2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
3SCHA 3GYDA 3I59B 4O9GA 3PNAA 4MV2A 4KWJA 4MGZE 4IEUA 4KU7A 1VJ2A 2ET1A 5CVRA 4IESA 4XF3A 4L2NA 1Q43A 1CAXB 1YLLA 4A2UA 4MZUA 1SEFA 1VP6A 1Y3TA 3KGLA 4UBGA 4HSJA 2E9QA 3GBFA 5KHGA 3ES1A 3FX3A 3U10A 2ZKLA 1OMIA 3CO2A 4FAGA 4IERA 3EBRA 5FLJA 4XFIA 2VPVA 4YRDA 3OCPA 4IEXA 4MGYE 5J3UA 2PFWA 3LOIA 5I93A 2F4PA 4QM8A 3KCCA 4IEZA 1O3SA 2D5FA 4IEQA 4XFHA 1PMIA 5AVPA 3E5UA 4HSLA 3DV8A 3L2HA 3G7DA 4Q0UA 3H1WA 3KMHA 4HMZA 1UIKA 2D93A 2PHDA 3EO6A 5KHKA 4LA3A 1O3RA 1NE6A 2PTMA 3ES4A 2XLGA 1OI6A 1CAWA 2PAMA 4PIZA 3RDIA 3VHRA 2ZCWA 5LEJA 5F1RA 2XL7A 2MNGA 4I01A 4OLLA 5T3NA 5FLHA 2PA7A 2IXKA 2N7GA 1FT9A 2Y0OA 3E5QA 3WW1A 3MYXA 5BUVA 5J7MA 3H7YA 3HQXA 1CAVB 3USSA 2B8MA 2BNNA 3OGJA 3BB6A 2VQAA 4Z82A 2UY9A 2OYZA 4XFCA 1J58A 3BU7A 3BCWA 3CL1A 3FE5A 4MX3A 4OFGA 3KSCA 4Q0PA 2PYTA 1J3PA 3H3ZA 4XFAA 5I8TA 1RGSA 2PHLA 4I02A 3HT1A 4IEOA 4AVBA 3UKNA 3SXWA 2K9ZA 4EWEA 3NJZA 5LEKA 3B02A 5FDBA 3SMHA 5FQ0B 4NVPA 1QWRA 3BPZA 2XKPA 4AVCA 4QX5A 4RD7A 4CYDA 1WLTA 2BNOA 3M3IA 4WBBA 3ST7A 4J1WA 3BALA 4I0AA 4BH9A 4E2GA 1YUDA 1V70A 2WC2A 4EWAA 2UYBA 2XHKA 2PQQA 4QGLA 1XRUA 4IEVA 3RZZA 4AXOA 3IDBB 2QVSB 3EHKA 4HVQA 3IBMA 2XKOA 2OA2A 5FCCA 3I59A 4PJYA 2FMYA 1J59A 4AVAA 3IIAA 1I5ZA 4J1XA 1ZZ8A 5KHHA 1NYWA 1O7FA 4TLFA 2BNMA 5I0SA 4EROA 5D1IA 3FHIB 1ZZCA 4I09A 5I8YA 4QXKA 1ZZ9A 1O5LA 3S7EA 1RC6A 4LLOA 4UXAA 4YARA 3MDPA 1ZZBA 1SQ4A 5LRRA 2XLAA 3E5XA 3FWEA 1ZZ7A 1O5UA 1ZRDA 1TQ5A 2QJVA 5EZWA 4IEWA 2IXJA 4KL1A 4LUMA 4Q0QA 1YFUA 3NKTA 1DZRA 3IWZA 2EA7A 1UIJA 4R52A 5C8WA 1ZRRA 2KXLA 3I54A 4BHPA 5BXXA 3D0JA 4XFFA 1CGPA 1QXJA 2Q30A 3D0SA 4FT8A 4I0BA 1UPIA 5JSOA 1EYBA 4XFBA 1CAVA 4XF4A 2UY8A 3H50A 2H6CA 5I8SA 4Z07A 4MUVA 3SCGA 1OFNA 4BYYA 1G6NA 3LA2A 4IEPA 5FPXA 4KU8A 4JV4A 3E6BA 5KBFA 2IXHA 2ATFA 4EWDA 4F8AA 5FQ0A 4I3PA 2Q1ZB 4LULA 3DKWA 4HBNA 1X82A 3E6CC 4MGKE 4F7ZA 3UKTA 5CADA 4PIXA 2HJIA 3H1MA 1GQHA 3ELNA 1XE7A 5KHIA 3S0MA 4B29A 2GC3A 3ZDSA 2GC0A 4IEYA 5EFUA 4ZU5A 2MHFA 1CAXA 4WVZA 1CAUA 4UBHA 4HN0A 2QDRA 4LA2A 5J48A 1LRHA 1L3JA 1H1MA 4O9EA 1O3QA 4QGMA 3KGZA 4FBFA 1QY4A 1YFWA 1XE8A 1RL3A 3NSTA 2CGPA 4HLTA 4ZU4A 1Q3EA 1YWKA 3M70A 1CAWB 3LZZA 2B5HA 4JTOA 2Q4SA 3JZVA 3O14A 1QXRA 2GH2A 1LKNA 2HKXA 2OPKA 1Q5OA 3C3VA 4X6QB 1LB2A 1J3RA 1O4TA 3RYKA 3WW3A 4D7TA 3SHRA 5JAXA 5C6CA 1FXZA 2IC1A 1ZNPA 3DL3A 5LRSA 3H8UA 2XGXA 1JUHA 4Q29A 1DGRA 1WA4A 1ZRFA 3FZ3A 4LTAA 1IPJA 3ROUA 1GQGA 3D82A 5K8SA 5KHJA 3OTFA 3CJXA 2Z2SB 3UKVA 2QCSB 4XF1A 4AQ6A 3WW4A 3RPQA 3HT2A 2C0ZA 2OZJA 2UYAA 1J3QA 1NZCA 4QMAA 3EQEA 5CU1A 1X8EA 4WZCA 1ZRCA 3IDCB 5JSRA 1WGPA 2H0VA 4H7LA 1ZREA 2PAKA 3LAGA 4KWLA 3QOPA 2BEOA 4LUKA 1HW5A 1FI2A 3PVBB 3EJKA 2ET7A 4IETA 2BYVE 2GZWA 4FAHA 3H1YA 5JR7B 1RUNA 1SFNA 1EP0A 4Q0VA 1YFXA 1RUOA 2MPFA 2ETEA 3CEWA 4HVRA 3CF6E 2O8QA 2K0GA 4META 1VR3A 1X7NA 3S7IA 2O1QA 5BPXA 4E2SA 3CLPA 3ETQA 4L11A 4GULA 2V09A 1ZX5A 2D40A 3SCFA 5HI0A 2QNKA 4YYOA 2EVXA 2P17A 2GC1A 1I6XA 5I0UA 1EY2A 1YFYA 4KWKA 4XF9A 3U0ZA 3LWCA 4XF0A 4YSFA 4AQ2A 4D7SA 4MGIE 2GAUA 5E16A 1J1LA 4HVOA 4MH0E 3H9AA 1H1IA 5JCTA 2CAVA 1U12A 5JSPA 4X6RB 3U11A 3TNPB 3R6SA 1UW8A 4I2OA 5BY5A 2EAAA 3RYRA 3OF1A 1CAUB 3RYPA 4XETA 2WFPA 3OD0A 3PLQA 4ORFA 5E1RA 4ZU7A 5BV6A 4K8FA 1ZZ6A 1RTVA 3RNSA 2VECA 2IXIA 1CX4A 1Y9QA 5I0RA 1ZVFA 4XFGA 3HIFA 2Q0AA 3FJSA 2I45A 2CV6A 3H3UA 3NL1A 1IPKA 4XEZA 2GC2A 3H7JA 5FLIA 4P9GA 2PAEA 3FFQA 3TNQA 4E2QA 4QM9A 3DN7A 4Q0SA 5FPZA 1UD1A 2H6BA 2XLFA 1UCXA 4QGNA 3N4MA 2GU9A 2D5HA 3WW2A 3LA3A 5I0TA 2DCTA 1LR5A 4YNIA 4BIFA 4ONUA 1OD5A 3MZHA 4PIYA 2CAUA 3E6DA 2IXLA 3MPBA 1PM7A 3E97A 3ACLA 1EPZA 3LA7A 3I7DA 4JVAA 3NVCA 2B9UA 1O3TA 4HZFA 4JTNA 5I91A 2Z69A 2OZ6A 1X8MA 1YHFA 1DGWA 4LEJA 3QACA 2FQPA 1DZTA 4DINB 4N9HA 2XL9A 1NE4A 3NW4A 4HN1A 1NXMA 2BGCA 4R8HA 2IXCA 4N9IA 4EV0A
chains in the Genus database with same CATH superfamily
3PNAA 1N1YA 3WFVA 4XHXA 1AL22 4QXHA 1HNWB 2N74A 1UWWA 1VP6A 1CZTA 3AP7A 5A33A 4AGVA 2HWC2 3STZC 4B3NA 4AFDA 2ZTNA 1O8SA 1PK6C 5HBAA 4PQ9A 4QU2A 5JVDB 1TAEA 2EIEA 5FUNA 3E86A 3K77A 1OCCB 2YSUB 2VD7A 3UGFA 1I94O 2DTWA 2QQLA 3WVJA 4CEYC 2ZCWA 3ETGA 4LNVA 4D6TH 4CDWB 1NTZH 1CIWA 4P5HA 1R64A 1KB9F 1YJ9V 5FJKA 2KM2A 3POFA 5CIRA 1ASJ2 2ZHMA 3FAVB 1QHDA 2WNEA 4KXRA 4XFCA 3T1YO 4YW7A 3CL1A 1S5HC 1ULOA 1DHKB 4IE4A 2G1MA 1RGSA 1DDLA 4I02A 1W04A 3MF6A 3UKNA 4XAAA 2WFF2 3RS6A 3F5TA 4G2KA 3B9IA 4BOWA 2HWE3 5HXVA 1XNKA 3J8F2 4NVPA 4DFSA 1GNZA 3BOPA 3VBHC 1K42A 3O1MA 3M3IA 3MHZA 1NCQA 2HWD2 3I2GA 4ZKIA 2CE4A 4CS4A 1UJWB 1MZFA 5IK8A 2JVDA 1XMQB 2QZ3A 1MACA 3WSOA 3S3XA 4B1MA 2P6CA 3OGIB 2KSDA 1VF7A 3I3BA 4FP3A 4G4FA 5CFCA 2I07B 1NCRC 4TWTA 4DR7B 4Q8LA 2JE8A 2W52A 4DR5B 1Y66A 4R9AA 1GOHA 1FD9A 4S2GA 4YIOA 4AFCA 5EK0A 5FYVA 5CA1B 4FPFA 2XLAA 5JLVA 5EC2C 2FMLA 2QJVA 4IE6A 5A2QN 1PZ8A 3ZN1A 3SH4A 2Q7HA 4DR1O 4H2AA 1UIJA 4TQFA 3MD0A 2BVBA 4OX9O 2KXLA 4C1XA 2QWNB 1QIQA 1UYPA 3PUHA 4XFFA 5C7GA 4EE2A 2Y64A 4GUNA 2QKSA 1P4RA 3JAWA 4XQWA 2WWWA 1S76D 2P22C 3UT0A 5FPXA 2DBNA 3J80N 2LTNA 2IXHA 1NXD1 2ADQB 4MS2A 1WA8A 2ZDIC 4GWNA 3C90A 1NS1A 1HXS3 3UKTA 2ZKNA 5B1NA 1LOEA 3M1HA 2Y34A 4RGKA 4XILA 3JXSA 3NO8A 2BVVA 2R041 4FLYA 4NXNO 3ZYGA 3VKLA 5CG9A 4DK0A 2E33A 1N4CA 4BQ1A 1NR1A 2AACA 1KP3A 1JI6A 2ID4A 1VB2A 1Z2GA 2IFWA 2HKXA 5C71A 1XNRB 1Q5OA 5H9RA 4BB3A 1VMGA 1HNXB 3M3QA 4I4TB 3MW2A 1YITV 4LBMA 2VQEB 1PL0A 3CZUA 3MDSA 1PVC1 4H44B 5EJ1B 2OIGA 1QJU1 4O2BA 2H0VA 2PAKA 3LAGA 4JV5B 3EJKA 2W95A 1RXFA 3N9QA 1K5MB 5IJ0B 5JOYA 4HVRA 5T54A 3IC7A 2BGPA 5JR2A 1VR3A 2YC2A 4ITCA 4GWMA 1VQMV 1Q8OA 3ZR6A 4IV3C 1RUJ3 5HI0A 5DG2A 4XUNA 4PCRA 2QWPB 1FPN3 1DGRN 1ASJ1 1ONAA 1J1LA 4HVOA 1H2MA 4WM7B 5C33A 5HCBA 2LFRA 1SERA 1QOOA 2B1GA 1RUJ2 3PU3A 2EAAA 3NWKA 5DN2A 1VF5B 2UXBO 2M6YA 3BODA 1FKAO 1BMV1 4AVVA 4J10A 2ADPA 3K03A 4UVAA 2VQFB 4LNUA 3P3NA 2HG5C 4XJZA 4W4ZA 5GKAC 1S72V 4PA7A 3KVBA 5BNOB 1AYN3 3E8GA 2J1UA 3HQUA 2CTPA 3OW2U 5CFDA 3PUAA 3O1OA 4LC1A 3OG2A 3ZFEC 4RGAA 3BTYA 3O1VA 3SR2C 2YU1A 4XDOA 2UUCO 4JI8O 1G1XB 3SEEA 4TZDA 2IZWA 1GOFA 1FMD1 1C8NA 4BU2A 5CA0A 1EFRG 5J2UB 2Q8VA 2D6MA 4NXMO 1Y4MA 3BRCA 4Y22A 2BGCA 3VDBA 3K3OA 1GP5A 2RS11 2W39A 1XXNA 3M99B 5DUXA 3K3NA 3K4DA 1HRI3 1T6GC 4IYIA 3PUQA 4HPKA 1VBE1 5JMOA 2VZPA 2D7FA 1OMIA 1YYNA 3W59A 1U0AA 3EBRA 2ZS6B 5K0UB 4FLVA 2HWF1 5I93A 4M0NA 4CCEA 4XFHA 1HIXA 2LW8A 4G27B 4Y20A 1AF9A 1GBGA 3FYIB 4HMZA 1FPOA 1HWYA 1K97A 1XEQA 2QTOA 1F4MA 2X7RB 1Z7S3 2MNGA 4ATEA 1HJGA 1W2NA 1SLAA 3ASOC 1CZVA 2JDNA 1CPMA 2VL4A 1JOYA 2ZACA 3ZXGA 4I9WA 4RYDA 4CH3A 3USSA 3VDDB 1P84F 1RXGA 3BTAA 3VBFC 5LXTB 3ZXKA 2ZM6B 2UY9A 1OH3A 2CGOA 4J42A 1S5JA 3ZDVA 1W2TA 3L71H 5A3LA 2UUBB 1AZDA 4TWKA 1AR5A 4AEMA 4JI7O 1JU3A 3I2KA 2YIBA 4M4PA 2BWAA 3RVHA 4RD7A 4TV8A 3CCQV 2BNOA 2OWOA 4J1WA 3BALA 5A1AA 4QX8A 4MVUA 3QTCA 2WKKA 2XHKA 1SLLA 1HQLA 4IEVA 1RUI2 2UUCB 2IVIB 4LFBB 1IS6A 1K33A 2JECA 2QQUA 5SV8A 1RUI3 4OPHA 4LBJA 2F4LA 2VVFA 5L7OC 5CN0A 2L9LA 5CAZA 1QDCA 1XYPA 4NAMA 3C7OA 1KYOF 1ZTEA 2Z0AA 4AEJA 2D3PA 1ZZ9A 2XDVA 3VB9A 1RC6A 1Y67A 1ZZBA 1KQRA 1QJEA 3OB8A 2H0BA 4D6SA 2JG9C 4I50A 4NJ4A 1Q6HA 1FYUA 3WDTA 2GUZA 5LMUO 2GNMA 3R4SA 4LR3A 1DZRA 1RM1B 4LFAB 4EFEA 3JYCA 1Q86W 4WBNA 3GWKC 1YTFD 5LBCA 2YEVB 4MHRA 4Z07A 1Z7S2 1QGLA 1C57A 2QQPA 4I3PA 4YJ2B 3POEA 3KKYA 3DKWA 2E53A 4MGKE 4YHHO 3KM5A 3T30A 1BT8A 4IDZA 2WLHA 4B29A 3AXDA 5CFCB 1QF3A 2GBOA 3WNXA 4QE7A 2E51A 4RUEA 4HN0A 1O3QA 3GXUA 1ENVA 4JASA 4OVEA 2D97A 4QX7A 3DEMA 2JXAA 3M7AA 2CGPA 4UFMA 1DZQA 1QCEA 4UCSA 2WS93 3WCRA 4LHLA 5JXIA 3LZZA 2A70A 2B5HA 3WF4A 1BQ0A 4CDWA 1YDXA 4GX1A 2G19A 3T1MA 2YPJA 2XUMA 1A34A 4LITA 4CE8A 3V0BA 4E4SA 2X6BA 1JUHA 4LF4B 2JDIG 2AHZA 5AC92 3ZCCA 3VD9A 2WZPP 4UFKA 1D5AA 2B1IA 3RJRA 3OTFA 1NLSA 1VBE2 2OX0A 5FXZA 3IIIA 5CA3A 3FBMA 3ASOB 4UCOA 3AYCA 2B9ZA 1I5PA 4IW3A 3QOPA 3ZR5A 5FPAA 1AR63 5FYIA 2CY6A 2YUAA 1ALYA 3LEGA 2BYVE 5H9SA 1SFNA 4LF5O 2XUEA 1TVGA 1MS4A 2OT7A 2MPFA 4OI2A 2P3YA 1K4CC 1M56C 1URFA 3EYPA 4NROA 1QU7A 2YC0A 5BPXA 1WMEA 3ZKUA 3AG4B 3FL7A 4BIUA 3WZ1A 3SNMA 5I0UA 3HMYA 3JCZA 1Y43B 1AX0A 1GU3A 3AP5A 4XCBA 2ZXWB 4XC9A 3WG3A 3H9AA 2QFEA 1EUUA 3U11A 2Q5TA 2D6PA 4XBNA 4PQQA 3A8TA 1W2OA 3SPGA 4CDXA 1AR1B 3SGIA 1JFFB 2IXIA 5JVDA 2YC4A 1YI2V 3MIFA 1JZ7A 3N7JA 1SESA 3T4HB 3WNLA 1RITA 2Y0IA 1Y7BA 3NL1A 2VULA 5DABA 4HNAB 4ICGA 4R4ZA 4GWIA 1WA6X 1TME2 4B4PA 2EF6A 2Y38A 1V00A 4PIYA 1PM7A 4AAXA 1O3TA 3J7MA 2NZ9A 4UV9A 1UYZA 1K92A 2J1SA 1N34B 4Q1RA 2ORXA 4R8HA 1Z78A 3AG1C 1E1QG 1H8TB 5J1XA 4DV1B 5FXXA 4IEUA 1KBHA 4Y4YA 1NZ6A 5FY5A 2E9QA 3FUQA 4YW4A 1THZA 3ES1A 5CBLA 4I7ZB 3RYFB 3EXUA 2NLRA 2WABA 3Q4HB 1XHZA 3ILRA 4D94A 3L2HA 4YG6A 2I2SA 1VQNV 1HDKA 2JK5C 1NLRA 5L36A 1CAWA 4OMDA 4A7YA 1ZM1A 3AMNA 4P5YA 2EIJC 4ZOLB 1ZBE3 3IT8A 1AX1A 4UW6A 2KG7A 4XDQA 3LNMB 3WNNA 2N7GA 4PV1B 1G6UA 1XB9A 1DLCA 1SZBA 3JD73 4N43B 1YJNV 2HLDG 1OCZC 1EUTA 1RUF1 4OFGA 4MX3A 2YU2A 2QWOB 1L1FA 4IHJA 4XFAA 1Q6IA 4MTXA 4YGDA 1NA1A 3HT1A 2X29A 3ZHVA 3QLQA 3O0WA 4LCUC 4Y33A 4MW8A 2BTVC 4LH7A 1OOPB 4NTXA 1DK1A 5FZAA 4RUFA 4LP8A 4WZFA 1HRV2 1L0LH 3NJYA 2VUCA 4LIUA 3GZUC 2XB6C 1AL0G 1WLTA 3AMPA 1XNQO 1OVSA 3T4ZA 2A6YA 1TVKA 2WC2A 3AG4C 3CXHF 1O9GA 4OUMA 2KA3A 4YJ3B 2TNFA 3CJHA 3VQXA 2HEVF 2JS3A 2O8OA 4SBVA 3A0KA 3I3EA 4N53C 1L7LA 1RUG1 2MEV2 2ZCEA 4AFMA 5IJ9A 2A6VA 3CZJA 4E4HA 2OVUA 3IGAC 4L8QA 2PHWA 3J8F1 3PVNA 3IM0A 1F8VA 2W68A 4XDLA 5EIYB 1MQTA 4PDWB 3RYHA 1NT0A 2QDNA 3SDLA 1MZ5A 1RIRA 1GN3A 2J1RA 1NH2B 2UURA 2WO7A 2FDJA 3I54A 2OS2A 3VUOA 1PO12 4FOWA 3F95A 1UZ0A 4KBZA 3H50A 4CBCA 4PI0A 3JAKB 2DCKA 5L7OA 3OGCC 1XBLA 5FJHA 1XPWA 2OTJV 1NCRB 3SPCA 4DY5A 1Q82W 3CC4V 4X20B 1URXA 1F15A 1POQA 5KHIA 5FO9B 1NKGA 3KF5A 4HT1T 4W6WA 4ZU5A 4DUYO 2K2SA 3D4KA 1R3JC 3MIHA 1XNRO 4QGMA 1F5FA 4PI2A 1ND3B 2YPDA 5HCHA 3G6EV 1VALA 1D4M2 2OIIA 1G9CA 3TGUH 2ZJCA 3B9CA 1LB2A 5JZGC 1WW4A 2VMGA 1H9WA 2BZDA 3DL3A 3LOBA 4RS5B 1DGRA 3B7MA 1OKQA 4QDRA 1H30A 5FPLA 3MV11 1VBC2 1ZL8A 1HQWA 5E1AC 5FZOB 1ZA7A 3UNPA 4CDUC 4FFKA 2R042 2Z5WA 1MNGA 3TN92 3RVZA 5JSRA 1UOJA 4CU6A 4Y24A 3AB0A 2K46A 3ZSJA 5BNNB 4K1YA 1S4CA 2WNUA 4UCTA 1KMIZ 4FMTA 4META 4CP2A 1Y76B 1XSQA 2QQJA 3ETQA 4UW5A 5IT6A 4GULA 5C8CC 3KLSA 4C0BA 2P17A 1EY2A 4UYBA 3OUSA 1W6QB 1N33B 4AF9A 1V55B 1RP3B 2CTQA 1LAJA 4AILC 1SG3A 4HL0A 3IAYA 2YBSA 1T2XA 3DKQA 2WFPA 4F6RB 3W7XA 4PELA 1QH7A 4BA6A 4RQFA 3VDDC 2HWE1 2HHHB 3H3UA 1BHAA 2VH9A 5GTIZ 1YF2A 2Q68A 3FFQA 2ZNJA 1VBA1 1W9YA 1SA0B 4BQ4A 4QGNA 4NXMB 1W8WA 1V9U1 1J1TA 3VKMA 4LBOA 3I3MA 2ZHLA 2Y6LA 4QPGA 3ZXEA 1GN4A 4XE9A 1RUE2 4GQ7A 3PUSA 5J37A 3HN1A 5FKCA 5CNAA 3NW4A 1JH5A 1NE4A 4N9IA 4DUZO 4JDMA 3SCHA 2VBPA 3S6PA 3WLUA 4MGZE 4H55A 1QVGU 1LGNA 1HR0B 4IESA 1F23A 1UFIA 5F3IA 4DV3B 4QPKA 4DO0A 3CO2A 4XFIA 3F7VC 5J3UA 4LO8A 3WG7C 2QQWA 4QM8A 3L70H 4IEZA 2HFEC 5EXOA 5CB7A 3G7DA 1WMFA 2WO2A 3FYEB 5IYYA 3EO6A 4J7ZA 3ASNC 4M3CE 1QOTA 3JATB 4Q4V3 5BYNA 1YXBA 5FZ0A 4HANA 2XR4A 5BNOA 1PK6A 3ZFEB 2VG9A 2CAZC 3WG7B 5F6LB 3UETA 2ZGMA 5J7MA 2ZZJA 2P1BA 3ZS8C 4YGBA 4GIQA 2C9KA 1K9MW 4A6OA 3B8MA 2GN3A 4LKFA 3AKRA 4JTAB 2WL1A 2VTXJ 4OHXA 5JJNB 1K8AW 3WDVA 5LYJA 3JB4C 5LHHA 5FDBA 5EQUA 4Q4Y2 3B40A 2JJ2G 1EM1A 3FLTA 4WBBA 2XT9A 2V73A 5KX5A 2Y6FA 1WW6A 4YW5A 1AR91 1XOUA 4XJ8A 4AZZA 2ZE6A 4U7NA 4E4DX 4TLFA 1W6NB 2FHRA 3Q4HA 4MTFA 4B08A 4D8MA 5KXCA 3ZEDA 2IUWA 2P3JA 2GMPA 3HKBB 3RYCA 4ZS3A 5JOWA 2LW7A 2QWRB 5LP6B 3TXSA 4K20A 1PGL2 5L3FA 4S2DA 2ZMNA 3CYOA 3PURA 1GMMA 4LF5B 1AR83 1QXPA 1FOD2 2WRAA 4KL1A 2R0FA 3Q8EA 5F5CA 1WLWA 5FMCA 3R0RA 5C8WA 4TTGA 3CBNA 2XTAA 1ZRRA 3POBA 3OEEG 1M4UA 4JI7B 5FZMA 1W0NA 2G9FA 3VBSC 2VQ0A 1DQ2A 3ZN4A 5FNVA 2WWUA 4UOJA 1N1SA 4OZXA 2A0LA 3ZIAG 2E74B 3SCGA 4I0WB 1RVF2 4YVSA 3ZOIA 1JYTA 5BR8O 3UYJA 5JDBA 1OOPA 3B09A 1LR1A 4E4ZA 1UX6A 2JG8B 5GLUA 4WV8A 1MS0A 2N04A 1MS5A 2RS53 5E6HA 3L72H 2YB7A 2DQ0A 4TSFG 1BLZA 2HWE2 1UF2C 2ZIMA 3M4FA 1U5ZA 3WXPA 4YM1A 1AI7A 1VBA2 3T1YB 2R7EB 3U1XA 2VMIA 3WU2Z 2JX9A 4CDXB 1WCDJ 1YFWA 2ETNA 1LUVA 4BPZA 4H33A 1YWKA 3LIHA 1XNAA 1CAWB 3CCMV 3JU9A 3P5BA 3W5MA 4J6GA 1M5IA 1W9SA 2QA4V 3RZJA 5B1AB 2EZPA 1J3RA 4GX2A 2WLMA 1UY4A 4ZKTB 4GALA 1LECA 4LJHA 2R062 3K79A 1F4HA 2XGXA 1GN2A 4AFAA 3ABKB 2VNRA 1VPHA 5GLWA 5LK5A 2FZ1A 3KT7A 4X65B 2WFF3 3K5MA 3HKEA 1ZYBA 1W6PB 4DZGA 2WUHA 4YM3A 5FO8B 4QD2A 3V64A 1PZ9A 3PVBB 5LBFA 3JQWA 3W20A 2R70A 2VY0A 1JJ2U 4ES9A 1ZBA1 4FAHA 1WB7A 1YFXA 4RR3C 2HEWF 3HBZA 3CEWA 1GM7A 4QKDA 5DAPA 1NX9A 1VIBA 2VZTA 1ZX5A 2D40A 5JUVA 2X10A 2Z5UA 4DR1B 5FWEA 4DOUA 2VW2A 5IK4A 4CRQA 4D7SA 4ZIBA 3SC7X 2YHJA 5A6YA 2XASA 4QX1A 5JCTA 4K35A 3LSDA 4AI9A 4FIPC 2WAAA 1Y76A 2ZR2A 1GP4A 5FYUA 3PDQA 5C5TA 1GN6A 3O1SA 1CZSA 5FZ3A 5CBHA 2BBVA 2XAFA 4ISRA 2ODMA 4RHV3 5H5NA 1FJGO 2XHNA 4E8CA 3WDXA 2VECA 1XJAA 4UFLA 4X1YB 4O61A 3RWNA 1I9RA 1ZVFA 2Q0AA 4MTOA 4Z92B 3HKCA 2CV6A 5JPMB 2P34A 1H8TC 5FZOA 1D5NA 1AR92 3HBKA 2JD9A 5JOZA 5I0TA 3HNYM 4YNIA 5B4NA 2X5IA 1OCCC 2XVKA 3MZHA 1MQTB 1G7YA 1VQOV 3I7DA 1SLIA 2AHYA 3SLIA 5CBGA 1OOPC 5F9TA 4LEJA 1RUD3 2KR2A 4N9HA 4QHZA 2Z42A 4AI1A 4NPLA 2XPJA 4OMCA 1K7DA 4EFBA 2EXIA 4W6YA 1HNWO 1DIWA 4MV2A 1UNBA 1C3HA 4AVSA 3RGBA 3LNNA 5D8AC 1H2KA 3A21A 3KGLA 2JDHA 1AR71 2A79B 4DV2B 3VQWA 1Q8QA 2PHUA 4DIQA 1BHBA 1QJX1 3I2IA 4L99A 2AGAA 3AKTA 3FBYA 3O0VA 5L3EA 4Q0UA 5KUMA 4X1IA 1O3RA 2RQ6A 5BMVA 5CKMA 1JBCA 3CCEV 1OI6A 5IVCA 1M4WA 1DQ5A 2Y6HA 3VHRA 1IOAA 1KITA 3H3LA 3T09A 3MW3A 4HXCA 4TQDA 3PHMA 4FM0A 2JKBA 5FLHA 2PA7A 4QJFB 2JGUA 2VZSA 4CCMA 1HV0A 3H7YA 4XMIA 1O4ZA 3SYPA 2E5LO 2A5ZA 1JHJA 1M57B 2P4EA 2OYZA 4XJWA 4CUBA 4GZRB 1SLBA 4YZ4A 2F1MA 3WHUA 3P3PA 4XUOA 4DV0B 2DTYA 3T2QA 2UUAO 3IMMA 4UFJA 4NIIA 4B3SB 4E27A 4YW6A 4YZ5A 1GWLA 4UB8Z 4JDNA 4Q1PA 5KAIZ 3VBRA 1NR7A 4J41A 3T2TA 1AXYA 2O57A 4O65A 3RG0A 1PMHX 4I0AA 3ETEA 3GDBA 3MIBA 4YJ3A 4KP4A 2A1XA 1SBEA 1ND3A 1X9PA 2QVSB 1RUG3 1AYM3 5IJRA 1OQEA 4IV1A 3JQXA 3THOA 5FZCA 5DQ0A 4X1KB 2FD8A 1IG3A 3ZJZA 1US3A 3H01A 4Y20B 1NG0A 1FXHA 3POJA 5IFPA 3JSLA 1DFQA 2RJ2A 2CSGA 4NR1A 3S57A 2QUOA 2UXNA 3NNJA 5IVYA 1MABG 3QD6A 5K9YA 4X8NA 2VMDA 2R073 1YJWV 3E5XA 3FWEA 3CNAA 1O5UA 3POGA 1DTOA 5FYMA 1ZRDA 3CC7V 3ABUA 4MVQA 2BOIA 2WWJA 3T4VA 2RS32 3AK2A 1GWMA 2IFRA 3LD8A 1WD3A 5BNNC 4UWDA 1XYNA 3AKSA 4CU8A 3KQ4B 5JIAA 4P9PA 1UMZA 1KJRA 2YGMA 4Y1ZA 4WFBV 4BYYA 2QKDA 5K4LA 4BW5A 3E6BA 5DZFA 3E89A 1TGOA 3ZFFC 5C8CA 1ZBE1 2HYKA 1KDMA 2IVJA 3ZYHA 4ZS2A 2CTRA 4J7JA 5CZKA 3RI9A 5EZYA 2ORZA 2ERFA 3AZZA 2WN2A 2Q8CA 4BJ0A 1BL8A 2OQ6A 3O7OA 1IS3A 2JG9B 3ETPA 5EFUA 3D36C 4MVRA 3H1KH 5D5PA 2MHFA 1WN7A 2ZE7A 1GTOA 5JH7A 3NKGA 5ABJC 2RR12 3KGZA 1PO11 4BLJA 1XE8A 4IIJB 2LJ2A 1CONA 3ZMNA 4NWWA 1W9WA 4RWUA 4N23A 1V9U3 3RZMA 3K5NA 1RMU1 1AYM2 1BVP1 1ACCA 4EEQA 1O4TA 2HP8A 3B00A 3WQBA 2XJVA 4U36A 2IC1A 3ZHUA 1BGYH 2FMDA 1AUYA 3FZ3A 3B3QE 2UU9B 2ADEA 4GX0A 1TME3 1STMA 5LA2A 4JX0A 4AQ6A 2E63A 1GO3F 3U75A 3PJYA 4QPWA 5H6QA 1X8EA 3IDCB 3C7HA 3LSEA 3WG4A 1FI2A 4XIKA 1C4RA 4UI9L 1CD3G 1RINA 3TOJA 2XH6A 4L97A 5LA6A 2D6OX 2BSKB 1PGW1 1MS3A 5DXDA 5EHDA 2O8QA 3A0NA 1XMOO 2OTLV 5FUPA 4AQTA 2PF4E 2GHYA 1WPBA 4CDUB 2XJUA 2PYLA 5IW0A 2ATKC 2A73B 4XF0A 3R4UA 5C3OA 1VF6A 5E16A 4GKJO 1FNYA 1GKBA 2VCCA 1PIV2 3D6EA 1IBLB 1OQ1A 1VRH1 4AEDC 3JALA 4X1IB 1R73A 2Q7GA 1N34O 2HVKC 5LOVA 2JD4A 3VKOA 3OSDA 3T4DA 5KMGA 4AGGA 5ITZA 2FDHA 5BV6A 2MW2B 1Q6UA 4E9KA 3BTZA 4FTSA 5FP4A 3TEZA 5A9GA 1CX4A 1AL23 4N7UA 2P37A 4BQWA 1IGOA 4TOIA 4LHNA 1IPKA 3H7JA 3RYIB 3SYCA 2WLNA 2ZINA 5BNNA 2D5HA 5A7PA 1HN1A 2YXHA 3K0DA 3LKJA 1IBKO 4J9YB 4QPIA 3VBRB 4JVAA 3NVCA 4BAYA 5DN6G 1OCZB 2VOVA 2Z69A 3NAPA 2OZ6A 1X8MA 1US6A 2WLLB 1NXMA 2AENA 2LO1A 1R082 1QLNA 4LO5B 2LGQA 4QQPA 5FY1A 2DFBA 2ZGOA 3T2OA 1W8UA 4DV7B 4YFZA 1JXNA 4L2NA 2WAOA 1YLLA 4INDA 4IV1B 3K04A 1NH2D 1JJOA 2QTWB 2ZHKA 2A3YA 4Q4W1 5C9AA 3OPZA 4WM8B 1UL9A 1LNSA 4IERA 3HN3A 1HB1A 1XQNA 1D7PM 1EBOA 1AROP 4E2LA 1AR81 5DMYA 2R043 1FMD3 3GWOA 3GCWA 5IK7A 2XHBA 3H8OA 5JJEB 5FZFA 1QMJA 1JOPA 1FXKA 3AM2A 4RS5A 1M57C 2WINB 2ZGQA 2J1VA 4I01A 1NCQC 3ECQA 5FZ9A 4CCOA 2UXXA 3CCSV 5EYXA 4AHXA 4FQ4A 5J2TA 1T5EA 4BR6A 5CYYA 2GV9A 4FLXA 2VZRA 5D8AA 3KSCA 1PVC3 4QU1A 2PHLA 3NXSA 4Y26A 5A3MA 4QHBA 4WCEV 2JRIA 4N21A 2R30A 1IQDC 2Z3YA 4D0QA 3LGRA 5IT9N 3ZN6B 1H8VA 5JXGA 3OGSA 4WVVA 3VZJA 2ZX4A 1IDSA 3N9PA 4P14A 1XBFA 4S2HA 5FYCA 3EHKA 4DV6B 2VUAA 2FMYA 2YGLA 4WFGA 3FUOA 3C7EA 2YG0A 4X64O 3DXRB 1ZAUA 5FWJA 4QPJA 5FYZA 3H1IH 2RHPA 2HWD3 4XHBA 2EXHA 1W6OA 1W0JG 2UXBB 3VBSA 1GK9A 3VOUA 1HB2A 3OTOO 4OI4A 4AK3A 2NR5A 3O1RA 4NHMA 5DDJ2 2B9VA 3VZOA 1LHVA 2NP0A 1LOBA 4AI3A 4IV3B 1OXCA 2XBO3 1F51A 2F4VO 1VMJA 4QAWA 2F95B 4AWDA 3D0SA 3J81N 1ULEA 1EYBA 5LA1A 4XF4A 1XL6A 1C5HA 1LU1A 3BTXA 3E2EA 5ACA3 1DG6A 3DGEA 4FXKB 1RUH1 4AHWA 1VQ6V 4E4EA 4NUBA 1XE7A 2G38A 1R1BA 2XBO1 1GZWB 5FY7A 1Y74B 2WPDG 2VQFO 1XSRA 1D2SA 2PXJA 4HOOA 3F2ZA 3WV6A 5JMCA 1SRYA 1A8MA 2KD7A 4YZ1A 4FBFA 1LENA 1BEV2 5G05L 5IVBA 3QF7A 4FCAA 3I97A 2W2IA 2ZE5A 4L8JA 1LEDA 2WN3A 4RHV2 5LBBA 3G6BA 4N43A 1R083 4QWNA 2Q4SA 4JI0B 4JAUA 4QT6A 2DU1A 4PD4F 4AFBA 1IXMA 4LBQA 2F17A 2BOBC 3H8UA 3FC0A 1WA4A 4CC6A 2XJPA 3ROUA 5F8PA 4IGQA 4ZPIA 3CCVV 1DQ0A 4XF1A 5EV7A 4Q4W2 4P9OA 4DR3B 1FXKC 1J3QA 1A3KA 5A7SA 4XDKA 2IJIA 4QKBA 3N36A 2RVAA 2VGDA 4R7CA 4C1WA 1RM1C 2V4VA 2OT5A 4MYEA 3QO5A 4P9IA 2YI9A 4X8AA 5B3SC 3O5SA 5ANQA 4YWAA 3QVNA 4GKYA 3ZXAC 5LBEA 5IATA 4WM8C 5F37A 4YYOA 2FCTA 5FZEA 1JYNA 4FOYA 4Y22B 1XL4A 3CKHA 3CPWU 1Y6XA 3E83A 3QO8A 1DF0A 4P9WA 3RYRA 2LFSA 4Z1VA 1HRI1 4EN8B 3OD0A 4GJYA 4ZU7A 1IBLO 1GZTA 2IJHA 4DXRA 3ZSLA 2WWSA 2CH7B 3ZVXA 2I45A 3NV3A 3MFCA 4B7EA 4B3RO 3CE2A 3LQCA 3MIEA 3VD5A 2PHRA 3WF1A 2J7MA 4QQ2A 4QX0A 3MBWA 3LA3A 1KFXL 4MLOA 5FREA 1RUC1 2YXLA 5FP8A 1OD5A 4A5UB 3VBHB 3VKFC 2ZX0A 3GZAA 1X50A 1EPZA 5IAVA 1X33A 5I91A 4HAMA 1RVF3 4GH4B 5FPUA 1DGWA 1DZTA 2XL9A 4HONA 4U3FH 3D8CA 1DU3D 2VZQA 2VM9A 5FZ8A 2R72A 1YI9A 3ZFGA 2ET1A 5FY4A 1AHSA 3AFKA 4MZUA 4DMIA 1EAH3 3FN9A 2WNVC 4XUQA 3FX3A 3INAA 1EV11 4MGYE 4JGZB 3FMGA 1TUEB 2VOXA 2F4PA 1IX9A 4CDWC 4GJZA 3M2MA 1GFF2 4HSLA 3KMHA 2E26A 1KD1W 4X64B 4QPIC 1OA2A 3UO3A 3OD4A 1WMDA 1RUH2 5T3NA 5BNPB 3K57A 4RQPC 3M8LA 1UKRA 4OI1A 4LBQB 3E8FA 3LDEA 1YRZA 4PA6A 4OHWA 3KT1A 4XAEA 1SQVH 1B35C 3HQXA 5FMOL 1OH4A 3BB6A 4CUCA 1Z5WA 3SKJE 4JDOA 5IVEA 5JI7A 1VAMA 4UF0B 4DUWA 1OHHG 1BEV1 1PNMA 2YIAA 2EIGA 4COVA 4AR2A 4RHV1 2JJ1G 1MEC1 4ZXKA 4QHOA 1XNDA 5JI9A 2V4DA 1XNQB 1M93A 5IWAB 4PLNA 4CYDA 2RMU1 3ASIA 1UAIA 3THCA 2VW0A 1W99A 3MV01 1LHUA 3OBTA 4EN7B 3KZIZ 5JJJB 4MVZA 4AE2A 1PHMA 1I5ZA 3JB8A 5I0SA 5JZGA 3ZFFB 1OPMA 1QKQA 2RS33 1MS1A 2GUZB 3WCSA 4CP0A 1VQPV 2UUBO 1FXKB 5CKQA 3BGAA 2BUKA 3ZSEA 3OMNB 4MSVA 2E5LB 4P9XA 5H9QA 1XU1A 5LRRA 3SJAC 1E5SA 1XE0A 2HJFC 2W92A 2QM7A 1POV3 2FDIA 5ACA2 1KDKA 3H1LH 4R52A 1OUXA 2E75B 2WQZC 3K9AA 4Y3OA 4KHPO 1IG0A 3MFAA 2RDCA 3VHNA 5CA6A 3ZN6A 4HK9A 4ZY9A 1OT5A 1NQTA 1WP7A 1XYOA 2HWF3 1IPSA 4IEPA 4JRAA 2PHFA 3PU8A 4LIVA 4P08A 2ENRA 1LULA 3WUDA 1H6XA 5JXJA 2DUQA 4A45A 1EN6A 3L2YA 3E6CC 3AK1A 5A7QA 4NB5A 1SQGA 1GQHA 4ASUG 1WUVA 5C93A 3S0MA 4U2AA 2AR6A 3SYAA 4JGYB 2RS31 1CN1A 3POYA 3FKSG 3K2OA 4BXFA 3N9OA 4LA2A 1L3JA 1H1MA 4DNYA 1MR5A 1C5IA 1XNCA 1N8RW 2YI8A 2K9PA 2LALA 3ZXLA 3NSTA 3OY8A 1FNZA 2A75A 1Q3EA 3V0AA 1RUF3 3RBZA 2CDYA 4ARXA 5J2TB 3ME2A 2VE1A 5FBJA 1VMHA 4LE3A 3SHRA 2DYSC 1W28A 1F4AA 1YI7A 2C4XA 4OGQB 3H0OA 1LU2A 1Q8SA 2DF7A 3S5QA 3LIGA 5F5IA 5KXDA 3RPQA 4K8RB 1EV12 2RM22 3OYWB 1PVXA 2R9IA 1KUQA 4TSVA 4FPGA 2RS13 1OCOC 3RQ0A 3OUFA 2NMOA 4YVSB 3WB0A 1VBD1 2QGNA 2DDUA 2K0GA 5LA6B 3CQOA 3R66A 1Y9MA 1SMVA 3OEBA 4JTDB 4LMFA 4E2SA 3JD2A 4MW3A 2ZGLA 3UQ8A 2RG4A 5HFLA 5LHIA 3KVAA 1MVEA 3PVOA 2Y4TA 3EVKA 4H14A 4JC1A 4JF3A 3PMSA 1SPPB 4QQOA 5LGTA 5A7WB 3OGRA 2ZBJA 4A3XA 1H1IA 1F2NA 2CAVA 1OA4A 1U12A 1UZVA 4YY3O 5DUUA 1GZ9A 4PT6A 5HV0A 2JDUA 5FK7A 4HETA 3RYPA 2QE7G 1MEC2 5E1RA 4FPHA 1FFXB 4K8FA 2NMNA 2B46X 2CHHA 3GVMA 3OUIA 5LXTA 3IN9A 4XFGA 4DRXB 5AFBA 2HYXA 1FAFA 2Q0OC 5LWBA 2E7QA 4RFRB 2IW5A 2PAEA 4G28B 2VR4A 5HV4A 3N7LA 1CVNA 3LEMA 4BQYA 4O4IB 2W3JA 1PM9A 5FAXA 1BBT2 3NQHA 2A6XA 4GKKO 2YYOA 2W46A 2F4VB 4DS0A 3ZMUA 3MPBA 2VU9A 3FHQA 5G04L 2D3OW 3THPA 1NU1H 1AB3A 2DFCA 1LGCA 5K0UA 1DCSA 3GYDA 4TV9B 4L9BA 2EBOA 3WOGA 1OC1A 2Q7EA 4KU7A 2RMKB 1K5MA 1WPXA 2TUNA 2W5FA 3GBFA 3K4ZA 1V6IA 5FLJA 4B3SO 2HWB3 1BVVA 1PM4A 1XUQA 1PK6B 3SJCC 5LATA 4LE4A 4EJRA 4NWVA 2PELA 3AP6A 4OPAA 2W1SA 4MVSA 1CQ9A 3VD7A 4Y5Z0 3E5UA 2RDNA 4AI0A 3HKDA 3DCQA 5A80A 2PAMA 2CU5A 2XL7A 1G9DA 5A7OA 1N3OA 4FO9A 4BQ2A 2GN7A 1XC6A 3OBAA 1ULGA 3VBUC 1U97A 5IYDO 4GYCB 4XUTA 4DXSA 4FPYA 3K4AA 3PTYA 4N90A 3FE5A 3USUA 1YIJV 4YVSC 2X8KA 5DEDA 3ZRWB 1HJFA 1AR82 3ZFEA 3H1JH 1FV3A 5I8TA 4YLZA 1UXZA 4CP1A 4COZA 1ULDA 3M3EA 3OOXA 3IJ4A 2K1EA 3DSQA 4AEDB 4D6QA 4DV6O 4C0HA 3T08A 5AG2A 1GICA 2LM3A 4NHXA 3VDCA 5F2VO 3JD4A 3IC9A 1XRUA 2DYSB 3RWRD 2WJSA 4HVQA 2PZSA 2OA2A 4X1KA 2QQKA 1V6MA 1N33O 4ES8A 2XAQA 4FLZA 2WLJA 1QJU2 1UY2A 3AK0A 4PJ0Z 3I55V 3OTOB 2RN9A 3TEXA 4OUSA 4IXLA 3EMRA 3DPRB 2RR13 3KHBA 4KG8A 5KX5B 4QX3A 4ZZ5A 1JMKC 4JI5B 2AZ0A 1GQPA 1HDJA 5JXHA 1CJDA 3APOA 1PGSA 3JARB 4DRRA 2Y60A 2DURA 1WBLA 5FMDA 3JASB 1B35A 1PZ7A 3CMEV 4K3AA 3QNEA 3K5LA 2BOCC 1IKPA 2FDFA 3I2DA 3I56V 3OYWA 3MUY1 3LFMA 2J42A 3SPHA 3LFIA 3BVCA 4JI6O 4XFBA 5JIUA 1COWG 5A32B 3FAVA 1H38A 1RUH3 4Q27A 5C4WC 1BMV2 5L3BA 2F43G 2VMHA 5A3UA 3S3WA 3KWVA 4WM8A 3C7FA 3UO2A 3ZKYA 5B4XA 1F9KA 3HQRA 5DDJ3 4WFHA 4JYAO 4DXTA 5BZBA 1MOFA 2HJIA 1VQ9V 3GM8A 1LJ7A 2OW4A 5FZHA 1HKDA 1W6QA 4TLGA 3AXEA 1OURA 1LHWA 3I8TA 1CAUA 3K75B 4PLOA 1LRHA 4DR6O 1VBB2 4DRVA 4R8CA 4CU7A 5AFEA 2HBTA 2ARAA 3RWKX 3MHHC 1RL3A 4BK5A 3NMBA 1OD3A 4MVTA 3BABA 4QQHA 5E8AA 1LKNA 3CU7A 1UY1A 1JS9A 4DR3O 1W3XA 5LRSA 2DJVA 1LUWA 2VZOA 2WNOA 4O4LA 1GQGA 5HCFA 3NNMA 5KHJA 3ACHA 3JCUZ 1ZL8B 4CDQA 1JR9A 4FPJA 2BJSA 1Q81W 3AL5A 1WW5A 2LGWA 1QNWA 1MZEA 1W2UA 4B8EA 1ZREA 3URFA 2EALA 2W08A 2XJRA 2W94A 1AR62 4XZUG 2X5IB 4F6EA 4PLMA 3UT5B 3GCXA 5K1XA 3LPGA 4FK5C 1KKDA 5CFDC 3TCUA 2O1QA 2A7WA 1VRH3 2V5YA 3M3CA 4NN0A 2KQXA 2QE3A 1POV0 4RQPB 2DCZA 1IZ3A 1W8HA 2GAUA 4GT1A 2BSKA 3SYQA 3GNEA 4X1YA 4C91A 1IHMA 1HQNA 1U5IA 4JI0O 4X6RB 2WR9A 1E5IA 1W9TA 4RGGA 1WCKA 3BVOA 5EYPA 2WYFA 4Q4X2 3ZM8A 1KP2A 1M1KW 1CAUB 4QKNA 2AZ2A 3KCXA 4AQSA 1IBMO 4A42A 1MS8A 1CESA 5JWPA 3ENRA 4JKLA 5IVFA 4ZI7B 5DM6V 1W8TA 3DPRA 3HD8B 3WNOA 4EN6B 2EILB 4P9GA 2CYFA 3BA8A 4YW2A 2P3KA 2XXZA 1T6BX 1FV2A 3P6BA 2GU9A 1A8DA 4GWJA 2EIKC 2W0FC 3WW2A 3WHTA 1LESA 2RE9A 1WW7A 4YIPA 5LK7B 2B9UA 2R49A 2ZGTA 2JENA 3QACA 4XPVA 2WBKA 3VBUB 4AG4A 2EIDA 1GSLA 4FLUA 2WLKA 2LQTA 1AR93 2WO1A 4GKKB 1G9BA 1BK1A 5EBWC 2XWJB 2QBXA 2X6CA 3WNPA 1RSOA 1AILA 3JALB 1CEZA 1VJ2A 3JAKA 3P1IA 4DV2O 4NPMA 2W1UA 1DF4A 3BA9A 2GALA 2B5UA 5C8CB 4BCUA 4OYUA 5LA0A 3G71V 3VDAA 3OBRA 2W9XA 2V7QG 1PNLA 3D36A 3KV4A 1WLEA 2DWEC 4PA4A 1YHQV 2CWMA 1R092 5AVPA 1G86A 1JZ4A 2Y48A 4IIJA 2WFF1 5GLZA 2EINB 5H6RA 5C9AC 5IY5B 2Q67A 5JH7B 3B94A 3WNMA 5LEJA 2YIBD 4YW3A 2R32A 1O6UA 3MGUA 1OPOA 3CEIA 3BKZA 1AJKA 1N3PA 4J25A 3E5QA 4X8PA 5B3SB 5GM0A 5BUVA 1O8PA 2HJDA 1SQBH 1WCSA 4XUPA 4FPEA 4RS5C 1SHWB 1J3PA 2VAUA 1PL4A 2Y6KA 3UM7A 1VARA 4P9YA 5KC6A 1HNZB 1ULCA 4CEWC 3ZFGB 4GH4C 4EB6B 5K0UC 4RAIA 2EZOA 1PO21 2D3SA 4O2AB 1SFPA 3AYDA 1UXXX 3ST7A 3I5DA 1AJOA 3CCLV 1G8WA 2WSSG 2AEYA 1IKQA 2HR3A 2XKOA 1FX5A 4PJYA 1N1TA 4EN0A 3HKDB 2XWBB 2WO3A 3N9MA 3V65A 3CHXA 2RS51 4PHZA 3IIAA 4J1XA 1O7FA 3ACIA 4YY3B 3AMQA 4IL6Z 1TVKB 1ZZCA 1B04A 3WINE 2WNVA 5JCOC 3S7EA 4DR6B 1XILA 4Y1YA 1P7GA 1YVWA 2GDSA 3Q8AA 2XNDG 2RMU2 4TT3G 2OCCC 2GNTA 4ZI7A 4FXGB 4IE5A 2JDYA 3KQRA 1WAZA 2E32A 3X2QB 3FB7C 5FNVB 4BHPA 3AL6A 3U4XA 4YZ3A 3PIGA 2P6JA 2P3IA 2UY8A 4ARYA 4IYHA 1OFNA 5H9CA 5T5OA 2UU8A 5FQ0A 3OT7A 3OBZA 4LOTA 3ABTA 4G3YC 1RHI3 1OA3A 3ZYPA 1UZZA 4JI4O 3KF3A 5LHGA 2RMU3 2OKXA 4RQPA 2RJKA 2A06H 2ZQMA 3HAGA 3CB2A 4BWAA 5A70A 5LY2A 4NTWA 4GB33 3GGLA 5LZ6A 1XOYA 4FFFA 4NTYA 4IL7A 2Q5ZA 1H8HG 5IYZB 1YIPA 3VBSB 4FTEA 4BQ5A 1YQ2A 5BR8B 4XTMA 3P32A 4JI1O 3K46A 5C6CA 1FXZA 1BSMA 4KGGA 4YVWC 5CISA 3K5OA 2PYJA 1S0DA 2XQRA 1ZRFA 1SETA 2NN8A 1IPJA 5GONB 4U3JB 3ZIWA 3O9OA 4N43C 4DV4O 3D82A 1AXZA 1FPN2 1PD3A 2QCSB 5K7PA 2DVFA 5I0DA 1ZX3A 3VBFA 4IV3A 2OZJA 2HWB2 3WR0A 3KCYA 2JWPA 3MHSC 1VQ8V 2PY5A 1VB4A 2ZGKA 1HW5A 3C3SA 3WP6A 4IETA 3N2KB 3VD3A 1SPPA 2R1DA 1SBDA 2YEVA 5LMNB 3M3OA 1NLQA 5GLVA 1R1A2 1L7RA 3AZWA 1KGYA 3AEIA 3WP4A 3ZFFA 5A3OA 2W0XA 3ABMC 1NCQB 3AYEA 1GM8A 1WP8A 3ZXDA 2ZGSA 1BJQA 3V0AB 1BZKA 3R4DB 2Q8EA 3GZEA 3TK1A 4XBQA 1W6MA 2VTXA 5BY5A 1W39A 5D21A 5T50A 1JYIA 4D7YA 4K6BA 1CJPA 3PLQA 1KRIA 3MW4A 1VBD2 1ST8A 1KQSU 3WX5A 3HIFA 4FFGA 1VQ4V 3H8XA 2FDKA 1I5XA 5FLIA 2ADDA 5FPBA 3LB9A 1SQFA 4R9CA 4E2QA 1NTKH 1CXZB 1MZ6A 2JKXA 5IUQA 2Z79A 1TNFA 1RB8G 3H1HH 2QKCA 4K40A 4K3UA 2RS52 2RJLA 5FP9A 5IDJA 2DW4A 3QH7A 3POWA 1BBT3 1C1LA 1SCRA 5C70A 3HKEB 2FQPA 3E1F1 3JAMN 4BQXA 4JCKA 2PI4A 3I59B 4LF8O 3O12A 2J1AA 4C7UA 3C7GA 1DF5A 1QJZA 3IB3A 2ZXWC 4NIDA 1VMFA 5E88A 1PO23 1FOD3 1NAEA 4H3WA 2F23A 4X88A 4D3WA 2ZKLA 1BBT1 4IEXA 2PFWA 3D5OA 3LOIA 1M56B 2VNOA 3ZFGC 4OQ9A 5IYZA 4RO2A 4LO6B 5KUKA 1PMIA 4X66B 4U3JA 5L3CA 3MO4A 3DV8A 3CJIA 2Q6AA 5J98B 2WNVB 5ITZB 3MI8A 5FV3A 5F7UA 3TB0A 5L3DA 2PTMA 3ES4A 3QG5A 1RFYA 1GAXA 3ZRVA 1RMU3 1AJPA 2ZMKA 1QJU3 2XMLA 2RNBA 2GMMA 1AI6A 2Q73A 1TZOA 4UFZA 3N7MA 1FT9A 4BQ3A 5LCWL 3WW1A 1OLME 1RUI1 5TISZ 2WNUB 4NOTA 2TEPA 5A7NA 1F31A 4FLWA 1UN1A 2XJSA 4JYAB 1EZVH 2EINC 5L7OB 2AXTZ 4LT5A 3B77A 3SQOA 2K9ZA 1LHOA 2A3WA 3I2JA 1D0HA 4TXWA 1MG1A 4KH9A 1YQ8A 3EB7A 4QX5A 3HWJA 1BKZA 1W6PA 4CZZA 2I74A 2WT0A 1NA1B 4LKEA 2QJ1A 3VZNA 4CCJA 1VBC1 3VZMA 4HPKB 4AXOA 2FYUH 2Q69A 2DVDA 2P4KA 2R9AA 5BNPC 3HKBA 4FFHA 5LA9A 2HWB1 4O2AA 2VRZA 4EROA 1ODMA 4BDVB 3HR0A 3O1UA 4LLOA 3ZLIA 3CMGA 4O4IA 5A3TA 1G9AA 3ZN0A 2JJ6A 5L19A 1M9NA 3W21A 5BNPA 2C5DA 2R0HA 3ZSKA 1UPGA 2VOKA 1A32A 1AL21 4IEWA 4PA9A 3IAQA 5B1OA 1XMOB 2HWC1 1WLCA 5A6XA 3VBOC 4KFMA 5LYJB 3MLJA 2JB8A 2B42B 5BXXA 2UWAA 3B93A 3ZHQA 2LROA 4YG3A 1TMF2 2CTWA 1H2NA 3WY6A 3GZTB 1HB4A 1JYXA 1QVFU 2VOWA 1G6NA 3ZIXA 3D3QA 3NV4A 1KFUL 5FYBA 2UXCB 2C6SA 1W8OA 4MO3M 5DAWA 1O91A 4JHTA 4DK1A 2FKXA 1OSGA 2JGDA 2GC3A 1LNQA 2O14A 1W0OA 1NA1C 4CS2A 4DV5B 2NPIA 4MGTA 3GF6A 4CCCA 4DXWA 4JKMA 4NPRA 3RVYA 1MS9A 4FZ0A 4NIHA 1XREA 2V72A 4YM2A 1FS0G 3M70A 1JN2P 3UGGA 4ZHQB 1ZWIC 2V5DA 1L0NH 3O14A 1JFFA 2OPKA 1TE1B 3C3VA 1APNA 1FXVA 1UQXA 1SA0A 2PLV2 2VXRA 4DPNA 2DWRA 4CS3A 3GALA 4ZOLA 3ZYJB 3VBBA 1OHFA 5A6ZA 5K8SA 1VQ5V 5FZIA 3UKVA 4LF6B 3K06A 4A7ZA 3GB7C 2UYAA 3EQEA 1DGWX 4JAAA 3D3AA 3NV1A 1ZRCA 5LY1A 1IS5A 5FZ6A 1WLDA 2ET7A 4NRQA 4Q0VA 1OZ0A 3TETA 1MMMA 3FLPA 2ETEA 1JTZX 3CF6E 4KG0A 4MVOA 4X89A 4OI0A 1MSDA 4Q4X3 3CLPA 4MGSA 4LO7A 4U7OA 4FPLA 5AC91 1N3QA 1I6XA 2WIIB 5C4WA 3RZKA 2XAGA 2P6HA 4MGIE 2FBEA 2WA4A 4KHPB 3Q9OA 4MH0E 4JI3O 1JA8A 3PVEA 3AJZA 1SZTA 2GTSA 3E8HA 3Q8FA 4RR3A 4I2OA 4N53A 2Y6GA 2QZ2A 1JZ2A 3OF1A 4XETA 4BM8A 3B4SA 4CH6A 1LEMA 4CZSA 1AR61 1PNGA 3K3WA 2XVGA 4XDPA 1JX9A 4DV1O 2JIJA 2Q1MA 4O4JB 1ODNA 4P00B 2ZR3A 2ZGPA 4F6RA 1UD1A 1REEA 2DVAA 2DYRC 1UX7A 4IE0A 2JB4A 2WLIA 1V0AA 4L0PA 1JCHA 4ZONA 5F5AA 1XU2A 3BN6A 2XVLA 2GP3A 1OVPA 3HJRA 1WB8A 2YFUA 3CWBH 2R16A 3G80A 2HEPA 3PTRB 2DOSA 2YIDA 1BHGA 2DBIA 4DEVA 3WDYA 4HN1A 3JD0A 5B5EZ 4MVMA 1ZBA3 3AG3C 2VW1A 2BRTA 5A7WA 2B7YA 4UAPA 1CIYA 3WQ7A 1CR7A 4WM7C 1DP0A 5FLXN 3WDUA 5GZDA 4UBGA 5KWRA 1GANA 5J9PC 1S0EA 3OM3B 5KHGA 1QU0A 2TBVA 4CH4A 1TME1 2QR4A 1FATA 3AZVA 2NLJC 1TMF1 1K5MC 4CP9B 4O4LB 3W7TA 1RVF1 4Y5TA 3G67A 1QQCA 3H1WA 2ARCA 3I49A 1SFYA 4C8DA 4CEWA 2DYRB 2GNDA 3JCIA 3OAAG 5F3GA 2YFZA 1ZUQA 2OCHA 3CRAA 1AR4A 3JAWB 2B8MA 4W65A 3N2GA 4ZBMA 1ZLZA 4Z82A 3VD4A 3G4SV 3BU7A 4Z2AA 4JI4B 4GB32 4CDQB 4PDVA 5LGNA 4QB6A 1WMXA 4X9QA 1RUJ1 5LB6A 3ZO0B 1Q90D 1SDDB 3THTA 1VRBA 4LWSB 2ITDC 3SXWA 1KC8W 2QQMA 4XDJA 1R3LC 1EN5A 4R50A 2Q4PA 1SLTA 1GM9A 5IWAO 1YC61 5FQ0B 2WLLA 3BY6A 4M01A 5AC93 4NHYA 1QHTA 2ZAHA 3BEHA 1AP6A 3ZYIB 1YUDA 3E22A 4QGLA 2W6JG 1WCUA 4XXAA 1K5QA 1XNTA 5B1AC 3UKMA 2VQUA 1C8M3 1YJKA 5F6KA 1RUF2 2FL4A 1U5YA 4UB6Z 1HB3A 4AVAA 4KUMA 4COWA 3CMAV 3R05A 1AXKA 4CDXC 5EIBC 5FY9A 4QPYA 3CRCA 3PUIA 2EXKA 1HRV1 2XOKG 4URTA 1ORQC 3VZKA 2G9ZA 3PMEA 1M90W 1OV9A 4EQVA 2VOTA 3USUB 4IV1C 5E79Z 1KKCA 3FHAA 1KJLA 3HNBM 4O4JA 1VF6C 3R65A 4Q0QA 3NKTA 4FJCC 2NN4A 1NKDA 1LOFC 4LLFA 2HWF2 1V54B 1X4TA 1QXJA 4D6RA 4OHYA 3UCSC 5IAXA 4WBNB 1MPXA 4XJAA 1RUG2 2MEV1 2ZEYA 1DQ1A 3LA2A 3J26N 2QQOA 1D4M1 5KBFA 1UU4A 2PI5A 2E7AA 4F8AA 5GZCA 3E8BA 4EB6A 3AP9A 5AVAA 1L8DA 5JVVA 1LOFA 1ROPA 5FBZA 2GC0A 4RFT0 2HBUA 1S0FA 2UXCO 1CAXA 3CRQA 3RZGA 4CU9A 4UVBA 5J48A 5IVJA 3CIHA 5IVVA 3POSA 1K45A 1GMGA 3WF0A 4YM0A 4FM2A 4GD4A 1DYKA 3O1PA 1QJFA 1JZ3A 3AVSA 4BW9A 1SQPH 5CB4B 3JZVA 4J80A 1S0GA 1N0NA 4BMBA 1DYPA 2ZABA 3RYIA 3TAYA 2CH7A 1QJY3 2LP7A 3DC6A 5FZBA 4Q29A 2P67A 4PF1A 1VE0A 3KV6A 4LTAA 2IU3A 2IH3C 1O9HA 4JZRA 2DCYA 2QWQB 3NAPC 4Q4V1 1NVPB 1P8JA 1RJ7A 5F3CA 3OEHG 2C0ZA 1ULFA 5GZEA 3BOWA 1SDWA 5DZGA 1NZCA 1DQ4A 3KV5A 5A3PA 1VAKA 3DXTA 1YQCA 3MIGA 3RW0A 4PF5A 1COV3 2XQXA 4I0XB 2CNAA 2CUGA 3WG1A 2FZ2A 1Z0HA 2B39A 2AEZA 2A6ZA 1MEC3 1UU6A 1X7NA 1H8TA 1S77D 1GV9A 2XOMA 1I7FA 1EV13 4WVMA 2R1BA 4HK8A 4NAOA 3AFGA 2QNKA 2GC1A 4COYA 4B3MB 1FPN1 2X5IC 3NV2A 2R6QA 2XJTA 5CKNA 3TN91 4GB31 5H2FZ 1JHNA 1F7YA 2OUJA 1I1EA 2PQSA 1S5LZ 5DPNA 4DO2A 1FJGB 1RUE1 4CCNA 5KR7A 4V1PA 1Z7S1 3OEAA 1XI1A 4JI3B 1WD4A 3B5LB 5ABJB 1R1A1 3FB8C 5B1BB 5CBFA 4L87A 2AREA 3T3YA 4A4AA 3G6JB 3J7NA 4KBBA 3EFFK 2D6LX 3CP1A 5KLVH 2CL2A 5FZLA 3O65A 1O59A 1UOGA 1CX1A 1VBC3 3VQYA 3K59A 3E97A 3IDEA 1N36B 2R063 4JTNA 4KNCA 1HP8A 1Y74A 2DUOA 1F35A 2QKAA 1GP6A 1ND2A 3DYPA 2P5BA 4EV0A 2P7TC 3SPIA 4H7MA 4O9GA 1D0GA 4WFEA 2VCBA 1AR73 4YGCA 1UY3A 4RQEA 1VBB3 4XF3A 1Q43A 1CAXB 2GNBA 3CC2V 4N7IA 4B3RB 4CPBA 4JZGA 4CCDA 1TNRA 1VBA3 2GTAA 1FYJA 3DXRA 2WDBA 4MTGA 1I08A 3SITA 1QBZA 2PHDA 1FFXA 4JI8B 5BXZA 1LGBA 1A6CA 3T1HB 1H0BA 4LBLA 5D8AB 3RDIA 3DYOA 5JOXA 3CCUV 4Q4Y1 3RZHA 4OLLA 1LHNA 2IXKA 3GBGA 5IYCO 3ZXFA 3H8RA 1X9TA 2FDGA 5LW9A 3CDZB 1HR0O 1GOGA 1S0VA 2JDMA 3V0BB 3A23A 4FSJA 4IEOA 3FB6C 1POV1 1QQP3 2JEXA 4EWEA 2WYSA 3B02A 3LDCA 5EWSA 1N32B 3ABLB 2ZPXA 3CSXA 3T0DA 1BYHA 3BPZA 1P49A 4AVCA 5FXWA 5C5UA 4W4LA 5A3WA 3ZRSA 1PGL1 4DY3A 3TBDA 3ABMB 3LCPA 4XW3A 4B3TB 5A3NA 4AI2A 5IK5A 4EWAA 4XQDA 1TEIA 1WA8B 2PQQA 1FOD1 3N2KA 3RZZA 4M00A 1JYVA 3L73H 3GJAA 4XQ4A 1WNSA 5FCCA 3I59A 1EPWA 4BIOA 4X20A 3ZHSA 4J9ZB 4BISA 3HPNA 3AKQA 2DE0X 2NYYA 3N9LA 4JI5O 1W6OB 2N05A 4CP9A 2VZUA 3W9AA 5D1IA 3HR9A 3MICA 4MOAA 1O5LA 1TG7A 1UY0A 4LBQD 1Q56A 3RRDA 1K5JA 4YARA 2WLIB 5HXMA 1PGW2 2M7WA 3ZX6A 3E35A 3VDDA 1SQ4A 3I2FA 4FFIA 2W87A 1ZZ7A 2Q8DA 4A3ZA 1K34A 2ZAAA 2F93B 5KA6A 2EJ7A 4B4QA 5FOBB 3W58A 3K58A 4Y1VA 1G8MA 2EA7A 4M3CA 1XHXA 1PIV1 4EZHA 3QO7A 2YXYA 1KU9A 2EX3A 4TN7A 2PUSA 1MVQA 1UYXA 2ARBA 2VVEA 4ET7A 4Z8BA 4S2FA 3D0JA 1IURA 2QSAA 1TMF3 5JSOA 1UPIA 1I3HA 1S2BA 4JI1B 5DAQA 3JASA 3STLC 1S2KA 1NCRA 2HH9A 4HFSA 1V54C 1KECA 4QIWF 4D69A 1JW6A 4AEDA 3ABKC 1BCXA 2C26A 4UUJC 2F6BA 3J8F3 4JGZA 4NHLA 4UT5A 4KI5M 4CVUA 4OULA 3JBG2 1N47A 1WCQA 2DV9A 1UMIA 4LK6A 5FK8A 5L3GA 3NR7A 1X36A 1PX4A 4YJ2A 1PV0A 5A33B 3I2HA 1NQJA 2BP6A 1PPJH 4B3MO 5F2SA 4Y4RA 3L9DA 1W8NA 2E76B 2VQTA 4N53B 4HLTA 4CXYA 1ZBA2 4V2WA 2ZE8A 2VWJA 3X2QC 2YROA 2GH2A 1XMQO 1JZ8A 3L74H 4IGGA 2B45X 3RYKA 3WW3A 4D7TA 2ZIOA 4IE7A 4CCLA 1RUE3 1J84A 2X09A 1E79G 1NY71 4H13B 2QQNA 3B69A 4DYLA 1VEWA 4LOSA 1GR3A 3ZMVA 3MLKA 1W06A 1OCRB 1C8M1 5GLTA 4UF0A 4DR2B 3RMXA 4QMAA 3ZMSA 4UW4A 3QH6A 5CU1A 4WZCA 5DECA 2NNUA 4AW7A 3AVRA 4ASKA 4GZ9A 3B01A 2YBPA 4AHCA 2AGSA 1VAVA 3H1YA 5CMUA 4QE9A 4WM7A 2FTKA 4DR4B 3BFRA 2PLV1 2R061 4DV5O 1E5RA 4L11A 1W0KG 4GH4A 3A4UA 1W6NA 5EZYB 2IJJA 4KWKA 4JI2O 1B6QA 4X65O 4LNUB 2AW9A 4UFHA 4PDWC 4IGOA 3UJQA 4ASMB 2CDPA 1UZWA 1UW8A 4LK7A 5KMGB 1CPYA 4ORFA 4GXLA 2RV9A 2OIEA 1Y4WA 1Y9QA 5FZ4A 2ZZQA 4V2VA 5LBQA 3ABZA 4QX2A 1AJQA 3N27A 2GC2A 3ABLC 2E6VA 1YEWA 2YZ4A 5A1FA 2CGNA 1UCXA 3OGVA 3AG2C 1W9FA 1Q8IA 1QJX2 4DXZA 2JG8C 4LHSA 2HVJC 4K7JA 4W50A 3LA7A 1QJY2 2JEMA 2BWCA 3NRUA 3MUZ1 2YICA 2RJZA 2W1WA 4LBKA 2Q1FA 5IFTA 1UOFA 3DECA 4XOGA 5FOJB 3DTUB 4FPKA 4DUZB 1U96A 5HPOA 2A6WA 1GYKA 2VZ1A 4IQPA 1SF9A 3H42B 3MAQA 1YQ6A 1REDA 4I3GA 3ORJA 2JGDB 3U10A 4FOQA 2DVGA 1GLHA 3AG7A 4IEQA 4LKDA 1SLCA 2D93A 3J7LA 1NE6A 3CJIB 4CXXA 2C24A 5FYYA 3TEYA 1DYOA 2A3QA 1PNKA 3ICXA 3ZXJA 2LUWA 4TUYB 4I9QA 4O2BB 4BXSV 3BUCA 4JI2B 4YW1A 3JBG1 3OY8B 2XBO2 5M0TA 1OLRA 4W4KA 1VQKV 2IWGB 3IPVB 4BIZA 1OUSA 2HLEA 1J58A 4KQ7A 1OF3A 4BLIA 3N2GB 4Q0PA 1JOJA 2HKOA 4E8DA 4FI9A 3WNKA 4X62B 2KB1A 4AQYB 2BPA2 3MF9A 4AVBA 3N3HA 5IJ0A 1ENQA 4TYSA 3NJZA 4LF9O 3WUCA 1OJHA 3JBG3 3SMHA 2R071 5B2GB 4MGQA 4FP2A 2XKPA 1ZA4A 1NY72 4JGSA 2SBAA 2E3CA 1VIWB 3T1LA 4DUXA 4LWSA 4E2GA 2NQYA 2YBKA 2JE9A 2ZEZA 1K3EA 1S0JA 3IBMA 3LEIA 1C8M2 1YO8A 1V9U2 3HEIA 2WAMA 2WQ4A 1US2A 5KHHA 1ZZ8A 4K9SA 3VQVA 2BNMA 2VNVA 2BFUS 5IYBO 1SZXA 4WFAV 4OQ8A 5FKBA 3VBRC 4QXKA 2CK3G 1V55C 2WSUA 5F3EA 2ZD9A 3BI3A 3KZ4C 1YIFA 4NRPA 2C1FA 3GHNA 5EC1C 4YHHB 4F83A 3MPPG 2SLIA 4Z1MG 3W7WA 3EHBB 1VP7A 2VUJA 2Q8OA 1TQ5A 5GTHZ 4LUMA 2GSYA 2MEV3 2ZX1A 1BZWA 4LFCO 3CX5F 1V6JA 5LASA 4QPGB 1ENRA 4I50B 1MSWD 2RR11 2Q30A 2R9RB 4YFWA 4FT8A 1SKVA 5KA5A 3VHOA 4QB1A 1RUD2 2H6CA 3LF7A 4J7KA 1IVSA 5T5LA 1W03A 2P4VA 4CSWA 1RMU2 4DB5A 4URAA 1QNYA 2UWCA 3I3QA 2D6NA 3N7KA 4GAZA 1OKOA 4Q4Y3 4LULA 3RZLA 4LORA 4L92A 4F7ZA 3LSUA 4ZHNA 1KXGA 1CPNA 3H1MA 2UU9O 1N1VA 1Q8VA 4I55B 5T5PA 2FB5A 4XIOA 5L9BA 3ELNA 3WB1A 2UXDO 4LQRA 4JQRA 3ZDSA 4AL9A 2YS8A 1HLCA 5B1BC 5DZEA 3I2OA 1UKGA 3ETDA 1NVPD 4O9EA 1QY4A 5C4WB 3U14A 3RMYA 1IXBA 4LF9B 2WSVA 1QJY1 4P9LA 1SC5B 4UFIA 1QQP1 4KWUA 4FLTA 1J83A 4LFBO 2DWDC 4X6QB 5D2AA 1ZBE2 2ES3A 5IE9A 2EXJA 4Z2WA 4QQLA 3JARA 5JCOA 3NNFA 4BZ4A 2WZR2 5CA1A 3KT4A 4ZXEA 3HT2A 4UCUA 3CCRV 1VRH2 2CTVA 4NO4A 1NQDA 4H7LA 4FFBB 4QPIB 4GKXA 1BCCH 2GZWA 2A71A 1EP0A 3U37A 4JV5O 4FPCA 1AYM1 4CTEA 3VBFB 4YZ2A 5L73A 3DUIA 4CUAA 2H3OA 4JGZC 2YY1A 3IAPA 3S7IA 2D44A 2DQ3A 4AHYA 5FPOA 3NAPB 4PDRA 4PDMA 1HV1A 3UV9A 5BNQA 1EZJA 3S30A 2QM4A 4OCTA 3U0ZA 4B3TO 4YSFA 2D3RA 3T1HO 2BOJA 2P5OA 1H6YA 4Q4V2 1BE3H 2G4IA 4XXPA 4XBLA 1K12A 1QLEB 3OMAB 4I55A 5JZGB 2C9AA 3SJBC 1R1A3 4OUEA 1ND3C 3VL9A 4OXSA 1GNHA 2BE3A 1R081 2QQVA 3A2FA 5EJZB 2RDQA 4N8MA 1U5XA 3N35A 5GALA 4JZ2A 4R4XA 4LF7B 2A3XA 3TNQA 2X05A 2D2CB 4LFAO 2VNGA 1VBE3 2YUEA 4J11A 4AGRA 1MA1A 1HXS2 1LR5A 1AI4A 3LSQA 1RHI2 2ZDIA 5A1LA 2RCVA 2ZGUA 2E31A 1KEXA 4CDUA 3A0HZ 5J2UA 2LRPA 1H8EG 2ZEXA 1AX2A 2VMCA 1QOSA 4FVMA 3QBQA 2EIJB 3O0XA 3LDDA 5CVRA 5BNOC 3IFXA 1COV2 3K51A 1SEFA 5ACA1 4W6XA 4YG0A 2FCVA 3HVDA 3NJXA 2GMEA 2ZGRA 3OCPA 3TN93 2D5FA 4O4HA 1IBKB 4EN9B 5D5QA 2BW8A 4GMP1 4QDSA 1IQAA 4GMP0 4PIZA 3RYHB 4XCAA 5F1RA 3WF3A 2PLV3 2BDRA 5FPRA 2J1TA 4MG2A 3DGTA 2JDPA 2W1QA 1N0JA 3HOBA 5JQGB 5GJ6A 2CDOA 4CCKA 3BU0A 3K08A 3MYXA 3IPVA 2ZA9A 3KV9A 1CAVB 2Y33A 4DV7O 3KS7A 1BEV3 4QXBA 3BCWA 3M8AA 3ML0A 4Q8KA 2EAKA 3VBHA 1LCLA 2BCCH 4NXNB 2E7TA 2VZVA 3SH3A 5TSWA 1V6KA 4G9SB 3WF2A 1QQP2 3FX7A 1WKYA 2UUAB 3ZMOA 1QEXA 1JZ5A 3ZHRA 3UESA 3APQA 1QWRA 2ZXQA 3BHPA 4ABMA 2Y6JA 1QR9A 3ZPOA 4LF7O 1GKFA 3BYWA 1RSOB 1DBNA 3JSNA 4Q6GA 3VHPA 2UYBA 2JEUA 2WZR1 1YJLA 2W6IG 4RA0A 1D4VB 1R6KA 1PO13 3RYCB 2A9HA 1A78A 1BXHA 3K0GA 1NYWA 1V6LA 4DQAA 3RYFA 3ZN5A 1J5EB 5BY1A 5FMOS 4P2ZA 3GJBA 4JRLA 1WBFA 2ARXA 3K48A 1XQ8A 2KG7B 1VQLV 2P90A 1IS4A 4DUYB 2IXJA 4OHVA 3U78A 4B4RA 2VUDA 3T2PA 3ON7A 3WD5A 4RN5A 1AR72 5LMNO 3IWZA 5KXBA 4DR4O 3AG1B 3EXAA 3C2UA 1HX6A 1N32O 4NRMA 1KS5A 4NIGA 4I0BA 1CAVA 4MXWA 2ZT9B 4MUVA 4GA9A 1SBFA 3AP4A 4KU8A 4K0KO 2ATFA 2WA3A 3CRMA 4M3CB 3T0AA 1W05A 2Q1ZB 5LGUA 1YQ5A 4HKLA 4JGYC 5F39A 1DGLA 2W47A 3AYAA 4F3JA 5EPAA 2ZMLA 1AVMA 1AVBA 5C8YA 1NI8A 2HWC3 1VQ7V 3ACFA 4WVZA 1XNBA 1E57A 1HXS1 2QDRA 5FR3A 3LEKA 1UMHA 1GRJA 1DGSA 2GDFA 4HG6B 1JU4A 5FY0A 1B06A 5EYPB 1W59A 4ZU4A 2L35A 1PP9H 1UZYA 4JGYA 4JTOA 4OX9B 3CCJV 4BE3A 2D6KA 4IT5A 4K8XA 5FRAA 4FPPA 4GLXA 4LBEC 3PN1A 2VXJA 5F5QA 5JAXA 2BU9A 1OCRC 4DR2O 3OPWA 4Y1UA 5C3RA 2F66C 4JQTA 3DF0A 2KKWA 5T5JA 2ZOEB 3GBWA 4QDQA 1H4HA 1COV1 1W3VA 1PX3A 3CJXA 1R6NA 2JIGA 3HKCB 3S5AA 4HZ3A 4LF8B 3J7HA 3WEZA 4UCRA 1IBMB 2V4AA 1BK0A 3AX4A 4KWLA 2BEOA 4AQYO 4XZPA 3ZYFA 1HRI2 1Q8PA 1I0HA 4ATFA 1F4NA 4CEYA 3U4SA 3LDKA 1KD7A 2RDRA 1SQXH 4A6SA 4QKFA 3AC0A 4NE9A 5EIBD 3KD4A 2G9GA 1HW7A 3LWCA 1WWYA 2Y4UA 1PIV3 1H2GA 1Q7YW 4LHKA 3SPJA 2JE7A 5C9AB 4NKGB 5IHRA 5EYYA 5JSPA 1RUC2 2ZM6O 3TNPB 4YXWG 3JUUA 4K0KB 1UPSA 4MHUA 4MXVA 1E5HA 1ZZ6A 2YV8A 2Y26A 4NIAA 1I5YA 2VO5A 4X62O 4Y1XA 5I0RA 1B35B 3FJSA 1VLNA 3AMHA 4R6ZA 3DYMA 3LUTB 3DN7A 5FPZA 1BMFG 2P2KA 5T52A 2XLFA 4IUGA 3ALQA 3KB5A 1OBNA 4AVTA 3ILFA 4WF9V 4C90A 1S0BA 4RL7A 4ASLA 3OPTA 1QNMA 2CAUA 2ZNIA 2IXLA 1ZRIA 4TV8B 2BFUL 4LXLA 3RI8A 4HKOA 1AP5A 3T1CA 3OE7G 5FIXA 1LODA 3VBOB 2IXCA 5FTTC 4FTBA 4HKWA 3J4UH 3HPLC 4KWJA 1G9FA 4FZ1A 4MXWB 4XMAA 2OPWA 4XJ9A 2BTQA 2JDAA 5FZDA 1W6MB 1Y3TA 3OMIB 4K1ZA 4H37A 3RT3C 3AMMA 5HFMA 5IJ9B 4CXWA 3TWIA 2OUHA 1ND2B 4FAGA 1WJZA 3LDRA 3X29B 1NT2B 3JD1A 4YRDA 5J36A 5FO7B 4TUYA 3LDBA 5IWFA 4Q4W3 3CRRA 3WP5A 1O3SA 2WZR3 1GNYA 5GZGA 4QPGC 1RUC3 3OUJA 4LFCB 5H9PA 4FM1A 1X59A 5KHKA 5E89A 3UK9A 1S3JA 2VBDA 4LPLA 3OGGA 3I4IA 4F4LA 5DG1A 3L75H 3POIA 2EICA 1KS4A 4HYOA 3IZOA 4DR5O 3H9VA 4DW1A 2Y0OA 5CG8A 3OGJA 2XAHA 2VQAA 4XABA 3THDA 2EJRA 4GMP3 1W8FA 5L9RA 4PDWA 4BMEA 4CC5A 2VCAA 3H3ZA 1HRV3 4I0XA 4FVVA 4CH5A 2HHHO 3GHMA 4X66O 2X53S 1S0CA 3MLLA 5C3PA 2JG8A 3W5NA 1SACA 1XDCA 4PA3A 4YVWA 1D2QA 2L6LA 3OJBA 2VWKA 3M7MX 2WNUC 3ZRXA 3FB5C 4BH9A 3ACGA 1W2AX 3DC5A 3VGIA 4WVMB 4LF4O 4KMQA 3BCCH 1W0PA 2PMWB 4AI8A 3ZX7A 1YCIA 2PGGA 1V9PA 1JPXA 2D43A 1D4M3 2EILC 4P9JA 1SQQH 2WS92 5CB4A 2VZ3A 5LOVB 3ATGA 3FLRA 1J59A 1SCSA 3J7AU 4CPBD 1N36O 1E1RG 4AOCA 4Q2FA 1TUBB 5FZKA 3HB3B 4I09A 3ZHTA 4FQZA 3A7QA 2YMZA 4UXAA 1NUKA 2R072 3CJHB 2FCUA 1H4GA 5EBLC 3ZSMA 2ITCC 4CUGA 5DAVA 3OUHA 4DRXA 4JYBA 1J5EO 4COUA 1LOGA 1YFUA 4A44A 1DQ6A 1ASJ3 4JI6B 1C1FA 5FPVA 4DEQA 1R1ZA 3PJQA 2VS0A 3AKPA 4Q4X1 3C3TA 5FYTA 4K21A 1GZWA 2DYCA 4JV4A 3OR6C 5KC5A 3ILNA 5FZ1A 4DV4B 3D3IA 2JDZA 4UXNA 3VBUA 2P06A 4HBNA 4YVWB 1X82A 1H2SB 1FFTB 1BQPA 1R093 4PIXA 3WDWA 4UV8A 4XTPA 1YNAA 2B4KA 4JYCA 2VMEA 3BIEA 4DV3O 1V6NA 4IEYA 4LKSA 4DUVA 4LR4A 3ITQA 4Q26A 5B66Z 1PVC2 3SYOA 1PKXA 2DUPA 2RM21 2ZGNA 2BBAA 2H94A 5FY8A 2EIMB 5F2WA 1RUD1 5LP6A 4YPJA 4UVCA 4MADA 4NMIA 2PHTA 1JOBA 2WZ8A 4O4HB 3W7UA 2VC9A 1K3IA 1GZCA 3NNLA 3K9SA 4OHZA 5C3SA 2BERA 3VZLA 1H1AA 3BPSA 4Y5SA 5BMVB 2XAJA 1TUBA 3A0BZ 3RN4A 1OF4A 5L9VA 5K1PA 1ZNPA 2H8PC 1UU5A 4JYYA 1DLLA 2BV4A 3RFRA 1H9PA 1QJX3 4UW3A 5FZ7A 2Z2SB 1W8ZA 4QB2A 4HNAA 4EZ4A 2LW1A 2Q9LA 2QDOA 1OQDA 3WW4A 3AJYA 4M0HA 5T55A 4M4RA 4LO4B 5A6QA 5GW7A 1R3IC 2VCMA 4AYUA 4B1LA 5KXEA 5J96B 1R091 3CJIC 2CWSA 5DAXA 5JR7B 2BQPA 3P30A 1GWKA 2UXDB 2Z4FA 1K4DC 2BGOA 2UWBA 2RM23 3SISA 5CEHA 3E22B 4GCZA 3RSJA 2V09A 4FFBA 5DDJ1 1EAH1 4XF9A 3WB2A 5F32A 4AQ2A 2ZX3A 2OQ7A 5FYSA 3I3DA 4PBPA 3HNMA 3ZYRA 2JIZG 3WT3A 4LF6O 2VVDA 1JVMA 2QM8A 4AHZA 1YXWA 3U07A 2YXSA 1FMD2 4AEKA 2GH8A 1REFA 1JYWA 3LSSA 3VLBB 3JATA 1YZBA 1MQTC 4WFFA 3A22A 4I4TA 1PO22 3V56A 3KG2A 1ULPA 1UOBA 1CWPA 3VKNA 1VBD3 2RS12 3AK3A 3AG2B 5FUIA 2ILMA 2PN5A 3IDAA 2H6BA 4CEWB 3B2EE 5APAA 4R9DA 3N4MA 1AYN1 1QR8A 1R3KC 1YSCA 2DCTA 2WS91 4BIFA 1FAYA 4ONUA 4O7XA 2J1EA 2BTOA 3FD9A 3E6DA 1PMJX 2XG3A 4GKJB 2ARHA 1S0IA 3LE0A 4A7KA 2GSMB 4P02B 1QDOA 5ANNA 1GH6A 2JS5A 1JMUB 5FYHA 1ENSA 4H0LB 1JODA 1RPRA 1GUIA 2IM9A 1B3QA 1JZ6A 2WLQA 3ZPYA 5A32A 5SV5A 4CEYB 1OLMA 4QGPA 3UT5A 2XJQA 5IY5C 2AUYA 4A2UA 2QEXV 2OCCB 4HSJA 3TXQA 2IU0A 2VJXA 4QNHB 4JHZA 3VBOA 2VPVA 2W91A 4JPRA 2DN9A 1RHI1 4FPOB 3KCCA 3ZMZA 4WVWA 4RR3B 1UIKA 4XACA 4LA3A 4CDQC 1BQZA 2C2AA 2XLGA 2WZEA 1LOCA 5EP9A 3WG2A 1Z5VA 4YGEA 5EBMC 3IKWA 4IGPA 3WP3A 5LP6C 4LBNA 2EULA 1NZIA 3CS5A 2ZEWA 3VN4A 2BNNA 3UGHA 1CP9A 2LS6A 3SJQC 3F7YC 4SLIA 1UYYA 1LOAA 2PYTA 5J09A 1PNFA 3C8XA 1HNZO 4R9BA 1NJIW 4A41A 3AZXA 5LEKA 1DLBA 2D98A 3KHCA 4NYKA 1QLEC 1RJ8A 2OXBA 2VMFA 1RPOA 2EIBA 3BIWE 4EKWA 2JICA 1B09A 1RYYA 3W7SA 4EYUA 3B8NA 4QXCA 4XBFA 5FP3A 2XONA 1V70A 5EJ3A 3JD72 4XJUA 4DR7O 3IDBB 4K8ZA 3AG3B 5C8YB 1JYCA 3L9JT 1EN4A 4ZHQA 2AC1A 1I94B 2DCJA 1BS3A 2QTSA 2EIMC 3TEWA 2AZ5A 3FHIB 5I8YA 5FZGA 4B7KA 4Q20A 3PIJA 1H2LA 3WQ0A 4W8JA 3Q8CA 1S1AA 3MDPA 3CD6V 4UCVA 2JDKA 4I30A 4OZOA 4Q5OA 3SEPA 4LH6A 5CFDB 5HCAA 4PDLA 1JQ0A 5JQGA 1EAH2 3JD3A 5EZWA 2A7AA 2QQIA 2ZHNA 5GONA 2WT2A 1YTFB 1JUIA 1W2BU 3NNGA 5FXVA 2IH1C 2DMXA 3ZYBA 2IBZH 2IJKA 1VBB1 1CGPA 4MSWC 4JTCB 4DW0A 5I8SA 3O1TA 4BWOA 1J95A 1NTMH 4KGQA