CC2V 2ZXWC 1F4NA 4BIZA 3MHHC 5B3SB 4P30A 2EZOA 5IYCO 1FS0G 4RAIA 3ABKC 1S76D 1VQNV 1Q7YW 2XAJA 3SJQC 3AG3C 2XAGA 4P9PA 2JEUA 1MOFA 5LGTA 3E8BA 4JGSA 2WLJA 1YJ9V 1GK9A 2IJIA 4JYCA 3T1CA 1K3EA 1OCZC 2DWDC 1W0KG 4PDMA 4LBEC 3K04A 2BOCC 4GX1A 2ITCC 1K4DC 3SYAA 1K7DA 3CD6V 2OTLV 4PA6A 4MTFA 1CP9A 1GM7A 2A79B 1GO3F 2UXNA 1J95A 3TCUA 4JTDB 5CBGA 5GW7A 2XAHA 5KUKA 1I5YA 3SPCA 1SERA 2DYRC 1JJ2U 2DW4A 3ASOB 2WLLA 5DN6G 1VQ5V 2JJ2G 4I9WA 1G4YB 3JD4A 3ZRWB 2HR3A 1S72V 4JAVA 3OUFA 4P9OA 2EIJB 4PA3A 3ABUA 4UVBA 3ZMZA 2ZXWB 4KP4A 1Q82W 1MABG 3P30A 1NVPC 2HLDG 2B1GA 4MW3A 2W0FC 3OE7G 3ABLB 1Q86W 3E8HA 2EIMC 5LGUA 1QVFU 4JAUA 3AG3B 1NR7A 5CBFA 5J9PC 3T4ZA 2D3OW 3QO8A 5LHIA 1S3JA 2WWWA 1JPXA 3QO7A 3E89A 2QE7G 4RUFA 3WG7C 1K97A 2P7TC 3JD2A 3I55V 4PDRA 4G28B 5C93A 1VQ7V 2ZR2A 1AR1B 2XASA 1KC8W 4MVQA 4JPRA 3AG2C 1S0VA 3K06A 4GX2A 3RBZA 1NKDA 4RUEA 3SPIA 4MVSA 1MG1A 1M90W 3OEEG 1XL4A 1OHHG 2X6CA 3OAAG 3AG4B 4JF3A 4QE9A 1FXHA 3IC7A 2IU0A 4TWKA 1VQMV 3M99B 3K03A 3CC7V 4UVCA 4UUJC 2EINB 1S77D 5KA5A 4XDJA 1JVMA 1Q81W 3CXCU 3X2QC 4XDLA 1L1FA 2IU3A 1JOYA 1SRYA 4R8CA 5IYDO 5BZBA 2Y69B 1GM8A 4PA7A 3OUSA 2XOKG 1AI5A 2Q69A 3RVZA 1CEZA 2Z3YA 4WFGA 1AI6A 4GCZA 3CCLV 2R9RB 1K33A 1R3IC 3ABLC 4DO2A 2EIMB 1V54B 1OCRB 2ITDC 1YJWV 3STZC 2JIZG 1YITV 1M56C 4CBCA 1XL6A 2DYSC 4R6ZA 3ZMTA 3KG2A 2ZDIC 3R65A 1DF4A 2QM8A 3WG7B 1R6KA 2H94A 1E1QG 2B1IA 2JK5C 1K9MW 1BMFG 3SYOA 3AG1C 1OCCC 3F5WC 3D3IA 4YXWG 5CBHA 3AG2B 2XAFA 5CA3A 4WFBV 1K34A 1PNLA 2EILC 3ABMC 4GT1A 3CMEV 3CCUV 1YHQV 1FXKB 1ENVA 2WLNA 3K3WA 3CCQV 3AG4C 1EZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 C;  5IYB O;  1NVP C;  1NH2 D;  5IYD O;  1NH2 C;  1YTF D;  1YTF C;  1RM1 B;  5IYC O;  1NVP D; 
#chains in the Genus database with same CATH topology
 4LF7 B;  2M6Y A;  4MVO A;  2LP7 A;  1D2D A;  1BL8 A;  4JYA B;  2P22 C;  4UVA A;  4PA4 A;  1KB9 F;  4LFA B;  5CA0 B;  2Q7E A;  3LSQ A;  4K3A A;  1K8A W;  4RQF A;  1NH2 C;  3OEH G;  2PGG A;  1N34 B;  1L8D A;  4OX9 O;  1B06 A;  3ASN C;  2YI9 A;  1KBH A;  4LP8 A;  2EZP A;  5FPR A;  2WLI B;  4O4L B;  3VQW A;  3ZHQ A;  5JVD A;  2WSS G;  4H37 A;  1GM9 A;  1PL0 A;  4KL1 A;  3CC4 V;  5KHJ A;  1AI4 A;  1ORQ C;  4XBF A;  2V1D A;  1VQO V;  1XMQ O;  4IYI A;  3JAK B;  3ZHS A;  3ZN0 A;  1XIL A;  1IBL B;  5EYP B;  4UXN A;  1T5E A;  3JSL A;  1K92 A;  2UXD B;  3CCR V;  4AQY O;  5KA6 A;  5IWA B;  2UXC O;  5B1B B;  3FB8 C;  4BIU A;  2X6A A;  2K1E A;  2PI4 A;  1VMG A;  2Q0A A;  1RP3 B;  1R6T A;  1K4C C;  2CAZ C;  4UV9 A;  1JA8 A;  1FPO A;  3OTO O;  4NR1 A;  4LF7 O;  1QVG U;  5FL7 G;  3I5D A;  3ZHR A;  4PEL A;  3JD1 A;  3ZHV A;  1SET A;  1XNQ O;  2AW9 A;  1S5J A;  4PDL A;  1IXM A;  5IT9 N;  4H44 B;  3DSQ A;  1ROP A;  1U96 A;  4ZKI A;  2WPD G;  2B5U A;  4B3M B;  5ITZ A;  3RGB A;  1OZ0 A;  4DW0 A;  2ZE7 A;  1RPR A;  3E22 B;  2ATK C;  4LF8 O;  2XTA A;  3VBB A;  1R1B A;  1W2B U;  3DXR A;  3ZMS A;  5B5E Z;  2WLH A;  1AJP A;  5KMG A;  4TV8 A;  2MK3 A;  4JTA B;  3B77 A;  3T4D A;  3CB2 A;  2X0L A;  2F23 A;  3LSU A;  5LMU O;  1Q5O A;  2R72 A;  1JR9 A;  4Z1V A;  1BHB A;  5IJ9 A;  2G38 A;  5LMN B;  2UXB O;  4B3T B;  2A3Q A;  3OMA B;  4DV2 B;  5IYZ B;  3Q4H B;  3RYF A;  4QGP A;  5K1X A;  3CP1 A;  1PD3 A;  1EN5 A;  2Y69 C;  5KLV H;  2DYR B;  1YEW A;  4ZOL B;  4FVM A;  4JI0 O;  3CCS V;  1KUQ A;  2L6L A;  4UCU A;  2ZR3 A;  3RVY A;  5EIB C;  4LFC O;  4X66 O;  2Y4U A;  1BCC H;  3SGI A;  3IC9 A;  1AJN A;  3U11 A;  1KP2 A;  3A8T A;  5JH7 A;  3SYP A;  4X89 A;  3RN4 A;  1QR8 A;  2YS8 A;  5B1O A;  1XNR B;  4ZI7 B;  2F95 B;  1XHX A;  4NTW A;  5AG2 A;  4RO2 A;  3W7X A;  3RYC B;  4LFB B;  5IY5 C;  3D36 A;  3CCJ V;  1Z2G A;  5LP6 B;  3OW2 U;  2WLK A;  1AJQ A;  2ZDI A;  2LJ2 A;  1GTO A;  3ZRS A;  4B3S O;  4DV5 O;  4NXM O;  1K73 W;  4WBN A;  1BS3 A;  3UT5 A;  2QR4 A;  4FIP C;  4MT8 A;  4LR3 A;  3W7W A;  4DR7 B;  4GKK B;  2P67 A;  4PDV A;  1J5E B;  1DF5 A;  1BE3 H;  2HEP A;  4LF9 O;  3D8C A;  1S5H C;  1R73 A;  2E76 B;  3AK3 A;  1XNR O;  3JCU Z;  1IBM O;  1XNQ B;  1JFF B;  5LXT B;  3L9D A;  2Q8V A;  3HPL C;  4MVU A;  4ZHQ A;  1YSC A;  3M7M X;  2DMX A;  4LCU C;  3SYC A;  4DR1 O;  3SPJ A;  2UUA B;  2YID A;  1HNW O;  4IHJ B;  3HKD B;  4JYB A;  5B1N A;  1WPX A;  3K79 A;  4I0X A;  4GKJ O;  1NH2 D;  3CSX A;  2VQF O;  1Y4M A;  2GBO A;  1K5Q A;  1RM1 B;  4LH7 A;  4LF5 B;  2A06 H;  1NI8 A;  4YIP A;  2ZE5 A;  1XQ8 A;  3JSN A;  2Q7G A;  4O2B B;  2V4D A;  1G1X B;  1JMK C;  3CWB H;  1FJG B;  1IVS A;  4DRX A;  3ASN B;  2F4V O;  3IGA C;  4DV4 O;  3CCM V;  1HR0 B;  3ZJZ A;  1B6Q A;  2YXL A;  2ZXW C;  1F4N A;  2LO1 A;  3MHH C;  5IYC O;  1FS0 G;  3ABK C;  1S76 D;  2N74 A;  3CEI A;  5CA1 B;  5BR8 B;  1Q7Y W;  2XAJ A;  2L35 A;  2XAG A;  2EUL A;  1MOF A;  3SDL A;  1DGS A;  4LNU B;  5BMV B;  2PF4 E;  4GKJ B;  4JYC A;  4FLU A;  1OCZ C;  2RN9 A;  1K4D C;  3JAW B;  3TGU H;  4IHJ A;  2OTL V;  4MTF A;  1TUB B;  1SQF A;  2HP8 A;  4EFE A;  3AK2 A;  4FM0 A;  2DYR C;  2WLL A;  1VQ5 V;  3LNN A;  4I9W A;  2R9A A;  3KZI Z;  2HR3 A;  1S72 V;  2YC0 A;  4JAV A;  5C8Y B;  1H2L A;  2UUB B;  1SA0 A;  3ZMZ A;  4KP4 A;  1Q82 W;  4DV6 O;  5LMN O;  1NVP C;  3CRR A;  2B1G A;  5CA0 A;  5B66 Z;  2YIC A;  4I55 B;  3N2K B;  1MNG A;  2CH7 B;  3ABL B;  3N2G A;  3JAS B;  4X1K A;  2XT9 A;  3AG3 B;  5CBF A;  4FLZ A;  3QO8 A;  5LHI A;  5LA6 B;  2WWW A;  1JPX A;  2ZT9 B;  2QE7 G;  4RUF A;  4JI1 O;  4X64 O;  3JD2 A;  4PDR A;  1KYO F;  1LR1 A;  1AR1 B;  3L72 H;  1I08 A;  1KC8 W;  3AG2 C;  3K06 A;  4RUE A;  4MVS A;  1MG1 A;  3OAA G;  1P84 F;  3IC7 A;  2IU0 A;  1V9P A;  1SQX H;  2ADQ B;  3CC7 V;  2DOS A;  4UVC A;  5KA5 A;  5J2T B;  5CB4 B;  2QWO B;  2IU3 A;  2ZCE A;  1JOY A;  4LF6 B;  1URF A;  5D5P A;  1GM8 A;  2PYJ A;  2Q69 A;  1SQG A;  3RVZ A;  3CCL V;  1IBK B;  2R9R B;  1PPJ H;  3S3W A;  1YJW V;  3ZHT A;  2JIZ G;  4Q6G A;  3B4S A;  3KG2 A;  2ZDI C;  2QM8 A;  4GYC B;  1R6K A;  2VQE O;  2B1I A;  2JK5 C;  2QWQ B;  1K9M W;  2QM4 A;  4O4I A;  1M5I A;  4FLT A;  4YXW G;  5CBH A;  2XAF A;  2QWP B;  3Q4H A;  3RYF B;  1YHQ V;  5J2U A;  4CC6 A;  1FXK B;  4DV2 O;  3CCQ V;  3AG4 C;  4KHP B;  5IY5 B;  3K9A A;  1MZF A;  3BEH A;  3ZMV A;  3C90 A;  2XUM A;  2YXH A;  2Q68 A;  4FJC C;  4BAY A;  1WLE A;  4AQY B;  4YY3 O;  4JAS A;  3SJB C;  4WFH A;  1HW7 A;  3ZCC A;  1FFT B;  1OCR C;  4FM1 A;  2UU9 B;  4JI7 B;  1IDS A;  1WP7 A;  2RQ6 A;  3KCX A;  3RT3 C;  3QTC A;  2BCC H;  2Q7H A;  1IXB A;  5LHH A;  2GSM B;  1P7G A;  2ZE6 A;  1GH6 A;  1FFX A;  1TVK A;  2UXB B;  5H2F Z;  1G6U A;  4FFK A;  2ARH A;  3I56 V;  4JI1 B;  4X64 B;  3ZRX A;  3HKE A;  2R9I A;  2M7W A;  3IFX A;  1L0L H;  2EX3 A;  4MS2 A;  1YTF B;  2PTM A;  1XMO B;  2YIB A;  3ZBH A;  4MTO A;  5GTH Z;  3BHP A;  1N34 O;  4L8J A;  4NXN O;  4R7C A;  2CGN A;  1OCO C;  4DUZ O;  1ZL8 A;  3FFQ A;  5FPO A;  1LUV A;  2X6B A;  1M9N A;  5EK0 A;  4FLY A;  1FFX B;  4J10 A;  1M57 C;  4LF8 B;  4CC5 A;  5IDJ A;  4H13 B;  4JI4 B;  3H01 A;  3ETD A;  1MZE A;  3LDE A;  1HNX O;  4IL6 Z;  4BW5 A;  4G27 B;  1ARO P;  1SF9 A;  2OT5 A;  2E5L O;  3K0G A;  1M4U A;  3VOU A;  1JX9 A;  2PI5 A;  1ZWI C;  1YF2 A;  3IJ4 A;  4O4H A;  4CS2 A;  1I94 B;  2P6J A;  1AB3 A;  4X8A A;  1RSO A;  1LUW A;  2FB5 A;  1Y66 A;  4NKG B;  1THZ A;  3TET A;  2HHH O;  3ML0 A;  2MW2 B;  4ZIB A;  4CS3 A;  2FTK A;  1KEC A;  2EIN C;  4PA9 A;  3K57 A;  5GTI Z;  1P49 A;  2XAQ A;  4JI6 B;  3EHB B;  1YJN V;  2ZM6 O;  4TV9 B;  1VF7 A;  4X1I B;  1XRE A;  2VS0 A;  4O4J A;  1X4T A;  4LF9 B;  5KAF Z;  1QQC A;  4O2A A;  1V54 C;  2BE3 A;  2VQE B;  4OXS A;  4RQE A;  2LW1 A;  2ODM A;  3SYQ A;  1NVP B;  5HFL A;  1YDX A;  2Y0P A;  3QO5 A;  2OYQ A;  2QEX V;  3UM7 A;  3ZHU A;  2CUG A;  3DGE A;  4X65 B;  4DR6 O;  1G8M A;  3JD0 A;  1Y76 B;  1UJW B;  4DR4 O;  1IX9 A;  1F4M A;  1NTK H;  4UCT A;  3F7Y C;  1V55 B;  4JI3 B;  4J7J A;  4DW1 A;  3BY6 A;  3QVN A;  3X2Q B;  5EBM C;  1N33 B;  4QIW F;  4I7Z B;  3FKS G;  5LA6 A;  1NVP D;  3A0H Z;  4PI2 A;  2QM7 A;  1VQ4 V;  3CYO A;  2Y0I A;  4MTG A;  1Y67 A;  3M8A A;  2CTW A;  4CH5 A;  3IAY A;  3L71 H;  1GN6 A;  2ZIM A;  1I94 O;  1O9G A;  1NBM G;  4Q20 A;  2ZNI A;  3BAB A;  3CCE V;  2DYS B;  1SA0 B;  1Y74 A;  5H6Q A;  1N32 O;  5IJ9 B;  1SQP H;  5KUM A;  4X1Y B;  1H38 A;  1QCE A;  3A0R A;  1HNZ O;  4J41 A;  3F5T A;  2BSK A;  2LFS A;  2P4K A;  2FML A;  3OMI B;  4YHH O;  4EKW A;  1DTO A;  3FX7 A;  1YTF C;  1W0J G;  4HAM A;  5JJJ B;  2C2A A;  3RYI B;  3TJT A;  3CHX A;  3K0D A;  2RCV A;  1HNZ B;  5TIS Z;  5DM6 V;  1VQK V;  5L3E A;  5L3C A;  5L3F A;  1XHZ A;  4B3T O;  1NQT A;  2LW7 A;  3K59 A;  5JVD B;  2F1M A;  3ETG A;  2ZM6 B;  1Q8I A;  1M57 B;  5EZY B;  4K8X A;  5J2T A;  3U0Z A;  5IJ0 B;  1N36 B;  1Q6U A;  4DV7 O;  4DK1 A;  4Z1M G;  2A0L A;  1KQS U;  1YXB A;  2UUC B;  1BQ0 A;  3CCV V;  4YIO A;  2EIK B;  3LSS A;  3T1Y B;  3GWK C;  4DR2 O;  3ZS8 C;  3H1L H;  3JAK A;  1MMM A;  4DR3 B;  1OJH A;  4P9P A;  3DC5 A;  3K5O A;  1EN6 A;  3R66 A;  2GDS A;  3E8B A;  4OPH A;  2Q5Z A;  1XMQ B;  2RNB A;  1N4C A;  1F7Y A;  3T1C A;  3CRA A;  4I55 A;  3KKY A;  2BOC C;  4GX1 A;  1K7D A;  5FNV A;  3CD6 V;  1B04 A;  4LFC B;  1PM9 A;  1GM7 A;  2A79 B;  3PN1 A;  1J95 A;  1ZUQ A;  2GUZ A;  4NXN B;  1I5Y A;  4JI3 O;  4LF6 O;  1JJ2 U;  2DW4 A;  1UFI A;  2JJ2 G;  4PA3 A;  4UVB A;  2ZXW B;  2HLD G;  4ICG A;  1SKV A;  4B3R B;  5LGU A;  1AR4 A;  1D5A A;  4HNA A;  3H1H H;  1D5N A;  3T4Z A;  2D3O W;  1MSD A;  1SZX A;  2QSA A;  4G28 B;  5C93 A;  2ZE8 A;  4DUZ B;  4B3S B;  2ZR2 A;  2CTP A;  1WPB A;  1NKD A;  3SPI A;  2F66 C;  3FAV B;  3OEE G;  1XL4 A;  3BPZ A;  2DJV A;  3JAL B;  4JF3 A;  2YI8 A;  4QE9 A;  1NT2 B;  2CTR A;  4OX9 B;  3K03 A;  3L73 H;  4UUJ C;  2EIN B;  1S77 D;  3UO3 A;  4XDJ A;  1Q81 W;  3JAT A;  3CXC U;  3X2Q C;  5CB4 A;  4XDL A;  4ZI7 A;  3T1H O;  1SRY A;  3BA8 A;  4AHC A;  1FYJ A;  4PA7 A;  2P4V A;  2XOK G;  1FD9 A;  1AP5 A;  1R3I C;  2EIM B;  1V54 B;  4AI8 A;  3STZ C;  1OV9 A;  4X66 B;  1XOU A;  1XBL A;  2DYS C;  2NN4 A;  3R65 A;  1DF4 A;  4EB6 B;  1E1Q G;  1BMF G;  4ZOL A;  3N27 A;  2JVD A;  3D3I A;  4K35 A;  4YY3 B;  1PP9 H;  1PNL A;  3ABM C;  4TOI A;  4DR3 O;  3ETQ A;  2Q9L A;  1ENV A;  3OD4 A;  3T1Y O;  1NTZ H;  3B2E E;  4YJ2 A;  4JI4 O;  2XND G;  2GHY A;  3WB2 A;  4MSW C;  2OWO A;  3SJC C;  2BTO A;  1I7F A;  2EJR A;  2UUA O;  1LNQ A;  4CH4 A;  3SR2 C;  1KKC A;  1I5X A;  4TV8 B;  4HZ3 A;  3O9O A;  5JWP A;  3OR6 C;  4KHP O;  2Q0O C;  3G80 A;  5EC2 C;  1IBK O;  3DXR B;  1EFR G;  2W6J G;  5H9C A;  5GON B;  5EBW C;  2NLJ C;  3B8N A;  1Q90 D;  1FXK A;  3HKC B;  3HKB A;  1VQ6 V;  1R6N A;  4WBN B;  3QF7 A;  5H5N A;  3CJH B;  3WFV A;  4LWS A;  5L3G A;  4B08 A;  2PUS A;  4ABM A;  3SPG A;  1JJO A;  4X1Y A;  5LP6 A;  4JYA O;  2AHZ A;  2EIK C;  2IJH A;  4LNU A;  2HJD A;  3FYI B;  1F23 A;  1HP8 A;  2DN9 A;  4YJ3 A;  4X62 O;  3TXQ A;  5B3S C;  1XEQ A;  2JEX A;  2ILM A;  4TUY A;  4N23 A;  1YTF D;  1N36 O;  5B1A B;  3DTU B;  4LFB O;  4J9Y B;  3JAL A;  3LDD A;  5KHG A;  1VP7 A;  1AVM A;  3K08 A;  3CS5 A;  3EXA A;  3AEI A;  3E83 A;  3LDC A;  4W4K A;  2Q6A A;  3G67 A;  2V7Q G;  1SZT A;  4N21 A;  3BFR A;  2UXC B;  2Y48 A;  3ZN1 A;  5KHI A;  3B8M A;  4I0X B;  2ZIN A;  2PY5 A;  3AG7 A;  2F43 G;  3N2G B;  5H6R A;  3OMN B;  4DYL A;  3MAQ A;  2DE0 X;  2QKS A;  2HG5 C;  2KB1 A;  1E1R G;  3ABT A;  2ETN A;  2DQ0 A;  3L74 H;  2N04 A;  3TK1 A;  4TT3 G;  1IBM B;  2BTQ A;  1WAZ A;  5KMG B;  1WA8 A;  2F93 B;  2ZIO A;  4DR4 B;  2WLL B;  2DQ3 A;  4WFE A;  2CTQ A;  1PKX A;  2VWK A;  1XI1 A;  2FKX A;  5CN0 A;  1TUB A;  4I50 A;  1EZV H;  3ZIA G;  3STL C;  2N05 A;  3G6E V;  2XHB A;  2AHY A;  4NVP A;  1VQP V;  1MA1 A;  3CRC A;  1WP8 A;  2KG7 A;  1NU1 H;  2HVJ C;  5KHH A;  1QLN A;  1H2S B;  4E4E A;  1Q6I A;  1H2K A;  2JS5 A;  3G4S V;  2HFE C;  3ASO C;  5L3B A;  3J7A U;  5CMU A;  4J7K A;  4O4H B;  1NTM H;  3S3X A;  4I4T A;  2Y4T A;  3WB1 A;  1WA8 B;  5IYB O;  1CXZ B;  4MTX A;  4DUY B;  3L70 H;  3E35 A;  3RYH A;  4MVM A;  5JJN B;  4G2K A;  1FJG O;  2QKA A;  3GB7 C;  1VEW A;  4C7U A;  2IJK A;  1PNK A;  3ZMU A;  5FLX N;  2ZD9 A;  5D5Q A;  2VQF B;  1KKD A;  5E1A C;  3CPW U;  5LL6 Y;  3A2F A;  1NR1 A;  1SES A;  1JQ0 A;  4LF4 O;  2WLI A;  3E8G A;  3GWO A;  2Z0A A;  4WFA V;  1Q6H A;  3HB3 B;  2F4V B;  1FXV A;  1YZB A;  2YEV B;  4D6T H;  4UCV A;  4IT5 A;  3LUT B;  3FB7 C;  3BVO A;  4KFM A;  3UCS C;  5KX5 B;  1GN2 A;  1DLB A;  2DWE C;  1QLE B;  2LGQ A;  2NNU A;  3BA9 A;  3LNM B;  1K5S A;  4JI7 O;  4K0K O;  4EFB A;  2EJ7 A;  3JAR B;  5K1P A;  4GKK O;  4QJF B;  4QPK A;  4QE7 A;  4TSF G;  4CZZ A;  2HVK C;  2EBO A;  2OCC C;  1BHA A;  4J80 A;  2RMK B;  1TAE A;  1OCC B;  4XDK A;  5DEC A;  4KUM A;  3UT5 B;  1H2N A;  4U7N A;  4LWS B;  5A9G A;  2EIL B;  5B1A C;  1QR9 A;  4P2Z A;  4I50 B;  2IH1 C;  3CX5 F;  5LOV A;  3B09 A;  3HKB B;  1VQL V;  5HFM A;  2VRZ A;  4PHZ A;  4DR1 B;  2HHH B;  4UCR A;  4JI5 B;  3U10 A;  1R3L C;  1N8R W;  4JZG A;  1GKF A;  4FMT A;  3EFF K;  3HR0 A;  3CMA V;  2LFR A;  3PJS K;  1TUE B;  4UCS A;  4X65 O;  2OCH A;  3AK1 A;  4YJ3 B;  1H8H G;  1AI7 A;  1QBZ A;  5JQG B;  3G71 V;  4QPJ A;  5LHG A;  1ZLZ A;  3NXS A;  1FAF A;  2GV9 A;  4ZBM A;  1RPO A;  5EC1 C;  3CRM A;  5JH7 B;  3UKM A;  4O4I B;  4J9Z B;  2BOB C;  3K9S A;  1M1K W;  4MVZ A;  1UPG A;  3UQ8 A;  3CJH A;  4B3R O;  2HJF C;  4NTY A;  3CC2 V;  4BIZ A;  4HNA B;  5B3S B;  4P30 A;  4RAI A;  3UO2 A;  5GON A;  4DK0 A;  4J7Z A;  4F6E A;  2D2C B;  1VQN V;  3SJQ C;  1DK1 A;  2JEU A;  5A2Q N;  5LGT A;  4IYH A;  1VAR A;  4JV5 O;  2WLJ A;  1N0N A;  3JAS A;  2IJI A;  5JCO A;  3A0B Z;  2DWD C;  4X9Q A;  5KAI Z;  2JRI A;  1CP9 A;  2PYL A;  5C8Y A;  2UXN A;  1RSO B;  3TCU A;  5CBG A;  2XAH A;  5KUK A;  2P5O A;  1M93 A;  3T1H B;  4EB6 A;  3ASO B;  4DV3 O;  3JD4 A;  3ZRW B;  4P9O A;  2EIJ B;  1PV0 A;  3ABU A;  3H1K H;  3JAR A;  4JI5 O;  4JI6 O;  3ZX6 A;  3VQV A;  3QG5 A;  1J5E O;  2W0F C;  3OE7 G;  1WJZ A;  1Q86 W;  3E8H A;  5IE9 A;  1QVF U;  1U97 A;  1NR7 A;  5J9P C;  4J42 A;  4LFA O;  1S3J A;  3BRC A;  3WG7 C;  3E89 A;  2P7T C;  5CA1 A;  1VQ7 V;  4JV5 B;  3H1J H;  3APQ A;  1S0V A;  4GX2 A;  3WU2 Z;  3RBZ A;  2FL4 A;  1OHH G;  2X6C A;  5FNV B;  4B7K A;  2JGD B;  3M99 B;  3J80 N;  1A32 A;  2YXY A;  4DRX B;  4NTX A;  3H1I H;  1KU9 A;  1JVM A;  2H3O A;  3EVK A;  1NS1 A;  1NZ6 A;  4DV5 B;  4R8C A;  5IYD O;  4IGG A;  4HBN A;  4IIJ A;  3OUS A;  3G6B A;  1AI5 A;  1WN7 A;  1PL4 A;  1SQQ H;  2JGD A;  2Z3Y A;  3HKD A;  4WFG A;  1AI6 A;  2JS3 A;  3ABL C;  4UCO A;  1OCR B;  1L0N H;  2ITD C;  4DUY O;  1M56 C;  1SC5 B;  1TA8 A;  2BSK B;  4DV0 B;  2FYU H;  1EN4 A;  2H94 A;  4NB5 A;  2ADP A;  3SYO A;  3L75 H;  3RFR A;  3AG1 C;  1OCC C;  3F5W C;  4DR6 B;  3AG2 B;  3FAV A;  5CA3 A;  4WFB V;  1K34 A;  4JI2 B;  2EIL C;  3CME V;  3CCU V;  1SS3 A;  4X20 A;  2GTS A;  2QDO A;  3VQX A;  2WLN A;  1W59 A;  3K3W A;  2QWN B;  1HNW B;  4DV1 B;  1BZK A;  4DV0 O;  4TQF A;  2HKO A;  4D7T A;  3OTO B;  5JCO C;  4DV4 B;  4X88 A;  4DV7 B;  3DC6 A;  5LMU B;  2LGW A;  2P90 A;  1YVW A;  3OFN G;  3C3S A;  3RYI A;  2GTA A;  4OPA A;  4PV1 B;  2WA4 A;  1KP3 A;  1P7B A;  1GN3 A;  4H33 A;  4PJ0 Z;  1US6 A;  1GRJ A;  1H2M A;  4GX5 A;  1XMO O;  3ZRW A;  2Z5U A;  1IBL O;  1N0J A;  1QLE C;  4ZHQ B;  1O9H A;  2LQT A;  4F6R A;  1VQ9 V;  5EIB D;  3MD0 A;  2QTO A;  1YI2 V;  3FD9 A;  1JFF A;  5LXT A;  2IJJ A;  2OIE A;  2YIA A;  1XUQ A;  1ZSP A;  3THO A;  3ABM B;  1FXK C;  3K58 A;  1BGY H;  3JD3 A;  4KXR A;  3RW0 A;  1I0H A;  2A9H A;  1COW G;  1HDJ A;  2UXD O;  5LYJ B;  3K5M A;  1EBO A;  3CE2 A;  5EBL C;  1BT8 A;  1HNX B;  4TV9 A;  4X1I A;  5LYJ A;  4LF5 O;  4LH6 A;  3BAA A;  2Q73 A;  4QNH B;  3FB6 C;  2QJ1 A;  4MW8 A;  1VF5 B;  1WNS A;  2W6I G;  2X7R B;  3RYC A;  3QNE A;  4L87 A;  1KMI Z;  1Y74 B;  3OTF A;  5IJ0 A;  3CXH F;  5EZY A;  4UV8 A;  2EIJ C;  1E79 G;  2UUC O;  2JJ1 G;  3D3Q A;  3SPH A;  2Q4P A;  1H2G A;  4JYY A;  4LF4 B;  5ITZ B;  4RWU A;  1X59 A;  4JI8 B;  5JJE B;  2WAM A;  1N32 B;  1BQZ A;  2E5L B;  5DED A;  3W7T A;  4I5S A;  2AXT Z;  3WB0 A;  4PI0 A;  3E22 A;  1VQ8 V;  2IW5 A;  1YIJ V;  2OIG A;  1OCO B;  2E3C A;  2YSU B;  4FLV A;  1AP6 A;  4TQD A;  4GZR B;  4ASU G;  4X62 B;  2K9P A;  1NJI W;  1QU7 A;  2R70 A;  4PD4 F;  5BR8 O;  4R50 A;  5LP6 C;  2YEV A;  3OGC C;  3ZRV A;  4Z2W A;  1B3Q A;  2UUB O;  2WLM A;  4GX0 A;  2IM9 A;  1GAX A;  3E86 A;  3C3T A;  2P06 A;  2RDC A;  4BW9 A;  3VQY A;  4I4T B;  1JCH A;  3HKE B;  3MHS C;  4WFF A;  1M56 B;  4FLW A;  1R3K C;  2E75 B;  4YHH B;  4O4J B;  3OR7 C;  1YCI A;  1H8E G;  1TGO A;  4A5U B;  3OM3 B;  4HYO A;  3B40 A;  4BR6 A;  1ZTE A;  3FYE B;  5LGN A;  1N33 O;  4J11 A;  1GMG A;  3AG1 B;  1Z5W A;  1KD1 W;  4W4L A;  3JAT B;  2KG7 B;  4JI0 B;  5KHK A;  3E2E A;  4DV6 B;  1IUR A;  1Y76 A;  1S5L Z;  3SJA C;  1QNM A;  4FPP A;  4UFZ A;  4F4L A;  4O4L A;  2AZ2 A;  3W7U A;  2QWR B;  4DV3 B;  2Q67 A;  3O65 A;  2CE4 A;  4UB6 Z;  3BCC H;  3P3P A;  1Z5V A;  3RYH B;  1BSM A;  2JDI G;  1CPY A;  1NH2 B;  3JCZ A;  1RM1 C;  3D36 C;  3FB5 C;  3JAM N;  2CK3 G;  3KCY A;  4GLX A;  3P32 A;  3RWR D;  1F51 A;  2W0X A;  2H8P C;  5J2U B;  4AIL C;  4FK5 C;  2ZNJ A;  5F2V O;  4CH3 A;  3F7V C;  4LC1 A;  1EM1 A;  2WA3 A;  4DR5 B;  2UXX A;  3ICX A;  3W7S A;  4X20 B;  4U3J A;  1Q43 A;  4JAA A;  1XDC A;  2QKC A;  3K5L A;  2QA4 V;  1V55 C;  3ABK B;  5LBQ A;  4JTC B;  4DXW A;  3E8F A;  4CH6 A;  2OTJ V;  1Y6X A;  5IWA O;  1HWY A;  4MVR A;  1MSW D;  1QHT A;  2BTQ B;  1FKA O;  3APO A;  4FLX A;  2YUA A;  4K0K B;  5L3D A;  1OCZ B;  2ZQM A;  2KKW A;  4U7O A;  5B1B C;  4FZ1 A;  4NYK A;  3T2M A;  2PZS A;  2IH3 C;  2NR5 A;  4B7E A;  1VF6 A;  3OGI B;  4WCE V;  4NXM B;  1R3J C;  1PNM A;  5BXZ A;  1P4R A;  2AGA A;  4H0L B;  2OCC B;  3JYC A;  4WF9 V;  3ETE A;  4E2L A;  1AIL A;  1ZL8 B;  4I9Q A;  4B3M O;  5E79 Z;  4FFB B;  4X1K B;  3CRQ A;  5JQG A;  2EZO A;  1ZX3 A;  3NR7 A;  4OGQ B;  3AG3 C;  5IYZ A;  5BY1 A;  4DR7 O;  4JGS A;  2YIB D;  4JI8 O;  2YDE A;  1GK9 A;  2IBZ H;  1YJ9 V;  3J81 N;  4TUY B;  1ZAU A;  1K3E A;  1IZ3 A;  1W0K G;  4PDM A;  4LBE C;  3K5N A;  3K04 A;  1TVK B;  4U3F H;  4DR2 B;  2ITC C;  3SYA A;  4PA6 A;  4CS4 A;  1AR5 A;  2QTS A;  1HR0 O;  1GO3 F;  2A7W A;  4JTD B;  5GW7 A;  4UB8 Z;  3SPC A;  2QGN A;  1SER A;  1Q3E A;  3GVM A;  5DN6 G;  1G4Y B;  3OUF A;  3TXS A;  1WB8 A;  3HKC A;  2AZ0 A;  1MAB G;  3P30 A;  4MW3 A;  2CH7 A;  3N2K A;  4FM2 A;  2EIM C;  3OT7 A;  4JAU A;  4BIO A;  5KX5 A;  1SQV H;  4GUN A;  3QO7 A;  1K97 A;  3I55 V;  4JZ2 A;  2CDY A;  2XAS A;  4YJ2 B;  3MDS A;  4MVQ A;  4JPR A;  5EYP A;  3H9V A;  4DV1 O;  1RFY A;  4DR5 O;  1M90 W;  3P3N A;  3AG4 B;  3JAW A;  1FXH A;  2JGU A;  4TWK A;  1VQM V;  4K8Z A;  4FZ0 A;  4JI2 O;  4IIJ B;  5BMV A;  1L1F A;  2ZKO A;  5BZB A;  1GN4 A;  2Y69 B;  4EEQ A;  2E74 B;  1CEZ A;  2CGO A;  4GCZ A;  1K33 A;  2KSD A;  4DO2 A;  4FFB A;  4D7S A;  1YIT V;  4U3J B;  4CBC A;  4R6Z A;  1XL6 A;  3ZMT A;  3ZED A;  4BWA A;  1WB7 A;  3WG7 B;  2B9Z A;  4O2A B;  4F6R B;  2UU9 O;  2GUZ B;  2O57 A;  2VWJ A;  5LOV B;  1VF6 C;  2RJZ A;  1VIB A;  4GT1 A;  4O2B A;  1EZJ A;  2KQX A;  1SQB H; 
#chains in the Genus database with same CATH homology
 2XND G;  2GHY A;  5IY5 B;  4MSW C;  3K9A A;  2EJR A;  2HKO A;  1LNQ A;  1I5X A;  4X88 A;  4MVO A;  3BEH A;  3ZMV A;  4HZ3 A;  2LP7 A;  3OR6 C;  2P90 A;  1BL8 A;  5EC2 C;  3OFN G;  2Q68 A;  1EFR G;  2W6J G;  4FJC C;  4PA4 A;  4UVA A;  2NLJ C;  5EBW C;  5H9C A;  4BAY A;  3B8N A;  3LSQ A;  1WLE A;  1FXK A;  4JAS A;  1K8A W;  1KP3 A;  1P7B A;  4WFH A;  3ZCC A;  4RQF A;  1VQ6 V;  1R6N A;  4H33 A;  1NH2 C;  1FFT B;  1OCR C;  3OEH G;  4GX5 A;  3ZRW A;  2Z5U A;  3WFV A;  5L3G A;  1QLE C;  3ASN C;  1VQ9 V;  3MD0 A;  2QTO A;  3SPG A;  1YI2 V;  4LP8 A;  2EZP A;  2AHZ A;  2WLI B;  2EIK C;  2IJH A;  2IJJ A;  3FYI B;  1F23 A;  5LHH A;  2GSM B;  3ABM B;  1FXK C;  5B3S C;  2JEX A;  2WSS G;  4N23 A;  1YTF D;  4H37 A;  1GM9 A;  3I56 V;  1PL0 A;  3ZRX A;  5B1A B;  3JD3 A;  3RW0 A;  2R9I A;  2M7W A;  3DTU B;  3CC4 V;  3IFX A;  2A9H A;  1AI4 A;  1ORQ C;  4XBF A;  1COW G;  2V1D A;  4J9Y B;  4MS2 A;  1VQO V;  1YTF B;  1EBO A;  5EBL C;  3LDD A;  4MTO A;  3ZN0 A;  3K08 A;  4QNH B;  4UXN A;  3FB6 C;  4R7C A;  1K92 A;  1OCO C;  3CCR V;  3AEI A;  3E83 A;  4MW8 A;  2W6I G;  3LDC A;  5KA6 A;  2Q6A A;  2X7R B;  2X6B A;  5B1B B;  3QNE A;  2V7Q G;  1SZT A;  3FB8 C;  4L87 A;  4N21 A;  1M9N A;  4BIU A;  5EK0 A;  2X6A A;  2Y48 A;  1M57 C;  2K1E A;  2PI4 A;  3ZN1 A;  3B8M A;  5IDJ A;  1K4C C;  4UV8 A;  4UV9 A;  3H01 A;  2EIJ C;  1E79 G;  2F43 G;  3ETD A;  2JJ1 G;  5H6R A;  3OMN B;  3LDE A;  3SPH A;  4BW5 A;  2QKS A;  2HG5 C;  1QVG U;  2KB1 A;  1E1R G;  5FL7 G;  3ABT A;  1H2G A;  4G27 B;  1ARO P;  2OT5 A;  2DQ0 A;  4PEL A;  3JD1 A;  3TK1 A;  1SET A;  3K0G A;  4TT3 G;  3VOU A;  2WAM A;  4PDL A;  1IXM A;  1JX9 A;  3W7T A;  2PI5 A;  1ZWI C;  4I5S A;  1ROP A;  2WLL B;  2DQ3 A;  2WPD G;  4WFE A;  4ZKI A;  2B5U A;  2P6J A;  1OZ0 A;  1RPR A;  4X8A A;  1PKX A;  2ATK C;  3VBB A;  1W2B U;  5CN0 A;  1VQ8 V;  3ZMS A;  2WLH A;  1AJP A;  1Y66 A;  3ZIA G;  3STL C;  2IW5 A;  1THZ A;  3TET A;  3G6E V;  1YIJ V;  3ML0 A;  2AHY A;  1OCO B;  2MK3 A;  2YSU B;  4JTA B;  1VQP V;  3B77 A;  3T4D A;  2X0L A;  2FTK A;  4ASU G;  2HVJ C;  1BHB A;  1KEC A;  1NJI W;  1QLN A;  2EIN C;  4PA9 A;  3OMA B;  4R50 A;  2XAQ A;  3EHB B;  1YJN V;  2YEV A;  3CP1 A;  3G4S V;  3OGC C;  3ZRV A;  2HFE C;  1PD3 A;  2Y69 C;  2DYR B;  2WLM A;  4GX0 A;  3ASO C;  5L3B A;  3CCS V;  5CMU A;  3E86 A;  1JCH A;  1V54 C;  3MHS C;  2ZR3 A;  4WFF A;  3RVY A;  1M56 B;  4OXS A;  4RQE A;  1R3K C;  3SYQ A;  1NVP B;  5HFL A;  5IYB O;  3OR7 C;  4MTX A;  3QO5 A;  3E35 A;  1H8E G;  4MVM A;  1AJN A;  3OM3 B;  4G2K A;  4HYO A;  1KP2 A;  3GB7 C;  5LGN A;  3FYE B;  3SYP A;  4X89 A;  1GMG A;  3AG1 B;  2QEX V;  1QR8 A;  1KD1 W;  5B1O A;  3UM7 A;  3DGE A;  2IJK A;  1PNK A;  3ZMU A;  1G8M A;  3JD0 A;  1UJW B;  3E2E A;  2ZD9 A;  1KKD A;  4RO2 A;  3W7X A;  5E1A C;  5IY5 C;  3D36 A;  1F4M A;  3CPW U;  3CCJ V;  4FPP A;  1NR1 A;  1SES A;  4F4L A;  3F7Y C;  1JQ0 A;  1V55 B;  3W7U A;  2WLI A;  3E8G A;  2Q67 A;  3GWO A;  3OW2 U;  2WLK A;  1AJQ A;  3BY6 A;  4WFA V;  3HB3 B;  2ZDI A;  1FXV A;  2JDI G;  1GTO A;  2YEV B;  3ZRS A;  3X2Q B;  1K73 W;  5EBM C;  1CPY A;  4QIW F;  3LUT B;  3FB7 C;  1NH2 B;  3FKS G;  4KFM A;  1NVP D;  4FIP C;  3JCZ A;  1RM1 C;  2QM7 A;  1DLB A;  2DWE C;  3CYO A;  1VQ4 V;  4MT8 A;  4MTG A;  1QLE B;  3FB5 C;  3W7W A;  2NNU A;  2CK3 G;  3LNM B;  3P32 A;  1F51 A;  1K5S A;  2P67 A;  2H8P C;  1NBM G;  4Q20 A;  4PDV A;  4FK5 C;  1DF5 A;  3CCE V;  2DYS B;  1S5H C;  4QJF B;  1R73 A;  4QPK A;  4QE7 A;  4TSF G;  5H6Q A;  3F7V C;  4CZZ A;  2HVK C;  2EBO A;  2OCC C;  5KUM A;  4LC1 A;  1BHA A;  1H38 A;  1QCE A;  3A0R A;  1OCC B;  4XDK A;  3HPL C;  4MVU A;  4KUM A;  2LFS A;  2UXX A;  3W7S A;  4U7N A;  1YSC A;  3OMI B;  2EIL B;  5B1A C;  1QR9 A;  4LCU C;  3SYC A;  4EKW A;  4P2Z A;  3SPJ A;  2QA4 V;  1V55 C;  2IH1 C;  1DTO A;  1VQL V;  3ABK B;  5HFM A;  4JYB A;  1YTF C;  1W0J G;  5LBQ A;  5B1N A;  1WPX A;  4HAM A;  4JTC B;  4DXW A;  3E8F A;  2OTJ V;  2C2A A;  3K79 A;  1R3L C;  1N8R W;  3K0D A;  1HWY A;  1GKF A;  4MVR A;  4FMT A;  5DM6 V;  1MSW D;  3EFF K;  3CMA V;  2LFR A;  1VQK V;  1NH2 D;  3PJS K;  1TUE B;  1Y4M A;  5L3E A;  5L3C A;  5L3F A;  1K5Q A;  1RM1 B;  5L3D A;  1NQT A;  1OCZ B;  2ZQM A;  4U7O A;  5B1B C;  1H8H G;  1AI7 A;  3ETG A;  3T2M A;  1QBZ A;  3G71 V;  4QPJ A;  2IH3 C;  5LHG A;  1M57 B;  3NXS A;  4ZBM A;  1RPO A;  5EC1 C;  4WCE V;  1R3J C;  3UKM A;  1PNM A;  3ASN B;  4J9Z B;  3IGA C;  1P4R A;  2A0L A;  4Z1M G;  1KQS U;  2BOB C;  2OCC B;  3CCM V;  3JYC A;  4WF9 V;  1M1K W;  4MVZ A;  3CCV V;  3ETE A;  2EIK B;  3LSS A;  3ZJZ A;  4E2L A;  1B6Q A;  2HJF C;  3CC2 V;  2ZXW C;  1F4N A;  4BIZ A;  3MHH C;  5B3S B;  4P30 A;  2EZO A;  5IYC O;  1FS0 G;  4RAI A;  3ABK C;  1S76 D;  1VQN V;  1Q7Y W;  2XAJ A;  3SJQ C;  3AG3 C;  2XAG A;  4P9P A;  2JEU A;  1MOF A;  5LGT A;  3E8B A;  4JGS A;  2WLJ A;  1YJ9 V;  1GK9 A;  2IJI A;  4JYC A;  3T1C A;  1K3E A;  1OCZ C;  2DWD C;  1W0K G;  4PDM A;  4LBE C;  3K04 A;  2BOC C;  4GX1 A;  2ITC C;  1K4D C;  3SYA A;  1K7D A;  3CD6 V;  2OTL V;  4PA6 A;  4MTF A;  1CP9 A;  1GM7 A;  2A79 B;  1GO3 F;  2UXN A;  1J95 A;  3TCU A;  4JTD B;  5CBG A;  5GW7 A;  2XAH A;  5KUK A;  1I5Y A;  3SPC A;  1SER A;  2DYR C;  1JJ2 U;  2DW4 A;  3ASO B;  2WLL A;  5DN6 G;  1VQ5 V;  2JJ2 G;  4I9W A;  1G4Y B;  3JD4 A;  3ZRW B;  2HR3 A;  1S72 V;  4JAV A;  3OUF A;  4P9O A;  2EIJ B;  4PA3 A;  3ABU A;  4UVB A;  3ZMZ A;  2ZXW B;  4KP4 A;  1Q82 W;  1MAB G;  3P30 A;  1NVP C;  2HLD G;  2B1G A;  4MW3 A;  2W0F C;  3OE7 G;  3ABL B;  1Q86 W;  3E8H A;  2EIM C;  5LGU A;  1QVF U;  4JAU A;  3AG3 B;  1NR7 A;  5CBF A;  5J9P C;  3T4Z A;  2D3O W;  3QO8 A;  5LHI A;  1S3J A;  2WWW A;  1JPX A;  3QO7 A;  3E89 A;  2QE7 G;  4RUF A;  3WG7 C;  1K97 A;  2P7T C;  3JD2 A;  3I55 V;  4PDR A;  4G28 B;  5C93 A;  1VQ7 V;  2ZR2 A;  1AR1 B;  2XAS A;  1KC8 W;  4MVQ A;  4JPR A;  3AG2 C;  1S0V A;  3K06 A;  4GX2 A;  3RBZ A;  1NKD A;  4RUE A;  3SPI A;  4MVS A;  1MG1 A;  1M90 W;  3OEE G;  1XL4 A;  1OHH G;  2X6C A;  3OAA G;  3AG4 B;  4JF3 A;  4QE9 A;  1FXH A;  3IC7 A;  2IU0 A;  4TWK A;  1VQM V;  3M99 B;  3K03 A;  3CC7 V;  4UVC A;  4UUJ C;  2EIN B;  1S77 D;  5KA5 A;  4XDJ A;  1JVM A;  1Q81 W;  3CXC U;  3X2Q C;  4XDL A;  1L1F A;  2IU3 A;  1JOY A;  1SRY A;  4R8C A;  5IYD O;  5BZB A;  2Y69 B;  1GM8 A;  4PA7 A;  3OUS A;  2XOK G;  1AI5 A;  2Q69 A;  3RVZ A;  1CEZ A;  2Z3Y A;  4WFG A;  1AI6 A;  4GCZ A;  3CCL V;  2R9R B;  1K33 A;  1R3I C;  3ABL C;  4DO2 A;  2EIM B;  1V54 B;  1OCR B;  2ITD C;  1YJW V;  3STZ C;  2JIZ G;  1YIT V;  1M56 C;  4CBC A;  1XL6 A;  2DYS C;  4R6Z A;  3ZMT A;  3KG2 A;  2ZDI C;  3R65 A;  1DF4 A;  2QM8 A;  3WG7 B;  1R6K A;  2H94 A;  1E1Q G;  2B1I A;  2JK5 C;  1K9M W;  1BMF G;  3SYO A;  3AG1 C;  1OCC C;  3F5W C;  3D3I A;  4YXW G;  5CBH A;  3AG2 B;  2XAF A;  5CA3 A;  4WFB V;  1K34 A;  1PNL A;  2EIL C;  3ABM C;  4GT1 A;  3CME V;  3CCU V;  1YHQ V;  1FXK B;  1ENV A;  2WLN A;  3K3W A;  3CCQ V;  3AG4 C;  1EZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...