2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
2D40A 4DINB 1CAUA 1CAXB 2IC1A 3FE5A 1WGPA 1ZREA 1ZZ6A 4I01A 2Q0AA 5LRRA 1UW8A 3JZVA 5T3NA 4MZUA 3NW4A 2P17A 2BNMA 4XFFA 3H8UA 3SCGA 4I0BA 3IBMA 3EQEA 1ZRDA 2EAAA 4HZFA 3I59A 2XLGA 2BNOA 4LUMA 1CAVB 5E16A 2PAEA 3RYKA 4LUKA 2E9QA 4Z07A 3SXWA 1UCXA 1ZRCA 3UKTA 4WVZA 4IEQA 5JAXA 3UKVA 2B8MA 1O3TA 3FZ3A 1OD5A 2OYZA 3TNPB 5BPXA 3HT2A 3E5XA 2CV6A 1X8EA 3ST7A 4R52A 4UBHA 5EFUA 1YFWA 4Q0UA 1VJ2A 4TLFA 4QGNA 1DZTA 1FT9A 2XL9A 5I93A 4Q0VA 1ZX5A 1GQGA 5I8TA 1ZZ7A 2ZKLA 4D7SA 2HKXA 4E2SA 5CU1A 2PYTA 2XL7A 4IEWA 1ZRFA 1XE7A 2GAUA 5HI0A 4QMAA 4KU7A 4MV2A 1Y9QA 3ELNA 4META 1XRUA 2IXLA 2DCTA 5BV6A 1RUOA 2Q1ZB 3BPZA 3IDCB 3IDBB 1EP0A 3BB6A 3O14A 1PM7A 4AXOA 1WA4A 5JSPA 4IERA 4IEOA 2IXJA 4D7TA 5FDBA 5KHIA 3H3ZA 5JSOA 3BALA 2PAKA 3DN7A 3IWZA 5LEJA 3E6DA 4BH9A 1EYBA 4B29A 1O3QA 4L11A 4YNIA 1H1MA 3WW2A 4BIFA 4I02A 1ZNPA 1Y3TA 2H6BA 1FXZA 3DL3A 3FFQA 3H7YA 4HVQA 4L2NA 4LLOA 1Q3EA 2D5FA 2UYBA 3EO6A 3M70A 1NZCA 3L2HA 3E6CC 2IXKA 2QCSB 2QVSB 2GH2A 5I0TA 1UIKA 1CAXA 3E6BA 1IPKA 2VQAA 2CAVA 3EJKA 3SCFA 1RUNA 4F7ZA 1O5LA 2ET1A 4Z82A 3S0MA 4XFAA 4AVAA 5J7MA 3M3IA 3LZZA 4EV0A 2QNKA 3BCWA 4HLTA 1CAVA 1ZZCA 2C0ZA 3MYXA 1VP6A 3CEWA 2MNGA 3HT1A 3QOPA 4XEZA 4HSLA 2IXIA 2Z69A 3GBFA 2UYAA 4IEPA 4MGZE 1O5UA 3PNAA 2PQQA 2UY9A 2Z2SB 1DZRA 5I0SA 3H9AA 2IXHA 3CO2A 5KHJA 3KMHA 4X6RB 4MX3A 5LRSA 4HN0A 3OF1A 4Q0QA 2PHLA 3R6SA 1CGPA 1DGWA 2BGCA 3FHIB 4HVRA 4AQ6A 4QGMA 2ET7A 1G6NA 1SFNA 2ZCWA 5KHGA 4PIXA 2Y0OA 1ZRRA 4MGKE 4PJYA 4A2UA 2BNNA 1WLTA 4J1XA 3B02A 4E2QA 1PMIA 4PIZA 2O1QA 5LEKA 2GC2A 3D0JA 3OD0A 3HIFA 4E2GA 3KGLA 1CAWB 1NE6A 1RC6A 2K9ZA 5C8WA 3SCHA 3ZDSA 3MZHA 4EWAA 5K8SA 5J3UA 5I91A 3N4MA 2GU9A 4IETA 4IESA 2BYVE 3RNSA 2WFPA 1J3PA 1YFUA 3RDIA 3WW3A 3LAGA 3NJZA 3NSTA 4RD7A 4XF1A 3CF6E 4Q0SA 3VHRA 4WZCA 1I5ZA 1QWRA 5KBFA 1QY4A 2QJVA 4JTOA 1RL3A 1H1IA 3RYRA 4QX5A 4LA3A 2N7GA 2HJIA 5FQ0B 3EBRA 4MGYE 1HW5A 4AQ2A 3RPQA 1ZVFA 3QACA 2H6CA 1UIJA 3UKNA 3OTFA 4XF4A 2OPKA 1O4TA 4XF9A 5JSRA 1J3RA 1OI6A 4XF0A 4FAGA 2XGXA 1IPJA 1TQ5A 2Q4SA 1SEFA 1YHFA 3TNQA 1O3RA 3HQXA 4WBBA 1YLLA 2QDRA 3S7IA 4ZU4A 1LRHA 5JR7B 1J3QA 2VPVA 3ES4A 4XFIA 4HVOA 3PLQA 4XFGA 4QGLA 4XFCA 1YWKA 1RTVA 2OZJA 1I6XA 2K0GA 4BHPA 1JUHA 4KWLA 3MPBA 1J59A 3G7DA 2CGPA 4IEYA 3H1WA 4KU8A 4YSFA 3LA3A 5BXXA 1V70A 4ZU5A 2IXCA 2Q30A 4KL1A 5JCTA 3KGZA 2ETEA 4IEUA 1Q5OA 4YRDA 3KCCA 4I2OA 1NYWA 3USSA 2D5HA 1RGSA 5I0UA 4MH0E 4FT8A 4JV4A 2F4PA 1J58A 5FCCA 4FAHA 2OZ6A 5BUVA 4AVBA 1LKNA 4X6QB 5E1RA 2XHKA 1NXMA 1CAWA 2PAMA 4KWKA 1YFYA 2V09A 2D93A 3WW4A 4FBFA 5KHKA 2PHDA 4QXKA 1CX4A 1LB2A 2MHFA 4Q0PA 4UXAA 4JVAA 3D0SA 5D1IA 4AVCA 4YYOA 2PA7A 4LTAA 1QXJA 3EHKA 3CJXA 2XKOA 2H0VA 1LR5A 4PIYA 2XKPA 3I7DA 2ATFA 3I54A 5BY5A 3H7JA 4IEVA 5I8SA 4LA2A 4N9HA 4O9EA 5EZWA 4UBGA 3H1MA 4H7LA 4JTNA 2B9UA 2UY8A 3ROUA 2I45A 4MUVA 4HN1A 5FQ0A 2GC1A 4CYDA 1UPIA 4KWJA 1L3JA 1VR3A 3ACLA 2PTMA 5FPXA 3OGJA 5KHHA 3NL1A 2O8QA 3SHRA 4MGIE 3FJSA 1CAUB 4I0AA 5CVRA 3LOIA 2GC3A 3NVCA 2FQPA 3H3UA 1OFNA 1J1LA 3E5QA 3IIAA 5FLIA 2XLAA 4XFHA 3DKWA 5F1RA 1SQ4A 2XLFA 4ORFA 5FLJA 1U12A 3BU7A 1X82A 4HBNA 3MDPA 3LA2A 3I59B 1YFXA 2MPFA 2WC2A 1XE8A 1EY2A 4QM9A 2GZWA 3U10A 4F8AA 4HSJA 4EROA 1Q43A 5C6CA 2BEOA 5J48A 3CL1A 4N9IA 1X7NA 3S7EA 4IEZA 3RYPA 4Q29A 3E97A 1X8MA 3RZZA 4XETA 3H50A 4QM8A 3ES1A 2EVXA 3GYDA 3U0ZA 3FX3A 2CAUA 1GQHA 4P9GA 3H1YA 1EPZA 4XF3A 4EWEA 3ETQA 4LEJA 4I09A 3FWEA 4K8FA 4NVPA 4HMZA 2OA2A 1UD1A 4IEXA 5I8YA 1OMIA 5AVPA 2PFWA 2B5HA 4LULA 5I0RA 3WW1A 1DGRA 3E5UA 5CADA 4XFBA 3D82A 1ZZ8A 4EWDA 3NKTA 2EA7A 4J1WA 4OLLA 3KSCA 1FI2A 3LWCA 4ZU7A 4OFGA 3DV8A 3CLPA 1NE4A 3LA7A 4BYYA 4ONUA 3C3VA 3OCPA 5FLHA 2GC0A 1O7FA 2VECA 2KXLA 5FPZA 1QXRA 3PVBB 4O9GA 1O3SA 3U11A 1YUDA 4R8HA 3SMHA 2FMYA 4YARA 1ZZ9A 4I3PA 4GULA 1ZZBA
chains in the Genus database with same CATH superfamily
2VGDA 1RYYA 3HPNA 4CP9A 2PHRA 2ZX2A 4ASMB 2VZ1A 3M1HA 4KGGA 4DV7O 1JUIA 1S2EA 2P37A 1JU3A 3WEZA 4HZFA 3I59A 3O1PA 1B04A 1VLNA 4Q1PA 4LUKA 1NT0A 3IT8A 3VZNA 2BTOA 2IJHA 3OY8B 4L92A 3I97A 4FSJA 3CWBH 2OYZA 1BBT3 4Q8LA 1YFWA 5F2WA 2WT2A 3K06A 4FPOB 3OGVA 2TNFA 1FPOA 3K0GA 4TYSA 3H8XA 1W2TA 3MV01 4P9IA 3TGUH 2P3KA 5IVFA 1ENXA 2C6SA 2RHPA 2IXJA 3VLBB 3R4DB 4RHV1 5LZ6A 1VF6C 5DQ0A 5KMGB 2F17A 3MGUA 2RDNA 4A45A 4PBPA 5F3IA 4Z2AA 2W46A 4JX0A 4BIFA 1GN2A 4OHZA 2YHJA 2QM7A 1CPMA 4HVQA 3DXRB 5LMUB 1FMD3 1QOSA 3GWKC 5JCOC 3ZXJA 4XJ9A 3FBYA 3MLJA 3L70H 1M56B 3E6BA 4DR4B 1IPKA 2PLV2 4L0PA 1ND3C 1YQCA 2E5LO 2QSAA 4XZPA 1DQ1A 1SLTA 4NXNB 3WX5A 3ZHQA 4XAEA 3JASB 1OT5A 2OUHA 1F9KA 4NB5A 1FOD2 2VMGA 2EAKA 4F6RA 4JGYC 2NMNA 4ZKIA 4ZBMA 5A7SA 1CGPA 3AG3C 2VMEA 4DV4O 5CFDA 4W6WA 2E7AA 1NH2D 1IGOA 4BR6A 3HIFA 4QPGA 5C8WA 3GXUA 5I91A 4HETA 3T1MA 5EYYA 3ZMTA 1AR82 3W59A 4MVOA 3WQ1A 3TCUA 5H9PA 3ILRA 3ME2A 2PYLA 1JOYA 3PJQA 3NV4A 5KLVH 2WZ8A 3UKNA 3USUA 2NN4A 3DGTA 2LW1A 3POEA 1JMUB 5EZYA 2WABA 3CRAA 2QKAA 2IFWA 4AHYA 4KGQA 4LKSA 2P6JA 1JYCA 3AKQA 4HVOA 1YWKA 2BGOA 2W68A 2E26A 2XJSA 4UXNA 2D2CB 3I4IA 4GUNA 4NHMA 1N34O 1ZM1A 4PDVA 4P14A 3H1WA 3LA3A 3BTYA 2XAHA 1JYTA 5JCTA 4COUA 1UOJA 1QOOA 1UX6A 2YG0A 2HLDG 2DN9A 2B4KA 3RMXA 3FX7A 5E88A 4HKLA 3SQOA 3UGGA 1OCRC 5CA1A 1KRIA 4BPZA 3WT3A 4TLGA 1TVKB 4HK9A 2PHWA 3FLRA 3H42B 5D5QA 1J84A 1JN2P 1K5JA 4UI9L 1S4CA 1IKQA 1LB2A 3AK0A 2PZSA 2VMFA 4YLZA 1GKBA 5KA5A 4YY3B 1XQ8A 2YROA 4UW3A 2ODMA 1IDSA 4UT5A 1SLBA 1HLCA 2RS13 1HRV1 4X62O 1G9AA 1QDOA 2WLPA 1QQP2 2GC1A 3JARB 5T54A 1UY3A 3LEGA 4JI8O 4KG0A 1LODA 2RR12 3FJSA 5A6QA 3KKYA 3AXEA 3LOIA 3ZRSA 4GKKB 5FREA 1DQ4A 4K3UA 3JATB 2JE7A 3IIAA 1W0OA 2XBO3 4XJ8A 4JTCB 1AP6A 5K7PA 1X82A 5DAWA 2ZGOA 2QQKA 2YU2A 2WZEA 3LOBA 4JPRA 3KCYA 1XC6A 4MT8A 5EYPB 2GZWA 1FXKC 2ZAHA 5AG2A 1DF0A 1VF7A 4PLNA 5KAIZ 3PUAA 5B4XA 2LGQA 4RQEA 2DCJA 3ICXA 1QEXA 3ZXFA 3H50A 3WDYA 4FP3A 1QQCA 1YTFD 1MACA 2VMHA 1LTEA 1ND2A 1BCCH 5KA6A 3RZLA 4Z2WA 3SGIA 2OA2A 2GHYA 5AVPA 1G86A 2DYSB 1AX1A 4PQQA 4XFBA 3K0DA 3KCXA 4J42A 2NLRA 1ROPA 4DRXA 4D8MA 3R4SA 2JE9A 3WD5A 2LGWA 1WBLA 2RS31 5EK0A 5A7PA 4NIAA 3MW4A 4DV0B 1UY4A 1KC8W 4LE4A 4RR3C 4LFCO 1QXRA 1PHMA 2FMYA 1YRZA 2FDGA 3K4DA 2EZPA 4IHJB 4B3SO 2UUAB 1ZREA 1JS9A 3H9VA 1KDMA 5A32A 3GWOA 3ENRA 2MEV3 5FZMA 5HCAA 2VQ0A 1JMKC 1V0AA 4CP2A 1ZRCA 4UUJC 2WO1A 4RS5A 5HFMA 3VD7A 3UKVA 3BTAA 3ABMC 1NLRA 4MO3M 2B8MA 1O3TA 1BZKA 4GJYA 3CP1A 1OPOA 4QU1A 2ZE5A 4RHV2 4QGNA 2CDYA 2A1XA 1DZTA 3CJHA 3VBFB 4P30A 2XL9A 4BCUA 3HNMA 4AW7A 2LFSA 3RWNA 4E2SA 4QKDA 5B3SB 4QMAA 4NPRA 4J9ZB 1HXS1 5L7OB 3M3QA 5C3OA 5FWEA 5JSPA 2JDYA 3I5DA 2I2SA 2V7QG 3O5SA 1BHAA 3HN1A 5L9BA 3J8F2 4AE2A 1VQMV 4WM7B 1W6QB 3FAVB 3U1XA 1W05A 4XHXA 2Y34A 2YDEA 2E53A 3T0BA 3I2FA 2UUBO 1US2A 4X89A 3SYPA 5C4WB 2CE4A 4CVUA 4DUZO 2WSVA 1ZWIC 3ECQA 1GOFA 1UYZA 1STMA 2NMOA 5J96B 3MUZ1 4IL7A 1UIKA 1COV2 4DZGA 3JD3A 3O1RA 1AR63 2VS0A 1N1SA 3ACFA 4Z82A 1QJY3 3S0MA 2VZRA 3OGRA 1W9TA 3FKSG 5FO9B 3Q4HB 4Y5TA 2VUAA 1HRI3 2MNGA 4AAPA 2W9XA 1YJWV 2EILB 3OY8A 3CXCU 1ULCA 1F31A 4GZRB 1VBC2 2C9KA 1QJX3 4JGZC 1SF9A 2VY0A 4BJ0A 2IFRA 4PIXA 1ZRRA 5ABJB 2IUWA 2EIDA 3MIDA 4UFIA 1H8TC 5L3GA 5FYYA 3MZHA 4QX2A 1R3KC 4K9SA 1Z7S1 4FJCC 5GZCA 4LHSA 1LAJA 2JJ2G 1O4YA 5EIBC 3RDIA 4YPJA 2B46X 2RM21 2DU0A 5KMGA 2QQMA 1I94O 1N47A 1QWRA 2JENA 4BQWA 1OCCB 2XAQA 3BEHA 1AI4A 5FLXN 1J1TA 5DZGA 1AI5A 4LA3A 5LA1A 5CYYA 4XBQA 2Z5UA 5FXWA 3DXRA 1QH7A 3MLLA 2ZEXA 4QX3A 2XQXA 2VBDA 3HQXA 3CZUA 1DCSA 3VL9A 3J80N 2WN3A 1I5YA 1G9CA 3ZBHA 1NR7A 4WVMB 3EB7A 3ZXKA 3SISA 1GMMA 1Q56A 5JI7A 4JYYA 4XMAA 3LD8A 1FPN3 4CEYC 2DWRA 5FV3A 2ZXQA 5IK5A 3C7OA 3T1YO 5FMCA 2R063 4QWNA 5F32A 3ZRWB 2HWF2 1SQQH 5BR8O 2WZR1 1WCKA 2ETEA 1IHMA 4H2AA 1LOBA 4YRDA 2DVBA 1LOFC 1HRV2 1KDKA 1J58A 1GSLA 4I50B 4UFZA 3NJYA 1BKZA 4QXKA 4NRQA 1XBFA 5C5TA 2HWB1 1FATA 4Q26A 2PA7A 1B09A 2G19A 4QQ2A 2PQSA 4K0KB 3KF3A 4TOIA 3I54A 2C5DA 1QU7A 3B77A 4DUWA 4H7LA 5FY4A 4A41A 4JZ2A 1KB9F 4CDWB 4JI2O 4E9KA 5CBFA 1M06G 4XIOA 1JQ0A 2YMZA 4QPWA 4M01A 5B2GB 1R1A1 2YFZA 2YC4A 3MDSA 3B4SA 5GONB 1OFNA 5FIXA 1J1LA 4QE9A 4XFHA 2UXDO 4QJFB 1XMQO 5FZHA 2R071 4HBNA 3RS6A 4D6SA 1D0GA 4IW3A 3AFGA 4I3GA 3CKHA 3WNMA 1EAH2 4DR5B 5A1LA 1YIFA 5H9RA 3ABLB 4DV6O 3OMAB 2EICA 3IMMA 5FZ3A 1R64A 5IUQA 2AGSA 4EROA 4XC9A 5FZDA 1X7NA 1VAMA 1BYHA 3WHUA 4FQZA 2A6VA 2YPDA 2RS32 2B5UA 2VJXA 1VF5B 1MZ5A 4CDUC 4EWEA 1YEWA 1TVKA 3ZFGB 3AL5A 2X29A 1W06A 3DC6A 3BVOA 1YQ8A 5BZBA 3JSLA 4CCCA 3ZKYA 4BYYA 4IGOA 1X36A 1SCSA 4E4SA 1JU4A 1UZZA 1GOHA 5FZ6A 4MVTA 2W47A 3JARA 2UUCB 2W87A 5LP6C 3POYA 1O3SA 4XUOA 4R8HA 3ZYGA 2UXXA 3MIBA 1YI2V 4CH3A 2CTQA 5GLUA 3PUHA 1UW8A 3JATA 5FZ8A 4KWUA 3ZSLA 2JX9A 4YZ1A 5GZFA 2BNOA 1GWMA 4AG4A 3C7HA 5EYPA 1MABG 1HN1A 4LMFA 3BYWA 4JYAO 4ITCA 3RZJA 1OD5A 4BIOA 3G6EV 3U07A 3JD1A 1PIV2 5I93A 3AM2A 5EBLC 2XVGA 4A5UB 2Y8KA 2A75A 5C8YB 4R4XA 4DY3A 3IDCB 5L3FA 2AH2A 5DG2A 2EULA 4EZHA 2JG9C 4BIZA 5DAQA 2PN5A 4J11A 2FDFA 4Y1VA 4LQRA 2BVBA 4ZOLB 2JS5A 3DN7A 4BH9A 2UXCB 4R9BA 4B29A 4J7JA 3G4SV 4I02A 1WPXA 2H6BA 4K8ZA 1REFA 3V64A 4YVSC 5FPBA 2CL2A 3U14A 3FFZA 3N27A 3H7YA 3QO7A 5DG1A 2LFRA 1E5HA 3E6CC 4IHJA 2PYJA 1G4YB 1GM8A 3EJKA 1V6LA 2DTWA 4GAZA 3M3OA 3SCFA 3RZMA 2W95A 3BTZA 3A23A 2Q4PA 2XAJA 3LZZA 1AR92 5BNQA 1GP4A 4MTGA 4N21A 2DFCA 2Y4UA 3URFA 2YYOA 2QBXA 3H1LH 4PT6A 4AQYB 3R0RA 5B1AB 4YW3A 5DDJ1 4NIHA 5LRSA 1OBNA 4A3XA 4Z1VA 5FZFA 4AFCA 2FD8A 1G6NA 3VBFA 4WM8B 1XB9A 3LDBA 1WLTA 5FUIA 4JHTA 1HV1A 2WINB 2R041 2K9ZA 5L7OA 5J3UA 4W6XA 5T5OA 1SFPA 3MO4A 2P3YA 1W0JG 2WNUB 4WM7A 3J81N 1W6QA 3FAVA 4WZCA 4BQ3A 1TME2 3MAQA 1RXGA 2QJVA 1BQ0A 4JTOA 3BKZA 2CY6A 2E3CA 5C4WA 1XOYA 2X53S 2OPKA 4G3YC 5J37A 3CJIB 4NXMO 4ATEA 2LALA 2WZR2 5EHDA 3RYCB 1LOEA 1Z2GA 1ENQA 4AI9A 4QGPA 2YI8A 1VBD2 4ASUG 4G9SB 1NCQB 1LHOA 2E76B 3G71V 4FVMA 3Q4HA 3PTYA 3LCPA 1H8EG 1HNWB 1YO8A 3CBNA 4W4ZA 2PF4E 2IW5A 5FMBA 2CGPA 3KLSA 2VWKA 1O9GA 1PZ8A 1MQTB 4KL1A 3LE0A 3JCZA 4P9YA 4FVVA 1GTOA 2P4EA 5IYYA 3WP6A 3WG7B 5ABJA 2L35A 1W28A 2OXBA 1H1AA 2ERFA 5GJ6A 2HYXA 1NQDA 4QHZA 5C9AC 1BQPA 3PHMA 3GDBA 4FBFA 2R9IA 1CX4A 5FJKA 1R1A2 4KBZA 4JZGA 3EHKA 2WSSG 4LBJA 1GNYA 4EFBA 2WSUA 1HNZB 3VUOA 2O57A 1JHNA 5H9QA 4I9WA 2R072 2XJPA 3OBTA 4Y1XA 4DR7O 1VEWA 1QJZA 3NV1A 3F5TA 2DURA 3K5NA 3ZKUA 1C28A 1L3JA 1XPWA 3POJA 1GANA 1PGW2 1M4UA 2QQVA 1RFYA 5HXVA 4I0AA 2GC3A 2P90A 1CESA 5FRAA 4WVMA 4IV1C 1OHHG 1HXS3 4IT5A 2F66C 1EY2A 3U10A 3OPWA 5HV0A 1SG3A 2P67A 2A3WA 2BEOA 4Y22B 2ZXWC 3PIJA 1BJQA 2GNDA 3ZRWA 1O9HA 4XETA 3T3YA 4X64O 3ES1A 3WG2A 2F1MA 2HKOA 1W8TA 1AYM3 1W03A 1G1XB 4RQFA 2CWMA 5F6LB 4I50A 3WQBA 2DWDC 2PHXA 2QWRB 1P4RA 1OXCA 1PNGA 5FY7A 3P3NA 3ZMSA 3U75A 3GGLA 3R4UA 3D82A 1KECA 3THPA 1X33A 1UMHA 2OS2A 3ASNB 1CZVA 1UYXA 1UPSA 4K3AA 4H3WA 1AR71 3B8MA 2DCYA 3OCPA 1GOGA 1NKGA 2LROA 3WVJA 2GC0A 4AYUA 2PHTA 4YW7A 4CDWA 2BP6A 1M90W 1W6NB 1BT8A 4IYIA 4Q4Y2 4JAAA 1ZZ6A 5DAXA 5GONA 3TN92 4Y26A 4RQPB 2HHHO 3K5LA 3ZX6A 4I0BA 1B35B 1Z7S3 2Q7EA 3SJBC 4YHHB 3NWKA 1IXBA 1L0NH 1OLQA 3AJYA 4J6GA 1RUJ2 4OI4A 4HG6B 1L7RA 3NV3A 1FYUA 2ZM6O 2RM23 3APQA 2RE9A 2DVFA 1S0EA 4R52A 4FM1A 2QZ2A 1GUIA 3OUHA 2JGDB 4Q0VA 1P84F 5CU1A 1KFXL 1YQ6A 2HWE1 2QQNA 1TUBB 4P5YA 4LNUB 5FXXA 3BPZA 3GM8A 3ZFGA 3HOBA 2VNVA 3V0BB 3O14A 4IERA 1XMOB 2TEPA 4UW4A 4DUYB 2OIIA 1PNMA 4EE2A 1AVBA 1EYBA 2IWGB 2VMDA 5FPRA 3OE7G 3K4AA 5FXVA 3CSXA 1GR3A 4CZSA 2P1BA 2ES3A 2ZAAA 4JI5O 3WNPA 2VW0A 3IMNA 1UZWA 2DE0X 5GW7A 3DXTA 4LBLA 2QCSB 4SLIA 4CPBA 3VDDB 1LOAA 2XJVA 4A7ZA 4F7ZA 1K3EA 3ZSMA 1GRJA 3THCA 3RJ2X 4JDNA 1LJ7A 4P9WA 3WDTA 4N43C 2Y48A 2QFEA 3M99B 3CCQV 2HWB3 3Q8BA 1ZZCA 2C0ZA 3HT1A 3ZX7A 4CC5A 4MGZE 4LHLA 3MHZA 4EN8B 4QPJA 1FV2A 4ZY9A 3KV9A 3ASOC 4JRAA 4C91A 2ZQMA 1YHQV 2Q7GA 3LDKA 2Z42A 1H8VA 1Q8VA 1VMFA 1AB3A 5EIYB 3GJAA 3TK1A 1VBA3 5LEKA 2KG7B 1S72V 4GWMA 5C8YA 3MLKA 3VBSB 1SQXH 1NZIA 1HR0B 2WLLB 2ZX4A 4IETA 1E79G 3K5MA 1J3PA 2Y69C 3LAGA 5CFCC 5LY1A 5DXDA 4UYBA 4XF1A 4ZOLA 4MVMA 4FLUA 4CTEA 5K0UC 5JXHA 2W08A 4LF4O 1LGCA 4QD2A 1UIJA 4QQLA 2XASA 3CCUV 1O4TA 1Y9GA 4AI2A 1SACA 2KA3A 1IPJA 4Y20B 2JEUA 4WBBA 2AGAA 4IE4A 4LBMA 2IBZH 2CWSA 3WY6A 2CK3G 3ALQA 3ZR5A 1ZLZA 4DXSA 4MLOA 5JPMB 3A0BZ 4P9PA 5LHIA 3KZ4C 3CRQA 4XE9A 3TB0A 2YIAA 3JXSA 1X50A 5IYCO 1UOBA 2VTXA 3CS5A 4LFAO 3O12A 4AVVA 4DV2B 4WM8A 4Q20A 5LL6Y 1G9DA 3TBDA 4LFBB 2RMU3 3LFMA 3ETDA 4K35A 3WOGA 2G9FA 4JI6O 4FAHA 2YFUA 1MS4A 2DYRC 3GZUC 5A7WB 1NCRB 2HWD1 5F39A 5D1IA 1AYN1 2RNBA 2UXNA 1FKAO 3J9SA 5FZ0A 2QQLA 2WNUA 5F5CA 1DFQA 4UVBA 1MEC1 1J83A 2XJRA 3CE2A 1TAEA 5CA6A 1ND3B 1PGL1 1YXBA 4B7EA 1KP3A 4TSFG 5L3CA 1GZWB 4R50A 1SC5B 4IE0A 3SYCA 4NWVA 2ZMNA 3CJIA 4EB6B 4MGQA 1VP7A 3WF3A 1VRH1 5GKAC 3RQ0A 3RYCA 1QXPA 1NTZH 2E5LB 2DFBA 4AI8A 1XXNA 2OCCB 2CSGA 4JGYB 3KT1A 4LR4A 5C3QA 4DR6O 4BDVB 1NCQA 3LA2A 4D6QA 1M57C 3AG3B 3I2HA 1EV11 2Q69A 1XNDA 1POV0 3VKLA 3P30A 1C4RA 2RS51 1WCUA 1SQBH 3T0AA 3PVOA 3C7FA 1ASJ3 1MQTA 3KT7A 3ZHVA 4CDQB 2RCVA 1NY71 2E75B 2JGUA 5IYDO 1Y74B 4GLXA 2NM1A 4CUAA 2W0XA 3ZSJA 5KXCA 3N7KA 4AVTA 1UL9A 2UU9B 1HIXA 4PD4F 4FZ1A 2Y4TA 4X65B 2QE7G 3QCWA 4JTDB 1W8ZA 4EN7B 2JICA 4ONUA 1KD7A 4OHXA 4CXXA 5G05L 2K46A 1OUXA 2CTRA 1H2SB 5DDJ3 4CEWC 4UWDA 2VVFA 4NKGB 1ZZ9A 3I2OA 4GULA 1Q6UA 1O91A 1W0NA 2VQFO 4MZUA 4OULA 2R043 1SLAA 1LHUA 1PVXA 4DR3O 1VB4A 2HWE2 1ZRDA 4J41A 3E8GA 2FDHA 4MYEA 1QOTA 4NHXA 3RYKA 1N3QA 1QKQA 1BVP1 2ZGKA 5KUMA 1OCRB 4Y22A 3TETA 2BZDA 1CONA 4TXWA 1XSQA 2VW1A 1WMEA 3KVAA 3KV6A 1GNHA 3C3SA 1POV3 4XDQA 4OI0A 4PDRA 1GWKA 5ERLA 1ONAA 1KYOF 1RPRA 4Q8KA 3RYFB 5BV6A 4TSVA 3OW2U 3JD2A 4AHCA 2KQXA 4JCKA 4J7ZA 1QR8A 4XBNA 1RUD1 4LF7O 4D7TA 5JOXA 3H3ZA 3E8HA 1AROP 3BALA 3RYHB 2PAKA 5FOJB 1PO12 2NR5A 2FHRA 4IYHA 4AFBA 4X62B 1H0BA 4O4IB 4N7IA 5A3UA 1IBKO 3ZRXA 2WLKA 3ZXAC 1HW7A 5F2SA 4LLOA 2UYBA 1W6NA 1Y66A 2GH2A 4DQAA 3WUCA 4MHRA 4XDPA 3I3BA 1ZX3A 2J42A 4OZOA 1LHWA 4RQPA 3FLPA 1V54C 1B35A 5ANQA 1PO23 2IJIA 2E7QA 4QX1A 1WB7A 2KD7A 4HLTA 1HV0A 4YG0A 1I1EA 2HJFC 2IXIA 2FDJA 2YUEA 3PU3A 4KFMA 1B6QA 1KKDA 3ZFEC 2B39A 4MVSA 1DGRN 4NO4A 1XHZA 4OMCA 3CO2A 4C90A 3NKGA 4Q0QA 3VBHC 2BGCA 4LHKA 2JGDA 5SV5A 5CAZA 5ISLA 5K1XA 5F5AA 1TUBA 1YJLA 3TEYA 3HB3B 2GC2A 4LNUA 2Z3YA 5F6KA 5JMCA 3MICA 3VQWA 1MVQA 2X10A 3AL6A 3N4MA 3V0BA 1XQNA 3TEZA 4AOCA 4RR3B 1YFUA 3AYEA 2JEMA 4ZS3A 3AMQA 4PLOA 1RUH1 1W3XA 4I7ZB 4IGGA 2XB6C 3ZRVA 5KBFA 3NXSA 5C4WC 4QKNA 2RQ6A 4LR3A 2EIEA 3POSA 3QACA 2JK5C 3N9OA 3M8LA 5FK7A 4E4ZA 4LH6A 3T09A 1S0VA 4BIUA 5FZ7A 3E83A 1TQ5A 1DQ5A 3S7IA 3VDDA 3ABMB 2HYKA 2J1SA 2XJQA 1BEV2 3W20A 1D7PM 1A8MA 3CHXA 4OQ8A 4M3CB 1IPSA 2IVJA 1WW7A 4BHPA 2J1EA 1F4NA 1CP9A 4X1IB 4C0BA 1UF2C 3NNGA 4J7KA 3OR6C 3QVNA 3K5OA 4HFSA 5BXXA 1AR73 3V0AB 4NRPA 2Q30A 3ABZA 4IEUA 1NYWA 5AVAA 2BOCC 2WN2A 4NAOA 1J5EB 5C33A 2CTPA 4AZZA 2QTWB 5JIUA 5L9RA 3E8FA 4NTXA 2KG7A 3B8NA 3EXUA 3WW4A 2C26A 3VBSA 1NTMH 3LPGA 4Q0PA 4MS2A 1GH6A 4JVAA 2AACA 1ZYBA 4LTAA 1W8UA 3SPHA 1S2KA 1ULPA 1VRH2 5FPLA 1SA0B 3ZVXA 2ZHLA 5APAA 5LGNA 2GTSA 1UZ0A 2UUBB 3K75B 3HMYA 2ZIMA 3ROUA 4FLXA 3D8CA 3VZLA 4DUZB 5CG8A 1DLLA 1H30A 3O0WA 3N2KB 4QQOA 2BCCH 2KKWA 1KJLA 2RS52 2VQEO 3SLIA 1GWLA 4AAXA 4K1YA 4Y20A 1RMU2 2FCUA 2PXJA 2VZ3A 3SPIA 3ZMZA 1DGWX 1SQ4A 2XLFA 2AYHA 1NY72 3OPZA 1LUVA 2BVVA 3OEEG 4JGZB 4BK4A 2OKXA 3N9QA 5FYVA 2ARAA 4LF8B 2PHUA 4LO5B 3SEEA 1JX9A 2GDSA 1ACCA 1C8M1 1H8TB 3WHTA 5JPNB 4JAUA 1Q81W 4Q29A 3WCRA 2HEPA 1XNQO 4YZ3A 1RUC1 2J1TA 4LOTA 4P9GA 1ODNA 2DMXA 2JDNA 1VF6A 3UYJA 4LEJA 2TBVA 1VQNV 5A7WA 1NCRA 4QPKA 4IIJB 4IEXA 1OC1A 2PFWA 1DGRA 2VZOA 4BOWA 1AJQA 4PHZA 3ZN0A 4OLLA 3SDLA 3RZHA 3THTA 1I94B 2LO1A 1W2NA 3CRMA 3ZMUA 4O61A 3JSNA 3AG7A 1AXYA 3CNAA 4BM8A 5FLHA 3K03A 5C3PA 1SESA 1ND3A 1O7FA 4PA7A 3JB8A 1KFUL 5LB6A 3HPLC 3B00A 1VBB1 3JBG1 2YGLA 3O7OA 4EB6A 4P9LA 1W3VA 1CQ9A 1VQPV 3S5QA 4I01A 3ZJZA 5FAXA 4LPLA 4I4TB 1LNSA 3JYCA 4AHWA 2QE3A 4JGYA 4FPLA 3VD3A 3I2KA 2XLGA 3DC5A 5J36A 4ATFA 3GHMA 3SKJE 2VZPA 3Q9OA 1VB2A 2HFEC 3FD9A 5FKBA 3TNPB 1RUD2 5BPXA 5T5LA 5BR8B 2CV6A 3H0OA 4GB32 5EFUA 2G38A 1NVPD 3VDCA 4CDQA 4D7SA 4R6ZA 1Y74A 4GX1A 3AKRA 1Y4MA 2HP8A 3PU8A 4BA6A 3NNFA 3BA9A 3AK2A 2YS8A 4COWA 5C8CC 1VAKA 5FYIA 2VXJA 1UU6A 3ETGA 4DW0A 3SEPA 2CGOA 2PUSA 1Z5VA 3T2TA 2PMWB 3AJZA 4Q4X1 4RGGA 1ENSA 2KM2A 4JI2B 1HDKA 3WF1A 4O65A 4K7JA 1UOGA 5FBJA 1ODMA 1Q3EA 5JLVA 5H5NA 2QWOB 3O1TA 1C1FA 3L2HA 2ZGPA 1WLCA 1T5EA 2E33A 1VQ9V 2UXDB 5FP7A 2D3PA 1XMQB 1ZBE1 3O1MA 4XTPA 3ZXLA 4XFAA 3AYCA 2HWD3 4ISRA 1OLMA 1YIPA 1QDCA 4EV0A 4FLTA 3AC0A 4AK3A 2JD4A 2PELA 1AYN3 5JOWA 2RJLA 4XEZA 5D8AC 1SQGA 4LITA 3W7TA 3M7AA 4CDUB 1XI1A 1RUG1 1S0JA 1N33O 3IDEA 1MEC3 4MGSA 3PUIA 1OSGA 4I9QA 4Y24A 2ZA9A 3ZCCA 1F5FA 1R6NA 3MF6A 4PIZA 5FY1A 1XU1A 3MW2A 2BUKA 1HN0A 3RYFA 1RC6A 1Y76B 4OHYA 3D36A 5IT6A 3ZHSA 2BYVE 1N4CA 1MVEA 4YXWG 5LA2A 5E79Z 3CC2V 2WO2A 3HJRA 3ACGA 5E8AA 2QQWA 5LP6B 3RYHA 5F5QA 4JI1O 1EV13 3HAGA 2HR3A 4FXKB 3WG3A 5M0TA 1RPOA 1MPXA 3TEXA 4O4IA 3JCIA 4XDLA 5IVBA 3TWIA 2RS53 5FQ0B 1K12A 4AQ2A 1O8SA 1WJZA 4H33A 5FZAA 1RB8G 1NKDA 1MR5A 4GWNA 4XF0A 2N04A 3AK1A 5GZGA 1JVMA 1BXHA 2JDMA 3IIIA 2I07B 3TXQA 5JR7B 3QO5A 3GCXA 2FL4A 1GN6A 3ES4A 4NR1A 4OMDA 3UJQA 4I0XB 3T08A 1ZBA1 1PZ9A 4L87A 4RO2A 1Q8IA 5L73A 2VZVA 2K0GA 2BGPA 5KC5A 4FTBA 3PMEA 3O0VA 2WNOA 2ZHKA 4ZU5A 1W2UA 1IG0A 2DUPA 3JAMN 4GJZA 2JG9B 3QF7A 3EXAA 2ZX0A 2VRZA 4PBOA 2QQIA 3K46A 3VBUC 4LBQB 2RDSA 1Q8PA 5AC91 1L0LH 4M3CF 5E1RA 1IOAA 4L99A 2NYYA 4U3FH 2DVAA 4P00B 3QH6A 4Q5OA 4UXAA 4PDLA 4LKEA 5IVEA 4RR3A 4YVSB 3VQXA 4KH9A 1VARA 2WL1A 1DBNA 3HBKA 5F3GA 2F4VO 3JAKB 1NU1H 4DV5O 3H1MA 4CCDA 2WRAA 3B7MA 2I45A 4EKWA 4GKYA 2YV8A 3M8AA 1DHKB 2E31A 4Q27A 4DFSA 3I49A 5KHHA 3NL1A 2AW9A 1AL23 1RUI2 4XUNA 3MV11 3NVCA 4QIWF 3EHBB 4Q4W1 1R081 1W8NA 3E5QA 3SC7X 2FZ1A 1PP9H 3K4ZA 1PVC1 4ORFA 4MSVA 1W8OA 3BU7A 5F9TA 1RUC2 2DCZA 1SDWA 3T1LA 2CUGA 4M3CA 5FPVA 4X1IA 2GH8A 1WMXA 2CYFA 1S3JA 3S3WA 4GXLA 4AFAA 2IVIB 2WLMA 4GKJO 1UAIA 3V0AA 5JOYA 5IJ0B 1GFF2 3WG7C 2CAZC 2XNDG 3APBA 3FB5C 2YBSA 3WB0A 3HKDB 4I09A 1JFFB 4RL7A 1W9YA 1TUEB 5J2TB 1LR1A 5LGTA 4HOOA 4EJRA 4BMBA 4JV5B 2R32A 1HJFA 5LK7B 4FPCA 4LNVA 3T2MA 1SA0A 2YIBD 3ZM8A 4UFHA 3DSQA 4LK7A 1LENA 3N2KA 3PVBB 1R3LC 4NXMB 3FLTA 2OIEA 2IM9A 3B09A 2IC1A 1BK1A 3RVHA 4B3NA 3JQXA 2VE1A 4L9BA 2UWCA 1HB4A 2P17A 2BNMA 3H8UA 1S55A 2QR4A 1RHI2 3E2EA 1WCDJ 2DQ3A 4O2AB 4JGZA 4D94A 5E16A 2ZE8A 2ZE7A 3STZC 3HR9A 4Z07A 5A2QN 4WVZA 3CCVV 4ZHNA 1RUH3 3BIEA 3KHCA 3T2PA 2W52A 2BTQB 4TT3G 3E5XA 1EN5A 1H8TA 5C9AB 1JOPA 3O1VA 3T1HB 4UBHA 2XG3A 1OA4A 3KVBA 3KM5A 3VKMA 3W58A 5I8TA 1AUYA 1SLIA 2XVKA 1BHGA 2VOKA 2ZNJA 1N1TA 3WU2Z 1DG6A 5FYZA 2D3SA 5LATA 4IIJA 2G9GA 3RBZA 5H6RA 1YI9A 2CDOA 5EP9A 1LGBA 5JSOA 1NH2B 1G6UA 4DR2B 3ZEDA 2AR6A 1H38A 1AR81 5T5PA 2I74A 1ZBE2 1V9U1 1VBE2 3INAA 4DR7B 1H1MA 5A6YA 1HQLA 4IV1B 3OT7A 1OLME 5T50A 1SFYA 3EO6A 3M70A 1DF4A 1RUG2 2JXAA 3OMNB 3K79A 3QLQA 4XYXA 2RDQA 4I4TA 3OUFA 2VUDA 5FP3A 1HQNA 2ZXWB 1KQSU 2P4KA 5FMOS 4GWIA 2ORZA 1AXZA 2OQ7A 5FZ9A 2Y33A 1CVNA 3MYXA 3CEWA 1LOFA 5FYUA 2AZ2A 1GP5A 2D6KA 3TJTA 5EQUA 1IZ3A 2WFF1 3W7UA 2YBKA 3BABA 3ZDVA 3BHPA 3RI9A 4MX3A 4UCRA 1S5HC 4LE3A 5BMVB 2XQRA 5KHGA 1C5IA 2QQUA 2P34A 3JU9A 4A2UA 4E2QA 1PMIA 2BRTA 4E2GA 4N90A 4X9QA 3S57A 3ZDSA 5A7QA 4JI3O 2HG5C 2ZGLA 2L9LA 1QJU2 4RD7A 4KMQA 5DPNA 1SZXA 4BXFA 5KX5B 1KBHA 3NAPC 1FJGB 1QBZA 2ZJCA 2P5BA 4XDJA 1RL3A 4QB1A 1M5IA 1C8M3 1ZBA2 1NT2B 5LW9A 3RPQA 4B4QA 4J25A 1QQP1 5EBWC 3UO2A 5IJ9B 1ULGA 4FAGA 1RVF3 2X5IC 3EMRA 2HH9A 4ZU4A 2XUMA 3RRDA 2EBOA 1G7YA 1J3QA 3N2GB 4Y1UA 1K4CC 4V1PA 3WP4A 2LRPA 3LUTB 3GHNA 2GMPA 1CZSA 4XACA 5AC92 1HB3A 1FAFA 2OVUA 4QX8A 2ZHMA 3BU0A 3VKOA 3OUIA 4GKKO 4CDUA 4YSFA 4W4LA 1IS3A 2H8PC 3KGZA 1MG1A 1FD9A 1W90A 1Q5OA 1HKDA 3KCCA 2AZ5A 2BDRA 2BSKB 2UXBO 4CBCA 3JBG3 1VBB3 4XHBA 2J22A 1D5NA 4RUEA 4R4ZA 3ON7A 1NXMA 1Y76A 1UO9A 2MK3A 3JB4C 4GQ7A 1YTFB 3D0SA 5GTIZ 1XILA 1RUF1 1R1BA 3HKCB 4NE9A 4Q4W2 1R082 5LP6A 2ZX1A 3TEWA 2VQUA 3A4UA 1PVC2 3H7JA 4YIOA 5FUPA 5FQ0A 5A7OA 5JJJB 4KWJA 3T4DA 1AJPA 1UKRA 4N43B 2YXYA 1SCRA 2D3OW 2R30A 4A7YA 4M3CE 4AEDC 1W6MB 1EN4A 2V4DA 4N53B 2FQPA 4A4AA 4ZKTB 5FLIA 5F1RA 1I7FA 2JEXA 3ASOB 3D3IA 4DV0O 4I0XA 2YZ4A 1XE8A 4WBNB 1JZ8A 2YUAA 1REEA 4XQWA 1NQJA 2ARBA 3VBRC 1LEDA 3AB0A 5C6CA 2VG9A 3S7EA 3FB8C 1ALYA 2VZQA 4Q4X3 1QNMA 4M0NA 2JG9A 5F37A 2P6HA 2Y69B 3SR2C 5CFCB 4XCAA 4P08A 2CAUA 1GQHA 5H6QA 4LBQA 5ACA1 1NCRC 1EPZA 4FPFA 3O1OA 2VWJA 1PM4A 3ETPA 2BWAA 1GP6A 1PX4A 1V00A 5K0UB 3ZIWA 4CCOA 2Y6KA 3RYIB 4XQ4A 4YVSA 2V73A 3AG1C 1EFRG 1NX9A 3LDCA 2JKBA 3J8F1 5FZCA 3JAKA 4NROA 3S5AA 4DR1O 4H14A 2XT9A 1QNWA 3K9SA 2P6CA 4IL6Z 4OUSA 4NRMA 4MTXA 5KWRA 1DQ0A 3MUY1 1C3HA 4JI7B 4F3JA 3AKSA 3U11A 1WMFA 4YARA 1PX3A 1D5AA 3DF0A 4I3PA 3PL0A 4LO7A 4Y1YA 2OCCC 4LBEC 1COV1 2EIJC 1E5SA 3SCGA 2Y6GA 2WS91 5CBHA 3E22B 4RGAA 4B3MO 2E9QA 3AP9A 4R9CA 1D4M2 2HWC2 3SH4A 2EF6A 1N1VA 3J7NA 1NLSA 1XUQA 2DYRB 1R092 4CDQC 4FPHA 4LFAB 4GX2A 5IJ0A 5GZDA 3SNMA 1VBC1 5EPAA 1V9U2 3VZKA 5FY0A 4I30A 4JI6B 5LBEA 1Y9QA 4O2BB 3HKDA 3QNEA 2E6VA 3CB2A 1JFFA 3CC7V 3OEAA 3WSOA 3CMGA 1M4WA 5J2TA 4GMP1 2QWPB 4DMIA 1WA4A 4P02B 2V4VA 4DS0A 1N36O 3N7MA 1FFTB 1ORQC 4JGSA 2BOBC 5FPAA 3AZXA 5FZEA 3UM7A 3VV1A 3ZSEA 2Z0AA 1JPXA 3SJAC 1CPNA 5GLVA 4W8JA 3E35A 4PA9A 1DYPA 4QB6A 3LSSA 1M57B 1NZCA 4ET7A 3POWA 2WFF2 1TGOA 1UY2A 1SQPH 1H2KA 1GLHA 4X8AA 3C90A 2BTVC 2WLQA 1W39A 3B9IA 3CXHF 4LF5B 2ET1A 4BLIA 3H8OA 2YU1A 1FNZA 2QKCA 3K51A 3VKFC 4O2AA 3PTRB 2Q8DA 2PY5A 3QOPA 2QA4V 2D6OX 1WLDA 2ZE6A 1QJFA 1PD3A 2XH6A 1DGSA 2BBAA 2BTQA 4FFFA 2QKDA 5C9AA 2K2SA 1ENVA 3KMHA 4KNCA 4HN0A 5FPOA 4QB2A 1OJHA 3F7YC 3HBZA 1RUE2 2HWF1 3WNKA 1PNKA 2EIGA 2R1DA 4TWTA 2DVGA 4KG8A 4MW3A 4XBFA 4AILC 3D36C 2QQJA 5IAXA 4BW5A 3LEKA 4O4JB 4FCAA 4M00A 5KUKA 3GNEA 1IQDC 4CEWB 2FBEA 2VCBA 1PL0A 3ZO0B 5K4LA 1BS3A 5FP8A 3NMBA 5C5UA 4IGQA 3RYRA 3EBRA 2D97A 2J1VA 2WQ8A 4K20A 4IV1A 1Y9MA 4S2GA 3APOA 3OTFA 4XF4A 1H2MA 1I5PA 5EC2C 1CIYA 2VQFB 2PI5A 3NNLA 3ZYJB 3ZFFC 1RINA 1BLZA 5FXZA 2O8OA 4JZRA 1KKCA 3A0RA 4Q4V2 4DR3B 2EX3A 5A7NA 4XFIA 1MZFA 2Z5WA 1JW6A 3A22A 1TEIA 3MFAA 2N74A 3TXSA 4G27B 1PGSA 4Z8BA 1EN6A 3RWKX 3P32A 5K9YA 1EAH1 2X05A 3ZR6A 4A6SA 1RUF2 3MD0A 4PI0A 3GZAA 1V70A 1QJEA 4OCTA 5BMVA 1GAXA 4S2HA 4CP1A 4QQPA 2D5HA 2ZMLA 1V9PA 2WYFA 2OYQA 5FCCA 4DR5O 2YGMA 4AVBA 2PAMA 3ETEA 1BMV2 5BNOC 3H01A 5JZGC 1W9WA 4AHXA 2ZR3A 4AVCA 2WWSA 2F23A 3WQ0A 2PLV3 1MA1A 3NR7A 4CXWA 2EXHA 2ATFA 4A7KA 3F95A 5KX5A 4RGKA 4YVWC 4BW9A 1D2QA 2VNGA 5IWAO 4B1LA 1YIJV 1V55C 1IBKB 2B9UA 5F2VO 4CP0A 1FOD3 4LO6B 4FO9A 3U4SA 1W9FA 1V54B 1WBFA 1C8NA 1Y6XA 3P3PA 3UO3A 5IJ9A 3LQCA 5C3SA 3SHRA 2AZ0A 1CAUB 1N3PA 1LECA 3LEIA 3DYPA 1QLNA 1BBT1 3N9MA 2WKKA 1AJOA 4NN0A 3ZFEB 3N2GA 2JS3A 2A79B 1U12A 1R1ZA 1QCEA 1YFXA 3VBHB 5ACA2 1WP8A 2Y0PA 5KR7A 2VU9A 4F83A 4NYKA 1WW5A 2D43A 1AR83 4LF6O 2Q8VA 2Y6FA 2W0FC 3E97A 2EXKA 1V6KA 3LSEA 4UW5A 5L36A 2O0OA 1CN1A 2JKXA 2BSKA 2V4AA 1PIV1 2EINC 4FPEA 4IDZA 3HKBB 2V5YA 1B3QA 1EUUA 1W6PB 2QEXV 3OUSA 1SBEA 4PDWC 1YVWA 2W1QA 2ID4A 1TMF2 1XNAA 4LLFA 3HKCA 1NQTA 1MSDA 4KXRA 2JRIA 3CLPA 4XABA 4NHYA 2WS92 3CCRV 4D0QA 3RJRA 4DV3B 1YC61 2AUYA 4O9GA 5FZLA 4CS2A 2JDKA 5IJRA 3NJXA 2HEVF 4N43A 4UB6Z 1R73A 4MW8A 2Q7HA 4AQTA 2A6XA 1WGPA 3R65A 1W6MA 1LGNA 4N53A 5T3NA 3I8TA 4E4DX 2FCTA 1NJIW 2UXCO 2EIBA 4WFFA 2JDPA 2VCMA 3EQEA 4LKFA 4BQ1A 1VQ5V 5FZ1A 4WBNA 4G28B 1AILA 1AR91 5IT9N 3UV9A 3B9CA 4XOGA 1OF4A 4CP9B 3HT2A 1H6XA 4ISQA 1X8EA 2YSUB 4BU2A 4AL9A 4TLFA 5FYTA 1FT9A 5L3EA 4JDMA 1ZZ7A 2HKXA 4IEWA 5CFCA 2GAUA 3I2JA 1QQP3 3SJCC 1JZ3A 2LW7A 4AQYO 2RR13 1UFIA 5K0UA 1SZBA 2WWUA 3RYIA 2LQTA 3O9OA 2ZR2A 2Y6LA 4WZFA 1IKPA 2RJKA 1YQ2A 3J4UH 3RZKA 2KR2A 2YB7A 4ZXKA 1O3QA 3OSDA 3L9JT 1FS0G 1OVPA 3SPJA 1TME1 1F8VA 5FBZA 2XAFA 4AHZA 4L2NA 3JASA 3O1SA 5FK8A 4JI4O 1M9NA 4QE7A 5LWBA 5I0TA 3WQ7A 4CRQA 2VQAA 1RUNA 1HDJA 4UB8Z 4MTFA 3K08A 3E22A 3KG2A 1VBD1 3KQRA 5CNAA 4AGVA 3UGHA 2ZBJA 2UYAA 2B7YA 5FPUA 1O5UA 1UY1A 2JDIG 3ZIXA 1XEQA 1DZRA 4LORA 4AQSA 2PHLA 3FHIB 1T6GC 1XNRO 1XREA 1KP2A 5LA6B 3M7MX 2Y0OA 3Q8EA 4FFGA 3IN9A 4J1XA 2NNUA 3B02A 2H3OA 2X7RB 4O2BA 2ITDC 5EIBD 1HNWO 5F8PA 5JUVA 4OGQB 4Y5SA 3SCHA 4CUBA 4GA9A 4FFIA 5CBGA 1I0HA 1MSWD 3WNOA 1VQ7V 4C1WA 1LHNA 4NUBA 2VVDA 3WNLA 2GN3A 3ZLIA 1SQVH 1LESA 3I3QA 3VL8A 4YIPA 1YF2A 2D98A 2GN7A 4L8QA 1ZVFA 2A7AA 4GMP0 4MGTA 2H6CA 2JB4A 5A6XA 3QO8A 4QDRA 1PGW1 5ANNA 3ZN6B 4FLZA 5L3DA 4RHV3 2Q4SA 1YHFA 1S1AA 3MIFA 3JAWB 2OUJA 1HNZO 1JZ6A 4MXWB 2JECA 4LBOA 4JKMA 1CZTA 1BSMA 3MFCA 2ZT9B 2DTYA 4Q1RA 3M3EA 1Q6HA 3NRUA 1VQLV 4IEYA 3J8F3 3T2OA 5DN6G 2ZZJA 3TAYA 5C8CB 3GZEA 4QHBA 4CS3A 1DU3D 1RGSA 2F6BA 2XHKA 4HPKB 4GCZA 4V2WA 4YWAA 4O4JA 2PHDA 1K42A 2XJTA 1DYKA 1JOBA 3J7LA 2Q8CA 1COV3 2AREA 4PF1A 3H1IH 3J7MA 2NZ9A 1WLWA 4CEWA 2H0VA 1BBT2 4K6BA 2XKPA 3AKPA 1RJ8A 2B9VA 3ZPOA 3UETA 3V56A 3BODA 2F95B 4MG2A 1UPIA 5FPXA 2GMEA 1VBC3 3K3WA 1Y43B 3QTCA 5D8AB 2GSYA 1SPPB 1IQAA 3I2GA 3H3UA 4Q4Y1 3VBBA 2BOJA 2XLAA 1DGLA 2GUZB 4LOSA 3TN91 3WUDA 5IVCA 4GMP3 4DUXA 3I56V 4H0LB 4K21A 1QLEC 3CD6V 1RUJ1 1SETA 3N9PA 4QAWA 3DPRC 4GIQA 1FMD2 2EJ7A 2VMCA 3M3CA 5EXOA 1K8AW 2EVXA 3BOPA 4OYUA 4EN6B 4ASKA 4XF3A 4IE5A 4DYLA 1BCXA 4YFWA 1K5MC 2G4IA 1OMIA 3C7EA 2B5HA 1CPYA 1WNSA 4DK1A 1C57A 3E5UA 1SLLA 2QTSA 1FXVA 1UZVA 4JI1B 3RMYA 2EIKC 2ZGTA 3WF0A 4E4HA 2GALA 1UYPA 3H1HH 4CSWA 3X2QC 1BGYH 4DV1B 4P9OA 1KJRA 4TZDA 4W65A 1XMOO 1RXFA 2HWF3 5CB7A 3H8RA 5ITZB 3J26N 1CAUA 5FYHA 3D4KA 2Q0AA 1K45A 4JQRA 4XFFA 1ZAUA 3ZFEA 4QXHA 1Q8OA 2A3XA 3S30A 1HRV3 1N0NA 3VBHA 3IGAC 1APNA 1JI6A 4DXWA 4FP2A 2ADPA 1MZ6A 3VBUB 4OI1A 2WO7A 1X4TA 3RWRD 1RM1B 1NA1C 1OH4A 4YGEA 1I5XA 5A1AA 2ATKC 4OZXA 2WWWA 2IZWA 1VMGA 2EJRA 5A3MA 5C71A 4E4EA 4ES8A 3JD4A 2WNVC 4BQ5A 5LYJB 1R3JC 1W2OA 2PYTA 1ZRFA 2NQYA 3CPWU 1CX1A 4PQ9A 4UV8A 3OB8A 3H1JH 2E74B 2FMLA 2Q1ZB 1W6PA 3IDBB 4HKWA 4NAMA 2P06A 3ZYHA 1QNYA 2W1UA 2YXHA 5CMUA 1L8DA 3IWZA 3VKNA 4DV5B 3E6DA 1WLEA 1F35A 1W8HA 5JXGA 1Z78A 3L75H 5CA0B 4DIQA 2NP0A 1EAH3 1AX0A 4RWUA 3DL3A 2DBIA 1Q8SA 4JC1A 2DOSA 2B45X 2IXKA 4O4LB 5DUWA 5CB4B 1LHVA 5B4NA 2QVSB 3KS7A 2R061 3W9AA 5DMYA 1QU0A 2RDCA 2CAVA 2WLJA 2RS33 4C8DA 3M3IA 2LW8A 1VQ8V 2RS12 2X8KA 2Q73A 2NLJC 5LMNO 1SS3A 5GLZA 5SV8A 2Z2SB 2W1WA 4GKJB 2IXHA 3WDUA 4PV1B 3DCQA 5FZBA 1SFNA 4RFRB 4JKLA 2XBO2 2JDUA 5E6HA 4XJAA 2ZINA 3HEIA 3AMNA 1W2AX 1CAWB 1NE6A 4WVWA 1JJOA 2AEYA 1IS5A 2XUEA 5DAVA 2IJJA 2R1BA 1P49A 1X9TA 3NJVA 5LASA 1FYJA 3BPSA 4DV2O 4ZONA 3FB7C 3R66A 4LFBO 1I5ZA 1R3IC 1DIWA 2XJUA 1H1IA 3W5MA 4QX5A 1YSCA 1O6UA 2HJIA 2Q6AA 4YJ2B 5C70A 1KXGA 3PVEA 3W7SA 3AP7A 3ZXGA 1OF3A 5IVVA 1C5HA 2XGXA 2GNBA 5EJ1B 3BRCA 1UY0A 1PIV3 3OEHG 1IBLB 4NPMA 2QJ1A 4B7KA 3MPPG 1Q6IA 1AR1B 4WFGA 4KWLA 3B93A 4GALA 3OGGA 3AZWA 4B08A 4UCUA 3CX5F 5FL7G 4GX0A 4Z92B 1DK1A 2VD7A 1IS4A 3D3QA 5LA6A 3USSA 4W4KA 1F15A 1QHTA 3SPCA 1WMDA 4MH0E 1SRYA 2MEV2 3K2OA 3SJQC 5LA0A 4HZ3A 1YITV 2MHFA 1JZ7A 4I55B 1XNBA 4PA6A 3CJXA 2R0FA 2RV9A 5FYSA 2FYUH 3FUQA 1AR93 5FWJA 2HVJC 3WF4A 5K1PA 3AVRA 4D6TH 4O9EA 2W94A 3FBMA 4UBGA 3T2QA 2WNEA 2WA4A 3ZN1A 3CC4V 3K58A 2OWOA 4JF3A 4EN9B 1A3KA 1JYXA 2UU9O 4CUGA 5D2AA 3WXPA 3O1UA 3ZN6A 3ZYFA 5KXBA 4X65O 4BWAA 4CDXC 3JAWA 3L2YA 3MIEA 3GVMA 2WIIB 1Y67A 3CRRA 3D5OA 4MXWA 2XTAA 3ZMOA 1BVVA 2ZDIC 2X09A 2CDPA 3HR0A 2WAAA 1OHFA 2Y60A 4LBKA 3AMPA 4R7CA 5A3OA 5HFLA 4N9IA 1QHDA 4HONA 4JASA 1JJ2U 4YGDA 2BOIA 1U5YA 5C8CA 1D0HA 1TME3 2BJSA 4P9XA 1AR62 4BQ2A 3U0ZA 1QJY2 1XYNA 4A44A 4N8MA 2B1IA 2VH9A 4HPKA 3NAPB 4K8FA 1VRBA 2ETNA 3DTUB 1UU4A 4V2VA 1HRI2 5EJZB 1OQ1A 1A32A 4JI3B 5I0RA 4CXYA 1WA8B 4XJWA 2WZR3 3PN1A 1ZZ8A 5T55A 5BNNB 3SPGA 1FI2A 1VBD3 1QJX2 3PUQA 1NE4A 4H13B 2A6YA 2X5IB 4B4PA 1PO11 3ZIAG 4WFAV 3OJBA 4FPPA 2UURA 3WNNA 3LFIA 4ZZ8A 2ZOEB 1AI7A 1UNBA 2QDOA 1GYKA 1NI8A 4FK5C 4N53C 4N7UA 1CAXB 2ZGUA 1HB2A 5DUXA 4QQHA 5D8AA 1SPPA 3OEBA 2JVDA 4B3TO 4KBBA 2GUZA 2BU9A 2R7EB 3OBRA 5GLWA 4DRVA 1CAVB 2DJVA 3AG2C 1UCXA 3DEMA 1R1A3 4XDOA 1JYNA 5FKCA 3ZYBA 5JVDB 1VJ2A 3BOWA 2R073 2UXBB 1CR7A 1ZX5A 2Y38A 3WV6A 2VL4A 1HNXB 1XE7A 3F5WC 2SLIA 3KF5A 4UFLA 3P1IA 2B9ZA 3ZXEA 2IXLA 1LU2A 2RDRA 1FPN2 4LF9B 1PM7A 2Y6JA 2Y6HA 2XWBB 4GKXA 2R062 1B06A 4NPLA 4XW3A 5LBCA 5G04L 2LP7A 3Q8CA 3NO8A 1V6OA 4H44B 4AEDB 3HQRA 4DV7B 4CCMA 4YM2A 1PK6C 1LULA 5GZEA 4RUFA 2GP3A 3WB2A 1K7DA 3ABTA 2D5FA 1WCSA 4M4RA 1VE0A 5ITZA 3I2IA 3CYOA 1IURA 1ZL8B 3DYMA 3OTOO 3F7VC 1S0GA 3VBRB 1MZEA 1O5LA 1OQEA 1JZ4A 2VW2A 4AVAA 2F93B 3OGIB 4UOJA 4AI3A 1BEV1 1WW6A 1GM7A 4IQPA 3VBUA 5C7GA 5I0SA 4F4LA 1W2BU 4CU6A 1US3A 1Q7YW 2C4XA 1Y4WA 2RJ2A 5LYJA 2FDIA 3CMEV 4YFZA 3AG1B 3RI8A 5L9VA 4CC6A 4I5SA 1YJNV 2JDAA 5CEHA 4RAIA 2GU9A 3PDQA 1EZVH 4IESA 4Q4Y3 3MF9A 1OKOA 4UF0B 2WFPA 4LIUA 3N9LA 3TN93 3TRSB 3ZYRA 1RITA 1PL4A 4Q0SA 1J5EO 5IAVA 1AHSA 4DR1B 4Y5Z0 5CA0A 1WD4A 5FNVB 4GYCB 4PF5A 1L7LA 1RUJ3 5DAPA 1JA8A 3BCCH 2DUQA 2EIJB 1URXA 5FZIA 2YBPA 1XJAA 5DABA 3IB3A 4MVRA 4XF9A 3CCMV 4O4LA 5CB4A 2FCVA 1IX9A 2VAUA 3GBWA 1XL4A 3TNQA 1YLLA 2XOKG 3AZYA 3LF7A 1RMU1 1GZ9A 4UAPA 4CU7A 4WF9V 4DV4B 4B3MB 4QGLA 4J9YB 1AYM1 1H4HA 4GX5A 1ZA7A 2OZJA 4B3RO 2W92A 1JUHA 2YICA 3VOUA 4E27A 4DEVA 2WO3A 3CDZB 3ZHTA 2P5OA 2ILMA 4KHPO 1KEXA 3OM3B 3VBOB 4YG3A 1K33A 1SERA 1SHWB 4I2OA 5A3PA 2ZZQA 1GM9A 2F4PA 2D6PA 4JAVA 3CEIA 4LF8O 1CAWA 3SKVA 1C1LA 3WF2A 4LBNA 3S3XA 1YFYA 2V09A 2BERA 2DW4A 2OTJV 1N36B 4YYOA 2YC2A 1QXJA 1W59A 4FFBB 2ZGQA 4PIYA 1OKQA 3I7DA 1PMJX 3T0DA 2ADEA 4LJHA 1EBOA 4IEVA 2ZABA 4JTNA 4CCEA 1CWPA 4MUVA 2DF7A 2VOWA 4HN1A 1ULEA 4YJ2A 4FTSA 1VR3A 1LU1A 5DZFA 4YGBA 3HN3A 3C7GA 2PTMA 3OGJA 3BIWE 3NNMA 1JH5A 1BQZA 3UJOA 1VIWB 4MGIE 4LCUC 5JDBA 1N34B 2MW2B 4OI2A 3FHAA 1S0CA 1AJNA 2WQ4A 4ARXA 3POBA 1T6BX 3L72H 1TZOA 2Z79A 2MPFA 4DEQA 4YW5A 5BNPC 1UJWB 4QPIC 2VBPA 2EALA 1IBMO 3K57A 5A9GA 1EZJA 4OPAA 1JYIA 2JG8C 4GB31 2GP5A 5LBFA 4DNYA 1OPMA 4INDA 2XDVA 4XCBA 1YI7A 4XUQA 3D6EA 3M2MA 1NVPB 4X66O 2RN9A 4LKDA 5FY5A 4JI8B 4I55A 1J95A 4M4PA 4ZS2A 1EUTA 2OCHA 3DYOA 3OFNG 4YM1A 4R8CA 3DV8A 2A3QA 3T4HB 2CTWA 3ZFFB 3ZYPA 5E1AC 3FYIB 2FB5A 3HVDA 3JCUZ 4AI1A 5DM6V 4XBLA 1NBMG 4S2FA 2R72A 1JYVA 3R05A 5BY1A 3SMHA 2ZEWA 5KAFZ 3VDAA 2D40A 2RMKB 5IATA 4WVVA 4DINB 3FE5A 4CA9A 3OR7C 2A9HA 2UWAA 4XIKA 2CTVA 4W50A 5T52A 3OOXA 3L71H 1BL8A 3BY6A 4OHVA 3LIGA 4CCNA 3H3LA 1VBA1 3CCSV 3ZYIB 1DLBA 1GN3A 3KWVA 4UFJA 5BNOB 4Q0UA 5JZGB 4LHNA 5D5PA 1G9FA 1UXXX 1XRUA 3NAPA 4YVWB 1OOPC 3KD4A 1DP0A 1VALA 2XOMA 4DPNA 4LFCB 2A70A 4U7NA 1V55B 4YW2A 1WA8A 1MNGA 1L1FA 4JYBA 5BNNA 4B3SB 2A0LA 2QWQB 3DECA 4GH4C 5CKMA 3OBZA 2ZACA 4DOUA 2EXJA 3A0NA 5IWAB 4MVQA 1OZ0A 2X5IA 1W6OB 5F3EA 3DKQA 4ZI7B 4FM0A 3BFRA 3ASIA 1YJKA 3PVNA 1X9PA 4NIGA 1EPWA 4LT5A 5A33B 1KQRA 1FAYA 5LBBA 1CAXA 5IFPA 4O4HB 3V65A 4IUGA 2JDHA 1AI6A 5IVJA 2KSDA 2K1EA 1P7BA 1POQA 3ZHUA 2ITCC 1H2NA 3LKJA 2RMU1 4UW6A 1CAVA 4QKFA 3OD4A 1VP6A 2Q68A 4HSLA 1Y7BA 4LF6B 3OMIB 2EINB 4JRLA 5FZ4A 5I0DA 1VQ4V 4TWKA 4FQ4A 2WLLA 3AG4C 1E1RG 3P6BA 5KHJA 4X6RB 5LHGA 5JVDA 1HQWA 4PDWB 2ET7A 5C3RA 5LY2A 4TUYB 4AEKA 3KZIZ 4KI5M 1XNCA 1HXS2 1NTKH 4URTA 3KGLA 1NZ6A 2GBOA 3LB9A 1OA2A 5KC6A 3IJ4A 2XWJB 2JIGA 3WW3A 3NJZA 5DN2A 4J10A 4X1YB 2HWE3 5IFTA 4AEDA 1AYM2 4BAYA 1HW5A 1YZBA 2XMLA 2DU1A 3U4XA 5JSRA 5HBAA 5FO7B 4CCLA 2NN8A 5A70A 3OAAG 1JCHA 1ZL8A 4MADA 4Q2FA 3VBRA 1ASJ1 1RUI1 3ABKC 1OLRA 1N32O 4QNHB 2ZKOA 4XVHA 2AHZA 1JZ2A 1VQOV 3MPBA 4ZIBA 3AVSA 1I9RA 5KXEA 3LNMB 4WV8A 1PO13 3PUSA 1WD3A 3VZJA 3ZMNA 3T4VA 3RW0A 3U78A 4Y4RA 4ZXEA 1WA6X 5I0UA 4HNAB 4J80A 5CKNA 1Z7S2 4DXTA 3AYDA 1UN1A 4LIVA 5IYBO 5LK5A 1AVMA 1QVFU 5IHRA 5TSWA 1SBFA 2VM9A 3POGA 5CFDC 3F2ZA 4UF0A 4NHLA 1GZWA 2RM22 1CXZB 5L19A 1D2SA 4QPGC 1W0PA 5KXDA 1ENRA 4AEMA 4LA2A 5EZWA 5FNVA 3BA8A 3CIHA 3EYPA 4CYDA 3TOJA 1OCOC 1LOCA 4JI4B 3ACLA 4JV5O 3SYOA 1OQDA 3RVZA 3T1YB 5FZGA 1UYYA 4WFEA 3MIGA 3IKWA 4QHOA 1DQ2A 4ZHQB 2JIJA 4AF9A 5FLJA 1SZTA 3A7QA 2GNTA 4COYA 1POV1 1RHI1 4QXCA 5FJHA 3GALA 2W5FA 2D7FA 1GICA 5B1BC 4BK5A 4N23A 5J48A 3CL1A 4HXCA 4B8EA 1U96A 1A78A 5FOBB 4R9DA 2Q9LA 1XNRB 2A5ZA 4CU9A 3VBOA 4ARYA 3B2EE 1JTZX 3RZZA 2EXIA 4XXPA 2ZMKA 1XNKA 3GBGA 1DF5A 2AHYA 3VGIA 2O14A 2HWB2 1TA8A 2BV4A 1Z5WA 3G67A 5CZKA 3UGFA 4LULA 5FP9A 3T1HO 2WDBA 1YXWA 1Z0HA 4UCOA 4FFBA 2YXSA 3ATGA 3LSDA 2LTNA 3LWCA 1W8WA 1S77D 1BEV3 4JTAB 1Q8QA 3W7XA 1QR9A 2VO5A 1R6TA 3DXUA 1VBE1 1AXKA 1PO21 2VCCA 2M6YA 1VBA2 1SMVA 5FZOB 4RN5A 2XONA 3I55V 3IZOA 3IAPA 4DV6B 1MS3A 1SQFA 3G6BA 2OPWA 2P7TC 3JD71 4DR2O 4PELA 2VVEA 4KQ7A 1TNFA 5LRRA 2V1DA 3JZVA 3LGRA 3LSQA 3WLUA 2ZTNA 5JXJA 3FN9A 5AFBA 3E89A 4XZUG 3AMMA 2ZEYA 3EVKA 4LWSB 3IBMA 2QQPA 2IJKA 2PAEA 4CCJA 3SXWA 3AZZA 3P5BA 5IK8A 5TISZ 5H9CA 3CU7A 1OCZC 2P3IA 1VRH3 3C8XA 1UMZA 4QPYA 2ADQB 2XHBA 5B5EZ 4BB3A 4FOQA 2XL7A 3TYJA 2GSMB 3CMAV 3ELNA 2AEZA 1RUOA 3O65A 4DXRA 3BB6A 2ARCA 3FMGA 4FXGB 1K92A 2ZHNA 1RMU3 2LS6A 2FDKA 5KHIA 1ULOA 3MHSC 1H2GA 2PGGA 4XJZA 1ND2C 3SYAA 2A7WA 4JI0O 1QJU1 1XOUA 3G80A 1XSRA 3ZFFA 5LOVB 4YZ2A 2RMU2 2D44A 4CPBD 1US6A 2YC0A 4W6YA 3WP3A 1WAZA 2NPIA 1OVSA 1SDDB 4YGCA 1S5JA 4XDKA 4JYAB 3J7HA 4AEJA 5JMOA 1K73W 1QLEB 3ORJA 4IGPA 4I0WB 3VDBA 3RT3C 4OQ9A 1FJGO 3DPRB 1FFXB 4TTGA 4QX0A 5JI9A 2WUHA 5IE9A 2C9AA 4OX9O 3IC9A 1VMJA 4HK8A 3LPFA 1RM1C 3ZHRA 3GBFA 4IEPA 5BYNA 5FY9A 4UCTA 4EFEA 3PNAA 4NOTA 3ZXDA 4HAMA 1S0IA 5BNOA 5IYZB 1K5MB 5JZGA 1DGWA 4AQ6A 1UPGA 4FMTA 4FZ0A 2R70A 1DQ6A 4L97A 4RS5C 4A42A 4IV3B 3WDWA 2EIKB 4YVWA 5EV7A 1X59A 2WA3A 3RNSA 5JJEB 2VTXJ 1BMFG 3X2QB 5FP4A 4QU2A 1V6IA 1ASJ2 4KUMA 4TQDA 1CJPA 3ACIA 2OX0A 1EM1A 1SLCA 3Q8FA 1W6OA 1QY4A 3AZVA 3ZN4A 2OT5A 4ZI7A 1VIBA 3STLC 4MGYE 4YW6A 2EIMC 3MBWA 1RUD3 4GB33 5A33A 2A3YA 4O4HA 4FPGA 3A8TA 1LRHA 5IW0A 1NA1B 2VNOA 2K9PA 2W1SA 5EYXA 2CNAA 4XFGA 5IY5C 2GDFA 2WNVB 5GTHZ 1I6XA 4PLMA 5EWSA 3AP5A 5DDJ2 4MTOA 2JJ1G 2X6AA 3B5LB 3W5NA 4BQ4A 1NLQA 2Z4FA 1M93A 4PDWA 1YQ5A 5E89A 2ZPXA 3JUUA 4TUYA 2R042 2WWJA 4FT8A 3GCWA 4ABMA 2VULA 1KD1W 1G8MA 2J7MA 4YM3A 3J7AU 1V6JA 4HYOA 1WPBA 4LH7A 1TVGA 2XKOA 3PIGA 3WG1A 1LR5A 3KHBA 1D2DA 4X1YA 4TQFA 2RVAA 5BY5A 4AI0A 2ZCEA 4BXSV 1XE0A 4UFMA 2WLIB 4N9HA 3BGAA 1KITA 4NIDA 3N35A 4SBVA 4TV8B 3IPVB 1VPHA 5LMUO 1K5SA 3I2DA 4H37A 3N36A 1W8FA 1XNTA 4DR4O 2CH7B 4M0HA 2VC9A 3OG2A 2UU8A 1RP3B 2A6ZA 1PPJH 4NXNO 1M56C 3THOA 5LMNB 4JI7O 1SBDA 3AXDA 5CN0A 1Q43A 2A06H 4FIPC 5FYCA 1D4M1 4P9JA 2HWC1 4AFMA 2QDNA 4BLJA 4IEZA 1BK0A 1HB1A 3QH7A 3UT5B 1PNFA 1X8MA 4DW1A 1F4HA 1R091 1UOFA 5FTTC 1LOGA 4QM8A 2IU0A 4BWOA 4HNAA 3PJYA 5H2FZ 1AX2A 3H1YA 3AEIA 1PO22 2WBKA 1NG0A 4G4FA 5D21A 3FWEA 4HMZA 1URFA 4QX7A 3NV2A 5IK4A 3IAYA 3LDRA 3N3HA 2Q1FA 1GZCA 2ZD9A 5IVYA 3JD72 2ENRA 4J1WA 2EA7A 5LCWL 3B40A 3FYEB 3KSCA 4COZA 2EZOA 4FTEA 3CZJA 4MOAA 1KMIZ 3C3VA 4D69A 2VECA 2KXLA 2VOXA 2YIBA 4AGGA 3ILNA 3THDA 3I3DA 5B1OA 1I3HA 3WDVA 1UU5A 4PJ0Z 2DDUA 3VD9A 4OUEA 4GWJA 5HPOA 1JODA 4ZHQA 4UFKA 3ZN5A 3SH3A 4X64B 5GLTA 4XURA 1GMGA 1YYNA 4CH4A 2BWCA 3E1F1 4QT6A 3N7LA 2BW8A 3AP6A 4LF5O 1AL0G 1PV0A 1ZSPA 1GQGA 2JE8A 5IK7A 1RUE1 5HI0A 4KU7A 4MV2A 5FFOC 4CH6A 2D3RA 1VQKV 3LNNA 1EP0A 5JH7B 5BNNC 4FLVA 4A3ZA 1RUI3 3VQVA 4IEOA 1WW4A 1JOJA 2WYSA 1KGYA 2J1RA 3DUIA 3PJSK 4YY3O 1G9BA 1AR72 2CGNA 2ZNIA 4YJ3B 2DUOA 1RUC3 2XVLA 2HHHB 4L11A 2JIZG 4CDXB 1ZNPA 4WFHA 3RG0A 5FZOA 4E2LA 1QIQA 1BHBA 4LC1A 1XDCA 2Q67A 1CJDA 3EFFK 4URAA 2ZM6B 2C1FA 2W2IA 5CA3A 3JQWA 1HX6A 2AXTZ 3RFRA 2VZUA 5DECA 1JZ5A 4LWSA 1O8PA 3QD6A 4Q4V1 2SBAA 3BCWA 5GALA 4GD4A 4Y4YA 4L8JA 5JQGB 4H7MA 3WR0A 1F5JA 4X8PA 1DTOA 2Z69A 4XQDA 4ICGA 1BE3H 2PQQA 4LO4B 2VZTA 3MW3A 1Q82W 3R6SA 4CUCA 5B1NA 4IE6A 2VOTA 1OUSA 3JALB 4K8XA 4JDOA 2O1QA 3X29B 1PMHX 4C0HA 1XYPA 1DDLA 3G6JB 4JI5B 5A3WA 1E5RA 2WAOA 2D6LX 1BMV1 4K40A 1HJGA 1AL21 4O7XA 5HV4A 3CF6E 1RHI3 2VUCA 3POFA 2Y0IA 5HCFA 4NHKA 2A73B 1I08A 5LOVA 2DYSC 3WB1A 1N8RW 3M4FA 3OBAA 1KU9A 1OA3A 4XILA 3HD8B 2WZPP 4C7UA 2QM4A 1K34A 5FYMA 3OYWB 3AG2B 1FXHA 4ES9A 1YCIA 1H4GA 2VMIA 3UESA 1O3RA 2UUAO 4B3TB 1K3IA 1K97A 2QDRA 2N05A 1JBCA 5J2UB 5BXZA 2J1UA 4NMIA 4DB5A 3DPRA 1FFXA 2CU5A 4E8CA 4G2KA 3PLQA 5FO8B 4XFCA 5HXMA 2XHNA 2OTLV 4OXSA 1GKFA 3KQ4B 1FX5A 2P2KA 2G9ZA 1UX7A 1FXKB 4RYDA 3UKMA 3W7WA 1KS5A 4AGRA 2IXCA 4FOYA 3BTXA 5IYZA 1K5MA 1VBE3 1ZBE3 2A71A 2V72A 3AK3A 4H55A 4IV3A 5FY8A 5CKQA 5DUVA 1OFSA 3JD73 3CCJV 1CEZA 4LF4B 4KWKA 1IS6A 4EEQA 5KHKA 3I3MA 4WCEV 2XR4A 1RUG3 2YI9A 2VCAA 3VBFC 2Q5TA 2YIDA 1PK6B 5EJ3A 3Q8AA 5B3SC 1TMF1 2GMMA 4BMEA 1QVGU 4JYCA 5L7OC 1F4AA 2HBUA 2VUJA 4DY5A 4XUTA 4UV9A 1AJKA 3BN6A 1AR5A 1K4DC 2YPJA 2B1GA 3NQHA 4WM7C 2O8QA 3OTOB 5CVRA 4D7YA 4UVAA 3RVYA 1XU2A 4S2DA 3WNXA 1NA1A 3LIHA 3DKWA 1JR9A 1YNAA 1MS9A 4NWWA 4OUMA 4DV3O 5FMDA 4JKKA 4P5HA 2WNVA 2RG4A 3VD5A 3W21A 1QJU3 5EBMC 3VBOC 4PA3A 2WLNA 2DV9A 2BQPA 4EN0A 4F6EA 4JQTA 2DWEC 3GYDA 3N7JA 3FX3A 2EILC 1ZBA3 3AYAA 4MVZA 2HWD2 3B01A 4NVPA 1AYN2 1WUVA 1UD1A 1AR4A 1R6KA 5CADA 1H6YA 5ABJC 1WP7A 5A3LA 4EWDA 3NKTA 4CE8A 3RN4A 1MEC2 4HKOA 3LA7A 4LP8A 1PGL2 2W6JG 5AC93 2WLIA 3QG5A 1OV9A 1U0AA 4DR6B 3VB9A 2WJSA 3GJBA 1U97A 3A0KA 4TV8A 1YUDA 3IPVA 3HQUA 2Q5ZA 4X1KB 1OCCC 5L3BA 5LBQA 5F3CA 2E51A 5JJNB 2CH7A 3KV5A 3NW4A 1S76D 1ZRIA 1EV12 3OGCC 4HANA 3GF6A 4YM0A 4B3RB 1MS5A 1XL6A 1BZWA 3UKTA 4IEQA 4U7OA 2F43G 4KHPB 4Q4W3 1COWG 4FOWA 5CISA 1R083 4C1XA 1U5XA 3B69A 1PVC3 3UT5A 2X6BA 4HT1T 1H9PA 2ZKLA 2HVKC 5T5JA 4META 3GB7C 3WINE 1D4VB 1REDA 2YEVB 4LXLA 4AXOA 2R49A 1F4MA 1GK9A 1UQXA 1AZDA 2D6NA 2R9AA 3A21A 5GM0A 1RVF1 3FHQA 3LEMA 2DCKA 1YJ9V 5EC1C 5LEJA 4K0KO 2Q1MA 3PURA 3RSJA 1L7QA 1XBLA 5LXTB 2QUOA 4B1MA 4U36A 1OURA 1FXZA 3FFQA 1W9SA 1GU3A 4BQXA 1WB8A 4E8DA 4FOVA 2X0LA 4QDSA 4AWDA 5JCOA 5BNPB 3FUOA 1E5IA 4NTYA 1W99A 4QPIB 2JJ6A 4BZ4A 4CDWC 4UVCA 2WAMA 4YZ4A 5J7MA 2JG8B 3BI3A 2QNKA 4IXLA 1N0JA 1LCLA 4CEYB 3VQYA 2GV9A 5IDJA 4AR2A 1IBMB 3SYQA 2W3JA 5DUUA 4DO2A 3B94A 2ZGMA 4LF7B 3OF1A 5LHHA 1AL22 1FV3A 2AENA 2ZCWA 2HEWF 3ABLC 1NXD1 4MGKE 4FPYA 4PJYA 3DGEA 2BNNA 4BE3A 1UKGA 4GZ9A 1T2XA 3OD0A 2CHHA 4X66B 3K77A 1GO3F 1UMIA 1ULFA 5J9PC 4EWAA 5K8SA 3WDXA 3VN4A 5JH7A 4QXBA 1RSOB 3WG4A 1GZTA 1KS4A 1NUKA 3NSTA 3JD0A 4QDQA 3IAQA 1MS1A 2ARHA 4YJ3A 4U3JB 3OPTA 3ZFGC 1GQPA 4CDXA 1A8DA 2ORXA 2N7GA 1D4M3 4X20B 2WLHA 2HWC3 1GV9A 4YG6A 2AC1A 1TNRA 2UWBA 2UUCO 4NTWA 2ZDIA 1R093 1QH6A 2HBTA 2WPDG 2VQTA 1F7YA 2V5DA 1MS0A 1V9U3 3ZOIA 2VPVA 1WKYA 4JHZA 2IU3A 2LM3A 2WT0A 4TV9B 4CZZA 2WQZC 1S5LZ 1KUQA 5JQGA 5B66Z 1HWYA 1S0FA 2E63A 2ZX3A 2Y64A 1J59A 1MOFA 3G7DA 3MI8A 1V6MA 1ZTEA 1OOPB 1FMD1 4ZZ5A 3UK9A 1H2LA 1IXMA 1F51A 1PNLA 2VTFA 2W91A 1YDXA 3HKEB 3JALA 4JV4A 1W0KG 2OZ6A 3K59A 1DZQA 1LKNA 2DBNA 4GH4B 4X6QB 3SITA 5CBLA 1DLCA 4FPJA 1SKVA 2D6MA 2IH1C 2BBVA 2E7TA 2WFF3 3QBQA 3KV4A 2H94A 1RUH2 2QM8A 4YW4A 1GNZA 3WP5A 3VZOA 2QTOA 4GT1A 1UZYA 3ZSKA 1WZXA 2QKSA 2JDZA 3VD4A 4PDMA 1LNQA 2YY1A 3K9AA 2UY8A 4PI2A 4PA4A 4XAAA 5C93A 3ILFA 2QGNA 1UXZA 3OYWA 1A34A 4Y33A 3FB6C 5HCBA 1IVSA 1RUE3 5A1FA 4DK0A 4DO0A 4OPHA 1H9WA 2LJ2A 5J2UA 4B4RA 3FC0A 3AG4B 4EYUA 5CIRA 3VHPA 3I59B 3WCSA 2FKXA 4DV1O 2QWNB 3MHHC 4HSJA 3UT0A 1FXKA 5H9SA 4PCRA 2G1MA 5J09A 5FMOL 3WZ1A 4CU8A 2ADDA 2W6IG 1F2NA 4XTMA 3ITQA 3RZGA 4ZPIA 2HJDA 3S6PA 5B1AC 4DRRA 5J1XA 3POIA 1JXNA 4CCKA 5I8YA 1O59A 2ARXA 4WM8C 3WW1A 3ACHA 3BVCA 1PK6A 2KB1A 4UCVA 2VQEB 3CCEV 1PM9A 4Q4V3 4ZU7A 4U2AA 3UNPA 2ZGRA 3SH5A 2PHFA 3L73H 3K3OA 2FMDA 1V6NA 3ZS8C 1XYOA 2WT1A 4MSWC 1M1KW 4K8RB 3ABKB 3K04A 2BE3A 4XPVA 2OIGA 1RIRA 1RUF3 2WNUC 2QQOA 3L74H 1ZZBA 4XXAA 3HNBM 3A2FA 1U5ZA 3UQ8A 4R9AA 2Q8EA 1W04A 3BAAA 1N32B 3GZTB 2F4LA 3D3AA 1XNQB 2P3JA 2P22C 3LDEA 2GNMA 2EAAA 1Q86W 5AFEA 3C3TA 3CJIC 5JVVA 4LUMA 3LSUA 3PMSA 4UCSA 2C2AA 1C8M2 4LK6A 3ML0A 1MMMA 3HWJA 3AKTA 5JAXA 2RS11 1ZUQA 1CIWA 2IH3C 3FZ3A 2BFUL 4F6RB 3C2UA 3H1KH 4KP4A 3ST7A 1NCQC 2R0HA 5FR3A 5A3NA 1RVF2 3A0HZ 3L9DA 2J1AA 4FLYA 5CFDB 5FUNA 2VR4A 2VNRA 4BQYA 2XBO1 2DCTA 4QPGB 5DEDA 1MQTC 4RA0A 4HL0A 4ASLA 1N1YA 5FDBA 1OCOB 4IE7A 5JIAA 1LEMA 4BISA 1RJ7A 1G8WA 3KB5A 5J98B 1GN4A 2Q8OA 5ACA3 3AFKA 4YNIA 3LDDA 3NNJA 3WW2A 1Y3TA 3JBG2 1VBB2 1QF3A 3IDAA 1TE1B 3BUCA 3USUB 3IC7A 2QZ3A 3E86A 5EZYB 2ZS6B 5A6ZA 1MS8A 2P4VA 4X1KA 4P2ZA 1PZ7A 5B1BB 5HCHA 2OT7A 2XXZA 1NAEA 2A6WA 1P7GA 1U5IA 1TMF3 2UY9A 5IWFA 3H9AA 1WN7A 3CQOA 1IBLO 2PLV1 4HVRA 4QGMA 2WS93 3KT4A 2Y26A 3K48A 2B42B 2Q0OC 1NR1A 2GTAA 4CS4A 5CA1B 3D0JA 5LA9A 5A80A 1FOD1 3UCSC 2MEV1 2W39A 2YEVA 1FNYA 2JB8A 4X88A 1F23A 2FZ2A 1K9MW 3ABUA 4Q4X2 4FI9A 3VHRA 2R9RB 1N3OA 2ZEZA 1OH3A 2R16A 3VHOA 2HLEA 5LXTA 4MVUA 3VZMA 2OW4A 4TN7A 4DUVA 3FL7A 4X8NA 1JHJA 3ASNC 3B3QE 4OVEA 4NIIA 1J3RA 1OI6A 1WWYA 4AVSA 1DYOA 3AMHA 4EQVA 3MEPA 2XAGA 1N33B 1SEFA 4A6OA 5BNPA 4FM2A 2JWPA 4QPIA 2PI4A 1E1QG 1OCZB 2DYCA 2C24A 2WR9A 4YW1A 1VQ6V 2JG8A 1XHXA 2ZKNA 1RTVA 4YHHO 3RGBA 5JXIA 4COVA 2H0BA