2Q0AA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2q0aA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q0aA02
2Z69A 4O9EA 5D1IA 4BH9A 3VHRA 4MGYE 3DN7A 3DV8A 4IETA 4JTOA 4P9GA 2IC1A 1UD1A 2MPFA 4I3PA 4Z82A 3TNPB 4LLOA 4UBHA 3UKNA 4F7ZA 1CAUA 3FHIB 1O5LA 3EQEA 5LEJA 3H3UA 5JCTA 2PHDA 1FI2A 3U10A 1LRHA 3FWEA 5FPZA 4KL1A 2Z2SB 4I2OA 2EA7A 4AVAA 1ZZ6A 4HVOA 4EWAA 2IXIA 4IEYA 2Q4SA 1DZTA 2PHLA 4WBBA 1YFYA 2Y0OA 4Q29A 4XF0A 2QDRA 4KWLA 3H50A 1NE4A 1UW8A 1EP0A 1X82A 3PNAA 4HLTA 3OGJA 4XF9A 4YRDA 3UKTA 4LULA 4IERA 5CU1A 3SCHA 2Q30A 4MGIE 1OFNA 4EV0A 1YHFA 4HSJA 2GAUA 2IXHA 5CVRA 1UPIA 2CAVA 2Q1ZB 2VQAA 2BNMA 3KSCA 1CAWB 3L2HA 3S0MA 1O3TA 3ES4A 1FXZA 4LEJA 2O1QA 3H1YA 3I59A 5JAXA 2FQPA 3S7IA 2H6BA 2GZWA 4N9HA 3CF6E 5C8WA 3LA7A 1SEFA 3NL1A 1TQ5A 4J1XA 4E2QA 4MGZE 1ZZ7A 1CAVB 3E6CC 2VPVA 4PJYA 3H8UA 3USSA 3SCFA 1EPZA 4HMZA 2GC0A 4PIXA 2N7GA 2BEOA 4WZCA 4OLLA 4IEVA 2BYVE 3SCGA 4Q0UA 3E6BA 3ETQA 3M70A 1RC6A 1IPKA 1V70A 1NYWA 1VP6A 2IXKA 5JSOA 4MZUA 3WW4A 4MV2A 2FMYA 3SXWA 2OZJA 4F8AA 4AXOA 5BY5A 3HIFA 5LRRA 1X8MA 4UXAA 3MPBA 4TLFA 1VJ2A 2CAUA 5BXXA 4YYOA 1QXRA 4LA2A 2PFWA 4E2SA 1YWKA 2ET7A 2PAMA 3NKTA 4FBFA 4GULA 3M3IA 4L11A 4XFAA 4E2GA 4LUKA 4LA3A 5FPXA 2OZ6A 2D5HA 4Z07A 2UY9A 1X7NA 3OCPA 4J1WA 4QMAA 4PIZA 1GQHA 3RNSA 3PLQA 1O3RA 2HKXA 4WVZA 3IDBB 3JZVA 2ET1A 2XLGA 3DKWA 5I0SA 2K9ZA 3ST7A 5KHIA 3ELNA 1SQ4A 1XE8A 4HN1A 4X6QB 4QGMA 3LAGA 1NXMA 1ZVFA 4EWEA 4H7LA 3SMHA 2H0VA 4PIYA 1UIKA 3KCCA 4KWKA 1O7FA 4R52A 5E1RA 1SFNA 4KWJA 2CGPA 2VECA 5HI0A 5AVPA 5KHHA 1ZZBA 1CAUB 1H1MA 2B5HA 5T3NA 4A2UA 4RD7A 2C0ZA 1OMIA 5FQ0A 3CO2A 1QWRA 3CEWA 3HQXA 2IXJA 4I01A 2GU9A 2DCTA 4I0AA 3D0SA 4IEZA 1RTVA 4FT8A 3BPZA 1RUOA 4BYYA 4D7TA 3RZZA 2PAEA 4O9GA 1ZRDA 5I0TA 4FAHA 3D0JA 3QOPA 3ACLA 5FLHA 3BU7A 3O14A 5KHKA 4LTAA 4OFGA 5JSRA 3MZHA 3H3ZA 3RDIA 3OF1A 1IPJA 2XLFA 5BUVA 5KHGA 2XKPA 4I0BA 3I59B 2MNGA 1LR5A 3H7YA 4Q0VA 1FT9A 3ZDSA 4QX5A 1CX4A 5FLIA 2GC1A 3LA2A 4XFGA 4LUMA 2XL7A 3FX3A 4IEOA 2XHKA 3CLPA 2QVSB 3H1MA 2CV6A 1YUDA 4XFFA 1ZNPA 1OI6A 1YFWA 3GYDA 4Q0PA 3EO6A 3LWCA 3I7DA 2QJVA 1I6XA 1H1IA 5C6CA 2EAAA 2D40A 2WC2A 4MX3A 2UY8A 5FLJA 3CL1A 1QXJA 2H6CA 4DINB 4YSFA 1CAVA 4HN0A 5I8YA 4XFHA 1DGRA 3IBMA 4QM8A 5F1RA 1YFXA 2D93A 5EZWA 3G7DA 4IEXA 2PA7A 2I45A 1J3PA 1ZZ9A 3C3VA 4ZU5A 4BHPA 1Q43A 2P17A 3RYKA 3FZ3A 3H9AA 1J59A 1ZX5A 4B29A 4AVBA 4XFIA 2ATFA 4XF4A 1JUHA 2GH2A 4MH0E 1ZZCA 4Q0SA 5I91A 3UKVA 3E5QA 1EY2A 3DL3A 3TNQA 5LEKA 2ZKLA 1Y3TA 4XETA 3RYRA 3FJSA 1HW5A 4AVCA 4UBGA 3GBFA 4XF3A 1UCXA 3RPQA 4N9IA 5EFUA 4HBNA 4NVPA 1O4TA 1ZRFA 4L2NA 5I0UA 1CAXA 4MUVA 2D5FA 3LOIA 2UYAA 1J3QA 4XEZA 5KHJA 1GQGA 2XLAA 3IDCB 4ORFA 5JR7B 1X8EA 2PYTA 3H1WA 3NSTA 4KU8A 5FQ0B 5J7MA 1DGWA 4I09A 5I0RA 1RUNA 1ZRCA 3KGLA 4ZU4A 5J3UA 3HT2A 4QM9A 1ZRRA 4META 2PTMA 5FDBA 1EYBA 3NJZA 2E9QA 3BCWA 4ZU7A 2WFPA 3ES1A 3RYPA 1Q5OA 2ETEA 4XFCA 3SHRA 2F4PA 2IXCA 2OYZA 1O3SA 4AQ2A 4JV4A 2K0GA 3EBRA 5BPXA 4JVAA 1UIJA 4JTNA 1J58A 3OTFA 1PMIA 2PAKA 3D82A 1XRUA 1Y9QA 4MGKE 3IWZA 4HZFA 5JSPA 2EVXA 4KU7A 4IESA 3OD0A 5KBFA 4YARA 1ZREA 1DZRA 2GC2A 3FE5A 2OA2A 3H7JA 4I02A 2OPKA 2KXLA 4YNIA 3KMHA 3I54A 2BGCA 1G6NA 3E5XA 3MDPA 1QY4A 3IIAA 3PVBB 2BNNA 1J1LA 4QXKA 2O8QA 3CJXA 3E5UA 3KGZA 3BB6A 4FAGA 5E16A 4HSLA 1LKNA 2GC3A 1CAWA 1O3QA 2MHFA 1WGPA 1PM7A 5I8TA 4HVQA 4IEQA 1WA4A 4EROA 4IEPA 5I93A 2XL9A 2IXLA 2ZCWA 1NZCA 2XGXA 4D7SA 5I8SA 2QNKA 5LRSA 4AQ6A 4Q0QA 5J48A 3WW1A 3QACA 4XF1A 3FFQA 1L3JA 1ZZ8A 3NW4A 3EJKA 4XFBA 4QGLA 1YLLA 2B9UA 2Q0AA 1O5UA 3WW3A 1J3RA 4EWDA 3S7EA 1RL3A 2V09A 1Q3EA 4CYDA 3E97A 3WW2A 3N4MA 1I5ZA 3EHKA 3U11A 3LZZA 2XKOA 2HJIA 2PQQA 5CADA 3E6DA 3HT1A 3NVCA 3U0ZA 1U12A 4X6RB 3ROUA 2BNOA 1CAXB 4IEUA 3R6SA 5BV6A 3LA3A 1WLTA 1LB2A 5FCCA 3MYXA 1XE7A 4ONUA 5K8SA 4R8HA 1CGPA 1RGSA 1NE6A 4IEWA 2QCSB 3B02A 1VR3A 3BALA 4K8FA 2UYBA 4BIFA 1OD5A 1YFUA 2B8MA 4QGNA 4HVRA
chains in the Genus database with same CATH superfamily
3POJA 3H1KH 4WBNA 1SQGA 4P9GA 4PDWA 2ZZJA 1Z7S2 1PO12 1W8HA 2LFRA 3LB9A 4RR3B 4F7ZA 4AEMA 2BERA 2R32A 1WW6A 4FPCA 2QE7G 4WM7B 3J7AU 4DXWA 2ZX3A 3JBG3 4PHZA 4CDQC 2JGUA 1LOFA 2FBEA 4YGBA 3RWKX 1D4M1 5HCFA 4COUA 1JOJA 3V0BA 2XUMA 4B4RA 1UMHA 3LEIA 1UL9A 2W1UA 2B1GA 3CX5F 2ZEXA 1JJ2U 1UKRA 2B9VA 1WN7A 2R062 3CSXA 3WR0A 4G28B 2O1QA 1JTZX 1LNSA 2EIJC 1FPOA 3HKCA 1LOCA 2VUCA 5IDJA 1RUJ2 1VBA2 1VBC1 1CAVB 1EPZA 2VVFA 3QLQA 1J5EO 4IE5A 3H8OA 3GBGA 1NG0A 4C0BA 2OYQA 5AC91 1D2QA 1DF5A 1QLEC 2JS3A 3ETQA 2VBDA 3BKZA 2ZEYA 5B1NA 1NYWA 4DV1O 1U5XA 2GTSA 5KX5A 4C0HA 1C5IA 1SS3A 2Y48A 2ORXA 1B09A 2IH1C 1QXRA 4LA2A 4PQ9A 1YWKA 2RE9A 4QPGC 4IYIA 3N9MA 1S0IA 3GZAA 5FZOA 1Q82W 4I55B 5DABA 2BTQA 5E89A 4AHXA 4B3SB 4B3RB 2D6LX 4D3WA 1PPJH 3ZJZA 4W50A 3ELNA 1TVKA 2AH2A 1DF0A 2HWF2 1SCSA 1FNYA 2DYSB 4U2AA 1TA8A 3ZXKA 2HWD2 4NMIA 2DMXA 2P90A 5DXDA 5HI0A 3ZYFA 1OCRC 2DTYA 4AQYB 3E8HA 5FZAA 3EHBB 3R0RA 1L0LH 2QZ2A 2DJVA 2AACA 1W9FA 3CEWA 3OUSA 4DV2B 4H2AA 1E1RG 2ZA9A 5FKCA 1UY1A 1NZ6A 1VBB2 1RUOA 5F2SA 3KWVA 4H14A 3TYJA 4E8CA 5CKMA 2VAUA 3W7WA 5KHKA 4J7KA 4FOYA 4FPYA 5LA1A 4L99A 4JDNA 2W47A 1WKYA 3A7QA 4RSUA 4A42A 2DVGA 4O4LB 5CKQA 1IPJA 4KGGA 4I0BA 4JKLA 1GUIA 4BM8A 1FT9A 3J7NA 2F6BA 2YEVB 2XQXA 4JQTA 3CS5A 3T4VA 1SZXA 5EBMC 2DVDA 4YFZA 1K3EA 5IVVA 1SETA 3I7DA 4RUFA 2A71A 2EILB 2IVIB 3L75H 3UT5A 3JAKA 5FZ0A 3ORJA 2R071 2BSKB 1DGRA 4HAMA 3D4KA 4JDOA 3P30A 4JKKA 1NZIA 3PUQA 1Y66A 2G38A 4E4HA 4AAPA 2FDKA 4BHPA 3K4ZA 3AZWA 1W9WA 5F5IA 3RYHA 5B3SC 1Q8OA 2HWC2 3JU9A 2P5OA 1RUD2 4TYSA 3ABMB 1YQ6A 3H3LA 2NLJC 1EV12 4Y1XA 3QBQA 1MG1A 2ZKLA 3T0BA 3HR0A 1W6OB 2BZDA 5J98B 1XILA 3ZSKA 4HKWA 1H8HG 2Y6FA 2NQYA 4M01A 2VL4A 2VUDA 4NIAA 1XEQA 5I0RA 1AI5A 3ZRVA 5KMGA 4BQ3A 4ZXEA 4TN7A 2N04A 2W46A 2KG7B 1ONAA 3ACFA 4A4AA 3CQOA 3ZXAC 3THDA 2XH6A 1O3SA 5K1XA 3EBRA 2C4XA 3USUB 1PMIA 3IWZA 4DIQA 4UB6Z 4QHBA 5IAXA 1AR62 5T52A 3H7JA 4V2WA 2XBO1 3HBKA 5J2TA 1LU1A 3E5XA 4DEVA 3MDPA 4IE7A 2CSGA 5LGUA 4NOTA 1TMF2 1J1LA 1PK6A 4FPJA 1IXBA 1AX0A 2EF6A 4LT5A 2IW5A 1SLTA 1AVMA 1VRH2 2JDKA 4GKXA 3EMRA 4AI0A 2WYSA 5CKNA 1HNXO 3BTZA 2XGXA 1C8M1 5LRSA 1LR1A 1PGL2 3WW1A 1X9TA 5EWSA 4YFWA 3QACA 1AR91 1WMEA 3LSUA 1LOBA 1WMFA 3ZYBA 2W2IA 3ZHRA 2D6MA 5BNNC 4JYYA 3WP3A 3WY6A 5CA0B 2YMZA 4OHYA 1HRI1 2Q8OA 2WO7A 1W9SA 1QU7A 2PQQA 5CADA 1F4AA 1W6QB 2R70A 2HLDG 2PHFA 5DEDA 3OEBA 3OBAA 2VOWA 5K8SA 1NE6A 1VQMV 4K8FA 3KM5A 3VZNA 2QWNB 5ITZB 3CCRV 1QR8A 3DV8A 1RXFA 1WNSA 2OT5A 1YSCA 2IC1A 4DEQA 2V4AA 2P6JA 3ZMZA 3JARB 3ABLC 4IYHA 2W6IG 3GZEA 4E9KA 3VKNA 1DF4A 2UUBB 2HYXA 3DF0A 2RM23 4P00B 2C1FA 4DY3A 1CESA 4XF0A 4J10A 3H50A 3PNAA 4UVBA 4D0QA 1UU4A 4F6RB 3SCHA 2B5UA 3E86A 2JE8A 1UPIA 3S0MA 3B8MA 1G9FA 2ES3A 2ZKNA 3CJIA 4Q4Y1 5FZMA 1D0GA 3ZMOA 5F3EA 1CONA 5H6QA 4BQ5A 2WNUC 5KC5A 4R9BA 5DPNA 2XOKG 1WMXA 1TGOA 1GWMA 3VBOB 5FZ8A 1LHVA 3B9IA 4P5HA 4XABA 2P4EA 1M90W 2BEOA 5A3TA 1JFFB 3AVSA 1QJU3 3OPZA 2Q7EA 3LF7A 4Q0UA 2WT0A 5GONA 3CCVV 3WG1A 3PJYA 3GCWA 4LLFA 1RHI2 4OXSA 4PELA 2YS8A 4H44B 3O0WA 3MPBA 2ZDIC 1VJ2A 1GP4A 3WV6A 1GV9A 4X64O 1AILA 3IMMA 3K3WA 1O3RA 1UYXA 3IDBB 2XLGA 5GZFA 4WBNB 5GTIZ 4ZZ5A 3K58A 1IBKO 4CCMA 3K4DA 4PDWB 1ODNA 1A34A 2OCCB 4PQQA 1SQQH 1KECA 2QQJA 3D3IA 4KWKA 4A5UB 4M3CE 3PMSA 4NWWA 4XOGA 4NXMO 3ZMSA 1SPPA 4Z1VA 2ZX4A 2LJ2A 2GV9A 3RZHA 4U7OA 3EVKA 4N53C 2JECA 4MW8A 2W6JG 1XNCA 2YROA 4X1KA 3LDKA 4KBBA 4OI1A 4XDKA 3V0BB 2Q68A 3RZZA 4ISQA 4KGQA 1XNQO 1SA0A 3R4UA 3KV9A 2G4IA 2WR9A 4LF9B 4OULA 5FP4A 5LA2A 1WZXA 3MDSA 1MZ6A 4L92A 4ZXKA 3HKCB 1QF3A 1QLNA 1QCEA 4PBPA 4K20A 4YJ2B 2VXRA 4UFKA 2XHKA 3R66A 5HXMA 3AXDA 3MFCA 4PDRA 2NN4A 4IT5A 2RS51 3T08A 3Q8BA 4HXCA 4YW4A 2RG4A 1YFWA 1RP3B 3CXCU 4QQOA 3JB4C 2EAAA 3LE0A 4OGQB 3OGCC 2QKCA 1PGW1 3AZVA 5KX5B 3HAGA 5BR8B 1EUTA 4CEYB 5FZ1A 1BQZA 1BMFG 2B4KA 2FCVA 1AL23 1OCZC 1AP5A 3CZJA 2XJPA 3CE2A 2Q69A 5FL7G 1BBT1 4QHOA 3C3VA 1N1VA 3W20A 5FZOB 3OBZA 4TWTA 2BTQB 4PDMA 4CPBD 1OH4A 4YGCA 3M1HA 3HKDA 2JDIG 1XNBA 2E7QA 5ACA2 1TVKB 1CIYA 4LPLA 2WFF1 1LCLA 1PL0A 3WDWA 1IBMB 3RZGA 5B1BC 5LP6C 3LDDA 1YITV 1JU4A 1GZCA 2XLAA 4ORFA 2PYTA 4QDQA 4V1PA 2ZE6A 2BRTA 5C9AA 1WPBA 1B35A 2Y4UA 2PTMA 4MGQA 4KP4A 2QKDA 5EYXA 1W39A 3JASA 2ZXWB 5FLXN 3RZMA 1CZVA 3I2JA 3ZEDA 1VMGA 3U75A 1YTFB 1Y9QA 2R043 1JOBA 4QPIA 3FB5C 4DRRA 4KHPB 2WZR3 1MS3A 3ZMTA 3M3EA 2YFUA 2Q7GA 5LA9A 3FE5A 1FPN2 3J8F1 4BW5A 2GN7A 1V9U1 3TOJA 3A0NA 1LOAA 1N32O 3TN91 4UFJA 1JW6A 4X89A 4PF5A 4BK5A 2ZR3A 2YPDA 5DUVA 1JODA 3JUUA 3T1CA 5I8TA 1KBHA 4IEQA 1Q6HA 3D36A 4ASUG 1ND3C 5I93A 3UT5B 2IXLA 2LUWA 2XL9A 5FY5A 4URAA 3JAKB 2VZVA 1W2OA 4UW4A 2QNKA 3WNLA 3FLRA 4LFAO 3BN6A 3FMGA 2CGOA 1YI2V 4HKLA 1QQCA 3ZIXA 2LW1A 4QKFA 1RUG3 3RYHB 2VW0A 3P3NA 4COYA 1MA1A 4YW5A 2J1RA 2R30A 2VTXJ 1YQ2A 3N4MA 3NJVA 2VZSA 4XMAA 2CTQA 2XJTA 4LKDA 2ADPA 4TT3G 3VQVA 2ZBJA 3KCXA 5JZGA 3ROUA 1XXNA 4WFAV 5BV6A 2X53S 2WZPP 3ZHVA 4A7YA 4PDLA 2VMGA 2K9PA 3ZFEC 2J1EA 1PNKA 4K0KB 3CZUA 1H8TC 1CPMA 5FPBA 5KMGB 3AM2A 2K46A 4IETA 4KMQA 1GRJA 1RPOA 4I3PA 5EQUA 3TNPB 4JI6B 3ABZA 3CRMA 4A41A 1IOAA 4TOIA 4YGDA 2OUHA 1O5LA 3EQEA 4GLXA 2DFBA 3U10A 3AFKA 2ORZA 2KQXA 3ZDVA 4RR3C 4ISRA 3LCPA 2BTVC 4UW6A 1SQFA 1HXS2 2UUCO 1RJ7A 5J2TB 1JZ4A 2ARAA 4WM7C 4HLTA 3OGJA 3WG7C 1S0BA 5JMOA 2P06A 1PK6B 5CU1A 3POSA 1LENA 2Q30A 1AR82 5FOJB 4HKOA 1YHFA 4X65O 1G9DA 3I3MA 4JI5B 2ZEWA 1R3KC 1G8MA 4CCCA 3S7IA 2X8KA 3HMYA 4K9SA 5FMDA 2JJ6A 1N1TA 4AOCA 5JI9A 4HMZA 2GC0A 3LUTB 1IPSA 3WQBA 2UXXA 1MS0A 3OR6C 4OLLA 4NHLA 4P5YA 4WV8A 4OYUA 4MTOA 4QIWF 1S0VA 3WD5A 4OPHA 3A22A 2X05A 2UXCB 4Q20A 2IH3C 4E4SA 4LF7O 3IMNA 1SERA 2Y6JA 3A23A 4AXOA 3HIFA 1UKGA 4QQPA 2JEMA 4E8DA 5BXXA 5C33A 4IGOA 1D4VB 1D0HA 5FPXA 1Z5WA 2LTNA 4Z07A 1BJQA 2NR5A 2W0XA 4LR4A 1PZ9A 1X7NA 4Z92B 2A7AA 2VBBA 5FZ9A 5D21A 4NKGB 2BPA2 5JVDA 1SQ4A 2W0FC 4RHV3 1REEA 1IBLB 1NXMA 4M00A 4CTEA 1V6OA 5IJ0A 1O7FA 4R52A 2PLV2 1HNWO 2CGPA 2VMHA 3OEHG 4PI0A 1Y6XA 1TNFA 1LHUA 2DYSC 2F66C 4A2UA 2RNBA 2C0ZA 1OMIA 2EIGA 5LGNA 3SEEA 1QWRA 4J80A 1VE0A 4I01A 2KM2A 1H8EG 4UFHA 1F4NA 4IV1B 4DUYB 1V6MA 2JK5C 1MQTC 1D5NA 1AYN1 1OQEA 4QQLA 1RUC1 5A7PA 1JI6A 1K5MA 3OF1A 2XLFA 1ASJ2 1P49A 3CJIB 1VBE2 1R1A1 3OYWA 1QHTA 2QZ3A 4WFEA 5IK7A 1UZZA 2JEUA 4RQPA 4LKFA 3VQWA 3G80A 3S57A 4XBNA 5F7UA 1K12A 1SG3A 4HG6B 4DV7B 1ZM1A 1ZNPA 4BISA 3OGVA 2VH9A 5A7NA 2K2SA 5JOZA 2VMIA 4HT1T 1NY71 1GOFA 1I6XA 2D3PA 5F2VO 3TWIA 5GONB 2UY8A 3ALQA 1FS0G 3IAPA 3WNKA 4DINB 1FX5A 4PF1A 1S2BA 3QH7A 3UJQA 2XB6C 2E5LO 1EAH2 4NPMA 5LYJB 1YZBA 2EIKB 1JOYA 2W91A 4XBFA 1J59A 2VQFB 3M3QA 5ERLA 1WPXA 5AC93 3K75B 2D6KA 3UKVA 2EULA 4LIUA 1S0DA 4UBGA 2IFRA 3K04A 4HBNA 3PDQA 4Y5Z0 3I55V 4MUVA 5KXCA 4XEZA 5DN6G 2Z4FA 5FAXA 2VZ1A 3NSTA 2JEXA 4LF4O 4I09A 3CC7V 5EXOA 4ZU4A 5BNPA 4DV5B 1G1XB 5A3NA 4LR3A 4X1KB 1N47A 1S4CA 1EYBA 4Y5SA 3AMPA 1Q5OA 4XFCA 1NXD1 3UJOA 4AHZA 1ST8A 1NH2B 1SA0B 4GT1A 3AKRA 1HB4A 1MS1A 1I94O 3BTXA 3LNMB 2RR11 2ZX2A 4NB5A 5JOWA 1JQ0A 2A75A 1N8RW 1NOVA 2DW4A 1CXZB 5C4WA 2AEZA 3WG2A 2G1MA 4FM1A 3JCIA 4L8QA 2ETNA 4GKYA 1ND2A 4PLMA 4HVQA 4K35A 1VQ8V 1UN1A 4BU2A 1M4UA 4X66B 4Q0QA 4TZDA 3BABA 2XVGA 3WNPA 1RUF1 4BDVB 2RS12 1V0AA 3HNYM 4LBLA 4XFBA 2V4VA 1W9TA 5LASA 2UXDB 3HKDB 2QSAA 1AP6A 3KKYA 3R05A 3POBA 3K51A 5CBFA 1AR5A 2YHJA 5JPNB 4QXBA 2HJIA 1T2XA 3RZKA 2R6QA 4RL7A 3NRUA 4EN8B 4LFBO 3VKMA 1HRV2 1WLTA 5D5QA 2YFZA 1HQLA 1I5YA 3E22A 2LGQA 4Q4W3 5A7SA 5A6QA 4O9EA 1HDJA 2ZZQA 3VHRA 2ZJCA 1B35B 5FY9A 5DZGA 4RGGA 5H6RA 3VZJA 2LW7A 3JASB 3LEGA 3I97A 2KA3A 4QPIB 4CPBA 3AMQA 4E4DX 1RUI1 1GP6A 1COV1 1OPOA 4AVAA 2RMU1 3LSSA 1ZA7A 3WB1A 4DW0A 4O61A 1VBD1 3MUY1 1X9PA 4FLUA 1EP0A 4YRDA 1UX6A 4LBEC 1AZDA 4Q5OA 4Y22A 3KSCA 2ZNIA 2E63A 3RVZA 3TCUA 5L36A 4ET7A 2XONA 3OUHA 4OQ9A 4BAYA 4M0HA 2H6BA 3ILNA 2A73B 5J9PC 3SYAA 1NTMH 4MTGA 2YUAA 2VPVA 3NV4A 2HG5C 3VZOA 2VC9A 1DBNA 3RW0A 3APOA 1ZBE2 1LULA 3IT8A 3WF2A 4GH4B 3M70A 2HWB2 3VBOC 1XNAA 3ZR5A 2FB5A 3EYPA 4AAXA 2C26A 2WWUA 4LIVA 1NCRA 1JYCA 1RXGA 3VL9A 4GX5A 4CEWC 3KV5A 1K4CC 5JZGB 3AYDA 5LHGA 1UY4A 4LKSA 1UYZA 4DV0B 4L11A 4K8RB 5BNOA 1AR93 1DQ4A 4B7EA 3VD4A 2RHPA 2IJJA 1P7GA 3WZ1A 1VF7A 5FYYA 1G6UA 3PMEA 3GF6A 1UIKA 3FC0A 5J36A 4DK1A 1HRI3 5E1RA 2OS2A 2BOBC 2IJHA 4P08A 3SH5A 2HH9A 1D4M2 1HQWA 1STMA 2CDOA 2V7QG 2LFSA 2F4LA 2OCCC 4M4PA 3AP9A 5GLUA 4NPRA 4IGGA 3D0SA 4FZ1A 2PHWA 5FMOS 2XJVA 2PAEA 2DUQA 1LOFC 2R0HA 1MEC2 1K4DC 1Z7S1 1PO11 3ZSMA 1QJEA 1OLMA 4OCTA 5BUVA 5DUWA 5KHGA 4CDWA 4ARXA 5LBEA 3QG5A 4QHZA 3K3OA 2XL7A 5IVJA 1UPGA 2QTSA 2YB7A 2QVSB 4DB5A 1PP9H 1ULCA 4R6ZA 1WLDA 1YUDA 2HEVF 2ARBA 4A45A 1SF9A 5FLJA 1VARA 1QXJA 4CXXA 1NLRA 1D7PM 5LMNB 4FLXA 2R061 3ZN1A 2N05A 5FYTA 2WO1A 3AP6A 3JBG2 4GMP1 1RUJ1 1LOEA 4NTWA 1VBA1 3J7MA 2P17A 4CEYC 1KJLA 3BCCH 2QQWA 4LO5B 2ATFA 1AI7A 2QWRB 5JVDB 4J42A 5F6KA 1KKCA 3E89A 2P2KA 3TNQA 4FP3A 4K8ZA 3ME2A 1AF9A 2BCCH 5IJ0B 3DCQA 3SYPA 3KT4A 4DV6O 3K08A 2QKAA 2TBVA 2B7YA 2ZGPA 4FFBA 3RZLA 2A7WA 1EPWA 5FK8A 2WS91 5FPLA 2ZM6O 1RUNA 3CBNA 1UOJA 4ZU7A 4JI1B 1QKQA 3E83A 4O4HA 4NUBA 2QTOA 2HWE3 1RUE3 4JVAA 2HWF1 1MNGA 5T5OA 4HETA 1K5MB 3N9PA 1O8SA 3DXTA 1REFA 3SH3A 3AXEA 3OYWB 2GC2A 5LOVA 1YJKA 1POV1 2YZ4A 4RQPB 4RQEA 2AUYA 1BMV2 2KB1A 1KEXA 1GICA 1W05A 4BIUA 2FDHA 2QWPB 2A6VA 2R072 3BB6A 4FOVA 4LE3A 4FAGA 4HSLA 1VBB1 4HNAA 5H9RA 3P3PA 2MHFA 4RGKA 3FLPA 4RGAA 4B1LA 1OXCA 3V64A 5DAVA 4NRMA 4QPJA 3CRAA 4CZSA 4AQ6A 2WNVA 3VKLA 1H30A 2JDPA 3MHZA 3K5LA 2HBUA 2JG9C 3NAPA 1ZZ8A 1FMD3 2QWOB 1GSLA 1PMJX 5FJHA 3SC7X 2AZ0A 1MS5A 1TE1B 3AKTA 4PLOA 3I3DA 4PJ0Z 3TEYA 2C9KA 4BA6A 1I5ZA 1XMOO 3BTAA 3QO7A 2HEPA 1JOPA 4HZ3A 3N27A 3T1YO 5JUVA 5F37A 4IEUA 4AZZA 2UU9B 3BIWE 4AGGA 4E2LA 4F4LA 2D6OX 5EK0A 1ULFA 4YY3O 2B39A 4NTYA 5LY2A 3CD6V 3O1SA 3FD9A 1PHMA 2Z69A 5BNPB 5FIXA 3ASIA 2VZOA 4X62O 2BBAA 3GHMA 2EZPA 2HWC1 4QGPA 4XYXA 4QX7A 3RJRA 1RUD1 1R082 1FFXB 4IGPA 3HKBA 4AW7A 2MPFA 4GA9A 1XNRO 1PX4A 2WFF3 3UNPA 1EV11 2ZMKA 2WLNA 3GNEA 1SQBH 1XOYA 4KL1A 5D5PA 3AEIA 4BMBA 3T0DA 2QQOA 2VQTA 5C4WB 1SDWA 5FZCA 3VKOA 4ZONA 1QMJA 1OFNA 4LOSA 3ZVXA 1CIWA 1N1SA 1AJNA 1ND2B 5J96B 1QBZA 2F23A 1PK6C 3IKWA 3WNNA 2BE3A 1OFSA 1S5HC 1YRZA 4P9WA 4IL6Z 4NJ4A 3VBRC 4DOUA 3TN93 2Z79A 4N21A 4Q26A 5A3OA 4DUWA 4I50A 1TMF1 3VHNA 4W8JA 3X2QB 2YDEA 1SESA 1TUEB 1SFPA 1BQPA 3S3WA 1QVGU 1PVXA 2D2CB 5LATA 5BNNA 4TLFA 1HV0A 3PL0A 1XMQB 2ET7A 2JDHA 5JDBA 4WFGA 1PGL1 1K5SA 2OZ6A 1UF2C 2Q1FA 4QB2A 1J5EB 3E22B 1PM4A 3M8LA 1VMJA 2YIBD 3MHSC 2FD8A 1QQP3 2G9FA 4DO0A 2H0VA 1Y4MA 2ARCA 1WCUA 4FOQA 1K42A 4OHZA 3B9CA 5FZLA 5H2FZ 4AFBA 1W9YA 2N74A 1L0NH 1B06A 1ENXA 1C28A 4JI4O 4MXWA 2OIGA 4QU1A 3RT3C 3VBFC 3OOXA 4BYYA 3ZFGA 5EC2C 2IFWA 3ZSLA 4AI8A 5IVBA 5C5UA 2F4VO 4Y22B 2PXJA 3H1LH 4AR2A 4IV1C 1WW4A 1UZVA 3W58A 3H7YA 2W5FA 5GZCA 1VPHA 5FLIA 4FO9A 4TSVA 1BCCH 3CLPA 1GNYA 1V6IA 3KS7A 2VE1A 3AJYA 4LHSA 3WFVA 2WNUA 2RS32 4JI2B 1DDLA 1Z0HA 4Y1UA 2X10A 1NCRB 1ODMA 2LROA 4FTBA 4AFMA 1C5HA 3APBA 4P30A 5EJZB 4X9QA 3M2MA 3IBMA 3BI3A 2ZE8A 3WX5A 2RM22 2XJSA 4XW3A 5BNOB 2QQUA 3FZ3A 3GB7C 5LHIA 4B29A 5B4XA 4LITA 3A0RA 2ILMA 3BAAA 1F35A 5A2QN 1ZZCA 5FWEA 2ZCEA 1U5ZA 1W04A 1O4YA 2P22C 3ZLIA 1QJZA 2J22A 2XJRA 1N34O 1D2SA 2Y4TA 3S5AA 5FZGA 4OI4A 1CAXA 1RHI1 4GCZA 4FJCC 3F5TA 3N2KA 4LF5O 5T5JA 1S5LZ 5IT9N 5J7MA 5EV7A 1QJFA 3KGLA 3MFAA 4IQPA 1FV3A 1QJU2 4QX2A 1FKAO 2JE9A 4DYLA 4N53A 1AX2A 1G86A 1J84A 5KAFZ 3ML0A 4JZ2A 2DWEC 4CDWB 3PIJA 4LHLA 2KD7A 4RS5A 2GNTA 5C7GA 1SC5B 2Y26A 3FL7A 1QJX1 2PY5A 4QPKA 2VWJA 3DXRA 2ZIMA 3MF6A 3DC5A 1R091 1LTEA 1QH7A 1X4TA 2QWQB 3PJSK 5JIUA 1F31A 2W92A 1HNZO 3ZCCA 4FLWA 1F7YA 2ITCC 1HWYA 3PTRB 3FHAA 1BBT2 3CJHA 2FKXA 5LK7B 1BZWA 4XBLA 4NHXA 3HNMA 1MPXA 1R6TA 3NJYA 5CEHA 3HPNA 3FFQA 2UURA 4G3YC 4QDRA 1SLIA 4NIGA 1AI6A 1LGBA 4O7XA 3JB8A 2RN9A 3B01A 3ETEA 3K5NA 4RA0A 2XKOA 1I1EA 2J1SA 1EN4A 3ETPA 1W06A 3RS6A 4G4FA 3BHPA 3BUCA 3AZZA 1K34A 2HFEC 1A8DA 4ONUA 4FFBB 5CIRA 5F6LB 4YG6A 1S3JA 1X33A 3C8XA 1NKDA 5CBGA 5DAWA 4O4HB 3WF3A 2ATKC 5D2AA 1GR3A 1AB3A 5ACA1 3K5OA 5FK7A 2QJ1A 1IGOA 3CCJV 2I74A 4DV3B 2G9GA 3W21A 4YHHB 1VF6A 3VHPA 3FWEA 3ZXJA 1AL22 4L97A 3MGUA 5LOVB 1NBMG 1DQ2A 2OQ6A 5JJNB 3N7LA 2W9XA 5KR7A 4JI8O 4MGIE 4CCLA 4YZ2A 4EV0A 4PI2A 4HNAB 4AQSA 1LUVA 3DSQA 1NLSA 4CU8A 2VGDA 4LOTA 3VUOA 3LSDA 2RR13 4W4ZA 1QIQA 2GZWA 3H01A 2WNVB 2D7FA 2IWGB 4EN7B 3VDAA 2P34A 3SCFA 4IUGA 4Q8KA 1FPN1 3LDEA 1ND3A 3NAPB 2D3OW 5DUXA 4B7KA 3RWNA 2AZ5A 5KXBA 3LGRA 5CBHA 3KD4A 2UWCA 3WXPA 3L72H 5HV4A 3ZXFA 4FPPA 1QVFU 2BUKA 1HP8A 5B3SB 1NVPD 4GH4C 5BY5A 5IYBO 1YQCA 1MVQA 3IZOA 1N4CA 4YW1A 2Y8KA 1RUF3 4NO4A 3OT7A 2YC2A 1WBLA 4QMAA 5JZGC 4ATFA 4CCOA 4JGZC 1P4RA 4JYAB 4BB3A 1GP5A 3OPTA 4EWEA 4H7LA 3HKBB 3HJRA 4Y20A 1H8TA 3APQA 4N23A 1DFQA 3GHNA 1H1MA 4NXNO 1G8WA 5J09A 4IV3A 4UF0A 4RD7A 1ENQA 5H9PA 1N33O 3NQHA 3E1F1 4CP0A 5K0UC 3IAQA 1XYNA 5LY1A 1W8OA 3PU8A 3B93A 2GU9A 4BMEA 4DR7B 1O59A 3AB0A 4IEZA 1IBKB 4YJ3A 1UY2A 3LIHA 5I0TA 3O0XA 4W65A 2VW2A 3CU7A 4OFGA 1W28A 2DUOA 3PHMA 1RUI3 2D6NA 4YW3A 2E33A 2ZGQA 4Q4X3 2YC4A 3T1HB 5JOXA 3LA2A 3MEPA 1JYVA 1CJDA 2R7EB 1HXS1 1UJWB 2JDAA 5EJ1B 3IJ4A 1SZBA 4BLIA 4B3RO 1L1FA 5FP3A 4GWJA 2PI5A 1V6LA 1XNQB 2LM3A 3AC0A 5L3FA 1AR81 4FTEA 2H6CA 5L3EA 4DR2O 1CAVA 1EZJA 4XUPA 5BNNB 1QOSA 5FFOC 1QNYA 5LWBA 2I45A 1BL8A 2EXKA 3P32A 5KXEA 2VULA 4QE7A 3SPIA 1JUHA 4D6QA 4C8DA 4UW3A 1YJNV 2WKKA 1GZWA 3DL3A 4K40A 1YVWA 4C91A 2JIGA 1BGYH 1Q56A 3T30A 3SDLA 2V72A 1K5QA 1AR72 1XSQA 5I0DA 3MIDA 5G05L 3JAMN 3GCXA 1WP7A 2Y33A 3TGUH 4C7UA 4QKDA 2P4VA 3ILFA 3VL8A 5FDBA 3NJZA 4MXWB 3BCWA 2AENA 2P4KA 1DLBA 3MIFA 5C3PA 5FTTC 5A9GA 2F4PA 3ZFGB 2IXCA 3IC9A 4XUQA 2OYZA 4JV4A 1MOFA 2K0GA 5A6YA 1R1A2 5BPXA 4K8XA 1SZTA 1O6UA 2PLV1 3I2DA 1QJY3 1FYUA 1HX6A 4KBZA 1MQTA 1WLCA 2YIBA 1ZREA 2IJKA 3W5MA 2VZ3A 1V55B 2KXLA 3MF9A 3KMHA 1T5EA 2A3YA 1K5MC 3L2YA 1MS4A 2VMFA 2A6WA 3UESA 3GXUA 1W8ZA 3ZBHA 3P5BA 4CCDA 2WNUB 4AWDA 3MW3A 2W52A 5A1FA 1CAWA 1Z7S3 4YXWG 4A44A 3LDRA 3G67A 1ASJ1 1F4HA 2FCTA 1N32B 1YQ8A 2LS6A 2CDYA 2ENRA 3ZM8A 1RJ8A 5GTHZ 3AP4A 1LECA 4ZS2A 1U97A 5F3GA 4CYDA 4XDPA 2M6YA 3U11A 3E8BA 3DC6A 4MYEA 3NVCA 1KD1W 2R063 1U12A 4CCEA 4C1WA 3L9DA 1CAXB 3R6SA 3K5MA 4LFAB 5ANQA 1BHAA 1EAH1 4GMP3 1VBA3 4IEWA 3FFZA 2Z3YA 3AKPA 1NR7A 1FOD1 4XHXA 2A06H 3VD7A 4DW1A 4TXWA 1QR9A 2YXLA 1FXHA 2LGWA 3TEXA 2YIDA 2J1VA 4LO7A 4N53B 4K7JA 1UZYA 3AJZA 4Y4RA 1BEV1 5JR2A 3H3UA 5A80A 1HW7A 2D3SA 4WZFA 4H37A 2BFUS 4JAAA 3JD73 4RS5B 5FZ7A 2Y0OA 4BQ4A 4Q29A 4KWLA 4UFMA 1COWG 1NX9A 1X82A 3OSDA 4XXAA 3M7AA 4B3NA 3DXRB 1IG0A 3AZXA 2OTLV 1LUWA 2LRPA 3J26N 4AK3A 3ZXDA 2XQRA 5CVRA 3L2HA 5C4WC 4OPAA 3AG2C 5HPOA 4QWNA 2HWF3 3ES4A 2ZR2A 2RJKA 1WB8A 2HWD3 3CJHB 1K97A 1B6QA 5F9TA 2PHRA 5B1AB 4PJYA 3JYCA 3U4XA 2UUCB 3C3SA 3WB2A 3VBHA 2JIZG 2EIDA 1Q86W 5TSWA 2JD9A 4N43A 4X65B 1IS3A 1KXGA 4MZUA 3OW2U 2BTOA 2QM8A 3WW4A 3E8GA 1Q8VA 5CG9A 1JJOA 4YYOA 1RUH2 4N8MA 3M3IA 2GNMA 4HL0A 1P7BA 4LA3A 2UUBO 5JIAA 3PUAA 3PLQA 2RS11 4WVZA 2PGGA 2YI8A 1YJLA 1OHHG 1I08A 2LW8A 5CA0A 2NM1A 1CPNA 5F8PA 2HJDA 1HQNA 3ASOB 4LF7B 4ZY9A 5FZ6A 1I5PA 2B5HA 4QPYA 3MAQA 4XTPA 1NJIW 4D7YA 1W8NA 2E6VA 5CA1A 3AL6A 5FRAA 3BA9A 1BK0A 2HWC3 2W68A 1OQ1A 4UW5A 1KQRA 5FPUA 1EV13 2XAFA 4GZ9A 2A5ZA 1J83A 2F1MA 4AG4A 2JICA 4CUGA 3HN3A 2P6HA 1DG6A 5B4NA 1XDCA 2JVDA 3SR2C 5FYMA 3CMEV 1XOUA 3DTUB 3U1XA 2QUOA 4DRXA 1Q8IA 2BQPA 2AGAA 2GC1A 4XFGA 2GP5A 1ND3B 4Q4W2 5FO8B 2ZGKA 4XUOA 2ERFA 4QDSA 3T09A 4XFFA 3EO6A 4GB33 4TUYA 3WP5A 4GJZA 1BCXA 1W0KG 1SBEA 4RQFA 1UWWA 4MX3A 2UUAO 2BV4A 3THPA 4C1XA 5I8YA 3HN1A 1FJGO 1YFXA 4UAPA 2O14A 4IEXA 2D44A 5BNQA 1Q43A 5HFMA 1AR63 4CEWA 2GNBA 5EJ3A 5GLZA 1SLLA 1QEXA 2HKOA 5IUQA 1ZBE1 4AFCA 1TZOA 4S2FA 1Q90D 2E31A 2D3RA 4HANA 3SPGA 4XILA 4XETA 2HWB1 3MIGA 1PNLA 3JAWA 4BQ2A 1VRH3 4Y20B 4UVAA 5J2UA 2R1BA 5EFUA 3WG4A 4NVPA 1BE3H 5I0UA 1SDDB 4EFBA 4OI2A 3WDVA 5ISLA 2E5LB 4LF9O 5L3CA 2V5YA 1W2NA 3VZLA 4IV3B 4UF0B 4ZKIA 5M0TA 3MLKA 2EIEA 3DYMA 4B3MB 1URXA 3MV11 2WLJA 5FOBB 1W0JG 2AW9A 1W2AX 1OLRA 3LFIA 4YJ3B 1LOGA 4J25A 2B1IA 4BXSV 1C1LA 1G9BA 1NUKA 1XRUA 2P67A 4R9AA 1O4ZA 3QVNA 2OKXA 3WG7B 4LKEA 2EVXA 1DYOA 4LCUC 4NRPA 5BR8O 3H8XA 3G6JB 1VIBA 3G71V 4KG0A 4D69A 4DUVA 4QXHA 2JKBA 5F2WA 5HV0A 4LF4B 1RVF2 3K06A 3ZFFC 1BYHA 3IIAA 4CDWC 5B2GB 3E5UA 3VBBA 1ZYBA 3T4HB 1LKNA 1OLME 1W2TA 2W1WA 4YW2A 1MEC1 2LALA 3UGHA 4TTGA 2A79B 5IYDO 1PVC2 3T2PA 5IYZB 4D7SA 1QXPA 4YJ2A 5J48A 2WLMA 2GN3A 4YM3A 3WP4A 2MEV3 5FYBA 1RB8G 4CCKA 2W3JA 1JPXA 4JRAA 2VY0A 1ZSPA 5GW7A 4Z8BA 2V09A 5E88A 1JYWA 3WW2A 1GZWB 4DUZO 4CEYA 2VOKA 4AEKA 4XZUG 1DU3D 1TME3 3IDEA 2WS92 3C7OA 2ZD9A 3AMMA 1M4WA 4MVZA 2E74B 4KHPO 3KHBA 3MYXA 1FATA 4ZPIA 5FYCA 4EZ4A 1CWPA 5J1XA 4CDUA 3JBG1 4B8EA 3BEHA 3JCUZ 4X1IA 4QX0A 1U96A 4IHJA 4LBQD 2OIEA 3SEPA 4UCUA 4UBHA 1H4GA 1KFXL 1M1KW 5JMCA 3C3TA 4LFBB 1ZX3A 2EJ7A 1SCRA 1OZ0A 3THOA 1MQTB 3WT3A 2QM4A 1DZTA 5DMYA 3DUIA 4WBBA 4ZIBA 2OQ7A 3WSOA 4Q8LA 1H2SB 2B9ZA 1ENSA 4DR4B 2CWSA 5AVAA 2J7MA 4CC6A 2WQZC 2GAUA 2VZRA 2IXHA 1KITA 2Q1ZB 1CAWB 5DDJ3 4JYBA 1HIXA 3I59A 2FQPA 2ZGLA 1W6PA 1VQPV 1KS5A 3LA7A 2VO5A 5KWRA 4J1XA 3H8UA 5IVFA 5DAPA 4MT8A 4J41A 3KG2A 4IEVA 2GUZA 2WNVC 4QKNA 1ULPA 4K0KO 1BMV1 4MGSA 1FD9A 1WCKA 4H3WA 3AYAA 4QE9A 2JG9A 3NAPC 1OOPC 2HWE2 2JENA 1RUE2 3K46A 4FLZA 2EXHA 3LEMA 3O1VA 2OZJA 2WBKA 2L6LA 4UXAA 1MR5A 1JX9A 3G6BA 2ZGRA 4M3CA 4H0LB 3SYOA 5FPAA 4E2GA 3ZMUA 3THCA 1DZQA 1SBFA 5HXVA 5LBBA 5K7PA 1ULDA 1Y9GA 1JXNA 1GK9A 3OR7C 3I56V 4X6QB 5CMUA 2XT9A 2WQ4A 3LAGA 2ADDA 3OD4A 1R3IC 4PIYA 1WCDJ 5BY1A 5T54A 3LDCA 2I2SA 2EALA 4R4ZA 2ID4A 2R72A 2XXZA 2CUGA 3EB7A 5CFDC 4DFSA 4CZZA 4JTAB 1FMD2 2H3OA 2IXJA 3HBZA 5JLVA 3BIEA 1OC1A 5IJRA 5LW9A 1P8JA 4BOWA 4I4TA 3BYWA 3OUJA 3AK2A 3WNXA 3FYEB 4OZOA 5ACA3 1R081 5A3MA 1GO3F 3G6EV 3WNMA 3MZHA 3J7HA 4FK5C 2XKPA 4GD4A 3AG3C 3OPWA 1GN2A 1S77D 1CX4A 5JXJA 1OH3A 5C8CB 2XAQA 4DS0A 3O5SA 3ZMVA 4MVTA 1PX3A 2JJ1G 3WHUA 3VBHB 1L8DA 4MG2A 3D8CA 3WP6A 4N43B 3VBRA 4KUMA 1C4RA 3L71H 4RFT0 4URTA 1JN2P 3KT1A 4HN0A 2WAOA 1IKQA 2ZGTA 5EZWA 2PA7A 5F3CA 1GTOA 2E3CA 3MICA 1XNDA 2FMDA 3KB5A 2YIAA 4QPWA 5J37A 4ZI7A 4XF4A 2ADEA 2VMCA 1YHQV 2P3IA 4Z1MG 3B69A 3ZN5A 4FLVA 1EY2A 4K3UA 5LEKA 3TXSA 2X0LA 4H7MA 2Z5UA 1YC61 4XF3A 1IS6A 2MW2B 1O4TA 3W7SA 4PCRA 4AE2A 2P6CA 1J3QA 2DYCA 3IDCB 1QNWA 1GZTA 1X8EA 1RYYA 2FCUA 5CA1B 2YXSA 3VB9A 1XU1A 2GSMB 2QA4V 5J3UA 4QM9A 4JX0A 4META 3B4SA 5IK4A 4GJYA 2DTWA 1SQPH 4BJ0A 1H1AA 3TEWA 5BMVA 1PIV2 4ATEA 3KLSA 2JJ2G 5CB7A 3TAYA 3VBFA 3MLLA 1SFYA 5E8AA 3ZFGC 3OD0A 1N1YA 2Y69C 5FMOL 1DZRA 1HR0B 3R4SA 1Q6IA 4DRXB 4IV1A 2C6SA 1H2NA 1M5IA 1VQKV 1OCOB 2WN3A 1V55C 4LORA 2JWPA 1UOFA 3J80N 4Q2FA 4TUYB 1RFYA 1AJPA 3DGEA 2BVBA 1FAFA 4MVRA 1DLLA 3RVYA 5C3RA 3ON7A 3E35A 5FPOA 3AP5A 3Q8FA 5T5LA 5FZHA 1OHFA 4MVMA 4XF1A 1OURA 5DQ0A 1W6NA 3EJKA 4CEWB 1GN3A 4QGLA 4IL7A 3O12A 4O65A 4FZ0A 4OHWA 3VV1A 3EHKA 3P1IA 1UFIA 2VU9A 3ACHA 1K7DA 1AR83 2RS31 5A7WA 1OA3A 1V00A 3B00A 3BOWA 4U3JA 3JAWB 1CD3G 5LYJA 3LD8A 5J2UB 4XURA 2GP3A 4GUNA 4XJWA 5FYZA 5IHRA 3CXHF 1KYOF 4LH6A 4PT6A 2VZTA 2RM21 1TUBA 4JAUA 1W8TA 1W90A 3C7EA 2B8MA 3VDCA 2ARHA 4XMIA 4Q4V3 3DN7A 5F39A 1WA6X 4BCUA 1W8FA 1NVPB 1UD1A 1XMOB 5BZBA 1LEMA 3M8AA 4YLZA 5DG2A 2AXTZ 4GALA 3JD3A 1OA2A 1JMKC 3T1YB 4GAZA 4YW7A 2R0FA 1LRHA 4DPNA 2WUHA 1QJX2 1N0JA 2WWWA 1AX1A 2Q4SA 1R092 4YY3B 2CY6A 3JQXA 4CVUA 1LHNA 3NNJA 5IVCA 5KC6A 5FZBA 4AHWA 3UK9A 4X62B 2C9AA 4LULA 3V65A 4RS5C 1QJU1 3K3NA 5AFEA 1XNRB 3HEIA 1IG3A 4TSFG 4NHYA 1FXZA 3AK1A 3POEA 2IM9A 4XUNA 3H1YA 3JATB 2ZGNA 1NU1H 1CEZA 4CC5A 3AYCA 1VMHA 4W6WA 5F5QA 5A33A 4JPRA 4QQHA 4BXFA 4MGZE 4XC9A 5EBLC 4J9YB 3K2OA 3O1MA 3CRRA 2YXYA 5E6HA 2BYVE 3SCGA 3H1JH 2Q1MA 5B1AC 4UV8A 2RQ6A 1V70A 5LBCA 4I5SA 3RYFA 4L9BA 4Q1PA 3POWA 3T2OA 3SKVA 2CYFA 3SXWA 3OGRA 3ABTA 1X8MA 4B1MA 1K33A 2JB8A 4QQ2A 5T50A 5DUUA 1VBE3 3GM8A 4HPKA 3ACGA 4G2KA 3FBYA 4LXLA 3ATGA 4CDUB 4J1WA 4QB1A 4K3AA 1XSRA 1UZWA 2K9ZA 4X1IB 5KHIA 1UOGA 2Y0IA 2ZT9B 4IHJB 1R6KA 4J11A 3NO8A 1AL0G 4AL9A 4LF6O 1ZBA3 5A3PA 3IFXA 4JI0O 2ZXQA 5SV5A 2VECA 2WDBA 3UV9A 5AVPA 2C2AA 3U78A 1ENRA 1J95A 3OEEG 3ASOC 1EAH3 5GLVA 3VBSC 4I9QA 2BGOA 2R1DA 5FKBA 1GFF2 1VF6C 5JCOC 1LHOA 2GDFA 1SKVA 2QKSA 1K45A 1JYNA 1LGCA 2WABA 3L70H 1JYIA 4D7TA 4LJHA 5KXDA 3WCRA 3O14A 1CPYA 5IK8A 4GKJB 4OUMA 4PV1B 1Y76A 3CB2A 5L7OA 4DV4O 5FYUA 4ZZ8A 3I59B 1ZTEA 1W03A 3IDAA 1W6PB 4LBQA 5EZYB 5IFPA 1AL21 5CB4A 2DF7A 3J7LA 2ITDC 4EN0A 3FX3A 3KF3A 4IEOA 3V0AA 1M56C 3TRSB 4JI4B 4ZKTB 2GUZB 2ZEZA 1JCHA 5EIYB 5A3UA 2JG9B 5C6CA 2F4VB 3WNOA 2WO3A 3I49A 2J1TA 3PVNA 3VZMA 4XFHA 2X09A 3IN9A 3PVOA 4M3CB 1J3PA 5IE9A 1Y4WA 2ZTNA 3RI9A 3LNNA 4BLJA 4GH4A 3UYJA 2WLPA 4XFIA 2GH2A 4MH0E 1YJ9V 5I91A 4P9IA 3VDDA 3ZX6A 1R1ZA 2DWDC 1IQDC 1Y3TA 2RJ2A 2DUPA 4CCJA 1MZEA 4DR5O 3MLJA 4JGZA 4QT6A 1WLWA 2ZKOA 4L2NA 1XE0A 1AYM3 3POFA 3OEAA 4RUEA 2QQIA 3RWRD 3SKJE 4CP1A 2H8PC 2WZR1 5JR7B 1BLZA 1W8UA 3ILRA 1PZ7A 1TVGA 4PBOA 5HCBA 2E9QA 3PJQA 4IV3C 1JU3A 1BZKA 3RMXA 4I4TB 3RN4A 1DQ0A 3FLTA 2ZHLA 4CH3A 1PO22 4OZXA 2DCJA 1N34B 2VCBA 5K0UA 2P3JA 5FJKA 3T1MA 1H2KA 3M3OA 1DGWX 4P9YA 2DBIA 4IESA 5FP7A 4LF5B 5FYHA 1HRV3 1BHBA 4FMTA 4YZ3A 2H0BA 3MIBA 3SJAC 3RJ2X 3AK0A 5GLWA 2EBOA 2V73A 4QXKA 3AL5A 3CJXA 3KZIZ 2XDVA 3V56A 5E16A 3OGSA 1XHXA 1WGPA 4LH7A 3VBRB 1AXYA 3HOBA 4RWUA 1XC6A 3AG1B 1SBDA 3EXAA 1M9NA 3HQUA 1RINA 1YEWA 3H8RA 1A3KA 1XL6A 1L3JA 4JGYA 3D3AA 1BVP1 2ZGUA 1UYPA 2CDPA 2B9UA 3WW3A 3NNLA 3SPJA 2YYOA 4ZI7B 4O2AA 1DQ5A 1NCQA 1XBFA 4YIPA 4LC1A 2QQLA 3F7YC 3O1RA 3A2FA 1HNZB 4JI1O 2W39A 4CU6A 2DQ3A 5APAA 4WFFA 1DK1A 3PTYA 2BNOA 1UU5A 1F15A 3CKHA 4XZPA 2YY1A 1R6NA 5FCCA 4Q4X2 3ZYHA 3ABKB 4R8HA 5SV8A 1CGPA 1Y67A 4A6OA 4DO2A 5LBFA 1CR7A 1XHZA 1YFUA 4QGNA 4MGTA 5EYPA 1YDXA 2CTRA 3LDBA 4Z82A 1XPWA 5TISZ 1NT2B 5BMVB 2HWB3 5FNVB 4GIQA 3J9SA 1DQ1A 5A3LA 3UGFA 4K1YA 1JVMA 1O8PA 2YXHA 3VBFB 1UMIA 2VVDA 3PUHA 4UXNA 4HVOA 2CAZC 4QU2A 2AC1A 3GWOA 1AR71 4GZRB 2Q73A 3FYIB 3JQWA 4EN9B 2X5IC 3UKTA 4CBCA 1FFTB 5HFLA 4P9JA 1AHSA 3ZXEA 3VBUA 4NHMA 3URFA 3DYPA 4DR1O 2WNOA 1I5XA 4EN6B 4GX1A 3CF6E 4LBMA 1D4M3 3N7KA 1PZ8A 2CL2A 1GZ9A 2UU9O 1W6NB 1GH6A 4WZCA 1E5HA 1OJHA 2R9AA 4JI8B 4R9CA 1KC8W 5A7OA 3TETA 1BVVA 1SQVH 3W7XA 3NR7A 1MEC3 4JHZA 5A7WB 1VQ4V 4U3JB 1E5IA 3NKGA 4BQ1A 5FUPA 1VBC3 4ES9A 3NNGA 5LA0A 4FBFA 1IURA 4Y1VA 1FOD2 5FZ3A 4KXRA 4LWSA 2UY9A 1VAKA 1Q6UA 2E7AA 2YI9A 4PIZA 1R1BA 1TUBB 1A78A 4QX8A 2ET1A 4YM0A 3ZN0A 1OVPA 1BEV2 5FO9B 2P5BA 2UXBO 3OMNB 4ICGA 2Z0AA 5LA6A 5GZEA 5FXXA 1AI4A 4KWJA 5EYYA 2AHZA 4ASMB 3CYOA 5KHHA 4PA3A 2XPJA 4AEJA 1DLCA 2BP6A 5L73A 3BU0A 1JS9A 3UO3A 2Q8EA 1D2DA 1YIPA 1VMFA 1REDA 5FZ4A 2Y6GA 1ROPA 5C8YA 1FFXA 1GKBA 3MUZ1 4B4PA 3RYIB 4LF8O 1C57A 2EX3A 4CDXA 4FT8A 2PHTA 2VUJA 2OTJV 2IU0A 1KJRA 3CDZB 4UWDA 3E2EA 1B04A 4QJFB 1JH5A 4DMIA 3B40A 2ZAAA 4NXNB 1LR5A 4RFRB 5A33B 2EXIA 3I2FA 2A3QA 1N33B 5EP9A 3X29B 1FYJA 1NT0A 1XMQO 4LUMA 4BWOA 2Q8CA 3K48A 4BQYA 3LPFA 3LSQA 5CFCA 3I2HA 3GYDA 5C8CC 1YIFA 4CH6A 2QJVA 4AVVA 3T3YA 3S30A 2OUJA 3RYFB 1FXKC 1S0JA 1GOHA 1EN6A 2ZIOA 3VBHC 5FPVA 3CCUV 2XVKA 4OMDA 3ZYJB 4QM8A 4N43C 3CPWU 3GBWA 5LL6Y 3CNAA 3JD72 2XNDG 1WLEA 4XAAA 4HPKB 1ACCA 2EINB 1ZX5A 5A3WA 3A0KA 4DXSA 2JB4A 4YVSA 4HYOA 1AR1B 3NNMA 4E4EA 1ZL8A 3AG4B 4AYUA 3POGA 4KWUA 3FJSA 2Z5WA 1YXWA 1HW5A 2R073 5GKAC 1RM1B 1SQXH 2CTWA 4N9IA 2E51A 2NZ9A 3RZJA 4DR2B 2WAMA 4WF9V 2VWKA 2OIIA 1BSMA 1RUH1 4I9WA 1S76D 4WFHA 3H0OA 5IT6A 3H1WA 1E57A 5EPAA 3J4UH 1W0PA 1C8NA 4MSWC 4A7KA 1US6A 3R4DB 1F8VA 4N7UA 1JZ6A 4FM2A 2XJUA 4OUSA 1H6XA 1FNZA 5F5AA 4EEQA 4JI2O 2PMWB 1Y76B 5JSPA 5L7OB 2W94A 2FZ2A 4XPVA 2OPKA 4LBQB 4YNIA 4S2GA 1RMU2 5CB4B 2BW8A 4P9XA 1SLBA 3V0AB 1WP8A 2VRZA 1DGSA 3JD0A 4YVWB 3Q9OA 3ZPOA 5LCWL 4OUEA 3AKQA 1R083 3OY8A 1WCSA 1OCOC 1ORQC 1NQJA 4S2HA 1NZCA 1Q8PA 1IHMA 2XBO3 2X29A 1WCQA 4ARYA 4HOOA 4OX9B 3LFMA 1IXMA 2VNVA 4Q4W1 5FXWA 1F51A 1V6KA 3VDDB 4CXWA 1WB7A 1JZ5A 1C8M3 2HHHO 3ZHTA 3OBRA 2VS0A 4JGZB 1Y7BA 3HT1A 4KI5M 1IS5A 1GOGA 4LP8A 2GTAA 2VTXA 1ZLZA 1VB2A 1US2A 3LA3A 2TNFA 3DYOA 4NAOA 3ZSEA 2ZINA 1WD3A 4JAVA 2YU2A 5JJJB 4CP9A 4JTOA 3W7TA 4PDVA 3PN1A 4GB32 2RV9A 1V9PA 3BODA 3FB8C 5K0UB 5CYYA 2CU5A 5E1AC 5LEJA 4I2OA 1F4MA 2ZHKA 4IEYA 2JDZA 2WT2A 4DXRA 1I3HA 2ZMNA 4JGSA 2JG8A 4Y4YA 2HEYF 4JCKA 5KA5A 1LODA 1MSDA 2P3YA 2AYHA 3ZN4A 3KV4A 3ZFFA 3L9JT 4FIPC 3C7FA 4DR6O 3ZHUA 4K6BA 4DNYA 2Y64A 1Y43B 3JD2A 1V6JA 2R9RB 3T0AA 1N0NA 1LHWA 4LNUA 2H94A 4UVCA 1BQ0A 4JGYB 2OWOA 5A6ZA 2DYRB 1PKXA 1HB1A 1RVF1 1UQXA 4DY5A 4O2AB 1NCQB 3K0GA 3T2TA 2R16A 1R64A 3UL2A 4K1ZA 2E76B 3DKQA 4Q4Y3 5IY5B 2DFCA 1UXZA 3AVRA 1PVC1 2PFWA 4E2SA 5T5PA 4DV3O 4SBVA 2VQEB 4YHHO 1MS8A 1Y74A 2JDYA 3TB0A 4JHTA 3I3EA 3ETDA 1UAIA 3I2KA 3AP7A 3ZMNA 3L73H 5EYPB 2VUAA 1GAXA 4CDUC 5L19A 3N3HA 3SMHA 1SHWB 2RS33 4XDOA 4FVMA 1ZUQA 2BWAA 4JI7B 3U37A 2DBNA 4H33A 2PHUA 2IU3A 2D97A 3ABUA 4AQTA 2HR3A 5JXGA 3K03A 1UO9A 2MEV2 2PYLA 4CE8A 2PYJA 2VZQA 3JD4A 1AXZA 4ASKA 5FBZA 1GQPA 1KRIA 4RO2A 4DK0A 4FPKA 3MIHA 1RTVA 1S2KA 1OBNA 2PELA 4O9GA 3CCEV 2TEPA 3D0JA 2BFUL 5GM0A 3QOPA 4B3TB 5FLHA 4LTAA 3VBUB 1QDCA 3H3ZA 3N7MA 3KCYA 1W6MA 1NA1A 4JV5O 2RDCA 1TME2 3GJAA 4UV9A 1O91A 3SJBC 5C3OA 2CV6A 2Y34A 3QO8A 2QFEA 2XR4A 1UZ0A 5IWAB 4JYAO 4LE4A 1NAEA 1QDOA 3ZXGA 2DVFA 2DVAA 3WF0A 5F1RA 1OOPA 2JX9A 2HEWF 4LWSB 5BYNA 2RS53 4YZ4A 4UCVA 3I5DA 4AVBA 5JPMB 4LFCB 1KP3A 5ABJA 1ZAUA 1W2UA 4N7IA 2F43G 4DR7O 5LXTA 1OF3A 1PL4A 4AVCA 2PF4E 2UUAB 5LA6B 5DDJ2 3KQ4B 2HWE1 1QGLA 1RUE1 1ZRFA 3F95A 1BBT3 1FJGB 3WDTA 2JGDA 3DPRA 3SH4A 1OUSA 2OW4A 3H1IH 2BBVA 1ZRCA 3T1HO 2WLKA 2YC0A 2WZ8A 2ZABA 5C8YB 5CFDA 4CDXB 3ZYIB 3SHRA 4AQ2A 5FR3A 3D82A 3IPVA 1I0HA 1AJKA 2GDSA 4LQRA 4BW9A 4B4QA 4FM0A 1XJAA 5CZKA 4XDJA 1SLCA 2OA2A 4I02A 4L87A 1LNQA 3AG2B 2BGCA 2RVAA 1CZSA 3OJBA 1QOOA 4M0NA 1FMD1 4MTFA 4YM2A 2O8QA 5CFCB 1QH6A 5C70A 4JQRA 2GHYA 1K73W 5D8AA 5C93A 3RFRA 4EROA 4AVSA 1BXHA 3J8F3 4Y3OA 2Q67A 3WDUA 1V9U3 3THTA 4LBNA 5LMUO 2NPIA 3AG1C 2WIIB 2GH8A 2XUEA 5KUMA 2NYYA 1O5UA 2Y0PA 2CE4A 2QQMA 4YVSB 3S7EA 1SRYA 3C2UA 1Q3EA 1ZL8B 3A21A 3ACIA 3UQ8A 5ANNA 1W0OA 4YWAA 4GX2A 4LK6A 3I2GA 4HK9A 4O4IA 5FPRA 2GBOA 3ZYPA 2V5DA 2KSDA 4NHKA 4Q27A 4JZGA 2OT7A 4WCEV 4L8JA 3CCQV 1VR3A 2XHNA 3GWKC 4BH9A 1CX1A 1ENVA 4JI3O 4DV1B 3ABKC 2DQ0A 2VMEA 1NR1A 4DUZB 1XQNA 3F5WC 3MV01 1YNAA 4IDZA 5FZIA 1GMGA 3WU2Z 4EE2A 1N36O 4TV8A 5FPZA 2Z2SB 1JR9A 4CH4A 1ULOA 3RG0A 3HB3B 1XQ8A 2PI4A 4AGRA 3CC2V 1CQ9A 4P9OA 2IUWA 2XAJA 3VLBB 4D6SA 2VZUA 4WVVA 3M4FA 3AKSA 1VIWB 1WWYA 4HSJA 2WZEA 1VQ7V 4ZHQA 2BNMA 3OY8B 1PIV1 2W1QA 3QH6A 3U4SA 3BVOA 3U14A 3TBDA 3RGBA 4QNHB 4Y33A 5C8WA 4WVMA 3A0BZ 3E6CC 5FUNA 2BU9A 2N7GA 2WAAA 3WEZA 3E6BA 2CGNA 5LB6A 1MABG 4M3CF 1GANA 1RC6A 2VOVA 3E8FA 2YV8A 1JA8A 3VGIA 3ZO0B 4AEDC 5H5NA 1VP6A 5JSOA 1QQP1 2JD4A 2QE3A 2VCMA 3AFGA 5LRRA 5T55A 5CAZA 2CAUA 3O9OA 1ULGA 4G27B 3NKTA 2AREA 2XWBB 1Y9MA 4FTSA 2WSSG 2B42B 4J6GA 2ZAHA 1EM1A 4CP9B 3EXUA 3KCCA 3SLIA 5JQGA 2J1AA 4W6XA 5EC1C 2DN9A 5FP9A 1XYPA 5T3NA 1F5JA 3H9VA 1VQOV 4YW6A 3OTOO 4E4ZA 1K5JA 2ZHMA 2Y6LA 3CEIA 5FZKA 1W3VA 2JG8B 1XL4A 1H8VA 5FXZA 3MHHC 3FB6C 2QDOA 5GALA 3BPZA 5L9RA 5C3QA 4FAHA 3ZFFB 4BQWA 3K79A 4UCRA 3RDIA 5F32A 1NLQA 2HVKC 3MO4A 4BQXA 4CUCA 2FDFA 1AR73 1HJGA 4LNUB 2VG9A 1V54B 2Y60A 1MSWD 2EIBA 5LBQA 1T6BX 1R3LC 3OGIB 1AYN3 4Q4V2 2CH7A 1RSOA 4XJUA 1RUC3 4MXVA 4DXZA 1AJOA 1R1A3 4ZBMA 5IVYA 5DZFA 3CMGA 4AFDA 3G7DA 2YUEA 3AX4A 2VR4A 3BOPA 4MHUA 2GMMA 3RYKA 1Y74B 1G4YB 1TEIA 1LJ7A 2D43A 3K9AA 1BKZA 2V1DA 1DHKB 4QX1A 4GKKO 3PU3A 2EINC 4JDMA 3N9QA 3SPCA 1HNXB 3A4UA 4AILC 3KZ4C 3JXSA 4XAEA 3BA8A 4CRQA 2CK3G 4J7ZA 2MK3A 3I2IA 5F3IA 2LO1A 3AG4C 2D5FA 3LOIA 3VOUA 2G9ZA 3K9SA 2GSYA 5CBLA 3I2OA 1RM1C 3FN9A 3CIHA 4GWMA 4C90A 4XXPA 4CS4A 4I0WB 3LSEA 2ZX1A 4XCBA 2UU8A 1Q8QA 3VBSA 1UY0A 2X6CA 1S0FA 3SPHA 3B94A 4FFFA 4YG3A 1UIJA 4IGQA 3OTFA 5JCOA 2VTFA 4QD2A 5FZFA 4TV9A 3CWBH 5L9VA 3ZPYA 1W6MB 1O9GA 4TQDA 1NA1B 4H55A 1F5FA 1OLQA 3SJQC 4DR3O 2XASA 5L7OC 1FV2A 2IBZH 3N9OA 2JDUA 3PVBB 3QCWA 1PMHX 3POIA 2W87A 1RIRA 3T4ZA 3NNFA 2K1EA 5A6XA 1DQ6A 3FKSG 3ETGA 5HCHA 3GVMA 1ZBA2 2A3WA 4YVWC 2ZCWA 2NMNA 2A6ZA 4CUBA 1OF4A 4Y1ZA 3DXUA 4A7ZA 2PZSA 1OOPB 2QTWB 2SBAA 2WWSA 3QD6A 2Q8DA 2EILC 3AK3A 2VW1A 4EWDA 1CVNA 1IVSA 3K57A 4B3MO 5K4LA 5ABJB 3HPLC 3WLUA 2R042 5LXTB 5KA6A 4OHXA 1DYKA 3N36A 2YGLA 2WZR2 2JIJA 2WLLA 2VJXA 4AGVA 4X6RB 3VDDC 3ABMC 4JKMA 3W5NA 3B77A 2QQNA 2JGDB 1LB2A 1JHNA 3DPRB 2QCSB 4PA4A 2UYBA 4BIFA 1SPPB 3I3QA 2HVJC 3CRQA 4KG8A 5CFDB 1AR4A 2DOSA 3OUIA 1H4HA 3NV1A 2VCAA 1AROP 4BWAA 2GALA 1J1TA 1HKDA 3IPVB 4QXCA 4X64B 3ZX7A 4DQAA 2DWRA 3HKEA 1ZZ6A 1RUH3 4EWAA 2PHLA 1RUG2 4WM8A 2BOIA 4TQFA 2VOXA 1NE4A 1OCCB 3CRCA 2ZGOA 4BIZA 4OVEA 4KFMA 3SJCC 3AG3B 3O1OA 4RYDA 2WLIA 5D8AB 2VQAA 3AMNA 4QKBA 5FYIA 3F7VC 4NYKA 1WJZA 1HN0A 4NXMB 1PO21 1COV3 4D6TH 2EJRA 1AYM2 2RMU3 5JH7A 4BE3A 3WF4A 1APNA 1VBD3 2EAKA 3ITQA 4N9HA 4OMCA 3N35A 2W95A 3KHCA 1JMUB 5LZ6A 1PNMA 1EBOA 3B5LB 5FZDA 1KQSU 1DGLA 5DAQA 1NTKH 4PIXA 3FX7A 4B3SO 4NTXA 1Z5VA 2ZE7A 4R7CA 2P3KA 2VNRA 4DUXA 1IPKA 4DXTA 4ZS3A 4JGYC 5IYZA 1S0GA 2VD7A 2HYKA 2DYRC 4MV2A 4NN0A 2FMYA 4INDA 4FOWA 3SQOA 4O4IB 1NCQC 4AQYO 5IWFA 4AHCA 2YBPA 2R9IA 4JTDB 3K59A 1NQTA 5FXVA 5IY5C 3O1PA 1Q81W 1A6CA 4UFIA 4KNCA 3OCPA 1Z78A 4P14A 1GQHA 4DV2O 2HKXA 3JZVA 2OCHA 3PUIA 3RRDA 1XREA 3TEZA 1KP2A 5C9AB 4DR4O 2ZMLA 1ZVFA 1XB9A 2DE0X 3UKMA 1AXKA 4XHBA 2D6PA 4EQVA 1YO8A 2FDIA 2I07B 2EIMB 4XJ8A 4TV8B 4BR6A 3FUOA 3ZYRA 3CO2A 4XDQA 4YZ1A 3JALA 4Q4X1 3WUCA 1W2BU 3O1UA 1JYXA 2YBSA 1IQAA 1HLCA 2Y69B 5IYCO 4HFSA 1ZRDA 5JVVA 5JJEB 4LF6B 4YIOA 4EKWA 4ZHQB 5JSRA 2ZACA 4JI0B 3KVAA 5LGTA 2X5IA 3LQCA 5L3GA 5H9SA 4LO8A 4JF3A 3ZDSA 3I8TA 2Q9LA 1CN1A 4WVMB 3VBUC 2OX0A 2TUNA 2BGPA 1CP9A 5EBWC 1AUYA 2ZE5A 4ZOLA 2FHRA 4RHV2 3O7OA 1OI6A 4XJZA 1PD3A 2B45X 2F95B 1PO13 2DVBA 2YG0A 4IE0A 4LBOA 1H1IA 2WC2A 3D3QA 4DV4B 1QHDA 1NKGA 2XHBA 4CCNA 1M93A 4FP2A 1Q7YW 2NLRA 5EIBC 2X7RB 4NAMA 1E5SA 1ZWIC 2JS5A 1HV1A 5FMCA 2WA3A 3ASNB 4R9DA 1RVF3 4NPLA 4OHVA 1PNGA 2QBXA 1GKFA 1AJQA 3S3XA 5DZEA 1S55A 4JZRA 3RYRA 3POYA 3FUQA 5CISA 5JQGB 3RPQA 3FAVA 1QU0A 3RMYA 1PVC3 3K4AA 1RUJ3 1GN6A 4FFKA 1QJY1 4PDWC 1MACA 3P6BA 3A0HZ 4KU8A 3EFFK 5K9YA 2XG3A 3HT2A 3ZIAG 2RDRA 2WFPA 3O1TA 1HB3A 1IX9A 3JD1A 3OB8A 4CDQA 1KB9F 1XU2A 3O65A 1VRBA 4JTNA 4DR5B 4MGKE 4CDXC 4XTMA 2OVUA 4MLOA 5EHDA 3BY6A 1VBC2 5A1AA 3CHXA 2P1BA 2WS93 1H9WA 4R4XA 4IE4A 5AC92 1UU6A 1G6NA 4MO3M 2QDNA 4XDLA 1W59A 5B5EZ 4COWA 1KKDA 4ITCA 1JZ3A 2CH7B 2NN8A 1RSOB 2WNEA 2JXAA 5KLVH 4GWIA 2ADQB 2UWBA 5CFCC 3PUSA 2Y6KA 5I8SA 3S6PA 4X8AA 5C8CA 1JZ8A 1POV3 4MS2A 2R49A 1FXKA 2BWCA 1IDSA 1VAVA 5FYVA 2SLIA 3UT0A 1YLLA 3WUDA 1VBB3 3KVBA 3SYQA 2VNOA 4UT5A 4CU7A 1US3A 2YBKA 1TNRA 1K9MW 4QPGA 2RDQA 4CA9A 2UWAA 1H6YA 1W3XA 4YVSC 4XBQA 1EZVH 3U0ZA 3T4DA 4E27A 4S2DA 3MD0A 3C7GA 1M06G 3WB0A 2P37A 4UOJA 2XVLA 1HR0O 3JD71 2V4DA 5DM6V 4D94A 4AI3A 2Q8VA 5FZEA 3DGTA 2PHXA 1EFRG 3VBSB 4BK4A 3UKNA 1Z2GA 1NQDA 5FY1A 1ULEA 3GDBA 2E75B 4TV9B 5JCTA 2PHDA 3MW4A 3STZC 1FI2A 2CHHA 5LK5A 1VQ5V 2EA7A 1MS9A 2HWD1 3ZHSA 2IXIA 2ZXWC 1RITA 3PURA 1C1FA 3OMAB 2QDRA 1Q8SA 3VQYA 1UW8A 1RUD3 1W8WA 5FV3A 5C3SA 3IC7A 4IERA 3OAAG 1HNWB 3A8TA 2VQUA 2ZQMA 1G7YA 1M56B 2ZGSA 5JAXA 3BGAA 5CN0A 5DAXA 5FO7B 2FMLA 2HP8A 1VB4A 3USSA 4MTXA 2A0LA 1RMU1 3H42B 1E5RA 4CU9A 5GJ6A 4NR1A 2WLHA 2XAGA 4A3XA 1UX7A 3M99B 4IXLA 3WF1A 1S72V 1PGSA 1ZRIA 4I7ZB 4DR1B 2WLLB 3VD9A 3IGAC 3ZR6A 2OPWA 3WCSA 4XCAA 3ZKUA 1NS1A 4XFAA 2JRIA 4IIJA 2D5HA 2HLEA 1VLNA 4LBJA 1TMF3 4AHYA 2LQTA 1U0AA 3ST7A 2WSVA 1LGNA 2CTVA 1XE8A 4LBKA 2VOTA 4RN5A 3UGGA 3AZYA 1SFNA 3Q8CA 1MMMA 1ZZBA 3BPSA 1OV9A 4NROA 1VQ6V 3J81N 1LAJA 2XBO2 3HKEB 1F2NA 4GXLA 2F17A 2Y6HA 1XBLA 2WRAA 3HQXA 5IVEA 4WM8B 2DCKA 5IJ9A 1O9HA 2DCTA 3D6EA 4GQ7A 3BVCA 4LK7A 2WQ8A 4MHRA 4GWNA 5K1PA 3LOBA 2UXBB 3R65A 5IATA 2WLIB 3ACLA 2XOMA 2JG8C 4GB31 1C8M2 3QNEA 5FY0A 1JHJA 1HDKA 1VALA 3KT7A 4W4LA 4MOAA 3N2GA 3NXSA 5JH7B 1AR92 4O4JA 4Z2WA 3ZSJA 4D6RA 4GMP0 4EB6A 1AR61 4LF8B 4MADA 3ECQA 1OD3A 1V54C 3WQ0A 2YGMA 1HRI2 4I0XA 3JATA 1I94B 1SLAA 5FP8A 2X6AA 2A6XA 1PIV3 3ICXA 1KDMA 4X20A 3OM3B 4X8PA 1GMMA 1IBMO 1VRH1 3O0VA 4X1YA 3Q4HA 4W6YA 2D93A 4FXKB 2ARXA 4UUJC 1OUXA 1B3QA 3JCZA 3WINE 3PVEA 4XJ9A 2UXNA 4AI1A 3HD8B 3S5QA 1GM8A 2ZHNA 4NIIA 3WQ7A 4GKJO 1WW7A 4MSVA 4YGEA 1S0CA 2UYAA 4UYBA 5G04L 3TK1A 1KGYA 4OI0A 1GN4A 2HBTA 4Z2AA 1POV0 3LEKA 5KUKA 3JALB 1ZRRA 3ZN6A 2G19A 1HN1A 1WA8A 3ES1A 4YG0A 3MI8A 1P84F 5C5TA 3ZXLA 1IKPA 4P9LA 4Q4Y2 1J58A 1RHI3 2VCCA 2QQVA 1MVEA 2X5IB 5BXZA 3STLC 2WWJA 5FMBA 2XMLA 2B46X 4YARA 2WINB 2YU1A 1DP0A 4AVTA 1XI1A 2MEV1 1NA1C 2NP0A 4YPJA 4ZOLB 2BNNA 3CJIC 5FBJA 2WYFA 1X59A 5CA3A 3KGZA 2Q7HA 4FI9A 3HR9A 1K92A 4SLIA 3LKJA 5EZYA 3ZRSA 1POQA 4R8CA 5AG2A 2EZOA 5JI7A 2PN5A 1TME1 4OQ8A 4WVWA 2C24A 1QJX3 3K77A 1G9AA 1AVBA 2FDJA 3W7UA 4Q1RA 1R093 1DIWA 4L0PA 1R3JC 1L7LA 3QF7A 2ZDIA 3H1HH 4I30A 4UCOA 1SMVA 1M57B 2EIKC 4JI6O 2RCVA 3HNBM 2ZNJA 3LZZA 1H9PA 3E6DA 3SISA 5ABJC 1QNMA 2YPJA 3FAVB 3OFNG 4FPEA 1BHGA 4NRQA 4YM1A 1EN5A 4KH9A 2VMDA 1XYOA 3BALA 3KQRA 1OD5A 5L9BA 5FY8A 3TJTA 1OA4A 4A6SA 4KQ7A 3DPRC 4MVQA 2RMKB 2A3XA 2FZ1A 1TAEA 2ZX0A 3LIGA 2HHHB 2JDNA 4CDQB 2Y38A 4JI5O 4HONA 3K0DA 1CAUA 4JC1A 4NE9A 5DDJ1 3UO2A 2DDUA 3W9AA 2C5DA 2DU1A 4J7JA 3FBMA 3DECA 5DG1A 4XIKA 2VVEA 1YFYA 5A7QA 5HCAA 3I3BA 1HJFA 2RS52 1N3OA 4COZA 1EUUA 5A32A 2YSUB 4XF9A 1CJPA 5FWJA 2EIJB 4J9ZB 3WDXA 4MVSA 1PGW2 2XTAA 2UXCO 4F6EA 1OCCC 1U5YA 1GNHA 4LEJA 4CH5A 4Q6GA 3BRCA 2JKXA 3SYCA 3DEMA 1SEFA 3NL1A 5D8AC 1TQ5A 4E2QA 1QLEB 1S1AA 4BIOA 4NIHA 3WQ1A 1FXKB 4ASLA 3RYCA 1F23A 5CG8A 2XAHA 3C7HA 3QO5A 1DYPA 1F9KA 5H9QA 3NJXA 2WFF2 1UOBA 4AF9A 1IBLO 1L7RA 4GX0A 4QPGB 4XIOA 4DR6B 4G9SB 4AFAA 2AZ2A 1GLHA 2Z42A 4FFIA 3OMIB 2VBPA 4U3FH 1FPN3 3W59A 4LUKA 3SNMA 5L3BA 2FYUH 1YI7A 1ALYA 3RNSA 3SGIA 4ES8A 2RJLA 2YICA 2WSUA 3DKWA 1FAYA 1RPRA 2KR2A 5LP6A 4DUYO 1OCRB 4HN1A 4QGMA 1THZA 2QEXV 3Q8EA 1XUQA 1XNTA 3I4IA 3UCSC 3M7MX 2VXJA 3L74H 5C9AC 3D5OA 1B35C 3GJBA 3J8F2 5LHHA 3TXQA 3M3CA 1GNZA 1V9U2 4IW3A 2CWMA 3TN92 5FQ0A 2DCYA 1C3HA 2EIMC 3KF5A 2WLQA 3ENRA 4CSWA 1IS4A 4QPIC 5FNVA 4DV7O 1HB2A 4FPHA 3BTYA 4D8MA 1I7FA 4QX3A 3ZIWA 4EFEA 4DV6B 4JASA 4XVHA 3RQ0A 1GM7A 2RJZA 2WO2A 2W1SA 4O2BA 2A9HA 4MW3A 1S5JA 5EIBD 3ZS8C 4ABMA 1PNFA 3T1LA 2QQPA 1UMZA 2ZM6B 3QTCA 5A1LA 4FPLA 4COVA 2O8OA 3OUFA 2WPDG 3WG3A 5IYYA 2VQFO 3ZKYA 3D36C 4A3ZA 4FFGA 2NNUA 1QQP2 1JZ7A 4Q0PA 3LWCA 5H9CA 1OQDA 2E26A 3ZRWA 4LO6B 2D40A 3CL1A 4WFBV 1PO23 4YSFA 3INAA 4JV5B 2AEYA 2DCZA 4I3GA 4AEDA 2RDSA 2CNAA 1VP7A 1HXS3 1ZZ9A 4ZU5A 4PA9A 4IIJB 4IE6A 3N7JA 2XWJB 1JUIA 2VM9A 5CA6A 1NI8A 4DV5O 4FXGB 3UM7A 3IM0A 3E5QA 1YF2A 2AGSA 3IB3A 3ASNC 1SACA 3GBFA 3ZFEA 1UCXA 1LU2A 3NV2A 3T2MA 1VQ9V 1KFUL 1E79G 2E53A 5KHJA 4TWKA 1CZTA 4MVOA 4EYUA 5GLTA 1DGWA 1KMIZ 1VF5B 2A1XA 5IJ9B 3B2EE 3IIIA 2GMPA 2JE7A 1WW5A 1MZFA 3RYPA 2VNGA 1D5AA 1DCSA 1X36A 4RR3A 2IVJA 1YYNA 2BOCC 2PAKA 2F93B 4EJRA 2A6YA 4TLGA 2Q0OC 4KU7A 1H2MA 4CP2A 4WM7A 3N2GB 4X66O 5KBFA 3NMBA 4XQDA 1I9RA 4UI9L 4O4JB 3RYIA 3HVDA 4EB6B 2EICA 1QY4A 4M4RA 1BK1A 2ZPXA 2PUSA 2UXDO 2EXJA 3RSJA 1PV0A 2Q5ZA 2GC3A 1O3QA 4NIDA 1LEDA 4I0XB 1PM7A 4I50B 1R73A 1VEWA 2PLV3 3B8NA 5IAVA 1WA4A 5IFTA 4X88A 4X20B 1GWKA 4PA6A 3VD3A 2XJQA 4FQ4A 3WOGA 4X1YB 3Q4HB 2P7TC 4Y1YA 3OBTA 4HK8A 3MIEA 1W0NA 4V2VA 2WJSA 1N3PA 4XACA 1J3RA 2AHYA 2CTPA 4FLTA 2DV9A 3N9NA 3E97A 1S0EA 4Q4V1 2Q6AA 1H2LA 1YXBA 1K8AW 2RDNA 1ASJ3 4FQZA 4UCTA 5LMUB 3LPGA 4I55A 4CS3A 1YTFD 4MVUA 3IAYA 4EZHA 2A70A 1RGSA 3B02A 2QR4A 5FYSA 3ABLB 1WUVA 3CCSV 4HVRA 4Q0VA 4U36A 5D1IA 4MGYE 3ZN6B 2FTKA 1AYN2 2E7TA 1H2GA 1TG7A 1WA8B 1UYYA 5GZGA 1RUC2 2ZGMA 5JXHA 4LLOA 2WA4A 5E79Z 4YZ5A 3FHIB 3RI8A 1YCIA 1KUQA 4LHKA 3OE7G 4XJAA 3AG7A 1A8MA 4F3JA 4XQWA 4Y26A 1QOTA 3HQRA 1FOD3 3MW2A 4UB8Z 2WN2A 1BS3A 4JI3B 3CMAV 4OX9O 1DTOA 1NY72 5KAIZ 1OKQA 2L9LA 2QM7A 2NMOA 1BEV3 2CAVA 1PM9A 3WHTA 1O3TA 1H0BA 4O4LA 4RQPC 3WDYA 3VKFC 1N36B 3VN4A 1FXVA 3U07A 3ZRXA 1UPSA 1ZZ7A 2YEVA 4DV0O 3OGGA 4XE9A 4F83A 1OSGA 1VBE1 5C71A 3VDBA 4YVWA 4RAIA 1MZ5A 3FHQA 1U5IA 1KU9A 3WVJA 1KD7A 2WL1A 2IXKA 1OPMA 3OG2A 4X8NA 1YI9A 3B3QE 2BSKA 4F8AA 1ZBA1 3AMHA 3MBWA 3GZUC 3T2QA 2IZWA 1WD4A 3B7MA 2PAMA 4GULA 2O0OA 1VAMA 1W99A 2J1UA 4K21A 1K3IA 2L35A 3N2KB 2IJIA 5I0SA 5B66Z 2O57A 4Y24A 4AI2A 1W6OA 1BT8A 1WBFA 1L7QA 3CC4V 5FUIA 2RR12 2R041 1H38A 5CNAA 5B1OA 1CAUB 5BNPC 4LMFA 2Q5TA 4BPZA 1VQNV 3B09A 2RS13 5FY4A 1DGRN 4CS2A 2W08A 1UXXX 2BDRA 2KG7A 4I0AA 2DURA 5A32B 4UFLA 5IK5A 4FFHA 1UNBA 2BVVA 4UFZA 4P2ZA 3JSLA 1S2EA 4WM8C 3USUA 3BU7A 1YJWV 3AYEA 1OT5A 3ZYGA 2KKWA 1WMDA 2E32A 3ZOIA 1GYKA 5LMNO 3VZKA 2MNGA 3NWKA 1RUF2 4U7NA 1E1QG 3OTOB 4QX5A 3C90A 1VQLV 4NWVA 1NTZH 1ND2C 4JTCB 2VQEO 1RUG1 4FVVA 5FY7A 1G9CA 3H1MA 4GYCB 3RYCB 4FLYA 2AR6A 4R50A