2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
3FJSA 2FQPA 4LTAA 3MDPA 3RZZA 1UIJA 1J3QA 1X8EA 4HBNA 5FQ0B 3EQEA 5FDBA 5FCCA 3PVBB 4XFGA 4XFHA 4AQ6A 1YUDA 4Z07A 3M70A 1CAWB 4MUVA 5I0TA 3N4MA 2UYBA 3KSCA 1DGRA 3CL1A 3HQXA 3HIFA 1O3TA 3WW1A 2CAUA 2PYTA 1O7FA 3KCCA 1JUHA 4IEQA 1SFNA 3D82A 4N9HA 1YFUA 5BV6A 2GC2A 4XFBA 2EA7A 4QMAA 2XGXA 1ZZ8A 2ETEA 1ZZCA 3SMHA 1CAVB 4E2GA 1X8MA 1H1IA 2IXLA 4FT8A 4I2OA 2CV6A 4HVOA 4N9IA 1XRUA 4WVZA 4OFGA 3L2HA 1O5UA 5JSPA 2KXLA 1ZNPA 3NW4A 4BIFA 5CU1A 5D1IA 1NZCA 4FAHA 2I45A 2Y0OA 3BALA 1O3SA 5T3NA 5KHHA 3RPQA 2D5HA 3FX3A 5I91A 3LAGA 4HVRA 5FPZA 3HT1A 4AQ2A 2OZJA 2XKPA 3CO2A 3E6DA 3OTFA 3E5XA 3DN7A 4HLTA 1V70A 4D7SA 2OYZA 1GQHA 4IEXA 3ZDSA 3KMHA 4AVAA 1DZTA 4MGZE 1CAUB 4MV2A 2EVXA 2PFWA 2B8MA 1UIKA 3IBMA 4XEZA 4BHPA 3LOIA 4YRDA 5I93A 4IEZA 2UY9A 5KHKA 2XLAA 1J1LA 1L3JA 4AXOA 1QXRA 2BYVE 2D93A 3DKWA 2MHFA 2GU9A 4QXKA 4Q0PA 3GYDA 4PIYA 4Q0SA 3EO6A 4I3PA 1O3QA 1ZZ9A 5KHJA 3OD0A 2E9QA 3MZHA 3U10A 1YWKA 1HW5A 4PJYA 2CGPA 4HSJA 2C0ZA 3RDIA 2XL7A 4EV0A 1QXJA 5E16A 4DINB 3H1WA 2PA7A 1EPZA 2Q30A 1Y3TA 3H1YA 4XF9A 1CAUA 4AVBA 2VPVA 2FMYA 4ZU4A 4I01A 3JZVA 5HI0A 1XE7A 5LEJA 5EZWA 4P9GA 3RYKA 4QM8A 1SEFA 5I0UA 3CJXA 2PTMA 2PHDA 4GULA 3QACA 4XF1A 2Q4SA 4HMZA 3HT2A 1Q3EA 3UKVA 1WA4A 2MPFA 1RUNA 3S7EA 1WLTA 5JSOA 1J3RA 4IEOA 5KHGA 2B5HA 4HSLA 4JV4A 4F7ZA 4WZCA 3BCWA 3WW3A 1FI2A 2IXCA 3M3IA 3DV8A 1EYBA 4A2UA 5FLJA 1RTVA 2Q1ZB 3R6SA 2OZ6A 4MGIE 1Y9QA 1UD1A 4QM9A 5J7MA 4IEPA 2H6BA 4HZFA 2WC2A 4Q0QA 4QGLA 2MNGA 3U11A 3OGJA 4IEUA 2DCTA 3ACLA 2F4PA 3BPZA 1NE6A 3O14A 1CGPA 1DZRA 1RUOA 1ZRFA 4XFCA 4Q0VA 5C8WA 1LB2A 3SXWA 4YNIA 1H1MA 4MGKE 1YLLA 3NKTA 3I7DA 3U0ZA 5JR7B 3BU7A 1OFNA 3SCGA 3S0MA 2GZWA 2BNNA 1OI6A 3ETQA 1PMIA 1ZZ6A 4LEJA 5E1RA 3ROUA 1YFWA 2OA2A 4LA2A 4ZU7A 1O5LA 3MPBA 4IEYA 3LA3A 2CAVA 3DL3A 3IWZA 3D0JA 4MGYE 1CX4A 2GH2A 3G7DA 1FT9A 3D0SA 1EY2A 5JSRA 2XHKA 4XF0A 3H8UA 1YFXA 3I59B 4O9EA 1LKNA 3E97A 4H7LA 2O1QA 2QVSB 5CADA 4XF3A 4JTOA 3CEWA 1CAVA 5F1RA 2K0GA 4J1WA 5LEKA 1UW8A 5FLHA 2H6CA 3NSTA 2XL9A 3ST7A 4KWLA 4D7TA 1WGPA 4LUKA 2QDRA 3H9AA 4LUMA 1DGWA 4KWKA 4NVPA 4HVQA 1RC6A 3IDCB 5BUVA 2GC3A 4XF4A 2XLGA 3H3ZA 4Q29A 4YSFA 4K8FA 1CAXA 4I0BA 3S7IA 3NVCA 4PIZA 2ET7A 4JTNA 4X6RB 5I8YA 5I0RA 4TLFA 1Q43A 1X82A 2PHLA 4MX3A 5J48A 3FE5A 2GAUA 3TNPB 1OMIA 1EP0A 4Z82A 2QNKA 4LULA 3I54A 4I0AA 1ZREA 1YHFA 1ZZBA 4EWDA 3ELNA 3NJZA 2QJVA 5I8SA 3LA2A 4ONUA 3KGZA 4HN1A 4KU8A 4UXAA 5KHIA 4JVAA 1J59A 4UBGA 4EWAA 2IXJA 3FZ3A 1VR3A 2UYAA 2P17A 4BYYA 3UKTA 4EROA 2VQAA 4F8AA 4XFIA 4IEVA 3PNAA 4L11A 3VHRA 3PLQA 1RL3A 4J1XA 4QGMA 3QOPA 1QWRA 4RD7A 4AVCA 1X7NA 2HJIA 4KWJA 3BB6A 3I59A 1RGSA 4MZUA 3LWCA 3SCFA 3EJKA 2V09A 5BPXA 2GC0A 3H1MA 3E6CC 1OD5A 4UBHA 4FBFA 1O3RA 1Q5OA 3LZZA 5EFUA 3E5QA 3SCHA 5FPXA 2IXIA 1U12A 3CLPA 4FAGA 1ZVFA 2Q0AA 3E5UA 1ZRCA 4OLLA 1CAXB 4KL1A 2HKXA 4I09A 2Z2SB 3MYXA 4META 4XETA 2D5FA 3FWEA 1J3PA 2BNOA 3IDBB 1ZRRA 2H0VA 3FHIB 1NYWA 2ZKLA 3OF1A 2PAKA 5LRRA 5JAXA 2PQQA 2WFPA 1XE8A 4L2NA 3C3VA 3EHKA 2PAEA 4MH0E 4HN0A 3WW2A 4XFFA 2O8QA 3WW4A 4QGNA 3UKNA 5AVPA 3CF6E 5K8SA 4E2QA 3KGLA 4IETA 1VJ2A 5FQ0A 2BNMA 4I02A 3TNQA 4X6QB 2IC1A 3H7JA 1G6NA 2IXKA 2QCSB 3NL1A 1TQ5A 2XKOA 2N7GA 1VP6A 2D40A 3H7YA 5I8TA 4CYDA 1IPKA 2VECA 5FLIA 1LRHA 3RYPA 3B02A 2ZCWA 1NXMA 5I0SA 2OPKA 2B9UA 4LA3A 3FFQA 3OCPA 4R8HA 4B29A 1UPIA 2PAMA 2EAAA 3LA7A 2ATFA 4Q0UA 1ZRDA 1I5ZA 4IERA 2BGCA 1CAWA 4O9GA 4YYOA 1PM7A 3H50A 3RYRA 1ZX5A 5LRSA 3ES1A 3ES4A 1YFYA 4KU7A 4IESA 5JCTA 5KBFA 5C6CA 4E2SA 3H3UA 3RNSA 4YARA 4QX5A 4XFAA 3USSA 1ZZ7A 1J58A 2BEOA 2ET1A 1IPJA 1O4TA 5BXXA 4BH9A 1FXZA 5CVRA 1NE4A 3IIAA 3E6BA 4WBBA 4PIXA 4EWEA 4ZU5A 4ORFA 4R52A 5J3UA 2Z69A 1UCXA 2GC1A 2IXHA 2UY8A 1I6XA 4LLOA 5BY5A 1QY4A 1LR5A 3GBFA 2K9ZA 4IEWA 2XLFA 1SQ4A 3SHRA 1GQGA 3EBRA
chains in the Genus database with same CATH superfamily
4LTAA 3LDEA 2WRAA 3RZZA 3RG0A 1A32A 4GKXA 2R16A 3PVBB 1YQ6A 4LBLA 1JI6A 4DUZB 3R65A 1LHUA 5H5NA 1P7BA 2DOSA 4LHLA 2R9IA 3Q8FA 4RR3A 4QWNA 1REEA 5SV8A 1UX6A 1QVFU 1YFUA 4PLNA 2E76B 4IV3B 4CP0A 2CTPA 3AYEA 2WQZC 4QMAA 2YB7A 3DC5A 3OY8B 1ZZCA 3AM2A 3SMHA 1X8MA 1JU3A 3ENRA 5CIRA 4EZHA 4D7YA 2GNDA 1VBB2 4C1WA 3O12A 2EIDA 2UXNA 5A3UA 2JIGA 4O2BB 2KA3A 3AB0A 5DZGA 5I91A 5IATA 4AVTA 3MF9A 1EM1A 5B1BC 3THTA 3SJCC 3T2PA 3CB2A 4DW0A 4HLTA 3AL5A 5ANNA 2PFWA 1KMIZ 3IBMA 3IZOA 1GWMA 1TME1 2JB8A 3VZJA 2WZR1 4GXLA 4EEQA 3WG4A 1QJZA 2BOJA 1AR83 1H8HG 2VWJA 2HR3A 3RYCB 3QG5A 2GNBA 4Q2FA 2VZSA 4YGCA 4OMCA 4YVSC 2ZGNA 2UXDO 5HXVA 1DIWA 3IMMA 1HB1A 2W87A 2WZ8A 2XVKA 2R9RB 4I01A 3JZVA 4HKOA 1MS5A 2PY5A 3B3QE 3JBG2 4TT3G 2PTMA 2Q4SA 4H37A 3JD71 3VBHA 3CPWU 2R063 5IYYA 5FWEA 2Y6HA 4IW3A 5ACA1 2BTOA 3BCWA 5EP9A 4X1YB 5C8YA 1RTVA 3IC7A 5JOWA 4JI1B 4MGIE 2A6WA 2A7AA 4JDNA 2EZOA 5F3CA 1QLNA 2WFF3 2DVGA 4CC6A 3ACLA 1JH5A 2W5FA 1KS5A 3O14A 4IV1C 5D8AC 4LWSA 2XH6A 1J83A 4LF9B 1WD4A 5LOVB 4GJZA 3FUQA 2R061 1JZ8A 3ILNA 2AYHA 3BYWA 3ASIA 3DL3A 3D0JA 4MGYE 2RDRA 3ZFFC 1R3KC 3I59B 2KG7B 2EIMB 1GM9A 1SLIA 4FM1A 5LL6Y 2ZHKA 4K21A 4DY5A 1MS0A 4CVUA 4JI0B 4FPHA 3ZXAC 4FPJA 1MEC1 1RUJ2 3X2QC 1GKBA 2GP5A 4HVQA 2HWE3 4FQ4A 4RN5A 2HG5C 4I50B 3K2OA 5LP6C 3BY6A 1CAXA 5GLVA 3K3WA 4WFBV 2PUSA 4IT5A 4HKWA 1E5RA 2ATKC 4FPEA 4ATFA 1TGOA 2X6BA 2UUBO 3J4UH 1D5NA 4J7ZA 1X82A 2NN4A 1REDA 2VW2A 3ZFGC 3CCMV 2JG9A 2JDAA 1G9CA 3VBRC 4DK1A 4LNUA 5FUPA 1HX6A 2W94A 2JIZG 4ONUA 3ALQA 2OIEA 4I4TB 2PZSA 4LF6O 2WSVA 3VKOA 1WUVA 1RJ7A 1PGSA 4EROA 3A0KA 3U1XA 2JXAA 3VHRA 5BNNC 5HCBA 2BP6A 1S4CA 2XAHA 2Y0IA 3E2EA 3Q8CA 5EIYB 5DAPA 1R6NA 5FY9A 2J1EA 5BPXA 3K08A 5FKCA 3H1MA 3WNLA 2WLLA 1HKDA 3O5SA 2QSAA 5FPXA 1K5MC 4GZ9A 3E5UA 1DDLA 2XAJA 2WAOA 5FREA 3UO2A 2CTQA 2RVAA 2OIGA 3K5MA 1BHAA 4NRQA 3FB5C 1SCSA 2BSKA 5GZFA 2A7WA 1NYWA 4XUOA 4FTSA 2LROA 4CDWA 4CXXA 3KVBA 4O7XA 4YZ3A 4QGNA 5FUIA 3KG2A 2BV4A 5T5PA 3RVZA 1LJ7A 3CKHA 4G28B 3SPIA 4M01A 4L8JA 2N7GA 2YU2A 4FPLA 1FYJA 3KQRA 4AQTA 2VNRA 2E53A 1ND2B 4R8HA 3AKTA 1AVMA 1RUE3 2A0LA 2JG9B 3T4DA 2R073 4OX9B 3GHMA 1HQNA 2WLQA 2DQ3A 2ZE6A 4JYAB 4JI5B 3UJQA 1W6NA 3CS5A 1UO9A 2DUOA 1OCZC 4BH9A 2VQFO 1AI6A 4QAWA 4H44B 2UUAO 3W5NA 4HANA 2Y8KA 5C3PA 3W9AA 3E8FA 4BLJA 4RO2A 2XLFA 1NVPD 1W04A 3IMNA 3G4SV 2FQPA 1OVSA 4J80A 4HBNA 4WVMB 1XU1A 3P3NA 5CA3A 3K59A 3JD2A 1QOTA 1OT5A 1CR7A 2CYFA 4JZ2A 3JXSA 5JZGA 3VKLA 4RQPC 5LBCA 4PV1B 4RQPA 1BS3A 1MZEA 4P14A 1BSMA 3WDWA 2VQEO 5EZYA 1H2SB 2ENRA 1R6TA 1NT2B 1XRUA 4XUQA 4I9WA 2MEV3 1Y74A 3J7NA 1WP8A 3AK3A 5DDJ1 5FPBA 5CU1A 4Q4X1 3AG4B 2R0FA 4QX1A 1K5SA 5KHHA 2JE9A 2WL1A 1V9PA 1RUH3 2R062 5GZDA 3JD4A 3OSDA 2GDSA 1DYOA 2ZMKA 1LHWA 1COV1 1M06G 4CDQC 4NTXA 1V70A 4D7SA 1W2OA 5LA2A 4Q4X3 2RV9A 4DRVA 4NTYA 2YEVB 4D94A 5KX5A 3IDAA 3RJRA 3WNNA 2XAQA 4LHKA 5B3SB 3K5NA 1LGBA 2EIBA 1ULOA 2XMLA 2XAFA 1EBOA 3D36A 3IDEA 4FPKA 1ZZ9A 3M3EA 2GNMA 4LF5O 3ORJA 2DWRA 3MZHA 4OPAA 4OQ9A 1SC5B 3JU9A 1CAUA 1F8VA 4BJ0A 3RYKA 1SESA 1FOD2 4I0XA 4JDOA 1SEFA 4XTPA 5I0UA 3CJXA 1US6A 1OCRB 1HN0A 1K5QA 4AQSA 2QJ1A 3ZXJA 1UOJA 1B09A 1WLTA 2CWSA 1WLDA 2Y4TA 4HK9A 3AP7A 4R8CA 3F2ZA 2X6AA 3M3IA 4A2UA 5FZBA 5CKQA 2OZ6A 1Z7S2 2ZEXA 2UXXA 1H30A 2ZX4A 1OCOC 4WBNA 2P06A 3ZYPA 1NA1A 3VKMA 1EUTA 3GWOA 1VQ7V 1QCEA 5EJ1B 3ZSMA 5GLZA 2JE7A 2R49A 5B66Z 3HQUA 1W6OB 3DXUA 2DN9A 5IYDO 1LECA 4QX8A 3WOGA 4CCJA 2QTWB 1AR4A 2JD4A 4J6GA 1Q7YW 3RT3C 2OA2A 4LF8O 4IEYA 3DPRA 4ZKTB 4TWTA 1QLEB 1QJU3 4QPIA 4FXGB 4TYSA 3N9NA 2GH2A 1OXCA 3EMRA 2VTXJ 4DV3O 1RUG1 3ZHVA 4K0KO 1QLEC 1FXKB 4DV7O 1JMUB 1Q90D 1SBDA 2AXTZ 2A70A 1DQ2A 2QM4A 4U2AA 3USUA 2F4VO 4QQLA 2YICA 1WZXA 3CCVV 3N9OA 2WS91 3OMAB 4JPRA 3JCZA 3TCUA 4LT5A 4CH5A 4Q4W1 1PO22 5A7QA 2YIBD 4LNVA 4D6RA 3M3QA 4W6WA 3WP6A 4X8AA 1AR5A 3TAYA 5CFDC 4MVRA 5J48A 5GZEA 2OVUA 3JB8A 3ZMVA 1EP0A 4TSVA 4OQ8A 2OTJV 1C1FA 2WAAA 4J25A 3LA2A 4ASLA 3KGZA 4F6RB 3VBFB 1Q8VA 3KV9A 2QM7A 3GZEA 4CS4A 1VAMA 3JB4C 1HJFA 3WXPA 4BDVB 4TV8B 1VQ5V 4YG6A 5K7PA 5FRAA 2AACA 1KYOF 5CA0A 5FYUA 1BCXA 2V4AA 4QPIB 4Q4V3 2RG4A 1Q6IA 2JKBA 3SYPA 4UW4A 1BQZA 4Y22B 4AHXA 4NXNO 4XETA 5KXEA 1C5HA 5A3WA 4E4EA 3SH4A 1I0HA 3AMPA 4MXWB 2A6VA 1FATA 3J8F1 3EVKA 3C3VA 4TV9A 3MUY1 1IOAA 3Q4HA 2BNMA 4YM0A 3CZUA 5KMGB 3ZHSA 1TUBB 2OCHA 2OWOA 2E5LO 4L92A 4GALA 2HVJC 4GB31 1QU0A 5KLVH 2XAGA 1BT8A 1K92A 3VDCA 4CCMA 2ARHA 2ZD9A 1P8JA 5IY5B 5IYZA 2VU9A 2JB4A 2ZM6B 4C1XA 5ITZB 2CE4A 4EZ4A 3BVCA 4I50A 1VQPV 3AXEA 5E8AA 2NP0A 4XHBA 5KBFA 1JFFA 1KEXA 3ZXFA 1VF5B 1P84F 4YARA 3USSA 1QKQA 1ZZ7A 4IYHA 1VF7A 4JI5O 3OTOO 2ARXA 1SHWB 4DK0A 1TVKB 1W0JG 5E6HA 3AP9A 1O91A 1XL4A 4O65A 2OT5A 4LH7A 1NCQA 2H8PC 3EHBB 4Q6GA 1UU4A 2VVEA 4XDKA 1SQ4A 4ASMB 1XNRB 5LK5A 5FQ0B 1UYZA 5JH7B 2VG9A 4CPBA 2R70A 3RYIB 2QWNB 5A7PA 1D4VB 2ZDIA 4F6EA 2QEXV 2P3IA 3WUDA 2VBBA 5BV6A 2Q68A 1LOFA 5JQGB 1PO12 3RRDA 3PMEA 4RAIA 2IU3A 3J7LA 1OF3A 1FNZA 1FNYA 4X1YA 1Z7S3 3VBSB 5DZEA 3O9OA 5C4WC 2CWMA 2UXCO 2Y0OA 1O3SA 4FP2A 4ZZ5A 3NNLA 5IDJA 5FY0A 1TNFA 5KC6A 3CO2A 3EXAA 5IJ9A 4CU6A 4COUA 1RMU2 2BCCH 3UO3A 2CUGA 4MGZE 5FP3A 2TBVA 1C5IA 1QQP1 4Y20A 2GV9A 5LHHA 1OKQA 2D3OW 2FDKA 4CP1A 1ND3C 5CKNA 3ZPYA 1KRIA 4UW6A 1ONAA 3O1UA 4Q0SA 4P9LA 1V9U2 4B3SB 3LSQA 2DWDC 2JJ2G 2YV8A 3RDIA 2XL7A 4Y4YA 2B9ZA 5JOZA 5FMBA 2XPJA 2CDOA 2RM23 1NBMG 3POYA 2YI8A 1RM1C 2FMYA 2VUJA 4X62B 4B3TO 1GZTA 2HWD2 4W65A 4I30A 1XREA 3N35A 2DYCA 2J1UA 1N3OA 4GULA 1ENSA 3ZDVA 1OLME 1RUNA 4QHZA 1J3RA 4IEOA 4Y1VA 3K9AA 1S0GA 1UY1A 3IC9A 2ZS6B 2WNEA 2Q8DA 2J1TA 1UD1A 1K12A 2WNVB 3TRSB 4URTA 1PMHX 3HMYA 2ZXWC 3FBMA 4LH6A 2GTSA 2WABA 2HWB2 3CYOA 4MGKE 1EUUA 1SA0B 3KCXA 3GZAA 5DN2A 5CAZA 3AYCA 3ZYFA 1PMIA 1HNWO 4AEKA 1FPOA 1MABG 3LSUA 3TXSA 3K48A 1EFRG 2RR13 1NJIW 3AG1B 5J1XA 4K8XA 1HXS1 5JSRA 2W2IA 3D5OA 2QQJA 3TEWA 1O4ZA 4JQTA 1OPOA 3TB0A 4XF3A 3UJOA 5L36A 4ZI7A 2H6CA 4DY3A 3L71H 1IG0A 3T4VA 4OULA 2Y33A 3ZHUA 5BYNA 1FXHA 4PDLA 1LU1A 3RBZA 4JGZA 3IDCB 1VAVA 2BOBC 4QU1A 3S7IA 4KHPB 3ZHQA 1S1AA 4Q8LA 3AZZA 4H13B 4NXMO 3FLRA 4KWUA 5IVCA 3UQ8A 2GMPA 4CEYB 4LFAB 4W50A 5KUKA 3RWNA 4GLXA 1OMIA 3WG3A 1I7FA 2Z5WA 4OPHA 4Y3OA 3ASNB 2V4VA 1W8ZA 2QJVA 4L87A 4X89A 2Y48A 3I3EA 2QQVA 1OZ0A 3PJYA 2EINC 3CXHF 3AVSA 1J59A 2VUCA 2XJRA 2GNTA 1DQ5A 1UPSA 3RYFB 1VR3A 2VOTA 1A78A 4F8AA 2E74B 4IEVA 1QHDA 3QO5A 1RL3A 5BNQA 5E79Z 4LHNA 1D4M1 3GZTB 2HWD1 3JAWB 4AR2A 3WDTA 5IW0A 4MZUA 4JHZA 1VQ8V 4OHXA 5FZKA 1Q8IA 1C3HA 4NKGB 4Y22A 1WW4A 2QQOA 1G86A 4RFT0 5EFUA 1BHBA 3E5QA 1O9GA 3MEPA 5IVBA 3V0AA 2R041 2WZR3 2PYLA 1DF4A 5FZ4A 1ULGA 2WLIA 4L2NA 1G7YA 3H1IH 1PIV2 1ZBE1 2RN9A 1JXNA 4DR4B 1AI4A 5K8SA 3E1F1 3CRRA 4FLYA 3KQ4B 4AGVA 3T1LA 3T09A 3JQXA 4YW2A 1WMXA 3OJBA 3LPGA 1ULDA 3LFMA 4BMEA 5I8TA 1NTKH 4V1PA 3ZXKA 3T2MA 3CC7V 4FIPC 1S0EA 4CSWA 3NRUA 3JAKB 1Q8QA 1WW6A 3NR7A 2YC4A 4DV5O 3NJYA 1XDCA 1S0VA 1THZA 2RS52 3V0BB 2O0OA 5LBBA 1R1A1 4XFAA 1UAIA 2VOKA 1UF2C 4RSUA 1SF9A 1WCDJ 2JVDA 4YJ2A 4PCRA 3AKSA 1NE4A 2OKXA 3M8AA 4WBBA 1MSWD 5JLVA 1H2KA 1VQOV 1DYPA 3CD6V 1BQPA 4BAYA 2ZGKA 3IFXA 1WA8B 5B2GB 4XZUG 2VQUA 3K58A 3GVMA 1X8EA 1X59A 5K0UA 2Q9LA 4H3WA 4DUZO 4YZ4A 4WVWA 2DYSB 3B8NA 5FZOB 4I55A 5LY1A 3WINE 1AZDA 4WM7A 5AG2A 2EJRA 2OT7A 2E7QA 1QH7A 4IEQA 4GKJO 1Y76A 1AXKA 3PUSA 4X65B 1BL8A 1SACA 3VD5A 2ZR2A 2RS33 4EQVA 2EILC 5FMOS 3DXRB 2YXLA 4JAVA 3VZKA 4XDJA 1JZ2A 1GWLA 1PK6B 1N36O 1XB9A 3HB3B 5E1AC 2DYSC 1LNSA 5D1IA 2WN2A 4NIIA 4DXZA 1KS4A 2Q8CA 4JV5B 2FD8A 4PF5A 3ZCCA 4QHOA 2QM8A 4R4ZA 3ZDSA 4MV2A 5LATA 1GP6A 4LR3A 3CMAV 5JVDA 2VOVA 1N32O 1W59A 3T1MA 4QXKA 4W4ZA 4LBQA 4TV9B 4HNAB 3AKRA 3TN92 3S5AA 2JDZA 3ETDA 1H4HA 4GJYA 4OI2A 1H6XA 1JTZX 2WNVA 1F5FA 3JAMN 2A6ZA 4DINB 4Q27A 2YMZA 3VBOC 1F4NA 4XJAA 1ASJ2 5E89A 4U36A 2BBAA 5FZ8A 1Z2GA 3VV1A 1ULFA 4GH4B 1SFYA 1WBFA 3OGIB 3VBOB 4AEDB 5L7OB 4DXRA 1AX1A 5CB4A 3HT2A 2UXBO 1WA4A 3S7EA 2WYSA 3DXTA 1S0BA 2PHUA 3U78A 4KG8A 1JHNA 2PHFA 3T1HO 2WC2A 2WYFA 4DW1A 3AX4A 1F4MA 2CH7A 1ZX3A 2DCTA 4U7NA 4CEWA 4HFSA 2VO5A 1W6PB 1RUOA 5FP9A 1TMF2 4ASKA 2ZDIC 3BGAA 4BIOA 2NM1A 1H1MA 2WS92 2FDFA 5JR7B 3DXRA 1JBCA 4R9DA 3CCUV 5JOXA 2BNNA 4DB5A 1HNWB 1GSLA 2CDYA 3MPBA 3VZLA 4DNYA 1V55C 3D0SA 2QE3A 3H8UA 4EB6B 4N43A 1WMEA 1NUKA 3UNPA 3CIHA 1RSOB 4Q4Y1 2D6KA 5ACA2 2ZGTA 3ZS8C 5EBLC 4YSFA 3CCSV 1QNYA 1VMFA 4CC5A 5DG2A 1JYVA 1SZXA 1N0NA 2GBOA 1WCSA 1XNTA 1JZ6A 2HWF2 2YDEA 1CPNA 4HXCA 4U3JB 1JCHA 4I0AA 4O2BA 4FPGA 1SQVH 1DFQA 3C7FA 3THOA 2BBVA 1TA8A 4UXAA 5KHIA 5J2TA 2D6PA 3QO7A 3OG2A 3ETPA 2UYAA 3BVOA 2R32A 3PNAA 3ZFEA 4AGRA 2G19A 1ENRA 4J1XA 1SZBA 4P5YA 4WM7C 4BQWA 2ZGSA 3SQOA 3LWCA 5A1AA 2R1BA 2X0LA 3HKBB 3VD4A 4B8EA 4N8MA 1AJQA 3N2KB 4LMFA 5LMUO 1KKDA 5LA6A 3CMEV 4COWA 3STLC 2W1QA 1YIJV 3FWEA 4K1YA 2QQUA 4UF0A 4WM7B 1TEIA 5A7NA 3WNPA 5JAXA 3ASOB 3OBZA 2VM9A 5L3GA 1KECA 1OHFA 4JGYB 4CCEA 3LNMB 2O8QA 3ZFEB 4FPYA 4JF3A 1V9U1 2WNUB 5A3OA 2CK3G 4X6QB 4MHRA 1M1KW 5FXXA 1JN2P 4QIWF 4A5UB 1AHSA 2NMNA 1V6JA 4XAAA 1F2NA 2VULA 3RYPA 2DQ0A 3FB6C 5FPVA 1PZ8A 1M90W 3SDLA 3FFQA 1SLAA 3Q8EA 4K40A 2PAMA 3AG4C 2ATFA 4PI0A 4DV5B 4MGTA 1UY3A 3SEEA 1FFTB 4FLZA 4NWVA 5C6CA 4JYAO 1GN2A 1YXBA 4PBPA 1VRBA 1VRH2 3X2QB 3WG2A 4AI1A 5CB7A 4CP9B 4JGZB 3ZX6A 2X6CA 2DVBA 5HCHA 3S6PA 3K03A 1IHMA 2YYOA 3J81N 4AI9A 4YGEA 4S2FA 1OOPA 4WVVA 4FLXA 4UV8A 1WAZA 4P9PA 4LQRA 2BWCA 2FDJA 5C8YB 1POV3 2QQLA 1JZ3A 1F23A 5FDBA 4XFHA 4AQ6A 4X64B 1MSDA 1W2BU 3SLIA 2VQ0A 2HWE1 1XNQB 5DAVA 4P00B 1BMFG 1VP7A 3RMYA 2XBO1 3K5LA 3N7KA 2Y4UA 1CAVB 1SA0A 3WZ1A 1SQXH 1HWYA 2ZIMA 4MS2A 1ZBE3 2YI9A 3KCYA 4CH6A 4MSVA 1GZ9A 1R3JC 4JYYA 3ZFGA 1FMD2 4MVMA 1YQCA 1CESA 2A3YA 1SBEA 2VOWA 4XEZA 3POGA 3M99B 1AR91 4B08A 1N32B 2XG3A 3N2GA 2RS31 3IAPA 3ZXEA 1I5XA 3SJBC 4HKLA 1BK1A 4CDWB 4YFZA 2E7TA 2VXJA 3B09A 4QE9A 2EIEA 4OYUA 1I94B 1U5YA 2W95A 4UVAA 4N23A 3H1WA 4D69A 3O1VA 3WDYA 4XF9A 1VQMV 1R3IC 1GOFA 2CH7B 4UFHA 3AG3B 1OCOB 2NPIA 1IKPA 2GN7A 1DQ1A 2W91A 4CDUC 1NQJA 4V2WA 2JJ1G 4L97A 2D7FA 4UVBA 4BCUA 2ZIOA 2FZ2A 4CEYA 3INAA 3UGGA 5BNOA 1W90A 4QB2A 2NLJC 2OYQA 4FFKA 2GUZA 3LE0A 2FB5A 2G9GA 1EYBA 1PV0A 1PO23 3HWJA 1ACCA 4JI7B 5D5QA 3DYMA 4HZFA 4FO9A 3RZLA 4P02B 4NO4A 3HOBA 1OURA 1XNKA 1S2BA 3TYJA 1OA3A 4ZI7B 3L72H 1CGPA 5H9CA 3SPJA 4R50A 1HR0O 3OBRA 2KD7A 2GHYA 4CUCA 1CX1A 3K4ZA 4NR1A 3R4DB 3SCGA 1ZUQA 1AL22 3GF6A 3ETGA 2ZPXA 4B3RB 1JHJA 2A73B 5EYPA 1IBKB 2CAVA 4LXLA 4LLFA 1XUQA 2QQMA 1JPXA 4NAMA 1EY2A 1ST8A 4XF0A 4XHXA 1YFXA 4JYCA 1GLHA 1U97A 3C7EA 4AHYA 5F37A 5FZ7A 2K0GA 1AJPA 1LHVA 2F4VB 1QNMA 4D7TA 1K5JA 5DN6G 1VBD3 2WLHA 4KWKA 1HNXO 2G4IA 4NWWA 1IGOA 2PHRA 1FKAO 4HL0A 3DKQA 1LUWA 5LZ6A 1Q43A 4B1MA 3K4AA 5A3MA 2QQIA 2GAUA 3ZOIA 2ZABA 1OH3A 2Y60A 3TETA 3VBHC 1XU2A 1N8RW 3CCLV 3T08A 3C7OA 1VBC2 3JD72 5JI9A 1SFPA 1WW7A 3MLJA 1ZL8A 4OZXA 5LK7B 2WAMA 1GBGA 3LEGA 2XASA 3TBDA 1VBE3 1J1TA 2UU9B 4KWJA 3B5LB 5IVJA 4FSJA 3C3TA 2LJ2A 2X5IC 3PTRB 1AX2A 2WQ8A 1ZL8B 4PHZA 4N43C 2Q1FA 4JI4O 2H3OA 4JASA 2ZE5A 5K9YA 4INDA 2GALA 3S3WA 2WPDG 1XNBA 4IGQA 2DTYA 4NXNB 4R9AA 5HXMA 4IL6Z 1PNMA 1OOPC 3MV01 3L74H 2ZKLA 1GNZA 5DAQA 5L19A 4DXWA 1JOYA 3PIJA 3AMMA 3LDKA 4GH4A 3ON7A 5AVPA 1X33A 2L35A 2Q6AA 3H7JA 1AYN3 2AENA 4M3CA 3RW0A 4AE2A 1HP8A 4NAOA 4IIJA 5JCOA 2XKOA 1NKDA 1W05A 5FYTA 2D40A 1J5EO 2DCYA 3M4FA 4CYDA 4OGQB 5JQGA 3NNGA 1PO13 4WF9V 4MT8A 4YFWA 2ZM6O 3AG7A 2RMKB 2JEUA 1UFIA 3OPTA 1ZRDA 3SJAC 1KXGA 1HB2A 1ZX5A 3T30A 2ZHNA 1JZ7A 5EJ3A 1EV13 4WFFA 1QMJA 3H3UA 5DAWA 4N43B 1G9AA 4ZIBA 3OTOB 1IPJA 3HBZA 5FYIA 5C7GA 4GWMA 5JI7A 1NCRC 2OUJA 3T0DA 4FPCA 1WB8A 1JYCA 1E5HA 1O59A 5G04L 1UOBA 2LFRA 3MI8A 1OCCB 1AI7A 3ZN6B 1EV11 1N47A 1QY4A 5J2TB 3HPNA 3VQVA 3D4KA 4AEDA 3WQ0A 5LP6A 3CEIA 3EXUA 3N27A 1K9MW 3UCSC 2UURA 2ZGQA 1M4WA 2ZTNA 1WPXA 2VGDA 1OF4A 2DFBA 2RDCA 4FLUA 2OPWA 3ACFA 4YPJA 3LGRA 1XQNA 1SFNA 1GWKA 3RVYA 4Z2WA 1JODA 4FTBA 3OYWA 3MPPG 4Q4X2 2CGNA 3KV4A 5DDJ2 1M93A 2D98A 2ZZQA 4CCDA 1ZNPA 3NW4A 4EN7B 3OBAA 3ZXLA 3OGVA 1JX9A 5B1BB 1LR1A 3OPWA 4HVRA 1TAEA 1BYHA 1W03A 1YCIA 4DV6O 2BVVA 3B9CA 1Y4MA 2YY1A 4MTOA 1Y66A 2PYJA 3SISA 1JW6A 4FZ0A 2B46X 1J1LA 2Z42A 3B40A 4IGOA 4NHLA 3WVJA 4URAA 2BYVE 2JDHA 3PUQA 3WHUA 4I4TA 2X05A 4Q4V1 1F15A 2DVFA 1QDCA 2VZPA 4I3PA 2LW8A 3CJIA 1QNWA 4B3SO 1V0AA 3U10A 3ZFFA 1HW5A 4PJYA 2CGPA 5EC2C 2ORXA 4HETA 3BRCA 2SBAA 3BABA 5FPAA 1MVQA 2VS0A 2AC1A 4I5SA 1XOUA 3FYEB 2RM22 4X62O 1XE7A 1HXS3 2V4DA 5K0UB 3KHCA 4MLOA 1W8OA 2JEMA 1JYTA 1PVC1 1W9YA 1H8TB 1VBD2 3TOJA 3NV3A 3CC4V 1Q3EA 4HOOA 5IVFA 4NTWA 2W3JA 4HSLA 1HW7A 4S2HA 1FI2A 2P34A 1AL0G 4LPLA 3CXCU 4PT6A 2IXCA 4MOAA 4XMIA 3K57A 5FLJA 4JI7O 4YHHO 2EIMC 5AFBA 1IBMO 4J42A 1IXBA 2PXJA 5C4WB 4Y5Z0 1VF6A 2BUKA 4GMP3 2DWEC 4YW3A 5F7UA 3C7HA 4X20A 5LBQA 3BPZA 2B1GA 4QD2A 1ZRFA 4LE4A 4WFGA 1MACA 4Q0VA 1E1RG 5C8WA 4RHV2 4YNIA 1XBLA 3ZRWA 5CG9A 2WBKA 3I7DA 4MADA 3U0ZA 1OFNA 5BNNA 3S0MA 5JH7A 1CIYA 4LWSB 4P9JA 1OI6A 4B3RO 3JCUZ 5E1RA 4ZU7A 1IBKO 2P3JA 1MA1A 3PMSA 2FTKA 1CX4A 1XYOA 3K46A 4DV4B 5IJRA 2ADQB 4YW5A 5L9RA 3WSOA 3MDSA 4LBJA 2R072 1MQTC 4XABA 2O1QA 3HD8B 4M3CE 4UB8Z 1YI7A 1CAVA 2Q8VA 3VD3A 4Q26A 4DV1B 2QDRA 4DS0A 2ADEA 4BQXA 1DGWA 4K3UA 5BUVA 1HNXB 2W47A 4BQ2A 2JX9A 4I0BA 3NVCA 3ZN6A 4BWAA 1PO21 1ZA7A 4BM8A 1JR9A 1LTEA 4BA6A 3GM8A 3H8RA 2WR9A 4TZDA 1YTFD 1Z0HA 1YI2V 1C1LA 1W3XA 1YO8A 1TUEB 1T6BX 3Q8AA 3I4IA 2EULA 3ELNA 2LUWA 4DUVA 2NLRA 4OHZA 4MVQA 2VBDA 4HN1A 1S0CA 1UY0A 1YC61 4Q8KA 4LF6B 2WSSG 1APNA 2W08A 5EXOA 2WFF1 1VBB1 2CTVA 2IW5A 4COYA 2ITDC 2YXSA 4LFBO 1W3VA 2WDBA 3NXSA 3I59A 4GKYA 3AG2B 3MW4A 4FFIA 1AR92 3T0BA 2DU0A 5CKMA 4R9CA 5EC1C 1L7LA 3ABMC 4RGAA 4KBZA 4GB32 4XJ9A 2BTQA 2ZKOA 1XOYA 4CDXB 3I2KA 4AAXA 1VQKV 4N7UA 4I09A 2Z2SB 3MYXA 4META 2D5FA 1Z7S1 2BNOA 2FDHA 4CPBD 4CUGA 4A44A 1XE8A 5DEDA 4PF1A 2DU1A 3OUIA 1JA8A 2OCCC 3I8TA 2LQTA 2HP8A 1W99A 1NXD1 1LEDA 1Y74B 4R6ZA 1KU9A 3NL1A 1FPN1 2AZ2A 2HWE2 2G1MA 4Q4Y3 2VZOA 3WF0A 2HWF1 3IIIA 4E2LA 4BXFA 4LFCB 3L75H 3DGEA 2HWC3 5J9PC 1RSOA 4CH4A 3OCPA 4X8NA 2RJZA 4DIQA 1CZTA 5BR8O 3OB8A 2VZTA 4DO2A 4K8RB 4FLTA 4DRXA 3JD3A 4DV0B 2C2AA 2BDRA 5C93A 4C8DA 4KU7A 2D3PA 5JCTA 2F1MA 3VB9A 1M57C 5TSWA 3MIHA 4QX5A 4YVWC 1W8UA 5BMVA 2WZPP 2ET1A 2PF4E 4E4ZA 5J36A 3HQRA 4KGGA 1JYIA 2EIKC 4ZU5A 4TLGA 5A7WB 2JEXA 4MTXA 1VB2A 1WD3A 1VF6C 1PO11 3POBA 5JIUA 1VB4A 3MDPA 2E31A 1OLMA 5DZFA 4LF4O 3WQ7A 3QH7A 1XHZA 2Q1MA 1KJRA 5LCWL 5DPNA 4GKJB 3D82A 4FVVA 1QVGU 1AI5A 4QQ2A 1IS6A 5C8CB 4YVWA 2QA4V 1HDJA 3KS7A 1US3A 1AVBA 2LP7A 5JZGB 1BBT3 1YJWV 2GTAA 2V72A 4IE6A 1UKRA 3S3XA 3RPQA 2KR2A 1SQBH 3T4ZA 3WT3A 2ZEYA 1PGW2 1IPSA 3PURA 3LAGA 1OCRC 5D8AB 4XDQA 5JVVA 4TUYB 5FYCA 5CYYA 3OW2U 1LGCA 4XVHA 3UESA 3CNAA 5L9BA 2YHJA 3H01A 2EINB 1YVWA 4AQYB 3VHPA 5FOJB 3VDDA 3L2YA 4RYDA 4DXSA 1K97A 5FZIA 1S76D 1NG0A 2VC9A 4OVEA 4JI6O 5BNPA 2OX0A 4M3CB 2P3KA 3LDRA 1AR62 4UUJC 2VPVA 4XC9A 3O0VA 4P9GA 1KB9F 4Q4W3 5C3QA 2PHDA 2A6XA 2IU0A 2XBO2 4GZRB 4BXSV 4J7JA 2Z4FA 2CL2A 3OY8A 4BR6A 4XDPA 3OEHG 1GYKA 4NRMA 1QJY2 2YROA 4XQWA 4XIOA 1KQSU 3DCQA 1YHQV 1MZ6A 2OXBA 3ILFA 2F6BA 5AC91 2X09A 2OTLV 4GKKB 3N7JA 3UM7A 3ZMSA 5C8CC 1KP3A 4I0XB 3ABKC 4DR5O 1C57A 4IEUA 1YITV 4DMIA 1RP3B 1QOSA 4LO6B 1ZSPA 3ZRVA 1VLNA 5ERLA 1RUH2 1ZBA3 2YXHA 3THPA 2V1DA 4AVVA 2RMU2 2GH8A 3THDA 4X66O 3H0OA 1ODNA 2Y38A 3JCIA 4LKDA 1YFWA 2VTFA 5LGTA 2D3RA 2YXYA 3JARB 4XOGA 4DV4O 3CJHB 2YGMA 5LOVA 4DV7B 3BTAA 4G2KA 2JJ6A 4D6TH 2Q7HA 2QVSB 5LMNB 4DR7O 2D2CB 4HYOA 1RHI2 2AEZA 3E35A 1KUQA 4O4IA 4QKNA 1OSGA 2ARAA 1UKGA 3ZFEC 2VXRA 5I8YA 1MR5A 1CVNA 2BSKB 1KITA 5FYMA 3C8XA 4A3ZA 3FE5A 1PX3A 4D6SA 3NJXA 1QJY1 2GDFA 4Z8BA 4W8JA 1YHFA 5JVDB 4EWDA 1IQDC 4PDWB 1MG1A 1N33B 1XQ8A 5FZCA 2W6JG 1Q56A 4KU8A 3V65A 3PVNA 1TVGA 1J84A 3ZMZA 2ADPA 1OA4A 3FZ3A 1PIV1 1V00A 1PK6C 4F6RA 4WFHA 4LFBB 1OFSA 3LKJA 5F5IA 1FV2A 2JIJA 1S2KA 3T1YB 4JAAA 1UXXX 1PX4A 4OI0A 3WF2A 1KBHA 5F2WA 3FLTA 1OBNA 3VD9A 3CQOA 5EBMC 5IAXA 5LMUB 3ZFGB 2QTOA 4FAGA 4CEWB 2Q0AA 3RJ2X 5ITZA 3OGGA 3VBSA 3LEIA 3B77A 4PQ9A 4DYLA 5FZOA 5LRRA 3SPHA 3RWKX 2ZGOA 2VZ3A 4LITA 1EZVH 4MVOA 5L73A 3A21A 2E6VA 3CX5F 2D6LX 5A33B 1GOHA 1TQ5A 3AYAA 2V5DA 3JBG1 4MW3A 3N7MA 4DR1B 1BKZA 1KC8W 5DECA 3FN9A 4AGGA 4ET7A 4LFCO 2WLNA 2EXKA 2EICA 1W9SA 2HHHB 1NCQB 1UPIA 2XHNA 1M9NA 4OCTA 3ETEA 3MHSC 3AKPA 3H50A 4BQYA 3ES4A 1SPPA 3RNSA 3JATA 4IV1B 4AAPA 3Q9OA 3PUHA 4NN0A 1U96A 1KDMA 2BGOA 2HJFC 4NB5A 4Q4V2 4UFZA 2Z69A 2IUWA 3PN1A 4Z1VA 2VBPA 3GBFA 4IEWA 4JZGA 1O6UA 5IY5C 2VWKA 5IHRA 4PDVA 1FV3A 2PI4A 1J3QA 3M1HA 3WX5A 1JZ5A 5H2FZ 3L9JT 3K9SA 3SPGA 1W0NA 1XILA 1UMHA 1AUYA 1W0OA 1DGRA 4PI2A 4FOYA 4MW8A 4MVTA 4O4HA 4Y1YA 2GSMB 5B3SC 1JOPA 1BE3H 4L8QA 1GN4A 2WNVC 2ETEA 1H1IA 1SMVA 1COV3 2AW9A 2WZR2 4LO5B 5AFEA 3L2HA 4O2AB 4A6SA 4UF0B 5FY4A 4N53B 1ND2C 3VLBB 1W6MB 5KXBA 1OV9A 4GIQA 4NHMA 4AQ2A 1HRI3 5DM6V 3RYFA 4X1IA 5ABJC 5B4XA 3AG1C 3ZO0B 3K75B 2BZDA 1OLQA 3H42B 3DPRB 5D8AA 5JZGC 5KWRA 4IEZA 2AZ5A 3DKWA 5C33A 2VNGA 4JC1A 4RFRB 1K3IA 3WQBA 1E57A 2ZT9B 5J09A 2J22A 2ZACA 3GALA 3NAPC 2WO3A 1L7RA 4JI6B 2VE1A 1MMMA 3ZN5A 3UL2A 4ZHNA 3N9LA 2EZPA 3SEPA 1F31A 2UU8A 4IE5A 2XT9A 4TQDA 4WVMA 1YI9A 2VZQA 5HV4A 4FXKB 3D3QA 1A3KA 1YEWA 4C0BA 4RR3B 3KV6A 1JOJA 3NAPB 1Q6UA 4DPNA 4AEMA 5FMCA 1SETA 2E3CA 4NJ4A 1YQ5A 4NROA 3DV8A 3CJIB 5FIXA 5F39A 2DE0X 3F95A 4ISRA 3V64A 2CY6A 4QM9A 4MG2A 3DGTA 2YU1A 4Q0QA 1IS3A 1JS9A 4DR5B 1B04A 4YJ3A 5GKAC 2B45X 5CA1A 5C5TA 3LSSA 4DFSA 3HJRA 3SXWA 5IVYA 2ZMNA 3ZR6A 3BU7A 4NPMA 2HWB3 4EFEA 4ZS2A 2GZWA 4LBEC 2L9LA 3AK0A 3C2UA 5KX5B 1PK6A 5LA0A 5LXTA 3WD5A 4WM8C 5GJ6A 1AP5A 1D4M3 3QD6A 3MBWA 2ORZA 5C8CA 3OGCC 1JOBA 3FHAA 3GJAA 4E4HA 4O9EA 5FYHA 1L0LH 1POV0 4DR7B 5FLHA 1SCRA 4JI0O 1XNDA 1WJZA 3BAAA 2XBO3 1S0FA 1QDOA 3H9AA 4LR4A 4FTEA 5CFCC 2KQXA 4XF4A 1DQ4A 2JG8A 2QBXA 4KHPO 2W6IG 4A6OA 1W28A 2TNFA 1H2GA 4B4PA 3AG3C 1AR63 3H1HH 4WBNB 5A7SA 3VBOA 3KVAA 4A4AA 2LTNA 2VOXA 1G4YB 2KKWA 5FXZA 3D6EA 2P37A 2MEV2 4Z82A 1DLLA 1DK1A 1ZREA 4A7YA 3NJZA 2FCUA 2ZX1A 4JI2B 1V54B 1UOFA 4UCVA 4JX0A 3ZSEA 1S0IA 2X53S 4BYYA 2VQAA 2ARCA 4UFJA 2D6MA 2EJ7A 2XVLA 1I3HA 5FZFA 1D4M2 5B5EZ 5FTTC 1AJNA 2UU9O 1STMA 3VUOA 1LHOA 1QH6A 1W6MA 3B93A 1AXZA 1WB7A 1YF2A 5JWPA 4NMIA 2D44A 2Q0OC 1QJX3 1RUI3 1AL21 1AYM2 3BA8A 2E32A 5FBZA 4H14A 2H0VA 3EB7A 3FHIB 2P67A 4B7KA 5F5AA 4FPPA 2PQQA 2ZNJA 1WCKA 3UGHA 1OJHA 1IQAA 1Q8OA 2N05A 4JI8O 1C8M1 2WINB 2IXKA 4GX5A 2QCSB 2C1FA 5C70A 1QXPA 3ZYRA 3KLSA 5KUMA 3P6BA 3ZYIB 2Q7EA 1V6LA 5DAXA 1J5EB 3SH5A 3LUTB 1RJ8A 5FYVA 5F5QA 4LA3A 2IVJA 3GZUC 5FPOA 4B29A 4Q4W2 5DUWA 4XMAA 3LA7A 3DYPA 1FMD1 2R042 3MICA 1YFYA 3PUIA 2XR4A 2UWBA 5FZ9A 2EIJB 1MOFA 1UWWA 4MGSA 4AVSA 2KG7A 2ES3A 2W39A 4EYUA 4IE4A 3VBFA 5JXJA 1W6QB 1OD3A 4IXLA 3E6BA 2WWJA 4YW4A 3A0RA 1BHGA 4KXRA 4CXYA 4GMP1 4AEDC 3PIGA 4NHYA 5C9AB 5BY5A 2K9ZA 2ZCEA 4LO4B 1F51A 3Q4HB 2XNDG 2VCAA 2P90A 4FM0A 1AR82 2I07B 2VVFA 4QPWA 1GN6A 3O1RA 1QHTA 4XFGA 4Z07A 3M70A 1QU7A 2YZ4A 4LIVA 3HQXA 3ZIAG 1QBZA 2WLMA 3Q8BA 1O7FA 3VDDB 5A32B 4D0QA 1JUHA 5GZGA 4OHYA 4EN8B 4UCOA 4NIHA 4H33A 1KQRA 2VQEB 3WP4A 2IXLA 3WP3A 1GU3A 2CV6A 4M3CF 4UXNA 4CS2A 5DQ0A 2AR6A 4UCSA 2QUOA 3VZMA 1F4HA 4IHJA 2DYRC 2D5HA 1FXVA 1PZ9A 4J11A 2QKDA 4TUYA 1UJWB 5EYYA 1M56C 3SR2C 3F7VC 4DV6B 1UX7A 3JD1A 1PNFA 5F6LB 3U75A 4F3JA 2OYZA 2VZRA 1URFA 4N21A 1UIKA 4U7OA 3WV6A 4BHPA 5GLUA 2UY9A 5KHKA 3U4XA 4ARXA 1WLEA 5M0TA 2HWC1 2I2SA 5CBFA 4IDZA 2HLDG 3IGAC 3GYDA 4PIYA 1GH6A 4QDSA 1K73W 1V6NA 1NCRB 3F5TA 1S77D 3I3BA 4G27B 3RZJA 4CU9A 5L7OC 2Y69B 4GUNA 1UOGA 3OUFA 3J9SA 4UFKA 4XJZA 1A6CA 2P1BA 1S0DA 1YJNV 5LEJA 2QWPB 4QX3A 4QM8A 1UMZA 3S57A 4YM2A 2J7MA 1H0BA 5IVVA 5IVEA 1S5JA 1FFXB 5KMGA 3D3IA 4HMZA 2Q7GA 4PA9A 2EIGA 3T1CA 4WZCA 2J1SA 1OUSA 1LESA 4N53C 1WMFA 5FZEA 1W2AX 3RS6A 1OPMA 1Y9QA 4YHHB 3BTYA 1UPGA 2PLV1 1NX9A 3AP5A 4PA3A 5C3SA 4LO7A 1KP2A 5LGUA 2MNGA 3OGJA 3KT1A 2VTXA 3KKYA 3JAWA 4PLMA 3RYCA 1SDDB 2R7EB 4P9WA 4QPGC 1MPXA 3AJZA 4RHV3 1W8HA 4YVSB 2YFZA 1ND3B 3CC2V 3LCPA 3ETQA 2RS12 4LF8B 4BISA 1AB3A 2HWC2 5BXZA 5JJEB 3HBKA 1H8VA 4CDQB 4NRPA 2C9KA 4JHTA 4PDMA 1LKNA 4UFIA 4GCZA 4JTCB 5JCOC 3AZYA 4UW5A 4JTOA 1LU2A 4FOVA 4DR6O 4J1WA 3KF3A 3ZKUA 1IS5A 1VEWA 2O57A 1VQ6V 5LYJB 5A7WA 3W5MA 3RZMA 4DV1O 2W68A 1ZM1A 3H3ZA 3A8TA 3V0AB 2P5OA 5D21A 4P9XA 4AL9A 1YYNA 5GALA 4X6RB 5A9GA 1B06A 2VY0A 1QIQA 4SBVA 2EXHA 1R1ZA 1N3QA 2AEYA 1XYPA 3R66A 3RGBA 2YGLA 1VQ4V 5B1AB 2E51A 4FMTA 2VMFA 3FB7C 3USUB 2HEWF 1VARA 3TN93 5LA6B 5F5CA 5J98B 2HLEA 2IH1C 2IXJA 1F5JA 1NH2B 4KBBA 2PHTA 4OUEA 3O0XA 2HYXA 3QVNA 4RR3C 4PELA 4WM8B 5FK7A 4DQAA 5IWFA 3VN4A 5JIAA 4BB3A 1AR61 1WWYA 4FCAA 2AUYA 4AFDA 4PJ0Z 1LHNA 3E6CC 2A1XA 4FBFA 1QOOA 5KAFZ 1MS9A 1VRH1 1PL0A 4FZ1A 1RHI1 4L9BA 1BXHA 3F7YC 4KL1A 3LSEA 1PM4A 2A3XA 3IDBB 1Y76B 3CWBH 2WFPA 3B01A 2Y6JA 3DC6A 3OPZA 4XFFA 2ILMA 1OH4A 1EAH1 2EALA 3I2JA 4YM3A 5FP8A 4JI8B 3I3MA 3TNQA 4JKKA 3R0RA 1H4GA 3E8HA 4ZKIA 2E5LB 1NQTA 2VMDA 1YNAA 1HQWA 5FXWA 4YG3A 1W39A 1U5XA 1G9BA 2VMCA 2BFUS 1LRHA 2W1WA 4ES8A 1I5PA 4QDRA 1WMDA 4OHVA 2DF7A 2DVAA 5DXDA 3TGUH 4BQ5A 2ZAAA 4D8MA 3QTCA 1FJGO 4ZOLB 4GQ7A 1YJKA 3P30A 1BBT2 4LJHA 3HEIA 4Y4RA 1YDXA 4LOTA 1VPHA 3T4HB 1J58A 2BEOA 4Q20A 1SLTA 4FFFA 1B35A 4KG0A 1JMKC 4XUNA 5T5OA 3CRAA 1RUE2 4LF7B 3I56V 5FMOL 3G80A 1W0PA 2E7AA 3SHRA 1GQGA 5A6ZA 5IYZB 3FJSA 3K79A 1UIJA 2LW7A 4W6XA 4I55B 1GM7A 5BY1A 1K33A 4KNCA 2AH2A 4Y1UA 4OUMA 1CAWB 4MUVA 3LEMA 1V6MA 1FMD3 3N4MA 3ABLB 3DEMA 4YGDA 1CWPA 2ZR3A 3E83A 1XNQO 1PVC2 4Y24A 2VRZA 4AI8A 4XUTA 3RYIA 2DUQA 1SQQH 3EYPA 5A1LA 1CZVA 4QB6A 5I0DA 5JDBA 5JSPA 2KXLA 4BIFA 2YS8A 2R1DA 4MSWC 2D97A 1NTZH 2RS11 3E86A 2F93B 4JQRA 3C90A 2RS51 3OEEG 3HT1A 2OZJA 5G05L 4Y1ZA 1B6QA 2C4XA 3E6DA 5F8PA 3OEAA 3QNEA 5IJ0A 2ZZJA 2X5IA 1QJX1 1RUI1 1X50A 3G67A 5FZMA 3LOIA 4YRDA 3HN1A 1GMGA 2DBIA 5FZ6A 1O8PA 4AXOA 2PLV2 5FZAA 5BNOB 2Y34A 3FAVB 1NY71 4BQ3A 2BFUL 4FQZA 1FAFA 2BW8A 3POIA 3POSA 4BZ4A 3W7XA 1KJLA 3FAVA 1H2LA 3PVOA 4CXWA 4WCEV 2DYRB 1P49A 1LUVA 1IKQA 2UXDB 4FOWA 2VMEA 2Q5ZA 3VBRA 5FWJA 1NCRA 1EPZA 2ZMLA 3J7AU 4FVMA 4EN6B 1PPJH 1R1BA 2X5IB 4B3TB 5H6QA 2JDYA 5LB6A 3RWRD 4JRAA 2C24A 5FKBA 4QXHA 2DTWA 2B5HA 5GONA 1U5IA 2FDIA 2WO7A 1AP6A 5FO7B 3ABTA 1HV1A 5BNPC 1AJKA 4JI1O 4XILA 4IEPA 2P6HA 1SERA 4GKKO 1ZA4A 3PJSK 3UKMA 1NCQC 5BNNB 4AFCA 5IK5A 2L6LA 2CTRA 2LO1A 2QKCA 3ZRWB 3MF6A 1GOGA 1RM1B 2N74A 2EF6A 3LF7A 5GLTA 1IX9A 1YLLA 1SQGA 1C28A 1RUC2 2HEYF 4O4IB 1POQA 3KD4A 4LEJA 5A80A 3ROUA 4LA2A 3POJA 2TUNA 4AHCA 4XTMA 4YVSA 2KM2A 2Q8EA 3K3OA 5A3PA 3WDVA 1FT9A 1LOCA 1XEQA 1AF9A 1G8MA 4QGPA 4YLZA 5F32A 3ZMNA 3KV5A 5FMDA 3PJQA 4RL7A 1D5AA 1K42A 4BW9A 1X36A 3W7TA 2IBZH 3RYHB 1WGPA 3IAYA 1XMOO 4IE7A 1OC1A 4AG4A 3HR9A 3RI8A 4Z1MG 4LBOA 4K8ZA 4NXMB 2FBEA 3ZEDA 1P7GA 3OOXA 2XQRA 4L0PA 4FFHA 3NJVA 4LK7A 1K5MB 4Y1XA 3CZJA 4UCUA 3FC0A 3AEIA 1SLCA 4QPGB 1SZTA 2IFWA 4QQPA 4MVSA 3JALA 1U0AA 5A3LA 2XXZA 2IJIA 1GQPA 4GX2A 1WPBA 3K5OA 2Z0AA 1UZZA 4YXWG 4QGMA 3VQXA 4Q1PA 1TME2 1YXWA 3T1YO 1W8NA 2RM21 1RUE1 3I2FA 4X8PA 2BTVC 1HXS2 3K4DA 4CP2A 4YVWB 4JI4B 1HRI1 3NKGA 1OD5A 4GWJA 5EV7A 2IXIA 3T2OA 4GA9A 3ZN4A 3B8MA 1PL4A 1A34A 2W1SA 4MVUA 1X9TA 1ZRRA 2BJSA 1RVF2 3M7MX 2ZINA 1T2XA 2XQXA 4ARYA 4AHWA 4NPRA 4DR4O 2QZ2A 4DR3O 1I08A 1G1XB 1R092 3ZXDA 4I02A 3RQ0A 2FHRA 1GFF2 3CP1A 3BODA 2WLLB 4E4DX 3UETA 4SLIA 1CP9A 2J1VA 3HKBA 3OUHA 4DR1O 4X1KB 5JXHA 5FO8B 3TEXA 2W9XA 4JRLA 3IM0A 3HKDB 1VQLV 2HHHO 4ZOLA 3GWKC 4L99A 4NIDA 4ZZ8A 1EZJA 2WWUA 3A2FA 1FJGB 4O9GA 2DCZA 4MTFA 3ZPOA 2J42A 1TE1B 4O4HB 5GTHZ 3T2QA 2BE3A 2M6YA 4RUEA 2ZAHA 2RMU1 3ZBHA 3ZX7A 1AR72 2B39A 3LEKA 1UU5A 2FCVA 2XJPA 4GMP0 1TZOA 3BFRA 4BE3A 4EJRA 2M7WA 2UY8A 1PNGA 4LLOA 4PDRA 4OI4A 4YZ1A 5FZ1A 2FMDA 4M0HA 2VCBA 1NLQA 2E33A 1XSRA 3EQEA 3ASNC 3ZSJA 4K20A 3L70H 4S2GA 3KSCA 1SPPB 1Y9MA 5LXTB 5K1XA 3X29B 1H38A 3D8CA 3KCCA 3FMGA 3MIGA 3K3NA 1HLCA 1DYKA 2LRPA 3VHNA 2WNUA 2JGDA 2JKXA 4Y5TA 4C90A 1QR9A 4TQFA 5KXDA 4HVOA 3ZHRA 3D3AA 1R082 1MEC2 2F23A 4P08A 2QWQB 3MGUA 3CJIC 5FAXA 2XKPA 3AYDA 3EFFK 3WUCA 4XXPA 2P4EA 2RS13 3VD7A 3DN7A 3U4SA 3SYAA 2JDNA 2P22C 4AVAA 1W9TA 4G9SB 2LM3A 4LK6A 1FD9A 3LIGA 2DJVA 5FK8A 2A9HA 5CEHA 4XBLA 5FOBB 2ZHLA 3ZFFB 1ND2A 1XJAA 2WT1A 2QQNA 3GDBA 1UL9A 3BTXA 4LF5B 1W9WA 2RCVA 4XCBA 2X29A 1YWKA 4QU2A 3UGFA 1NR7A 1XL6A 5IYBO 1LCLA 3NNFA 2RDNA 3CE2A 5CFDB 4B3MO 1QJU1 3P1IA 3AFGA 1CPYA 5HBAA 1H2NA 3MAQA 1S72V 3QACA 2XUMA 5K1PA 3WB1A 4EFBA 4PA6A 4ASUG 2C5DA 5CISA 5F2SA 2WQ4A 4UWDA 3L73H 3I2DA 2UUCO 5KXCA 4LCUC 3CBNA 3JATB 3H1LH 2JE8A 3T1HB 2WJSA 1Y6XA 1K45A 3N3HA 3A0BZ 3WB0A 1DQ6A 1PVXA 4A7ZA 2WA3A 5D5PA 5T5JA 3SGIA 3I2IA 4QGLA 2VUAA 1V6OA 2BOIA 2HWD3 3W20A 1X9PA 1B3QA 1RUF2 4K6BA 2ZQMA 3RYHA 3VDAA 4UV9A 2WS93 1POV1 2OS2A 1DCSA 3NKTA 5LP6B 5FY7A 1Y7BA 2JICA 3ECQA 5BZBA 1HDKA 2Z3YA 1CJPA 1BZWA 2JG8B 1O5LA 1MS8A 3THCA 2XJTA 4CDUB 3AMQA 4LHSA 4DV3B 1SQFA 4PA7A 1QQP2 2ZE7A 5IK7A 1GTOA 5JUVA 3WLUA 3BIWE 1GICA 5JJJB 4H7LA 1MEC3 4QPKA 2OUHA 1R3LC 4QQHA 3WCRA 2AGAA 4CCNA 5LEKA 4D6QA 1NS1A 3ME2A 1N3PA 4XZPA 1HNZO 3VBFC 4HZ3A 3ZYBA 4YZ2A 1RMU3 5IWAO 4MVZA 2X8KA 2XOKG 2YBPA 4CRQA 3B00A 3JUUA 5L3DA 4IUGA 2YUEA 4XBQA 4BOWA 4PIZA 4AHZA 3IKWA 4DEQA 1K8AW 5I0RA 4BIUA 1AR93 3C7GA 3DYOA 3GB7C 4YWAA 5GTIZ 2NNUA 4QX0A 2W0FC 2P5BA 1W0KG 1ZZBA 1N34O 4QJFB 2ZGUA 5I8SA 5FP7A 3OE7G 2ERFA 2W1UA 2Q69A 2QDOA 1A8MA 5ANQA 5LBEA 3CHXA 4AOCA 4JVAA 4EWAA 3ABLC 4XFIA 2YC0A 5CA0B 1K34A 1ULCA 2OIIA 1DGSA 4YG0A 3OGRA 1OA2A 3KT4A 1PKXA 4LE3A 5EIBD 4DOUA 2Z5UA 4OLLA 2ZXQA 1ODMA 3BPSA 1CAXB 4S2DA 2HKXA 3AK2A 2VAUA 5L3BA 3WHTA 2OCCB 3CRMA 1J3PA 5SV5A 5B4NA 5EIBC 4B3NA 2B42B 2PAKA 3EHKA 2PAEA 4F83A 2VD7A 4LNUB 4ZXEA 4IETA 3HKEA 1OCZB 2IJJA 4DUXA 3HKDA 1DF5A 3O1OA 1Z5WA 1IZ3A 2VUDA 5FJHA 1IPKA 2VECA 3GBGA 2B9UA 2WA4A 4N90A 1ENXA 5C9AC 1K3EA 1W8TA 1Q81W 4ICGA 4QX2A 4DV0O 3TXQA 2YG0A 3I3DA 3JSNA 3WF4A 2J1AA 3K51A 3WDXA 4AI2A 4C0HA 2VMIA 1V9U3 2VW1A 3BIEA 2ZNIA 1W6OA 4QE7A 3F5WC 1AR81 2B9VA 4B4QA 2FKXA 3VKFC 5HCAA 1S5LZ 3MFCA 1NT0A 4FLVA 4FP3A 3AMNA 1XNRO 3IT8A 1US2A 1VIBA 2ZBJA 2BERA 5F3EA 3TEZA 2VZ1A 4LF4B 1PGL2 3FD9A 1PGL1 3ML0A 5I0TA 1V54C 1AR71 1WNSA 2JRIA 3E8GA 4Q5OA 3W21A 5A6XA 4NUBA 4AK3A 1L0NH 1LODA 2AZ0A 4JKLA 1RUG3 4B1LA 4AI3A 4I2OA 4N9IA 4OFGA 3AP6A 1JVMA 5GLWA 2I45A 2UXCB 3U07A 1D2QA 4DV2B 3G71V 3T3YA 1H9PA 2XDVA 1W2UA 3MIBA 3NMBA 4QX7A 2QE7G 4CCLA 1WBLA 4XAEA 4IEXA 2NMOA 2JS3A 1XI1A 4XDLA 1UNBA 2WIIB 4HAMA 1GO3F 3BUCA 1HQLA 2V5YA 5A6YA 3CMGA 2YIDA 4EKWA 3VL9A 4TTGA 3SKJE 1IBLO 1TG7A 5KHJA 1S3JA 3BCCH 3B4SA 1L1FA 4G3YC 1UXZA 5FXVA 1SLBA 4AZZA 2PA7A 4K3AA 1ROPA 2JENA 5A6QA 2BU9A 4ZU4A 2HFEC 5HI0A 4YM1A 2K1EA 5F6KA 1WP7A 3G6BA 1NKGA 3LDBA 4J10A 4ZONA 2XOMA 2JDMA 2HH9A 4RS5B 1OVPA 1XHXA 5EYPB 4GWNA 2MPFA 2IFRA 4HONA 3PHMA 3WDUA 3B7MA 2BRTA 3LFIA 3APOA 4LC1A 1VE0A 4H55A 4QT6A 1XMQB 1IXMA 4FK5C 5EHDA 3ZSKA 4ES9A 4JAUA 4EE2A 1TVKA 1DZQA 3BA9A 1RINA 4YZ5A 1W2TA 1PIV3 3U11A 5KAIZ 3O1SA 4UOJA 1TME3 1FOD3 2WWWA 2YPDA 4LP8A 2RS53 4D3WA 4G4FA 3ZRSA 1M56B 4KP4A 1VBA2 2VVDA 2WLPA 2C26A 3MHZA 4LOSA 2Q8OA 5K4LA 2Y0PA 3C3SA 4J7KA 3LA3A 5KA6A 3M2MA 5T5LA 3H9VA 2WFF2 1BZKA 3R05A 2DBNA 3BOWA 4HG6B 3J26N 4RS5A 4JI3O 1H9WA 2P6CA 2B1IA 3ST7A 3IN9A 1OKOA 2WO1A 5IWAB 2QQPA 1EN5A 4LUMA 4PLOA 2XLGA 3MD0A 1BMV2 1BEV2 2E26A 1RUD3 2QQWA 4ZY9A 2A3WA 1RPRA 5CN0A 1WKYA 2P6JA 3OR7C 3AZXA 4HPKA 3UT5B 4YGBA 1E1QG 1JJOA 3H1JH 5CBHA 3QLQA 1N34B 1K5MA 1S2EA 1JFFB 4TV8A 2W52A 3JD73 1RUD1 5FNVA 1W6NB 3FLPA 1YIFA 2WN3A 2P3YA 5JOYA 3A0NA 4WV8A 1H1AA 2WUHA 1YTFB 2ZGMA 3QOPA 2XONA 2JG8C 3WG1A 1AYM1 1X7NA 3HNBM 4XCAA 3WG7B 1RGSA 3CCRV 4MGQA 4QPJA 4A42A 1O3RA 1TNRA 1JYXA 4GB33 2VMHA 1TMF3 3IAQA 2DMXA 1ZRCA 3ABMB 3SH3A 4H7MA 1JJ2U 3W58A 1OHHG 4RA0A 3OMNB 3LB9A 2ZGRA 2Y64A 1RUF1 2Q4PA 4WM8A 5J37A 1DGRN 1XXNA 4W4LA 4X1KA 3WW4A 1OOPB 2HEPA 5LHGA 1N1SA 3UKNA 1QJEA 3KGLA 3FFZA 1JYNA 4HNAA 1G6NA 2JDIG 3MW2A 1H8TC 1MQTA 1SBFA 4OMDA 3NV2A 2A5ZA 5IUQA 3H8OA 1TMF1 3VBSC 2ZCWA 1IG3A 2OPKA 2QTSA 2OW4A 3RN4A 4N7IA 3O0WA 3TEYA 2HWF3 4TXWA 4XPVA 1RXGA 1I5ZA 3NNMA 4YYOA 1WCQA 5A7OA 5LRSA 4EN9B 1RFYA 4TSFG 2XJUA 1KD7A 1GUIA 3L9DA 3WU2Z 4RQPB 2CHHA 1ORQC 4M0NA 5KC5A 2A6YA 1D2DA 1Y9GA 2VR4A 1FXZA 3J8F3 1LEMA 4XDOA 1WLWA 4PIXA 1UMIA 3RI9A 5J2UB 4NE9A 1WLCA 1DQ0A 5EK0A 3U37A 2G9FA 2BGPA 5DUUA 4MYEA 1BEV1 1E5IA 2V7QG 4R4XA 5B1OA 5DMYA 5FCCA 4ZHQA 4FJCC 2ARBA 2XUEA 3RZHA 2WT0A 5L9VA 5A1FA 3HIFA 3WW1A 2F95B 1GR3A 2D43A 4N9HA 3AK1A 3CCJV 4XJUA 1VIWB 2QKAA 4XFBA 3UYJA 4ZHQB 2XGXA 3I49A 1SKVA 4ZPIA 4FT8A 1NH2D 5HFMA 1NTMH 1DTOA 1D0HA 5C71A 4AILC 2ADDA 2DDUA 5C4WA 4BPZA 5JMOA 4DV2O 2DCJA 2FYUH 3A23A 3QCWA 5IJ9B 1NLRA 3QBQA 2K46A 5FZLA 3GCXA 2LGQA 1RUJ3 2BVBA 1VBA1 2GP3A 1NZ6A 4YW6A 2QZ3A 4GH4C 2B8MA 1HB3A 4QKDA 4LKEA 1UYPA 1UZVA 5LGNA 3AC0A 1MZ5A 3SKVA 1L3JA 4FM2A 3P3PA 4CDQA 4QNHB 3ASOC 2O14A 1ZAUA 1S5HC 3OM3B 2RE9A 1V6KA 3EO6A 2XVGA 1IBLB 1PHMA 3I2OA 4KUMA 3S5QA 3S30A 4CU7A 3BKZA 2HBUA 1LNQA 5CFDA 3JASA 4EV0A 4E4SA 5DUXA 1AR1B 2YSUB 2RJ2A 5T55A 2HKOA 5LY2A 5H9PA 3D36C 4Q1RA 2H94A 3J8F2 4B4RA 3QO8A 2BPA2 1D2SA 3N7LA 3O7OA 5EBWC 3N9MA 1KDKA 4UW3A 3NV4A 4O2AA 1I1EA 3NWKA 4O4JB 1F4AA 3TK1A 3WCSA 2JECA 1HRI2 3HKEB 3ZVXA 4K9SA 4CCCA 5JSOA 1MNGA 3MLLA 1QJFA 4F7ZA 4W6YA 3ILRA 3G6EV 2OQ6A 1AILA 1JUIA 1XMQO 4M00A 2CTWA 5DDJ3 3R6SA 1NLSA 1OUXA 2ZXWB 5A2QN 4BQ4A 4A7KA 1R091 5IAVA 3N9QA 1EPWA 3RMXA 1DZRA 4GWIA 1C4RA 4RGGA 3KM5A 4YY3O 3OYWB 3CSXA 3AXDA 3H1KH 1GRJA 1ZZ6A 1FYUA 4DXTA 2JK5C 5HPOA 4Y26A 3VGIA 3PTYA 3FL7A 3O1PA 5LYJA 1YZBA 4P30A 3KWVA 4QB1A 3URFA 1LOGA 3J80N 1GANA 2C6SA 1K7DA 5BMVB 5ABJB 5FP4A 2WNUC 2XL9A 4AW7A 4AFBA 4KWLA 2B7YA 1HRV1 2XB6C 1RXFA 3LNNA 1Y4WA 4Q29A 4K8FA 4YW7A 2CGOA 3VQWA 1EN6A 1D7PM 2NN8A 4TLFA 3VQYA 5AC92 1U5ZA 2QWOB 4KMQA 4CCOA 5CZKA 3A22A 5A3NA 1A8DA 3R4SA 4JGSA 1B35C 1VBC1 2Y6FA 3BTZA 5A32A 3MLKA 3I2HA 4JI2O 3WB2A 2PELA 3AZVA 3UKTA 1KFXL 4L11A 5HV0A 1L8DA 3PLQA 4XW3A 2DFCA 1GM8A 4V2VA 5IK4A 4A41A 2XHBA 1N0JA 1GK9A 3J7HA 3AJYA 5AVAA 5C9AA 4GT1A 2P4KA 2V09A 3WNXA 1HIXA 2B4KA 3UT0A 1K4DC 3WNOA 2RHPA 2JDUA 2GMEA 3BOPA 5IT6A 1LOBA 1PVC3 1U12A 1ZVFA 5FYBA 5DG1A 3VBUA 5L3FA 3APQA 5ACA3 3WQ1A 3W7UA 2MK3A 2I74A 1BMV1 3ACGA 4NOTA 5BNOC 5FO9B 5FYYA 1OCCC 4HN0A 1ND3A 5AC93 4OUSA 5IJ0B 4DR3B 1VJ2A 5FQ0A 1RUC3 2HBTA 2IC1A 2EXIA 4A45A 1VMGA 2ETNA 4DEVA 4QDQA 5CBLA 1ZBA1 1K4CC 1GNYA 4B7EA 2YBKA 1QJU2 5I0SA 4K35A 3V0BA 1QJX2 1RUI2 1UY4A 5EWSA 1XNAA 4DRXB 4HK8A 1YSCA 5BR8B 2CAZC 1PM7A 3RYRA 3ZN0A 3OT7A 4CDWC 1W6PA 2JWPA 1O4YA 2PN5A 2X7RB 3JD0A 2YIAA 3H8XA 1COWG 1QGLA 1NA1C 1EAH2 3B9IA 5BXXA 2P7TC 1NR1A 2BWAA 3GXUA 3FUOA 4R52A 2KB1A 1IS4A 1UCXA 3BHPA 2GC1A 2IXHA 1BLZA 2LFSA 4GYCB 4CP9A 2R6QA 1RUF3 1SLLA 3E8BA 5J2UA 3N2KA 5FFOC 1VALA 3VDDC 2R9AA 2VNOA 1AL23 4X64O 4XQ4A 3VDBA 2IM9A 4HPKB 1DGLA 2LGWA 3SYOA 5H9RA 3ACHA 3LDDA 4CBCA 1FAYA 1ENQA 2EA7A 5LASA 1VBB3 4J9YB 2RS32 4E2GA 2TEPA 3PVEA 4NIAA 4ZS3A 4TN7A 5T54A 4WVZA 4DUYO 4LBQB 2RJKA 1AYN1 2QQKA 1OQDA 1SDWA 4PD4F 2WNOA 4AYUA 1RMU1 3JQWA 5T3NA 4RWUA 2CDPA 5FPZA 1LOFC 1M5IA 3OTFA 3DF0A 3AP4A 3FYIB 2HJDA 1GQHA 3KMHA 1DZTA 1R081 2AHZA 4IGPA 4LBQD 3WNKA 1QXRA 1HJGA 2D93A 1JU4A 1UU6A 2MHFA 4JCKA 2ZX2A 3APBA 1VQ9V 2ZX3A 5F3IA 4AQYO 3AZWA 1O3QA 1SS3A 5LA1A 1KGYA 1N1VA 3OD0A 1IDSA 4HSJA 1I94O 5C3RA 2OQ7A 3UT5A 3KHBA 1I9RA 1ZLZA 5H9QA 2QR4A 3NV1A 4O4LA 4AI0A 4AWDA 1UN1A 3H1YA 4KI5M 2F66C 1R73A 1D0GA 2QFEA 5IFPA 5CA1B 2JD9A 4O4LB 4XYXA 2DV9A 2JGUA 3N2GB 3K77A 3VZOA 1VMJA 1PGW1 1MS3A 1R64A 4WFAV 2A75A 1E5SA 3MUZ1 4JV4A 1CQ9A 1WA8A 3WW3A 2Y26A 2VCCA 2WSUA 2UUCB 3HNYM 1VBD1 2ZHMA 3CRQA 3MO4A 5APAA 4BK4A 1M4UA 1JZ4A 3NAPA 2ZGPA 3OEBA 3POFA 3UK9A 1NOVA 2Q73A 3ZHTA 1ZYBA 1Z78A 1NE6A 1GNHA 1RHI3 1LB2A 4YY3B 1HR0B 1YRZA 1H8EG 3TN91 1GKFA 4LF9O 1ZWIC 3GJBA 2EXJA 2WLJA 2RDSA 5FUNA 3OGSA 3PL0A 4QXCA 2HEVF 3JAKA 1CD3G 5GW7A 3MIDA 1Q8PA 5LBFA 4FFGA 2ZE8A 3E97A 3STZC 2RDQA 5A3TA 2FDGA 3CEWA 1GP4A 5FZ3A 3WNMA 5F1RA 4DR6B 5C3OA 2IZWA 1GV9A 3MIEA 2IH3C 3N9PA 1I5YA 2YFUA 1ULPA 4LUKA 3LQCA 4RGKA 1QR8A 2GC3A 3BI3A 4ABMA 3AVRA 5JR2A 4BWOA 2WZEA 2DUPA 1ZRIA 1N1TA 4JTNA 2UUBB 5F3GA 4LFAO 3KT7A 2VW0A 1CPMA 2GN3A 3TNPB 2GSYA 4DR2O 4LULA 1AR73 5FY8A 2K9PA 1N4CA 5LA9A 3ITQA 3POEA 1N33O 5IFTA 4QPIC 4DRRA 1FFXA 1JYWA 1DGWX 2J1RA 5KR7A 4Z92B 3LSDA 2RR12 1FOD1 1UYXA 2A06H 1Q82W 1EV12 3RSJA 2IJKA 4AVCA 2UWAA 2IVIB 1GN3A 4MXVA 3JALB 3SCFA 1BQ0A 2Y6LA 2QDNA 3EJKA 3O1TA 4C7UA 1XPWA 3PU8A 3LZZA 1T5EA 5JXIA 1EN4A 2XWBB 1R1A2 3DUIA 1UYYA 5EZYB 4X1IB 5FBJA 1LOEA 5IE9A 1LGNA 4CDXA 3WP5A 2LALA 3T0AA 3OF1A 1YJ9V 1OQ1A 3HVDA 4CU8A 3ABKB 1RUD2 3BEHA 4LO8A 4E2QA 3U14A 5FLXN 5JMCA 4Y5SA 2WLKA 4LKSA 1LULA 4QPGA 3SITA 1VP6A 5CBGA 4CUBA 4RQEA 5A33A 3B02A 1S55A 3M7AA 2UWCA 4Q0UA 3JASB 4UB6Z 2BGCA 1CAWA 3BN6A 4LKFA 1GZWA 5FR3A 4TOIA 1W9FA 2A71A 1VBE2 1SQPH 4E2SA 1NY72 1GZWB 1CN1A 2D6NA 4IV3C 2ZOEB 1C8M2 2Z79A 1J95A 3VOUA 1UQXA 5B1NA 4NHKA 2EIJC 2VZUA 5CVRA 4P2ZA 3IIAA 5IK8A 1VBC3 1DF0A 4EWEA 2UUAB 4CA9A 3I2GA 4ORFA 4XUPA 5K0UC 3CCQV 2FMLA 4LBNA 1GP5A 1NAEA 4CS3A 5FYSA 4F4LA 4P5HA 3I3QA 4XJ8A 3OD4A 3W59A 4XBNA 4W4KA 4FOQA 2VL4A 4GD4A 3JBG3 2UYBA 3CL1A 5F2VO 1O3TA 2GMMA 2CAUA 3DSQA 3JSLA 2PYTA 4WFEA 1XBFA 3AMHA 3I97A 2F4LA 3ZLIA 2Q67A 1NA1B 3SJQC 4LBMA 4X65O 4IHJB 3WG7C 2Q5TA 4UYBA 3O1MA 1QF3A 3K04A 1RITA 4UI9L 5KA5A 4DUYB 3HNMA 1N36B 1X4TA 1LENA 2EX3A 2JDPA 3FKSG 1NZCA 2XJQA 2DCKA 4FAHA 1G9DA 4JV5O 4ISQA 3SC7X 2P2KA 3FX3A 3VL8A 2CNAA 2H0BA 1RUC1 1L7QA 1F9KA 3P32A 4UAPA 4I7ZB 3E5XA 2ZEZA 5T50A 4CE8A 4P9OA 3KZ4C 2FZ1A 3WFVA 1G8WA 1CAUB 2AHYA 3RFRA 4CDUA 1P4RA 4GX1A 1ASJ3 2K2SA 3E89A 3LDCA 4J9ZB 1NQDA 2PLV3 4RUFA 3JARA 4IYIA 1QQP3 1YJLA 3LD8A 2A79B 1UZ0A 1F35A 3ABUA 4GX0A 2LS6A 5CA6A 4UT5A 1W2NA 2Y6KA 4H0LB 1GMMA 3M3CA 2Q30A 4AFMA 5JPNB 1VBE1 4PDWA 4X9QA 1BEV3 1W8WA 4UCTA 1RVF1 1PP9H 2ZA9A 2KSDA 2SLIA 4E27A 3UKVA 2W92A 2UXBB 4BU2A 3OMIB 3ICXA 1IVSA 2WWSA 5FY1A 1FS0G 4COVA 1NVPB 2Q1ZB 1T6GC 1SG3A 1DP0A 1BBT1 5J7MA 3IB3A 1IBMB 2R071 1Y43B 4WZFA 5H6RA 5DABA 3OUJA 2R0HA 3KB5A 5FL7G 4I0WB 2WT2A 5C5UA 1RB8G 3NNJA 1PM9A 1FPN3 2D3SA 3SPCA 4XFCA 3HR0A 1H8TA 1FX5A 3ABZA 1O9HA 4TWKA 1ULEA 5EQUA 1VBA3 1UZWA 2RQ6A 4KH9A 1GAXA 5B1AC 1RVF3 1Q86W 3A7QA 2YBSA 3IWZA 2NZ9A 3LOBA 1NU1H 1XNCA 4BK5A 2XHKA 3OBTA 3SNMA 3ZYHA 1TUBA 4CZZA 4K0KB 1W8FA 1ZBE2 2WLIB 2MW2B 5D2AA 2Y69C 4YIOA 4JI3B 1DG6A 3VBHB 3DPRC 3ZR5A 2PHWA 4FPFA 4EB6A 3NSTA 3WEZA 4N53A 2ZKNA 3CJHA 4NIGA 4JTAB 3HKCA 5HFLA 4JYBA 4JDMA 3IPVA 4R9BA 4KGQA 1C8NA 1XMOB 5FPUA 4NVPA 4U3FH 2VQTA 3N36A 3ZJZA 3VBUB 4O4JA 1JQ0A 5ABJA 2ET7A 2VMGA 3ZIXA 4LBKA 4HT1T 1F7YA 4UFMA 1Y67A 2VH9A 5CFCB 2E75B 1GZCA 1R083 2FCTA 3CDZB 1E79G 4CUAA 2PHLA 3I55V 2YC2A 2EBOA 4DR2B 3FBYA 1QEXA 2QNKA 3I54A 3VBUC 2RJLA 2BTQB 1OQEA 5FPRA 1S0JA 1AYN2 4M4RA 4ZBMA 4UBGA 3OUSA 5EYXA 4JGYA 2RMU3 1VRH3 4JGYC 4QKBA 3MV11 3MHHC 4PQQA 2EIKB 4OHWA 2QWRB 4RD7A 2HJIA 5A70A 5FJKA 3MW3A 1PNKA 1PZ7A 2ZGLA 3FHQA 4KFMA 3G6JB 2GC0A 1BJQA 2VJXA 2ZJCA 1PNLA 3TWIA 1Q5OA 2DW4A 4IQPA 1DBNA 2DVDA 3SCHA 5JPMB 4BW5A 5EPAA 1BK0A 5GONB 5IT9N 3OFNG 1PD3A 4Y20B 3TJTA 2E63A 4CEYC 5TISZ 2W46A 4I3GA 4MH0E 1V6IA 2JGDB 4LIUA 3ZRXA 4MHUA 1UY2A 3B69A 1CJDA 4JTDB 3CF6E 1MZFA 1SRYA 3PDQA 3P5BA 3AL6A 3ZMUA 5H9SA 1HRV3 4MTGA 4JKMA 2VNVA 2GUZB 1DU3D 1RUH1 2R72A 5FLIA 2LW1A 3LIHA 1NXMA 5CNAA 1N1YA 2XWJB 4UFLA 2YUAA 4NYKA 3M8LA 1G9FA 4P9YA 4ITCA 4QQOA 1R093 4IERA 2FL4A 4H2AA 1Q6HA 4BIZA 3GCWA 5FV3A 3ATGA 4CCKA 4E8DA 1EAH3 1MS4A 2W0XA 4AFAA 1O4TA 1LOAA 5FZGA 3MFAA 1VMHA 2XJSA 3W7SA 2RNBA 4ATEA 4YW1A 3JYCA 1XSQA 4OZOA 3T2TA 5J3UA 4EN0A 3A4UA 1W6QA 1UZYA 1I6XA 2P4VA 3WY6A 3A0HZ 1LR5A 2RR11 1O8SA 3EBRA 1HV0A 4LORA 2ITCC 1CXZB 1WCUA 3ZIWA 3H3LA 1YUDA 3O65A 4A3XA 5HCFA 5E88A 5FY5A 3OAAG 4IV1A 3E22A 4COZA 1ZTEA 4PDWC 2GC2A 1ZZ8A 3ZM8A 4JZRA 1W06A 3HAGA 1NZIA 3KZIZ 4FI9A 1KFUL 3AFKA 3I5DA 4QXBA 1O5UA 1XE0A 4XXAA 4O61A 3BALA 4YJ3B 2XJVA 1KKCA 1KD1W 3ZYJB 4M4PA 5CB4B 1B35B 2YEVA 1AROP 4Z2AA 2HWB1 4DO0A 4QPYA 2PQSA 4BQ1A 1AYM3 2R043 2EVXA 5I93A 4R7CA 3VHOA 4PBOA 2PHXA 2XLAA 3FB8C 3BU0A 4KQ7A 2NR5A 2GU9A 3M3OA 4Q0PA 4UCRA 1ENVA 3RZGA 1CONA 4CEWC 3K0GA 2X10A 5T52A 3E22B 2CSGA 1C8M3 1FXKA 2E9QA 2QKSA 3ZN1A 2C0ZA 1QXJA 3UV9A 4YIPA 4UVCA 5E16A 3CCEV 5GZCA 1MQTB 5GM0A 1Y3TA 4B3MB 4FFBB 2VCMA 4AVBA 1CIWA 4X20B 3J7MA 5EZWA 1YQ8A 2EILB 2G9ZA 2ZX0A 2IJHA 1DLCA 3VBBA 3KF5A 4CTEA 5ISLA 1CEZA 2Y6GA 2F17A 1XC6A 4XF1A 4RQFA 1MVEA 1CZSA 3LPFA 1Z5VA 3NO8A 3ZYGA 4K7JA 1VAKA 5FPLA 5KHGA 1PMJX 4QKFA 3HN3A 5LWBA 5JJNB 4XQDA 5F9TA 5FZ0A 3ACIA 4J41A 2ODMA 1AJOA 4RS5C 2JG9C 1DHKB 4P9IA 2H6BA 3ZMTA 3VBRB 4K1ZA 1MS1A 3WF3A 2BOCC 2PGGA 3V56A 2XTAA 2IWGB 5JXGA 1ASJ1 4X88A 3B2EE 2F4PA 1LAJA 4BLIA 1BGYH 1XYNA 4XBFA 5CG8A 2CU5A 1QJY3 3VKNA 5L3CA 1R1A3 4X66B 4BMBA 1YIPA 5FYZA 2NQYA 2JDKA 3POWA 1URXA 2N04A 4DUWA 2EAKA 3G7DA 4GAZA 2O8OA 5L7OA 4XE9A 3B94A 4ZXKA