2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
4MGZE 1H1IA 5I8SA 5J3UA 3FE5A 1V70A 3NJZA 2GC0A 5LRRA 4E2SA 2F4PA 4XF4A 1X7NA 4N9HA 4ORFA 4UXAA 4Q0UA 2GC1A 5E1RA 5KHJA 2UY8A 5JR7B 4LA3A 4IEVA 4HVQA 4XETA 2PFWA 1CX4A 1Y3TA 1J1LA 3B02A 2WFPA 3EBRA 2Q0AA 2QDRA 3JZVA 4UBHA 1RL3A 1ZREA 4O9GA 1OI6A 1RC6A 3OF1A 2PHDA 2BNOA 1GQHA 3GYDA 3D82A 1EY2A 1WLTA 2QJVA 4LUMA 2PYTA 3H7YA 1J3PA 1YFUA 4KU8A 2IXIA 4ONUA 4FAGA 2OYZA 2XKOA 1I6XA 2Y0OA 3ES4A 4ZU7A 3U0ZA 4JVAA 4JV4A 5KHIA 3LOIA 1G6NA 3HQXA 2GZWA 2O8QA 2D5HA 3ELNA 4PJYA 5BPXA 3WW3A 3BU7A 4RD7A 4YNIA 1XRUA 4PIZA 4AVBA 3MDPA 2XL9A 3M3IA 2ET7A 2CGPA 3I59A 5FDBA 3TNQA 4QXKA 4H7LA 1RUNA 1O3RA 1Q3EA 5BY5A 5I0TA 4EV0A 1ZZCA 4LULA 4ZU4A 1NE4A 4I0AA 3IIAA 4Q29A 3LZZA 1RUOA 4KU7A 1CGPA 4D7SA 4XFIA 4Z82A 1GQGA 4AVAA 1FXZA 4IEUA 4FAHA 2XGXA 5BUVA 5CADA 3IDBB 2QNKA 5I93A 3FWEA 3DV8A 4I0BA 4IEQA 3IWZA 3EHKA 3OTFA 1VR3A 2B9UA 2HKXA 3EQEA 4LTAA 4Z07A 4QM8A 3PLQA 2GC2A 3RYRA 4XEZA 1UW8A 4I2OA 4IERA 2FMYA 4XFCA 4MGKE 2BNMA 4LA2A 1DGRA 1H1MA 2D5FA 4JTNA 2VQAA 3QACA 4FBFA 4HBNA 2OZJA 2CAUA 5C6CA 4Q0PA 4BIFA 4HVOA 5CVRA 1CAXA 1O5LA 2HJIA 4YARA 4I02A 5FPZA 3SCGA 4JTOA 3HT1A 3KCCA 4NVPA 3S0MA 2B5HA 2GC3A 3FJSA 4GULA 4QX5A 3E6BA 5I8TA 2EAAA 4BYYA 4IETA 3SCHA 4HZFA 3UKNA 1FI2A 2VPVA 3FX3A 5FLJA 4META 3GBFA 1VJ2A 4O9EA 3ZDSA 2Z69A 2BYVE 2Z2SB 3CF6E 1I5ZA 1RTVA 1DZRA 3BPZA 4IEZA 1YLLA 3NW4A 4OFGA 2Q4SA 1QXRA 4IEYA 1ZZ8A 5I8YA 3O14A 2D40A 4E2QA 2P17A 1ZRDA 1LRHA 4R52A 2QVSB 1UCXA 4F7ZA 4XFGA 2ET1A 2PAEA 4QMAA 1VP6A 2XLFA 4XFAA 4FT8A 1YUDA 1ZZ7A 2PAKA 3ES1A 3SCFA 4CYDA 5EFUA 3RYKA 4YYOA 2N7GA 2H0VA 4HN1A 3FFQA 4P9GA 3H1WA 4BH9A 1ZZ9A 4OLLA 4PIXA 2XHKA 3LA2A 3NVCA 1O5UA 3KGLA 1IPJA 2CAVA 1YHFA 3VHRA 1L3JA 3UKTA 4WVZA 1EPZA 1O4TA 1ZVFA 3CEWA 3WW4A 3D0JA 2IXCA 1CAVB 1IPKA 1CAWA 3RDIA 1ZZ6A 4QGMA 5CU1A 2BGCA 1Y9QA 5I0UA 5I91A 1NYWA 5I0RA 1QWRA 1CAWB 3U11A 1SQ4A 3E97A 2GU9A 2MNGA 3KMHA 5FQ0B 4N9IA 4QM9A 3I54A 2IXKA 1O3SA 2ETEA 5FQ0A 3S7IA 2IXJA 3CJXA 5HI0A 3L2HA 4MV2A 1X8EA 1CAVA 5FPXA 2ZCWA 4EWDA 4K8FA 4X6QB 4WZCA 3OCPA 1X82A 4I01A 2I45A 2Q30A 4YSFA 3E5UA 5F1RA 3RNSA 4MGYE 5KHHA 2IC1A 1YWKA 2K9ZA 4L2NA 4XFHA 2PTMA 4AQ6A 3EJKA 5JAXA 1OD5A 1ZZBA 5JCTA 1NE6A 1EP0A 3N4MA 2WC2A 3S7EA 3UKVA 2MPFA 4MGIE 2MHFA 4Q0QA 3H1MA 2K0GA 3CLPA 5JSPA 2Q1ZB 4XF3A 1PMIA 2KXLA 1X8MA 2C0ZA 5LEJA 4MZUA 4KWLA 4IEPA 5J48A 3NSTA 5KHKA 1ZX5A 3ST7A 4EROA 5KBFA 2PAMA 3NKTA 3RZZA 3HIFA 3H3UA 4XF0A 5KHGA 3PVBB 1CAUA 4F8AA 4KWKA 1J59A 5LEKA 1WA4A 2D93A 1WGPA 5AVPA 4WBBA 2IXLA 3WW1A 4XF1A 2XKPA 4AXOA 1CAUB 3E5QA 4IEXA 4QGLA 2GAUA 4X6RB 4IEWA 3IDCB 3ACLA 3PNAA 4D7TA 1XE7A 4EWAA 3ETQA 1PM7A 3OD0A 1SEFA 4XFFA 1LB2A 1SFNA 3DN7A 3FHIB 4J1XA 1JUHA 3G7DA 4QGNA 3IBMA 2BEOA 2VECA 1FT9A 3H50A 3I59B 3E6DA 4KL1A 1UPIA 3H1YA 5FLHA 5I0SA 3I7DA 4LUKA 1LKNA 1J3RA 1NZCA 4A2UA 3MPBA 3HT2A 1ZRCA 2XLAA 4AVCA 2OPKA 3USSA 2OZ6A 5K8SA 4XF9A 1UIKA 3EO6A 4XFBA 4Q0SA 1Q5OA 4AQ2A 1UIJA 5E16A 4MUVA 2BNNA 4I09A 2PA7A 1YFYA 2IXHA 5BXXA 2H6BA 1J3QA 3FZ3A 3NL1A 1ZNPA 4PIYA 4L11A 3DL3A 3CL1A 3E6CC 3H8UA 4EWEA 4B29A 1DGWA 1ZRRA 2DCTA 4I3PA 3BALA 5J7MA 2PQQA 3MZHA 3M70A 3H3ZA 4HLTA 3RYPA 4KWJA 2O1QA 1OFNA 3BCWA 2XL7A 3KSCA 4IEOA 4HVRA 2CV6A 5JSOA 4MX3A 1O3TA 1J58A 3ROUA 1NXMA 2PHLA 1U12A 5FLIA 4MH0E 4R8HA 1TQ5A 3LA3A 3WW2A 2QCSB 3SHRA 1O3QA 4DINB 4YRDA 5JSRA 4TLFA 4HMZA 1HW5A 2EA7A 1YFXA 2XLGA 4HSLA 1ZRFA 3KGZA 1O7FA 3U10A 2FQPA 4E2GA 2E9QA 3SXWA 1XE8A 5T3NA 2H6CA 4Q0VA 5D1IA 1UD1A 1OMIA 2B8MA 2OA2A 2UY9A 1QY4A 1YFWA 1CAXB 2UYAA 1Q43A 4UBGA 5C8WA 3RPQA 3D0SA 4J1WA 3H7JA 1EYBA 4LEJA 4LLOA 2EVXA 2GH2A 5FCCA 5LRSA 3TNPB 3LA7A 3LWCA 3E5XA 1RGSA 3DKWA 1QXJA 3LAGA 3SMHA 5BV6A 2V09A 5EZWA 2UYBA 4HN0A 3H9AA 3MYXA 2ATFA 4ZU5A 3C3VA 1DZTA 4HSJA 3QOPA 1LR5A 3OGJA 4IESA 2ZKLA 3BB6A 3R6SA 4BHPA 3CO2A
chains in the Genus database with same CATH superfamily
4MGZE 3L2YA 2GC0A 4EN0A 4O2BB 5AC93 4Q27A 3WP6A 1SG3A 4UW4A 1DTOA 4Q4Y2 4FIPC 1WWYA 4U36A 1XEQA 3QBQA 2FDJA 4O9GA 1OI6A 3CCVV 2PHDA 2R071 5JXIA 4L92A 5E89A 5DZGA 4PI0A 4PT6A 3VQWA 4ONUA 2WO2A 1HQLA 1W9YA 4Y24A 4PQQA 5FZ9A 3MW4A 2Q73A 3ES4A 4JQRA 4W4ZA 3ZFGC 5LBCA 3I3QA 3OGSA 5KHIA 4DV6B 5F2WA 5FYYA 1XBFA 1EN6A 3HQXA 1RUJ1 3R4UA 3WW3A 4JDMA 3H1IH 4XQDA 5IYBO 1Q6IA 1ASJ1 5F8PA 2ZJCA 5DUXA 3I59A 1PK6A 2BOCC 5LGUA 1RUE2 3ILRA 2GNTA 1DGLA 4BZ4A 3R66A 4WBNA 1W0NA 3AMNA 2M7WA 1PVC3 2DCJA 1GV9A 1GLHA 3LEIA 3WEZA 4XEZA 5FL7G 4PA4A 4E8CA 3APOA 1R3LC 3VDDC 1JFFA 1FMD3 1WJZA 4XJUA 2CE4A 3P6BA 4LBQA 2D5FA 3RGBA 3CWBH 4MG2A 1UOJA 1E79G 4Q0PA 4XJ9A 4DV2B 5D8AB 3W20A 3RQ0A 4JX0A 1JXNA 2QDNA 4LO8A 4P9OA 3SYQA 1MSWD 2PUSA 1QXPA 4JASA 4P9WA 2VQTA 1R092 3FX3A 3SKVA 4GWNA 4BCUA 4P9LA 1BBT1 1I5ZA 2D6OX 2DV9A 4AI9A 3K3WA 4MVOA 1RHI3 4F3JA 2VG9A 2P17A 3BA9A 3A0NA 2ORXA 1VQPV 2ZGQA 1UZYA 4UF0B 2YC0A 5GJ6A 4FPEA 3FFQA 2VXRA 2JIZG 5ANNA 1WCDJ 2DJVA 2JIGA 2XTAA 3W7SA 5BNNA 4YWAA 2AZ5A 4WVZA 3CEWA 2A7WA 2W2IA 1E5RA 5LA6A 3LOBA 5FZMA 5I0RA 4MO3M 2ZAHA 4HFSA 2EZPA 2KM2A 3ZHUA 4AEDB 3F7VC 1UWWA 2IUWA 5C7GA 3NJYA 1D4M3 5FQ0A 1ENVA 1O9GA 2B4KA 5LBEA 4WM8A 2WABA 3IJ4A 2LQTA 1X33A 1LUVA 3AKQA 4GWMA 4C90A 4MXWA 3IKWA 3RNSA 1BQPA 5FXVA 1HR0B 5LOVA 3AP4A 3UGHA 2DF7A 1YSCA 4O4HB 1NVPB 4ET7A 1PO13 5LEJA 4DUVA 3NSTA 4WFFA 4JTCB 1K8AW 3J80N 2FCUA 5DG1A 2VZRA 3ZFGB 1MEC2 4WBBA 3P32A 4CVUA 2IXLA 4ZKTB 2A75A 3ECQA 5A32B 3J7AU 4GX1A 4UCSA 3FB5C 1YCIA 1YDXA 4EWAA 5FY1A 1PPJH 3K0DA 2AW9A 4LK7A 4QQPA 4ES8A 3R4DB 1F5JA 4P9IA 5FO7B 3FAVB 4LUKA 2ITCC 4FVMA 1XILA 2VVFA 1XJAA 1V9U1 1IDSA 2A5ZA 4JTDB 5K7PA 3ZPOA 3BUCA 2DBNA 2WNUA 3HN1A 2YFUA 2HH9A 4ZOLA 1US6A 1U96A 4YGEA 5LBFA 4FM2A 4Q20A 5BNQA 3ABMB 4QPIA 2JDZA 1Q8SA 2AENA 3ZR6A 5IJ0A 4PI2A 4CP2A 3ASNB 2WS93 1GN4A 1O59A 3A22A 4MVSA 3N27A 4B3MB 3IB3A 2CV6A 4HKWA 4CDUC 3A8TA 1MS3A 5IVBA 2QKSA 5CB7A 1YQ8A 4HMZA 3DECA 4HAMA 1FXHA 3FL7A 1GR3A 2X6AA 3KGZA 3SXWA 5FBJA 5KX5A 1PD3A 2CH7B 1OOPA 3MICA 3PVEA 2Y4UA 4COVA 2JG9B 2PI5A 1Q43A 5C8WA 3OEBA 4RUEA 1HJFA 2BSKA 5IT6A 1ZYBA 4OVEA 3LA7A 1HB4A 1SESA 3O65A 2JS5A 3VDDB 2ZGRA 3MYXA 3FX7A 2A6WA 4MGQA 4CP0A 2WO3A 4YJ2B 4QPJA 1N36B 1P8JA 3R6SA 1NKGA 3CP1A 4RS5B 1U5XA 2HWC3 4UXAA 4Q0UA 4IEVA 2DTWA 3GF6A 2D6LX 4NIHA 4LOSA 3M8LA 4QU2A 4H3WA 2VOWA 3ZXKA 4UW3A 1W2TA 4R6ZA 1CJPA 2XHBA 3O1TA 4OZXA 1RVF1 1D0GA 1B35B 1GBGA 4DXRA 2IXIA 3FB7C 1UXZA 5H9SA 3OUSA 4O4JA 4ISRA 3BHPA 3CJIB 1Q8IA 4QPGC 3I3EA 4ZZ5A 2EZOA 1IOAA 1D4M1 5A3NA 3BU7A 2LM3A 3ZHTA 4PDRA 4EN9B 3BAAA 4BIUA 3MIFA 1F8VA 5A33B 1IQDC 1FNZA 4QHBA 2CTQA 1S0CA 3LZZA 5DDJ1 2W92A 2ZS6B 4FLZA 1RUG1 1MZ6A 1KYOF 4QT6A 3WNMA 3W7UA 2MEV3 3C7OA 4OMDA 2RJZA 1YO8A 3CEIA 1ZBE3 2WR9A 2FZ1A 2X6CA 4NTYA 1NQTA 5A3LA 1QJX2 1SZBA 2ZGLA 3N7MA 3P3NA 1SETA 4WM8C 5FMOL 2H0BA 3RYFA 1HRV3 3C7GA 4NVPA 1J95A 5J37A 3VBRA 3ACGA 5H5NA 1VRH1 4BYYA 4UWDA 1Q56A 2LGWA 4DPNA 2WZR1 3MBWA 3ZFFA 3MEPA 5C71A 1RTVA 2XBO1 5KXDA 3CKHA 5BNPC 5KMGA 4JCKA 2D40A 5F2VO 2BCCH 2QVSB 3LSDA 3ILNA 1DHKB 1G9BA 2DVDA 2RR11 1NTKH 3DC6A 2AHZA 2ZBJA 3WZ1A 3X2QB 5CAZA 1HB2A 2VMHA 4OLLA 2VUCA 3ZYIB 1I3HA 3WG1A 1CESA 2D3SA 1Q82W 1RM1B 1RMU3 5FREA 3C7FA 1WW5A 1CAWA 3AM2A 3AX4A 3TEZA 2V72A 3H3LA 5I0UA 2QFEA 2ZKNA 2YZ4A 5JVDA 2MNGA 1GMMA 3K75B 4GLXA 4QM9A 2R043 2GUZA 3ZIAG 3HVDA 4XZPA 2A6XA 1QU0A 5IYYA 4NTWA 5E6HA 1N3QA 4XXPA 3OCPA 1QR8A 2ZE5A 4CP9A 2CWSA 4WF9V 5KHHA 4Q4Y1 3VQYA 5IE9A 1YQCA 3G67A 1DGRN 5JAXA 1OD5A 4TV9A 2VNRA 1PNFA 1E57A 3E8GA 2EIGA 2OTLV 1X4TA 4JKKA 5FPOA 1XMOO 5DAVA 2CAZC 5TISZ 4IV3A 2OX0A 3AG7A 3JAWB 1NZ6A 4ZONA 2CY6A 2JG9C 5IWAB 5FKCA 4MW8A 4AVVA 3F5TA 1JTZX 4UYBA 1QBZA 3BU0A 1AI6A 4DR4O 3CRQA 1G1XB 5ABJB 2XAFA 2P5OA 1JUHA 4OZOA 2VECA 1GWMA 1VQ4V 2CNAA 4QQ2A 5IYCO 1WPBA 1UOBA 1JZ2A 4U7OA 4Q4X3 2GHYA 4CP9B 3LDKA 4OI0A 4CEWB 1RJ8A 2LW1A 4IV1C 4YM3A 1FPOA 2PA7A 1S4CA 4JI6O 3NL1A 1DDLA 1DK1A 1SBFA 5A3PA 3I97A 3VBFC 2HYKA 4AFMA 1YHQV 1M57C 5LA1A 3MZHA 3DYOA 3AZVA 4CH3A 4JI4B 4DO2A 1IHMA 2QQWA 4JYAB 4QU1A 4QPGB 3AG4C 2WKKA 3OGCC 1CN1A 3VDDA 4IGQA 3KV9A 3PL0A 4FLTA 1W6NA 4ASLA 1JI6A 4LHNA 4YVWB 2QWPB 5ISLA 3THOA 3CHXA 1JFFB 4DR2B 4AWDA 1OMIA 4YM0A 3DYMA 4DUYO 3URFA 1J5EB 4UBGA 5JOZA 2XJPA 5FUIA 1URXA 2AH2A 4R9DA 1Z2GA 3H8XA 1UX7A 3CMGA 2XJRA 1GWKA 1MZEA 1H2LA 3QLQA 1WP8A 1COV2 1KJRA 5FTTC 3BVCA 4NE9A 5CMUA 5EZWA 2K2SA 3RJ2X 2TUNA 1OQ1A 5JPNB 1BK1A 2X6BA 1L0LH 4YW2A 2DFBA 5FFOC 2VOTA 1OHHG 3FN9A 2OQ6A 2W9XA 1L7RA 4ZXEA 3VD4A 3APQA 4E2SA 4XF4A 3ZYPA 3HNMA 5T5LA 1SQFA 1AR92 1L1FA 3PU8A 3EBRA 5FYSA 1MSDA 1TME1 3TJTA 1ZREA 2W94A 3AC0A 3NWKA 1BL8A 5FYZA 2QTWB 1M5IA 2XONA 3H7YA 3USUA 1QQCA 2ZR3A 2OYZA 3ABKC 1FOD1 4PDVA 4CUGA 1YQ6A 2P90A 2XOMA 5BPXA 2VNGA 4AVBA 4W50A 2GUZB 1RM1C 2XL9A 1ND3C 4RHV2 1XSQA 4Q1PA 1QJY1 4B3SB 4K7JA 1SA0A 2CDOA 4JHTA 3WF0A 4KBZA 3IIAA 2BGPA 3D6EA 1GQGA 2QE3A 4RO2A 3WDWA 2HP8A 1W2OA 2DUPA 3FWEA 2CDYA 3RFRA 3RYRA 2PZSA 2VW2A 2W1QA 3THPA 4HPKA 3ALQA 4MGKE 1AP6A 4LA2A 5LP6A 1AI7A 4JTNA 2HWB1 4Q4V3 5K9YA 2CK3G 1UZVA 1M06G 4BIFA 2AC1A 1R093 1NCRC 4DV0B 4E8DA 5FPZA 2OVUA 1YJ9V 4J80A 2NQYA 3DGEA 1LNSA 4P30A 2BV4A 4S2HA 1M57B 2EAAA 4QQHA 2Z5UA 1CR7A 4WVWA 3FLPA 4LXLA 2PHUA 3ZDSA 4Z1MG 2K1EA 2RN9A 4JGZA 4IEZA 5E79Z 1U5YA 2FKXA 2ZZQA 3N35A 2YB7A 3AP5A 2YI9A 3N2KA 2YIBA 4R52A 2R0FA 1US2A 5GLWA 4D7YA 1VP6A 1S0GA 2XLFA 4IL6Z 1S76D 1IBLO 1YUDA 3J7LA 2W08A 1K34A 4CXYA 4NO4A 3MUZ1 1PVXA 1QDOA 5B2GB 1T6GC 2PLV1 4AGVA 1SQXH 2RG4A 5FZCA 2R062 3B4SA 2P5BA 2Y8KA 2BTQA 3HNBM 1BYHA 3JD73 4JGZB 5I91A 1Y74B 1RMU2 3GHNA 2JECA 3LSSA 1UOFA 3KT1A 4ISQA 1VQ5V 3VZOA 3R4SA 1PGSA 3T1HO 3MF6A 2R72A 2JD4A 5FJKA 3L2HA 3OG2A 4FPJA 5FP3A 3QF7A 5FAXA 2UUAO 1K45A 1W0KG 1WPXA 2D6KA 2R042 4ZS3A 4AHWA 2PHRA 4B3RO 2D6PA 3MHZA 4XOGA 2PGGA 4HK9A 5EC2C 3JYCA 1M56B 2PTMA 5ERLA 2LFRA 1J83A 4LBKA 3KCXA 2ZIOA 4NWWA 3H1MA 1F4HA 4CCEA 4OUMA 1HDJA 5JH7A 4IHJB 1D2SA 2Q1ZB 5A7PA 3I2DA 2YXYA 4A6SA 4DXZA 5LL6Y 4NB5A 1N1TA 4X1YB 2W39A 3MIEA 3HKDA 2JIJA 2PAMA 1YXBA 2XBO2 1F7YA 4AQYO 1WMEA 2F6BA 3PVBB 1BVP1 3OUHA 1XNBA 4F4LA 1W8WA 4AXOA 1HNZB 2G9GA 4W8JA 3WG7C 5EXOA 1LB2A 3FHIB 1PV0A 1IS3A 3ZMZA 3EVKA 4J42A 3H1YA 3SJAC 2UURA 5FLHA 3O12A 3MPBA 3VBRC 2JGUA 3OT7A 5JDBA 3USSA 5KC5A 5F5AA 4K20A 1I1EA 2LW7A 1R1BA 1FYUA 2ZCEA 1KU9A 2JB4A 3DPRB 1NCQC 2JEUA 5EYPB 3JARB 2QM8A 1Q6UA 3POGA 2AHYA 3DC5A 5A1FA 3VBUC 2CUGA 5GM0A 2E5LB 3LF7A 2Y6KA 1K5JA 1AYN1 1RUJ3 4LF4B 2PLV3 5BYNA 5JSRA 4RGAA 3ETPA 4HANA 3S3WA 2Y6JA 4X64O 3B3QE 4E2GA 1PO11 1DU3D 5DUWA 4DIQA 3K59A 3ETDA 1JZ6A 2EIBA 4Y1YA 2RR13 5FPLA 4LEJA 1E5IA 4W4KA 3TNPB 2XXZA 5J9PC 2ZABA 3R0RA 2OIIA 2WDBA 2WZR3 1VP7A 1QXJA 5CIRA 1BHGA 3SH3A 4LF9O 2Q8CA 1VRBA 2C1FA 2YY1A 2DWRA 5J3UA 3O1PA 1VIBA 5AVAA 1W2AX 2EIKC 2DWEC 3V0AA 1ALYA 3WFVA 4I30A 2P1BA 2PFWA 3T08A 2WFF1 1HRI1 1LOEA 2R1DA 2QJVA 2H94A 2JDKA 4JAAA 4PHZA 1VBA3 1NAEA 4F6RB 4MXVA 1I6XA 2ZGPA 4CSWA 1C8M1 1BMFG 3FLRA 4EB6A 2HHHB 1BCCH 1Y67A 2RNBA 1L7LA 5FP4A 4BK5A 1AR5A 1K33A 4O4LB 2IW5A 5J2UB 1KKCA 4AE2A 3GM8A 1TGOA 2V5YA 2D3PA 5LMNB 2DTYA 4MSVA 1Q3EA 4GWIA 1AR73 4OYUA 5A3MA 4XQWA 4XJAA 4DV7O 3IGAC 1AP5A 4IEUA 1R6TA 1WD3A 2AR6A 1GQPA 3RW0A 1RUC3 5L9RA 3NV2A 4QM8A 3POYA 2Q0OC 4NYKA 4XFCA 4ASUG 5CG9A 3ZHQA 4Q5OA 1AYN2 3K5LA 1DGRA 4EFEA 3IC9A 3SITA 2Q68A 2OZJA 4NHLA 3AMMA 4PV1B 2A3WA 1MQTB 2X8KA 2VVDA 2NLRA 3SCGA 1AR93 4O2BA 3VKLA 4GALA 2UXNA 4X88A 1IBLB 4HZFA 1VMFA 2VPVA 1UMHA 4LPLA 4LF7O 5EYPA 2FDIA 4GKJB 2ADEA 2ZAAA 3VD7A 2BBVA 1QHTA 2PYLA 2JWPA 4A5UB 2YSUB 5CBFA 1KFUL 1HXS3 5DZEA 1XC6A 2XJVA 4QMAA 3WNXA 4UFIA 3CSXA 4HT1T 2ES3A 1PIV1 5CFCC 5L73A 1L8DA 2DYSB 3JBG1 3AZXA 3HOBA 3H42B 2OT7A 4MLOA 2XWBB 3VZKA 1KEXA 4QGPA 4Q8KA 3WQ1A 1QJY3 3BODA 4CC6A 2IXCA 2RS12 3VB9A 3ZLIA 3AP9A 1NU1H 1RUE1 4RS5A 2ZMLA 4OMCA 2IJIA 1W6QA 4LBEC 3ORJA 5C8YA 4MVUA 4GMP0 1O3SA 5HCAA 2F4VO 2A6VA 2VM9A 1VBD2 2HLDG 4MV2A 1RVF3 1K97A 3A2FA 4WM7C 3SQOA 3OGIB 1YF2A 3OY8B 3C2UA 2VTXA 2ZQMA 2IM9A 1MA1A 1PVC2 5KMGB 3EMRA 1MNGA 5BR8O 4XPVA 5FUNA 1OF3A 1KFXL 3K79A 4LF6B 1NCRB 1ZAUA 4PBOA 1PMIA 2ZX3A 4XUPA 2X53S 3G6EV 3WNKA 3JB4C 3ILFA 1AJKA 4ASKA 1H6XA 4NRMA 3U4XA 3CJHB 2FTKA 1CAUA 1POV0 3ZFEB 3OJBA 1RUH1 3LNNA 1VBB2 5FZ3A 4FVVA 1Y74A 4YHHB 3BTYA 4JZGA 5JJNB 4JQTA 1KECA 4J1XA 1CIYA 5CNAA 5CB4A 2GDSA 1NCRA 4O2AA 4CH4A 1TME2 2QSAA 5FWEA 3O0XA 3DKQA 2KSDA 4SLIA 4CDQB 1VMJA 3CCUV 2OZ6A 3NAPC 5AFEA 4FPOB 3EO6A 1MS9A 3UT5B 4AFAA 1LULA 4QB1A 4CH6A 1LOFA 4MUVA 1IBMO 2VNOA 2L9LA 4NPLA 5JMOA 3VV1A 4MTXA 1GZWB 2QWOB 1C28A 1HV1A 2ZNJA 1KBHA 1WA8A 2R7EB 1WCKA 2V4AA 2PHTA 3O5SA 4EN7B 4UFMA 1XBLA 4AHXA 1AYM2 3K51A 1VQKV 4NMIA 3GJBA 5DAQA 1ULEA 2IVIB 2VMFA 1WA6X 2YXSA 3IMNA 2GH8A 1DFQA 1FATA 1O3QA 1LOBA 4RQPB 1LTEA 1TVGA 2YG0A 4GAZA 1D5AA 3M3EA 4P5YA 1EUUA 2GP3A 1SC5B 1HJGA 1RJ7A 5DUVA 1GU3A 4BQ3A 3H8RA 5FZEA 1JYNA 1SCSA 1WP7A 1QJZA 2C2AA 1H2GA 2ZACA 4GZ9A 3ZOIA 1QY4A 1YFWA 1CAXB 1DLCA 2W1SA 5CFCB 3KHBA 4GD4A 4BE3A 4L97A 1TNRA 3ZN1A 1J84A 4M0NA 5L9VA 3AEIA 4XJWA 5BV6A 5BY1A 4JI0B 4D0QA 1RUD3 2RCVA 2ORZA 4ZU5A 3NNGA 1XSRA 2ZM6O 1NVPD 2UUCO 1OCZC 1H1IA 4X1KA 4CU7A 3VDBA 3NJZA 4PA9A 5IJ9A 4YZ1A 4YXWG 1QNYA 2D6MA 5E1RA 5KHJA 3V0BA 3SDLA 4XETA 2P6HA 2RM21 1NUKA 2B45X 4EN6B 4BMBA 2ZNIA 1VAMA 3GYDA 2P6CA 3E89A 4MVTA 4K35A 1VB4A 1J3PA 1S5HC 1QVFU 4E4HA 2ADPA 2JB8A 3MUY1 3CB2A 1FX5A 5FYUA 1RPOA 2DYSC 4LFAO 1ZX3A 1G6NA 1NG0A 5ACA2 1OCCC 2Y6HA 1WLDA 5IAVA 1JPXA 2AZ0A 1EV12 4LNVA 1TUBB 4MGTA 5DN2A 4IL7A 1VBC2 4MVMA 5JXJA 1JZ8A 1J1TA 5CA1A 1ACCA 1NE4A 3HNYM 5L3EA 1OA2A 4WCEV 1D7PM 4KU7A 4Z82A 1OH4A 1WBLA 1H38A 4H37A 3UL2A 4BQYA 3OW2U 5LATA 5HXVA 3OTFA 4XMIA 2WS92 3MW3A 4FQ4A 1XE0A 4C91A 4CEWC 1AUYA 1SLLA 5C9AA 3OEHG 4GKJO 4P08A 3FHAA 4D6QA 1NTMH 2QM7A 4UI9L 4TSFG 2N04A 1REDA 4I0WB 3AMQA 4KNCA 5IVFA 2DVBA 3PIGA 1Q86W 5LA0A 3FUOA 5K0UC 4BQ1A 1WW7A 4JI1B 2IH3C 3V56A 1NY72 4LR3A 2HWD3 4B4QA 3BPZA 1H30A 1W8UA 1YLLA 3HKBB 2IU0A 2YIBD 4BQWA 1N0NA 1LHNA 2P67A 5F3CA 3I2FA 4TV8A 2A6YA 2ARCA 3WVJA 4NAOA 2OIGA 2E33A 4FT8A 3VHNA 1GM9A 5DMYA 4OPAA 2ZD9A 4R9AA 1NBMG 4UF0A 3T4DA 4X8PA 2NZ9A 4V2VA 3LA2A 1PP9H 4TN7A 3W21A 1OKQA 1WZXA 5LY2A 5T54A 1HB3A 2F1MA 1AR83 2GMPA 3VQVA 4XACA 1JZ4A 3KG2A 3N7JA 1YXWA 1KDKA 4ITCA 1SBDA 1PO23 4UVBA 4WFEA 3NAPA 3KMHA 2VW1A 1W2NA 2QEXV 1G86A 1ZA7A 2IXKA 1MEC1 3M99B 4N7UA 1KS4A 3LSUA 4BM8A 4P9PA 4CPBD 3PJQA 3CD6V 5A3OA 3I3MA 5GLVA 2I74A 2JRIA 2K9ZA 4YHHO 4UV8A 3K9SA 2QKCA 1JH5A 1K73W 3CLPA 4DV3B 2VMDA 2EXHA 4CTEA 4FTBA 2C9AA 4QWNA 2J1SA 1H0BA 3N7KA 5KHGA 2EXKA 5C93A 1NT2B 3KQ4B 3VBOA 3AK2A 3CMAV 4QGLA 3FBYA 5FZ1A 4OX9B 1R1ZA 4IEWA 3PNAA 3JAMN 1UU4A 3T0DA 1ND3B 4C8DA 5JCOA 2WAMA 3Q8FA 2GMEA 3I55V 4LBQD 3G7DA 2JDIG 3H50A 3NKGA 4KL1A 3OB8A 2E6VA 3LE0A 4A2UA 1ZRCA 4EZ4A 2BFUL 1UPGA 1F15A 4XIKA 4XF9A 3VLBB 2ZHMA 2Y0IA 5JIAA 1QIQA 3SYPA 4I09A 1MABG 2ID4A 4LR4A 2X0LA 2WT2A 3DTUB 2JICA 1X59A 4I3PA 3AYEA 3A23A 5CFDA 5T5OA 3FC0A 2Z5WA 4K6BA 1R091 3D36C 4DUZB 4IEOA 3HD8B 1TVKB 2VMEA 4LWSB 3T0AA 3S5AA 2DVFA 3WW2A 5KWRA 2FDKA 5DG2A 3OR6C 4HKOA 3DUIA 4OUEA 5AG2A 3NNLA 3J7MA 4HNAA 1HQNA 5C3OA 3POBA 1DF4A 2R9RB 2WNVB 2PXJA 4PF1A 2Q8DA 4I0XB 2EIMB 3UV9A 4UXNA 4FI9A 5JIUA 2YGLA 3DKWA 3LAGA 2WSUA 2OKXA 4FPPA 5FZ7A 4C1WA 2W0FC 4COWA 5DAPA 1QR9A 1Q8PA 3W7XA 4LKDA 1ASJ2 1J5EO 4UB8Z 1D5NA 5DABA 4H13B 3ZSLA 1YZBA 4IQPA 5CBHA 5L19A 2LROA 2F4PA 5GZCA 2C26A 1REEA 2QWNB 5JR7B 2VUAA 4HVQA 5EIBD 3KD4A 3K77A 3SYOA 3I49A 1N33B 3ZM8A 4Y1VA 5FYTA 2XUEA 3ZMVA 3M3OA 3L70H 1WKYA 3IPVA 1QJU3 3CZUA 2FDHA 5EIYB 2FDFA 4JV4A 2GZWA 4ZPIA 3MDSA 3B09A 4EJRA 5FXXA 5FPRA 2OW4A 5EWSA 4YIPA 4DXSA 4QE9A 5FO8B 3MDPA 3OUFA 3WLUA 3M3IA 4RQPC 1W59A 5BNNB 5FDBA 3TNQA 3OTOB 1MVEA 2RS33 3MFCA 3RVYA 5I0TA 1ZZCA 5HXMA 5BNOA 3NRUA 1RUC2 4GJZA 3OY8A 1PGL1 3RYIB 1AYN3 1E5SA 2ETNA 3T30A 1VR3A 1JBCA 2HKXA 3ZYRA 1LGNA 3HBZA 2FMYA 3RYHB 4JI1O 2VZOA 3F7YC 3CZJA 3OPZA 5CKNA 4JI3B 5FY5A 5IWFA 1M90W 1XL4A 1AYM1 1KGYA 4H7MA 3SR2C 4JI2O 4X1IA 1US3A 2Q5ZA 1OCZB 1AXZA 2VUDA 2QQLA 2J22A 3BTAA 3KS7A 2YBSA 3ASOC 2WO1A 3O0VA 4DXWA 4G3YC 1R3KC 3BA8A 3OOXA 3HAGA 3HKBA 5L7OC 5FZ0A 2UXDB 2K9PA 5FZ8A 1TMF2 1RUF2 2YC2A 4GH4C 4YLZA 4XFGA 3QO7A 1QJEA 2RS11 3L75H 3J4UH 4BB3A 4YYOA 3PMSA 4FLVA 2WBKA 4COYA 2AACA 3MIGA 1T5EA 5IW0A 1L3JA 4FPKA 4GYCB 2E75B 3W7WA 1ZVFA 1OD3A 4XUTA 2XOKG 3RVZA 3SNMA 3SGIA 1QJX1 1W3VA 4P2ZA 5LGTA 4CEYA 3OTOO 2BGCA 4KWUA 5FK7A 1CAWB 4YGDA 1OLME 1SACA 1EAH3 4A45A 3GZAA 1XNRB 2V1DA 4N9IA 5B1BB 5H2FZ 4FMTA 4YVWA 3NQHA 1SQBH 5JQGA 2UU8A 3PURA 4DV3O 4UT5A 4AEMA 5FZBA 2GNBA 3L74H 2ZCWA 1BK0A 4BQXA 4LMFA 4XHBA 2JS3A 4LLFA 1STMA 5JXGA 1DQ2A 3NMBA 2IC1A 2B5UA 1AXYA 4JI3O 4PF5A 1FPN2 3T0BA 5JCTA 1EV11 5FMCA 2UWAA 1G4YB 2XDVA 4DR2O 4MZUA 1FYJA 3KWVA 4WFBV 1JCHA 4FCAA 1C1FA 5L3FA 1N34B 4IV3B 4NHMA 3VBHB 2VMCA 3WDUA 4I3GA 5LBBA 1KC8W 1CAUB 3E5QA 1W04A 1ZLZA 4TV9B 1B3QA 1C8M2 3G71V 4LCUC 1HXS1 4YVSA 2GN3A 1RXGA 1X9PA 4DR5O 3N9LA 3N9QA 4CRQA 1FXKA 2R70A 3HKCA 5JQGB 5KAIZ 2ODMA 3FHQA 2E26A 1MZ5A 5FYVA 2W91A 2HWD1 3FAVA 3ZXGA 3HKEB 1OLQA 4FTEA 4MTOA 2Q8VA 4CPBA 5FV3A 4B3MO 3MW2A 4TLGA 1VBB1 2IXHA 4YJ3B 2QBXA 4CDWC 4DV4B 1H9PA 1BBT3 2W68A 1XHXA 4QX7A 3WF2A 4A42A 4UFZA 2FMLA 4JAUA 4LHKA 3ZYBA 3OFNG 1NX9A 3DXRB 4FQZA 2XG3A 1COWG 1HIXA 4KWJA 3RSJA 3GCXA 1VF5B 4HVRA 1R3IC 3ASOB 2OXBA 3ATGA 4X1KB 4XJ8A 3ZN6A 4Q26A 4JF3A 4D8MA 4FFFA 1RUF1 1W9WA 2EIDA 4JRAA 1ULFA 2VZ3A 4QXHA 2R063 2EA7A 3ZKUA 2EIJB 1VBD1 3SKJE 1RFYA 1SPPA 5IK5A 5A80A 4K40A 4YY3B 4Q0VA 3UETA 2GMMA 3CCRV 1W3XA 2QQOA 1GM8A 2DYCA 2WYFA 3K5OA 4XVHA 1JMUB 3TN92 1W6MB 1KP2A 2J1RA 2BGOA 3RWRD 1BHBA 4X64B 3WXPA 1DF5A 1WCSA 3HQUA 5IVYA 3H01A 4AVSA 2ZX2A 1CONA 1XXNA 1HDKA 5F5QA 2VCMA 3AL6A 2ATFA 4M01A 3IIIA 4IYHA 1H2NA 3CRMA 1NR7A 1H2MA 5CEHA 3N2GA 3OGJA 4CCDA 3GWKC 1G9FA 3A0HZ 1XNCA 2W0XA 2J1UA 3WNLA 5LRRA 2Y4TA 3ZBHA 1D0HA 2GC1A 3Q8AA 3A4UA 2W6JG 4MW3A 2QWRB 4H44B 4UCTA 3JZVA 4Y22A 4K0KB 3BTXA 2JDHA 2BNOA 1A3KA 3J7HA 1ZA4A 2RMU2 4UFLA 3RYFB 4YG3A 5FR3A 1KUQA 1HN1A 3P5BA 2D6NA 3I2IA 5FY9A 1XNTA 4JI4O 5CFCA 2EILC 3EXUA 4IHJA 1XRUA 4XUQA 2YFZA 4PIZA 1JYXA 5LBQA 3MV01 2B1GA 1IBKB 3ZFEC 3CIHA 4CC5A 4QKNA 4QPIC 3VBHC 4FFKA 4UVAA 1YIJV 2Q1FA 5J1XA 4ZU4A 4MHUA 4ATEA 4AI2A 2FB5A 2QJ1A 4Q4X1 4A7YA 1NA1A 4D7SA 4C0BA 1GOGA 2WPDG 2RS32 2DCKA 2IU3A 2XGXA 3AJYA 1HN0A 1UY4A 3EHKA 2VXJA 3EQEA 2KG7A 1EN5A 1M4WA 1XNDA 4HG6B 4HKLA 5EIBC 3WY6A 4URAA 4B3RB 4N7IA 1LHOA 2QQUA 2ILMA 1Z7S3 5EJZB 4JI7O 1OOPC 4BWAA 4WZFA 1K92A 4GKXA 4PA3A 2FD8A 4FFHA 3SH4A 5KAFZ 4JTOA 1LU1A 3KCCA 1UJWB 1JOJA 1OCOB 3JD0A 3GBFA 4QDQA 1CVNA 5C5UA 3JAKA 2NNUA 1KDMA 4DV1B 3WV6A 1HNZO 5A7NA 2XVKA 3FYEB 4X89A 2H3OA 4CP1A 4LF5B 3TYJA 4F7ZA 4ZHNA 1OFSA 4BK4A 2X05A 1RUG2 4CYDA 3QTCA 4KFMA 5BZBA 4DQAA 5FP9A 4GCZA 3H1JH 4AQTA 1IPJA 5ANQA 1M4UA 3A21A 1GOFA 2ZGUA 4N53A 4CA9A 3I2KA 1F2NA 1IPKA 4QX0A 5DN6G 4B3SO 1Y9QA 3VBBA 5JZGC 3UGGA 2HR3A 3K5MA 2BERA 4RSUA 5FK8A 1SQ4A 4TV8B 5FOJB 1QU7A 2RR12 4M4PA 1XNQO 1QVGU 5IT9N 3JAKB 1DYOA 2JG8A 4Q2FA 3ZHVA 3VBOC 3A0RA 1XL6A 3CU7A 4Q4V2 5E88A 4EWDA 5JOXA 1IG0A 4X6QB 4AQSA 4B4PA 4LF8O 2HWC1 1A8MA 3E5UA 2XVGA 3T2PA 2Q69A 3T1YO 5FKBA 2BVBA 3K4AA 5LK5A 3WNOA 4OULA 5KR7A 3MF9A 2WC2A 5EBLC 5D21A 2MHFA 4V1PA 4L87A 2HVJC 5C4WC 4XF3A 2P3JA 4IEPA 1LR1A 3ZFGA 5B5EZ 3LDRA 1RUI3 1ZX5A 2ZZJA 1AZDA 5CBGA 4DNYA 3ZXEA 1I08A 2JDMA 4DO0A 3ZRWA 5L7OB 4MS2A 2YPDA 5BR8B 1OURA 4DK1A 4B7KA 3CJIA 3NJXA 2ADQB 1CZVA 2WLKA 4R4XA 2JE7A 3CCQV 5KX5B 5CKMA 1OHFA 2MEV1 4XAAA 3WB2A 1CWPA 1L7QA 2ZEYA 3S30A 3B93A 4EYUA 2O8OA 5LYJA 2X5IA 5CA6A 1AI4A 2ZOEB 3N9NA 3UO3A 2VH9A 4DR7B 1EPWA 2GP5A 1RUE3 3ZYJB 3ACHA 2YC4A 4DR1O 1IKQA 1UN1A 4LORA 1MZFA 1QH6A 1LOGA 4DR3O 1RYYA 3WP3A 1VEWA 3DL3A 5A6XA 4CCOA 2NPIA 1B04A 1OLMA 2VO5A 2VQUA 3GHMA 4FO9A 3ZN5A 4PDWC 4XDPA 1NQJA 5J7MA 1VMGA 1F31A 2P4VA 4WVMA 1OUXA 1S0EA 1REFA 4C0HA 1VBC3 1COV1 4DB5A 2HHHO 1HNXB 1R081 3WP5A 3ZXAC 1FOD3 2PHLA 4KQ7A 4N43B 3JATA 1TQ5A 5GZEA 4YVSB 3OSDA 3SJQC 5JXHA 1IS6A 1UMIA 3CC7V 3SYCA 4A41A 2XQXA 3KVAA 3N9MA 2RDNA 5FPVA 4CEYC 2CH7A 4GMP3 5DPNA 4B3NA 2A79B 2WUHA 4G2KA 4M3CA 1NT0A 1C1LA 3MPPG 1XYOA 1LGBA 2UY9A 5FMDA 3GDBA 1WLWA 4Q8LA 2WLIB 5FCCA 5LRSA 5IYZA 2AYHA 1S2EA 1HRV2 4ZOLB 4NRQA 4WV8A 1CD3G 4PA7A 3IDAA 3AMPA 1FJGO 1PIV3 4LOTA 1OLRA 5A2QN 1SLBA 5A3WA 2EINC 4G28B 5FZFA 2HWD2 1YI2V 3KVBA 3FMGA 2NP0A 2ZPXA 5BNPA 4CZZA 5BMVB 3ACFA 4YW3A 5L3DA 4N9HA 1SLTA 2VULA 4LA3A 1SZTA 1QNWA 4K8XA 1PL0A 4XDKA 1FXKB 2QDRA 5B3SB 1CIWA 1CZSA 3HR9A 1CZTA 4DR1B 1VQOV 1RC6A 2SBAA 1H8EG 5FIXA 1V54B 2GTSA 2FZ2A 1RSOA 4I9QA 1W8TA 1YFUA 2TBVA 4KUMA 2FL4A 5T55A 3D3IA 3C3TA 2Y0OA 2VMGA 4ZU7A 2WLIA 4BQ2A 3GZEA 1KJLA 2GNDA 1OXCA 3VUOA 3WHTA 3B77A 4YNIA 4H2AA 3O1VA 1JZ5A 3KZIZ 3B2EE 4IE6A 2ET7A 4NHYA 3FB8C 1RB8G 3H8OA 2VS0A 4Y5SA 2JE9A 1WW4A 1XQ8A 3P30A 4IE7A 1R1A2 3RS6A 4L8JA 2J1AA 4XUNA 3VD9A 3VKNA 3JQXA 1OVSA 1O6UA 3ZVXA 4AW7A 1VF7A 4A3XA 2Y34A 3TXQA 3PLQA 4NXNO 2LGQA 1VQ9V 2NN4A 2JJ1G 1HW7A 3B94A 2YS8A 2HBUA 3CBNA 4TUYB 3K04A 1MQTA 1VMHA 1FAYA 2QUOA 3VBFB 3ZXJA 4O65A 1QNMA 2CAUA 4JV5O 2WS91 1UAIA 2CDPA 2G38A 1SDWA 3HN3A 3W58A 3JXSA 2YI8A 4J7KA 4X9QA 2Z4FA 4Z2WA 1RUF3 4GZRB 3FD9A 1AJOA 4B7EA 4J6GA 4DY3A 2Z2SB 4XAEA 5E8AA 4FOVA 3NW4A 3Q8EA 2Q4SA 5EBWC 2R073 4IEYA 4JKMA 4RL7A 4AK3A 3E86A 3KV6A 2DURA 4JI8B 3DXTA 5M0TA 3PIJA 2HYXA 1OVPA 4IUGA 2J1VA 3PTYA 4Y3OA 5FP7A 4GWJA 4IV1A 4DS0A 5AC91 4O4LA 2PN5A 1JODA 1S1AA 2QTOA 1MS0A 3UKTA 2QM4A 3AG1C 1LEDA 4BQ5A 3WW4A 2ARBA 2ADDA 4NPMA 3IMMA 1ZZ6A 4EQVA 4I9WA 1ZBA1 3ZYHA 3U14A 1ZM1A 3AYDA 4JTAB 5FYCA 4DR6O 4I4TB 4RGKA 2R16A 1ZBE1 4OHYA 4U3JB 3PVOA 1X8EA 2XPJA 3VGIA 1OSGA 4D94A 4PELA 2XQRA 1HRI2 3E83A 5F32A 2FCTA 4FZ0A 5EC1C 3LEMA 4YSFA 4MVRA 4XDQA 3CE2A 3WSOA 4L2NA 2ZGOA 4X66O 4XTMA 1IX9A 3PHMA 1EZVH 4JV5B 3B8MA 1AR1B 1UY1A 5DECA 1BGYH 5J36A 3J7NA 5J09A 4KWLA 1V55B 2GTAA 4Q4W3 3THCA 1SQPH 4EROA 2AZ2A 3AG3C 4TXWA 1LHVA 4E9KA 4GT1A 4PLOA 1M9NA 3DF0A 3KHCA 1UO9A 3BKZA 2FBEA 1BQ0A 3T2QA 4AF9A 3O1SA 4CDQA 1XMQB 5DDJ2 5JJEB 4OXSA 3T2MA 2LS6A 2VQFO 3ZIWA 1SEFA 4XFFA 4O2AB 2ZM6B 1R3JC 4Y1XA 4YGCA 5H9PA 3RN4A 4AHCA 2W3JA 2Y38A 4R7CA 2DUQA 1J3RA 4QB6A 4YM1A 1AX1A 3TK1A 4E2LA 2XLAA 2ZX0A 3KKYA 3WNNA 1UIJA 3M7AA 3MLKA 2FMDA 2YXHA 5BXXA 2A3YA 4DUWA 4UW5A 3I4IA 2VW0A 2ZHKA 5C9AC 3ICXA 2VWJA 3H8UA 4Y5TA 4BPZA 1DGWA 4BQ4A 2UWCA 2WT0A 3I2OA 3J9SA 3M70A 3H3ZA 1C3HA 2O1QA 5CFDC 3KSCA 3WOGA 2YEVB 1O3TA 1J58A 1VARA 3BEHA 3B8NA 1BCXA 3B5LB 1VALA 2EF6A 3SHRA 3LPGA 2DYRC 3RMXA 1O8PA 1NI8A 2E7QA 1RUI2 1BZKA 1RUH2 1ND3A 3I3DA 3OE7G 5T3NA 1Z5VA 2H6CA 3D8CA 4OPHA 1ND2A 2XAHA 4UUJC 1DQ6A 5FPBA 2YGMA 2EALA 1GTOA 1W8ZA 4RGGA 1EYBA 3C3SA 1UU6A 2FHRA 4O4HA 3J26N 4GJYA 3AFGA 1YIFA 3I3BA 3IFXA 1PMHX 4AEDC 3H9AA 2Q8EA 3THDA 2HWB3 4Q4V1 3QOPA 5EJ1B 1JZ7A 2WAOA 1R64A 5B1AC 4Q4Y3 4WM8B 3LDDA 2WT1A 3BIEA 1WMDA 1TMF3 5GONB 4J11A 4ORFA 4QE7A 3PUHA 1RITA 2BVVA 3ZSEA 2WQ8A 1Y3TA 1I0HA 4X65B 5LA9A 2VZ1A 4ZI7A 1IBMB 3JASA 1MS8A 5LK7B 4DUXA 1GQHA 4N8MA 4JYBA 1JN2P 5LMNO 2KKWA 2PYTA 4QB2A 2OT5A 1QQP1 2UU9O 1G7YA 2J42A 2WNVA 4JVAA 2BUKA 3K46A 4JDOA 4N23A 5FY0A 5LHGA 3H0OA 1V55C 1IS5A 1Y4MA 2RS52 2B46X 3SJBC 2UXBB 1W03A 3DEMA 4NUBA 2BPA2 2KD7A 2LFSA 3ACIA 4LO5B 3WB1A 1YRZA 1R083 1Z78A 1DZQA 2QNKA 3UK9A 3WQ0A 3V65A 2ZA9A 3HQRA 3JALA 3AK3A 2CTRA 1KMIZ 3IC7A 4B1LA 3MFAA 4HZ3A 3DXRA 5FZLA 1RSOB 3H1HH 2VZTA 5FYIA 3A7QA 4JI5O 1UYXA 3H1LH 1PK6B 4TT3G 3RMYA 2WIIB 3K9AA 4P9YA 4CCJA 4A7KA 2RQ6A 5LCWL 5IVVA 3OM3B 1K12A 3TEXA 5LGNA 1D2QA 1V9U3 2GC3A 3CCLV 1FV2A 3OAAG 3OMNB 2Y6FA 3E6BA 3WCSA 2RM23 2ZIMA 3V64A 1ODNA 3QCWA 4V2WA 5HV4A 2E51A 2VZSA 5D2AA 3EYPA 3ZN0A 2A71A 2GSYA 1DLBA 3CS5A 4Y26A 4GX0A 4JYCA 1ZZ7A 4BDVB 5ABJA 4AG4A 2YBKA 2ZDIC 5DZFA 5B4XA 1ZZ9A 2KQXA 2CAVA 4EZHA 3SPIA 2XAJA 3BFRA 5A1AA 3B9IA 1R6KA 3OUJA 3ZYFA 1SCRA 1ND2B 2B7YA 3D0JA 3CCSV 1MPXA 3USUB 4QGMA 4FOWA 1H8VA 3BVOA 1LESA 5C4WA 5L9BA 4AOCA 5C3SA 1AI5A 1D2DA 1IQAA 1ZBE2 4IT5A 4MGSA 3ZRSA 1VQMV 5CFDB 4CDXB 1QKQA 1CAVA 4RR3A 4WVMB 1LUWA 1COV3 1GP6A 2AGSA 5A33A 3N36A 4Y4RA 1BSMA 4I01A 2I45A 1JOBA 2NMNA 4XHXA 5CN0A 5FPAA 1W0JG 4AQ6A 1B35C 1LHWA 4J9YB 2EIEA 4B4RA 4FPCA 1WLEA 1DQ5A 1DGWX 4X62B 1BHAA 1LENA 5J48A 3HEIA 3ZSJA 1V6OA 1OPOA 4NIAA 1KXGA 3MIBA 2P22C 4LBMA 1VBA1 1O9HA 1F9KA 5AVPA 1A6CA 3WW1A 5BNPB 4KP4A 1ENXA 4RQPA 5K4LA 2EILB 1RXFA 4K1ZA 1OJHA 5C3RA 4IDZA 5JOWA 1GNZA 4W6WA 1RUD1 3IBMA 4K21A 2MK3A 2ZE8A 2GBOA 4DOUA 1UPIA 3B40A 3FUQA 4NHXA 5SV8A 1R6NA 3LCPA 1H4HA 3GWOA 4K8RB 2G1MA 1H2KA 3CJHA 1H8TC 4DR4B 5DAWA 5E16A 1WW6A 1YFYA 1VRH3 3AYCA 3J81N 4F6EA 1C5HA 4FTSA 4HETA 1HRV1 2DUOA 1Q81W 1OA3A 3E6CC 1SF9A 2AUYA 4LHSA 4AGGA 3I2JA 5FBZA 4NJ4A 3VD3A 1FOD2 1OOPB 3HKDB 3KZ4C 2RVAA 4U3FH 2XASA 1URFA 4HXCA 1S72V 3ABKB 5CB4B 2XL7A 2HJDA 5FZOA 1C8NA 1PNLA 1BJQA 2QGNA 3BN6A 1DP0A 5DEDA 4CCCA 3ZHSA 2Q5TA 5JUVA 4YRDA 4W4LA 4B08A 4TLFA 2VU9A 1HW5A 4FLYA 1YFXA 1W9FA 1MACA 3C90A 2DCYA 1KKDA 5GTHZ 4LE4A 3TXSA 3ZXFA 3W9AA 3ZMOA 4NIIA 5D1IA 2KR2A 5CISA 1Z7S2 2OA2A 3MAQA 4J25A 1RUH3 1TUEB 1G9CA 3VKOA 3PUSA 2DBIA 4O4JB 2LRPA 1OQEA 4CCMA 4NIDA 4OHXA 4GB31 1P4RA 4LBLA 1BEV1 2I07B 2OWOA 2V09A 4C1XA 4XDLA 2RJLA 2IFRA 2UYBA 4HN0A 4K3AA 4X1YA 2VL4A 2VBBA 1HLCA 1XDCA 3JD4A 3T09A 4P02B 3BB6A 1DG6A 3T2TA 2YEVA 3N2KB 2R1BA 3PDQA 5I8SA 3M7MX 4R8CA 1SHWB 3SISA 1ENQA 4LNUB 5BMVA 1DLLA 1CX4A 3BGAA 5G04L 3H1KH 4Q4W1 1S0FA 4XZUG 3LDCA 2HWF3 1JYVA 4AI0A 2N74A 4E27A 3ZMNA 3WDTA 3FYIB 2JDYA 4ZHQA 1Q6HA 2RS13 1BS3A 4XE9A 1IXMA 1LOFC 3ZEDA 3LOIA 2BDRA 2A73B 2D44A 4X8AA 3RI9A 2D5HA 4I4TA 2WYSA 4YW7A 3JASB 3K2OA 3WUDA 5ABJC 3JSLA 4QXKA 2VCCA 4JZRA 3QNEA 3KT4A 4W65A 5FZKA 3APBA 3T2OA 1W28A 2DU0A 4FPFA 1RUOA 3UNPA 1VBC1 1UY0A 4LFCB 2E32A 4AVAA 5DQ0A 5HV0A 4LWSA 5FZIA 3ZFFB 3DV8A 2W47A 2R041 4IV1B 1V6KA 3L73H 4CDXC 4N53B 2GC2A 4DY5A 1QMJA 2J1EA 2HEWF 3WP4A 1ONAA 5IAXA 1RVF2 3WR0A 4CDWA 1G9AA 4RWUA 4HVOA 3TETA 5GONA 3S0MA 4PDWB 2VZUA 2TEPA 1XOUA 3Q4HA 3AG4B 2YMZA 4PDMA 3SC7X 4DRXA 1XHZA 3UKNA 5A6YA 3ASNC 4YW1A 4META 2QR4A 2R061 1VJ2A 4XBQA 3J8F3 2WZPP 1W06A 1VQ7V 5IFPA 4CDUB 5FYBA 5I8YA 2P4KA 5T52A 2WWWA 1W6QB 4E4EA 4AFDA 1B09A 1ROPA 5A7WA 4CS4A 3QD6A 2PAEA 4KG8A 3ITQA 4R9BA 4GKYA 4CEYB 2OIEA 3SCFA 5EFUA 1PMJX 1OV9A 1PHMA 2H0VA 4BH9A 1SQQH 1SMVA 2IBZH 3WDVA 2D98A 2W46A 2HKOA 2KG7B 5T50A 1H8TB 2Z0AA 1CAVB 4JI6B 5LHHA 5LW9A 1AILA 3RDIA 3KLSA 5CU1A 4LKFA 5HFMA 5C3PA 5A7OA 2IH1C 3U11A 5H9RA 2SLIA 3AJZA 3UO2A 2B9ZA 3UCSC 3NV1A 4DFSA 4BXFA 3BRCA 1IG3A 3U37A 3ABMC 3ME2A 1NR1A 4UB6Z 5HPOA 1Y66A 1WAZA 4Y20B 5FWJA 4JYAO 5ACA1 3RT3C 1JX9A 1P7GA 2Q1MA 4UFJA 4WZCA 1SFYA 5CZKA 1OPMA 5GW7A 5G05L 4AFBA 1AYM3 5F1RA 2R30A 5GLZA 3LIHA 1XU2A 1IVSA 1KD7A 1UYZA 1NE6A 1PGW1 5B3SC 4QX1A 3N4MA 5A32A 1OCRC 4D6RA 5ITZB 3MHHC 2MPFA 2BQPA 2OCCC 3UESA 4RR3B 2C0ZA 1XPWA 5KHKA 5SV5A 3RRDA 3HPNA 3AP7A 3L9JT 3HIFA 4KGQA 3PTRB 1WGPA 2RDQA 2F95B 2RDSA 1H2SB 2GSMB 3IDCB 4KI5M 3WX5A 4O4IB 3T1CA 3RVHA 3DN7A 4P00B 1TG7A 1EFRG 3X29B 1AJPA 3E2EA 1RIRA 4NRPA 3HT2A 5GZDA 2ZE7A 1AR91 4QPYA 4OUSA 1QQP2 4KXRA 5KUMA 5D8AA 3TB0A 4Y5Z0 3VL9A 4OHZA 3FZ3A 3JD3A 4L11A 1SLIA 2JJ6A 4BISA 2DCTA 1H8HG 3O1RA 1FD9A 2DOSA 3LIGA 5IYDO 3I8TA 1PZ8A 1F23A 2Y6LA 1S0JA 4ES9A 1OFNA 3BCWA 3O9OA 4RAIA 5C3QA 2IWGB 3TBDA 4MYEA 3CRCA 1NXMA 3WU2Z 4IGPA 3MIHA 5JVVA 3IAYA 3LA3A 3ETGA 1IBKO 1ZBA3 1BMV1 3C7HA 1UPSA 5GZFA 4I55B 1POV3 5TSWA 2HVKC 3U10A 2E9QA 4LH6A 4TQFA 1BQZA 4FLWA 2DFCA 1RHI1 5LP6C 2YV8A 3POIA 4JGSA 2Q4PA 3RI8A 4JC1A 4BIZA 4AFCA 2JDPA 4AGRA 5F37A 3AZWA 4J1WA 4LF4O 3H7JA 5B4NA 4N53C 4I0XA 1GOHA 5K1XA 2MEV2 1RINA 4DRXB 2AXTZ 2Q67A 3ZX6A 2CYFA 4GX5A 4P9JA 1BT8A 4CDXA 1ZL8B 1H6YA 3W59A 1S77D 1OUSA 4HSJA 4HNAB 1XOYA 1MQTC 5FZOB 1LGCA 3JQWA 3WF1A 4BHPA 5L3BA 3E22B 3FE5A 2RS51 5FPUA 3MO4A 4AEJA 4WM7A 3VDAA 1V6NA 4WFHA 1TVKA 3SEEA 4COZA 5K0UA 4PJ0Z 3HWJA 3K57A 2OTJV 3POWA 2YICA 1RL3A 2BOJA 1PGW2 3DGTA 1OC1A 1DGSA 2HEYF 4S2GA 2J1TA 2D3RA 3G4SV 1U5IA 3WUCA 2BU9A 2XKOA 1YEWA 1SRYA 4RR3C 5LB6A 3UT0A 1NLRA 3ELNA 4PJYA 1MOFA 2RJKA 3KV5A 1VF6C 5LXTB 5DAXA 2B42B 4L99A 1R082 3PJYA 1K5SA 4F83A 3NV3A 4K1YA 4NIGA 2O14A 4BWOA 2OUHA 4PDLA 2WLHA 4ZHQB 3JD2A 4I0AA 4Q29A 1G9DA 1AR82 4D6TH 2WA4A 2Y48A 1PO21 4K8ZA 1SS3A 3IDBB 1TUBA 4F6RA 4XTPA 2B9UA 2XMLA 3VHPA 3TOJA 2EAKA 3G80A 4YZ5A 4LF8B 1WLCA 2ATKC 3STZC 2RDCA 4J10A 1FNYA 2WNUC 1YQ2A 4L8QA 4LFBO 4HBNA 3EXAA 1B06A 4LBQB 2AGAA 1YVWA 3HT1A 1UQXA 3LEGA 3CCMV 4LNUA 4UAPA 2OQ7A 4AEKA 3NV4A 3WCRA 2WLLB 5I8TA 4IGGA 4ARYA 1H8TA 5EYXA 1WCQA 4A4AA 1V9PA 4JAVA 2WZ8A 1AVMA 4OFGA 1NLSA 1ZZ8A 4E2QA 1ZRDA 2BE3A 2QTSA 1Y7BA 2HFEC 1R1A1 4X1IB 3PUQA 3CJIC 4IXLA 4M3CF 3OMIB 1QJFA 2XWJB 2W87A 3KCYA 1NCQA 1POV1 2HG5C 1ZTEA 1GNYA 5IJ0B 1DYKA 2A6ZA 1YITV 3LQCA 3VBUA 1CEZA 2VJXA 2DVAA 1W8NA 1WCUA 2VUJA 3LNMB 3OPWA 2IVJA 5F6KA 3OBZA 1N0JA 4AAPA 1HNXO 1W8FA 4PLMA 2E76B 2WWUA 3ZKYA 1YI9A 5F39A 1QF3A 1N34O 2YROA 1THZA 2YXLA 4JHZA 2VTFA 4DMIA 2ZXWC 1JHNA 4H33A 4DR6B 1WBFA 2WN3A 1EP0A 1LECA 5C8CC 4MGIE 1CPYA 5EK0A 2QKDA 1SKVA 3UM7A 3ZCCA 3RJRA 1QH7A 3ZS8C 4AL9A 1POQA 4AZZA 1YJWV 3ST7A 5KBFA 4A3ZA 3RZZA 1RHI2 4F8AA 4KWKA 1J59A 2Y0PA 4LITA 3ABTA 4FXGB 1W2UA 1PVC1 2IJHA 1JU3A 3ACLA 4CUCA 2WLNA 4CUAA 3Q9OA 5FY4A 1RUG3 2D7FA 1BEV3 3LSQA 1PM7A 1AR63 3WDYA 5FZGA 1IPSA 3AP6A 1BKZA 2XUMA 2PELA 1EUTA 2E7AA 2N05A 2RS31 3T1LA 4AEDA 1OF4A 1I94O 1HP8A 3VD5A 1GZ9A 1N32B 2QZ3A 4MT8A 1A34A 1Z7S1 1UYYA 4PD4F 1V6LA 2VCAA 1Q5OA 2MW2B 3ZO0B 2YU2A 2Y64A 2VQFB 5FRAA 5F7UA 4FOQA 2Q8OA 3TEYA 1PL4A 4FXKB 1WN7A 3BALA 4UFKA 2Y26A 2CL2A 1O91A 1PK6C 1BLZA 3M1HA 3D3QA 4YZ3A 2GALA 3OUIA 4YFZA 3OBTA 2V5DA 2OYQA 2VD7A 3V0AB 1QJU2 1PGL2 3RYCB 5FNVA 4CE8A 5IJ9B 1NLQA 1LODA 1UKRA 5ITZA 3E8HA 3DYPA 2DQ0A 1EBOA 3AMHA 2OCCB 2CHHA 5CA0A 2AREA 4DV7B 4TZDA 4RHV3 1RUI1 4TUYA 1S5LZ 3RG0A 2DMXA 1UD1A 3VKFC 3W5NA 1DF0A 1AXKA 4OGQB 1TA8A 2ZX4A 3N9OA 3SEPA 1UOGA 1GUIA 3NNMA 4O4IA 5F5CA 3LWCA 3U78A 4Q6GA 4INDA 3ZX7A 5FYHA 2WNUB 1GANA 1FMD1 1IGOA 4LBOA 5B1BC 1AJQA 1VBE2 1HNWB 1WB7A 4J7JA 5F3EA 5FXWA 3SYAA 3N2GB 2UUBB 3CDZB 1I94B 5IYZB 1BEV2 4LF7B 2LO1A 5J2UA 2FCVA 1V6IA 2A70A 3B01A 4DR7O 2Q0AA 5JWPA 2E7TA 2QKAA 1AL23 4DW1A 2WNEA 1JZ3A 4TTGA 4IW3A 4A6OA 2VWKA 3LKJA 3D82A 1EY2A 1LCLA 1M56C 4LUMA 2R9IA 1CX1A 3LEKA 4IV3C 4JYYA 4DYLA 2VZVA 2E53A 2E5LO 5LXTA 4Z2AA 2JG9A 2ZEZA 2BOBC 3KF5A 4LIUA 4K3UA 2IJJA 2Z3YA 3UJQA 3LDEA 3UKMA 4MVZA 5KA6A 4YVWC 1O3RA 2VOVA 4DRRA 2XVLA 3BABA 4MSWC 4XBNA 4JI7B 4AYUA 1FXZA 4YPJA 4M3CE 5BUVA 3MIDA 4DV0O 1W6OB 5CADA 5FLXN 3NAPB 1AR72 3RYHA 5IFTA 3ZDVA 2WQZC 2OCHA 5GLTA 1AR4A 3VZLA 4ZI7B 4CU8A 1RP3B 1YI7A 3VHOA 3HR0A 3AKPA 3RZHA 4D6SA 2WNOA 1JU4A 3LB9A 2WINB 2EJRA 2OUJA 2HWC2 3JATB 2HEPA 3J8F2 2G4IA 3FJSA 3K48A 2DWDC 2VTXJ 4IETA 5C8YB 4HL0A 2ZGSA 2Q7GA 2BJSA 5FLJA 1AJNA 4NR1A 1VBE3 2BYVE 4XURA 4OI4A 3WF3A 4QD2A 3ZRWB 5IUQA 3O14A 1W2BU 1Q8QA 1B6QA 4YZ4A 2C6SA 2YPJA 4FOYA 3AXDA 5GALA 4CCLA 2EBOA 4XFAA 4AAXA 1GFF2 3GXUA 3I5DA 2YDEA 3D5OA 1A78A 4LKSA 1UU5A 2N7GA 3F5WC 3M4FA 3LDBA 3NVCA 3VBRB 1ASJ3 4RFT0 1BBT2 1UY2A 5IK8A 1XYNA 3AYAA 1OKOA 1JW6A 4XIOA 3ASIA 2CTPA 1NYWA 3GALA 3PMEA 1QJY2 4ZIBA 5IATA 4Y33A 2GU9A 1VB2A 1W39A 5D5QA 2UXCB 2QWQB 1VQ6V 3CJXA 2GV9A 3O1MA 2WZEA 4RQEA 3E8FA 3T4ZA 4YFWA 2EIKB 3G6BA 2A7AA 4LT5A 2YBPA 4MGYE 1CPMA 1QCEA 1QJU1 3OBRA 1S0DA 1CJDA 5FO9B 3WQBA 4UFHA 1K7DA 1P84F 1JS9A 1Q90D 2K0GA 4PLNA 4Y22B 1F35A 2FYUH 2WNVC 1OCCB 2EJ7A 4IIJA 4BLIA 1RPRA 5B1NA 3H3UA 4XF0A 2A0LA 1KITA 2JG8B 4XF1A 2XKPA 2VGDA 1MR5A 3EFFK 4XBFA 2RM22 3UGFA 2WO7A 3JCIA 2WZR2 3STLC 3JU9A 3OGGA 1FT9A 3AZYA 4ARXA 3VZMA 4S2FA 1Y76B 1LKNA 1M1KW 1VAVA 3IPVB 4AVCA 4RUFA 4FP3A 3K3NA 4OX9O 4X65O 4KMQA 5IY5C 1UIKA 4H55A 4XXAA 4CS3A 3MV11 5F6LB 3SH5A 3KT7A 2A1XA 3PVNA 3CL1A 1KRIA 1G8MA 3WHUA 1N1YA 5IVEA 1AF9A 1RUC1 4IIJB 1ULOA 4HLTA 2Q7HA 4I5SA 2ZXQA 2E3CA 1S3JA 2UXCO 2DDUA 2VR4A 4HOOA 1AHSA 1Q7YW 5JSOA 1PM4A 1UXXX 5FLIA 2LW8A 2NLJC 2VAUA 3QVNA 5D5PA 1TNFA 2ZXWB 2B9VA 1VPHA 1FV3A 3POFA 4OHWA 4NHKA 1GZWA 5JLVA 4O61A 4DUZO 2JD9A 1NS1A 2HEVF 4A7ZA 1XUQA 3AG2C 2JVDA 5FYMA 4MADA 3WF4A 1YC61 4NROA 4RA0A 2RHPA 5HCBA 1K42A 4NWVA 2Z79A 3J8F1 1I5XA 4G9SB 2QQIA 2WQ4A 4O7XA 4TWTA 3G6JB 5FOBB 2OPWA 1LR5A 1UX6A 2HJFC 5CA1B 5FZ4A 2JENA 2EULA 5EZYA 1EAH1 5JCOC 5HBAA 1NKDA 3JD72 1JR9A 1VF6A 2WLPA 3AKRA 5IHRA 4XCAA 1J1LA 3B02A 4BXSV 3TRSB 4BJ0A 4TYSA 4WFAV 4WM7B 4FZ1A 3VBFA 4FLUA 5I0DA 2BZDA 3OF1A 2PYJA 3JAWA 4U7NA 1N36O 1WLTA 2Y6GA 4DZGA 5ACA3 4KU8A 3HB3B 3CRRA 4Z92B 2Q9LA 5C5TA 1OCRB 2VC9A 1LOAA 3U0ZA 3ZMUA 4YGBA 2VY0A 3BPSA 1PNGA 4RD7A 2YUEA 2QQPA 4HYOA 1C4RA 1DIWA 1JOPA 3GNEA 3D36A 2CGOA 4BW9A 4TSVA 4TWKA 1QGLA 5BY5A 4EV0A 5DUUA 4W6XA 5C8CA 3BOWA 1K3EA 3ZRVA 2QZ2A 3KF3A 5JZGA 2O0OA 1JHJA 1ODMA 4FAHA 5FZ6A 4I0BA 2LALA 2F23A 3ZXLA 1UY3A 4XYXA 4U3JA 3LD8A 3TGUH 1H1MA 1BZWA 2VQAA 5LMUB 4XABA 2ZEXA 3F95A 5FMBA 2GNMA 4UCVA 3UQ8A 4GX2A 3SJCC 2UUCB 4DW0A 2R072 3ZMSA 4CBCA 1W0PA 2W1UA 2Q6AA 4O9EA 2G9FA 5A7QA 1PNKA 3M3CA 1BXHA 2C9KA 1Y43B 2JEXA 4YW4A 3L71H 1W6PB 3NO8A 4KG0A 2D97A 1LRHA 1XREA 2HBTA 1PZ7A 1QLEB 4EB6B 3N7LA 4Z8BA 1YYNA 3ZN4A 4MTFA 1HKDA 5H6QA 3VL8A 3ABUA 1W8OA 4HN1A 4CZSA 2A9HA 2WWJA 4PCRA 2UXDO 1QOSA 4CU9A 2F4VB 2PLV2 4I50A 2EXJA 1YHFA 2ENRA 3CXCU 1EPZA 3QO5A 3MHSC 1KS5A 3E8BA 1T6BX 3T4HB 1Q8OA 4N90A 1JA8A 4MOAA 5FQ0B 4J41A 2WLJA 4UCRA 1AB3A 1ZBA2 1YNAA 2PHFA 2RMU3 2B39A 4JZ2A 4GKKO 2P2KA 3I2GA 5HI0A 2CWMA 5IVJA 2CGNA 4U2AA 2BTVC 1FFXA 4LHLA 1DQ4A 3WT3A 4KH9A 4B3TO 5FZHA 2P06A 3LUTB 1F4AA 2F43G 5F5IA 1XYPA 3EJKA 1XNRO 1ENSA 2NR5A 5LMUO 4BA6A 1XMQO 4XBLA 5F9TA 5KUKA 4Q0QA 2LTNA 4GMP1 1UFIA 1PNMA 2JKBA 2YHJA 3O7OA 2BRTA 1SFPA 1AROP 3IAQA 4CEWA 2L35A 2C24A 5LEKA 1WA4A 2D93A 4JGYA 1LHUA 5JI9A 1GN3A 4OHVA 3AB0A 5LASA 4IEXA 3NNFA 4X6RB 2EICA 1W9TA 1XE7A 3INAA 3POJA 1CXZB 3K06A 3MLLA 2HWE1 4QHOA 5GKAC 5I0SA 1DQ0A 4QX8A 1S0BA 5JH7B 3GVMA 1G8WA 2BWCA 3KV4A 3UT5A 5J96B 2V73A 1DCSA 3JD71 2VQEB 5F3IA 2P3IA 2P3YA 5LY1A 1GP5A 1TAEA 1EAH2 2H6BA 1N33O 1VIWB 3VN4A 3K4ZA 4FM1A 4DXTA 1GRJA 4B29A 1ZRRA 4P9XA 4I7ZB 1ORQC 3JD1A 4URTA 2JX9A 4E4SA 2VZPA 3CRAA 4RN5A 1HXS2 3POEA 2P4EA 4UCUA 2HLEA 3WQ7A 5CYYA 4GB32 3ENRA 1GN2A 4MH0E 5CG8A 1SERA 1R1A3 1UZWA 3AKTA 1JQ0A 4R4ZA 1UKGA 2QCSB 3GB7C 4DINB 4QAWA 3AK1A 3OD4A 4B3TB 2XLGA 1ST8A 4QPIB 1X36A 3B69A 1CPNA 1GM7A 1XE8A 4K9SA 2QQKA 4XUOA 2BTQB 4Z1VA 4RYDA 1W6PA 4X62O 1RMU1 2B8MA 1APNA 1FMD2 3AZZA 4FFBB 3NXSA 3PN1A 4CXXA 3K08A 3WNPA 3IDEA 4QX3A 3O1UA 3LFMA 3RZKA 4CUBA 3V0BB 2XJSA 3ABLB 3B9CA 4JGZC 5A3UA 1WMFA 3PUAA 1F5FA 2ZKLA 4E4ZA 3T4VA 4DK0A 1W8HA 5BNOB 5A1LA 3UJOA 1N4CA 4CH5A 4GH4A 2Z42A 5A6QA 4CDQC 1AX2A 1JOYA 3N3HA 3QH6A 4YIOA 4NN0A 4TOIA 3OEEG 2UY8A 3A0BZ 4DV6O 2PF4E 3BYWA 4GIQA 2VQEO 2O57A 3POSA 4UBHA 3WB0A 2QDOA 1S2BA 4LBJA 3MD0A 4CDUA 2I2SA 3IZOA 2WRAA 3FKSG 4A44A 1D4M2 1GH6A 4E4DX 4YG0A 5HCFA 2QQMA 4IYIA 3LSEA 5C8CB 3VKMA 2PHXA 5EPAA 4FP2A 5KXBA 4QDSA 2ARHA 1NA1B 2LJ2A 2RDRA 2V7QG 1VQLV 2C5DA 4R50A 4K0KO 1Y6XA 1SA0B 3RZMA 1MVQA 2CGPA 2F17A 4H7LA 1Y76A 3BTZA 3FB6C 2JDNA 2BTOA 1CGPA 2ZMNA 3TN93 3WG7B 4TQDA 3AL5A 5A70A 1JJ2U 2BSKB 5A6ZA 5I93A 4FFGA 4IEQA 3IWZA 3E22A 2ZHNA 5EV7A 4LTAA 3JBG2 3P1IA 4NTXA 1GK9A 2ZE6A 2XT9A 2C4XA 4W6YA 4I2OA 2P34A 4G27B 1ZL8A 4JKLA 3WG4A 2BNMA 2BBAA 2YU1A 3IT8A 4Y4YA 3VDCA 1I5YA 4MTGA 2JJ2G 3QACA 2XAQA 1O4YA 5T5PA 1CAXA 1O5LA 3ABZA 3A0KA 1Z5WA 3DPRC 1DQ1A 4I02A 4DV5O 1VE0A 3VBSC 2B5HA 2JXAA 3E1F1 1NCQB 2ITDC 4QX5A 1MS4A 1W6OA 5IVCA 1AR62 2HWF2 3VBUB 1UZ0A 3K3OA 1DZRA 4Q4W2 4UOJA 3ON7A 4LFBB 2EIJC 1W9SA 1QXRA 2VRZA 3Q8CA 2X5IB 4DR5B 3ETEA 4ATFA 1NTZH 4H14A 4QPKA 1QOTA 4QPGA 5A9GA 3JSNA 3RWNA 5IK7A 3FBMA 4JGYC 4Y1UA 3BIWE 4QNHB 1PM9A 1RUD2 3OBAA 2PI4A 2DN9A 4AI8A 4BLJA 3EB7A 1ZWIC 3T3YA 5C70A 2JGDA 3VHRA 2XNDG 4ZKIA 1FPN1 4JDNA 4Q4X2 4HPKB 4NPRA 1BE3H 3WDXA 4LIVA 4NXMO 2WSSG 4D69A 5FY7A 5B1OA 4S2DA 4JRLA 4M4RA 2ZKOA 2G9ZA 3ABLC 2ZT9B 4LFCO 2H8PC 2ETEA 2WL1A 3S7IA 4CU6A 4AHYA 2IXJA 5K1PA 1FXVA 4QIWF 1MS5A 4K8FA 4RFRB 4N43C 1N3OA 4YJ3A 5FMOS 1K3IA 2JEMA 4AI1A 1NZIA 3W7TA 1OQDA 1K4CC 4UVCA 5APAA 5JI7A 4KHPO 1K5MA 1XNQB 4QXCA 3T1HB 3DSQA 1SLCA 4QQLA 3S57A 4DV5B 4I50B 4DUYB 4RQFA 4EEQA 1KB9F 4COUA 2XJQA 1ZUQA 5JOYA 4X8NA 4D7TA 3ZN6B 1PZ9A 1D4VB 1Y9GA 2RV9A 1IXBA 2P7TC 4X20A 2LP7A 2DW4A 1OH3A 2VVEA 3I59B 4ZBMA 5H9QA 5JR2A 1LEMA 3I7DA 5KC6A 4BMEA 2G19A 3RYCA 4CCKA 3TAYA 2VCBA 1TMF1 2YUAA 5FZDA 3UYJA 2R32A 5K8SA 2BWAA 5L3GA 5E1AC 5LYJB 2JDUA 2BNNA 1SLAA 1UMZA 3U4SA 4HK8A 4LQRA 1S5JA 2WFF3 2ZGMA 4LO4B 4PA6A 3ZSKA 2R6QA 1ZNPA 4PIYA 1E5HA 4LC1A 1ZRIA 1S2KA 2ZHLA 1GSLA 3P3PA 2ARXA 3VOUA 1V54C 1ULPA 1W6NB 2D43A 2DU1A 4BIOA 1AL0G 1N32O 3IM0A 1OCOC 3E35A 4XDJA 1NA1C 1FS0G 4MX3A 4R8HA 1QJX3 5F3GA 2KA3A 4AILC 3ZPYA 4C7UA 1LOCA 4XC9A 3M3QA 2R9AA 2ZMKA 1FKAO 5L3CA 3R05A 4OQ8A 2V4DA 1ZRFA 1U5ZA 4YZ2A 1YJLA 1Y4WA 1W90A 4Y20A 4KHPB 2RMU1 5GLUA 4BU2A 1UYPA 2HWE2 1XMOB 1XNKA 4CXWA 3M2MA 1JJOA 3AVSA 4QHZA 3U75A 2UYAA 1K4DC 5JMCA 2WAAA 1ND2C 2OS2A 3JCUZ 4ZXKA 4LLOA 3SPHA 2WA3A 2CU5A 3GGLA 3CNAA 3EHBB 4ZY9A 1R73A 2WLQA 3ZSMA 1MEC3 2ARAA 5L7OA 3T1MA 3K0GA 1DYPA 3CO2A 2WSVA 3S5QA 4FLXA 5HFLA 1X7NA 5LZ6A 2WN2A 3QH7A 3DPRA 2GDFA 1BMV2 2WFPA 5FNVB 3TEWA 1JMKC 4LE3A 4GA9A 3F2ZA 4XILA 1HV0A 1CP9A 1LU2A 2X5IC 4DV4O 1XQNA 4AR2A 1HNWO 2PHWA 1GICA 1AX0A 2M6YA 1JYIA 4LH7A 3ZXDA 3OGRA 1KP3A 2QA4V 3IN9A 3RYIA 2Y33A 5DM6V 5KA5A 1SQVH 1X9TA 3BCCH 2JG8C 1RUNA 1I9RA 4ICGA 3PU3A 2W52A 1I7FA 1HQWA 3LFIA 3SPJA 2JE8A 4GQ7A 5LA2A 3ZHRA 1N47A 4KBBA 3KQRA 4LO6B 2Y69B 4QQOA 4XCBA 4YY3O 1X50A 1OA4A 3S6PA 5FZAA 4JI2B 5JVDB 2LUWA 1WMXA 3PJSK 2D2CB 2UUAB 2YYOA 3AFKA 5GZGA 3B7MA 4UCOA 3CX5F 1MS1A 5EYYA 2UWBA 4G4FA 1S55A 1EM1A 1EN4A 4OQ9A 5IY5B 1F51A 3W5MA 1YJNV 2AEYA 4FBFA 1L0NH 2RMKB 2VE1A 2HJIA 4YARA 1GYKA 5FJHA 3I56V 1LAJA 1WUVA 1UZZA 4GULA 3D4KA 4MHRA 3SCHA 1GMGA 1IURA 4YVSC 3CPWU 2ZGNA 1XB9A 1WNSA 2R49A 4EN8B 2Z69A 3CF6E 1FXKC 5LWBA 2DVGA 2X29A 3L72H 5IDJA 1FFTB 3MI8A 1DBNA 4FFIA 1C8M3 4NXMB 3IAPA 1HB1A 3ES1A 2WLMA 1ENRA 2J7MA 3RYKA 4XQ4A 5HCHA 1K9MW 3VBSA 3PUIA 4PIXA 2XHKA 4PDWA 1JYWA 1O5UA 3KGLA 4XW3A 1C5IA 3H9VA 2VMIA 1G6UA 3AG2B 5IK4A 2VOXA 4OI2A 2YIDA 2JKXA 4JI8O 5B66Z 5EBMC 4IE0A 1K5MB 4CDWB 5AFBA 4P14A 3GZTB 5DXDA 1QWRA 5T5JA 1NH2D 5CBLA 3TCUA 1N8RW 3I54A 2WJSA 1S0VA 3OGVA 3ZFEA 3SLIA 3L9DA 1T2XA 1X82A 5H9CA 3CYOA 2Q30A 1TE1B 5IWAO 1V0AA 2QQNA 2VOKA 1YWKA 3JB8A 5J2TA 2EXIA 4FPGA 2YIAA 2QQVA 3K5NA 3B00A 4BW5A 1V6JA 1YTFD 2WLLA 4J9ZB 3CXHF 4YM2A 3VBSB 2X09A 3U07A 2RJ2A 2KXLA 1X8MA 4PQ9A 3NKTA 3O1OA 1O8SA 1AL22 1JVMA 2ZGKA 3D3AA 1PO12 5KXCA 1XNAA 4FFBA 4DV1O 4LF9B 3MGUA 3TN91 3ETQA 4X20B 4LF5O 5H6RA 2X7RB 4N21A 3CMEV 4QGNA 1GAXA 3N9PA 2X10A 2BEOA 5FY8A 4BOWA 2FDGA 4ASMB 1Y9MA 5B1AB 3OEAA 2VBPA 4Y1ZA 4AHZA 1M93A 1H9WA 1SZXA 4AVTA 2OPKA 1V9U2 1ULGA 1NQDA 3I2HA 5IJRA 3AG1B 4AQ2A 3JUUA 2ZEWA 1E1QG 3GJAA 1J3QA 3VZJA 4GXLA 1QHDA 5EJ3A 2DCZA 1WB8A 4EWEA 2P3KA 4ZS2A 2NMOA 4BAYA 1AR71 2WFF2 3RYPA 4WVVA 4XJZA 3S3XA 1P49A 3VBHA 2XH6A 1A8DA 3GBWA 5K0UB 4LP8A 3AXEA 4HONA 3ML0A 3NNJA 1E1RG 3T1YB 3JARA 4HSLA 4PBPA 1O4ZA 1O7FA 5JPMB 2FQPA 4FK5C 1MMMA 1W99A 3VQXA 3X2QC 1VQNV 1QLEC 4IGOA 4L9BA 1NOVA 2BFUS 2ERFA 1GO3F 2Y69C 2ZDIA 3AG3B 1S0IA 5FXZA 1F4MA 4NXNB 2ZTNA 5EHDA 2CSGA 2E63A 1WD4A 3C7EA 4NOTA 2E74B 3OYWA 4N43A 4QKBA 5BXZA 1RGSA 1GN6A 4B1MA 1LNQA 1AVBA 1YTFB 2ZR2A 1KD1W 5AC92 2IJKA 5JZGB 5EZYB 4YG6A 2AEZA 1XI1A 2NM1A 1UF2C 4WFGA 4CS2A 1EZJA 1V70A 4OCTA 1VLNA 4QXBA 3K03A 1VAKA 2NYYA 4YW5A 3AVRA 2Q7EA 3JALB 4QDRA 1ULDA 1GKBA 5C9AB 3OYWB 4I55A 1B35A 2JGDB 3ZR5A 4M3CB 4QKDA 2KB1A 4J7ZA 1P7BA 4QX2A 4FAGA 4MXWB 1SBEA 1ULCA 3VZNA 2B1IA 5LOVB 1TEIA 1V6MA 4WBNB 2PMWB 2O8QA 1K5QA 4FM0A 4Q1RA 2WWSA 2Y60A 1QLNA 4XMAA 1IKPA 2P37A 1UNBA 4H0LB 4JPRA 1YIPA 4FJCC 3BI3A 2HWE3 4NAMA 4LULA 1K5MC 1GZTA 1YQ5A 4XFIA 5LA6B 3GCWA 4LFAB 2W1WA 4KGGA 2F93B 4Z07A 4FSJA 1GKFA 1UW8A 2F66C 4IERA 1XU1A 5GTIZ 1VBD3 2HWB2 1Z0HA 4XDOA 4X66B 1RUJ2 1FJGB 3RZLA 5C6CA 2EX3A 1OT5A 3HJRA 5CVRA 1SQGA 5J98B 1H4GA 2A06H 5C4WB 1SDDB 2GN7A 3RZJA 1LJ7A 3ZYGA 1OZ0A 4LO7A 4LKEA 2UUBO 1FI2A 3SPGA 1VRH2 4DEQA 3WG2A 3THTA 2K46A 1AL21 1N3PA 4R9CA 5CA0B 2DYRB 4UW6A 4JI5B 2V4VA 3Q8BA 5A7WB 4ABMA 4RHV1 1N1SA 4DV2O 3CC2V 3ZRXA 5LP6B 1VBB3 1CQ9A 1UCXA 1NJIW 2ET1A 1W0OA 4BR6A 1AR61 2RS53 1MG1A 1JYTA 2UXXA 2JK5C 2PAKA 4FPHA 4P9GA 3GZUC 3H1WA 3JCZA 3HPLC 2PY5A 1H1AA 1U97A 2XJUA 1TME3 1O4TA 2EIMC 5J2TB 4CCNA 2XR4A 2BP6A 3TWIA 3AKSA 4AI3A 4EE2A 1YJKA 1NXD1 4P5HA 3O0WA 4IE4A 3CCEV 4GB33 1QQP3 3WG3A 5EQUA 3E97A 3CC4V 3RWKX 3RZGA 5JJJB 1GP4A 2NN8A 4B8EA 4QJFB 5KLVH 1ZSPA 3QO8A 4FPYA 1FFXB 5BNOC 1VBA2 1A32A 1PO22 2XHNA 3DCQA 4DRVA 4MVQA 5FPXA 3U1XA 4FPLA 1IZ3A 2IZWA 2VBDA 4AQYB 1F4NA 2QE7G 3HKEA 1JYCA 1UL9A 4XFHA 1ZZBA 3S7EA 3UKVA 1HRI3 4IE5A 2XB6C 3Q4HB 4EKWA 5A3TA 4GKKB 5JSPA 1NH2B 2CTVA