2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
2Z69A 2QDRA 1CGPA 1O3SA 3MZHA 3D0SA 4GULA 4QXKA 2K9ZA 3WW1A 3H8UA 4XFBA 1UCXA 2QVSB 1J3RA 3ROUA 2D5FA 5KBFA 2D40A 5KHJA 4XEZA 5I0TA 2BGCA 4PIYA 4HN0A 1UD1A 1ZRFA 1PMIA 2PTMA 3NKTA 3FZ3A 1GQHA 3UKTA 3SXWA 1PM7A 4Q0VA 2MHFA 4LLOA 5C8WA 3OCPA 4I09A 2PAEA 5I8YA 1X8EA 1X82A 2MNGA 3CLPA 3R6SA 3SCGA 3UKVA 2BNOA 4AVCA 3EBRA 4MGZE 1Q5OA 2GH2A 4MGYE 4O9EA 2FMYA 1YUDA 1NE4A 2OA2A 4I2OA 5JSOA 3LZZA 4P9GA 2ET1A 2UY8A 5BPXA 1QXJA 1HW5A 2P17A 1UIJA 1RUOA 4O9GA 4PIXA 1CAVA 4QM8A 4Q0UA 1NXMA 4I0AA 4JV4A 4LUMA 4RD7A 3H3ZA 3HT1A 4IETA 4TLFA 4YRDA 2EVXA 3RZZA 1G6NA 1SQ4A 1CAVB 4B29A 1J59A 1ZREA 2IXIA 3H1WA 3LA2A 2CV6A 2Q30A 5CU1A 4HBNA 2VPVA 4FAHA 5J48A 2Z2SB 1IPJA 5FDBA 4EV0A 4Z82A 3E5UA 5D1IA 4Q0QA 3I7DA 4YARA 1I6XA 2D5HA 4LULA 3OF1A 5I0UA 4QM9A 4YSFA 4XFAA 2UYAA 4L11A 5FPZA 2ZKLA 3BCWA 2DCTA 3RYRA 5FLIA 3H7YA 4HN1A 3OGJA 1WLTA 5K8SA 4FBFA 5F1RA 4QGLA 2QJVA 5E16A 4XETA 3WW2A 3M3IA 1CAWB 1GQGA 1FT9A 1ZRCA 3LA3A 4D7SA 2VQAA 5JAXA 3HT2A 4YNIA 2GAUA 4MX3A 2GC2A 1ZRDA 4JVAA 2V09A 1O5UA 4XF0A 1CAXA 4WZCA 3IDBB 5EZWA 1X7NA 1JUHA 3NL1A 4JTOA 4UBGA 2PHDA 5I0RA 1J3PA 5E1RA 1CAXB 3SMHA 2IC1A 5BXXA 2OZ6A 3TNPB 3PNAA 2H0VA 4HZFA 5JR7B 3SCHA 3FHIB 1TQ5A 1OFNA 2CAVA 4Z07A 2ATFA 4PIZA 3B02A 1DZTA 2PAMA 4IEYA 4R52A 1QXRA 5T3NA 2Q4SA 3H3UA 4YYOA 3FX3A 3GBFA 4Q29A 3IBMA 5KHHA 2GZWA 1ZZ7A 1I5ZA 4QGNA 3S7EA 3PVBB 4XFGA 3HIFA 3WW4A 4I3PA 3E5XA 5KHIA 5FPXA 1YFWA 5C6CA 5LEJA 4QGMA 3CL1A 1Q43A 2QNKA 2ETEA 5JCTA 1RC6A 3CEWA 2BYVE 1DGRA 3BPZA 1XRUA 2XKOA 4UXAA 1O3RA 1ZX5A 2QCSB 1OI6A 2H6BA 3FWEA 1NYWA 4BH9A 2GC0A 1QWRA 4KU7A 2EA7A 2OZJA 4OLLA 3GYDA 4IERA 1OMIA 3I54A 4H7LA 3MDPA 4XF4A 3TNQA 3E5QA 4AQ2A 2K0GA 3E97A 1O4TA 4ZU7A 2KXLA 2F4PA 2IXCA 1ZRRA 2O1QA 4MV2A 4KWJA 2XL9A 1NZCA 4HSJA 2XGXA 5FQ0A 3ZDSA 2PAKA 5J7MA 2XL7A 4IEOA 1RUNA 4PJYA 1CAUA 5FQ0B 1O5LA 1Q3EA 3SCFA 2CGPA 1YHFA 4CYDA 4LUKA 1DGWA 4KWLA 4Q0SA 4Q0PA 2ZCWA 1J3QA 1RL3A 3NVCA 4ORFA 2H6CA 4IEXA 3WW3A 5I8SA 2PYTA 3H1MA 2UY9A 4I0BA 2XKPA 3CO2A 2XHKA 3EJKA 2N7GA 3QOPA 3MYXA 4IESA 4BYYA 2VECA 4XFIA 1ZZ8A 5J3UA 1FXZA 2I45A 3E6BA 2O8QA 1L3JA 4META 4AXOA 3FJSA 2PFWA 1H1MA 2GC3A 4FAGA 3DKWA 4K8FA 1VR3A 2GC1A 1O7FA 5CADA 2C0ZA 4R8HA 2CAUA 2PHLA 3QACA 3OD0A 1ZZBA 5BUVA 4LA2A 4HLTA 1SFNA 5BV6A 3ST7A 3FFQA 4LTAA 3HQXA 2BNMA 4XFCA 3G7DA 3PLQA 5JSRA 1LR5A 2B8MA 3BALA 2OPKA 3LOIA 4KWKA 3IIAA 1XE8A 4HVQA 1YLLA 2XLAA 1ZZ6A 3LAGA 2E9QA 4IEUA 3S0MA 4AVAA 1EPZA 1YFUA 3ETQA 2HKXA 3SHRA 4MUVA 3CJXA 3KSCA 4BHPA 3RDIA 2XLGA 4N9IA 4XF9A 4MH0E 3OTFA 5BY5A 3BB6A 3L2HA 4HVOA 3DV8A 4AVBA 5LRSA 4JTNA 1O3QA 4EWDA 3I59A 2BEOA 5JSPA 4HMZA 4L2NA 3RPQA 1VP6A 3M70A 5I0SA 2Q1ZB 3EO6A 4J1XA 3IWZA 1WGPA 4I02A 1OD5A 3I59B 2FQPA 5HI0A 3LWCA 5EFUA 3KGLA 4EWAA 2IXHA 3U10A 1SEFA 2GU9A 4LEJA 2WC2A 4FT8A 3U11A 3DL3A 4DINB 5KHKA 1IPKA 4HSLA 4ZU5A 1NE6A 2BNNA 2Q0AA 3H7JA 2EAAA 3RYPA 4BIFA 4IEZA 3MPBA 4EROA 3H50A 4F7ZA 2IXJA 1RTVA 2B9UA 3LA7A 3EHKA 3IDCB 4IEQA 3UKNA 2UYBA 3KMHA 1LRHA 2PA7A 3USSA 4IEWA 4E2QA 4ONUA 1EY2A 2OYZA 1LKNA 5FCCA 5I91A 3E6CC 5LEKA 3EQEA 2WFPA 3FE5A 3S7IA 3N4MA 2ET7A 2IXLA 4MGIE 1H1IA 4A2UA 4IEVA 4LA3A 1J1LA 1ZZCA 1WA4A 4XFFA 4X6RB 5FLJA 1CX4A 1CAUB 2D93A 4D7TA 3NJZA 3ES4A 3KGZA 3BU7A 1QY4A 1YFXA 2MPFA 4E2GA 4HVRA 4KL1A 1J58A 1EYBA 1UW8A 3DN7A 1LB2A 4I01A 5I93A 4NVPA 4AQ6A 1Y3TA 1YFYA 2IXKA 2Y0OA 1UPIA 1ZVFA 5I8TA 1O3TA 4IEPA 4XFHA 4UBHA 5FLHA 4N9HA 4QMAA 4WBBA 2HJIA 4MZUA 4QX5A 3RYKA 4ZU4A 1YWKA 1X8MA 5CVRA 4KU8A 3RNSA 4EWEA 4OFGA 3ES1A 2B5HA 4J1WA 5LRRA 4WVZA 1V70A 1CAWA 3ELNA 3ACLA 1FI2A 1UIKA 1ZZ9A 4X6QB 3NW4A 1DZRA 3NSTA 3VHRA 3E6DA 3CF6E 3H1YA 1U12A 3H9AA 3O14A 4MGKE 1XE7A 4E2SA 3KCCA 1ZNPA 1VJ2A 4XF3A 1RGSA 3U0ZA 1Y9QA 3JZVA 5AVPA 3C3VA 1EP0A 5KHGA 3D0JA 4F8AA 4XF1A 2XLFA 3D82A 2PQQA
chains in the Genus database with same CATH superfamily
4QKDA 3R05A 4PLOA 1CGPA 1IURA 5CBGA 4XFBA 3WX5A 5KHJA 1V6MA 4S2HA 4U36A 3RZKA 1SLAA 4XHXA 3ABUA 5F2VO 3D36A 1RUE2 3OCPA 5B1BB 2EINB 1X82A 4AHWA 5CKQA 1ULOA 1XXNA 3CCJV 5GZGA 4XC9A 1OLME 3K4AA 1MABG 2HEPA 4JI0O 4LF8O 4P9GA 1QXJA 1GP6A 2UUCB 1RUD1 4LXLA 4O4JB 4PELA 4R9CA 3FB5C 1W39A 2VRZA 3BVOA 2YHJA 1H2GA 1XNTA 2XAJA 2ADDA 2VBDA 3RVYA 1M4WA 2XONA 5GLZA 3E5UA 3QCWA 3AMHA 1SERA 4DR1O 1R3JC 5L9RA 3RBZA 1AI7A 2ZIMA 1RUD2 2BBVA 3WDXA 3POFA 1W8NA 3THOA 4PLNA 4QB6A 5JIUA 1E5SA 4QGLA 1S5HC 3MLJA 1WMFA 3H9VA 4DXSA 3VBBA 4XUTA 3TEYA 4H37A 1S2BA 2PUSA 3CJIC 3JAMN 1K42A 4QB2A 2OIIA 1JX9A 5FPVA 4JVAA 3RYFA 2PY5A 1Y7BA 1WN7A 4KBBA 5JH7A 4HKWA 4MSVA 2D6LX 5DG2A 3ATGA 2XHBA 5ITZA 1SRYA 4NHKA 2JK5C 4RWUA 1XILA 1TE1B 4YYOA 2ZHLA 1OA4A 5FZ1A 3J7AU 2RMU1 5DDJ1 1R64A 1KMIZ 1S0JA 3NNFA 4FPEA 2ZZJA 2VMHA 3PVBB 3SJCC 3E5XA 1BHAA 1CX1A 2YSUB 5JCTA 2BWAA 5CMUA 2VQ0A 1ZX5A 5DM6V 2VZ1A 5CA1A 3GB7C 2VOTA 1DYPA 1OA3A 4N23A 3A23A 3O1OA 1IBKO 2RMU2 5DDJ2 1UJWB 3AK0A 1RUG3 5A6YA 2O8OA 1CZTA 1V6KA 3AYCA 4QJFB 2JGDA 1K7DA 3HNBM 5LHHA 4S2GA 2XR4A 2OQ7A 3FUOA 2ZNJA 3OUIA 2XL7A 3ZFGC 1BVP1 4QPJA 1AR1B 4DRXB 3K48A 2R9RB 4DV5B 4LF6B 4FOVA 4KWLA 1WJZA 3SNMA 1BKZA 4UFZA 1OC1A 1PX4A 4CDUA 4FOWA 3WW3A 1A8MA 2PYTA 4FLYA 4V2WA 4K3AA 4WVWA 1PL4A 2XKPA 2BOCC 2GN7A 2ZD9A 1VB2A 1XU1A 3V0BA 2R0HA 3MFCA 3KKYA 2WUHA 4WCEV 3FFZA 2V4AA 1AB3A 1VRH1 3MPPG 4J10A 1ZAUA 3Q8FA 4LFAB 4DR5B 1CD3G 4YZ1A 3GBGA 3QACA 4OUSA 4Y33A 4JKMA 3KF3A 1ZBA1 1WD3A 3FFQA 1F35A 5IT9N 4GMP1 4CDWB 4AHYA 2WWWA 1HQNA 4J9YB 3CYOA 1VRH2 3G67A 1YLLA 1REFA 1OQDA 3ETQA 4EN0A 2C4XA 4ZOLB 3ZKUA 3JQWA 1ZBA2 2YS8A 5LXTB 4L2NA 4TTGA 4Y4YA 1NT2B 3KCXA 3VUOA 1JJOA 4RGKA 3DC5A 4CZSA 2GU9A 4INDA 1YXWA 4QQPA 3U11A 2AH2A 1Q8IA 3ZHUA 3E8HA 1NUKA 5EZYB 4JC1A 5LCWL 3GF6A 3OEHG 4EQVA 2P90A 1RTVA 3OOXA 2X0LA 4LNUA 5ABJA 1QQP1 1A6CA 1C5IA 3CIHA 2BERA 3MBWA 1F4NA 1VMHA 1QJZA 5C7GA 1UXXX 1J1LA 5FLJA 1CX4A 2ORZA 2VY0A 1UXZA 4Q8KA 5JCOC 1D4M3 3B8MA 1FXKC 5EIBD 2ZE5A 3RYCB 2ZX1A 3RVHA 1YFXA 3B01A 1EYBA 4GD4A 2YROA 1QQP2 1POQA 2VCBA 2VMDA 1SF9A 3MI8A 3C7FA 5EC1C 3THDA 4LBOA 4GKYA 3GCWA 4UBHA 1SETA 1GZCA 2D6MA 1EUTA 4FFBA 4MGQA 5CZKA 3I2OA 4JPRA 1HNWB 1U5XA 4CH6A 1LNQA 1SLLA 1ZRIA 1RUH1 3ACLA 1KFXL 2WT0A 3V56A 1PIV1 4X6QB 4OHXA 5A7WB 1V6JA 4LF5B 2HWF1 2WYSA 5DMYA 1HB2A 2BBAA 2PHTA 5A3LA 2Y26A 5HCBA 3MGUA 5ANNA 1OVSA 5J1XA 2DJVA 3VBFC 4J7ZA 1VIWB 1BSMA 2YEVB 1M4UA 3AK3A 5FZKA 5FXVA 1SESA 4NAMA 1RUH2 2PQQA 2QDRA 5FR3A 3CCLV 1FMD1 1PIV2 4AQYO 1N34O 2QVSB 4A6OA 4YVWC 1NLSA 2HWF2 4Q4W3 1I5YA 2EALA 3N2KA 2KG7B 3CXHF 1NCQB 4NHYA 2WNEA 2PHRA 5H9SA 4LP8A 5A7SA 2QFEA 4UV8A 4CCJA 3J9SA 3ZHQA 2X10A 4X8AA 1FMD2 3HKBA 3M4FA 4M3CB 2B9VA 2FMYA 2YU2A 2WNVA 1HJFA 1LOEA 3MW4A 2IWGB 1EAH3 2ET1A 3P1IA 4ZKTB 2UY8A 5H5NA 4GKXA 5C8CB 3ZXKA 2AZ5A 2VQFO 4C1WA 4YZ2A 3CJHA 4ZZ5A 4WVMA 1WP7A 1STMA 4UWDA 1LHVA 4YZ5A 1IBMB 4HBNA 3HBKA 1DQ2A 4S2DA 2FTKA 3V0AB 3VL9A 1SBEA 2WWUA 3WR0A 3BVCA 5EV7A 3A0RA 4JV5B 1GP5A 2BGOA 5FZFA 4IYIA 1FJGB 3ZS8C 2DCTA 1HB1A 4NYKA 4FOYA 4GH4A 1H8VA 3OGJA 1VALA 5BNPB 5F1RA 3IB3A 3IGAC 2NN8A 1N1VA 2XHNA 3WP3A 2WO3A 4AI3A 4D7SA 4AWDA 1ZRDA 5A33A 2E7TA 4C90A 4UBGA 5I0RA 3KB5A 4DO0A 2HYXA 3JCZA 2ZGLA 5T5OA 1J83A 2Y64A 2A0LA 4L8QA 4DUXA 1OT5A 3FKSG 4W4KA 1UKRA 2GZWA 5A3TA 3SLIA 4YLZA 4ICGA 3FL7A 1S1AA 5A6XA 1HR0B 1Q43A 1WB7A 4P9XA 4JDNA 2H94A 3ORJA 4OPAA 4PQ9A 1NTKH 4AHZA 3N7MA 5EHDA 2OQ6A 4HZ3A 3O0WA 5EBLC 1PV0A 2Q7GA 1M1KW 2UXCO 3ZYRA 3P6BA 2GMMA 3W7SA 4ZU7A 4LPLA 1CJDA 2XL9A 4KWJA 4YM2A 4KG8A 5JXHA 4XDPA 4E2LA 2DYSC 2ID4A 2RG4A 4YG6A 3A0HZ 2HJFC 2NR5A 1ULEA 3AMQA 3D6EA 1TMF1 3ABMC 4GLXA 4BU2A 2RMKB 4P08A 1KJRA 3X2QC 1ZYBA 3TGUH 2EILB 1JQ0A 4JCKA 3CRRA 2HBUA 3E8FA 5EBMC 3AG7A 3AZVA 4QX2A 3ME2A 1TMF2 1NH2D 3AG3B 2LM3A 3M3EA 2WAMA 3ABKC 1ZWIC 5AFEA 2XQXA 2B4KA 4GCZA 5JH7B 2WZ8A 1Q56A 4BQ5A 1JZ7A 1ZZ6A 4J11A 3K5LA 2QE3A 2Z3YA 1ULDA 4FZ1A 5BNOC 1KQRA 2ADEA 4NROA 4I30A 1PZ8A 2AEZA 2BEOA 5APAA 3ZFEC 2VCMA 2HWC1 3KT7A 3JD0A 1G9FA 1AL21 1IQAA 4NHLA 1N3QA 1SEFA 3UK9A 4OI1A 3DL3A 4DINB 1MVEA 2VQEB 1FNYA 3A7QA 3TWIA 3ZXEA 5CKNA 2GDFA 3MV01 4H2AA 5FO8B 2HWC2 1CEZA 1LKNA 5DUVA 1AL22 2JGDB 4XUPA 1B6QA 2YXYA 4MGIE 1H1IA 3G6EV 2D3OW 4PI0A 3BU7A 4A6SA 3DGEA 1X4TA 1G4YB 5GM0A 1POV1 1EM1A 4CUBA 2PZSA 3AJZA 4CDUB 2AHZA 3MHSC 3POWA 3HN1A 3WY6A 1YFYA 4GUNA 4DUZO 1S0DA 4MHRA 3V0BB 1DFQA 4DPNA 2LW8A 5IJ9A 1QR8A 4XFHA 3WCSA 1H8EG 1JODA 1YSCA 4ZU4A 1HRI3 4HKLA 2TBVA 5BNNC 4KU8A 3JAWA 3ASOB 1XNRO 4Y1UA 1MS5A 3ASNC 4YGBA 3KV4A 4GB33 1AJKA 5I0DA 5GALA 2GNTA 3DKQA 1DGWX 2ZGRA 4GYCB 1KBHA 2XTAA 4RUFA 4ES9A 1SG3A 1WP8A 4NRQA 1AR5A 3D0JA 2YIBA 4R4XA 2E75B 3AL5A 4XDJA 5F6KA 3UKTA 2W08A 1D5AA 5IJRA 4BQXA 2A5ZA 4E4SA 3KT4A 1G8WA 3NNGA 1KECA 2J1EA 2FDJA 2V4DA 1ASJ3 1UD1A 3N2GB 1GNZA 4LO4B 4O2BB 4YM0A 1LJ7A 3WNKA 3EBRA 1ZL8B 4WBNA 2OIGA 4OYUA 3NNLA 4OZXA 3RZMA 4W4ZA 3IAQA 3VBHC 5DG1A 4LNUB 1HKDA 2RDCA 1RINA 3OUHA 1GNYA 4TZDA 3KQRA 4LUMA 3KVBA 2I2SA 4NPRA 1CAVB 1MS8A 2WLIB 5ACA3 5FKCA 2VTFA 3H1WA 1M56B 2ZS6B 1IPJA 4N8MA 4Z82A 2FCTA 2Q8EA 3C7OA 3ZYJB 1YI9A 4IV1A 1LUVA 1I6XA 4WFFA 1N36B 3ZMNA 2D97A 1JVMA 1RMU1 1F51A 1ODMA 2WZEA 4LBJA 4CH3A 2FDGA 2HYKA 4FFBB 2NNUA 1DLLA 3A0NA 3VKOA 1H8TC 1JHJA 3ZFFA 4TUYA 4XETA 4JGZA 2HFEC 4BAYA 1JN2P 2QKCA 2ZMNA 1N3OA 1RMU2 2WL1A 4OX9O 4LQRA 4G27B 3NNJA 1O59A 3J80N 4JGYC 3A8TA 3DYOA 4LITA 3T2OA 5JMOA 3O1VA 5DAXA 3UM7A 2P6CA 1BEV1 1TQ5A 4Z07A 2RS53 5T5PA 4IL6Z 2PAMA 2EXKA 3VZMA 4OQ8A 3T4HB 3PTRB 5BR8B 1U5IA 1OCRB 1YQ5A 2XAFA 3TBDA 4PF1A 3HAGA 4TXWA 4I3PA 3PIJA 1NI8A 1BEV2 1M5IA 1O3RA 3OUJA 1NYWA 3BY6A 3POIA 5A3OA 1NJIW 2VE1A 2ZEXA 4GKKO 4B3SO 2QKAA 4Q5OA 4CEYC 2O1QA 3FMGA 4CCDA 2BOBC 4IV3C 1H6YA 3CJHB 4GWIA 4WVMB 2RQ6A 2D3RA 4B4PA 4CYDA 5L73A 2YXLA 1QJFA 4XJ9A 2M6YA 4IEXA 2JIJA 4ZS2A 3H1MA 5SV5A 5BNQA 5LBQA 4X64O 4YW7A 2Y8KA 3ZSLA 2LQTA 1PMHX 3W5NA 4YJ2A 4A45A 3VZJA 4YPJA 3PUQA 5F39A 4GH4B 4D94A 1AYN3 3AM2A 5E8AA 2W9XA 3MW3A 1O7FA 2C0ZA 1JZ8A 4CCKA 1KP2A 5GLVA 3U07A 4QGPA 1JA8A 2W39A 4F3JA 5LHIA 3BFRA 3NR7A 1S76D 2E7QA 4XUQA 1XE8A 4W65A 4JI0B 1RPRA 1VBC1 2CDYA 1ENRA 4JYCA 1Q86W 1HB3A 4X1KB 1DCSA 4RL7A 3S0MA 1BBT1 4K35A 4MUVA 2BSKA 1P84F 2R071 1I5PA 3O9OA 4YM3A 2L6LA 4BZ4A 4IIJA 4NRMA 1W8ZA 2YPJA 5LK7B 2PHUA 2JS5A 4DR2O 1VP6A 4PDWA 1UQXA 3HB3B 1OD5A 4LF4O 2PHWA 1VBC2 2Y6KA 3AG1C 4DR1B 1QOOA 4NXMO 1BBT2 3M2MA 2BVBA 1NA1C 2R072 5FP3A 1JZ2A 2ZACA 2GNMA 4BIFA 2NP0A 1AX1A 1UY4A 3N9PA 3AMMA 2JIZG 3S5QA 2VZQA 3VB9A 1Q6HA 2R061 3EB7A 1ODNA 3WF1A 2EIEA 4AI9A 4FFHA 2NQYA 2VUDA 2IVIB 5HFLA 1HX6A 1OLQA 2ENRA 4UW4A 5A7OA 3SPCA 1X9TA 2WLMA 5C3PA 1Y74A 2D98A 5DAPA 4HETA 1Z5WA 2R062 3DXRA 4FLWA 1W6PB 5LMUB 3T1HO 3Q8EA 2DUPA 4PA3A 4X66O 2TEPA 4F6RA 4G28B 1F4HA 2A6XA 1UZWA 1YWKA 2HLDG 1OFSA 3K3OA 1X8MA 4E4ZA 4PJ0Z 4RYDA 1MQTB 3N9NA 1BL8A 3ZM8A 4ARYA 2AREA 1UIKA 4FPYA 1GM8A 3ZIAG 1UY3A 4GJZA 2JS3A 3CKHA 2JIGA 1AYM1 1A32A 4XF3A 2WS93 5C3OA 2WPDG 1IBKB 1IS3A 2Y4UA 1KUQA 2ZX2A 5EP9A 2VOKA 2JKXA 1YJWV 5EYXA 3D82A 2Q8CA 3CCUV 1D4VB 4GULA 4MVQA 2K9ZA 3WW1A 1PKXA 1BZKA 3H8UA 3WHUA 3SPJA 1Q8OA 3QO5A 1AYM2 3MAQA 1DF4A 3NKTA 1TGOA 3I2JA 4FLZA 1TG7A 5T5LA 2Q9LA 2X05A 3R6SA 3R66A 2PQSA 4QDQA 4UFLA 5GTHZ 2TNFA 2ZEWA 1XNQO 4QNHB 5J98B 5L3CA 3DYMA 1XSQA 2OX0A 3N7JA 1EV12 5FIXA 4XMAA 3AXEA 3WXPA 3E8BA 4Q4Y3 4PA9A 2WA4A 2Y6FA 2VW0A 1J59A 2P5BA 4L8JA 1DF5A 4JI5O 1ND3C 1EPWA 4FAHA 5J9PC 1OPOA 2QQVA 1N32O 5KXBA 3C7EA 4DXWA 1SBFA 3JATB 2AR6A 5F5AA 4RGGA 2YC2A 1QBZA 1KD1W 4QM9A 2QGNA 4XFAA 1DQ0A 2JVDA 1W8OA 5H9PA 1BCXA 1NCRA 1TUBA 2GALA 4OZOA 3JAWB 2DYRB 4LKFA 2IU3A 1AROP 4AR2A 4MG2A 1ND2A 1O5UA 2A75A 4AZZA 3NL1A 2RJZA 1FD9A 3SMHA 5IW0A 4G9SB 1LNSA 3KT1A 1GM7A 3SCHA 1K5MB 3URFA 3P3PA 4DRVA 3O1PA 5G04L 2XB6C 4UYBA 4QIWF 2UURA 2VVEA 4LK7A 3PN1A 1VBA1 1OCOB 3HIFA 1DU3D 3E1F1 2ZEZA 4O4HB 3E22A 4I0XA 2JDMA 3CEWA 3K0GA 3OBZA 2V7QG 5SV8A 5B4NA 3H1IH 2DUOA 3POEA 2OPWA 4OLLA 4DXZA 4N53C 1VBA2 4XJWA 1VQOV 3OEAA 3BUCA 3G80A 1AJPA 3DPRB 4BLIA 1Y67A 2RM22 3ZXLA 5FYVA 4FO9A 2PAKA 5JOXA 2ZTNA 3ZN6A 5LY2A 4RR3C 1KS5A 4LUKA 3UETA 4D7YA 1J3QA 2ZA9A 5JZGB 2AZ0A 5EWSA 5I8SA 3P5BA 4PDRA 2Y69C 4LBKA 4Q4X3 4YHHO 3WUDA 2Y6HA 3WF3A 5KXDA 2WZR1 2VC9A 4AQYB 5EK0A 1O4ZA 4N21A 2CSGA 2XT9A 2W94A 3VBUC 1VR3A 1W0PA 3AX4A 1RJ7A 1R1A3 4CDXC 4TUYB 5L3DA 2PF4E 1WCKA 2W52A 4AF9A 3CRMA 4JGZB 1D7PM 1ZZBA 4CDQB 4C7UA 1QMJA 4LA2A 3I2FA 4DY3A 2WZR2 1N0JA 1H4HA 1L0NH 3PLQA 4QPGC 1ZA4A 1MEC1 3FHQA 4MW8A 3HQUA 1U0AA 3O1UA 3GZEA 5J2TB 1QNWA 3VKLA 2XBO3 4DS0A 2ZHNA 2HH9A 5HPOA 3GCXA 1OCZC 3HKDA 2B5UA 1TME3 3DV8A 1JMUB 1S0BA 1R091 1GOFA 3EO6A 3G71V 1VQLV 4K9SA 1MEC2 1RVF1 2ZPXA 2UU9B 1F2NA 3U10A 4LEJA 3LEMA 3KHCA 2JXAA 2P06A 3I97A 2UXXA 1OOPA 1PP9H 1GN3A 4MHUA 1R092 3VL8A 1LRHA 2E74B 4BK5A 1RVF2 3UV9A 5J09A 5CA0A 3WCRA 1EBOA 2XPJA 1PNLA 3H01A 1K12A 4JZRA 4FXKB 2IXLA 5CISA 5B1AB 3WP6A 1XBFA 3E89A 1N47A 3AG4C 2YGLA 1FAYA 2IW5A 1AX2A 3FD9A 1FNZA 1E5HA 2XUMA 4UOJA 2PYJA 5F5QA 1G9DA 4AQ6A 2R6QA 4XACA 3IPVA 1GZ9A 5FY5A 2HWE3 4PQQA 1DQ5A 3ZDVA 4FZ0A 3WB0A 4UCUA 1T6BX 4YJ2B 3ZMTA 5FY8A 3VBSA 3UESA 5FLHA 5B4XA 2YI9A 2EIKB 2E5LO 2DCJA 2ZGNA 3EHBB 2Q5TA 4UT5A 5K1PA 2YC4A 4ARXA 5LMNO 3I2GA 1YF2A 3KV6A 4I7ZB 4Q2FA 3K08A 2IJIA 5EJ3A 2CTRA 2GSYA 3HBZA 2MW2B 3L73H 4JAAA 2BV4A 4P5HA 3H9AA 5GZEA 4MGKE 1VJ2A 5KAFZ 5B1BC 2IJJA 2EINC 3JD4A 3WB2A 4WM7B 1UYPA 2XWBB 3IMNA 1BLZA 4JRLA 1K92A 5IAVA 2BSKB 5FP9A 1AX0A 3D0SA 2XWJB 4GZRB 3DSQA 2DE0X 1QH6A 5FZBA 1VQ5V 4UFJA 2QTSA 5K9YA 3C8XA 1HRV1 2D40A 2JWPA 4P9PA 4QXBA 4A7KA 3T1YO 1FPOA 1PNMA 5FYSA 3C3SA 2CTWA 2WFF3 3CLPA 2XQRA 4A3ZA 3SISA 5IYCO 2ITDC 4A41A 1YUDA 1HRV2 4E9KA 4PCRA 1D2SA 1SLTA 4CU8A 2WNOA 3QNEA 4PIXA 3OTOB 2VBBA 4Q0UA 4I0AA 1W06A 3HT1A 4JI7B 2BGPA 1WWYA 1OURA 3TCUA 5JQGB 4YW6A 3WG1A 1ZREA 1GMGA 5L9BA 1QF3A 5FDBA 2VMEA 3BN6A 4K0KO 2GBOA 2AXTZ 2WLNA 3CB2A 2A9HA 1Y74B 5FOBB 2D5HA 4DR7B 4FLVA 2ZX3A 3WU2Z 1KRIA 2UYAA 3J26N 4HONA 4NB5A 2XJRA 1ULPA 4D6TH 1PVC3 4I50B 1APNA 2QQJA 3AVSA 5J36A 1HW7A 2WAOA 3I49A 5FY0A 4XCAA 1E1RG 3VBRA 2HEWF 1IDSA 4RQEA 2P5OA 5L9VA 2JEXA 4NIDA 3OR6C 3SYOA 3NV2A 1CAXA 3ECQA 2XOKG 5IVYA 5BMVA 1SQXH 4SLIA 1V6LA 2YBPA 1J3PA 2AHYA 3TNPB 3X2QB 1CPMA 4HL0A 1Y66A 4DV3O 1QXRA 4DYLA 3CJIA 1M57B 1DQ1A 4PA4A 1XNAA 1NZIA 3S7EA 4GT1A 4CCOA 5KHIA 2W95A 3VDDB 2YUEA 2QNKA 1DGRA 1KDMA 1SLIA 2ZE7A 4OGQB 1IXBA 1OI6A 1BMFG 3ZN1A 1OSGA 2HHHB 1QWRA 5HV0A 3UO3A 4EN8B 3N7KA 4AQ2A 3OYWA 1O4TA 4I5SA 4NWWA 1XNRB 5JI7A 2W6IG 2ZXQA 2FL4A 3JB8A 1Q3EA 3D3IA 4GWNA 1H2MA 1YJLA 4KI5M 5FYMA 3RYHA 2X7RB 4CE8A 3CWBH 4LF9O 2JDAA 1R3KC 3BRCA 4LNVA 4CDWC 1RSOB 1FXZA 2I45A 3U75A 3E6BA 4LWSA 2ZDIC 1VQ6V 3A0BZ 3TYJA 1K33A 1TUBB 4META 4L9BA 3IC7A 4YFWA 2VMIA 5JLVA 1UYZA 2CAUA 5F3CA 1PO11 2PHLA 3L9JT 1K97A 1N4CA 2FBEA 4R6ZA 2K2SA 1ND2B 4K1YA 3ZLIA 4OMDA 1RUG1 2LS6A 4COUA 3PUHA 4YM1A 2Q69A 1AF9A 1Y9MA 3OPZA 3UT0A 2JEMA 1WW5A 1CPNA 4DV2O 1PO12 1SCRA 2OT5A 2UXBB 4X8NA 4YXWG 2DURA 5L3FA 4CH4A 3B7MA 3IM0A 1RUG2 3IWZA 3VD7A 3I59B 5E88A 3LWCA 4DR6O 2MEV1 1G1XB 5FYYA 1UL9A 4NPLA 3T4VA 5FZHA 1S77D 3UKMA 1Y6XA 1TVKA 4GALA 5LYJA 2WNUA 2Z42A 3FBMA 4E2QA 1KFUL 1LR1A 3LKJA 4CEWA 2MEV2 1XYNA 4X9QA 3VGIA 1ZZCA 1XQNA 3ZN6B 4CBCA 3ZR5A 4OX9B 3S30A 4QHBA 2RN9A 3K9AA 1QY4A 1YI7A 4W6XA 2ZNIA 3VDBA 2GV9A 2PYLA 3OGRA 4LR3A 4I01A 5I93A 3ZYIB 4O2AB 4UXNA 1LHUA 4D6QA 3VZLA 1QEXA 4JI1O 4WM8B 1G9BA 3VQWA 2P4VA 4FFIA 1JUIA 1DG6A 3ZPOA 5JJEB 1AR61 3WQ1A 2WT1A 3NRUA 5LRRA 5CA6A 4IHJA 3LSUA 1WA8A 3BOWA 4BMEA 4U3JA 1NCQC 1JCHA 3ZN0A 1JBCA 2ZR2A 1AI5A 4AEDA 5DUWA 3KCCA 4D8MA 4GKKB 4ZIBA 1RB8G 4B3TO 5LATA 1ZX3A 3C3VA 5FUNA 5LP6B 2C2AA 1VF7A 4XF1A 2XLFA 1H9PA 3K03A 1D4M1 3HNMA 1UOGA 4QX0A 4ISRA 3MIFA 4M4RA 4O61A 3HKDB 3K79A 3KZIZ 2ZR3A 4UW6A 1RFYA 5C8CC 4M00A 5I0TA 2RVAA 2X5IB 2RR11 2P3YA 2VWKA 3FZ3A 1MACA 1YXBA 1NTZH 1MVQA 4R9DA 3FB8C 1W2TA 2B46X 5I8YA 4PDLA 3JALA 1D4M2 1N1SA 4GX2A 4YG0A 2IJHA 4I4TA 3FYEB 1W04A 1RUC3 3OR7C 1MS1A 4YVWA 4DNYA 2C1FA 1RUE3 2RR12 1LTEA 3RRDA 4LKEA 1B06A 1KGYA 3H3ZA 1B3QA 5B1NA 4ZZ8A 2QM7A 4GXLA 3FLTA 4B29A 5BNPC 3DECA 5GONA 2E31A 4B3MB 4RUEA 5FMOL 4PHZA 1YNAA 4LKDA 4X1YA 1Z78A 1ENSA 3OF1A 4CCMA 2GP3A 1BYHA 4RFRB 4PV1B 4AQTA 4FTSA 3BCWA 1AILA 2GTSA 1WLTA 3GXUA 4FBFA 4EYUA 4CU7A 3ZRXA 4LF4B 2RDNA 3ASIA 1JYIA 1X59A 5FOJB 3BKZA 5CB4A 4AILC 4DV1O 1B35A 4NXMB 3KM5A 5C71A 1RUD3 4ZXKA 2JE7A 5K1XA 3NAPA 1VRBA 2GC2A 3PMSA 4J7KA 1FXVA 5CFDA 1DF0A 1VB4A 2BTOA 4YW4A 5E1RA 2O57A 2Q8DA 5M0TA 1D2DA 1Q8SA 5IVVA 2OZ6A 3KG2A 5FAXA 2H0VA 4HZFA 2J1AA 4JTCB 4IGGA 2QKSA 3S6PA 3N9QA 5T3NA 2FCUA 2J1UA 2Q4SA 2WKKA 1VF5B 4XJUA 3VD4A 5F2WA 1URFA 1GOHA 3JARA 3ZHTA 2DF7A 2QQMA 1CVNA 1NQDA 5F2SA 1YFWA 4UVBA 1W3XA 4DV6O 3I8TA 3MV11 2QQUA 1EN5A 5FTTC 2VZVA 1K34A 2OTJV 3GYDA 3LCPA 4H7LA 1V55C 1HDJA 3MDPA 4W6YA 1WUVA 1RUF1 1LENA 4PA7A 2QKDA 1FFXA 1R3LC 5FQ0A 1KKCA 2EILC 3RI8A 5AVAA 1Y43B 5BZBA 1CAUA 5IK4A 3ZSKA 5DDJ3 4PBPA 4NPMA 3AG3C 4YW3A 4DR3B 5DAVA 3RT3C 3DGTA 1RUF2 2XJVA 3BCCH 5FY9A 5LGUA 2E3CA 1MS0A 4NTWA 3JXSA 3TRSB 5DEDA 5J3UA 4R50A 5KX5A 4JI4O 1JJ2U 5A9GA 1FV3A 2R0FA 4FMTA 3S3WA 2R1BA 4Y1VA 5BYNA 2BDRA 4JI3O 1MSWD 2CTVA 4R8HA 1PZ9A 4UB8Z 4FJCC 5K0UA 3PU3A 3VBRB 3B5LB 2VQTA 2JG8A 4UI9L 3SKJE 3HQXA 3K9SA 1RP3B 1SCSA 1MR5A 4TSFG 3NJVA 5BMVB 2OPKA 3WF4A 3K46A 1COV1 1S4CA 3L2YA 3W5MA 4IEUA 1EPZA 1W99A 3CJXA 1RITA 2EIBA 1V9U3 2VM9A 1QNYA 2HWD1 1K5SA 3OTFA 4EWDA 4DR4B 3T0BA 2Q67A 2W1WA 5FPLA 1VRH3 1MS4A 2FB5A 3GNEA 5EFUA 1COV2 2XVLA 4LK6A 4CP0A 1OH3A 2JRIA 1VF6C 4HSLA 4BJ0A 3SKVA 3MIGA 5BNOA 4LBQA 2HWD2 5DAQA 1ZBA3 3I3DA 4CDUC 5EYPB 4RHV1 3JD71 4P9JA 3BABA 2RS11 2XAQA 3AFKA 3IAYA 3OYWB 3H1KH 1UX6A 2VNRA 2L35A 3E6CC 4QDSA 3AP7A 4QE7A 2J1RA 3PDQA 2YIAA 3O0VA 2OT7A 5CB7A 1W2NA 3GBWA 3ASOC 4RHV2 3JD72 4X88A 3NV4A 2RS12 2JG9A 4CP2A 4BWOA 5L3BA 2R72A 3MDSA 4B7KA 3APBA 3VZNA 3RS6A 3WDUA 2ZHKA 2EICA 2R70A 2W87A 2EULA 2W6JG 4DUYO 5KC6A 5L3GA 4NHMA 1H2NA 4J1WA 1KC8W 3ZHSA 2VWJA 2F43G 1VPHA 1FI2A 4AGGA 4OHWA 4EEQA 3CMAV 1DP0A 1VBD3 3Q9OA 2LGWA 1TAEA 4K8XA 2CTQA 2BOJA 1NKDA 4X20B 1EP0A 1L7RA 5KHGA 2BPA2 3I5DA 1WMEA 5JIAA 5GW7A 5F5CA 1AJQA 4LOTA 3K5MA 4Z2AA 1XSRA 2GMEA 3PVEA 1LUWA 3AXDA 3WVJA 4FPFA 5JR2A 2FKXA 4Y22A 1JR9A 1JOJA 4DUWA 1ZRFA 4XTMA 3K75B 4CCLA 1NXD1 4ET7A 2MHFA 1RUH3 5BY1A 1M56C 1YO8A 3K5NA 4YHHB 3CCSV 3ZO0B 1JYNA 2Z0AA 1HRI1 1RUI1 3ZRVA 2GH2A 1PNKA 2A3XA 3ILRA 1VAMA 3VDCA 1NE4A 5LYJB 1Q6UA 2WDBA 2YFZA 3SPIA 2WNUB 5BPXA 5T54A 4X1IA 4JV4A 4CEWB 2XDVA 3JCIA 4FM2A 5C5TA 5F8PA 5F5IA 4MLOA 1P7BA 1O8SA 1WCSA 3RGBA 4H33A 1HRI2 1RUI2 4LBQD 1NKGA 2VOXA 1QLNA 1XUQA 2BJSA 1MS3A 3OGVA 5D1IA 3VBHA 4C1XA 1VIBA 4NXNB 4UCRA 2VGDA 2DVFA 4NJ4A 5FZ8A 2UXNA 2X29A 1NX9A 4TV8A 2JICA 5LBFA 1IQDC 4AHCA 3DCQA 3H1LH 1QHTA 2ZINA 5K8SA 2A3WA 5IT6A 4H44B 2VNOA 3H3LA 3T08A 3AYEA 3FAVB 4IHJB 2CWMA 4MXVA 2X6AA 3ZN4A 1OCRC 1WA8B 2VQAA 3F2ZA 3APQA 1AJNA 3LEGA 4U3JB 2BFUL 1QJU1 5IVBA 4AEDB 4WZCA 4HAMA 1SA0A 2NLRA 3MUZ1 5EZWA 2OCHA 1COWG 5DN6G 3QLQA 2R49A 1H8TA 5BXXA 4CUCA 1HLCA 5JR7B 1N33O 4ZHQA 2M7WA 4CTEA 1FOD3 3RWRD 1K3IA 5H9RA 3EYPA 4BOWA 4WZFA 1QJU2 1UMZA 4MVZA 2KSDA 3C7GA 2WT2A 2BFUS 2XVKA 1I94B 1RXGA 4XILA 3CL1A 1JHNA 3JUUA 3TN93 3BPZA 3GWOA 2WN3A 3ACGA 1OUSA 2PI5A 3LOBA 4C91A 2DVGA 2OZJA 5FXXA 1G7YA 2EZOA 4G4FA 2K0GA 2R9AA 4FQ4A 1F4MA 1I0HA 3F95A 1I08A 1ZLZA 2ZM6O 4Q1PA 4GH4C 3LNMB 2ZX0A 5GONB 1SMVA 1WPXA 2QA4V 3I3EA 4L87A 2CGPA 2ZE8A 3T4ZA 1QJY1 2H6CA 4BQYA 4X1YB 2RS51 5DUUA 4CEYA 3M7AA 5D5PA 5G05L 4MVRA 2AENA 4U2AA 4IV3A 1PX3A 4IW3A 4RA0A 3M99B 3K77A 3NQHA 1H1MA 2VU9A 4LO7A 2F4LA 2OUHA 4CH5A 1QJY2 4RGAA 3T1YB 2RS52 5A2QN 5CB4B 1F5FA 3RJRA 1B35B 3U1XA 1JTZX 3OD0A 4LIVA 4UCOA 3AP9A 3NAPB 1SPPA 4O4LA 2R16A 4BWAA 4ZKIA 5CFDB 3F5WC 4KMQA 5CG8A 3IIAA 2P2KA 3K4DA 3KCYA 4SBVA 3K0DA 4CS4A 1QGLA 3VD9A 4W4LA 1TMF3 3A21A 2P67A 5FUPA 3PURA 2XLGA 1V00A 1XNCA 2I74A 4R9BA 3Q8BA 1GQPA 1LODA 5IWAB 3WDTA 4LFCB 5EJ1B 2B1IA 2QZ3A 1IOAA 4XTPA 3ZXDA 4CPBD 1SQVH 5IFTA 4DFSA 1AYN1 2WAAA 1JYXA 1R6TA 3NXSA 3H50A 3ZOIA 4F7ZA 2VTXA 3LA7A 1NG0A 4UVAA 3AMPA 4IEWA 2WSUA 1YJKA 4DK1A 5C70A 1LU2A 3FN9A 3OBTA 3W58A 1W8UA 4JI6O 4X6RB 1CAUB 2E32A 1NA1A 2Q7EA 1AYN2 1KITA 3ES4A 1VBE1 2CYFA 1MQTC 2C9AA 1QU0A 3JAKA 5KC5A 4HVRA 1F9KA 3VOUA 1QJEA 1AL23 1XL6A 1GK9A 1NTMH 1VE0A 2JDUA 1ZVFA 2P22C 3NMBA 4DV3B 4O65A 5I8TA 1JOPA 4XCBA 1GRJA 2FCVA 4QXHA 1DLBA 3J81N 1VBE2 3S57A 2ORXA 4OVEA 2UUCO 4TT3G 5K0UB 4F4LA 1CAWA 3O65A 1HQWA 2JG8B 3VHRA 3ZRWA 1U12A 3FX7A 1RGSA 1YRZA 1ST8A 1Y9GA 5AVPA 4YY3B 3RQ0A 1QKQA 4QPYA 3LDKA 1QHDA 2C5DA 2DVBA 4X62O 3OY8A 4Y3OA 3CQOA 3L71H 2VULA 1O3SA 3MZHA 5DABA 1FV2A 4DV4B 3NJYA 2D5FA 1JMKC 4RQPA 1YQ8A 5DXDA 1KB9F 2O0OA 2QM8A 4OCTA 1LECA 1D2QA 4HN0A 4YFZA 1GQHA 4XUOA 2RS31 4LLOA 4LF9B 1V6NA 4O4IA 2FZ1A 5GJ6A 3ZMVA 5C9AA 5LBBA 2OCCB 2F6BA 2VAUA 4I3GA 4MGZE 5IJ0A 4NMIA 3LGRA 4GIQA 1RIRA 1QLEB 2VW2A 3W7WA 5CG9A 1RUOA 2RS32 2A6YA 3WNOA 4BM8A 2W3JA 5D8AB 2EVXA 5IY5B 3ZYBA 5IVFA 3K58A 2WS91 2DYRC 1J95A 3LF7A 4OI4A 4Y5SA 3OJBA 3POSA 4RFT0 2JG9B 1LEMA 1UOBA 4YARA 1NQTA 2ZAHA 4MXWA 2Q1FA 1SZBA 1JU3A 3T0DA 3AG2B 4B3RB 2WS92 2Y38A 4LR4A 5FLIA 4UCSA 3ZKYA 4AEKA 1YQ6A 1K5MC 5KAIZ 5TSWA 1GTOA 2VMCA 3T30A 4XQWA 3N9OA 2BRTA 3AZYA 1YCIA 1EUUA 1Y76B 4LF6O 1OCOC 1YZBA 5IYZA 4JYAB 1PMJX 4XF0A 1Q90D 5FZMA 1QDCA 1JYTA 3DEMA 4FPCA 2JKBA 3HKEA 1GZWA 2QQNA 4XBLA 1M06G 1MMMA 4TYSA 2JD9A 1YQ2A 3RG0A 2OTLV 2JJ6A 5FYTA 1W6MA 2X53S 3B02A 2V1DA 1RMU3 3QD6A 4XPVA 5C8YA 1XMOB 3FX3A 4LOSA 1VQ9V 3BGAA 4LFAO 3GHMA 1AZDA 4Y22B 4LBMA 3DPRC 5A32B 5FWEA 5A7QA 5FZDA 2QQLA 3KD4A 5C3SA 4U3FH 2YY1A 1DLCA 4LJHA 3CE2A 3GJAA 3JSNA 5JZGC 4JI1B 3KQ4B 4KU7A 1W6QA 4QWNA 5H9CA 1AR71 5IUQA 3B2EE 4X1IB 5EQUA 2J7MA 1BEV3 5JXJA 4IEOA 1FAFA 1X9PA 4M3CF 2VTXJ 1L8DA 4MTGA 2LJ2A 2ZCEA 3LIHA 4JGZC 3STZC 4QPWA 4CDQC 4DZGA 1FS0G 1AR72 3VHNA 2OWOA 2UY9A 2GP5A 4JI8B 1K4DC 3H8OA 1YDXA 4YWAA 2Z79A 2QWPB 3C7HA 1ZZ8A 2GN3A 4TV8B 2ZGOA 4Q8LA 5GLTA 5H2FZ 3MICA 5E79Z 4RR3A 1C8M3 1THZA 3E2EA 4N43A 4CU9A 4XYXA 1UU6A 4HG6B 4MT8A 1SFNA 5BV6A 5KWRA 1DK1A 1U5ZA 3G7DA 5JDBA 5JSRA 1SA0B 3BALA 4AFCA 3GZTB 3LDDA 3JD3A 2VNGA 1F7YA 4CDXA 3OPWA 2EZPA 4ZHQB 4BHPA 4YIOA 3OUSA 5A6QA 1HP8A 3GGLA 4FLTA 4HVOA 5TISZ 2JB4A 1HNWO 1I1EA 4LF7B 5JXIA 3DXTA 3SJAC 5I0SA 4NOTA 2VXRA 5DQ0A 1WGPA 2N04A 5KMGB 1GP4A 4Q4X1 3HPNA 5B1AC 5FP4A 3RYIA 4LF5O 1W2UA 1W0NA 4G3YC 2JDYA 2W1SA 5KHKA 1SACA 3ZYHA 1K73W 3FLRA 3MFAA 1L0LH 2YPDA 3BPSA 1R1A1 4H14A 4BIUA 3F5TA 1LHNA 3U37A 1MZFA 4FP2A 4KBZA 1DGSA 4BW9A 2VUAA 4EB6A 5FZEA 3AZXA 4QPIB 1BT8A 3OT7A 4Q4X2 3AC0A 4NAOA 1BBT3 5I91A 4N7IA 4AGRA 5T5JA 5L19A 2DWRA 2EIKC 4DV1B 3N4MA 2DMXA 3ILFA 4MSWC 4LA3A 2CH7B 5F3IA 2W46A 4TQDA 1R1A2 3U4SA 2JE9A 2A3YA 3AZWA 2R041 4XQDA 2KB1A 1A34A 3T3YA 1HDKA 4Q27A 3OEBA 1V54B 3EFFK 1UWWA 4PDMA 5FXWA 4QMAA 4WM7C 3MF6A 1LOCA 3WDWA 2PXJA 2R042 2R063 4WVZA 1OA2A 4CCCA 4JYBA 2GHYA 4OI0A 1IBMO 4I55A 1SPPB 4O4LB 5L36A 4FTEA 2YG0A 3K4ZA 3SYPA 1ZNPA 5FWJA 2AACA 4AGVA 2ZJCA 2HWB3 3POBA 4JV5O 4Y20B 5FREA 3ZXAC 1FJGO 3PU8A 2Z5UA 3UCSC 1HV1A 3HMYA 1OZ0A 2A06H 2ZGMA 3ROUA 1AR83 2Y60A 1MZEA 1PM9A 2WRAA 3KF5A 4FPPA 2PN5A 2HWE1 4XIOA 4CC5A 3WP4A 1CXZB 5CFCA 4Q6GA 1T5EA 3SCGA 4BR6A 2Z4FA 2BNOA 2P3IA 4Y26A 4F6EA 4O9EA 3SYCA 4JI4B 3J8F1 4COYA 4UFMA 3MD0A 2OA2A 4I2OA 1UOFA 3RFRA 2HWE2 5LK5A 2J22A 4O4JA 4MVTA 1LOFC 4YRDA 3QH7A 1GSLA 4QE9A 5JWPA 1IVSA 2IXIA 3CZUA 5CU1A 1GN4A 3JAKB 4FLUA 1WKYA 3J8F2 3VKMA 2DCYA 1FPN1 2ARAA 2QBXA 3HJRA 4LHLA 1OF4A 1K45A 4AI2A 2FZ2A 5I0UA 4YSFA 2F95B 4BXSV 1V55B 4EFBA 1QR9A 3SR2C 1PHMA 4EKWA 2YV8A 3O5SA 1QH7A 1FPN2 4LC1A 2WFF1 5E16A 4AVSA 1M57C 1CAWB 1K5QA 4P9WA 1Y4MA 4TOIA 1H9WA 3ZRWB 1GM9A 3VDDC 2PHDA 3RYFB 2IC1A 3THPA 4EJRA 1J84A 3CXCU 2WFF2 3FHIB 2GUZA 4MS2A 4FPOB 4UF0A 1PZ7A 3UGGA 4QT6A 5ITZB 3CD6V 5KHHA 4RQPB 1HNZO 4IXLA 1OCCB 5FPXA 1US3A 4Y1ZA 3N7LA 5C9AB 2UUBB 3ZSEA 2DOSA 2E53A 5CNAA 5IYBO 2GTAA 1S2KA 4QQHA 2CY6A 4IERA 3PJYA 5CA1B 1Q8QA 3HR9A 1W6NA 4BE3A 1NR7A 4FFFA 2VVDA 2O14A 4BK4A 1DYKA 3CCQV 4IE7A 4DRXA 3K3NA 4H0LB 2FDHA 1A3KA 5FBJA 2VQUA 1SQGA 4TLGA 1N1TA 2QQOA 3AEIA 2IH3C 2RJ2A 1ND2C 3OE7G 1XNDA 4MXWB 1W9TA 1XU2A 2YIDA 3A22A 1NT0A 4LH6A 2J1SA 1KEXA 2WLHA 3M7MX 2J1VA 2GC3A 3O7OA 1KU9A 3X29B 1XEQA 1S5JA 3BIEA 1HN0A 4K8RB 2UXDO 4J7JA 2H0BA 3ETDA 3KS7A 1W8FA 3CRQA 1RXFA 1WMDA 1JZ5A 5IYZB 5FPRA 3BA8A 3PTYA 2ZDIA 3Q4HA 4DV7O 4LFBB 4XXAA 1GZWB 4L97A 1R083 1CP9A 4YW5A 4BCUA 4AVAA 5GZDA 4DXRA 4YVSA 3MHZA 1X50A 2VO5A 1W0KG 3CNAA 5LXTA 4AFAA 3WB1A 4MH0E 4CCEA 5C8YB 5BY5A 3L2HA 3TEXA 2DCZA 5FLXN 1OHHG 1TNFA 2RDSA 4J1XA 4BQ2A 2FQPA 4DEVA 1H2KA 1JI6A 2XXZA 4KHPB 3O1MA 4IGQA 2KKWA 1XQ8A 3HN3A 2WC2A 1AXKA 3ABZA 2X6BA 2Y48A 3POJA 2E33A 1C3HA 2GDSA 5HXVA 2ZOEB 3V64A 2IXJA 1W6QB 1MEC3 2CU5A 4LLFA 4Z92B 4Y5TA 1JFFA 4XAAA 4X89A 4RS5A 1FYJA 5ABJB 4WM8C 3S7IA 2RHPA 1XDCA 2EXIA 3PJSK 2D93A 2FDIA 4CZZA 4E2GA 1LGBA 4HANA 4KL1A 3WF2A 3DN7A 5FZLA 1RVF3 1WZXA 4FLXA 2QQWA 1Y3TA 3AKSA 4XZPA 3OGGA 2IXKA 4OHZA 3H42B 1UPIA 3N9LA 4IEPA 4CRQA 4KP4A 5LP6C 1NBMG 3VHPA 2HJIA 1BHGA 3AYAA 4BISA 5C93A 3DTUB 4CP9A 1X33A 5IVJA 3ZHVA 5HFMA 5CVRA 1K5JA 1XC6A 4CC6A 3J7MA 2WWJA 1TZOA 3R65A 1I9RA 1LHOA 3ETGA 3E35A 3ELNA 4N43B 3SDLA 1DZRA 2CWSA 2X5IC 3UGFA 2VZOA 2D6OX 1AR91 1C4RA 1H6XA 4MVUA 2VCAA 5FZ7A 1WLWA 2ARCA 1N36O 4A5UB 3JZVA 4TWTA 2IZWA 1FKAO 1HXS1 3PIGA 2DVAA 4HFSA 2ZM6B 4FFGA 1PO23 2KG7A 1YHQV 3WZ1A 4BIOA 3T4DA 5C4WA 1NCQA 4AQSA 3D3QA 2NN4A 5IVCA 1AR92 3ITQA 4MO3M 1AP5A 5LB6A 1NVPB 3N2KB 1RM1B 3KVAA 3SXWA 3LDEA 2D6KA 3UJOA 3RYIB 4I09A 3FB7C 2FDFA 1HXS2 4M3CA 1YVWA 2D6NA 3AP6A 1Q5OA 1ONAA 2UUAO 1CZVA 1ENVA 4TSVA 1GKBA 1NLQA 3HKBB 3LEKA 2AC1A 4EB6B 2WNVB 1T6GC 1A78A 2CAZC 1DZQA 1NR1A 4IETA 5BR8O 1UY1A 1BJQA 3BA9A 2GMPA 1VMJA 1WB8A 2EIJB 1F4AA 3V0AA 1WPBA 1SZTA 2RJKA 4IE0A 1SC5B 4EV0A 4XAEA 2ODMA 4E27A 1NH2B 4XMIA 1ENQA 2NLJC 4M01A 2W91A 3AL6A 5A1AA 2CTPA 2ERFA 2W47A 3RYRA 3H7YA 1BMV1 2QJVA 1GFF2 4XE9A 1E5RA 1EZVH 1SZXA 1IZ3A 1US6A 2WLQA 2VR4A 1MZ5A 1RUC1 4I55B 5KUKA 4OXSA 4GKJO 3BOPA 3PHMA 4TQFA 1JUHA 1BMV2 3LFMA 1VBB1 5A33B 3QO8A 1IHMA 3CCRV 5A3MA 5KXEA 4LF8B 2Y34A 1OFNA 1UU4A 5CBHA 1Z7S3 3FB6C 4QDRA 1DZTA 1BHBA 4QX3A 2DYCA 1RUC2 1HV0A 4JI6B 1GKFA 1Q81W 3IBMA 1LGCA 5T55A 4JZ2A 4J42A 4NN0A 3JASA 4FCAA 1CPYA 1LGNA 3OW2U 3T1CA 2W1QA 5FMBA 1VBB2 3JCUZ 2P7TC 5LW9A 5LEJA 3MLLA 5CFCB 5CEHA 4LHNA 4I0WB 1Q6IA 1XRUA 1W05A 4DB5A 5AC91 2DN9A 4CCNA 4FP3A 2EJRA 2G4IA 3E5QA 3WHTA 2WQZC 1H0BA 4KUMA 1W2BU 4HNAA 3SQOA 4PDVA 1NZCA 1BQPA 4LCUC 2XJSA 4P2ZA 5AC92 3ZJZA 3SCFA 1YHFA 1DGRN 4A7ZA 3A2FA 1Q7YW 3VBRC 3I55V 2DFCA 3NVCA 4ORFA 5FY1A 1XNBA 2Z5WA 5J37A 1UN1A 1ENXA 3B69A 4ASKA 1RHI1 4B4QA 4X62B 2ARBA 2N7GA 3QOPA 3MYXA 3VQXA 4FPKA 1CQ9A 1CWPA 1D5NA 1KQSU 2ZGSA 1PNFA 3WUCA 4FAGA 4HK9A 3MLKA 2F66C 3J7HA 4QPKA 3SC7X 4B08A 4AFMA 1GN2A 5BUVA 1RHI2 4DV0O 1HNXO 2BE3A 2UWAA 1LR5A 5B1OA 2RCVA 3LOIA 5LOVA 5F6LB 3J7NA 5LMUO 1PK6A 1QXPA 2KR2A 4UF0B 2GUZB 1YYNA 4RN5A 1H1AA 3F7YC 1WLCA 1W9SA 3AFGA 3WG4A 4NHXA 4UFIA 5IK7A 5FZOA 4HMZA 2Q1ZB 5FUIA 1F31A 2CHHA 5FV3A 4AHXA 3WV6A 1ZM1A 3IAPA 2IXHA 4JGSA 1EV11 1PO13 5JOWA 2DQ0A 2FD8A 5B3SB 1W90A 3ZMUA 3NNMA 1E57A 4GZ9A 3RYPA 4PI2A 4IEZA 3ZX7A 1C57A 2AUYA 2UYBA 1W6NB 2WSVA 4X65O 5IHRA 2NMNA 2QQKA 2DWEC 2BP6A 3UQ8A 4A2UA 2QQIA 1VF6A 3U4XA 4GX0A 4NIHA 5D21A 3NJZA 4Y24A 5EJZB 1B09A 2CDPA 1V9U1 4B1MA 2XG3A 4FPHA 1SQFA 1FXHA 2MEV3 4H7MA 2QWRB 5A3WA 1XMQO 3O0XA 1WCUA 1O3TA 3G6JB 4KQ7A 4A44A 1KKDA 5FO9B 5IJ9B 1JU4A 3I3QA 4M3CE 1UKGA 3HOBA 5JOZA 3T2MA 3L9DA 3HR0A 1V9U2 4ZPIA 1GN6A 4JASA 2V5DA 2DW4A 2A6WA 3LSQA 1XREA 3M1HA 3WF0A 4BPZA 5C5UA 2VZUA 1YIPA 2X8KA 1XE7A 3Q4HB 1HQLA 2JJ2G 4GWJA 4F8AA 4YVSB 3WNLA 3OMAB 4QAWA 2WO1A 3M8LA 3N27A 1XHXA 2ZT9B 5J2UA 5FK7A 2WNUC 3JSLA 1UCXA 5KBFA 2LW7A 1GAXA 3N2GA 4O2BA 4XEZA 5JUVA 3CCEV 3DYPA 4CEWC 3GHNA 2W5FA 2WLLA 5KR7A 1AR63 4FM1A 1HB4A 5JVDA 2VBPA 1ZL8A 2PAEA 4UV9A 5FJHA 1IBLO 2DTWA 1X8EA 1YJ9V 2WQ8A 5A7PA 4DXTA 1GZTA 5DZFA 2RM21 2VZPA 2AEYA 2JDKA 3VHOA 2LO1A 4DRRA 1SQPH 4WBNB 5JSOA 5H6RA 2B9ZA 1JFFB 1SLBA 4RS5B 4Y1XA 1VBD1 1CAVA 4ZXEA 1O8PA 2WLIA 2VMGA 4TLFA 5HCHA 3RZZA 4IE4A 4P14A 3ZMZA 4B4RA 3H1HH 5B2GB 5LA9A 3TB0A 4P5YA 1S2EA 2RR13 2JECA 1UU5A 4AEDC 3ACFA 4ITCA 1VBD2 4IV1B 3ZR6A 5FPZA 3I2IA 2X6CA 1UPSA 4QU2A 4MTXA 3IN9A 5L7OA 1SS3A 4CP9B 1UZ0A 4CUAA 1N34B 2ADQB 4AAXA 1T2XA 5GLWA 1EN4A 2NYYA 1H30A 3AMNA 3CBNA 4COZA 3ZFFB 3LA3A 2CL2A 5JAXA 2Q1MA 4P9YA 3UO2A 3CSXA 3AJYA 1RJ8A 4V1PA 1UMHA 1YTFB 4J6GA 4FVVA 4OUMA 2CAVA 1QNMA 2ILMA 2XJUA 3L70H 4BDVB 5F9TA 2VQFB 4IL7A 1JW6A 4Q20A 1RYYA 5C4WB 2K1EA 4ZI7A 3IDEA 4EFEA 5FZ6A 5ERLA 3WW4A 2RV9A 3B3QE 4CUGA 3JB4C 3OEEG 1JPXA 1UX7A 4QX7A 1QU7A 2IH1C 3WG7B 1UFIA 2WLJA 1QJX1 3IZOA 3JU9A 3OGSA 3T1MA 3Q8AA 1O4YA 3I54A 2YDEA 3GVMA 3ABLB 4NR1A 2F4PA 1W3VA 4X8PA 3GDBA 3SEPA 4IGPA 5DZGA 1UZZA 4H55A 4LORA 2DCKA 1GU3A 2UU9O 1QJX2 1DGWA 1B35C 4NTYA 1RL3A 2Q0OC 3NAPC 1FOD1 4NE9A 5CFDC 1KDKA 5LZ6A 2D43A 1AXYA 1C8NA 4B3NA 1S55A 1L3JA 3D4KA 1VQ7V 2DDUA 4QX8A 4MW3A 3J7LA 4K8FA 1OKOA 3TN91 1XNKA 2BTQA 1RUF3 1GWMA 1YIFA 3AVRA 1F5JA 1FOD2 3EXUA 5A70A 2VG9A 3ZIXA 4GMP0 1KD7A 3ZVXA 5F3EA 4K8ZA 4X1KA 4KWKA 4U7OA 4HVQA 2XLAA 2BTVC 3TN92 1LAJA 4YW1A 3VBOA 3KSCA 2UXCB 4XVHA 3OFNG 3R4SA 4N9IA 2F17A 3BB6A 2WINB 3H1JH 1O3QA 3E86A 4PD4F 3JASB 1Z5VA 3B40A 4IIJB 2OS2A 4QD2A 3OPTA 4PDWB 1JOBA 1G8MA 2CE4A 1K4CC 1UYYA 5LBCA 3TXQA 2IJKA 1OPMA 2LFSA 2YGMA 1G9CA 4QHZA 5FKBA 2BNNA 5K4LA 1K8AW 1TA8A 1C1FA 1NVPD 3ZCCA 5A6ZA 4XBNA 2AGSA 4JTAB 4IEQA 3KMHA 4QQOA 2PLV3 1COV3 4V2VA 4HNAB 2OYZA 1H4GA 1RUJ3 3INAA 2WFPA 1Z0HA 4GX1A 2HWD3 4XFFA 3JBG3 1BS3A 2VVFA 5IK8A 4L92A 5K0UC 4IE5A 2G9ZA 1UNBA 1W0OA 2WJSA 1W6PA 4XXPA 4JX0A 2JG8C 4NUBA 2Y0OA 2VJXA 3DXUA 3LDBA 3DXRB 3U14A 4EE2A 1UY2A 1W6OA 1AHSA 4RHV3 3JD73 1FATA 4F6RB 1XOUA 2OVUA 4AL9A 3OTOO 2RS13 1HNZB 2AGAA 1MQTA 4A3XA 5LA1A 4JI7O 2D44A 4ZHNA 1S3JA 3WSOA 3N9MA 4J41A 1ZZ9A 2BW8A 2ZZQA 3E6DA 2RJLA 2XASA 1Q82W 2PELA 3K5OA 3CF6E 1CR7A 5LOVB 4DR7O 2OCCC 1PK6B 2DBIA 3VD5A 3T1LA 3W59A 1QLEC 3N36A 2VL4A 4FPLA 3QO7A 2V4VA 4LBEC 5FZOB 3THCA 5FYBA 4JQRA 3DUIA 2WWSA 5D8AC 4AK3A 5IY5C 3CPWU 5EXOA 4KWUA 1IX9A 5C8WA 2D3PA 4P30A 3CMGA 4XHBA 1ACCA 2JG9C 3ZN5A 4DUZB 4JF3A 2W0XA 2VZTA 2EXHA 3AK2A 4CSWA 4UB6Z 3LZZA 1IS5A 3ENRA 1O91A 1BVVA 2BZDA 1P49A 1UIJA 1JS9A 4O9GA 3HVDA 3AG2C 2UXDB 1NXMA 5DZEA 2LGQA 4WFBV 1YITV 3GM8A 1HWYA 2RDRA 4JKLA 4UW3A 1PGL1 1ZUQA 1JZ3A 1NZ6A 2DTYA 3JATA 1GO3F 4DV7B 4KGGA 5C33A 2VXJA 3KHBA 3LSDA 5FL7G 2QDNA 1XPWA 5A3UA 1NQJA 2EX3A 1VMFA 3OMNB 2HHHO 2AYHA 1DHKB 1REEA 4BQ3A 3HKCA 4LO5B 1RUI3 1PGL2 4ATEA 5IATA 1NCRB 3ZFGA 4LHKA 3V65A 4XJAA 1HJGA 3WW2A 1SHWB 4QQLA 1ZTEA 3OGCC 3M3IA 4DK0A 2VUCA 4JDMA 4YG3A 1V6IA 1GMMA 2VS0A 2ETNA 1C1LA 3IFXA 1X7NA 2XAHA 3PVOA 1OBNA 4D69A 1K5MA 3CEIA 4BQ4A 3FLPA 3F7VC 3PJQA 4A4AA 4PIZA 3NV3A 5FZ0A 3QTCA 5J2UB 1EN6A 2JENA 4KGQA 2YYOA 1W03A 4Q29A 4Z1MG 4Z1VA 1I5ZA 5JJJB 4O4HA 2WZPP 2WLLB 3LNNA 1S0EA 5JVDB 4IDZA 3E22B 2DV9A 4HK8A 2H6BA 4I0XB 1QJU3 2Y6GA 2GC0A 4NIIA 5A1FA 3JD1A 1OQEA 2HEVF 4PA6A 3C2UA 2HLEA 3TNQA 1IPSA 3DPRA 3SPHA 2UXBO 3E97A 1WD4A 2KXLA 5JOYA 4H13B 2K9PA 4PT6A 2B42B 2E51A 3KZ4C 3ZDSA 4M4PA 4LBLA 4PJYA 3B09A 5JZGA 1P7GA 4UFKA 5ISLA 3ZYPA 1ZBE3 1YQCA 5CBLA 3IMMA 3I4IA 4MGSA 3RZHA 3TXSA 2VECA 4XFIA 1SDWA 2W0FC 2IUWA 1DDLA 5LWBA 3L72H 1WCDJ 5FYUA 3FJSA 5L7OB 2PFWA 2EIMB 5IFPA 2KM2A 3OGIB 1GYKA 5JCOA 2WN2A 4CDQA 1U96A 1FXKA 4COWA 1CIYA 3WNMA 4WVVA 4JHTA 1BQ0A 1XOYA 2HVKC 3P30A 4QHOA 5LY1A 3LB9A 2ZMLA 2UUAB 2ZBJA 4XIKA 5J2TA 2V72A 4Q4V3 1QJY3 1G9AA 5FMDA 3TK1A 2HKXA 4B3SB 1V9PA 4BMBA 4OI2A 2D6PA 1DYOA 4ES8A 4NWVA 1GANA 1KXGA 4JTNA 1P8JA 4QPIC 3CS5A 4ZI7B 3RPQA 2EJ7A 5HI0A 3SH4A 4W50A 2YIBD 4LO8A 4GX5A 4ZBMA 2LRPA 3VBFA 1NE6A 2Q0AA 1R1ZA 2EAAA 2QEXV 4QU1A 3ALQA 4X64B 1VQ8V 1OOPB 1C8M1 1V54C 3QBQA 4ONUA 1EY2A 1YC61 1BK1A 3ETPA 5CA0B 2FMLA 5ANQA 4IEVA 3TEZA 1IG0A 2A79B 3SYAA 2VW1A 2VOVA 4GKJB 1POV0 3ML0A 4FOQA 4PLMA 5FFOC 1UW8A 4ZY9A 1C8M2 3LE0A 1WAZA 2F4VO 3S3XA 4JAUA 1D0GA 3LSSA 3VKNA 3LPGA 3IPVB 5CBFA 4OULA 4CXWA 3ZSMA 2DVDA 3OBRA 3LFIA 4Q4W1 2G9GA 2D3SA 1V6OA 3VBSB 2QE7G 2B1GA 4URTA 1KS4A 3IC9A 3RNSA 2BTQB 3I3MA 4Z8BA 4DR2B 4LHSA 5K7PA 4B3MO 2H8PC 1W0JG 1LESA 2GNDA 4Q4W2 1VBE3 2JDPA 3O14A 4WM7A 4E2SA 3OMIB 2PI4A 1EAH1 3R4DB 3D36C 5FXZA 4JQTA 4TV9A 3VBOB 1ALYA 4B1LA 3OD4A 2NZ9A 3G4SV 3JQXA 1BGYH 2HR3A 2Y33A 1J3RA 2R32A 1ULFA 1U5YA 4QB1A 2W2IA 3LDCA 2BGCA 1YTFD 3GZUC 4PIYA 1CESA 1PMIA 1EAH2 2K46A 2ZXWB 4MADA 1VQPV 2B45X 2JDZA 4CS2A 1W8WA 3BU0A 4OMCA 3T1HB 4U7NA 1GR3A 4QKFA 4X66B 1XI1A 5HBAA 2IVJA 5HXMA 5EPAA 5JQGA 2OXBA 3HEIA 1OVPA 1SQ4A 2P37A 4AYUA 4EN6B 4DV0B 1HNXB 3CCMV 4ZONA 2HWB1 3OM3B 2G38A 1UZYA 2Z2SB 4R8CA 5FNVA 3VN4A 2RMU3 3RZLA 2A71A 2RS33 1MG1A 2QSAA 1UAIA 1AR81 5FZGA 1LOFA 4XURA 3CC4V 2Y4TA 2FYUH 1MSDA 1JYCA 4I50A 1PM4A 1W6OB 4UUJC 1VMGA 3TETA 2HWB2 4W6WA 5FZ4A 2OIEA 2NPIA 3K3WA 4AE2A 4EZHA 5CYYA 3CP1A 5C3QA 4R7CA 3PVNA 4FM0A 4QQ2A 1GQGA 4R4ZA 2LFRA 4RQPC 1MPXA 3UT5A 1AR82 1OCCC 4YNIA 4FSJA 2GAUA 3WNPA 1SKVA 4DR3O 1SFPA 2V09A 3B77A 2QWOB 2C24A 1LEDA 3OSDA 5JPNB 5C9AC 1CAXB 1AUYA 3THTA 4AI0A 1XNQB 1S5LZ 2HEYF 3PNAA 4C8DA 4X65B 3POYA 5EIBC 4CA9A 1H8HG 1S0FA 3H3UA 2IFRA 5KXCA 1W9YA 5F7UA 3B9IA 4QGNA 3CJIB 3VDDA 2QZ2A 3CHXA 2P34A 4XFGA 3L74H 3AZZA 5JJNB 4JI5B 3MF9A 2E26A 1GOGA 4NKGB 4W8JA 4QGMA 5FO7B 2ETEA 1RC6A 2WYFA 4GAZA 4HXCA 3WFVA 1N32B 3T0AA 1XMQB 3FWEA 2SLIA 1W59A 1NAEA 1PGW1 3B4SA 1E5IA 4GMP3 4MV2A 3ZFEA 1H2LA 1XJAA 4TN7A 4JYYA 3FUQA 2LROA 4DR4O 5HV4A 3WEZA 1ULGA 5J7MA 5GTIZ 1PPJH 1Z2GA 5EIYB 4P9LA 4AEMA 3W21A 1PGW2 5A80A 4LKSA 4Q0PA 2ZCWA 4YJ3A 3RZGA 3WDYA 2YXHA 4GQ7A 1VEWA 4CVUA 3RYHB 3U78A 4Q1RA 1RSOA 5IDJA 3CC2V 3EJKA 1JZ4A 4JAVA 4HPKA 4BYYA 2CUGA 3HKCB 2CNAA 3AKPA 4LWSB 1UO9A 1GICA 2IU0A 3ZFGB 1AR73 2PHXA 1DTOA 2Q4PA 1URXA 1BK0A 1QQP3 1M90W 3ILNA 1IBLB 1XE0A 4YZ4A 3CCVV 1AP6A 3G6BA 2LALA 2BNMA 3R4UA 2F1MA 1Q8PA 4FXGB 4NRPA 3ZSJA 2E9QA 3IKWA 4Y4RA 1YFUA 1IXMA 2OW4A 2UWCA 3KV5A 4XZUG 5BNNA 5FPUA 3VD3A 4XF9A 5KA6A 4AVBA 5LRSA 4WFAV 3I59A 1M93A 5KLVH 5ABJC 5E6HA 1U97A 1ORQC 4JTDB 5FYCA 1S0VA 1IGOA 1WCQA 3ETEA 1UF2C 1OQ1A 5DN2A 3I2DA 3VQYA 3B00A 1IPKA 1WMXA 1NU1H 3SITA 1EFRG 4Q26A 1GWLA 1PIV3 1O9GA 3MPBA 1O6UA 2HWF3 4AI1A 1TVKB 5LA0A 1AI6A 1M9NA 5LEKA 4YGEA 4GB31 2ET7A 3CDZB 3O1TA 1GV9A 5LL6Y 3PL0A 1FMD3 2LTNA 1R081 1H2SB 4O2AA 4N43C 4LH7A 3APOA 2PMWB 4OUEA 4DY5A 1CZSA 2YZ4A 3I3BA 3RWKX 2QWNB 4WM8A 1GNHA 1VQKV 4GB32 4KNCA 2WSSG 5FJKA 3H8RA 4WBBA 2QTWB 1KP3A 4XQ4A 2GSMB 1ASJ1 1R082 3VQVA 1F23A 1FXKB 5A3NA 3VZKA 2AW9A 3EXAA 2ZMKA 2ZIOA 1F15A 2B39A 3UYJA 3QH6A 1QOTA 1RM1C 2XOMA 5LP6A 3RVZA 4NXNO 1ASJ2 3LQCA 3CX5F 4URAA 2R043 4AFBA 5F37A 1LOBA 5E1AC 4UFHA 2YB7A 4MVMA 4CPBA 3E8GA 5ACA1 1YIJV 4P9OA 2WNVC 2X5IA 5JPMB 1GLHA 2PTMA 3BTXA 4JDOA 1J5EO 1PM7A 1XYPA 4Q0VA 1I5XA 4YIPA 4JGYA 3WNXA 2EIJC 1NOVA 3B9CA 3UKVA 3VBFB 3CU7A 4AVCA 5EBWC 2ZHMA 3ZPYA 2ARXA 5ACA2 3BTAA 4EZ4A 3JALB 3KLSA 1BZWA 1B04A 2YBSA 4I4TB 1ULCA 3RJ2X 3K04A 4K3UA 4YVWB 2N74A 1C28A 2E5LB 3T2QA 1S0CA 4D0QA 3BEHA 4J80A 5LMNB 1WW6A 2CV6A 2C26A 4JI2O 1AI4A 1I94O 2WLPA 2VPVA 5J48A 3AKQA 4XDKA 3J4UH 1BE3H 1I7FA 4Q0QA 3I7DA 2E76B 1PO21 2G1MA 2J1TA 2V73A 1BCCH 1AVMA 3ZBHA 4P02B 2HP8A 1GWKA 3ZMOA 2ZKLA 1VP7A 2WO7A 3J8F3 4XBFA 1UY0A 2JE8A 1ZRCA 1PO22 3UJQA 1E1QG 4MX3A 3NJXA 3B93A 4XOGA 2J42A 5CFCC 3LPFA 5T50A 1FPN3 1XYOA 1LHWA 4TV9B 3LSEA 1J1TA 4JZGA 5D2AA 2V5YA 4IT5A 1D0HA 1UPGA 1OHFA 2YFUA 3JYCA 1N8RW 3ZMSA 3UNPA 3JARB 4XDLA 2EIDA 3RZJA 4K0KB 2QJ1A 3VDAA 2Q68A 4UXAA 1OXCA 2P4KA 1MS9A 3O12A 2YICA 2BVVA 2I07B 1OMIA 1OUXA 1ZRRA 3ZXFA 1JH5A 4HSJA 4DQAA 3PUAA 2XJQA 1S0IA 3RI9A 3L75H 3MIEA 4CXXA 1FFXB 4AVVA 5IWAO 2A73B 2NMOA 5FQ0B 4LFCO 4MTFA 1N3PA 1W2AX 5JXGA 4CS3A 2X09A 5FNVB 2AZ2A 2UU8A 5F3GA 4QXCA 1Z7S1 2HWC3 4LIUA 3A4UA 5FZCA 4I0BA 4AAPA 3CO2A 3ICXA 4BW5A 1OH4A 5H9QA 3QF7A 4AXOA 4FPJA 5KX5B 2XMLA 1W2OA 2W92A 2GC1A 1AXZA 4JKKA 2GNBA 2DYSB 1R73A 1UOJA 1Z7S2 1LOGA 4JRAA 5FPBA 1SQBH 1PL0A 2VZSA 2Q8OA 5EYYA 1LU1A 3UT5B 2VZ3A 3T2TA 4B7EA 3ST7A 3ABMB 3ZXGA 1GH6A 2W68A 4UW5A 1E79G 4S2FA 4XBQA 1VQMV 2P6HA 2E7AA 5B3SC 1GUIA 2VUJA 4AVTA 1YEWA 2B7YA 3CMEV 1POV3 3K06A 3N35A 1DBNA 2QDOA 3BIWE 1QCEA 2ZE6A 5IWFA 2ARHA 2R1DA 4FFKA 2DU0A 5FY7A 3KWVA 3VLBB 2G9FA 3SPGA 1I3HA 4DW0A 4QX1A 3AB0A 1IS6A 1REDA 3ABKB 1FFTB 3KGLA 5DUXA 3TOJA 3W20A 2VCCA 3AK1A 2Q8VA 5EYPA 2OKXA 4ZU5A 4K21A 3EVKA 4N90A 2LW1A 4EROA 4YY3O 5BNOB 4LBQB 2EBOA 3QG5A 4N7UA 3EHKA 3IDCB 3UKNA 2PA7A 4KH9A 3USSA 3WDVA 2ZKNA 4UCTA 4DV4O 3HPLC 3ZFEB 5FCCA 2RDQA 3TAYA 3FE5A 4RO2A 1OLRA 3PUIA 1MA1A 2ZEYA 2EF6A 2BWCA 4ASLA 2XAGA 4A42A 4YJ3B 1W8HA 4P00B 1LB2A 4DOUA 2UWBA 4RSUA 3DC6A 2JDHA 5CKMA 4HPKB 4IE6A 2OUJA 1WNSA 4MGTA 1L7LA 2VMFA 1V0AA 4DV2B 3ON7A 4N9HA 1AVBA 1IKPA 4MZUA 2A7AA 4YVSC 2CK3G 4DW1A 4WF9V 2EXJA 4OFGA 2R30A 2B5HA 1ND3A 5DAWA 1FYUA 3IT8A 3RSJA 4LO6B 4FVMA 3P32A 4DR6B 5IAXA 3NSTA 4YW2A 4AFDA 4XDQA 4CP1A 3H1YA 4X20A 4DV5O 4LE4A 4XABA 3HD8B 3H8XA 3U0ZA 1Y9QA 1DIWA 1W9FA 1W9WA 4Q4Y1 2ATKC 4B3RO 3H0OA 3IJ4A 3M3CA 5BNNB 3NKGA 2DWDC 2KQXA 3O1SA 5FPOA 4D6RA 4DUVA 3ASNB 3P3NA 5LA6A 4RS5C 2BU9A 4KG0A 5JI9A 3NWKA 3RMYA 4DR5O 1KYOF 3USUA 1BXHA 1C5HA 5A7NA 5FZ9A 4EN7B 4JYAO 4UVCA 1EZJA 4Q4Y2 5LBEA 3MIHA 1XBLA 3LUTB 1US2A 1AR93 3ZX6A 1QDOA 4ASMB 3OBAA 1LULA 4IGOA 4R9AA 2P17A 3M3QA 4IV1C 1MZ6A 1PGSA 3ZEDA 1XMOO 5LASA 4QM8A 1HXS3 1P4RA 2YI8A 1G6NA 3M3OA 1PNGA 2VH9A 3LIGA 4BIZA 3LA2A 2DU1A 2F23A 2RNBA 4L99A 1A8DA 3NV1A 1DQ4A 2JD4A 1FX5A 3ZFFC 2H3OA 5FZ3A 1S72V 4KFMA 1LCLA 4B3TB 1TVGA 3VBHB 5CAZA 3HNYM 4N53A 2F93B 4L11A 1DQ6A 1TEIA 3AYDA 2BCCH 4LMFA 2P3KA 3FAVA 2CGNA 1N0NA 5FMCA 5BXZA 3W7UA 2YBKA 1MNGA 3WT3A 5C4WC 2JDIG 4JHZA 4E4EA 1QIQA 4GA9A 2JX9A 2XUEA 3IDBB 1CN1A 2E63A 4JTOA 5IE9A 1AR62 4JI8O 3WINE 4BQWA 3WG7C 2OYQA 4FQZA 3HWJA 1HIXA 1NLRA 3VBUA 1WBLA 1H8TB 4GWMA 2ATFA 2XVGA 2HJDA 2DBNA 4IEYA 4R52A 2D2CB 1WW7A 1R3IC 3ABLC 5HCFA 2WLKA 1BQZA 1ZZ7A 4M0NA 5GZFA 4XDOA 4WFEA 1JZ6A 2YUAA 5FK8A 2F4VB 4QPGA 4OQ9A 3WG3A 4ISQA 3WP5A 4JGYB 3WQBA 5J96B 1WW4A 1W28A 4CU6A 2QCSB 2XH6A 2FDKA 1JYWA 2D7FA 4K6BA 2QWQB 1OD3A 1X36A 1VBB3 1JYVA 2ZGTA 4DIQA 2NM1A 3SH5A 4K1ZA 4B8EA 4D3WA 2ZKOA 1VBC3 1YI2V 3GWKC 4IYHA 2PHFA 4LF7O 2XGXA 4FIPC 1VQNV 5LGTA 1RUNA 1AR4A 4NIAA 1O5LA 2WBKA 5EC2C 3W9AA 3R0RA 2R073 4DEQA 4Y1YA 4AEJA 1NY71 5CN0A 2IM9A 2QR4A 3SYQA 4K7JA 5AFBA 1S0GA 3QVNA 2XBO1 4IESA 4CEYB 4P9IA 3WLUA 5AC93 1TME1 4MOAA 2O8QA 3W7XA 4HOOA 5FYHA 4IV3B 3UL2A 4FK5C 3DKWA 2A7WA 1NY72 2E6VA 5FMOS 3ZXJA 2ZGPA 4MVSA 5FRAA 2XBO2 3VKFC 4HLTA 3WOGA 2HBTA 4DV6B 2YXSA 3BTYA 2G19A 4PDWC 4XFCA 4KXRA 1TME2 1AJOA 2B8MA 5C3RA 2XJPA 2R7EB 3SEEA 1N1YA 2IBZH 2L9LA 4OHYA 3LAGA 1OF3A 2P1BA 2P3JA 2QUOA 2RE9A 1RHI3 2XJTA 2HKOA 3DF0A 5GLUA 2A3QA 2KD7A 3CRAA 1G6UA 1JOYA 3S5AA 4IUGA 5JSPA 3M70A 5FZIA 1WBFA 4EWAA 3ZIWA 4MTOA 3OAAG 1YJNV 2JEUA 4PBOA 3FHAA 2CGOA 4UCVA 4E4DX 1HN1A 2WA3A 3W7TA 3TJTA 3RWNA 2B9UA 3ACIA 1K9MW 3FC0A 2JJ1G 1AYM3 1ZSPA 5HCAA 3BYWA 3GJBA 4XW3A 1K3EA 1PD3A 4JI3B 5CIRA 1DGLA 1H38A 3GALA 4UAPA 2N05A 3AG1B 1WA4A 2VZRA 4YGDA 3BAAA 3JD2A 4D6SA 4WFHA 2EIGA 4FTBA 5A3PA 2MPFA 1NA1B 4DMIA 1J58A 3ZHRA 1HR0O 1LOAA 3K59A 1EV13 1RPOA 4HT1T 2BQPA 3VZOA 4AW7A 5KA5A 2A1XA 3AKTA 2WIIB 1PK6C 2MK3A 2R9IA 3K2OA 3O1RA 4QX5A 1SBDA 3RYKA 1CJPA 5F32A 3ES1A 1CIWA 1V70A 3POGA 1L7QA 1OKQA 2Y0PA 1KJLA 1ZA7A 3PMEA 2PLV1 4YZ3A 2JGUA 3MW2A 5IVEA 1MOFA 1RUJ1 3TEWA 4ABMA 3T2PA 2WR9A 3OG2A 2EAKA 3FBYA 3JBG1 2Z69A 4QXKA 3OY8B 2Y6JA 1SDDB 3BI3A 5LGNA 4H3WA 2PLV2 2Q6AA 2A70A 1IG3A 1R6NA 1ROPA 5LA2A 2A6VA 4Y5Z0 1RUJ2 5FY4A 3Q8CA 3SJQC 4COVA 4ZS3A 2Q73A 2WO2A 2FMDA 2MNGA 3JBG2 3RN4A 2QQPA 4O4IB 2P4EA 2Y0IA 2JB8A 4IQPA 4FPGA 4MGYE 1UMIA 2TUNA 1QVGU 1PVC1 2KA3A 5B5EZ 5FYZA 5IJ0B 4AI8A 4BB3A 4HYOA 4LBNA 1WLDA 2BUKA 1WLEA 5D8AA 5B66Z 1HW5A 4XJ8A 4DUYB 4OHVA 4RD7A 1QVFU 3LDRA 4NO4A 4NIGA 4M0HA 1NCRC 5DPNA 2IFWA 3B94A 4K40A 2Q30A 1PVC2 2UUBO 5JVVA 1VBA3 4LULA 2VQEO 1VAVA 2RM23 1W8TA 2BOIA 4AG4A 4HN1A 3WG2A 1VARA 2SBAA 1ND3B 1OLMA 1Y76A 2W1UA 1FT9A 3E83A 3AP5A 1QOSA 4ATFA 4YGCA 2DUQA 3RMXA 3HT2A 5GKAC 4CDWA 3ZRSA 2ZX4A 1SLCA 3NO8A 2DQ3A 3HKEB 3N3HA 1XL4A 2A6ZA 4ZOLA 1W6MB 5FP8A 1R6KA 1AL0G 5A32A 3GBFA 5LA6B 3MO4A 2WZR3 2Y6LA 1XHZA 4EN9B 3PUSA 1QQCA 4PF5A 3LD8A 2QTOA 4J9ZB 3A0KA 3WD5A 3USUB 5C6CA 4J25A 4BLJA 4I9WA 2BYVE 5LHGA 2XKOA 2PGGA 4FI9A 4LFBO 2ITCC 1VAKA 5FBZA 4BH9A 3IIIA 5EZYA 2WABA 2EA7A 5CA3A 1TUEB 4BA6A 4XF4A 2LP7A 5L3EA 2IXCA 4MYEA 3BODA 3M8AA 1Y4WA 5L7OC 2EIMC 1G86A 5GZCA 4HKOA 3CRCA 4KHPO 1JXNA 3RYCA 2CDOA 4Q0SA 3IDAA 3I2KA 1SFYA 4G2KA 1R093 2HG5C 3MIDA 2DFBA 5FPAA 4K20A 4CXYA 4E4HA 2XHKA 3AKRA 4N53B 2C9KA 3BTZA 2ZQMA 1N33B 3ABTA 3RW0A 1QJX3 5CADA 2ZGQA