5IYDO

Human core-pic in the initial transcribing state (no iis)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iydO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iydO02
1YTFC 1NH2C 5IYCO 1YTFD 1RM1C 1NH2D 1RM1B 1NVPC 5IYBO 1NVPD 5IYDO
chains in the Genus database with same CATH superfamily
3HKBB 2IJIA 5JJEB 3GB7C 1PNLA 4GX5A 1VP7A 4LF5B 4C7UA 3A8TA 1UFIA 3JAKB 2DWDC 3ETEA 5KHGA 2B9ZA 2VQFB 1BT8A 2HR3A 4CC6A 1FXKA 1JA8A 4DV6O 4YJ3A 1EN5A 3X2QB 1Q5OA 4W4KA 1XNRO 1VF6A 2H3OA 2WSSG 2GTAA 4CH3A 5H9CA 1K97A 4D7TA 1OCCB 3AG3B 1Y74B 1GK9A 1YJ9V 4JTAB 1IXBA 4DV3O 1BL8A 4J7JA 5KX5A 4KHPO 1V55B 3OTOB 4AQYB 4JYCA 4EB6B 2EJ7A 1A32A 1R1BA 4DYLA 1GKFA 1FXVA 3RN4A 2UXXA 5KA6A 3LDEA 2OCCB 3K57A 5E1AC 1UPGA 4BIOA 3HKCB 3CJHB 3E8HA 2EBOA 2PI5A 5GTHZ 1YIJV 3H1HH 1VIBA 4X1IB 2Q69A 3BRCA 4QNHB 4HYOA 4WFBV 3K58A 3JD0A 1YF2A 3G4SV 5D5PA 2WLLA 3FYEB 3CCJV 4O2AB 2FL4A 2PYJA 3AG7A 2M6YA 1AI4A 1D5NA 2QA4V 1AR1B 4K8ZA 5A9GA 4MSWC 3RYIB 4TQFA 1D2DA 1QCEA 2KB1A 3STLC 4RAIA 4ZHQA 3SPJA 2QWNB 2DE0X 5FLXN 2CTQA 3CC2V 4WFGA 3ZCCA 4JAUA 2UXBB 1NH2C 5IJ0B 2QR4A 4WBNA 3LNNA 1F4NA 3KKYA 3FB8C 3SR2C 2BCCH 3OFNG 3L71H 2V7QG 1N33O 4UXNA 4H33A 3QO8A 4LCUC 3UT5A 1GAXA 4UB8Z 3H1KH 5IYZB 2DYSC 4DR2O 3ZMUA 4XBFA 2AXTZ 2CDYA 2ZKOA 4TQDA 4X65B 4LFAB 3C3TA 4LFCB 4UCOA 3W7TA 3I56V 3STZC 3K04A 3L74H 2IJHA 1VQ7V 1PP9H 2HJFC 3K03A 4UCRA 2F4VO 3JAKA 1GTOA 4JI1B 2ZXWB 1K33A 3H1JH 1T5EA 2OIEA 1Q43A 1R6TA 4D7SA 1Z5VA 1BSMA 4FLXA 1PV0A 4LNUA 4JV5O 1N34O 1PNKA 3RVYA 2PUSA 2N04A 1P84F 4J42A 5CA0B 1BQ0A 5LXTA 1NU1H 4PJ0Z 2Y0IA 1WA8B 4P9OA 5EYPB 1MNGA 4YIOA 1Y74A 2YSUB 2E3CA 3O65A 4RWUA 4EB6A 3CP1A 4B3SO 1SQXH 4X66B 3SPIA 2LQTA 4HZ3A 4MTGA 3ZMSA 1QNMA 2ZNJA 1N0JA 1FS0G 5BZBA 1K3EA 1SQQH 2HFEC 3HKCA 3CJHA 2EILC 1I08A 4I0XB 3FD9A 4YY3B 1JCHA 3F7VC 3T2MA 5LP6B 4DUZO 1JFFB 1AI7A 2R9AA 1MZFA 4GX1A 4PA6A 1SETA 1SZXA 3K5MA 3CCRV 2ETNA 2X7RB 4MVUA 1GN4A 1AR4A 1EM1A 1NH2B 3P32A 4CH5A 1F4MA 4OGQB 5B66Z 4LF9O 3WU2Z 1N36B 1VQMV 1Q86W 3CRCA 1H2NA 1CP9A 1W0KG 3IC9A 3VQXA 3JALB 4MTFA 3ABTA 5IWAB 2G38A 2JS5A 4JI5B 2X0LA 4GZRB 2NR5A 5LOVA 4WFHA 5EIBD 3L9DA 1P4RA 2RNBA 5TISZ 1TVKA 3ICXA 4LH6A 4DW0A 3N2KB 4CBCA 4LC1A 3GWKC 1IBMO 2YXLA 2EIKC 2ARHA 5L3BA 3T1HB 3OMNB 2JEXA 2DYRB 3ZMZA 3N2GA 1LUWA 5DECA 1IBKB 4IYIA 1B3QA 5H2FZ 3ZHQA 2Q5ZA 2MW2B 4DV1O 4I55B 3RYFB 2IJJA 1YHQV 4GKJO 5IE9A 1EBOA 3TXSA 4K0KB 1MOFA 1N0NA 1MSDA 5CA0A 1B04A 2KKWA 2XUMA 5EYPA 1DF5A 4WFAV 3WG7B 2JEUA 1KBHA 1PL4A 2CTWA 4RQEA 2ZR2A 4PA9A 2HEPA 5LYJA 2VQEO 1AI6A 1DLBA 1R3IC 4UVAA 2LW1A 3VBBA 3CYOA 4Z1MG 4MTOA 3ZHTA 2PZSA 1FXKC 3PJSK 1WN7A 4JI6O 3WB2A 2YIBD 4DUYB 3W7SA 4DV7O 5FNVB 5EZYA 4GX2A 3ZN1A 4I0XA 4DR7B 2D2CB 3OTFA 5LP6A 1X59A 1VF6C 3SYCA 2LGWA 2EIMC 3B09A 2RDCA 2AHZA 2FKXA 5CBGA 4PDVA 4JI8B 1H2LA 1XMQB 4MVOA 2EZOA 4LF7B 2KG7A 2H94A 1KB9F 1WNSA 2B5UA 4FFKA 2JJ1G 2ODMA 4J9YB 3AK3A 1W59A 2CK3G 4DV0O 4JI7B 3JALA 5B1BC 2EULA 1S77D 4HAMA 4QJFB 1FD9A 3LSQA 3VQVA 5EBWC 5JWPA 1MA1A 2F1MA 1I0HA 1HNXB 1PM9A 3M99B 4U7NA 3I55V 3LNMB 1I5YA 3W7UA 1ZWIC 2Q4PA 3N2KA 2W0FC 1M56C 4JI2O 2OCHA 3G67A 2B1IA 2FTKA 4IGGA 4OX9B 3OW2U 3WB0A 5ITZA 5EBMC 5CB4B 4NYKA 1Q8IA 4R50A 5LMUO 3JARB 1GN6A 4I55A 3RYFA 2WLIB 3JYCA 2CUGA 4DV6B 2WA4A 1WAZA 3OD4A 2EIJC 5IY5B 4ZOLA 5IYDO 3CE2A 2VRZA 4A5UB 2EINC 1QU7A 4K8XA 3LSSA 1VF7A 1QR9A 5CN0A 4B3TO 1Y67A 3M8AA 4Z1VA 1WB8A 3OMIB 1OCRC 2A3QA 1HNWO 1OZ0A 5LGTA 3SPGA 4B3RB 3EHBB 2XTAA 4CH4A 2ZE7A 4DR1B 1FXKB 2V1DA 2KQXA 4YJ3B 4MW3A 1YCIA 2CH7B 2JGDA 3IAYA 2YI9A 4QE9A 5CA1A 2R72A 1YITV 1B06A 3ZIAG 2OT5A 4KP4A 3APQA 5FNVA 3X2QC 3UQ8A 2CAZC 3JAWB 5KX5B 5GW7A 5JJJB 4CZZA 2XAFA 2P90A 3DSQA 1Y4MA 5IJ9A 4DR6B 1VARA 1LNQA 3I5DA 1V55C 2E5LB 1XMOB 4KUMA 2P06A 2YDEA 3QG5A 4I9QA 4YHHB 2OCCC 4TSFG 1GO3F 3Q4HA 2ZR3A 2BOBC 2WLLB 2KSDA 2A9HA 5JVDB 2HKOA 4LF8O 1Q3EA 2JJ2G 3DTUB 1KD1W 3B4SA 2BOCC 2YC0A 5E79Z 1NTKH 5FPOA 1J5EB 3EVKA 1ZX3A 3KG2A 4P9PA 3OR6C 2P7TC 3PN1A 2HHHO 1K5QA 1XI1A 4GYCB 5DEDA 2GV9A 5DM6V 3OE7G 2PY5A 4JZ2A 2EJRA 4TV9A 1XUQA 4EKWA 1Q6IA 4LF4O 3JARA 4LR3A 4WCEV 3UT5B 2WLIA 3D3IA 1N34B 1IXMA 1R73A 1K92A 3TXQA 2QM4A 3L70H 3SJCC 3BFRA 3TGUH 1OCRB 2M7WA 4B08A 2YUAA 4ABMA 2UUAB 4FZ1A 5CMUA 3SGIA 3K9SA 4GKKB 5H6RA 3RGBA 1AJNA 1JJOA 4PI2A 1XBLA 1UJWB 5AG2A 4JYBA 4X64O 3ABLB 1GN2A 3THOA 1KP2A 3FB7C 2ZM6O 2DQ3A 1HR0O 4JF3A 4LNUB 5H6QA 1AJPA 2ZXWC 1ENVA 2CH7A 4LWSB 5C93A 1PNMA 5LXTB 2Y69B 1S5HC 4GT1A 5J2TB 4R7CA 1K4CC 1RPRA 1NS1A 3SJBC 1R3KC 4MVRA 4DUZB 3JAWA 1G8MA 3ZX6A 1RSOB 2P4VA 2QGNA 1J95A 5EC2C 4ASUG 4J41A 4JAAA 3JD3A 1XNQB 1IBLO 4I4TA 2YXHA 3TK1A 1HNZO 4LFBO 3B2EE 4UCSA 4DO2A 2P4KA 4FM1A 4YJ2B 5JVDA 1BS3A 1Q81W 5KHJA 1NR7A 3OAAG 2ILMA 4LF6B 4PDMA 5LP6C 3K79A 4X1KB 4NXMO 3K0GA 1NT2B 1OV9A 3UO2A 2VWJA 1FFTB 3ZRSA 1F51A 1V54C 1NVPC 3W7XA 3G71V 5CA3A 1M4UA 1XOUA 3HB3B 4WFEA 4TV8B 4DRXA 2N05A 2Q8VA 1NTMH 4PA7A 2ZNIA 5JCOA 3L72H 2Q0AA 4DR4O 5LA6A 4DXWA 4NKGB 5LOVB 3ML0A 4GKJB 4DV2O 2XAGA 3CRMA 4BW5A 1TVKB 3DXRA 4LP8A 3W7WA 4JTDB 4B3MO 1QVFU 2FYUH 2UUCO 4UUJC 3N2GB 4NXNO 2AZ0A 4X89A 3E8FA 2IH3C 3SDLA 2DYRC 3K5LA 4JYAO 4YIPA 4F6RA 1FPOA 4AHCA 3CX5F 1YEWA 4LWSA 1TA8A 3MDSA 1P49A 4P2ZA 1KP3A 3SYAA 2E74B 3ABMC 1WJZA 5J2TA 4U7OA 4X88A 3AEIA 1FJGB 2DW4A 4I7ZB 2GTSA 1RSOA 3CHXA 1WP7A 1QVGU 2CGOA 2MK3A 1K9MW 1VQ6V 4CS2A 5B1AB 2DN9A 3WG7C 4E2LA 4K35A 5LYJB 1SS3A 1L0LH 2AW9A 5JH7A 1B6QA 1M57B 3FB6C 3K0DA 4LF5O 2QM7A 3OR7C 1NZ6A 3E89A 5EZYB 1M90W 3K06A 1TUEB 2JS3A 2VQFO 4UCTA 3OEHG 3QNEA 5KUKA 1SA0B 4YJ2A 4DR5B 1S0VA 1I94B 4ZKIA 4GUNA 2X6CA 2QJ1A 3ZHUA 1O9GA 4O4LA 4X62B 4O4IA 4FFBB 5H5NA 4X1KA 2KG7B 1V54B 2PI4A 1NVPB 2QWPB 1YXBA 3QO7A 1K4DC 4PD4F 2OWOA 1E1RG 3OGCC 4JI4B 3JD4A 3OTOO 1VQ5V 2XOKG 1EFRG 3AG1C 2A0LA 4MS2A 3D8CA 4RQFA 3SPCA 2WWWA 1RM1C 1N32O 3IFXA 4TV8A 4DV4B 2GSMB 1ZUQA 1MMMA 4O2BB 2DWEC 2YIAA 2IBZH 3AK1A 1IZ3A 5BXZA 1W2BU 4IHJB 1QR8A 4RO2A 4DR3B 1AJQA 1G6UA 1HP8A 1KQSU 4E4EA 2F95B 2YEVA 1VF5B 3T1YB 2NNUA 2Q0OC 2NLJC 3BCCH 1FXHA 5LGNA 2YS8A 3H9VA 4CC5A 5ITZB 4O4HA 2ITDC 1VQ9V 1DK1A 3CCVV 2W6IG 2CTRA 2UXBO 3ABMB 2ADQB 2YXYA 4NVPA 3TJTA 4ZOLB 2E75B 3ETDA 4R6ZA 1OHHG 2LW7A 2XAJA 1YTFC 1S3JA 5IY5C 4TT3G 2OIGA 3U10A 3P30A 4DV5B 4JI3B 2OYQA 3R66A 1P7BA 3SYPA 5L3FA 4X65O 4LFAO 1AP5A 4LFCO 4PELA 2QEXV 3ZBHA 1U97A 4FVMA 4X1YA 2JGDB 4UVBA 3ZEDA 5CA1B 4X8AA 2YIBA 2LGQA 1IURA 1L1FA 1SA0A 3UCSC 3JAMN 4IIJA 2AZ2A 1E79G 3JCZA 4GCZA 1Y76A 5IJ9B 1MSWD 1KC8W 4UFZA 2XASA 1ZLZA 4FFBA 5LMNO 2QWRB 2UUBO 3AG1B 2ATKC 2ZDIA 1CEZA 1RM1B 5LHGA 2DOSA 3F7YC 3MHSC 4GX0A 2UXDO 5LL6Y 3ZMTA 2YIDA 3FKSG 3HKDA 4CS4A 2IJKA 1S72V 2HHHB 4LBEC 3Q4HB 2PTMA 1G4YB 3OUSA 1NH2D 1KKDA 4J7ZA 2Z0AA 3P3PA 1IDSA 2Z5UA 4O2BA 2R9IA 2UU9B 2UXCB 2BSKA 2OTJV 3QTCA 4IHJA 1IVSA 2ITCC 3BA8A 2Q7GA 4JASA 2P5OA 3CSXA 4ZI7B 4YY3O 2YI8A 2Q6AA 3SJQC 3JATA 3FFQA 1H38A 3CC7V 4R8CA 2ADPA 3ASOB 1KU9A 1CXZB 1R6NA 2QSAA 3OEEG 2WLNA 2UXNA 3OUFA 1N4CA 4TV9B 1BGYH 4B7KA 1FKAO 4J7KA 3FAVB 1N36O 3KZIZ 1YTFB 1R6KA 3RW0A 3LDCA 3CS5A 5JCOC 4PI0A 1XNRB 4G27B 1QHTA 5IWAO 4JI5O 1F23A 4FM2A 3ZMVA 2HVKC 4EEQA 2VS0A 1CPYA 4JAVA 1PKXA 2Y48A 3ABUA 4DV3B 5FPRA 4KXRA 4KHPB 4QGPA 1N8RW 3WFVA 2IH1C 4Z2WA 2Q68A 1GRJA 1RP3B 2L6LA 3M7MX 2K1EA 1OJHA 3ABLC 4RUFA 4IYHA 3S3XA 3ZS8C 2X6AA 3HPLC 1V9PA 2ZE8A 3T1HO 3CRAA 4L8JA 2PYLA 3SYQA 3ZN0A 1M1KW 3MD0A 1IBKO 2RCVA 3ZRWA 2QTSA 3CPWU 2Y69C 1NBMG 2A79B 4BIZA 1Y66A 2AGAA 1SZTA 1SQGA 2DQ0A 4K0KO 4MW8A 1H2KA 4OPAA 1MG1A 3A0RA 1HW7A 4HNAA 3JCUZ 1COWG 5C8YB 2NN4A 4I4TB 1ORQC 4DW1A 4MVZA 1SC5B 4PA4A 1JPXA 1SQVH 3MHHC 2LFRA 2JK5C 4UVCA 1BE3H 3E83A 3E2EA 1VQ8V 1Q90D 2GUZB 1GN3A 3ABKC 4X20B 1XL4A 4EFEA 1N33B 3TETA 3C3SA 3CWBH 3NR7A 3G6EV 1US6A 4DR2B 4DR7O 4J80A 1R3JC 4ZI7A 4J9ZB 4UV9A 3E86A 1VQNV 2WPDG 2XNDG 5F2VO 2HP8A 4JI8O 4TWKA 1XMQO 3JASA 3QVNA 2W0XA 4LF7O 1XILA 4MVSA 2F4VB 3ASNC 4DRXB 3K5NA 1KKCA 4NTYA 2WLJA 1GM7A 4IL6Z 5BMVB 3FAVA 5LA6B 4W4LA 3B77A 3CXCU 4ICGA 4JV5B 5K1PA 1VEWA 4JGSA 3HKEB 1JMKC 3DXRB 3APOA 3JD2A 3CMAV 4JI7O 2QWQB 4Q20A 1EZJA 2IU3A 4Q6GA 5EIBC 2DJVA 2QTOA 1ZSPA 3CMEV 1PL0A 2B1GA 1HNXO 4F4LA 3J81N 2F66C 2P6JA 5HFMA 3OT7A 4LH7A 2CE4A 2XAQA 4B3SB 4XDJA 1YVWA 3VOUA 5B3SC 3H1LH 4F6RB 3SPHA 3FYIB 2Q7EA 4N23A 3BVOA 2QKSA 4FLZA 1YZBA 2QDOA 5B1NA 4OX9O 3CCLV 1SRYA 1M9NA 1WLEA 5KUMA 3F5WC 1NTZH 2Q73A 4PA3A 5J2UB 4UB6Z 5IYBO 2LP7A 2WAMA 1R3LC 3EFFK 5EK0A 2JDIG 5B1AC 3HR0A 5JH7B 5C8YA 5BY1A 4LF9B 4G2KA 3ABKB 1SQFA 5BR8O 4QE7A 3VQYA 4B3RO 3E22A 5LGUA 4DR1O 1M57C 2IW5A 2QWOB 2RJZA 4JI0O 1N32B 2GUZA 4F6EA 1AB3A 3RYCA 2Q67A 2ZIMA 4DK0A 4X20A 4O4LB 4FM0A 3E8GA 1DTOA 4O4IB 2BE3A 2JGUA 4X9QA 4U3JB 4MVQA 1YI2V 2K9PA 4JZGA 1AP6A 3IJ4A 5KA5A 3UM7A 2LJ2A 1XQ8A 1H8HG 3A0HZ 1SERA 4UCVA 3ASNB 1QBZA 1IBMB 2ZDIC 2GHYA 2ZE5A 1THZA 2ZQMA 4DR6O 1VQ4V 3AG4B 1SQPH 3ZRVA 1NR1A 2E5LO 1WB7A 1AROP 1XMOO 3DC6A 5BMVA 1VQOV 1H2SB 3T4ZA 4DV1B 3OGIB 2JVDA 5KMGA 1I7FA 1VQPV 2FB5A 4YHHO 2HG5C 3HKEA 1LR1A 3K59A 3DGEA 1URFA 2AHYA 1EN6A 1OCOC 3ZHVA 3D36A 5CBHA 3B40A 2YEVB 2JRIA 1KUQA 1BCCH 1K73W 5B3SB 3BHPA 4O4HB 3A0BZ 5JQGA 5KHIA 1XEQA 1DGSA 2P67A 2F23A 4QPJA 4PHZA 1YJNV 5GONA 1KMIZ 4H44B 2VQEB 1J5EO 2BTOA 1BZKA 2FMLA 1WPXA 3HKBA 1AVMA 5L3CA 2Q7HA 4K3AA 3ZHRA 3J7AU 4JI6B 4J10A 3IGAC 1RPOA 4EFBA 1FYJA 4DV7B 1FFXB 4MTXA 4U3FH 5J2UA 2H8PC 2WLMA 3CRQA 1Z5WA 1YDXA 2R9RB 4N21A 1JVMA 5LMNB 2UUBB 1S76D 3OMAB 3SYOA 2UUAO 1NQTA 4X1YB 3VQWA 4GKKO 1G1XB 4FPPA 2QKAA 3AG2C 2UXDB 3QO5A 4CH6A 4P30A 3O9OA 5LBQA 4DV0B 3ETGA 3T1CA 3OM3B 5CBFA 2XT9A 3CCUV 4IIJB 1ZL8B 1Y76B 2IM9A 3A2FA 3GWOA 3JSLA 1VQKV 1PPJH 3BABA 3H1IH 2Y0PA 4FIPC 3CRRA 1OCZC 3SJAC 4U3JA 3ZJZA 1QLEC 1SKVA 4I50B 4X1IA 4AILC 3B8NA 5LHIA 5J9PC 1TUBB 4O2AA 4AQYO 3HKDB 1K34A 4NR1A 2W6JG 4FLVA 1NJIW 1MABG 4B7EA 1XL6A 4JI2B 4XDKA 3RYIA 1XNQO 1DF4A 2YICA 5LMUB 3E8BA 1D5AA 1OCOB 2PF4E 1E1QG 2BSKB 4XDLA 1YSCA 2HVJC 5IJ0A 4OPHA 1BMFG 3CCSV 4WF9V 5KHHA 3S3WA 3JATB 1RFYA 4L87A 2RMKB 2DYSB 4B3TB 3BPZA 4LF6O 1QLNA 4J11A 3G6BA 3ZHSA 2A06H 2CGNA 2OTLV 1HNWB 5IYZA 1ROPA 1GM9A 3ASOC 3UKMA 2QKCA 4RUEA 3CCEV 2ZD9A 1JR9A 1BQZA 3BY6A 2R70A 4HBNA 1HWYA 2BTQB 3L75H 2Z3YA 5A2QN 1JX9A 4I9WA 1S5LZ 1XHZA 1NKDA 4NB5A 1FFXA 4YXWG 3U11A 2O57A 3CB2A 4O4JB 4BWAA 1I5XA 1AI5A 5GTIZ 2IU0A 4QPKA 3RBZA 3K3WA 3WB1A 1XHXA 1LUVA 3AG2B 1M5IA 5KLVH 1WA8A 2Y4TA 4PDLA 2HLDG 4UV8A 2CTPA 3RVZA 4BR6A 4D6TH 5B5EZ 1O9HA 3UO3A 4JI1O 3R65A 5DN6G 4QIWF 3ZRWB 1JQ0A 2ZT9B 1KECA 2ZE6A 1OCZB 4NTXA 2EILB 5JJNB 3CC4V 3CXHF 4PV1B 4LF8B 1ZL8A 1GH6A 1QLEB 1EZVH 4H13B 1GM8A 3FX7A 4HNAB 3TCUA 1Q82W 5KAFZ 2RN9A 4FZ0A 1AR5A 1S5JA 1EN4A 1BHBA 4I50A 1FJGO 1JFFA 2P22C 2QM8A 1SQBH 1TUBA 1Y6XA 3LUTB 1Z2GA 4BW9A 4ZIBA 5LHHA 4FK5C 2GDSA 4X66O 2V4DA 1NVPD 4ZBMA 2E76B 3L73H 1L8DA 1HDJA 4LF4B 3LDDA 1VQLV 4H37A 1U96A 2F43G 4WFFA 2X6BA 1GMGA 4DR5O 3CD6V 3N27A 4JTCB 1I94O 4MVMA 2D3OW 3J80N 3CEIA 4X62O 4TOIA 3IC7A 3JASB 3KCXA 5L3GA 1P7GA 3AK2A 4X64B 4H0LB 4I5SA 4AI8A 2EIKB 3RYHB 2ZM6B 3H01A 1HR0B 4JI4O 4DK1A 2XHBA 1L0NH 1H2MA 2BTQA 4CS3A 3B8MA 1M93A 2EZPA 1K8AW 1NI8A 3ETQA 1TAEA 2VWKA 2N74A 4TUYB 3KCYA 5L3EA 1SESA 2Q9LA 4DV4O 2ZCEA 1W0JG 3ZRXA 4JYYA 4FLWA 1IX9A 1XREA 5D5QA 2ZIOA 3D36C 1KYOF 4O4JA 5K1XA 4FLYA 4NTWA 4KFMA 2JIZG 4DR3O 3K9AA 4JPRA 1BHAA 4FMTA 4KL1A 1ZTEA 1WP8A 5B1OA 2WLKA 3K08A 3T1YO 1IBLB 3BA9A 1F7YA 1HNZB 1Q6UA 4LFBB 5BR8B 3RWRD 2EX3A 1K7DA 2WLHA 1K5SA 4JI0B 4GLXA 1X4TA 3C90A 3GVMA 3QF7A 2QE7G 3BAAA 5IYCO 1ZAUA 4IT5A 4BAYA 5KHKA 2EIMB 2RQ6A 1JJ2U 4NXMB 3DC5A 1WPBA 4PDRA 1PD3A 1Q6HA 2A7WA 3E35A 4JI3O 4DV5O 3NXSA 2F93B 1OCCC 2PGGA 3AG3C 4UCUA 3E22B 5IT9N 3JSNA 2HJDA 5L3DA 3CCMV 4BIUA 3RYCB 1JOYA 2LO1A 1FAFA 4DR4B 1H2GA 5B1BB 3P3NA 4DV2B 4DUYO 1Q7YW 3JD1A 3BEHA 4G28B 1QQCA 1SF9A 3RT3C 1VMGA 5HFLA 4B3MB 4FLUA 1H8EG 2WA3A 2LFSA 2UUCB 3F5TA 3G80A 5KAIZ 4NXNB 1MZEA 1AILA 1M56B 4FJCC 4ZHQB 3RYHA 3D3QA 3AG4C 3EXAA 5KMGB 4JYAB 2DMXA 4WBNB 2L35A 5EBLC 2XAHA 3K5OA 4TUYA 2C2AA 5CB4A 2EIJB 2Y4UA 2UU9O 1TGOA 2GBOA 5IDJA 2UXCO 2EINB 5FL7G 4FLTA 1YJWV 1YTFD 4OXSA 3MAQA 5JQGB 1XDCA 2ZINA 3U0ZA 3CCQV 5GONB 4MT8A 3FB5C 5EC1C 3RFRA 3T4DA 3LSUA
chains in the Genus database with same CATH topology
2EINC 5L3CA 2IJIA 3ETDA 3LSSA 4R6ZA 1QR9A 5CN0A 1OHHG 3GB7C 2XAJA 1PNLA 4GX5A 1YTFC 1S3JA 3IGAC 1RPOA 5IY5C 4TT3G 2DWDC 3ETEA 3OMIB 1OCRC 3P30A 1OZ0A 4MTXA 5LGTA 3SPGA 2HR3A 3EHBB 1FXKA 1P7BA 3SYPA 2H8PC 2WLMA 1FXKB 2V1DA 5L3FA 2R9RB 4N21A 3X2QB 1JVMA 4MW3A 4PELA 2WSSG 2QEXV 1S76D 3OMAB 3SYOA 4QE9A 5H9CA 1YITV 1NQTA 1K97A 3ZIAG 4UVBA 1OCCB 3AG3B 4X8AA 2OT5A 1GK9A 4KP4A 3X2QC 1YJ9V 4FPPA 3AG2C 4JTAB 1BL8A 1V55B 3QO5A 5GW7A 4P30A 1L1FA 4JYCA 4CZZA 2XAFA 5LBQA 2P90A 3ETGA 3T1CA 3OM3B 5CBFA 1Y4MA 3CCUV 1E79G 3JCZA 4GCZA 1GKFA 1FXVA 1MSWD 1LNQA 2UXXA 5KA6A 3GWOA 1VQKV 1KC8W 1V55C 2XASA 3LDEA 2OCCB 3AG1B 4FIPC 1OCZC 2ATKC 5E1AC 3ZJZA 2ZDIA 3E8HA 4KUMA 1QLEC 2EBOA 2PI5A 1CEZA 1RM1B 5LHGA 3F7YC 3MHSC 4GX0A 1YIJV 2OCCC 2Q69A 3B8NA 4TSFG 4HYOA 3ZMTA 4QNHB 5J9PC 5LHIA 3FKSG 4WFBV 3JD0A 2IJKA 3G4SV 1S72V 2WLLA 3FYEB 3CCJV 1GO3F 2ZR3A 1K34A 2BOBC 2W6JG 2WLLB 4LBEC 2A9HA 1NJIW 1MABG 2HKOA 1G4YB 3OUSA 1XL6A 1NH2D 1KKDA 1AI4A 2QA4V 2JJ2G 1AR1B 4XDKA 3DTUB 2Z5UA 1KD1W 2R9IA 1DF4A 4MSWC 1QCEA 2KB1A 3STLC 3E8BA 4RAIA 1OCOB 3SPJA 2OTJV 2BOCC 1E1QG 2ITCC 4JASA 3CC2V 4WFGA 3ZCCA 4JAUA 4XDLA 1YSCA 2HVJC 2Q6AA 1BMFG 1NH2C 3SJQC 3KG2A 3CCSV 4WF9V 4P9PA 1F4NA 3OR6C 2P7TC 4L87A 3FB8C 1H38A 3CC7V 4R8CA 1K5QA 2DYSB 3ASOB 3OFNG 2V7QG 5DM6V 1R6NA 3OE7G 1QLNA 3OEEG 2WLNA 2UXNA 3OUFA 2EJRA 4UXNA 4H33A 2OTLV 3QO8A 4LCUC 4EKWA 4WCEV 1ROPA 1GM9A 2DYSC 3ASOC 2WLIA 3D3IA 3UKMA 3ZMUA 4XBFA 4RUEA 3CCEV 1IXMA 2ZD9A 1YTFB 1R73A 1R6KA 3BY6A 3RW0A 3LDCA 1K92A 1HWYA 3W7TA 3I56V 3STZC 4G27B 1OCRB 3K04A 2M7WA 2IJHA 5CMUA 1VQ7V 1F23A 2Z3YA 3ZMVA 2HVKC 2HJFC 3K03A 5H6RA 1JX9A 4I9WA 1AJNA 1CPYA 1NKDA 1GTOA 1UJWB 4JYBA 4YXWG 4JAVA 1PKXA 2ZXWB 2Y48A 1K33A 3ABLB 3ABUA 1KP2A 3FB7C 1N8RW 3WFVA 2IH1C 1I5XA 2DQ3A 1AI5A 2Q68A 4JF3A 2IU0A 1PNKA 4QPKA 5H6QA 3RVYA 3RBZA 3K3WA 1AJPA 2K1EA 2ZXWC 3ABLC 4RUFA 1ENVA 3AG2B 5C93A 1PNMA 2X6AA 3HPLC 2Y69B 1S5HC 4PDLA 4P9OA 4GT1A 2HLDG 4UV8A 3RVZA 2YSUB 4R7CA 1K4CC 1RPRA 3SYQA 3ZN0A 1M1KW 3MD0A 1R3KC 4MVRA 3R65A 3ZRWA 5DN6G 1G8MA 3CPWU 4QIWF 3ZRWB 1JQ0A 1KECA 2Y69C 1NBMG 2A79B 4BIZA 1Y66A 3CP1A 1SZTA 1OCZB 2EILB 2DQ0A 3CC4V 1J95A 5EC2C 4MW8A 3SPIA 1QLEB 1MG1A 3A0RA 4HZ3A 4MTGA 3ZMSA 4ASUG 1GM8A 3JD3A 3TCUA 1Q82W 1FS0G 1COWG 5BZBA 1K3EA 2HFEC 3TK1A 2EILC 1ORQC 1BHBA 4MVZA 4PA4A 1JPXA 1JCHA 3F7VC 3T2MA 2QM8A 3MHHC 4DO2A 2LFRA 1AI7A 2JK5C 4UVCA 3E83A 3LUTB 5LHHA 4GX1A 3E2EA 4PA6A 1SETA 1VQ8V 1Q81W 1NR7A 4FK5C 3ABKC 3OAAG 1NVPD 3CCRV 4ZBMA 4PDMA 1XL4A 2X7RB 3K79A 4MVUA 3TETA 1NH2B 3P32A 3K0GA 3G6EV 1F4MA 3LDDA 1VQLV 1R3JC 4H37A 1FFTB 1VQMV 1Q86W 3ZRSA 4J9ZB 2F43G 1F51A 4UV9A 1V54C 3E86A 4WFFA 2X6BA 1CP9A 1VQNV 2XNDG 1GMGA 1W0KG 2WPDG 3W7XA 1NVPC 3CD6V 4JTCB 3G71V 5CA3A 4MTFA 4MVMA 2D3OW 3ABTA 4TWKA 3HB3B 4WFEA 3IC7A 2X0LA 4MVSA 5L3GA 4PA7A 3ASNC 2WLJA 4I5SA 1GM7A 4WFHA 1P4RA 4DXWA 2EIKB 3B77A 3ML0A 3H01A 3CXCU 2XAGA 4BW5A 4JGSA 4LP8A 3W7WA 4CBCA 4LC1A 3JD2A 3B8MA 3CMAV 2EZPA 4JTDB 1K8AW 4Q20A 1EZJA 2EIKC 5L3BA 1QVFU 2IU3A 5L3EA 1SESA 3OMNB 2JEXA 2DYRB 3ZMZA 1W0JG 2QTOA 3ZRXA 4UUJC 3CMEV 1PL0A 2B1GA 4F4LA 2P6JA 5HFMA 4X89A 2IJJA 1YHQV 3E8FA 2IH3C 4KFMA 2XAQA 1EBOA 4XDJA 2DYRC 2JIZG 3VOUA 3K9AA 1MOFA 4JPRA 5B3SC 1BHAA 4FMTA 3SPHA 3FYIB 4N23A 5B1OA 4P2ZA 1KP3A 2QKSA 2WLKA 3K08A 1DF5A 4WFAV 3SYAA 3WG7B 3ABMC 5B1NA 4U7OA 4X88A 2JEUA 3AEIA 3CCLV 2DW4A 1SRYA 1K7DA 4RQEA 2WLHA 1M9NA 1WLEA 5KUMA 1QVGU 3F5WC 1K9MW 2MK3A 1VQ6V 1K5SA 2ZR2A 5B1AB 4PA3A 4PA9A 3WG7C 5IYBO 4E2LA 1AI6A 2LP7A 2WAMA 1DLBA 1R3LC 3EFFK 1R3IC 4UVAA 2QE7G 5EK0A 5IYCO 2JDIG 3VBBA 3CYOA 4Z1MG 4MTOA 4BAYA 2EIMB 5B1AC 1JJ2U 1FXKC 1B6QA 1M57B 3FB6C 3K0DA 3PJSK 2QM7A 3OR7C 3W7SA 4GX2A 3E89A 4G2KA 4PDRA 3ZN1A 1PD3A 3ABKB 1M90W 3K06A 4QE7A 1TUEB 3E35A 3SYCA 3OEHG 2EIMC 3QNEA 5KUKA 3NXSA 2AHZA 5LGUA 1S0VA 1OCCC 1M57C 3AG3C 4ZKIA 2IW5A 2X6CA 5CBGA 4PDVA 5L3DA 2Q67A 4MVOA 3CCMV 4BIUA 2EZOA 1JOYA 2H94A 3E8GA 1DTOA 1V54B 2PI4A 1NVPB 1H2GA 5B1BB 2B5UA 4MVQA 1YI2V 3QO7A 1K4DC 2JJ1G 5KA5A 1E1RG 3UM7A 1Q7YW 3JD1A 3OGCC 3BEHA 4J9YB 4G28B 1H8HG 3JD4A 1VQ5V 2XOKG 1EFRG 3AG1C 1SERA 2A0LA 3ASNB 1QBZA 2CK3G 4MS2A 4RQFA 5HFLA 2WWWA 3SPCA 5B1BC 2ZDIC 1S77D 4HAMA 4QJFB 2GHYA 1RM1C 1THZA 2ZQMA 1VQ4V 3IFXA 3LSQA 1H8EG 3AG4B 5EBWC 2GSMB 3ZRVA 2LFSA 1NR1A 1AROP 2DWEC 1M56B 1VQOV 4FJCC 3I55V 3M99B 4U7NA 3T4ZA 1W2BU 3LNMB 1QR8A 1I5YA 3AG4C 4RO2A 1VQPV 2HG5C 3W7UA 1AJQA 1ZWIC 1KQSU 2W0FC 3DGEA 2AHYA 1M56C 1OCOC 3D36A 5EBLC 5CBHA 2XAHA 2YEVA 2YEVB 2NNUA 2NLJC 2C2AA 2B1IA 2FTKA 3OW2U 2EIJB 1FXHA 1K73W 5LGNA 5EBMC 5IDJA 2ITDC 2EINB 4R50A 5FL7G 5B3SB 1YJWV 1YTFD 4OXSA 2WLIB 3JYCA 2P67A 4QPJA 1VQ9V 3CCVV 2W6IG 1YJNV 3CCQV 2EIJC 5IY5B 4MT8A 3FB5C 3ABMB 5EC1C 5IYDO 3T4DA 1WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF C;  1NH2 C;  5IYC O;  1YTF D;  1RM1 C;  1NH2 D;  1RM1 B;  1NVP C;  5IYB O;  1NVP D;  5IYD O; 
#chains in the Genus database with same CATH topology
 3HKB B;  2IJI A;  5JJE B;  3GB7 C;  1PNL A;  4GX5 A;  1VP7 A;  4LF5 B;  4C7U A;  3A8T A;  1UFI A;  3JAK B;  2DWD C;  3ETE A;  5KHG A;  2B9Z A;  2VQF B;  1BT8 A;  2HR3 A;  4CC6 A;  1FXK A;  1JA8 A;  4DV6 O;  4YJ3 A;  1EN5 A;  3X2Q B;  1Q5O A;  4W4K A;  1XNR O;  1VF6 A;  2H3O A;  2WSS G;  2GTA A;  4CH3 A;  5H9C A;  1K97 A;  4D7T A;  1OCC B;  3AG3 B;  1Y74 B;  1GK9 A;  1YJ9 V;  4JTA B;  1IXB A;  4DV3 O;  1BL8 A;  4J7J A;  5KX5 A;  4KHP O;  1V55 B;  3OTO B;  4AQY B;  4JYC A;  4EB6 B;  2EJ7 A;  1A32 A;  1R1B A;  4DYL A;  1GKF A;  1FXV A;  3RN4 A;  2UXX A;  5KA6 A;  3LDE A;  2OCC B;  3K57 A;  5E1A C;  1UPG A;  4BIO A;  3HKC B;  3CJH B;  3E8H A;  2EBO A;  2PI5 A;  5GTH Z;  1YIJ V;  3H1H H;  1VIB A;  4X1I B;  2Q69 A;  3BRC A;  4QNH B;  4HYO A;  4WFB V;  3K58 A;  3JD0 A;  1YF2 A;  3G4S V;  5D5P A;  2WLL A;  3FYE B;  3CCJ V;  4O2A B;  2FL4 A;  2PYJ A;  3AG7 A;  2M6Y A;  1AI4 A;  1D5N A;  2QA4 V;  1AR1 B;  4K8Z A;  5A9G A;  4MSW C;  3RYI B;  4TQF A;  1D2D A;  1QCE A;  2KB1 A;  3STL C;  4RAI A;  4ZHQ A;  3SPJ A;  2QWN B;  2DE0 X;  5FLX N;  2CTQ A;  3CC2 V;  4WFG A;  3ZCC A;  4JAU A;  2UXB B;  1NH2 C;  5IJ0 B;  2QR4 A;  4WBN A;  3LNN A;  1F4N A;  3KKY A;  3FB8 C;  3SR2 C;  2BCC H;  3OFN G;  3L71 H;  2V7Q G;  1N33 O;  4UXN A;  4H33 A;  3QO8 A;  4LCU C;  3UT5 A;  1GAX A;  4UB8 Z;  3H1K H;  5IYZ B;  2DYS C;  4DR2 O;  3ZMU A;  4XBF A;  2AXT Z;  2CDY A;  2ZKO A;  4TQD A;  4X65 B;  4LFA B;  3C3T A;  4LFC B;  4UCO A;  3W7T A;  3I56 V;  3STZ C;  3K04 A;  3L74 H;  2IJH A;  1VQ7 V;  1PP9 H;  2HJF C;  3K03 A;  4UCR A;  2F4V O;  3JAK A;  1GTO A;  4JI1 B;  2ZXW B;  1K33 A;  3H1J H;  1T5E A;  2OIE A;  1Q43 A;  1R6T A;  4D7S A;  1Z5V A;  1BSM A;  4FLX A;  1PV0 A;  4LNU A;  4JV5 O;  1N34 O;  1PNK A;  3RVY A;  2PUS A;  2N04 A;  1P84 F;  4J42 A;  5CA0 B;  1BQ0 A;  5LXT A;  1NU1 H;  4PJ0 Z;  2Y0I A;  1WA8 B;  4P9O A;  5EYP B;  1MNG A;  4YIO A;  1Y74 A;  2YSU B;  2E3C A;  3O65 A;  4RWU A;  4EB6 A;  3CP1 A;  4B3S O;  1SQX H;  4X66 B;  3SPI A;  2LQT A;  4HZ3 A;  4MTG A;  3ZMS A;  1QNM A;  2ZNJ A;  1N0J A;  1FS0 G;  5BZB A;  1K3E A;  1SQQ H;  2HFE C;  3HKC A;  3CJH A;  2EIL C;  1I08 A;  4I0X B;  3FD9 A;  4YY3 B;  1JCH A;  3F7V C;  3T2M A;  5LP6 B;  4DUZ O;  1JFF B;  1AI7 A;  2R9A A;  1MZF A;  4GX1 A;  4PA6 A;  1SET A;  1SZX A;  3K5M A;  3CCR V;  2ETN A;  2X7R B;  4MVU A;  1GN4 A;  1AR4 A;  1EM1 A;  1NH2 B;  3P32 A;  4CH5 A;  1F4M A;  4OGQ B;  5B66 Z;  4LF9 O;  3WU2 Z;  1N36 B;  1VQM V;  1Q86 W;  3CRC A;  1H2N A;  1CP9 A;  1W0K G;  3IC9 A;  3VQX A;  3JAL B;  4MTF A;  3ABT A;  5IWA B;  2G38 A;  2JS5 A;  4JI5 B;  2X0L A;  4GZR B;  2NR5 A;  5LOV A;  4WFH A;  5EIB D;  3L9D A;  1P4R A;  2RNB A;  5TIS Z;  1TVK A;  3ICX A;  4LH6 A;  4DW0 A;  3N2K B;  4CBC A;  4LC1 A;  3GWK C;  1IBM O;  2YXL A;  2EIK C;  2ARH A;  5L3B A;  3T1H B;  3OMN B;  2JEX A;  2DYR B;  3ZMZ A;  3N2G A;  1LUW A;  5DEC A;  1IBK B;  4IYI A;  1B3Q A;  5H2F Z;  3ZHQ A;  2Q5Z A;  2MW2 B;  4DV1 O;  4I55 B;  3RYF B;  2IJJ A;  1YHQ V;  4GKJ O;  5IE9 A;  1EBO A;  3TXS A;  4K0K B;  1MOF A;  1N0N A;  1MSD A;  5CA0 A;  1B04 A;  2KKW A;  2XUM A;  5EYP A;  1DF5 A;  4WFA V;  3WG7 B;  2JEU A;  1KBH A;  1PL4 A;  2CTW A;  4RQE A;  2ZR2 A;  4PA9 A;  2HEP A;  5LYJ A;  2VQE O;  1AI6 A;  1DLB A;  1R3I C;  4UVA A;  2LW1 A;  3VBB A;  3CYO A;  4Z1M G;  4MTO A;  3ZHT A;  2PZS A;  1FXK C;  3PJS K;  1WN7 A;  4JI6 O;  3WB2 A;  2YIB D;  4DUY B;  3W7S A;  4DV7 O;  5FNV B;  5EZY A;  4GX2 A;  3ZN1 A;  4I0X A;  4DR7 B;  2D2C B;  3OTF A;  5LP6 A;  1X59 A;  1VF6 C;  3SYC A;  2LGW A;  2EIM C;  3B09 A;  2RDC A;  2AHZ A;  2FKX A;  5CBG A;  4PDV A;  4JI8 B;  1H2L A;  1XMQ B;  4MVO A;  2EZO A;  4LF7 B;  2KG7 A;  2H94 A;  1KB9 F;  1WNS A;  2B5U A;  4FFK A;  2JJ1 G;  2ODM A;  4J9Y B;  3AK3 A;  1W59 A;  2CK3 G;  4DV0 O;  4JI7 B;  3JAL A;  5B1B C;  2EUL A;  1S77 D;  4HAM A;  4QJF B;  1FD9 A;  3LSQ A;  3VQV A;  5EBW C;  5JWP A;  1MA1 A;  2F1M A;  1I0H A;  1HNX B;  1PM9 A;  3M99 B;  4U7N A;  3I55 V;  3LNM B;  1I5Y A;  3W7U A;  1ZWI C;  2Q4P A;  3N2K A;  2W0F C;  1M56 C;  4JI2 O;  2OCH A;  3G67 A;  2B1I A;  2FTK A;  4IGG A;  4OX9 B;  3OW2 U;  3WB0 A;  5ITZ A;  5EBM C;  5CB4 B;  4NYK A;  1Q8I A;  4R50 A;  5LMU O;  3JAR B;  1GN6 A;  4I55 A;  3RYF A;  2WLI B;  3JYC A;  2CUG A;  4DV6 B;  2WA4 A;  1WAZ A;  3OD4 A;  2EIJ C;  5IY5 B;  4ZOL A;  5IYD O;  3CE2 A;  2VRZ A;  4A5U B;  2EIN C;  1QU7 A;  4K8X A;  3LSS A;  1VF7 A;  1QR9 A;  5CN0 A;  4B3T O;  1Y67 A;  3M8A A;  4Z1V A;  1WB8 A;  3OMI B;  1OCR C;  2A3Q A;  1HNW O;  1OZ0 A;  5LGT A;  3SPG A;  4B3R B;  3EHB B;  2XTA A;  4CH4 A;  2ZE7 A;  4DR1 B;  1FXK B;  2V1D A;  2KQX A;  4YJ3 B;  4MW3 A;  1YCI A;  2CH7 B;  2JGD A;  3IAY A;  2YI9 A;  4QE9 A;  5CA1 A;  2R72 A;  1YIT V;  1B06 A;  3ZIA G;  2OT5 A;  4KP4 A;  3APQ A;  5FNV A;  3X2Q C;  3UQ8 A;  2CAZ C;  3JAW B;  5KX5 B;  5GW7 A;  5JJJ B;  4CZZ A;  2XAF A;  2P90 A;  3DSQ A;  1Y4M A;  5IJ9 A;  4DR6 B;  1VAR A;  1LNQ A;  3I5D A;  1V55 C;  2E5L B;  1XMO B;  4KUM A;  2P06 A;  2YDE A;  3QG5 A;  4I9Q A;  4YHH B;  2OCC C;  4TSF G;  1GO3 F;  3Q4H A;  2ZR3 A;  2BOB C;  2WLL B;  2KSD A;  2A9H A;  5JVD B;  2HKO A;  4LF8 O;  1Q3E A;  2JJ2 G;  3DTU B;  1KD1 W;  3B4S A;  2BOC C;  2YC0 A;  5E79 Z;  1NTK H;  5FPO A;  1J5E B;  3EVK A;  1ZX3 A;  3KG2 A;  4P9P A;  3OR6 C;  2P7T C;  3PN1 A;  2HHH O;  1K5Q A;  1XI1 A;  4GYC B;  5DED A;  2GV9 A;  5DM6 V;  3OE7 G;  2PY5 A;  4JZ2 A;  2EJR A;  4TV9 A;  1XUQ A;  4EKW A;  1Q6I A;  4LF4 O;  3JAR A;  4LR3 A;  4WCE V;  3UT5 B;  2WLI A;  3D3I A;  1N34 B;  1IXM A;  1R73 A;  1K92 A;  3TXQ A;  2QM4 A;  3L70 H;  3SJC C;  3BFR A;  3TGU H;  1OCR B;  2M7W A;  4B08 A;  2YUA A;  4ABM A;  2UUA B;  4FZ1 A;  5CMU A;  3SGI A;  3K9S A;  4GKK B;  5H6R A;  3RGB A;  1AJN A;  1JJO A;  4PI2 A;  1XBL A;  1UJW B;  5AG2 A;  4JYB A;  4X64 O;  3ABL B;  1GN2 A;  3THO A;  1KP2 A;  3FB7 C;  2ZM6 O;  2DQ3 A;  1HR0 O;  4JF3 A;  4LNU B;  5H6Q A;  1AJP A;  2ZXW C;  1ENV A;  2CH7 A;  4LWS B;  5C93 A;  1PNM A;  5LXT B;  2Y69 B;  1S5H C;  4GT1 A;  5J2T B;  4R7C A;  1K4C C;  1RPR A;  1NS1 A;  3SJB C;  1R3K C;  4MVR A;  4DUZ B;  3JAW A;  1G8M A;  3ZX6 A;  1RSO B;  2P4V A;  2QGN A;  1J95 A;  5EC2 C;  4ASU G;  4J41 A;  4JAA A;  3JD3 A;  1XNQ B;  1IBL O;  4I4T A;  2YXH A;  3TK1 A;  1HNZ O;  4LFB O;  3B2E E;  4UCS A;  4DO2 A;  2P4K A;  4FM1 A;  4YJ2 B;  5JVD A;  1BS3 A;  1Q81 W;  5KHJ A;  1NR7 A;  3OAA G;  2ILM A;  4LF6 B;  4PDM A;  5LP6 C;  3K79 A;  4X1K B;  4NXM O;  3K0G A;  1NT2 B;  1OV9 A;  3UO2 A;  2VWJ A;  1FFT B;  3ZRS A;  1F51 A;  1V54 C;  1NVP C;  3W7X A;  3G71 V;  5CA3 A;  1M4U A;  1XOU A;  3HB3 B;  4WFE A;  4TV8 B;  4DRX A;  2N05 A;  2Q8V A;  1NTM H;  4PA7 A;  2ZNI A;  5JCO A;  3L72 H;  2Q0A A;  4DR4 O;  5LA6 A;  4DXW A;  4NKG B;  5LOV B;  3ML0 A;  4GKJ B;  4DV2 O;  2XAG A;  3CRM A;  4BW5 A;  1TVK B;  3DXR A;  4LP8 A;  3W7W A;  4JTD B;  4B3M O;  1QVF U;  2FYU H;  2UUC O;  4UUJ C;  3N2G B;  4NXN O;  2AZ0 A;  4X89 A;  3E8F A;  2IH3 C;  3SDL A;  2DYR C;  3K5L A;  4JYA O;  4YIP A;  4F6R A;  1FPO A;  4AHC A;  3CX5 F;  1YEW A;  4LWS A;  1TA8 A;  3MDS A;  1P49 A;  4P2Z A;  1KP3 A;  3SYA A;  2E74 B;  3ABM C;  1WJZ A;  5J2T A;  4U7O A;  4X88 A;  3AEI A;  1FJG B;  2DW4 A;  4I7Z B;  2GTS A;  1RSO A;  3CHX A;  1WP7 A;  1QVG U;  2CGO A;  2MK3 A;  1K9M W;  1VQ6 V;  4CS2 A;  5B1A B;  2DN9 A;  3WG7 C;  4E2L A;  4K35 A;  5LYJ B;  1SS3 A;  1L0L H;  2AW9 A;  5JH7 A;  1B6Q A;  1M57 B;  3FB6 C;  3K0D A;  4LF5 O;  2QM7 A;  3OR7 C;  1NZ6 A;  3E89 A;  5EZY B;  1M90 W;  3K06 A;  1TUE B;  2JS3 A;  2VQF O;  4UCT A;  3OEH G;  3QNE A;  5KUK A;  1SA0 B;  4YJ2 A;  4DR5 B;  1S0V A;  1I94 B;  4ZKI A;  4GUN A;  2X6C A;  2QJ1 A;  3ZHU A;  1O9G A;  4O4L A;  4X62 B;  4O4I A;  4FFB B;  5H5N A;  4X1K A;  2KG7 B;  1V54 B;  2PI4 A;  1NVP B;  2QWP B;  1YXB A;  3QO7 A;  1K4D C;  4PD4 F;  2OWO A;  1E1R G;  3OGC C;  4JI4 B;  3JD4 A;  3OTO O;  1VQ5 V;  2XOK G;  1EFR G;  3AG1 C;  2A0L A;  4MS2 A;  3D8C A;  4RQF A;  3SPC A;  2WWW A;  1RM1 C;  1N32 O;  3IFX A;  4TV8 A;  4DV4 B;  2GSM B;  1ZUQ A;  1MMM A;  4O2B B;  2DWE C;  2YIA A;  2IBZ H;  3AK1 A;  1IZ3 A;  5BXZ A;  1W2B U;  4IHJ B;  1QR8 A;  4RO2 A;  4DR3 B;  1AJQ A;  1G6U A;  1HP8 A;  1KQS U;  4E4E A;  2F95 B;  2YEV A;  1VF5 B;  3T1Y B;  2NNU A;  2Q0O C;  2NLJ C;  3BCC H;  1FXH A;  5LGN A;  2YS8 A;  3H9V A;  4CC5 A;  5ITZ B;  4O4H A;  2ITD C;  1VQ9 V;  1DK1 A;  3CCV V;  2W6I G;  2CTR A;  2UXB O;  3ABM B;  2ADQ B;  2YXY A;  4NVP A;  3TJT A;  4ZOL B;  2E75 B;  3ETD A;  4R6Z A;  1OHH G;  2LW7 A;  2XAJ A;  1YTF C;  1S3J A;  5IY5 C;  4TT3 G;  2OIG A;  3U10 A;  3P30 A;  4DV5 B;  4JI3 B;  2OYQ A;  3R66 A;  1P7B A;  3SYP A;  5L3F A;  4X65 O;  4LFA O;  1AP5 A;  4LFC O;  4PEL A;  2QEX V;  3ZBH A;  1U97 A;  4FVM A;  4X1Y A;  2JGD B;  4UVB A;  3ZED A;  5CA1 B;  4X8A A;  2YIB A;  2LGQ A;  1IUR A;  1L1F A;  1SA0 A;  3UCS C;  3JAM N;  4IIJ A;  2AZ2 A;  1E79 G;  3JCZ A;  4GCZ A;  1Y76 A;  5IJ9 B;  1MSW D;  1KC8 W;  4UFZ A;  2XAS A;  1ZLZ A;  4FFB A;  5LMN O;  2QWR B;  2UUB O;  3AG1 B;  2ATK C;  2ZDI A;  1CEZ A;  1RM1 B;  5LHG A;  2DOS A;  3F7Y C;  3MHS C;  4GX0 A;  2UXD O;  5LL6 Y;  3ZMT A;  2YID A;  3FKS G;  3HKD A;  4CS4 A;  2IJK A;  1S72 V;  2HHH B;  4LBE C;  3Q4H B;  2PTM A;  1G4Y B;  3OUS A;  1NH2 D;  1KKD A;  4J7Z A;  2Z0A A;  3P3P A;  1IDS A;  2Z5U A;  4O2B A;  2R9I A;  2UU9 B;  2UXC B;  2BSK A;  2OTJ V;  3QTC A;  4IHJ A;  1IVS A;  2ITC C;  3BA8 A;  2Q7G A;  4JAS A;  2P5O A;  3CSX A;  4ZI7 B;  4YY3 O;  2YI8 A;  2Q6A A;  3SJQ C;  3JAT A;  3FFQ A;  1H38 A;  3CC7 V;  4R8C A;  2ADP A;  3ASO B;  1KU9 A;  1CXZ B;  1R6N A;  2QSA A;  3OEE G;  2WLN A;  2UXN A;  3OUF A;  1N4C A;  4TV9 B;  1BGY H;  4B7K A;  1FKA O;  4J7K A;  3FAV B;  1N36 O;  3KZI Z;  1YTF B;  1R6K A;  3RW0 A;  3LDC A;  3CS5 A;  5JCO C;  4PI0 A;  1XNR B;  4G27 B;  1QHT A;  5IWA O;  4JI5 O;  1F23 A;  4FM2 A;  3ZMV A;  2HVK C;  4EEQ A;  2VS0 A;  1CPY A;  4JAV A;  1PKX A;  2Y48 A;  3ABU A;  4DV3 B;  5FPR A;  4KXR A;  4KHP B;  4QGP A;  1N8R W;  3WFV A;  2IH1 C;  4Z2W A;  2Q68 A;  1GRJ A;  1RP3 B;  2L6L A;  3M7M X;  2K1E A;  1OJH A;  3ABL C;  4RUF A;  4IYH A;  3S3X A;  3ZS8 C;  2X6A A;  3HPL C;  1V9P A;  2ZE8 A;  3T1H O;  3CRA A;  4L8J A;  2PYL A;  3SYQ A;  3ZN0 A;  1M1K W;  3MD0 A;  1IBK O;  2RCV A;  3ZRW A;  2QTS A;  3CPW U;  2Y69 C;  1NBM G;  2A79 B;  4BIZ A;  1Y66 A;  2AGA A;  1SZT A;  1SQG A;  2DQ0 A;  4K0K O;  4MW8 A;  1H2K A;  4OPA A;  1MG1 A;  3A0R A;  1HW7 A;  4HNA A;  3JCU Z;  1COW G;  5C8Y B;  2NN4 A;  4I4T B;  1ORQ C;  4DW1 A;  4MVZ A;  1SC5 B;  4PA4 A;  1JPX A;  1SQV H;  3MHH C;  2LFR A;  2JK5 C;  4UVC A;  1BE3 H;  3E83 A;  3E2E A;  1VQ8 V;  1Q90 D;  2GUZ B;  1GN3 A;  3ABK C;  4X20 B;  1XL4 A;  4EFE A;  1N33 B;  3TET A;  3C3S A;  3CWB H;  3NR7 A;  3G6E V;  1US6 A;  4DR2 B;  4DR7 O;  4J80 A;  1R3J C;  4ZI7 A;  4J9Z B;  4UV9 A;  3E86 A;  1VQN V;  2WPD G;  2XND G;  5F2V O;  2HP8 A;  4JI8 O;  4TWK A;  1XMQ O;  3JAS A;  3QVN A;  2W0X A;  4LF7 O;  1XIL A;  4MVS A;  2F4V B;  3ASN C;  4DRX B;  3K5N A;  1KKC A;  4NTY A;  2WLJ A;  1GM7 A;  4IL6 Z;  5BMV B;  3FAV A;  5LA6 B;  4W4L A;  3B77 A;  3CXC U;  4ICG A;  4JV5 B;  5K1P A;  1VEW A;  4JGS A;  3HKE B;  1JMK C;  3DXR B;  3APO A;  3JD2 A;  3CMA V;  4JI7 O;  2QWQ B;  4Q20 A;  1EZJ A;  2IU3 A;  4Q6G A;  5EIB C;  2DJV A;  2QTO A;  1ZSP A;  3CME V;  1PL0 A;  2B1G A;  1HNX O;  4F4L A;  3J81 N;  2F66 C;  2P6J A;  5HFM A;  3OT7 A;  4LH7 A;  2CE4 A;  2XAQ A;  4B3S B;  4XDJ A;  1YVW A;  3VOU A;  5B3S C;  3H1L H;  4F6R B;  3SPH A;  3FYI B;  2Q7E A;  4N23 A;  3BVO A;  2QKS A;  4FLZ A;  1YZB A;  2QDO A;  5B1N A;  4OX9 O;  3CCL V;  1SRY A;  1M9N A;  1WLE A;  5KUM A;  3F5W C;  1NTZ H;  2Q73 A;  4PA3 A;  5J2U B;  4UB6 Z;  5IYB O;  2LP7 A;  2WAM A;  1R3L C;  3EFF K;  5EK0 A;  2JDI G;  5B1A C;  3HR0 A;  5JH7 B;  5C8Y A;  5BY1 A;  4LF9 B;  4G2K A;  3ABK B;  1SQF A;  5BR8 O;  4QE7 A;  3VQY A;  4B3R O;  3E22 A;  5LGU A;  4DR1 O;  1M57 C;  2IW5 A;  2QWO B;  2RJZ A;  4JI0 O;  1N32 B;  2GUZ A;  4F6E A;  1AB3 A;  3RYC A;  2Q67 A;  2ZIM A;  4DK0 A;  4X20 A;  4O4L B;  4FM0 A;  3E8G A;  1DTO A;  4O4I B;  2BE3 A;  2JGU A;  4X9Q A;  4U3J B;  4MVQ A;  1YI2 V;  2K9P A;  4JZG A;  1AP6 A;  3IJ4 A;  5KA5 A;  3UM7 A;  2LJ2 A;  1XQ8 A;  1H8H G;  3A0H Z;  1SER A;  4UCV A;  3ASN B;  1QBZ A;  1IBM B;  2ZDI C;  2GHY A;  2ZE5 A;  1THZ A;  2ZQM A;  4DR6 O;  1VQ4 V;  3AG4 B;  1SQP H;  3ZRV A;  1NR1 A;  2E5L O;  1WB7 A;  1ARO P;  1XMO O;  3DC6 A;  5BMV A;  1VQO V;  1H2S B;  3T4Z A;  4DV1 B;  3OGI B;  2JVD A;  5KMG A;  1I7F A;  1VQP V;  2FB5 A;  4YHH O;  2HG5 C;  3HKE A;  1LR1 A;  3K59 A;  3DGE A;  1URF A;  2AHY A;  1EN6 A;  1OCO C;  3ZHV A;  3D36 A;  5CBH A;  3B40 A;  2YEV B;  2JRI A;  1KUQ A;  1BCC H;  1K73 W;  5B3S B;  3BHP A;  4O4H B;  3A0B Z;  5JQG A;  5KHI A;  1XEQ A;  1DGS A;  2P67 A;  2F23 A;  4QPJ A;  4PHZ A;  1YJN V;  5GON A;  1KMI Z;  4H44 B;  2VQE B;  1J5E O;  2BTO A;  1BZK A;  2FML A;  1WPX A;  3HKB A;  1AVM A;  5L3C A;  2Q7H A;  4K3A A;  3ZHR A;  3J7A U;  4JI6 B;  4J10 A;  3IGA C;  1RPO A;  4EFB A;  1FYJ A;  4DV7 B;  1FFX B;  4MTX A;  4U3F H;  5J2U A;  2H8P C;  2WLM A;  3CRQ A;  1Z5W A;  1YDX A;  2R9R B;  4N21 A;  1JVM A;  5LMN B;  2UUB B;  1S76 D;  3OMA B;  3SYO A;  2UUA O;  1NQT A;  4X1Y B;  3VQW A;  4GKK O;  1G1X B;  4FPP A;  2QKA A;  3AG2 C;  2UXD B;  3QO5 A;  4CH6 A;  4P30 A;  3O9O A;  5LBQ A;  4DV0 B;  3ETG A;  3T1C A;  3OM3 B;  5CBF A;  2XT9 A;  3CCU V;  4IIJ B;  1ZL8 B;  1Y76 B;  2IM9 A;  3A2F A;  3GWO A;  3JSL A;  1VQK V;  1PPJ H;  3BAB A;  3H1I H;  2Y0P A;  4FIP C;  3CRR A;  1OCZ C;  3SJA C;  4U3J A;  3ZJZ A;  1QLE C;  1SKV A;  4I50 B;  4X1I A;  4AIL C;  3B8N A;  5LHI A;  5J9P C;  1TUB B;  4O2A A;  4AQY O;  3HKD B;  1K34 A;  4NR1 A;  2W6J G;  4FLV A;  1NJI W;  1MAB G;  4B7E A;  1XL6 A;  4JI2 B;  4XDK A;  3RYI A;  1XNQ O;  1DF4 A;  2YIC A;  5LMU B;  3E8B A;  1D5A A;  1OCO B;  2PF4 E;  1E1Q G;  2BSK B;  4XDL A;  1YSC A;  2HVJ C;  5IJ0 A;  4OPH A;  1BMF G;  3CCS V;  4WF9 V;  5KHH A;  3S3W A;  3JAT B;  1RFY A;  4L87 A;  2RMK B;  2DYS B;  4B3T B;  3BPZ A;  4LF6 O;  1QLN A;  4J11 A;  3G6B A;  3ZHS A;  2A06 H;  2CGN A;  2OTL V;  1HNW B;  5IYZ A;  1ROP A;  1GM9 A;  3ASO C;  3UKM A;  2QKC A;  4RUE A;  3CCE V;  2ZD9 A;  1JR9 A;  1BQZ A;  3BY6 A;  2R70 A;  4HBN A;  1HWY A;  2BTQ B;  3L75 H;  2Z3Y A;  5A2Q N;  1JX9 A;  4I9W A;  1S5L Z;  1XHZ A;  1NKD A;  4NB5 A;  1FFX A;  4YXW G;  3U11 A;  2O57 A;  3CB2 A;  4O4J B;  4BWA A;  1I5X A;  1AI5 A;  5GTI Z;  2IU0 A;  4QPK A;  3RBZ A;  3K3W A;  3WB1 A;  1XHX A;  1LUV A;  3AG2 B;  1M5I A;  5KLV H;  1WA8 A;  2Y4T A;  4PDL A;  2HLD G;  4UV8 A;  2CTP A;  3RVZ A;  4BR6 A;  4D6T H;  5B5E Z;  1O9H A;  3UO3 A;  4JI1 O;  3R65 A;  5DN6 G;  4QIW F;  3ZRW B;  1JQ0 A;  2ZT9 B;  1KEC A;  2ZE6 A;  1OCZ B;  4NTX A;  2EIL B;  5JJN B;  3CC4 V;  3CXH F;  4PV1 B;  4LF8 B;  1ZL8 A;  1GH6 A;  1QLE B;  1EZV H;  4H13 B;  1GM8 A;  3FX7 A;  4HNA B;  3TCU A;  1Q82 W;  5KAF Z;  2RN9 A;  4FZ0 A;  1AR5 A;  1S5J A;  1EN4 A;  1BHB A;  4I50 A;  1FJG O;  1JFF A;  2P22 C;  2QM8 A;  1SQB H;  1TUB A;  1Y6X A;  3LUT B;  1Z2G A;  4BW9 A;  4ZIB A;  5LHH A;  4FK5 C;  2GDS A;  4X66 O;  2V4D A;  1NVP D;  4ZBM A;  2E76 B;  3L73 H;  1L8D A;  1HDJ A;  4LF4 B;  3LDD A;  1VQL V;  4H37 A;  1U96 A;  2F43 G;  4WFF A;  2X6B A;  1GMG A;  4DR5 O;  3CD6 V;  3N27 A;  4JTC B;  1I94 O;  4MVM A;  2D3O W;  3J80 N;  3CEI A;  4X62 O;  4TOI A;  3IC7 A;  3JAS B;  3KCX A;  5L3G A;  1P7G A;  3AK2 A;  4X64 B;  4H0L B;  4I5S A;  4AI8 A;  2EIK B;  3RYH B;  2ZM6 B;  3H01 A;  1HR0 B;  4JI4 O;  4DK1 A;  2XHB A;  1L0N H;  1H2M A;  2BTQ A;  4CS3 A;  3B8M A;  1M93 A;  2EZP A;  1K8A W;  1NI8 A;  3ETQ A;  1TAE A;  2VWK A;  2N74 A;  4TUY B;  3KCY A;  5L3E A;  1SES A;  2Q9L A;  4DV4 O;  2ZCE A;  1W0J G;  3ZRX A;  4JYY A;  4FLW A;  1IX9 A;  1XRE A;  5D5Q A;  2ZIO A;  3D36 C;  1KYO F;  4O4J A;  5K1X A;  4FLY A;  4NTW A;  4KFM A;  2JIZ G;  4DR3 O;  3K9A A;  4JPR A;  1BHA A;  4FMT A;  4KL1 A;  1ZTE A;  1WP8 A;  5B1O A;  2WLK A;  3K08 A;  3T1Y O;  1IBL B;  3BA9 A;  1F7Y A;  1HNZ B;  1Q6U A;  4LFB B;  5BR8 B;  3RWR D;  2EX3 A;  1K7D A;  2WLH A;  1K5S A;  4JI0 B;  4GLX A;  1X4T A;  3C90 A;  3GVM A;  3QF7 A;  2QE7 G;  3BAA A;  5IYC O;  1ZAU A;  4IT5 A;  4BAY A;  5KHK A;  2EIM B;  2RQ6 A;  1JJ2 U;  4NXM B;  3DC5 A;  1WPB A;  4PDR A;  1PD3 A;  1Q6H A;  2A7W A;  3E35 A;  4JI3 O;  4DV5 O;  3NXS A;  2F93 B;  1OCC C;  2PGG A;  3AG3 C;  4UCU A;  3E22 B;  5IT9 N;  3JSN A;  2HJD A;  5L3D A;  3CCM V;  4BIU A;  3RYC B;  1JOY A;  2LO1 A;  1FAF A;  4DR4 B;  1H2G A;  5B1B B;  3P3N A;  4DV2 B;  4DUY O;  1Q7Y W;  3JD1 A;  3BEH A;  4G28 B;  1QQC A;  1SF9 A;  3RT3 C;  1VMG A;  5HFL A;  4B3M B;  4FLU A;  1H8E G;  2WA3 A;  2LFS A;  2UUC B;  3F5T A;  3G80 A;  5KAI Z;  4NXN B;  1MZE A;  1AIL A;  1M56 B;  4FJC C;  4ZHQ B;  3RYH A;  3D3Q A;  3AG4 C;  3EXA A;  5KMG B;  4JYA B;  2DMX A;  4WBN B;  2L35 A;  5EBL C;  2XAH A;  3K5O A;  4TUY A;  2C2A A;  5CB4 A;  2EIJ B;  2Y4U A;  2UU9 O;  1TGO A;  2GBO A;  5IDJ A;  2UXC O;  2EIN B;  5FL7 G;  4FLT A;  1YJW V;  1YTF D;  4OXS A;  3MAQ A;  5JQG B;  1XDC A;  2ZIN A;  3U0Z A;  3CCQ V;  5GON B;  4MT8 A;  3FB5 C;  5EC1 C;  3RFR A;  3T4D A;  3LSU A; 
#chains in the Genus database with same CATH homology
 2EIN C;  5L3C A;  2IJI A;  3ETD A;  3LSS A;  4R6Z A;  1QR9 A;  5CN0 A;  1OHH G;  3GB7 C;  2XAJ A;  1PNL A;  4GX5 A;  1YTF C;  1S3J A;  3IGA C;  1RPO A;  5IY5 C;  4TT3 G;  2DWD C;  3ETE A;  3OMI B;  1OCR C;  3P30 A;  1OZ0 A;  4MTX A;  5LGT A;  3SPG A;  2HR3 A;  3EHB B;  1FXK A;  1P7B A;  3SYP A;  2H8P C;  2WLM A;  1FXK B;  2V1D A;  5L3F A;  2R9R B;  4N21 A;  3X2Q B;  1JVM A;  4MW3 A;  4PEL A;  2WSS G;  2QEX V;  1S76 D;  3OMA B;  3SYO A;  4QE9 A;  5H9C A;  1YIT V;  1NQT A;  1K97 A;  3ZIA G;  4UVB A;  1OCC B;  3AG3 B;  4X8A A;  2OT5 A;  1GK9 A;  4KP4 A;  3X2Q C;  1YJ9 V;  4FPP A;  3AG2 C;  4JTA B;  1BL8 A;  1V55 B;  3QO5 A;  5GW7 A;  4P30 A;  1L1F A;  4JYC A;  4CZZ A;  2XAF A;  5LBQ A;  2P90 A;  3ETG A;  3T1C A;  3OM3 B;  5CBF A;  1Y4M A;  3CCU V;  1E79 G;  3JCZ A;  4GCZ A;  1GKF A;  1FXV A;  1MSW D;  1LNQ A;  2UXX A;  5KA6 A;  3GWO A;  1VQK V;  1KC8 W;  1V55 C;  2XAS A;  3LDE A;  2OCC B;  3AG1 B;  4FIP C;  1OCZ C;  2ATK C;  5E1A C;  3ZJZ A;  2ZDI A;  3E8H A;  4KUM A;  1QLE C;  2EBO A;  2PI5 A;  1CEZ A;  1RM1 B;  5LHG A;  3F7Y C;  3MHS C;  4GX0 A;  1YIJ V;  2OCC C;  2Q69 A;  3B8N A;  4TSF G;  4HYO A;  3ZMT A;  4QNH B;  5J9P C;  5LHI A;  3FKS G;  4WFB V;  3JD0 A;  2IJK A;  3G4S V;  1S72 V;  2WLL A;  3FYE B;  3CCJ V;  1GO3 F;  2ZR3 A;  1K34 A;  2BOB C;  2W6J G;  2WLL B;  4LBE C;  2A9H A;  1NJI W;  1MAB G;  2HKO A;  1G4Y B;  3OUS A;  1XL6 A;  1NH2 D;  1KKD A;  1AI4 A;  2QA4 V;  2JJ2 G;  1AR1 B;  4XDK A;  3DTU B;  2Z5U A;  1KD1 W;  2R9I A;  1DF4 A;  4MSW C;  1QCE A;  2KB1 A;  3STL C;  3E8B A;  4RAI A;  1OCO B;  3SPJ A;  2OTJ V;  2BOC C;  1E1Q G;  2ITC C;  4JAS A;  3CC2 V;  4WFG A;  3ZCC A;  4JAU A;  4XDL A;  1YSC A;  2HVJ C;  2Q6A A;  1BMF G;  1NH2 C;  3SJQ C;  3KG2 A;  3CCS V;  4WF9 V;  4P9P A;  1F4N A;  3OR6 C;  2P7T C;  4L87 A;  3FB8 C;  1H38 A;  3CC7 V;  4R8C A;  1K5Q A;  2DYS B;  3ASO B;  3OFN G;  2V7Q G;  5DM6 V;  1R6N A;  3OE7 G;  1QLN A;  3OEE G;  2WLN A;  2UXN A;  3OUF A;  2EJR A;  4UXN A;  4H33 A;  2OTL V;  3QO8 A;  4LCU C;  4EKW A;  4WCE V;  1ROP A;  1GM9 A;  2DYS C;  3ASO C;  2WLI A;  3D3I A;  3UKM A;  3ZMU A;  4XBF A;  4RUE A;  3CCE V;  1IXM A;  2ZD9 A;  1YTF B;  1R73 A;  1R6K A;  3BY6 A;  3RW0 A;  3LDC A;  1K92 A;  1HWY A;  3W7T A;  3I56 V;  3STZ C;  4G27 B;  1OCR B;  3K04 A;  2M7W A;  2IJH A;  5CMU A;  1VQ7 V;  1F23 A;  2Z3Y A;  3ZMV A;  2HVK C;  2HJF C;  3K03 A;  5H6R A;  1JX9 A;  4I9W A;  1AJN A;  1CPY A;  1NKD A;  1GTO A;  1UJW B;  4JYB A;  4YXW G;  4JAV A;  1PKX A;  2ZXW B;  2Y48 A;  1K33 A;  3ABL B;  3ABU A;  1KP2 A;  3FB7 C;  1N8R W;  3WFV A;  2IH1 C;  1I5X A;  2DQ3 A;  1AI5 A;  2Q68 A;  4JF3 A;  2IU0 A;  1PNK A;  4QPK A;  5H6Q A;  3RVY A;  3RBZ A;  3K3W A;  1AJP A;  2K1E A;  2ZXW C;  3ABL C;  4RUF A;  1ENV A;  3AG2 B;  5C93 A;  1PNM A;  2X6A A;  3HPL C;  2Y69 B;  1S5H C;  4PDL A;  4P9O A;  4GT1 A;  2HLD G;  4UV8 A;  3RVZ A;  2YSU B;  4R7C A;  1K4C C;  1RPR A;  3SYQ A;  3ZN0 A;  1M1K W;  3MD0 A;  1R3K C;  4MVR A;  3R65 A;  3ZRW A;  5DN6 G;  1G8M A;  3CPW U;  4QIW F;  3ZRW B;  1JQ0 A;  1KEC A;  2Y69 C;  1NBM G;  2A79 B;  4BIZ A;  1Y66 A;  3CP1 A;  1SZT A;  1OCZ B;  2EIL B;  2DQ0 A;  3CC4 V;  1J95 A;  5EC2 C;  4MW8 A;  3SPI A;  1QLE B;  1MG1 A;  3A0R A;  4HZ3 A;  4MTG A;  3ZMS A;  4ASU G;  1GM8 A;  3JD3 A;  3TCU A;  1Q82 W;  1FS0 G;  1COW G;  5BZB A;  1K3E A;  2HFE C;  3TK1 A;  2EIL C;  1ORQ C;  1BHB A;  4MVZ A;  4PA4 A;  1JPX A;  1JCH A;  3F7V C;  3T2M A;  2QM8 A;  3MHH C;  4DO2 A;  2LFR A;  1AI7 A;  2JK5 C;  4UVC A;  3E83 A;  3LUT B;  5LHH A;  4GX1 A;  3E2E A;  4PA6 A;  1SET A;  1VQ8 V;  1Q81 W;  1NR7 A;  4FK5 C;  3ABK C;  3OAA G;  1NVP D;  3CCR V;  4ZBM A;  4PDM A;  1XL4 A;  2X7R B;  3K79 A;  4MVU A;  3TET A;  1NH2 B;  3P32 A;  3K0G A;  3G6E V;  1F4M A;  3LDD A;  1VQL V;  1R3J C;  4H37 A;  1FFT B;  1VQM V;  1Q86 W;  3ZRS A;  4J9Z B;  2F43 G;  1F51 A;  4UV9 A;  1V54 C;  3E86 A;  4WFF A;  2X6B A;  1CP9 A;  1VQN V;  2XND G;  1GMG A;  1W0K G;  2WPD G;  3W7X A;  1NVP C;  3CD6 V;  4JTC B;  3G71 V;  5CA3 A;  4MTF A;  4MVM A;  2D3O W;  3ABT A;  4TWK A;  3HB3 B;  4WFE A;  3IC7 A;  2X0L A;  4MVS A;  5L3G A;  4PA7 A;  3ASN C;  2WLJ A;  4I5S A;  1GM7 A;  4WFH A;  1P4R A;  4DXW A;  2EIK B;  3B77 A;  3ML0 A;  3H01 A;  3CXC U;  2XAG A;  4BW5 A;  4JGS A;  4LP8 A;  3W7W A;  4CBC A;  4LC1 A;  3JD2 A;  3B8M A;  3CMA V;  2EZP A;  4JTD B;  1K8A W;  4Q20 A;  1EZJ A;  2EIK C;  5L3B A;  1QVF U;  2IU3 A;  5L3E A;  1SES A;  3OMN B;  2JEX A;  2DYR B;  3ZMZ A;  1W0J G;  2QTO A;  3ZRX A;  4UUJ C;  3CME V;  1PL0 A;  2B1G A;  4F4L A;  2P6J A;  5HFM A;  4X89 A;  2IJJ A;  1YHQ V;  3E8F A;  2IH3 C;  4KFM A;  2XAQ A;  1EBO A;  4XDJ A;  2DYR C;  2JIZ G;  3VOU A;  3K9A A;  1MOF A;  4JPR A;  5B3S C;  1BHA A;  4FMT A;  3SPH A;  3FYI B;  4N23 A;  5B1O A;  4P2Z A;  1KP3 A;  2QKS A;  2WLK A;  3K08 A;  1DF5 A;  4WFA V;  3SYA A;  3WG7 B;  3ABM C;  5B1N A;  4U7O A;  4X88 A;  2JEU A;  3AEI A;  3CCL V;  2DW4 A;  1SRY A;  1K7D A;  4RQE A;  2WLH A;  1M9N A;  1WLE A;  5KUM A;  1QVG U;  3F5W C;  1K9M W;  2MK3 A;  1VQ6 V;  1K5S A;  2ZR2 A;  5B1A B;  4PA3 A;  4PA9 A;  3WG7 C;  5IYB O;  4E2L A;  1AI6 A;  2LP7 A;  2WAM A;  1DLB A;  1R3L C;  3EFF K;  1R3I C;  4UVA A;  2QE7 G;  5EK0 A;  5IYC O;  2JDI G;  3VBB A;  3CYO A;  4Z1M G;  4MTO A;  4BAY A;  2EIM B;  5B1A C;  1JJ2 U;  1FXK C;  1B6Q A;  1M57 B;  3FB6 C;  3K0D A;  3PJS K;  2QM7 A;  3OR7 C;  3W7S A;  4GX2 A;  3E89 A;  4G2K A;  4PDR A;  3ZN1 A;  1PD3 A;  3ABK B;  1M90 W;  3K06 A;  4QE7 A;  1TUE B;  3E35 A;  3SYC A;  3OEH G;  2EIM C;  3QNE A;  5KUK A;  3NXS A;  2AHZ A;  5LGU A;  1S0V A;  1OCC C;  1M57 C;  3AG3 C;  4ZKI A;  2IW5 A;  2X6C A;  5CBG A;  4PDV A;  5L3D A;  2Q67 A;  4MVO A;  3CCM V;  4BIU A;  2EZO A;  1JOY A;  2H94 A;  3E8G A;  1DTO A;  1V54 B;  2PI4 A;  1NVP B;  1H2G A;  5B1B B;  2B5U A;  4MVQ A;  1YI2 V;  3QO7 A;  1K4D C;  2JJ1 G;  5KA5 A;  1E1R G;  3UM7 A;  1Q7Y W;  3JD1 A;  3OGC C;  3BEH A;  4J9Y B;  4G28 B;  1H8H G;  3JD4 A;  1VQ5 V;  2XOK G;  1EFR G;  3AG1 C;  1SER A;  2A0L A;  3ASN B;  1QBZ A;  2CK3 G;  4MS2 A;  4RQF A;  5HFL A;  2WWW A;  3SPC A;  5B1B C;  2ZDI C;  1S77 D;  4HAM A;  4QJF B;  2GHY A;  1RM1 C;  1THZ A;  2ZQM A;  1VQ4 V;  3IFX A;  3LSQ A;  1H8E G;  3AG4 B;  5EBW C;  2GSM B;  3ZRV A;  2LFS A;  1NR1 A;  1ARO P;  2DWE C;  1M56 B;  1VQO V;  4FJC C;  3I55 V;  3M99 B;  4U7N A;  3T4Z A;  1W2B U;  3LNM B;  1QR8 A;  1I5Y A;  3AG4 C;  4RO2 A;  1VQP V;  2HG5 C;  3W7U A;  1AJQ A;  1ZWI C;  1KQS U;  2W0F C;  3DGE A;  2AHY A;  1M56 C;  1OCO C;  3D36 A;  5EBL C;  5CBH A;  2XAH A;  2YEV A;  2YEV B;  2NNU A;  2NLJ C;  2C2A A;  2B1I A;  2FTK A;  3OW2 U;  2EIJ B;  1FXH A;  1K73 W;  5LGN A;  5EBM C;  5IDJ A;  2ITD C;  2EIN B;  4R50 A;  5FL7 G;  5B3S B;  1YJW V;  1YTF D;  4OXS A;  2WLI B;  3JYC A;  2P67 A;  4QPJ A;  1VQ9 V;  3CCV V;  2W6I G;  1YJN V;  3CCQ V;  2EIJ C;  5IY5 B;  4MT8 A;  3FB5 C;  3ABM B;  5EC1 C;  5IYD O;  3T4D A;  1WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...