2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
1DGRA 3FZ3A 4I01A 4META 3S0MA 4XFAA 4OFGA 3MZHA 2PA7A 3DN7A 3IDCB 5JCTA 4A2UA 1ZZ7A 3BPZA 4BIFA 4FAHA 1VJ2A 3OTFA 3E6CC 2BNMA 1NE4A 5CU1A 2B9UA 2OA2A 2IXCA 4P9GA 2XGXA 2XLFA 1I6XA 1YUDA 5JSRA 4PIZA 1FT9A 3HIFA 3E6BA 1J3RA 4E2QA 4XF4A 5C8WA 1YWKA 4CYDA 1UW8A 1YLLA 3NKTA 2ET7A 3ZDSA 3KSCA 3N4MA 2WFPA 2D93A 2OZ6A 1O3TA 3H7YA 1OD5A 3E5XA 4XFFA 4E2GA 3NVCA 4UBHA 3RZZA 1CAWB 3FHIB 2Z69A 1LB2A 1H1IA 3QOPA 3USSA 1HW5A 3WW1A 5KHKA 1SEFA 2EVXA 4ZU5A 2IXIA 3MDPA 4I2OA 3NJZA 4BYYA 2BEOA 3UKNA 4QM9A 4I3PA 1WGPA 4HVQA 5J48A 5FLIA 2ZCWA 2H0VA 1ZZBA 3ES4A 1CAUA 4FAGA 2H6CA 3BCWA 4QGMA 4N9IA 5I0TA 2QCSB 1Y3TA 5BV6A 5FQ0A 4XFGA 5BPXA 5I0UA 1XE8A 2IXHA 2QVSB 2Q1ZB 2BNOA 1CAVA 2PFWA 4LEJA 1WLTA 3H50A 4IEQA 2CAUA 1O5UA 4MGKE 3WW3A 3KMHA 3E6DA 2DCTA 4LLOA 3U10A 2GAUA 4L11A 1QWRA 4Q0QA 4HBNA 2UYBA 3I59B 4X6QB 4QGLA 5I93A 5KHIA 1O3RA 3I54A 4AQ6A 3DKWA 3H8UA 3KGLA 1CGPA 4Q0PA 3PVBB 1UIJA 4HZFA 4N9HA 1O5LA 3LZZA 1EY2A 1PMIA 2VQAA 3OD0A 5C6CA 1Q43A 3LOIA 3NL1A 1RTVA 4Z82A 2PHLA 3D0JA 3RDIA 4Q0SA 2UY8A 3U11A 3ST7A 4YNIA 1CAXB 4QM8A 1O4TA 3UKTA 2ETEA 4IETA 4AXOA 3O14A 2XKOA 3H7JA 1LKNA 2F4PA 1RUNA 1ZNPA 3RNSA 2ATFA 4F7ZA 4LA2A 3SHRA 4I02A 3SCFA 1CAUB 1FXZA 4QXKA 2OZJA 1DZTA 5BUVA 3FFQA 4KU7A 4IEYA 2E9QA 1EPZA 1RGSA 1X8EA 4XF9A 3EHKA 4XFCA 4QGNA 4HVOA 2GH2A 1ZRFA 3I7DA 2HKXA 4NVPA 5I8TA 4XETA 4R8HA 1CAVB 4XFIA 1LRHA 4MV2A 5CVRA 1GQHA 5BXXA 5I8YA 2V09A 3OF1A 3VHRA 2FQPA 1XE7A 1RL3A 3U0ZA 1DZRA 2XLGA 2IXJA 2H6BA 4AQ2A 1OFNA 4MGZE 2D5FA 2BGCA 2K0GA 4BHPA 5J7MA 4HN0A 3WW2A 3GBFA 3ACLA 2PQQA 4EWEA 1IPKA 2C0ZA 4X6RB 5I91A 4MUVA 1YHFA 4BH9A 1UPIA 4IEVA 4ZU7A 4MH0E 2Q30A 1UIKA 4JTOA 2GZWA 4EROA 2VECA 5LRSA 4YYOA 4XF1A 5LRRA 1QXRA 5KHHA 1J3QA 3CO2A 4HLTA 2XLAA 1YFUA 2O1QA 2P17A 3B02A 5FDBA 3BALA 4AVBA 4KWJA 3NW4A 3H1YA 4JV4A 4PIYA 3DV8A 1TQ5A 2Q4SA 2Z2SB 3RYRA 1ZRCA 4EWAA 4DINB 2HJIA 3MYXA 4I0BA 1EYBA 3IBMA 4EV0A 2BYVE 4WBBA 1X82A 2QDRA 3R6SA 1NXMA 4FT8A 3DL3A 1RUOA 3BB6A 1PM7A 3NSTA 4ORFA 5F1RA 3GYDA 3E5QA 1JUHA 5CADA 4EWDA 1J58A 2FMYA 3UKVA 4PJYA 4J1WA 4E2SA 4F8AA 1ZVFA 5JAXA 4D7SA 1ZZ6A 4WVZA 2GC3A 4I09A 4QX5A 3HT1A 4HSLA 3JZVA 1QXJA 2GC2A 1OI6A 4AVCA 1L3JA 4XF0A 1NZCA 4IERA 3M70A 3PLQA 2B8MA 4ONUA 1RC6A 5LEJA 4YRDA 5AVPA 4UBGA 2PYTA 3ETQA 5E16A 4KWLA 1QY4A 5I0SA 2D5HA 5KHGA 1CAWA 2OYZA 5T3NA 2MNGA 1J1LA 4B29A 4L2NA 2B5HA 4IEZA 5JSPA 3MPBA 4LULA 1SQ4A 4HMZA 3E5UA 3H9AA 1XRUA 3KCCA 4IESA 3TNQA 1UCXA 4GULA 2Y0OA 5FLJA 2ZKLA 2CV6A 3CF6E 3EJKA 1ZZCA 2EA7A 5FQ0B 1FI2A 4KU8A 1ZRRA 5J3UA 3FE5A 1O7FA 1EP0A 2QJVA 2XL9A 2GU9A 4Z07A 4TLFA 4KL1A 1NE6A 3EQEA 4MGYE 2K9ZA 1YFWA 3HT2A 2PAMA 2UY9A 2GC1A 4XFHA 4XF3A 3G7DA 3D0SA 2ET1A 4O9GA 3S7IA 4J1XA 1UD1A 4IEXA 1ZRDA 3S7EA 4UXAA 3I59A 1Y9QA 3L2HA 1V70A 3QACA 4MX3A 3TNPB 3H1WA 5K8SA 3FJSA 1ZX5A 4PIXA 5JR7B 4XEZA 2XL7A 3SMHA 4XFBA 2N7GA 3H3UA 2PHDA 4O9EA 1U12A 2KXLA 1VP6A 4WZCA 5FCCA 2XKPA 3CLPA 1CX4A 1GQGA 2CAVA 2PAEA 3RYPA 5KBFA 1G6NA 1I5ZA 1ZZ8A 3H1MA 1CAXA 3PNAA 4LA3A 5KHJA 2MPFA 4JVAA 4ZU4A 3M3IA 2CGPA 4AVAA 3LWCA 4IEWA 2O8QA 3C3VA 5HI0A 1H1MA 1Q3EA 4IEOA 3IDBB 2OPKA 2UYAA 4I0AA 4MGIE 4LTAA 4H7LA 1VR3A 3EBRA 4HSJA 4IEPA 1O3QA 3D82A 3SCGA 4Q0VA 3SXWA 1J3PA 3WW4A 3SCHA 3BU7A 4K8FA 2WC2A 3E97A 3FX3A 4IEUA 2IXKA 2MHFA 3H3ZA 4KWKA 4QMAA 3CJXA 4HN1A 2GC0A 2IC1A 5I0RA 2PTMA 3HQXA 1OMIA 4HVRA 4YSFA 4Q29A 2IXLA 5D1IA 4D7TA 4R52A 1Q5OA 2PAKA 3ELNA 3ROUA 1ZREA 1DGWA 3LA7A 1WA4A 3OCPA 2EAAA 4LUMA 3KGZA 5EZWA 1SFNA 3IWZA 5JSOA 4MZUA 5LEKA 4Q0UA 4JTNA 5E1RA 5FLHA 1YFYA 1J59A 1X8MA 3RYKA 2BNNA 4YARA 3CEWA 5BY5A 3LA3A 4LUKA 1ZZ9A 2D40A 2Q0AA 1LR5A 3ES1A 2QNKA 3EO6A 3OGJA 2XHKA 3RPQA 4FBFA 2I45A 5FPZA 1NYWA 5EFUA 3IIAA 4OLLA 3LAGA 2VPVA 1O3SA 3FWEA 3LA2A 3CL1A 1X7NA 4RD7A 5I8SA 5FPXA 1IPJA 1YFXA
chains in the Genus database with same CATH superfamily
1ENQA 3TN93 1VB4A 2ZXWC 3SH4A 1SC5B 2K9PA 1VIBA 3U14A 3F95A 2LTNA 4LOSA 4J9ZB 1FOD1 3C7HA 1OJHA 4IGPA 1QCEA 4NPRA 3JCZA 4Q4W2 5FYHA 3ETDA 4W6WA 3POGA 4R6ZA 4DV2B 4YW7A 4JAUA 5C9AB 1F23A 3VGIA 1DQ5A 5IVFA 2SBAA 5A7SA 1DLLA 1WW6A 4PDWA 3OBTA 4SLIA 3THTA 3RZMA 4JI2O 3KHCA 3HKCA 1OVPA 5L9VA 5FY5A 2F95B 3JCUZ 1S4CA 2VO5A 1Z5WA 3SNMA 4EFBA 4DV1O 3FBMA 4YG3A 5FRAA 5EQUA 1KDMA 1VALA 1WGPA 2I2SA 4AEMA 2H0VA 5HCFA 3ES4A 4HT1T 5FWJA 3G80A 4WBNB 1K42A 1G9AA 1IQAA 3ZFFC 4B3MO 3ZN0A 4M00A 2BNOA 5T54A 1T6BX 3HAGA 4TWTA 1QQCA 1IKPA 3GVMA 1ZX3A 2BGPA 2P3KA 1XNTA 2WLIB 1PVXA 4ASKA 4DR6O 2XJUA 5HV0A 1VF7A 4BQXA 4RS5A 2EALA 1AR92 1L0NH 4LT5A 4LE4A 5LHHA 1RTVA 4Z82A 3VV1A 3BVCA 1KFUL 1A78A 3T4VA 1ODNA 4Z92B 1Y9GA 2QQVA 3WNPA 4DEQA 3LIHA 2TNFA 4JGZB 4LA2A 3SHRA 5EBMC 2NLJC 1BQPA 4IEYA 2E9QA 2R071 4RHV3 4HOOA 2YMZA 1T2XA 3OE7G 5KXBA 2XAHA 1R092 2VZSA 2OTLV 4Y22A 2Q6AA 1X50A 1WKYA 1WA8B 3RVZA 1PO11 4R9BA 1UMHA 2R0HA 4CZSA 3AVRA 1XI1A 1DGWX 1IPKA 4X6RB 4N90A 2B7YA 2N04A 2OXBA 1IVSA 1QJFA 1LR1A 3VDDC 2VW0A 1XMOO 4YWAA 1TMF2 3ETGA 3SR2C 2VQTA 4CH5A 5LOVB 4XIOA 4B3RO 1TE1B 3B02A 3WUCA 1WZXA 3TETA 5GZDA 4PELA 3MYXA 5HXVA 2V72A 4LBKA 2ZGOA 4DXTA 2BYVE 2UUAO 3OUJA 4NHXA 5A6YA 4TYSA 3PMEA 1LCLA 2WYFA 3ZPYA 5EIBD 1ASJ2 1TUEB 2WYSA 1NXD1 1AX2A 2QQUA 4AAXA 2UU8A 4QHOA 1L3JA 2P2KA 4XMAA 2HJFC 4BU2A 3JSLA 1D0GA 1YJ9V 4CDXB 1SQXH 2VVDA 2HVKC 2CSGA 5J2UB 5D8AC 2IVIB 4KWLA 1V0AA 1APNA 4CP1A 5I0SA 5CEHA 4M3CB 5C8YA 2A70A 4DR4B 3DSQA 1R083 4QNHB 3GZAA 3RZJA 4RFT0 4Z8BA 4M0HA 1JFFB 3BPSA 1NA1B 2ZKLA 3CF6E 4LFCO 4LWSB 4KU8A 5ERLA 3GM8A 1EV11 1FMD3 3DXUA 2VQFO 3WY6A 1UOGA 4DPNA 4DW0A 1C8M1 3H0OA 2R32A 1VARA 2BVBA 4AFDA 3S7IA 3GXUA 2R6QA 4BISA 1E57A 2VW1A 4F4LA 1RUI3 1THZA 1D4M2 3AP7A 1SBEA 1BHBA 1B06A 4XEZA 2XL7A 2PHDA 4Z1VA 5FREA 1GU3A 1I5ZA 3WHUA 1ZZ8A 1CAXA 3ABZA 1OCRC 2Q73A 5GZFA 4L8JA 5C4WA 2QQOA 2EZOA 4CDWA 1U5YA 1YQ8A 3D82A 1H2KA 3PVNA 2WC2A 3ON7A 4UFLA 2F17A 1QF3A 4N21A 4NJ4A 4IE5A 5JXHA 5B1AB 3JQXA 3SISA 4D0QA 4LBQB 1H8TC 2X5IA 4G3YC 1SZBA 3VHPA 2FDJA 1Y9MA 4B1LA 1RUC2 2E74B 1XU1A 1COWG 3B9CA 2NMNA 3EO6A 3NJXA 1G9BA 4RR3A 4K8XA 1S76D 1V6OA 1H9PA 5G05L 5JMCA 1PNKA 4CP9A 5JZGC 5FJHA 2ZJCA 1FFXA 3DN7A 2KM2A 3J26N 2HWF1 3LPGA 5A3LA 1QH7A 4P9GA 5JSRA 5IYYA 1AUYA 4P9LA 4F6RB 3TEYA 2QZ2A 1UW8A 2ZINA 2X6AA 2AEYA 1QU7A 2JGDB 3JBG1 4FPFA 2Y34A 1VIWB 3PU8A 1BT8A 1AYN1 1AR83 1R73A 1B35B 1W6MB 2JKXA 5HV4A 1C4RA 1KUQA 3T1HO 2ZGUA 3ACHA 3KVAA 1ZLZA 1HW5A 5H6QA 3W7XA 1IZ3A 4CDQB 3CRAA 2UXDB 3JAMN 4QM9A 5K0UA 4LFAB 1W8ZA 5FKBA 1YI9A 1ZZBA 2FTKA 5FKCA 3POYA 3OEAA 3EMRA 2PI5A 1OA2A 2ZGPA 4COZA 3WDVA 4XFGA 5FPLA 3DKQA 5KA6A 2QQIA 1QLNA 2Q0OC 1AR5A 4PBPA 2BBAA 1POV0 4M01A 3DYMA 4DUXA 1XBLA 4HZ3A 5LMUO 1N1TA 3WNMA 5F3CA 1NQDA 3AZVA 4GZRB 1H8VA 3ZYGA 5D21A 5IJ0B 3RYIB 2EJRA 1DQ1A 4Q0SA 3AKPA 1SG3A 3CRMA 1UY4A 1FJGB 3ABMB 4IUGA 4RGAA 5LMNO 4G9SB 2GNTA 3JD2A 2LS6A 1PMJX 1H2MA 3RNSA 2RJZA 1YCIA 1O9HA 4UXNA 4FZ1A 2E53A 1SBDA 3T4ZA 5BUVA 4YM3A 4LF6B 1US6A 2X53S 4PHZA 3EHKA 1ZRFA 1XREA 4O4LA 5FPUA 5B3SB 4OVEA 3ME2A 1GQHA 1HXS3 1BEV1 2FQPA 4GX5A 3U0ZA 2JECA 2R30A 4MGZE 1IBKB 3UL2A 3IDEA 4BHPA 4U3JA 3UM7A 3H42B 4AK3A 1RUG3 4LNUA 4Y26A 3VL9A 2D3SA 2C0ZA 4QDQA 4X1IA 4BQWA 4P5YA 1AL23 2EXJA 4ZU7A 2EX3A 4YYOA 4E4HA 1A6CA 3HQRA 4O2AA 2N74A 4AL9A 1SQBH 2EINC 1S72V 1E5IA 3BALA 1JH5A 4QPGA 1CVNA 3THCA 2R16A 3POFA 3OFNG 3ZYHA 2IFRA 3OEBA 1ULGA 5FY4A 1W0OA 4IV1B 3T4HB 3I3EA 3E5QA 4K0KB 1RUH3 2FMYA 1EM1A 5JI9A 4JV5O 4BM8A 2EIMC 3JZVA 5IYZA 5L19A 2KB1A 3MLKA 2C4XA 4DS0A 4IERA 1V9U2 5JVVA 2ZE8A 3JAKA 4AFMA 2BOCC 2YU1A 5C70A 2HWC2 2VMEA 1WPBA 2UXCO 1AXZA 3G6JB 5GLTA 5CKMA 3KT4A 1VBB2 5LA2A 2D6NA 4AQYB 3USUB 1CAWA 4CCKA 3WP5A 3NAPB 4IEZA 4Q4X3 4GQ7A 1Z7S2 5B5EZ 3KCCA 1M4UA 5CA1B 5A3WA 4MOAA 2LM3A 2E3CA 4W4ZA 1ZRRA 1UYZA 5FPBA 4E4DX 5HBAA 3JXSA 4Q4W3 3HPNA 1Q8IA 1XNDA 2WS92 4CCDA 4BZ4A 5DUWA 1MR5A 2C2AA 1R1A2 2O8OA 3D0SA 1XEQA 2WSUA 3BEHA 1YDXA 1HNXO 3TN91 3AYDA 3VBBA 1QOSA 2AYHA 1ACCA 2Q7GA 5LZ6A 3I3MA 1OC1A 2QTOA 1OA3A 3NV1A 3DC6A 1D5NA 3IJ4A 3TBDA 1G7YA 2Q68A 1JODA 3L74H 1XMQB 4JDOA 4LR4A 4DK1A 3L2YA 3ZFGC 4DUZB 2YV8A 1GLHA 3PL0A 2GV9A 3H9VA 2ZX1A 3OTOO 3A23A 4LOTA 4QQOA 4C1XA 1N3PA 3N7MA 1PD3A 5A3NA 3UT5B 2O14A 3JD1A 1US3A 3MHZA 2KD7A 1ULCA 2VU9A 1VBA2 1XE0A 1SA0A 5FBJA 2TEPA 1M56C 2EBOA 4KUMA 3ROUA 3FLRA 4OZXA 3WG7C 3OCPA 4DFSA 4P9JA 4R9CA 2XJRA 2F4VB 3BA9A 4P00B 4XILA 5LMNB 4FCAA 3PDQA 1BVVA 1X8MA 3FB8C 2P6CA 3LA3A 1KP2A 2IJHA 2JICA 2XHKA 1K33A 1OPMA 1UYXA 1O3SA 4I9QA 4YVWC 5H6RA 1QR8A 2WT2A 4OI0A 4D8MA 4I01A 3PTYA 5BNNA 4JI3O 2JKBA 4YW6A 2BNMA 3M8LA 3CC2V 1JU3A 5CU1A 3CKHA 3VDDA 2G9FA 1TVKA 3O1UA 1C5HA 2JVDA 1XXNA 1XOYA 4AHZA 5A7WB 1Q86W 4GKJB 1H0BA 1YLLA 1G9CA 1CZTA 3BIEA 2OZ6A 5FZ0A 4X64O 1R3KC 1PGL2 3AG3C 3NVCA 5FLXN 2E32A 3HPLC 1OLME 1PHMA 1QJU2 4MXWA 1LOFC 3VBUB 1HRI1 3ZHUA 4GJYA 1PM4A 4QPWA 4J7JA 2BOBC 5JR2A 2UXBO 1CPNA 1F4HA 2MEV2 1RMU1 2B5UA 3ZMTA 4UCTA 2D43A 1TME1 3O0XA 3H1HH 5FNVB 4FMTA 5E88A 2WKKA 3AXDA 2HWD2 4Y1YA 5FZAA 5LBQA 2W0XA 2IXHA 3C7EA 4L9BA 3O1RA 1TNFA 3SPIA 5B4XA 4NXNB 5LY2A 1SCSA 4I4TA 2CTQA 1J5EO 4L11A 4I50B 2NZ9A 2DU1A 3WB1A 3W7UA 4MTGA 3DYOA 2FCTA 2C6SA 3S3WA 1CGPA 4Q0PA 3KF5A 4IL7A 4ZI7B 4EN8B 2XR4A 3WF3A 3C2UA 1HQNA 4EN0A 3VD7A 5CAZA 5LBEA 4AEDB 3TWIA 4JTAB 2EULA 3UGGA 3L70H 3FL7A 5BMVA 5BNPA 2ZBJA 4E9KA 1URXA 1HKDA 4CCNA 3AEIA 1ZNPA 2XXZA 3HJRA 3SCFA 4QXKA 4JHTA 4R4ZA 2YBSA 3CC7V 3AMHA 2AZ2A 2W9XA 1K5MB 3RJ2X 3QH6A 3ZN4A 3ZFEC 2QWOB 4NVPA 1CAVB 3CBNA 4RL7A 4MSVA 1COV3 2LO1A 3LDCA 1CN1A 2NQYA 1WP7A 1AILA 5HFMA 1D4M3 4XQWA 2XBO2 1H4HA 5C3RA 3RWKX 1V54B 3RN4A 2VXRA 2DYSB 4CXXA 1HW7A 4JYAO 4CDUC 3WCSA 5EK0A 2PLV3 2W6JG 5J37A 1GFF2 4LH6A 4XTPA 5CFDC 2XHBA 5L7OC 4JKLA 4H44B 5LRRA 4GMP0 3A2FA 1I08A 4MGQA 2Q4SA 2XJVA 4YW2A 2L35A 3VBRC 1W59A 4ATFA 4KHPO 3IDAA 4AF9A 3GYDA 5CADA 4QX7A 4CVUA 3ZSMA 1I3HA 4FSJA 4OHWA 4P9XA 3JAWA 5FP4A 2WNOA 4PDWB 3U4XA 2DVBA 1ZRIA 5JDBA 1RC6A 2DFCA 3B01A 3HKCB 2E76B 1NX9A 3J9SA 4JI8O 2E7AA 2R49A 1WWYA 5JOXA 2YI9A 2XAQA 1GANA 2OYZA 1CJPA 2B5HA 5JSPA 1J83A 1JMKC 3UV9A 4WFHA 2RM21 4CUGA 4OHVA 3MIDA 5I0DA 2YGLA 1UZ0A 3WU2Z 5HFLA 5JMOA 1JOPA 4DV3B 4KGQA 2R042 2HLEA 3LKJA 4OQ9A 4ZKIA 4NAMA 2QQNA 4XF3A 4RS5B 3FD9A 1VQ5V 5DN6G 3M7AA 2E31A 1V70A 3I4IA 1W9FA 4LHLA 4XFBA 5FZOA 2DUQA 3ZEDA 1A8MA 4A4AA 3FC0A 2J1SA 1KS4A 4LA3A 3WG2A 4Q20A 4CUAA 3K4ZA 2MPFA 3HKBA 4AI0A 4W4KA 3I2KA 4IEOA 1R3JC 2P3YA 2OCHA 4QX8A 2RS52 3F2ZA 3QCWA 1TG7A 4BQYA 3SYQA 3MF9A 4Y22B 1POV3 1GAXA 4OUMA 1JJ2U 3SITA 2D2CB 5FYUA 3HWJA 3OY8A 2PTMA 3RYHA 5F9TA 4DOUA 3OEEG 5IWAB 4JI0B 4MVRA 2ZDIC 4D7TA 3ELNA 2ZM6O 4BR6A 3JD72 2BWAA 1SFNA 4MZUA 1QGLA 4LF4B 2WLQA 4XUNA 5SV8A 1EFRG 3A0NA 2K46A 1H6XA 2QNKA 3OR6C 4PLNA 2C1FA 5BXZA 4RO2A 1VPHA 5TISZ 1WCSA 2WNVC 2A73B 3S0MA 2RJLA 3JARA 2VZUA 1KGYA 1SLAA 3IDCB 2X8KA 3B09A 3RYFA 2R1BA 4OPAA 4MGSA 4LFBO 3AXEA 5A32A 1J3RA 4XF4A 5B4NA 1C8NA 4JTDB 2V4VA 1AR4A 4LF5B 2GMEA 4CC6A 1BBT1 1GKBA 3H7YA 1S0EA 1Q8VA 3N2KB 2YROA 2KR2A 1BL8A 1QOTA 2ADQB 2VULA 4DR5O 4XXPA 4DXRA 2RMKB 4ZU5A 4UWDA 5JVDA 2FDGA 1R6TA 1CX1A 1RUG1 1W0PA 4TXWA 1GH6A 5IUQA 4AW7A 1R6NA 2WWUA 3ZXDA 5DUVA 2B4KA 5IWFA 1EAH1 1JOBA 4TWKA 2QM7A 5E89A 3ZHVA 2ILMA 2Q1ZB 4MTOA 2XVLA 4FTSA 1O9GA 4UT5A 4N53C 5J9PC 3LCPA 1LEDA 2A71A 1V9U3 2JIZG 1M57C 3OGGA 1F31A 3CXHF 2HWC3 2W68A 4YM1A 4MLOA 2OPWA 3NR7A 3GWOA 4N9HA 4I9WA 4WZFA 4DV7B 5J36A 3WV6A 3CE2A 2HFEC 2JE8A 4LXLA 3ST7A 3VZKA 4UAPA 1CAXB 3ZRSA 1PK6A 1Z7S3 1OCZB 2YIBA 4A6OA 4P9IA 3TRSB 1MSWD 1UL9A 1GZCA 4COWA 5C4WB 1ZYBA 4K21A 4CDWB 4KGGA 2K1EA 5LBFA 2XQXA 1IS6A 3BU0A 2JS5A 2W6IG 1CAUB 3B8MA 2OZJA 4HNAA 1K5SA 2GTSA 4NAOA 2WS93 3ZN5A 4NWVA 4XQDA 1JPXA 4QQHA 1IDSA 2H94A 1IOAA 3AL5A 1HQWA 4AQ2A 5EIYB 2X5IB 2K0GA 2OW4A 3NNMA 1BJQA 3ZFGA 2R9IA 1NT0A 3ACLA 2VGDA 1NAEA 4GB32 4FLVA 1YIPA 3F5TA 1OOPC 3B3QE 3OUHA 5K9YA 3THDA 4W4LA 1UN1A 1N34O 2YXHA 1NQTA 4CU8A 4AFCA 3B8NA 3KCYA 4Y5Z0 1QXRA 3K75B 3VB9A 2XLAA 1G8WA 2RE9A 4FP3A 1PZ8A 3KZIZ 4EWAA 1EYBA 4BIOA 3VBFB 1FFXB 1B3QA 5F32A 2B46X 4TQDA 5IATA 3PJYA 4GKKB 4IV3A 4O4HA 1J58A 2VH9A 5LA9A 4E2SA 1YVWA 1ZVFA 1RUE2 5CA6A 4COYA 1RINA 1RHI1 1DYPA 2F93B 4LR3A 1H8EG 3AMMA 3ASNB 3J80N 4KFMA 5CNAA 4YLZA 4YVWA 2W95A 1OLQA 4WM7C 2A3WA 4P2ZA 4A42A 3E8FA 2HR3A 3FYEB 4WFFA 3IGAC 1J1LA 3MD0A 4XDOA 5K0UB 3ZHSA 2VZRA 1YITV 2DUPA 1C1FA 3MLLA 5A6XA 4LULA 1WW5A 1WD4A 1T5EA 1PKXA 4RFRB 1FI2A 1O8PA 1XNQB 2WAOA 3LDEA 4WVVA 4E27A 2EIKC 3ASOB 1K5QA 1MOFA 1PO12 1YFWA 4O4JA 1FYJA 3DGTA 5LA6A 4G27B 1XOUA 3K5MA 5A33A 4ZS2A 3OM3B 4J7ZA 4IW3A 5EP9A 3N9LA 5FZ4A 2ZNJA 1D0HA 5IJ9B 3N36A 4WF9V 4JDNA 1ZX5A 1VBD3 4W65A 2ARXA 1QJU3 3SMHA 3CCMV 3H3UA 3C7OA 1VP6A 1QBZA 2A7AA 5E6HA 5JCOC 2MEV3 4ZU4A 1DP0A 5D5QA 1PV0A 1UWWA 2HWD3 3H1IH 2FZ1A 1BK0A 3AVSA 5LA0A 1K8AW 1ORQC 3WQBA 4O4LB 1J3PA 5B1OA 1AYM1 4PD4F 2WLNA 2IXKA 4QMAA 2MHFA 3E8BA 2IH3C 2JG9C 2X10A 5I0RA 3W7WA 2P22C 4UF0A 5C8CC 4U3JB 4URTA 2UXNA 3PUAA 3C3SA 4D7YA 4LNUB 1URFA 3WNXA 4X1IB 1WA4A 2OUHA 2BCCH 1U5ZA 3ACIA 1UZVA 3S5AA 1Q8OA 4HXCA 2ZHMA 3KQRA 2WA3A 1U97A 1L1FA 2PHFA 1AVMA 4RGKA 3F7VC 4O2AB 3ZFEA 4FXGB 4X8AA 4XC9A 5ISLA 5BNOA 1KKCA 1EV12 4QPGB 5FPRA 4GWNA 4GXLA 1IPJA 1F8VA 3RFRA 2XTAA 3M4FA 1SKVA 1BK1A 3EB7A 1W6QA 1VAMA 1O8SA 5IYZB 4A7YA 2DTYA 2BOIA 5H9RA 2VNRA 2GTAA 5DM6V 3BN6A 2Z3YA 4CYDA 4LF9B 3AZYA 4QKBA 1RUF1 5DDJ2 2Q9LA 3ZXJA 1CAWB 2Z69A 3PUSA 1IXMA 4GMP3 2ZD9A 4XBFA 3ZIAG 1S2EA 4I3PA 3HMYA 4HVQA 4X62O 1GBGA 2XVKA 3TXQA 4FPOB 1VMJA 1H4GA 2H8PC 4PA6A 1YXBA 2WLHA 2PLV1 1WMDA 2CWSA 4QPYA 2CHHA 5I0UA 5FZ9A 2PFWA 2A3XA 2JB4A 2YFZA 4HBNA 4JGSA 2UYBA 4B4RA 2IUWA 5I93A 1QDOA 4N43C 1Q81W 1MQTA 4RQPC 2VZTA 3AG4C 5LK5A 3I8TA 3AG2C 5EBWC 4KXRA 3MBWA 5EIBC 5T5PA 3LOIA 3WX5A 3AK1A 4JI4B 5KR7A 3PN1A 4UYBA 4XURA 3ZCCA 2BJSA 1F2NA 2VW2A 5FMOS 3UETA 1UY2A 2OVUA 2OKXA 3HOBA 4AE2A 4AXOA 2X09A 3KB5A 1CPMA 4AEKA 1SLBA 1CR7A 2YXSA 1W8UA 3KG2A 5FP8A 3MLJA 2HWF2 1VQPV 1NCRC 1JZ8A 2V4AA 4UW3A 5C3OA 2B45X 4JYCA 4BQ4A 1LRHA 4X8NA 4CUBA 2VVFA 1QJY1 3ZMNA 3VBOC 1SA0B 2UXXA 4JF3A 1W3XA 2NPIA 1SFYA 2VCMA 3JBG2 3OOXA 3RMXA 2D3PA 1SQGA 1EN6A 3STLC 3ILNA 3J4UH 4JI1B 2Q67A 1O4YA 1HN0A 3SPHA 1JOJA 3AX4A 1YHFA 2LW7A 5F2WA 5FXZA 2ORXA 1Q7YW 3ILFA 3RRDA 4WV8A 1XNKA 2FDIA 1H6YA 1J3QA 3CCRV 5L3DA 2W52A 1JZ5A 5KLVH 2RR11 2XUEA 5FFOC 2O1QA 1XYOA 3L72H 5FDBA 1QQP3 2P5BA 4JV4A 5A1AA 1FXKA 5A6QA 1IURA 5BNNB 1LOGA 1RUJ1 3BB6A 1OD3A 3K04A 3VDDB 5KXEA 1MEC1 1TVKB 4B7EA 1ZZ6A 4GA9A 3FLTA 4JHZA 2QEXV 2NNUA 2OCCB 5EC2C 2BDRA 3VQVA 3JD73 2ES3A 4UW5A 1N36B 1IG0A 2WFF2 4LIUA 4CS3A 3G71V 2WSSG 5AVPA 5H9PA 4GH4C 2XJTA 4YM0A 1W90A 1I94O 5JPMB 5C3SA 5GZGA 1JYVA 1NR7A 4LNVA 5A3OA 2RVAA 2ZE5A 4AFBA 4MVMA 3DPRC 2PHRA 3CZUA 1RP3B 4NTYA 1F9KA 2WINB 2CV6A 2SLIA 1HRV1 3RBZA 4FP2A 5IK7A 3EXAA 2R063 2AHYA 5AFEA 3FE5A 2W1UA 2GSYA 3ABKC 5CKQA 5BR8O 5FUIA 4V2VA 4I4TB 2VBBA 5EPAA 5CA3A 1ND2C 1O91A 4FPCA 2A6YA 3D4KA 1UZWA 3LUTB 1Y9QA 3K48A 1HNZB 3QACA 4JYBA 1CZVA 5FBZA 3ZSKA 3SH3A 4YGDA 5EJZB 2GALA 1W06A 2E5LO 4Q26A 5BNPB 4K7JA 5FO9B 1EUUA 4QXHA 4FPLA 2LP7A 5CISA 2A6WA 3K77A 3IZOA 2CTPA 1Q3EA 3IDBB 2UYAA 1LU1A 1UOFA 1VR3A 1FPOA 1PL0A 3EBRA 2VZ3A 4DO2A 2ZX2A 3PTRB 3WW4A 1Z0HA 4U7OA 3RZHA 5GONA 5A7QA 1NVPB 2PY5A 3HQXA 1UMIA 1UX7A 2RMU3 1S55A 1RJ7A 5E8AA 1DZQA 4XJUA 1OCRB 2IFWA 3NNFA 1SLLA 3I2JA 2EILC 2B9ZA 1VBC1 3FHQA 4PQ9A 2QFEA 3FLPA 3K2OA 1YQCA 4MVOA 4LK6A 4FZ0A 1K34A 3T3YA 5JXJA 4CSWA 4Y33A 1ZZ9A 4P14A 3CX5F 3THPA 1FOD3 2YXYA 2JD9A 3D36A 3CCVV 2NYYA 2YU2A 2VY0A 3OUIA 1NY71 4META 3NRUA 4BAYA 4NTWA 1VQ6V 3AG1B 1AR71 3ZRVA 4A2UA 1CP9A 3TN92 3GHMA 4URAA 4B3SB 2WO1A 1I6XA 3JAWB 4NR1A 4QXCA 4QX2A 2AC1A 4XUTA 2OUJA 5C8WA 4HFSA 4F6EA 1HB3A 4LBJA 4IGQA 4WVWA 3M3CA 3VQYA 3I49A 3RZZA 4BXSV 3PUQA 2ZR2A 4CTEA 1H1IA 1W8FA 1MS9A 3MV01 3VLBB 4DV6O 1ULEA 5T5LA 2BEOA 1E5HA 3WF4A 1Y7BA 3N2GA 4N9IA 3VUOA 3GZUC 5BV6A 3HR0A 1V6MA 4K35A 3J7LA 5FXWA 2Q8DA 4GCZA 3WD5A 2CH7A 2CAUA 3O12A 1GWMA 2IVJA 4EZHA 3JASA 2XG3A 4HG6B 1SQFA 4BJ0A 1DTOA 3CPWU 3LDDA 1SZTA 1FV2A 5FMOL 5FZOB 1S0CA 3AJZA 3RDIA 3VL8A 5EZYB 4YY3O 4XBQA 4BQ2A 3ILRA 5LP6A 1WCUA 4C90A 3OW2U 1BYHA 1Z78A 2R073 3HKBB 3ZYIB 5C9AC 1LHOA 1C28A 1XNRO 2WRAA 5A3UA 3NV2A 2QE7G 1GMMA 3KZ4C 4KBBA 4FQ4A 1VLNA 3A7QA 4UFJA 4AHXA 3VKOA 4Y1VA 3OY8B 4R8HA 3RYHB 4XFIA 1YNAA 5CVRA 5A7OA 1V00A 3MW2A 2EZPA 1AX1A 4UFHA 4K20A 4ZXEA 1SMVA 2AREA 4QPIA 4BB3A 4Q8KA 1OFNA 4C8DA 2D5FA 3WW2A 1BVP1 2P3IA 4NXMO 4J25A 5JXIA 3QH7A 3MO4A 4L92A 1HRI2 1LULA 4GJZA 2VOTA 4IEVA 2GUZA 4GZ9A 1RMU2 3K06A 4EROA 4AG4A 4DV0B 5EBLC 3LF7A 3CCSV 2JG9A 4DB5A 4DR2B 2ZR3A 1JI6A 3K9SA 2Y69B 3NXSA 5F5IA 4C7UA 1BSMA 2Z2SB 1WW7A 1OCCC 5FZMA 1ZRCA 3JARB 1C57A 2W1WA 3OB8A 2JDMA 2NMOA 2LRPA 1NXMA 1OXCA 5A9GA 3HNBM 1W2NA 3MIFA 3RYFB 4ZZ5A 1SLCA 4JGZC 3K57A 3LEGA 2BTQA 3J81N 5A32B 5LK7B 5H9CA 1BHGA 3O0WA 3WVJA 4AVVA 2XWJB 5A3MA 4NIIA 1ZBE3 1OZ0A 3ABLB 4J80A 5FYVA 4KG8A 4Q4Y3 2LJ2A 5JVDB 4R8CA 2DJVA 4K3AA 2B1IA 3AL6A 1EV13 4NPLA 1HV0A 3AKSA 3TNQA 2WZPP 4CZZA 4B3TB 3SQOA 2ZMLA 4TSFG 3O1OA 1R082 1H2NA 4BWAA 3SYAA 1C8M3 2DW4A 5IE9A 5J3UA 3RYCA 1KP3A 2XL9A 3RVHA 2GMMA 2RS11 3ZM8A 1L8DA 1NE6A 4DXZA 5DAXA 3L9DA 4JGYA 3T0DA 4HL0A 5JJNB 4XHXA 1BMV1 5B1BB 2ZCEA 5B1NA 1M06G 4IEXA 3TXSA 4OMDA 5DUUA 5ACA1 2M7WA 1AHSA 5FP7A 4K9SA 4FK5C 3H1WA 4EN7B 3VDAA 1PZ9A 1PK6B 5TSWA 1ZBA1 1RUI2 5FCCA 4CBCA 1ZA4A 5FJKA 3DYPA 4CDXC 3X29B 4DUWA 2QA4V 1KDKA 2ZKNA 3M3IA 2O8QA 4HNAB 2ZNIA 3R4DB 3ECQA 4N43A 3SCGA 4Q0VA 3W7SA 4XBLA 1KQRA 3B77A 2DBNA 1JA8A 1OH3A 4FJCC 1WN7A 4H14A 4DV4O 3K0DA 4HKOA 1NA1C 2OIGA 2FDKA 4NRQA 2J1UA 3QO7A 2WAAA 3WZ1A 3ZFGB 4R52A 4JPRA 3LSQA 2Z4FA 4LO5B 1D7PM 4QDRA 1RXGA 1JOYA 3OD4A 3KGZA 3BAAA 1P84F 5DZGA 3J7NA 5JOZA 5IVYA 1NCRA 3J8F1 1SS3A 2Y64A 4OPHA 3B94A 1NTMH 1XNRB 2RM22 4KI5M 3FAVA 1GYKA 4FBFA 5FPZA 4JZGA 1XSQA 3VBOA 1H2SB 4P9WA 1AP5A 5I8SA 3PUIA 3ZJZA 2QKDA 2DN9A 5KXCA 4IV3B 1Q6UA 2GBOA 3ZXKA 5BNQA 4O4HB 2PA7A 3UJQA 3SYCA 1LOBA 2KG7A 3CXCU 2OA2A 4AQSA 3JBG3 2DV9A 3RI9A 1AYN3 2F23A 4NXMB 3ZPOA 4PIZA 2LROA 4FO9A 5FMDA 3AG7A 4AHCA 2BU9A 3OAAG 5KA5A 2VCCA 4YFZA 3CS5A 3TGUH 3LGRA 2IH1C 2QBXA 3LFMA 1S0IA 2DCYA 4Z2WA 4G2KA 3B00A 2JIGA 1CPYA 1JYCA 5B1AC 3NKGA 1AI7A 2JJ6A 1YO8A 3MDPA 3HB3B 4ZBMA 2VZQA 2FZ2A 5GTHZ 2DVAA 4GT1A 4X1YA 1SQVH 2WT1A 1MMMA 2HG5C 4AHWA 1KJLA 1XE8A 3JB8A 4O4JB 5LA6B 1ULDA 1MABG 2QM4A 2D6KA 4IEQA 3H50A 5A33B 4GH4A 1XJAA 2X0LA 1IQDC 2GNBA 2ZOEB 1YJKA 4IE4A 3MW4A 4H0LB 4V2WA 2GAUA 2QE3A 1QQP1 1QWRA 2E7QA 2XJPA 2JEXA 1WLCA 4JI6O 1IBLO 4JI7O 1JN2P 1PMIA 5C6CA 1AR91 5F5AA 5L3GA 1B09A 4I30A 1SHWB 2JE7A 2VMIA 4L99A 2PHWA 3UESA 1VRBA 2JS3A 4X65B 3JU9A 2WABA 4NUBA 2VQEB 2JG8B 1EN4A 4C1WA 3HKEB 1ENVA 1BEV3 5FZ3A 2ZTNA 3FFQA 4GWIA 1B35C 3AKTA 3HN1A 1HP8A 3SDLA 1EPZA 4X1KA 4I0XA 3DCQA 4XFCA 4DK0A 4NRPA 2GN7A 4CDQC 5IVCA 3W21A 3RW0A 2C9KA 4UF0B 3VHRA 2PZSA 4YVSA 1DZRA 2XLGA 1R091 4C91A 1VBE3 1M9NA 1H2GA 3HVDA 5CBGA 3CIHA 4LE3A 4MVUA 3UYJA 4DRRA 3POIA 1KMIZ 2CNAA 1EN5A 2VAUA 3ZN6B 1RFYA 3ZFEB 1RUG2 5JIUA 3CCLV 4QWNA 1UIKA 1M4WA 5BNOB 3ZSJA 1MSDA 3AYCA 1A32A 1K3EA 4DRXA 4XXAA 1TMF1 1ND3A 3ZIXA 3LFIA 3QO8A 4P08A 4CU9A 3RYRA 1ZTEA 4DV5O 3TCUA 3OEHG 1W6QB 3ABMC 4LPLA 4Y20A 1OQDA 2QQLA 5C93A 3UKVA 5FXVA 1KJRA 3SYOA 4QX5A 3A0KA 4R7CA 2F1MA 2J1EA 4DUVA 2GDFA 2JDAA 1KQSU 5L36A 3FUQA 2UWAA 5CZKA 2UUBO 4DR7O 3RZGA 3JALA 4FLWA 5FYCA 4AI1A 2RMU1 1KU9A 4GYCB 1PX4A 5JOWA 2A1XA 1W03A 2QDOA 3MPBA 1XRUA 2UU9O 2HVJC 2NP0A 4Q4X2 4JI5O 5A3TA 5AG2A 4UV9A 4FLXA 4CS4A 1IHMA 2OWOA 1EP0A 4Y4YA 4WVMA 3K5LA 3ZRXA 3AP6A 2B9VA 3K9AA 1IBMB 5J96B 1UO9A 2ATKC 2VTXA 1VF6C 3BHPA 1Q90D 4L97A 1PZ7A 3NNGA 3K5NA 3G7DA 1MQTB 1GWKA 2RS33 2A79B 1K3IA 4IV1C 5FWEA 1DQ2A 2HYKA 4DMIA 2EIJB 2Q69A 3JSNA 5K8SA 1OQEA 1GP6A 3KV4A 2QTWB 3O65A 4COVA 4QQLA 3C3VA 3WFVA 1N1VA 4LTAA 3ZXEA 2UWBA 4JQTA 2ZIMA 5GLUA 3B5LB 4CCOA 1POQA 3BU7A 3NAPC 4HKLA 5FZBA 4D6QA 5DABA 2YI8A 3CJXA 4RSUA 3E2EA 1YZBA 2ARHA 1RHI2 1K97A 4LO6B 4Q8LA 1OMIA 2QGNA 4Q29A 4FLTA 1GNHA 1YJWV 2PAKA 4A7KA 2VZOA 3QG5A 2WT0A 1ZA7A 4LCUC 3MV11 4M4RA 3A22A 3E8HA 1HNWO 4M3CE 1RUC1 3HBKA 4BQ3A 1IX9A 5C3QA 1NYWA 1CONA 1FXKB 3GZTB 1YI7A 3CL1A 5FO7B 4WBNA 2FD8A 4UCVA 5LYJB 1F7YA 1FS0G 2G38A 2AENA 1OBNA 2YC4A 4OFGA 3TOJA 1SDWA 4LF8O 4XMIA 1YSCA 1NE4A 2Y6JA 5K7PA 3AMPA 1IG3A 5K1XA 2YGMA 1GN6A 3T1YO 3QTCA 3AFKA 4JKMA 1HRI3 2ET7A 3WQ7A 4FPEA 3KSCA 3N4MA 3VD4A 2GDSA 3E35A 1UY0A 3ASIA 1I7FA 5GLVA 1RMU3 1ZL8B 1TME3 3FB5C 4WCEV 4XACA 2YUAA 3CMAV 3WW1A 4X66O 5A1FA 5DN2A 2ZCWA 1WCDJ 3CDZB 3ZLIA 3VDCA 2A5ZA 4X20A 1HR0B 1WP8A 3BCWA 4LHSA 2HHHB 4H7MA 1JYNA 4Y24A 3HQUA 2W08A 5JH7A 4AHYA 4FVMA 4S2HA 3Q8CA 2ZGMA 4DR3B 4NYKA 4QQ2A 1GMGA 2VXJA 1HDJA 3MDSA 4OX9O 2NLRA 3BTAA 4HZFA 1YHQV 1O5LA 2WA4A 2A0LA 2YC2A 3MAQA 4XDPA 2WNUB 1SACA 2P4EA 1XDCA 2PHLA 2UY8A 2YIBD 1G9DA 1W8NA 1QLEB 3L9JT 1S0FA 1MS1A 5LOVA 1W8TA 5FZCA 4MXVA 2P4VA 1JZ3A 1ZBE1 2PF4E 1CIYA 1NZ6A 1H2LA 4HPKA 4AGRA 3APBA 4Q4Y1 1CD3G 4QX1A 2ITDC 3KS7A 1YXWA 3VBUC 5GONB 4BMEA 4G4FA 1W6PA 3INAA 4Q1PA 1RUF2 1GTOA 1UY1A 2IXJA 4Y3OA 2PHTA 1N47A 2WO3A 1SERA 2UUCO 2NR5A 3CWBH 1DFQA 5FO8B 1COV2 4RAIA 1AP6A 3B4SA 4JI2B 2JJ1G 5A6ZA 4YM2A 4TV8A 5KWRA 1NTZH 2Q8VA 5KMGA 5LA1A 4DV1B 3VBSB 3FB6C 5LHIA 4JTOA 5IYDO 3KHBA 2GZWA 4ZHNA 2ZGQA 2PLV2 1MNGA 4M3CF 4HKWA 4EZ4A 3N9QA 1GZTA 3AYAA 1NCQA 1ZUQA 3WXPA 4DINB 2DCJA 4B3MB 1W2TA 4AEDC 4R50A 1PIV1 2VMGA 1IGOA 1YIFA 3ZDVA 3WG3A 3VOUA 4ORFA 1JUHA 3PU3A 4XJ8A 1REEA 1TUBA 2P06A 4WFAV 1BCXA 4ITCA 4DR6B 5JAXA 3JD0A 4I09A 2VUAA 1W0JG 3JQWA 2DVFA 2ZABA 3ZKUA 3VZNA 1K5MC 3WP6A 1JZ7A 3ACFA 3PUHA 4UVCA 1AXYA 2W3JA 1GR3A 2YYOA 1N3OA 1DGRN 2RM23 3WF2A 1QY4A 1VQ4V 3U75A 1VBB1 3ZS8C 1AR1B 3WQ0A 3S30A 2P1BA 1F35A 4LITA 1SQ4A 1V54C 2DYSC 1RUD1 4FFKA 2VR4A 4Q5OA 5E1AC 4MTFA 5DUXA 3N2GB 4LF8B 5L3EA 4ES8A 2EA7A 1QJY2 2BVVA 3MGUA 4UCRA 4MHUA 1S2KA 3PMSA 2CH7B 3GCXA 4RUEA 3AKRA 4IE6A 2Y60A 2HWB1 4JDMA 3JASB 1MZFA 4O9GA 1IS5A 2ZT9B 1GZWB 2V4DA 2RDSA 2TBVA 2X7RB 5KC6A 3LEMA 3GZEA 3I2FA 3WB0A 3VBHA 2KA3A 2EIBA 5LP6B 2QSAA 1BGYH 3IC7A 3BIWE 5JR7B 1X9PA 1XMOB 2GNDA 4QJFB 1N33O 2N7GA 1RB8G 2RR12 1E5SA 1XILA 1Q8QA 2PAEA 4XUPA 3VKFC 3MHHC 2Y0PA 4PDWC 4B3RB 2L6LA 2BW8A 3CJIA 4IIJA 2P6JA 3D6EA 3AZXA 1W9SA 1H1MA 4CCCA 2UUAB 1N1SA 4H7LA 3K58A 1N4CA 1MEC2 1GN3A 5JWPA 2CL2A 4U7NA 1OUXA 5FZGA 2IC1A 4QPIB 2DQ0A 3S6PA 2IWGB 5H2FZ 1VBA1 3HR9A 3Q8FA 4F6RA 3D8CA 1V6JA 3N7JA 2EXHA 2ZZJA 2YSUB 1LODA 1L7RA 2W46A 1JMUB 2GUZB 4BK4A 1BMFG 1MS5A 2RDNA 2F66C 3WP4A 4RS5C 1HRV2 2JG9B 4OZOA 2CDYA 2PYJA 4A3ZA 3SGIA 1OQ1A 4DO0A 2ADDA 4GX2A 4LFCB 4PT6A 3BVOA 4YW5A 1LHUA 4PCRA 5GLWA 2VQFB 2VD7A 2Y6GA 4OYUA 5GALA 2BTQB 1ZZ7A 4BIFA 1FYUA 4LK7A 2Y4TA 1BBT3 4BWOA 2BTOA 1XQNA 3MI8A 2B9UA 2IXCA 2EF6A 1VRH3 4DR1O 3OPTA 2IU3A 1HJGA 2VOWA 4H3WA 4O2BA 4Q2FA 4WM8A 5HPOA 1GOGA 2TUNA 4QPKA 3CRQA 1UOBA 3NKTA 2WLLA 3U37A 1UKRA 2BWCA 3RYIA 2WFPA 2JENA 4QAWA 2WLPA 5AC91 3OG2A 1DIWA 2QM8A 2Y0IA 2Z5WA 5A1LA 1PGL1 1EAH3 4MHRA 1VBE1 2EVXA 3LNNA 4A44A 3APOA 1L7QA 2D6MA 2V73A 5J48A 5DZEA 2WWJA 3RYCB 1C5IA 4PLMA 4DY3A 3DXRB 4FXKB 2JXAA 1YJNV 3LSEA 4JGYB 1OA4A 5ABJA 2VMDA 2WLKA 1JS9A 1JR9A 1VBC2 2DCTA 4FQZA 4HK8A 4X6QB 5J09A 1GM9A 1XSRA 3U78A 1R1BA 4YJ3A 4KMQA 1Y66A 2DU0A 2DBIA 4LKFA 3PVBB 3G6BA 3U07A 3RSJA 4OI2A 2DMXA 4PA3A 3KWVA 2VWJA 4LORA 3V0AA 1A3KA 3ZMZA 1WLEA 1NZIA 3APQA 1GRJA 1LECA 3OBAA 4LO8A 1PO21 1W05A 2ETEA 3AM2A 4K8RB 1K4DC 1VEWA 4IQPA 2IZWA 3BYWA 4F7ZA 4OHYA 2RJKA 5FK8A 4N43B 2IJJA 5F37A 1BE3H 3BODA 1EZVH 4QGNA 4HVOA 1PNMA 1YQ6A 4CEWC 5KC5A 5IVBA 2WLJA 2WWWA 4FIPC 2C26A 3ETPA 2F43G 3TYJA 3IIIA 2XVGA 5KX5B 4OHXA 1WD3A 4UI9L 2WBKA 4CU6A 4HYOA 1LGCA 3SJCC 2JE9A 5BYNA 1NCRB 2XBO1 3VHOA 1RXFA 3POSA 3T1HB 4EQVA 2XAJA 3FAVB 4YHHO 5IVVA 3TJTA 3K08A 2Q30A 4JAVA 3VBOB 3ZFFA 3UT0A 2RS31 1XBFA 5CA1A 3GALA 5FZIA 2W2IA 2Q4PA 4DXSA 2Y38A 4EV0A 4GX1A 4IHJA 5FZEA 1OCZC 2D6PA 1TGOA 1RHI3 5FY7A 3OMIB 2QQPA 5C4WC 4EWDA 5EJ3A 2ID4A 4CDWC 3VZLA 4J1WA 1WAZA 4F8AA 5LMUB 2E75B 1S0DA 1UNBA 3WP3A 2BP6A 3ITQA 1N32O 1H9WA 1BLZA 2DWDC 2Q1FA 1YYNA 2D6LX 4A7ZA 3BI3A 4LBLA 4LBNA 1UXXX 5F2SA 1GP4A 2ZE7A 4D6SA 4UCSA 4IXLA 2X5IC 5T3NA 4CEYC 1HN1A 4YGCA 4X1YB 5DQ0A 3AP4A 5T5JA 2JIJA 3K51A 4Q27A 4YPJA 1E5RA 2AXTZ 1WLDA 1BHAA 4GH4B 4JASA 3KV5A 2R041 4AI9A 3HT2A 3A21A 2GC1A 4PDLA 1MACA 3QLQA 1QVFU 3VBFC 2LQTA 2XJQA 1XPWA 4DV2O 1I5XA 1MS0A 4N7UA 2IM9A 2VOVA 4MX3A 2D44A 4QQPA 4GWJA 2XNDG 2Y6KA 5F6KA 3WR0A 1SESA 3ABKB 4WZCA 3CLPA 1UXZA 2HEWF 3OGCC 4B8EA 4QHZA 1AYM3 1MZEA 1VBD2 3ASNC 3ENRA 3PVOA 4OUSA 4Q6GA 3LWCA 4AVAA 1MS4A 3X2QB 2Y48A 2VCAA 3ZXFA 4X1KB 3R65A 3OBZA 1O3QA 4M4PA 3SXWA 3ZR6A 3ZR5A 2DWRA 5K0UC 2RS51 4O61A 4JV5B 4YVSB 5EC1C 4I3GA 4EN6B 3CRRA 5D8AA 4NWWA 4BLJA 1DGWA 4FPPA 4AEJA 2UXCB 1VE0A 3ASOC 4FPJA 2JD4A 4Q0UA 4Y5SA 2YC0A 3V64A 4NB5A 4XYXA 1YFYA 5FZ8A 2BNNA 1JBCA 1W99A 2P34A 4DRXB 5JJEB 5FZKA 1W2UA 3H8RA 3CC4V 1ND3B 3OGJA 4AVSA 1XYPA 5FXXA 3IIAA 3RVYA 3WDXA 3LA2A 2E51A 4XZUG 2QKCA 3POBA 2HYXA 5FOJB 4XPVA 1BMV2 4Y20B 4JAAA 2PYLA 1VJ2A 2YEVA 1OCOC 1RUF3 5ACA2 1DDLA 1HNXB 5C33A 4I50A 1IS3A 3UGFA 3HIFA 1WW4A 3E6BA 4ZY9A 4X8PA 3AB0A 1ZBA2 4ARXA 3WHTA 3SJBC 3ZDSA 4CPBD 2CTRA 1R64A 4XUQA 2XOKG 1OD5A 2E6VA 4LBEC 1F5JA 4UFIA 4NHKA 1NQJA 3USSA 5KHKA 1SEFA 1VQMV 4I2OA 4H13B 1G1XB 1NG0A 3BUCA 5CKNA 5L3CA 5CG8A 2W5FA 3OTOB 2VMHA 4YIOA 3HNMA 3V0BA 4XQ4A 2VNOA 1YTFD 2WZEA 2X05A 4PA7A 4UVAA 4WVMB 1DF4A 5C71A 1ALYA 4CP0A 2QVSB 1CAVA 2FL4A 1H8TA 4IE0A 4QPGC 4ICGA 1LHVA 3O5SA 3GNEA 3GBGA 3JATA 4ZOLA 4PJ0Z 3J8F2 2ZGTA 3DKWA 2XWBB 1SBFA 4K8ZA 3LZZA 1A34A 3M1HA 1QKQA 3MPPG 5C3PA 3VD9A 4JX0A 4MVSA 4WFGA 1PVC1 2BGOA 4IYHA 1UZYA 3H01A 2ZA9A 1SZXA 5JZGA 1Z5VA 1Q8PA 1OLMA 5DEDA 4DR4O 3UQ8A 1YEWA 3OT7A 2JEMA 2OQ7A 3Q4HA 1QJY3 1RM1B 3E83A 1S77D 4PA4A 3T4DA 3JD4A 4CCEA 4JI3B 4HETA 2R9RB 1XU2A 1V55C 4ES9A 4AOCA 1K9MW 1S5JA 4YG6A 5L9RA 5F5QA 2ODMA 1XB9A 5J7MA 2GP5A 3CRCA 2ZGKA 1KXGA 3A8TA 1WCQA 4BQ1A 4DQAA 4X64B 2A75A 3WLUA 3AC0A 1F5FA 2RR13 4GB31 4FM0A 2GHYA 2E63A 1OUSA 4MH0E 2Y8KA 1ULFA 1SCRA 3NV4A 3H1LH 4TN7A 1RUJ3 2O57A 2UXBB 3ZYFA 2Y4UA 1G9FA 3CO2A 2R0FA 5LASA 5L9BA 4IL6Z 1MEC3 3H1YA 4AR2A 4D69A 3VKNA 1HQLA 1XNCA 4FOYA 4ZKTB 1ENSA 1ENRA 4FM2A 1VF5B 3POEA 1W8HA 3NJYA 4A45A 2WL1A 1QQP2 5FZ6A 3W20A 5FTTC 2RNBA 2DOSA 1F15A 5FAXA 1J5EB 1JQ0A 4WVZA 2YICA 2R7EB 4XUOA 3NQHA 4AVCA 2LUWA 2JDZA 1DLBA 2GH8A 1RUE1 1OCCB 2BQPA 2XH6A 3EHBB 1HRV3 4GIQA 1ZSPA 1KC8W 3MIEA 4EYUA 2BE3A 4XIKA 3I3DA 3RWRD 1DCSA 2EXIA 4NIDA 1UCXA 2IJIA 4X20B 3C90A 3GCWA 3QBQA 5EHDA 4DZGA 4CA9A 2ZMNA 3IPVA 1LEMA 5JH7B 1LHWA 2YPDA 1VQNV 1JHJA 1W8WA 2BOJA 4EE2A 4TLFA 4MGYE 4NROA 2R062 2PAMA 1LUVA 4ISRA 1OURA 4AAPA 3WOGA 5A70A 3IC9A 4KP4A 1ZRDA 3S7EA 5BNNC 1ZM1A 4QPJA 1B6QA 1HJFA 4JYAB 2PI4A 3O1PA 2BRTA 4QT6A 2AACA 2WZR3 2LW8A 3VQWA 2OCCC 3OGVA 1U12A 2JDNA 4XBNA 1VRH1 2KXLA 3DUIA 3LDRA 1WCKA 5C8YB 5LBCA 2PELA 1DG6A 2ZEXA 1LGNA 3KQ4B 3WNLA 4E8DA 4HANA 2UXDO 5AVAA 3N3HA 5IFTA 2QUOA 4LFAO 4MGIE 2VC9A 5CIRA 5HCBA 4HPKB 1PGSA 3ZYJB 4IEPA 4KHPB 4I7ZB 3OMNB 1F4AA 4J11A 4K8FA 4CH4A 1BQZA 3E97A 3UO3A 3VZMA 1REDA 1W6PB 4AI2A 1VBC3 2BZDA 1VP7A 1P7BA 3AFGA 4HVRA 4YSFA 3TEXA 1NS1A 2HBUA 1QNYA 3ZRWA 3ZYBA 4NO4A 3MIHA 3MHSC 1SPPA 1OLRA 4TV8B 2CYFA 4JI8B 2RMU2 1HIXA 3K79A 5JSOA 5KMGB 3N2KA 1RVF1 5LHGA 4RN5A 1Y43B 3VD3A 4FI9A 1J59A 3RYKA 3IAYA 3CEIA 4YARA 4CEWA 1LR5A 1V6IA 1JJOA 3ES1A 3CNAA 1LGBA 3RWNA 1FJGO 3WDUA 1AR73 1Y6XA 4LKSA 4KWUA 1OKOA 3RZLA 1NCQB 1KBHA 3GHNA 1X36A 2J1RA 3N9MA 3EXUA 5FPXA 1YFXA 5BNPC 3WEZA 1B04A 1GN4A 1FOD2 4LF6O 1TUBB 3GDBA 4FAHA 1TEIA 5F6LB 2GN3A 3V56A 3ZVXA 5GZCA 1UX6A 5C7GA 2ZHKA 1OPOA 2BSKA 1IBKO 4P9OA 3FX7A 2YDEA 2HWE1 5DDJ1 3ZMSA 1D2QA 3FUOA 5F3GA 1LB2A 2R72A 4A3XA 1IPSA 1OH4A 3N27A 3OR7C 2FDHA 4V1PA 3E86A 4NRMA 3I97A 3OPWA 4RR3B 1YF2A 2DWEC 1TA8A 3CB2A 4A6SA 2WN3A 1CAUA 4U2AA 2BPA2 4ARYA 4CP9B 3D5OA 4BIZA 2YG0A 3WF0A 2NN8A 4YW4A 3TEWA 1Y3TA 5FQ0A 4UFZA 3W59A 3IKWA 3LPFA 3ZMOA 3ZSEA 1LJ7A 4MGKE 2P7TC 3N9PA 4K0KO 5L3BA 1VQ7V 3LDKA 2ZM6B 3G6EV 4GALA 1JCHA 5KHIA 2AGAA 4CEYA 1AR61 1J1TA 3VBHB 3AG1C 5L3FA 2PMWB 3H8UA 4INDA 4OI4A 5LBBA 1FXVA 1QHTA 1LOEA 3THOA 3WG1A 4OHZA 2VZ1A 3K5OA 2QZ3A 1OHFA 3CJIB 4IIJB 4AQYO 3P3NA 4EB6A 4M0NA 3O14A 2QWQB 4QDSA 2ATFA 1MS8A 4Y1ZA 2R072 2YUEA 4I02A 5EYPA 5IK8A 3AJYA 5GW7A 3JUUA 1KITA 1UU6A 2J42A 3VBFA 5KUMA 3WT3A 1XUQA 3ML0A 4J10A 3HN3A 4MTXA 3OBRA 4IGGA 5A80A 1XHZA 3P32A 4UOJA 3K59A 4O7XA 3J7AU 5DAQA 4LFBB 3W5NA 3OF1A 3P3PA 1DU3D 5K4LA 1QJX1 4NTXA 1STMA 1SLIA 1I9RA 3URFA 2Q5ZA 4HN0A 1JHNA 3K0GA 1NH2B 3TB0A 1LOFA 2HEVF 5EV7A 3RMYA 4GAZA 2DE0X 3T30A 1YI2V 2FCUA 4DR5B 3IM0A 3C7GA 5A2QN 3AP9A 3CD6V 4XF1A 4BK5A 3W58A 5JIAA 1XMQO 1PGW1 4DUZO 4AFAA 3MEPA 3BKZA 4I0BA 2YHJA 2ZIOA 2J7MA 4CUCA 2QDRA 2ORZA 5GM0A 1AROP 2NN4A 1PM7A 1F51A 1DF0A 4XDQA 1FAFA 3OGRA 2GC3A 3HT1A 1SF9A 4O2BB 4WM8B 2HKOA 4ASLA 5GTIZ 2WLLB 1W6NA 4F83A 4NIGA 1XL4A 5IJ9A 2WFF1 4ZPIA 3M2MA 1HV1A 4P9PA 1O4ZA 3UGHA 3WNKA 3H8OA 2F4VO 1KKDA 2K2SA 3CCQV 4S2DA 5IW0A 1P7GA 1MG1A 2D6OX 1W0KG 1ZBE2 2RS13 4C0BA 4KH9A 4E4ZA 4HMZA 4Q4Y2 5FP3A 1BXHA 2Y0OA 5IJRA 1R3LC 4DYLA 1FPN1 1ZZCA 2E26A 2DFBA 4E4SA 2C5DA 4JKKA 3KV9A 2DYRB 3MUY1 3FB7C 4W50A 5ACA3 5ABJB 1C8M2 3HKDA 4NHLA 2Y69C 4XFHA 4CDUA 3FKSG 4YJ3B 5E79Z 4J1XA 1ZBA3 4QB6A 4UXAA 3UJOA 3NJVA 3JAKB 3L2HA 3R05A 5CFDA 5L7OA 2AH2A 3V0AB 4GKJO 4CE8A 1JYIA 4NMIA 3BRCA 3K46A 1N34B 1ULPA 1K7DA 1PNLA 2ZXWB 2RV9A 4Y1XA 2XKPA 1ROPA 2ZHLA 2AHZA 3VBRA 3FFZA 3ALQA 5M0TA 1PIV2 5IT6A 1UU4A 2LFSA 1AZDA 4PDVA 5FYYA 4MVQA 1S1AA 2OPKA 2QQJA 4I0AA 3ABLC 2VNGA 1HB2A 3OJBA 3RJRA 3B2EE 3ZYRA 3JB4C 1JU4A 1AF9A 4Q4V3 4TTGA 4IEUA 4KWKA 2EXKA 1DYKA 4HN1A 2WR9A 5LW9A 1V6LA 3BOPA 2ENRA 3AK0A 1L0LH 4J41A 5J2TA 4RQFA 3ZHRA 1JVMA 1GICA 1JX9A 3A4UA 1I5PA 4IE7A 3J8F3 4NXNO 2CWMA 5D1IA 2ZACA 1XC6A 3OYWA 3LA7A 2ZHNA 4LUMA 2VM9A 1N3QA 2P3JA 5EZWA 2KQXA 2AZ0A 1RUD2 2N05A 5B1BC 3SYPA 3BCCH 3V65A 3ZFFB 1S0JA 3CEWA 5BY5A 1P49A 3SKVA 2PGGA 1RJ8A 5DPNA 3MFCA 2ETNA 3QVNA 1N1YA 3BTYA 3S57A 3I5DA 5EXOA 2VBDA 4RD7A 3KD4A 4IHJB 3FZ3A 3NO8A 4UB8Z 5KAIZ 1PK6C 3T1CA 1XNAA 2I07B 2HWB2 2Y26A 2ZEZA 1XL6A 3E6CC 1DF5A 4YXWG 2XGXA 5HCAA 2V1DA 4AQTA 4E2QA 4XHBA 2BV4A 2XOMA 1AYN2 2RDQA 4J6GA 2PN5A 3GF6A 1DBNA 4BA6A 1WMEA 2W91A 5FUNA 3ZIWA 4F3JA 3QOPA 1V9PA 4FLUA 1FKAO 5L73A 2BERA 2PQSA 3PJQA 4XTMA 2EIGA 1CXZB 2W92A 4TOIA 5FYSA 2QQKA 3M8AA 3TEZA 3S5QA 2H6CA 3NNJA 3POJA 1AL0G 5KUKA 2B42B 2ZDIA 2KSDA 1WBLA 2VQ0A 2OX0A 4LEJA 2ZQMA 1C1LA 2Z79A 4OMCA 3LE0A 1Y74A 1D2DA 1AR93 1LENA 3I3QA 1HX6A 2WIIB 1SDDB 3LEIA 4IV3C 4UFKA 5FZ1A 2G1MA 5IDJA 3SKJE 5FP9A 4FPYA 3AYEA 1KEXA 2FMDA 1BCCH 1DHKB 4BOWA 2CTWA 2WNVA 2QJ1A 2FKXA 1GP5A 4XDLA 2G19A 2WLMA 4QE9A 1LAJA 4MXWB 3K4DA 4IETA 4YW1A 2XKOA 4LJHA 4A5UB 3GJAA 4GKYA 5T50A 3BFRA 5HCHA 1R093 1U0AA 1X8EA 1NLSA 4MT8A 2GH2A 3I7DA 4DV3O 1BEV2 3BTZA 3ZO0B 5D2AA 1FATA 5F7UA 2V09A 3OUFA 5D8AB 1O59A 4YZ1A 4QU1A 2A6XA 4RHV1 2FB5A 5AC92 3GBFA 1CZSA 1W9TA 2FMLA 3SPJA 4EWEA 3K03A 3T2TA 5I91A 1TMF3 1VBE2 1S0GA 1P8JA 2A3QA 4P30A 3DXTA 3J7MA 3T2PA 2ADEA 5BMVB 2LW1A 4WFEA 2VECA 2LGQA 4S2FA 3CCUV 4X62B 3AZZA 4J42A 3MW3A 5JQGA 1DGLA 4N53A 1ASJ3 2WZR1 3T1LA 1Z2GA 4WBBA 3SH5A 1X82A 2C9AA 2YEVB 4DUYO 2P4KA 3L73H 2CTVA 1W04A 4GUNA 3ABUA 2J1VA 5T55A 2R70A 4PJYA 3E22A 2JG8C 3SEPA 2XAFA 4HSLA 3T09A 1RSOA 1F4NA 5IWAO 1PP9H 4JI0O 5IY5C 5ITZA 4XJAA 1PO22 4YRDA 3NV3A 4ZIBA 4CH3A 4LHKA 3L71H 4LP8A 4TQFA 5LY1A 4LF4O 1VQKV 1R3IC 1GKFA 1N8RW 3VZOA 2RN9A 3H1KH 4UUJC 5CFCC 4LIVA 1AJKA 1QOOA 4XABA 4ZHQA 3V0BB 4K1YA 4ASUG 4BLIA 2QTSA 2WNEA 1PX3A 4MSWC 3EJKA 2QQMA 4LLFA 2VTXJ 1IS4A 1R081 4UCUA 1H8TB 1ENXA 1IXBA 5BNOC 1LUWA 2JJ2G 2W1SA 2HEYF 4COUA 1AI6A 4FFHA 3JATB 2VS0A 4ZOLB 1MZ6A 2GP3A 4XCAA 1OOPA 4D3WA 1YQ5A 3DEMA 4LBQD 4N7IA 2JDYA 4YZ4A 1XQ8A 1KD1W 4LKDA 5GZEA 1FMD1 4E4EA 1QEXA 2F6BA 3CZJA 1F4MA 1KFXL 1AJPA 4LF5O 3KT7A 2RS32 5JZGB 4DW1A 4CPBA 3LNMB 3RYPA 1RUI1 3PNAA 3Q4HB 2ZEYA 3I3BA 3K3WA 2WJSA 3W7TA 5HI0A 1LHNA 2YS8A 2OQ6A 3RZKA 4NPMA 1Q6HA 3A0HZ 4HSJA 4MG2A 5FYZA 2Q1MA 1X59A 3BOWA 4BIUA 2ZAAA 3DGEA 2WQ4A 2JDHA 1UJWB 4LBMA 2VNVA 4WM7A 4PI0A 1GUIA 3NWKA 4I55A 1RUC3 1NH2D 4A41A 2CY6A 4NHYA 3OMAB 4PF5A 4QU2A 4GKXA 3SJAC 1I94B 1IKQA 4LKEA 3PHMA 1I1EA 3D3QA 4AGVA 4JTNA 1AJOA 3T08A 4CXYA 3F7YC 1U96A 1Q8SA 3ICXA 4DV7O 2VBPA 1VAKA 1MQTC 2ARBA 5FR3A 2ERFA 5EFUA 2FHRA 4OLLA 2EIJC 2AR6A 1X7NA 1BQ0A 2LGWA 1TNRA 1DGRA 2RDCA 1PNGA 1G4YB 1S3JA 2JGUA 3WQ1A 2P6HA 5BR8B 4XFAA 4AGGA 1QR9A 1VB2A 3LSUA 1W2BU 2RDRA 3OTFA 4UVBA 1UFIA 1OHHG 2XLFA 5FV3A 1EBOA 5CG9A 2GNMA 4EN9B 5ANNA 2PHXA 3ZBHA 5EYYA 5JCOA 2E5LB 5EZYA 3J7HA 4XFFA 4E2GA 2VMCA 2ZGNA 2QWPB 4G28B 1HB1A 4QGPA 1JZ6A 4BYYA 3M7MX 3UKNA 2VTFA 1TME2 3IFXA 4EJRA 1H30A 4DUYB 1AR81 1YIJV 2V7QG 3SJQC 3IPVB 2J1AA 4Q1RA 5C8CA 3S3XA 4Y4RA 1HDKA 4GKKO 3N9OA 4DY5A 2DYCA 1FXKC 3LB9A 3WW3A 4CCMA 3KMHA 1H38A 1SETA 5CB4A 3U10A 4QKFA 4QGLA 2W1QA 5GLZA 4AI8A 2Y6HA 2EINB 1K4CC 3POWA 3ZHTA 4LH7A 2VG9A 3MICA 1K92A 4YJ2A 1NJIW 1OSGA 1OKQA 2IW5A 2ZGRA 4QM8A 3UKTA 3R4SA 1EPWA 2VL4A 1JZ4A 5H5NA 4XE9A 1EUTA 2XUMA 1VAVA 5FPAA 2EIMB 4BPZA 2ZGSA 1FXZA 5KXDA 4CCJA 3T1MA 2WDBA 1RGSA 4DEVA 2XMLA 2BUKA 5F3EA 2XB6C 2H0BA 1XNQO 2BFUS 2KKWA 1FD9A 1NU1H 1XE7A 3ZRWB 1JTZX 2H6BA 4B7KA 1UY3A 1SPPB 4MS2A 5CA0A 3M3OA 2RG4A 4EEQA 4NHMA 4AI3A 1JZ2A 1HXS1 2A7WA 4TZDA 3MF6A 4PA9A 2Y6FA 4CEWB 1UPIA 5DZFA 3P1IA 4DV6B 3VDBA 3NMBA 2YY1A 1PIV3 2QWNB 5F2VO 4FLYA 2YZ4A 5KHHA 3AKQA 5JLVA 1TAEA 1AL21 4YW3A 1E1QG 3NW4A 2VWKA 2WNUC 3WB2A 2D98A 2HJIA 4GLXA 2VCBA 1GWLA 4UW6A 2ARCA 2ZEWA 1QLEC 1RUOA 4FT8A 4K6BA 1CJDA 3NSTA 4RQPA 1X33A 2JEUA 4YGBA 2FYUH 4YZ5A 4B08A 2VJXA 1OI6A 1FFTB 2BSKB 1NI8A 1VBB3 5LGUA 1PVC2 5IAVA 3ABTA 2IBZH 2WPDG 1RUH1 4Q4V1 3B40A 4YY3B 1RUD3 1MVEA 3MIGA 3WF1A 4PI2A 3E8GA 2D5HA 2DVGA 2OIIA 4UW4A 2E33A 3AZWA 3OGIB 2PXJA 1OF3A 3ZX7A 3TK1A 3STZC 4XW3A 2HWB3 5FMBA 5FQ0B 1M56B 2VMFA 3AK3A 3I56V 3VBSC 1G86A 3WG7B 1R1A3 1UYYA 4Q4X1 3T0BA 2GU9A 3D36C 1E1RG 2UY9A 2XHNA 3AMNA 2XAGA 1H8HG 2X6BA 4CEYB 5DG2A 1FAYA 5GJ6A 3DTUB 3IT8A 3ZHQA 5F39A 4XVHA 3I59A 4TUYA 4Q4W1 1AI5A 2A3YA 4UFMA 4YVWB 2XQRA 4LF9O 3SPGA 4PIXA 1S0BA 4W6XA 3B7MA 1GM7A 1ZAUA 4EB6B 1UQXA 2ZX4A 4BCUA 3IMNA 3GJBA 2OIEA 2DVDA 5KBFA 5JPNB 1G6NA 3H1MA 5F8PA 1E79G 4JVAA 5EYPB 2CGPA 2R9AA 2Z5UA 5APAA 5FYTA 2VOKA 4JC1A 4UCOA 3KT1A 1MVQA 2HLDG 2MW2B 3H1JH 1VBA3 1CESA 1J84A 1TZOA 4QKDA 3H3ZA 1UPGA 4XJ9A 3CCJV 3K3OA 1WUVA 3AG3B 1OV9A 5FZLA 1REFA 2IXLA 2VZPA 4IGOA 3KV6A 1DK1A 2XASA 2CUGA 1Q5OA 4TV9A 4WFBV 3N7KA 2WZ8A 4K3UA 3RT3C 1Y4MA 3LD8A 3IWZA 3DPRA 5LEKA 2YFUA 1VQ9V 2ZPXA 1JUIA 4MVZA 3ZYPA 4JI4O 1PNFA 2Q0AA 2VUJA 1S2BA 1LNSA 3RPQA 3T2QA 1MA1A 3LAGA 1NKDA 3IAPA 3CJHA 1QDCA 4QX3A 4FOWA 1WA6X 4FFBA 5LP6C 3BTXA 2HP8A 1M1KW 3M3EA 1ND2A 2ZX3A 1V6KA 1FXHA 3MZHA 2UURA 5JCTA 1KECA 3WINE 3WCRA 1D4VB 3ORJA 4HONA 1Q82W 4Y1UA 3O1TA 5AC93 4P02B 2J22A 1W6NB 4PQQA 4NIHA 1YWKA 2BBVA 1BBT2 1VRH2 1W6OA 2YPJA 3NNLA 3BA8A 4JI1O 4QPIC 3E5XA 2OT7A 1W39A 1OCOB 4L8QA 4S2GA 2CDOA 3NJZA 5FY8A 3E1F1 1JYTA 2JG8A 3HKEA 1EAH2 4MVTA 3LQCA 4FAGA 5T52A 4QGMA 5I0TA 2CU5A 2QCSB 4CXWA 4DV4B 2QQWA 3FYIB 3HKDB 5A7PA 2ZGLA 4ISQA 4CDUB 1Y76A 2JX9A 1AX0A 2JK5C 3PVEA 4I5SA 2L9LA 1RVF2 5CFDB 5L7OB 1RPOA 4UB6Z 2XJSA 5CFCA 1ASJ1 5IT9N 1M93A 1PO23 5JOYA 4N23A 1DQ0A 1N36O 2D97A 5IFPA 3OD0A 4XZPA 3ZN6A 4LMFA 4Y5TA 3D0JA 2PUSA 2FBEA 5B3SC 3VBRB 4YNIA 1SQQH 3K3NA 1W9WA 5J1XA 1O4TA 5FZHA 5FZ7A 4OULA 3ATGA 2W47A 4NKGB 3F5WC 4X9QA 1AJQA 1U5XA 4D94A 3CSXA 4O4IA 4MW3A 2VZVA 1DZTA 2B39A 5LXTA 3QD6A 2BFUL 3OSDA 4BDVB 2QWRB 1NLQA 4LBOA 1GO3F 2RQ6A 4FFIA 5J2TB 2EJ7A 1JXNA 4FTEA 2XBO3 2HH9A 3H3LA 3ZMUA 3OYWB 4QHBA 2BGCA 4FLZA 2HWE2 4XAAA 3LSSA 4L87A 4NOTA 4PBOA 4XCBA 2PQQA 4JGYC 5T5OA 1QH6A 2JDIG 4U36A 1S5HC 4ATEA 4CS2A 1COV1 1HNZO 2WWSA 4MUVA 2AEZA 2DCKA 3FBYA 3E89A 1V55B 1D4M1 1GZ9A 3BABA 4IT5A 2E7TA 4H33A 4LO7A 1YRZA 5FL7G 3MUZ1 1MPXA 3CMEV 4HLTA 2ZE6A 3T2OA 2CE4A 1BS3A 3C7FA 4AVBA 5DG1A 3O0VA 2ITCC 3WDWA 3R6SA 1YC61 4MGTA 3EYPA 3G4SV 5F1RA 1AR62 3VZJA 1HWYA 1QXJA 3CU7A 1U5IA 2ZS6B 3WSOA 4JI6B 1IBLB 3EFFK 2V5YA 1NZCA 4MADA 2ZMKA 4JI7B 3SC7X 3PLQA 2VUCA 4CCLA 5C9AA 3ZOIA 5DXDA 2JDUA 3ETQA 2OT5A 5E16A 1K5JA 2YBKA 5CBHA 2QDNA 4XDJA 2AGSA 2VOXA 2MNGA 3WNNA 4B4PA 3C8XA 4IYIA 1SQPH 1UKGA 2R043 4GULA 2DURA 5FLJA 1OT5A 2P90A 5G04L 4XJWA 3WDYA 1O6UA 4GD4A 1VQ8V 4NE9A 2JDKA 3VKMA 2QJVA 4W6YA 4Z07A 1UF2C 1QJX2 1KS5A 4KL1A 1NT2B 1Y74B 4AVTA 2W87A 1PM9A 1QIQA 3B93A 4CH6A 2ET1A 2P37A 4B3SO 1UD1A 2WUHA 1UAIA 3N35A 2WLIA 4DXWA 2XPJA 4JZ2A 4H37A 4EFEA 4XDKA 2DF7A 4PLOA 3TNPB 2WNVB 2DQ3A 4YIPA 1NR1A 1PGW2 4ZXKA 2A6VA 3SEEA 3I55V 2RS53 1W28A 5FIXA 2Q7HA 1YJLA 4TLGA 4NIAA 4DV5B 4FFFA 4JGZA 5LYJA 1VMFA 2YIAA 3RI8A 1AYM2 5JXGA 3U1XA 1ST8A 5DECA 3SCHA 3DF0A 2ARAA 4KBZA 1NLRA 2GC0A 4CRQA 1FV3A 2VVEA 3Q8AA 4KG0A 2EAKA 1DQ4A 4AZZA 1VQOV 4PV1B 1WA8A 4MO3M 1ZREA 3HBZA 1UOJA 2UUBB 1POV1 3D3AA 4DR7B 1FX5A 3HNYM 4EKWA 5FLHA 1ZL8A 1R6KA 4LUKA 1Q6IA 3ZX6A 2D40A 1FPN2 1BZWA 2WO7A 2LALA 2UU9B 1OFSA 1SFPA 1UU5A 2I45A 3AMQA 1QXPA 1V6NA 5JQGB 4N53B 4JI5B 1VMHA 2QR4A 2V5DA 1I0HA 4D6RA 1M57B 5IAXA 3BGAA 1LU2A 4JRAA 3DECA 2OTJV 2JB8A 2ZAHA 1PMHX 1BKZA 3E22B 3BPZA 5FPVA 3KM5A 5K1PA 1RSOB 3VN4A 3AK2A 3X2QC 1S5LZ 4RWUA 1KB9F 5ITZB 5B66Z 5KAFZ 2GMPA 2WQ8A 1WB8A 3GGLA 4CDXA 4YVSC 2WNUA 1O3TA 2M6YA 1WB7A 3FHIB 2R1DA 5J2UA 1GOFA 2HBTA 1XHXA 3PIGA 3ACGA 1QU0A 5FZDA 1GOHA 4FPKA 5DAWA 4ZHQB 4M3CA 3WDTA 4DV0O 1MZ5A 4OQ8A 1UZZA 2EIDA 1QHDA 1JFFA 4PDMA 4DR2O 3HEIA 1NA1A 4J9YB 1N0NA 5FYIA 4DNYA 3CP1A 3AP5A 1LOAA 2O0OA 4XAEA 4ASMB 4LWSA 1W9YA 5IK5A 5BPXA 1ND3C 1RPRA 1WJZA 1OOPB 2ZZQA 1WLTA 4K40A 1VQLV 1PVC3 3R0RA 4LLOA 4U3FH 3D3IA 5D5PA 1K73W 3W9AA 4MYEA 5CN0A 4HK9A 3I54A 3O7OA 1NBMG 4AQ6A 2VE1A 1KRIA 5IYCO 1AJNA 1HNWB 1ONAA 1V9U1 3U11A 3VBSA 5F5CA 2XONA 5FYMA 4DRVA 3W5MA 2HWC1 4QIWF 2ZX0A 4BE3A 3H7JA 3OUSA 1LKNA 2F4PA 1RUNA 1M90W 2Q8EA 4LF7O 2WAMA 3KCXA 1OVSA 3VQXA 4B3TO 4KU7A 5LATA 1Z7S1 1YTFB 1AVBA 4UV8A 4O65A 1DQ6A 4RA0A 1D5AA 1K45A 3ZKYA 1CWPA 2Z0AA 1GN2A 2MK3A 2B1GA 4WM7B 3SLIA 4BW9A 3CHXA 5BXXA 5I8YA 4I55B 3OPZA 3T1YB 2HJDA 4GB33 2G9GA 4OUEA 2EIEA 1G8MA 3UNPA 3QF7A 2WS91 5EYXA 3EVKA 1C3HA 2IU0A 1R1A1 4LBQA 3P6BA 3SPCA 3LIGA 4MW8A 1W3VA 4LHNA 4PDRA 4FPHA 4LC1A 4RGGA 5A3PA 4X66B 1X9TA 5H9SA 5LRSA 2EIKB 1K12A 4P5HA 1QMJA 4QB1A 5FMCA 1FNYA 2P17A 2OYQA 4KWJA 2Q5TA 4PIYA 5ANQA 1QNWA 1RUJ2 5FUPA 2Y33A 1RUE3 4YFWA 3DL3A 1SLTA 3T0AA 2RCVA 5HXMA 1NOVA 2YXLA 1M5IA 4D7SA 3L75H 1GNYA 4QX0A 1RM1C 3K4AA 4YGEA 1GZWA 4OX9B 1W2AX 1FNZA 3P30A 2YIDA 5LEJA 2A06H 2FCVA 3UO2A 2PYTA 2JGDA 5KHGA 1WLWA 2GSMB 4B29A 1B35A 2P67A 4L2NA 1W6MA 2W0FC 2UWCA 2DTWA 4CDQA 4R9AA 3H8XA 1HLCA 3G67A 5C8CB 5JJJB 1PO13 2G4IA 5FK7A 3TAYA 3QO5A 2CAZC 1H1AA 1XYNA 3A0BZ 3N7LA 2HEPA 4IDZA 2QKSA 4RHV2 1QNMA 3EQEA 3PIJA 4YZ3A 2K9ZA 1RYYA 5H9QA 5CB4B 1P4RA 1D2SA 4OGQB 4I0WB 2UUCB 3P5BA 5C5UA 5FYBA 2D3RA 2XDVA 1NTKH 5B2GB 1J95A 4ET7A 4LQRA 2AW9A 4YJ2B 3FJSA 5IJ0A 1AB3A 2H3OA 2G9ZA 4OXSA 1DYOA 2WZR2 4FFGA 2JDPA 4AILC 2A6ZA 4IEWA 1VBD1 3FN9A 4W8JA 4JQRA 1UYPA 1QJU1 3PJSK 4Z2AA 1LESA 5IYBO 3CQOA 3N9NA 4QXBA 2MEV1 1QJZA 2D7FA 1LTEA 4GX0A 2HWD1 1RVF3 5CA0B 1PPJH 2RJ2A 4KNCA 1Y4WA 4ZZ8A 1T6GC 2WO2A 2EAAA 1DLCA 5DAPA 3O1SA 1GV9A 1W0NA 5C5TA 3I2GA 3Q9OA 3QNEA 1Q56A 4YZ2A 4FOQA 5CBFA 1YQ2A 4HAMA 1LOCA 4LF7B 4Z1MG 1GM8A 2VPVA 3LOBA 3FWEA 2VUDA 1NY72 4GWMA 4LO4B 4X65O 3WNOA 1VF6A 2VQEO 1AR72 2C24A 3DXRA 4AWDA 5LCWL 2Q7EA 1Y67A 3JD3A 4JRLA 4RQPB 4QB2A 3AG4B 2A9HA 4B3NA 3ETEA 1FMD2 3AG2B 4IV1A 3IAQA 1WMFA 5LGNA 1RIRA 2NM1A 2HWE3 1YUDA 5DDJ3 3Q8EA 1FT9A 4CU7A 4R9DA 5FPOA 3R66A 1UMZA 3PURA 2D93A 2JWPA 2PHUA 1N33B 1UPSA 3FHAA 4L0PA 4CC5A 4UBHA 4AYUA 3RS6A 3JCIA 2IXIA 4FPGA 3USUA 1VMGA 5SV5A 3NAPA 5CB7A 5FLIA 2CK3G 2DCZA 4ZS3A 3MIBA 3RQ0A 2AZ5A 4QD2A 4GMP1 4OCTA 3T2MA 1GSLA 5IHRA 3UK9A 3VKLA 1AR63 5LB6A 4FVVA 4YG0A 3ZSLA 2W94A 2KG7B 1O5UA 3OGSA 1NCQC 2WN2A 4X88A 3E6DA 4BXFA 4Q0QA 3I59B 4TUYB 5J98B 2QKAA 5KX5A 1O3RA 4QE7A 3KGLA 2CGOA 1UIJA 4DIQA 3KKYA 1EY2A 5GKAC 2VQAA 1Q43A 3NL1A 1JYXA 1GNZA 5JUVA 4B1MA 2Q8CA 4N8MA 2HWF3 3R4UA 4J7KA 5IVJA 5IVEA 3B9IA 1X4TA 1QJX3 3IN9A 4XF9A 3MFAA 1XNBA 2HKXA 2VQUA 5I8TA 4XETA 5F3IA 1A8DA 4MV2A 4DR1B 4RR3C 2W39A 3I2HA 3ZMVA 1GK9A 3UT5A 1IBMO 1RL3A 4TV9B 3HD8B 5CMUA 3GWKC 1WMXA 2X6CA 1CEZA 3DPRB 1WNSA 2YBPA 4JTCB 1JW6A 2ADPA 1TVGA 2Y6LA 3M3QA 4BH9A 2VRZA 3KVBA 2DDUA 2WQZC 1AR82 4KQ7A 3O9OA 3CMGA 4X89A 3IB3A 1NKGA 3VBHC 3CJHB 1I5YA 2YB7A 4FFBB 5FOBB 1YFUA 1NUKA 1ND2B 1US2A 3DV8A 1TQ5A 1EZJA 4SBVA 3IBMA 4RYDA 4I0XB 3CJIC 4E8CA 2CGNA 1MS3A 1S0VA 2ZXQA 5BZBA 1WPXA 2WFF3 1BZKA 2X29A 2OS2A 2IJKA 2GC2A 5FZFA 2P5OA 3ZXLA 2WSVA 4XF0A 4JYYA 1W6OB 3M70A 2FDFA 5EJ1B 2B8MA