2GTSA

Structure of protein of unknown function hp0062 from helicobacter pylori
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
VQMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein HP0062
publication title Hypothetical protein HP0062 from Helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2gtsA00
4KXRA 4W4KA 4J10A 4IYIA 4J41A 4J11A 4IYHA 4J7KA 3FX7A 2GTSA 4J42A 2G38A 4J7JA 4W4LA
chains in the Genus database with same CATH superfamily
1Q8IA 2MK3A 2JEUA 4GX2A 2WLKA 1Q6UA 3SDLA 3ZRXA 4PA7A 2BTQB 2AHYA 3J80N 2EIMC 3IC7A 5K1XA 2HHHB 4YIPA 5GTIZ 4JAAA 1S77D 4G27B 3RFRA 2ZM6O 4UV8A 3HKDA 3CCJV 3DC5A 4X88A 5B1OA 4H0LB 1LUVA 2AZ2A 4BIUA 1JFFA 5LA6B 2Z5UA 3CRRA 3OTOB 4QGPA 2OIEA 3FFQA 4AHCA 4X1IB 3FB5C 4DR4B 2OYQA 3ZS8C 2XT9A 1N8RW 1NKDA 2UXXA 5FLXN 1J5EB 1GAXA 1YEWA 4H13B 3ASNB 4JI0O 2DYSC 2ILMA 1Q81W 1RFYA 3SJAC 3ABKC 1XI1A 1N34O 2EILC 1KP3A 4LFCO 2QWOB 1UFIA 1JJ2U 4TV8A 5IJ0A 3JARA 3TJTA 1URFA 5BMVA 4UCRA 5EYPA 1KB9F 4DXWA 4B3RB 2ZCEA 3JSNA 3X2QB 2R70A 3E8GA 1YF2A 4RUFA 5FL7G 2WLIA 1MNGA 4JI1B 3K5MA 4H37A 2P4KA 4NXMO 2Q0OC 1AP6A 5LHGA 4B08A 5JJNB 3J7AU 3G6EV 1PD3A 4P9PA 1BMFG 4YHHB 2JGUA 1S72V 4LFAB 4J9ZB 4JYYA 5K1PA 1Y76A 3WG7C 4L87A 1V55C 5LOVA 2B1GA 1JCHA 2ZIOA 2GHYA 5EBWC 1EZJA 4FZ1A 3GB7C 4Z1MG 3VQXA 1OCOB 4YJ3A 3W7XA 5IJ9B 1P84F 2QEXV 4HBNA 4XDKA 2ZINA 2HEPA 4IHJB 2Q69A 1VQKV 2CGNA 3CEIA 4FIPC 4LF5B 1TVKB 1FXKC 5B3SB 2HLDG 2ODMA 4KFMA 5KA6A 3K03A 1XDCA 3JD3A 3O65A 2UUCB 1M57C 5LGTA 4NTWA 3PN1A 3SYOA 1IBLO 2HG5C 4FFBB 3E89A 1Z5WA 4DV3B 3K58A 3T2MA 2NR5A 1CXZB 1THZA 1JPXA 2B9ZA 4RUEA 3CJHB 4IYIA 2F4VB 1TUBA 5KHHA 4LWSA 3BPZA 1R3LC 3G80A 1VQLV 1HNXB 4MVQA 3RVYA 1K3EA 1HWYA 5LP6A 1WB7A 1XMOO 2RQ6A 4UCSA 1XNQO 1AI4A 3LDCA 1HR0B 4DR6O 2P4VA 4JTAB 1HNZO 1M9NA 1JMKC 3AG1B 1FFXA 2JK5C 4QNHB 3C3SA 2DYRC 5B5EZ 1GK9A 2HR3A 2WA4A 4ZOLA 4DO2A 3E8HA 4XDJA 3JAWA 4X62O 5FNVB 4U7NA 5A9GA 2DE0X 1VQNV 4LFBB 2QKAA 2HVJC 5CMUA 3STLC 5BZBA 3L9DA 5GW7A 2OCCB 4DV7O 1PNMA 5KHJA 2WA3A 4P2ZA 2UUAB 1D5AA 1R6NA 4K8XA 2Z0AA 4WFAV 1YJ9V 1TA8A 2Y69B 5C8YB 4JI8O 2DWDC 4NTYA 2HVKC 3B09A 4LC1A 1V9PA 5JVDB 4PDLA 1ZL8B 1RM1C 5JWPA 4FLXA 4DV1O 5DM6V 1VQMV 2KKWA 3BCCH 1QNMA 5JCOA 1RSOA 4A5UB 4B3TO 4UV9A 2VQFB 5LYJA 3ASOC 4X1KA 5L3FA 3MHSC 5IY5C 3RYIB 1VF6C 1VQ6V 3ABLB 2NLJC 2F43G 2EULA 4LF6O 1Q43A 2GV9A 1IDSA 1H2NA 4MVSA 2IH3C 1SRYA 3IJ4A 1FXVA 2X0LA 3K59A 4J7JA 4CH5A 2UXDB 4LH7A 1FJGB 1N36B 1ZUQA 1B06A 3JD4A 4PA6A 1FFTB 3HKEA 3MD0A 1H38A 1NR7A 1GN3A 3D8CA 2XAJA 3K9AA 4DW0A 1BHAA 5TISZ 2BCCH 3CYOA 1KYOF 3ZRSA 3QNEA 2WLLA 5IYZB 4FLZA 2A06H 1US6A 5J2UB 3CHXA 2P22C 5IYCO 5B1BB 2RDCA 3CSXA 4UB8Z 5B1AC 3ZHVA 1I5XA 3ZHQA 4LCUC 1PL4A 5EZYA 4ABMA 3HKBA 1OCZB 2CK3G 3R65A 1W0JG 2JEXA 5KUMA 4O4HB 5H6RA 1QCEA 1L0NH 2Q9LA 2XAFA 2ZQMA 3F5WC 3WB0A 4R50A 4WBNB 3H1LH 5H6QA 4J9YB 1N33O 2QKSA 4DK0A 3MHHC 4KHPB 3JASA 4DRXA 2JS3A 5HFLA 2DQ3A 4PD4F 3ZN0A 2WAMA 2PI5A 2CGOA 4CBCA 2Q7GA 3MAQA 1NVPB 1QVGU 4UB6Z 3CRCA 5LGNA 4WFHA 4BW5A 4B7EA 2EX3A 3RYFB 1DTOA 5CBFA 3ASNC 1ZTEA 4JI3B 1U97A 5KMGB 3AG4B 5EK0A 1KP2A 4K3AA 3CMAV 1K9MW 1TAEA 3A0RA 2A3QA 5ITZA 1K4CC 5LXTB 3K0DA 3OGCC 2RCVA 2VQEB 2DMXA 4W4LA 3CX5F 5KX5A 4I0XB 4KL1A 1ZSPA 1SA0B 4TUYA 1VARA 4MVUA 3ABUA 4DUZO 3LDEA 3WU2Z 2G38A 1QLEB 3B2EE 4X65B 3JSLA 2WLJA 2YXYA 4YXWG 5L3GA 2M7WA 2LGQA 2UUBO 5JQGA 1SQQH 4LR3A 2JIZG 1K92A 3ZMVA 3CRAA 4MW8A 3BABA 5IYDO 4FM2A 1I08A 2WLNA 1R3JC 2HJFC 3JD0A 3QO8A 4PA4A 1SQXH 2PTMA 1FXKA 2ZM6B 2D3OW 2QWNB 1P4RA 2RN9A 3IGAC 1MG1A 1VF7A 2OT5A 2GUZB 1G8MA 3E35A 3L72H 2CE4A 2O57A 4JASA 2BSKA 2IJHA 5IWAO 4JGSA 1OCOC 4X20B 3RYCA 4TV9A 3FX7A 4DV0O 1F4NA 3I56V 4I50A 4JI0B 4FZ0A 1SKVA 2WSSG 2CTRA 4LF8O 4O4JA 2A7WA 1N34B 2JJ1G 3AK1A 5LP6C 4LFCB 1AJQA 1IVSA 1WPBA 3VQVA 4QE7A 2K1EA 2Y4TA 3QG5A 2KB1A 3TK1A 3AG2B 5B3SC 3FB7C 2LW7A 2YEVA 5BY1A 1NU1H 2ZE5A 2X7RB 3M7MX 4KXRA 2XOKG 3K5NA 2GTAA 2AXTZ 1A32A 2Q8VA 4DV4O 4NXMB 1AI6A 2IM9A 1OCRB 3FKSG 2E3CA 3ZMTA 4ZHQA 2B5UA 4FLWA 5JH7B 2HP8A 3TETA 1Q7YW 4K0KO 1XILA 3K5LA 5B1NA 2Z3YA 2EJ7A 3FB8C 1GTOA 3N2KA 2PYJA 3GWKC 4TOIA 3CRMA 2UXBO 2KG7B 3AG3C 3CC7V 3AG7A 4GUNA 4IIJA 2HJDA 4WF9V 4X8AA 3W7SA 4OPHA 2XNDG 1IX9A 1YJWV 1XMQO 5L3EA 4O4LA 1NTZH 4FLUA 1Y74A 3JYCA 2ZIMA 3ETDA 4DR1O 2OCCC 1VQPV 3ZRWB 3HKCA 4PA9A 4U7OA 4P9OA 1O9HA 4UCUA 5LGUA 3QO7A 1Y67A 3N2GA 4X9QA 1S76D 2Y69C 1OCCB 3JAKA 2JGDA 1IBLB 4WCEV 2K9PA 2LO1A 1SZTA 4GX1A 4I9QA 3W7UA 3OAAG 2R9RB 3B8MA 1S5HC 4RAIA 2B1IA 4TSFG 2KQXA 4I55B 2WWWA 4EFBA 1YZBA 4O4IB 4JYBA 3E22B 1XMOB 3ICXA 1DF4A 3ZMZA 4LP8A 1XNQB 4AQYO 4DR6B 3T1HO 1HNZB 4JI7O 2JVDA 4CC6A 2Q68A 2ADPA 4AILC 4N21A 3UM7A 4TT3G 1X59A 3FAVB 2BTQA 4DV6O 2H3OA 3OTFA 4CZZA 2WLHA 4JV5O 2P90A 2P6JA 2QKCA 1MSWD 4ICGA 3A0BZ 3SYQA 3R66A 4W4KA 4DV7B 2ITCC 4J42A 3CP1A 5LA6A 4MTGA 3BA9A 4JI8B 4DR5O 1HW7A 4X1IA 4NR1A 5DN6G 3T1CA 2ZE6A 3JATB 4I7ZB 1PP9H 1JJOA 1Q86W 3BEHA 3CXHF 2Q73A 1OCZC 1RP3B 3K08A 1S5LZ 4JI2O 2BOBC 3F7VC 4YY3O 4B3TB 2ZNIA 1NH2B 2Y0IA 3A0HZ 3OR6C 3WFVA 4BIZA 1M1KW 4XBFA 4MVOA 4DUYO 4LF6B 1J95A 4YIOA 4K35A 4Q6GA 5IE9A 1H8EG 4O2AB 2E5LO 1N4CA 4DR7O 3ETQA 4C7UA 2V4DA 5F2VO 4FJCC 4GX5A 4GX0A 3KCXA 3CXCU 3AG4C 4FVMA 2WLMA 3G4SV 1L8DA 4JF3A 1XUQA 1H2LA 3K5OA 4DV2O 5CA3A 3OM3B 2EZPA 3ZCCA 2X6CA 2X6AA 1Q3EA 2EIJB 3Q4HB 4LBEC 2P06A 4H33A 3P32A 4NXNO 1T5EA 4B3MO 1EFRG 1N32O 3ZHRA 1ZLZA 2C2AA 4D7TA 1EM1A 3ABMB 4UVCA 1FFXB 2RNBA 1XL4A 1GMGA 1GN6A 4JZGA 1R3IC 5IDJA 4Q20A 2E76B 5IJ9A 3F5TA 1QLEC 4MTOA 2ZE8A 2OWOA 3UKMA 5EC1C 3FYIB 4GZRB 3CC2V 5KUKA 1N0JA 1WJZA 4IHJA 1N33B 2Y48A 4OX9O 1R73A 2P67A 1TVKA 1VF5B 1G6UA 3ML0A 1QLNA 3RT3C 4ZBMA 3OEHG 5CN0A 2OIGA 4MVMA 2ADQB 4FFBA 3CWBH 3P3NA 1GM9A 3E8BA 4CC5A 3CCQV 3H1IH 4U3JB 4LF7O 4PDVA 4LF9O 4UCVA 1AI7A 3APQA 2GSMB 1SQVH 1M56B 3ZBHA 3CJHA 3IFXA 4N23A 3UT5B 2RJZA 1YJNV 1Y66A 3GWOA 1WB8A 2LGWA 1I94O 2UU9B 2CUGA 1WLEA 4ZI7B 4H44B 1KKCA 4OGQB 3ZHUA 3A8TA 3AG2C 1FYJA 2Y4UA 4G28B 4YJ2B 2UXCO 1GH6A 1K33A 2ZDIC 2HKOA 5LMUO 4DUZB 2EIMB 1XQ8A 4UCOA 3ZRVA 1QBZA 4DR3O 1WA8B 2FTKA 1NR1A 1PNLA 4MTXA 2UUBB 1FS0G 4D6TH 3A2FA 2PGGA 1KD1W 3C3TA 3OEEG 1SETA 5DECA 3SPJA 3LNMB 1EZVH 1R6TA 2PUSA 3BAAA 3IAYA 1QHTA 1EN4A 2DW4A 1QR9A 1XHXA 4X64O 2A79B 1IXBA 2Y0PA 3B40A 5C8YA 3PJSK 5LHIA 2LJ2A 3CCUV 1ZL8A 5IWAB 3UQ8A 2EILB 3VQWA 4DV0B 1SQBH 1H2SB 4CS2A 5C93A 1IZ3A 3APOA 3J81N 2ZR3A 4LF8B 1CEZA 1L1FA 3JD2A 5E79Z 3ZMSA 4LNUB 3ABTA 3RYIA 4MTFA 5J2TB 4PA3A 2DQ0A 1HDJA 3KZIZ 3D3QA 4O2BB 1OZ0A 4DK1A 4JI4O 1AR1B 1H2KA 4J7ZA 4HAMA 4J11A 2Q4PA 3SJQC 3UO2A 2GBOA 4QJFB 2AW9A 1JOYA 5EBLC 4X1YB 3JCZA 3I55V 1NS1A 1XBLA 2FL4A 1K8AW 4OPAA 4IGGA 1MABG 2QSAA 3VQYA 4DV4B 3HB3B 5FPOA 3EXAA 2V7QG 3SPHA 1NQTA 3OE7G 2QM7A 3T4ZA 2AGAA 3OUSA 3QVNA 4HZ3A 1KKDA 4K0KB 3SPGA 4JYAB 3TXSA 2XHBA 1SF9A 4L8JA 5IYZA 1WP8A 5J2UA 2UXBB 4FM0A 3K06A 2HFEC 1NH2D 2JJ2G 3FB6C 4PHZA 1AB3A 1S3JA 1K73W 1S0VA 2R9AA 1AR5A 4O4HA 4RWUA 3SR2C 5KAFZ 1KMIZ 3LUTB 2IJIA 1XMQB 3K9SA 3B4SA 2UUAO 2QGNA 3DTUB 4WBNA 2JS5A 3CC4V 1M57B 1MA1A 2Q7EA 4J10A 1MMMA 5H2FZ 4F6RB 5CA0B 4DR1B 3GVMA 3X2QC 3OMAB 2PZSA 4DV5O 2Q5ZA 3STZC 3HPLC 2BSKB 4NKGB 1VMGA 4JYCA 2Q67A 4EB6B 4DR2O 2LQTA 4UXNA 4QE9A 3U10A 1P7GA 3CPWU 3THOA 1XNRO 4IL6Z 4GKJO 3I5DA 3RYFA 1Z2GA 1ZAUA 3IC9A 5KMGA 2M6YA 3CD6V 4QPKA 2IW5A 5EBMC 1V54B 1Q5OA 5LXTA 4X66O 4JI5O 2QR4A 4JTCB 3ZN1A 2FMLA 2YSUB 4I9WA 4CS3A 1SQGA 4I0XA 4U3FH 3CMEV 1SA0A 1GN2A 3AEIA 1DLBA 4CH3A 3G71V 4R7CA 1R1BA 5CB4B 4I4TB 4AQYB 3T1HB 5D5QA 3H1KH 4AI8A 4JI7B 4PDMA 2LFRA 1BT8A 1B3QA 2QTOA 1KC8W 4LH6A 4TQFA 5JJJB 1ORQC 2FKXA 2IU0A 1W0KG 4DV6B 3KKYA 1YI2V 4RO2A 4JV5B 5GONB 1HP8A 4X89A 3DXRB 1G4YB 2EIJC 2ZD9A 1JR9A 2YI9A 1RM1B 1ROPA 2CH7B 2GUZA 4KUMA 4ASUG 1QVFU 3NR7A 5D5PA 2GTSA 4B3SO 4GT1A 4HNAA 3BHPA 1F23A 4DR5B 3CS5A 5CA1B 2W6JG 2A0LA 3OT7A 4X20A 1QQCA 2KSDA 3TCUA 1FD9A 1AJPA 3RYHB 4KP4A 4LF4O 3JALB 5JJEB 4JI2B 3DSQA 4YY3B 3T1YO 1NI8A 3OD4A 1JQ0A 2JGDB 4Z2WA 5LMNO 3AG1C 2ETNA 1IBKO 4F4LA 1PNKA 2ZDIA 4DW1A 3VBBA 3ZHSA 1AVMA 1FPOA 1NTMH 3HKDB 1GM8A 2RMKB 1AJNA 3H1JH 4P30A 5L3CA 1JFFB 2E5LB 4DR7B 1M4UA 4BR6A 4E4EA 3VOUA 4E2LA 3HR0A 4JI6O 5L3BA 4PJ0Z 2CAZC 5JH7A 4JAUA 4DV2B 2FB5A 2ZKOA 3MDSA 3G6BA 3ZEDA 3AK2A 3E2EA 4UCTA 1VP7A 3SGIA 3AK3A 2BTOA 4PI0A 4WFBV 4NXNB 4B3MB 1N32B 1KUQA 2A9HA 3UO3A 4EKWA 1VQ9V 4TV8B 3ZHTA 2YS8A 1XOUA 5IJ0B 4MW3A 3JARB 5BMVB 1E79G 1MOFA 2XAQA 5EYPB 2P5OA 4TQDA 5A2QN 2QWQB 4NTXA 3ABLC 2VS0A 1IBMO 3RGBA 2W0FC 3ZMUA 1Z5VA 2IH1C 3CCSV 2WLIB 5H9CA 3L70H 4FM1A 4CS4A 4OX9B 3EVKA 1WAZA 3ZRWA 1XL6A 1OV9A 3KG2A 1H2GA 4CH6A 3KCYA 2DWEC 3S3WA 3UCSC 2DOSA 5E1AC 4PELA 5B66Z 4X62B 1R6KA 3D36C 1Y76B 1WN7A 1EN6A 3L73H 5LOVB 1G1XB 1NTKH 4LF7B 2F93B 3LNNA 1OHHG 3N27A 4FLYA 4LF9B 1VQ7V 2H8PC 4ZKIA 1BHBA 1M93A 3CCEV 1K4DC 2WPDG 1GRJA 2EJRA 1NVPD 4YJ3B 5BR8O 4GKKO 5B1BC 3S3XA 2BOCC 2QTSA 3EFFK 3O9OA 1SERA 1Q6HA 1I94B 3F7YC 4I55A 3JCUZ 4DV1B 4NYKA 1K7DA 4O4IA 1NT2B 2N74A 3E22A 2E74B 2ZT9B 1KQSU 2Q7HA 4JTDB 2UXCB 5CBHA 4UFZA 5LMUB 1BCCH 2EIKB 2ARHA 1TUEB 1Q90D 4DR3B 3FAVA 4UVBA 2D2CB 5BXZA 2IJKA 3CB2A 1GKFA 3BVOA 4IYHA 5EIBD 3RVZA 2E75B 1R3KC 1HNWO 4JPRA 2PY5A 4HYOA 1TUBB 4X64B 4LWSB 2EINB 2CTWA 3OGIB 3ZJZA 3E83A 4J7KA 2OTLV 4PI2A 3JATA 3U0ZA 1YITV 1W2BU 3FD9A 5LP6B 3BY6A 1H8HG 2YIBD 1YVWA 1PL0A 4FMTA 2X6BA 3E8FA 1P49A 3C90A 4I5SA 2LFSA 3H9VA 4ZOLB 1BQ0A 3JAWB 1NZ6A 2L35A 3U11A 2PYLA 2HHHO 4JI4B 2NNUA 5LBQA 5KLVH 5EIBC 3CCMV 5J9PC 3OUFA 3RN4A 4CH4A 5IT9N 1QU7A 1D5NA 1COWG 5HFMA 4GCZA 4TWKA 3BA8A 4O2AA 3DC6A 3OTOO 1BQZA 3WB1A 1BS3A 4FLTA 4DR4O 2ZNJA 4BIOA 1BGYH 1J5EO 4GYCB 1GO3F 1BE3H 1V54C 3AG3B 1K5QA 3M99B 1RSOB 1MZFA 3Q4HA 3D3IA 2CTQA 5DEDA 1Q82W 5LYJB 4NVPA 5FPRA 4X1KB 1DGSA 5KHGA 2VRZA 4PV1B 2F66C 1I0HA 4B7KA 4B3RO 2XAHA 1X4TA 1VIBA 2ZXWB 1OJHA 3T4DA 1CP9A 1WNSA 2CTPA 4R6ZA 5H5NA 2DN9A 1GN4A 4FPPA 2QA4V 2QWRB 4JI1O 3CRQA 3LDDA 2QM4A 1D2DA 1F4MA 3OMIB 2YI8A 4J41A 1VEWA 2XTAA 4R8CA 1JX9A 3NXSA 4QIWF 1GM7A 1AILA 3HKEB 4DV5B 2OCHA 4UUJC 4BAYA 4YHHO 1SQPH 4LFAO 1M90W 1SC5B 5FNVA 1TGOA 4DR2B 1LUWA 1OCRC 3QTCA 2Q6AA 2ZE7A 1XNRB 4U3JA 1MZEA 2WLLB 4GKJB 5GTHZ 3OR7C 1KBHA 1BZKA 1E1QG 3UT5A 3K04A 3H1HH 2QDOA 3SPCA 2W0XA 4QPJA 1P7BA 5EZYB 4OXSA 3HKBB 3WB2A 1QR8A 1AI5A 3E86A 3H01A 2DYSB 4X66B 1I7FA 4JI5B 4WFEA 4FLVA 1BSMA 3ABKB 5JVDA 3TXQA 4ZI7A 2V1DA 1YTFB 1EN5A 2DJVA 1H2MA 4IT5A 4XDLA 1YIJV 4YJ2A 4LF5O 1XREA 3JASB 4DRXB 4K8ZA 4G2KA 1MSDA 2FYUH 1PPJH 2IBZH 2UUCO 1UJWB 2W6IG 2QWPB 4MVRA 1WA8A 4MVZA 4DV3O 1Y6XA 5EC2C 1WPXA 3LSQA 1VQ4V 1JVMA 1SZXA 4MT8A 3CCRV 3OMNB 2IU3A 5KHIA 2XASA 1OCCC 1K5SA 2JRIA 3K79A 1B6QA 2F4VO 1PKXA 1YDXA 1CPYA 2R9IA 1B04A 5ITZB 3TGUH 4BW9A 1YCIA 3D36A 1F7YA 4B3SB 3ETGA 3WG7B 1HNXO 3RWRD 1V55B 3JAMN 1U96A 3L71H 2YIAA 3LSUA 5KX5B 4RQEA 2UXNA 1YHQV 3CCLV 5CBGA 2EZOA 4TUYB 4DYLA 4LF4B 2R72A 3DGEA 1HR0O 2AHZA 4UVAA 2XUMA 4D7SA 4LNUA 3T1YB 1VQ8V 1VQ5V 3QO5A 5J2TA 2IJJA 1NBMG 2MW2B 1JA8A 5JQGB 4O2BA 2JDIG 4LFBO 4FK5C 1XHZA 5LMNB 1IBKB 1DK1A 1VQOV 1FXKB 1Y4MA 4EEQA 4X1YA 1ENVA 2ZR2A 1SESA 1WP7A 1AR4A 4JAVA 1KECA 1IXMA 2YDEA 1BL8A 3K0GA 3BFRA 2UU9O 2N04A 5KAIZ 1FAFA 1PV0A 2QM8A 4JI6B 3ZIAG 3RYCB 3CE2A 4TV9B 1YXBA 4I50B 4WFFA 4NB5A 3RW0A 2VQFO 1LR1A 4O4JB 5L3DA 3EHBB 3B77A 1NJIW 3OFNG 2Q0AA 1K34A 5KA5A 1YSCA 1I5YA 1ZWIC 2H94A 1AROP 3K57A 3CCVV 2EIKC 2CDYA 3SJCC 3K3WA 2YEVB 2F23A 1IBMB 2YXHA 4EFEA 3RBZA 2EBOA 3P30A 4FFKA 1XEQA 2DYRB 2UXDO 4MS2A 2BE3A 2YUAA 1FJGO 3P3PA 1N36O 1M5IA 5CA0A 2ATKC 2N05A 4F6RA 1E1RG 1KU9A 4HNAB 3SPIA 2YICA 4ZHQB 4EB6A 2GDSA 2EINC 2P7TC 1DF5A 2ITDC 3W7TA 1PM9A 3N2KB 1ZX3A 1UPGA 3M8AA 2YC0A 4IIJB 3QF7A 1SQFA 5BR8B 4BWAA 4GKKB 2YIBA 3ABMC 2XAGA 2QE7G 4F6EA 4O4LB 1LNQA 1Y74B 3ASOB 5IY5B 4PDRA 4RQFA 3B8NA 5LHHA 4MSWC 4KHPO 3BRCA 1RPRA 2PI4A 5CB4A 4I4TA 4ZIBA 3HKCB 3SYAA 1FKAO 2PF4E 3N2GB 1F51A 3L75H 3JAKB 5IYBO 1S5JA 1AP5A 1SS3A 2F1MA 4DUYB 2L6LA 5AG2A 3OW2U 4JYAO 2YIDA 3SYPA 2NN4A 3ETEA 4J80A 5GONA 3LSSA 4JI3O 3DXRA 4WFGA 5JCOC 3JD1A 2VWJA 2VWKA 3FYEB 2AZ0A 2YXLA 1FXHA 1HNWB 2LW1A 1W59A 1Q6IA 2CH7A 2QJ1A 4Z1VA 1IURA 5KHKA 1M56C 1L0LH 3SJBC 3W7WA 1RPOA 5LL6Y 2VQEO 5CA1A 3ZX6A 3SYCA 2LP7A 3G67A 1N0NA 3RYHA 1VF6A 2ZXWC 1K97A 3L74H 4JZ2A 3JALA 5B1AB 1O9GA 4GLXA 1EBOA 1YTFD 4X65O 2F95B 2OTJV 2KG7A
chains in the Genus database with same CATH topology
4KXRA 4W4KA 4J10A 4IYIA 4J41A 4J11A 4IYHA 4J7KA 3FX7A 2GTSA 4J42A 2G38A 4J7JA 4W4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXR A;  4W4K A;  4J10 A;  4IYI A;  4J41 A;  4J11 A;  4IYH A;  4J7K A;  3FX7 A;  2GTS A;  4J42 A;  2G38 A;  4J7J A;  4W4L A; 
#chains in the Genus database with same CATH topology
 1Q8I A;  2MK3 A;  2JEU A;  4GX2 A;  2WLK A;  1Q6U A;  3SDL A;  3ZRX A;  4PA7 A;  2BTQ B;  2AHY A;  3J80 N;  2EIM C;  3IC7 A;  5K1X A;  2HHH B;  4YIP A;  5GTI Z;  4JAA A;  1S77 D;  4G27 B;  3RFR A;  2ZM6 O;  4UV8 A;  3HKD A;  3CCJ V;  3DC5 A;  4X88 A;  5B1O A;  4H0L B;  1LUV A;  2AZ2 A;  4BIU A;  1JFF A;  5LA6 B;  2Z5U A;  3CRR A;  3OTO B;  4QGP A;  2OIE A;  3FFQ A;  4AHC A;  4X1I B;  3FB5 C;  4DR4 B;  2OYQ A;  3ZS8 C;  2XT9 A;  1N8R W;  1NKD A;  2UXX A;  5FLX N;  1J5E B;  1GAX A;  1YEW A;  4H13 B;  3ASN B;  4JI0 O;  2DYS C;  2ILM A;  1Q81 W;  1RFY A;  3SJA C;  3ABK C;  1XI1 A;  1N34 O;  2EIL C;  1KP3 A;  4LFC O;  2QWO B;  1UFI A;  1JJ2 U;  4TV8 A;  5IJ0 A;  3JAR A;  3TJT A;  1URF A;  5BMV A;  4UCR A;  5EYP A;  1KB9 F;  4DXW A;  4B3R B;  2ZCE A;  3JSN A;  3X2Q B;  2R70 A;  3E8G A;  1YF2 A;  4RUF A;  5FL7 G;  2WLI A;  1MNG A;  4JI1 B;  3K5M A;  4H37 A;  2P4K A;  4NXM O;  2Q0O C;  1AP6 A;  5LHG A;  4B08 A;  5JJN B;  3J7A U;  3G6E V;  1PD3 A;  4P9P A;  1BMF G;  4YHH B;  2JGU A;  1S72 V;  4LFA B;  4J9Z B;  4JYY A;  5K1P A;  1Y76 A;  3WG7 C;  4L87 A;  1V55 C;  5LOV A;  2B1G A;  1JCH A;  2ZIO A;  2GHY A;  5EBW C;  1EZJ A;  4FZ1 A;  3GB7 C;  4Z1M G;  3VQX A;  1OCO B;  4YJ3 A;  3W7X A;  5IJ9 B;  1P84 F;  2QEX V;  4HBN A;  4XDK A;  2ZIN A;  2HEP A;  4IHJ B;  2Q69 A;  1VQK V;  2CGN A;  3CEI A;  4FIP C;  4LF5 B;  1TVK B;  1FXK C;  5B3S B;  2HLD G;  2ODM A;  4KFM A;  5KA6 A;  3K03 A;  1XDC A;  3JD3 A;  3O65 A;  2UUC B;  1M57 C;  5LGT A;  4NTW A;  3PN1 A;  3SYO A;  1IBL O;  2HG5 C;  4FFB B;  3E89 A;  1Z5W A;  4DV3 B;  3K58 A;  3T2M A;  2NR5 A;  1CXZ B;  1THZ A;  1JPX A;  2B9Z A;  4RUE A;  3CJH B;  4IYI A;  2F4V B;  1TUB A;  5KHH A;  4LWS A;  3BPZ A;  1R3L C;  3G80 A;  1VQL V;  1HNX B;  4MVQ A;  3RVY A;  1K3E A;  1HWY A;  5LP6 A;  1WB7 A;  1XMO O;  2RQ6 A;  4UCS A;  1XNQ O;  1AI4 A;  3LDC A;  1HR0 B;  4DR6 O;  2P4V A;  4JTA B;  1HNZ O;  1M9N A;  1JMK C;  3AG1 B;  1FFX A;  2JK5 C;  4QNH B;  3C3S A;  2DYR C;  5B5E Z;  1GK9 A;  2HR3 A;  2WA4 A;  4ZOL A;  4DO2 A;  3E8H A;  4XDJ A;  3JAW A;  4X62 O;  5FNV B;  4U7N A;  5A9G A;  2DE0 X;  1VQN V;  4LFB B;  2QKA A;  2HVJ C;  5CMU A;  3STL C;  5BZB A;  3L9D A;  5GW7 A;  2OCC B;  4DV7 O;  1PNM A;  5KHJ A;  2WA3 A;  4P2Z A;  2UUA B;  1D5A A;  1R6N A;  4K8X A;  2Z0A A;  4WFA V;  1YJ9 V;  1TA8 A;  2Y69 B;  5C8Y B;  4JI8 O;  2DWD C;  4NTY A;  2HVK C;  3B09 A;  4LC1 A;  1V9P A;  5JVD B;  4PDL A;  1ZL8 B;  1RM1 C;  5JWP A;  4FLX A;  4DV1 O;  5DM6 V;  1VQM V;  2KKW A;  3BCC H;  1QNM A;  5JCO A;  1RSO A;  4A5U B;  4B3T O;  4UV9 A;  2VQF B;  5LYJ A;  3ASO C;  4X1K A;  5L3F A;  3MHS C;  5IY5 C;  3RYI B;  1VF6 C;  1VQ6 V;  3ABL B;  2NLJ C;  2F43 G;  2EUL A;  4LF6 O;  1Q43 A;  2GV9 A;  1IDS A;  1H2N A;  4MVS A;  2IH3 C;  1SRY A;  3IJ4 A;  1FXV A;  2X0L A;  3K59 A;  4J7J A;  4CH5 A;  2UXD B;  4LH7 A;  1FJG B;  1N36 B;  1ZUQ A;  1B06 A;  3JD4 A;  4PA6 A;  1FFT B;  3HKE A;  3MD0 A;  1H38 A;  1NR7 A;  1GN3 A;  3D8C A;  2XAJ A;  3K9A A;  4DW0 A;  1BHA A;  5TIS Z;  2BCC H;  3CYO A;  1KYO F;  3ZRS A;  3QNE A;  2WLL A;  5IYZ B;  4FLZ A;  2A06 H;  1US6 A;  5J2U B;  3CHX A;  2P22 C;  5IYC O;  5B1B B;  2RDC A;  3CSX A;  4UB8 Z;  5B1A C;  3ZHV A;  1I5X A;  3ZHQ A;  4LCU C;  1PL4 A;  5EZY A;  4ABM A;  3HKB A;  1OCZ B;  2CK3 G;  3R65 A;  1W0J G;  2JEX A;  5KUM A;  4O4H B;  5H6R A;  1QCE A;  1L0N H;  2Q9L A;  2XAF A;  2ZQM A;  3F5W C;  3WB0 A;  4R50 A;  4WBN B;  3H1L H;  5H6Q A;  4J9Y B;  1N33 O;  2QKS A;  4DK0 A;  3MHH C;  4KHP B;  3JAS A;  4DRX A;  2JS3 A;  5HFL A;  2DQ3 A;  4PD4 F;  3ZN0 A;  2WAM A;  2PI5 A;  2CGO A;  4CBC A;  2Q7G A;  3MAQ A;  1NVP B;  1QVG U;  4UB6 Z;  3CRC A;  5LGN A;  4WFH A;  4BW5 A;  4B7E A;  2EX3 A;  3RYF B;  1DTO A;  5CBF A;  3ASN C;  1ZTE A;  4JI3 B;  1U97 A;  5KMG B;  3AG4 B;  5EK0 A;  1KP2 A;  4K3A A;  3CMA V;  1K9M W;  1TAE A;  3A0R A;  2A3Q A;  5ITZ A;  1K4C C;  5LXT B;  3K0D A;  3OGC C;  2RCV A;  2VQE B;  2DMX A;  4W4L A;  3CX5 F;  5KX5 A;  4I0X B;  4KL1 A;  1ZSP A;  1SA0 B;  4TUY A;  1VAR A;  4MVU A;  3ABU A;  4DUZ O;  3LDE A;  3WU2 Z;  2G38 A;  1QLE B;  3B2E E;  4X65 B;  3JSL A;  2WLJ A;  2YXY A;  4YXW G;  5L3G A;  2M7W A;  2LGQ A;  2UUB O;  5JQG A;  1SQQ H;  4LR3 A;  2JIZ G;  1K92 A;  3ZMV A;  3CRA A;  4MW8 A;  3BAB A;  5IYD O;  4FM2 A;  1I08 A;  2WLN A;  1R3J C;  2HJF C;  3JD0 A;  3QO8 A;  4PA4 A;  1SQX H;  2PTM A;  1FXK A;  2ZM6 B;  2D3O W;  2QWN B;  1P4R A;  2RN9 A;  3IGA C;  1MG1 A;  1VF7 A;  2OT5 A;  2GUZ B;  1G8M A;  3E35 A;  3L72 H;  2CE4 A;  2O57 A;  4JAS A;  2BSK A;  2IJH A;  5IWA O;  4JGS A;  1OCO C;  4X20 B;  3RYC A;  4TV9 A;  3FX7 A;  4DV0 O;  1F4N A;  3I56 V;  4I50 A;  4JI0 B;  4FZ0 A;  1SKV A;  2WSS G;  2CTR A;  4LF8 O;  4O4J A;  2A7W A;  1N34 B;  2JJ1 G;  3AK1 A;  5LP6 C;  4LFC B;  1AJQ A;  1IVS A;  1WPB A;  3VQV A;  4QE7 A;  2K1E A;  2Y4T A;  3QG5 A;  2KB1 A;  3TK1 A;  3AG2 B;  5B3S C;  3FB7 C;  2LW7 A;  2YEV A;  5BY1 A;  1NU1 H;  2ZE5 A;  2X7R B;  3M7M X;  4KXR A;  2XOK G;  3K5N A;  2GTA A;  2AXT Z;  1A32 A;  2Q8V A;  4DV4 O;  4NXM B;  1AI6 A;  2IM9 A;  1OCR B;  3FKS G;  2E3C A;  3ZMT A;  4ZHQ A;  2B5U A;  4FLW A;  5JH7 B;  2HP8 A;  3TET A;  1Q7Y W;  4K0K O;  1XIL A;  3K5L A;  5B1N A;  2Z3Y A;  2EJ7 A;  3FB8 C;  1GTO A;  3N2K A;  2PYJ A;  3GWK C;  4TOI A;  3CRM A;  2UXB O;  2KG7 B;  3AG3 C;  3CC7 V;  3AG7 A;  4GUN A;  4IIJ A;  2HJD A;  4WF9 V;  4X8A A;  3W7S A;  4OPH A;  2XND G;  1IX9 A;  1YJW V;  1XMQ O;  5L3E A;  4O4L A;  1NTZ H;  4FLU A;  1Y74 A;  3JYC A;  2ZIM A;  3ETD A;  4DR1 O;  2OCC C;  1VQP V;  3ZRW B;  3HKC A;  4PA9 A;  4U7O A;  4P9O A;  1O9H A;  4UCU A;  5LGU A;  3QO7 A;  1Y67 A;  3N2G A;  4X9Q A;  1S76 D;  2Y69 C;  1OCC B;  3JAK A;  2JGD A;  1IBL B;  4WCE V;  2K9P A;  2LO1 A;  1SZT A;  4GX1 A;  4I9Q A;  3W7U A;  3OAA G;  2R9R B;  3B8M A;  1S5H C;  4RAI A;  2B1I A;  4TSF G;  2KQX A;  4I55 B;  2WWW A;  4EFB A;  1YZB A;  4O4I B;  4JYB A;  3E22 B;  1XMO B;  3ICX A;  1DF4 A;  3ZMZ A;  4LP8 A;  1XNQ B;  4AQY O;  4DR6 B;  3T1H O;  1HNZ B;  4JI7 O;  2JVD A;  4CC6 A;  2Q68 A;  2ADP A;  4AIL C;  4N21 A;  3UM7 A;  4TT3 G;  1X59 A;  3FAV B;  2BTQ A;  4DV6 O;  2H3O A;  3OTF A;  4CZZ A;  2WLH A;  4JV5 O;  2P90 A;  2P6J A;  2QKC A;  1MSW D;  4ICG A;  3A0B Z;  3SYQ A;  3R66 A;  4W4K A;  4DV7 B;  2ITC C;  4J42 A;  3CP1 A;  5LA6 A;  4MTG A;  3BA9 A;  4JI8 B;  4DR5 O;  1HW7 A;  4X1I A;  4NR1 A;  5DN6 G;  3T1C A;  2ZE6 A;  3JAT B;  4I7Z B;  1PP9 H;  1JJO A;  1Q86 W;  3BEH A;  3CXH F;  2Q73 A;  1OCZ C;  1RP3 B;  3K08 A;  1S5L Z;  4JI2 O;  2BOB C;  3F7V C;  4YY3 O;  4B3T B;  2ZNI A;  1NH2 B;  2Y0I A;  3A0H Z;  3OR6 C;  3WFV A;  4BIZ A;  1M1K W;  4XBF A;  4MVO A;  4DUY O;  4LF6 B;  1J95 A;  4YIO A;  4K35 A;  4Q6G A;  5IE9 A;  1H8E G;  4O2A B;  2E5L O;  1N4C A;  4DR7 O;  3ETQ A;  4C7U A;  2V4D A;  5F2V O;  4FJC C;  4GX5 A;  4GX0 A;  3KCX A;  3CXC U;  3AG4 C;  4FVM A;  2WLM A;  3G4S V;  1L8D A;  4JF3 A;  1XUQ A;  1H2L A;  3K5O A;  4DV2 O;  5CA3 A;  3OM3 B;  2EZP A;  3ZCC A;  2X6C A;  2X6A A;  1Q3E A;  2EIJ B;  3Q4H B;  4LBE C;  2P06 A;  4H33 A;  3P32 A;  4NXN O;  1T5E A;  4B3M O;  1EFR G;  1N32 O;  3ZHR A;  1ZLZ A;  2C2A A;  4D7T A;  1EM1 A;  3ABM B;  4UVC A;  1FFX B;  2RNB A;  1XL4 A;  1GMG A;  1GN6 A;  4JZG A;  1R3I C;  5IDJ A;  4Q20 A;  2E76 B;  5IJ9 A;  3F5T A;  1QLE C;  4MTO A;  2ZE8 A;  2OWO A;  3UKM A;  5EC1 C;  3FYI B;  4GZR B;  3CC2 V;  5KUK A;  1N0J A;  1WJZ A;  4IHJ A;  1N33 B;  2Y48 A;  4OX9 O;  1R73 A;  2P67 A;  1TVK A;  1VF5 B;  1G6U A;  3ML0 A;  1QLN A;  3RT3 C;  4ZBM A;  3OEH G;  5CN0 A;  2OIG A;  4MVM A;  2ADQ B;  4FFB A;  3CWB H;  3P3N A;  1GM9 A;  3E8B A;  4CC5 A;  3CCQ V;  3H1I H;  4U3J B;  4LF7 O;  4PDV A;  4LF9 O;  4UCV A;  1AI7 A;  3APQ A;  2GSM B;  1SQV H;  1M56 B;  3ZBH A;  3CJH A;  3IFX A;  4N23 A;  3UT5 B;  2RJZ A;  1YJN V;  1Y66 A;  3GWO A;  1WB8 A;  2LGW A;  1I94 O;  2UU9 B;  2CUG A;  1WLE A;  4ZI7 B;  4H44 B;  1KKC A;  4OGQ B;  3ZHU A;  3A8T A;  3AG2 C;  1FYJ A;  2Y4U A;  4G28 B;  4YJ2 B;  2UXC O;  1GH6 A;  1K33 A;  2ZDI C;  2HKO A;  5LMU O;  4DUZ B;  2EIM B;  1XQ8 A;  4UCO A;  3ZRV A;  1QBZ A;  4DR3 O;  1WA8 B;  2FTK A;  1NR1 A;  1PNL A;  4MTX A;  2UUB B;  1FS0 G;  4D6T H;  3A2F A;  2PGG A;  1KD1 W;  3C3T A;  3OEE G;  1SET A;  5DEC A;  3SPJ A;  3LNM B;  1EZV H;  1R6T A;  2PUS A;  3BAA A;  3IAY A;  1QHT A;  1EN4 A;  2DW4 A;  1QR9 A;  1XHX A;  4X64 O;  2A79 B;  1IXB A;  2Y0P A;  3B40 A;  5C8Y A;  3PJS K;  5LHI A;  2LJ2 A;  3CCU V;  1ZL8 A;  5IWA B;  3UQ8 A;  2EIL B;  3VQW A;  4DV0 B;  1SQB H;  1H2S B;  4CS2 A;  5C93 A;  1IZ3 A;  3APO A;  3J81 N;  2ZR3 A;  4LF8 B;  1CEZ A;  1L1F A;  3JD2 A;  5E79 Z;  3ZMS A;  4LNU B;  3ABT A;  3RYI A;  4MTF A;  5J2T B;  4PA3 A;  2DQ0 A;  1HDJ A;  3KZI Z;  3D3Q A;  4O2B B;  1OZ0 A;  4DK1 A;  4JI4 O;  1AR1 B;  1H2K A;  4J7Z A;  4HAM A;  4J11 A;  2Q4P A;  3SJQ C;  3UO2 A;  2GBO A;  4QJF B;  2AW9 A;  1JOY A;  5EBL C;  4X1Y B;  3JCZ A;  3I55 V;  1NS1 A;  1XBL A;  2FL4 A;  1K8A W;  4OPA A;  4IGG A;  1MAB G;  2QSA A;  3VQY A;  4DV4 B;  3HB3 B;  5FPO A;  3EXA A;  2V7Q G;  3SPH A;  1NQT A;  3OE7 G;  2QM7 A;  3T4Z A;  2AGA A;  3OUS A;  3QVN A;  4HZ3 A;  1KKD A;  4K0K B;  3SPG A;  4JYA B;  3TXS A;  2XHB A;  1SF9 A;  4L8J A;  5IYZ A;  1WP8 A;  5J2U A;  2UXB B;  4FM0 A;  3K06 A;  2HFE C;  1NH2 D;  2JJ2 G;  3FB6 C;  4PHZ A;  1AB3 A;  1S3J A;  1K73 W;  1S0V A;  2R9A A;  1AR5 A;  4O4H A;  4RWU A;  3SR2 C;  5KAF Z;  1KMI Z;  3LUT B;  2IJI A;  1XMQ B;  3K9S A;  3B4S A;  2UUA O;  2QGN A;  3DTU B;  4WBN A;  2JS5 A;  3CC4 V;  1M57 B;  1MA1 A;  2Q7E A;  4J10 A;  1MMM A;  5H2F Z;  4F6R B;  5CA0 B;  4DR1 B;  3GVM A;  3X2Q C;  3OMA B;  2PZS A;  4DV5 O;  2Q5Z A;  3STZ C;  3HPL C;  2BSK B;  4NKG B;  1VMG A;  4JYC A;  2Q67 A;  4EB6 B;  4DR2 O;  2LQT A;  4UXN A;  4QE9 A;  3U10 A;  1P7G A;  3CPW U;  3THO A;  1XNR O;  4IL6 Z;  4GKJ O;  3I5D A;  3RYF A;  1Z2G A;  1ZAU A;  3IC9 A;  5KMG A;  2M6Y A;  3CD6 V;  4QPK A;  2IW5 A;  5EBM C;  1V54 B;  1Q5O A;  5LXT A;  4X66 O;  4JI5 O;  2QR4 A;  4JTC B;  3ZN1 A;  2FML A;  2YSU B;  4I9W A;  4CS3 A;  1SQG A;  4I0X A;  4U3F H;  3CME V;  1SA0 A;  1GN2 A;  3AEI A;  1DLB A;  4CH3 A;  3G71 V;  4R7C A;  1R1B A;  5CB4 B;  4I4T B;  4AQY B;  3T1H B;  5D5Q A;  3H1K H;  4AI8 A;  4JI7 B;  4PDM A;  2LFR A;  1BT8 A;  1B3Q A;  2QTO A;  1KC8 W;  4LH6 A;  4TQF A;  5JJJ B;  1ORQ C;  2FKX A;  2IU0 A;  1W0K G;  4DV6 B;  3KKY A;  1YI2 V;  4RO2 A;  4JV5 B;  5GON B;  1HP8 A;  4X89 A;  3DXR B;  1G4Y B;  2EIJ C;  2ZD9 A;  1JR9 A;  2YI9 A;  1RM1 B;  1ROP A;  2CH7 B;  2GUZ A;  4KUM A;  4ASU G;  1QVF U;  3NR7 A;  5D5P A;  2GTS A;  4B3S O;  4GT1 A;  4HNA A;  3BHP A;  1F23 A;  4DR5 B;  3CS5 A;  5CA1 B;  2W6J G;  2A0L A;  3OT7 A;  4X20 A;  1QQC A;  2KSD A;  3TCU A;  1FD9 A;  1AJP A;  3RYH B;  4KP4 A;  4LF4 O;  3JAL B;  5JJE B;  4JI2 B;  3DSQ A;  4YY3 B;  3T1Y O;  1NI8 A;  3OD4 A;  1JQ0 A;  2JGD B;  4Z2W A;  5LMN O;  3AG1 C;  2ETN A;  1IBK O;  4F4L A;  1PNK A;  2ZDI A;  4DW1 A;  3VBB A;  3ZHS A;  1AVM A;  1FPO A;  1NTM H;  3HKD B;  1GM8 A;  2RMK B;  1AJN A;  3H1J H;  4P30 A;  5L3C A;  1JFF B;  2E5L B;  4DR7 B;  1M4U A;  4BR6 A;  4E4E A;  3VOU A;  4E2L A;  3HR0 A;  4JI6 O;  5L3B A;  4PJ0 Z;  2CAZ C;  5JH7 A;  4JAU A;  4DV2 B;  2FB5 A;  2ZKO A;  3MDS A;  3G6B A;  3ZED A;  3AK2 A;  3E2E A;  4UCT A;  1VP7 A;  3SGI A;  3AK3 A;  2BTO A;  4PI0 A;  4WFB V;  4NXN B;  4B3M B;  1N32 B;  1KUQ A;  2A9H A;  3UO3 A;  4EKW A;  1VQ9 V;  4TV8 B;  3ZHT A;  2YS8 A;  1XOU A;  5IJ0 B;  4MW3 A;  3JAR B;  5BMV B;  1E79 G;  1MOF A;  2XAQ A;  5EYP B;  2P5O A;  4TQD A;  5A2Q N;  2QWQ B;  4NTX A;  3ABL C;  2VS0 A;  1IBM O;  3RGB A;  2W0F C;  3ZMU A;  1Z5V A;  2IH1 C;  3CCS V;  2WLI B;  5H9C A;  3L70 H;  4FM1 A;  4CS4 A;  4OX9 B;  3EVK A;  1WAZ A;  3ZRW A;  1XL6 A;  1OV9 A;  3KG2 A;  1H2G A;  4CH6 A;  3KCY A;  2DWE C;  3S3W A;  3UCS C;  2DOS A;  5E1A C;  4PEL A;  5B66 Z;  4X62 B;  1R6K A;  3D36 C;  1Y76 B;  1WN7 A;  1EN6 A;  3L73 H;  5LOV B;  1G1X B;  1NTK H;  4LF7 B;  2F93 B;  3LNN A;  1OHH G;  3N27 A;  4FLY A;  4LF9 B;  1VQ7 V;  2H8P C;  4ZKI A;  1BHB A;  1M93 A;  3CCE V;  1K4D C;  2WPD G;  1GRJ A;  2EJR A;  1NVP D;  4YJ3 B;  5BR8 O;  4GKK O;  5B1B C;  3S3X A;  2BOC C;  2QTS A;  3EFF K;  3O9O A;  1SER A;  1Q6H A;  1I94 B;  3F7Y C;  4I55 A;  3JCU Z;  4DV1 B;  4NYK A;  1K7D A;  4O4I A;  1NT2 B;  2N74 A;  3E22 A;  2E74 B;  2ZT9 B;  1KQS U;  2Q7H A;  4JTD B;  2UXC B;  5CBH A;  4UFZ A;  5LMU B;  1BCC H;  2EIK B;  2ARH A;  1TUE B;  1Q90 D;  4DR3 B;  3FAV A;  4UVB A;  2D2C B;  5BXZ A;  2IJK A;  3CB2 A;  1GKF A;  3BVO A;  4IYH A;  5EIB D;  3RVZ A;  2E75 B;  1R3K C;  1HNW O;  4JPR A;  2PY5 A;  4HYO A;  1TUB B;  4X64 B;  4LWS B;  2EIN B;  2CTW A;  3OGI B;  3ZJZ A;  3E83 A;  4J7K A;  2OTL V;  4PI2 A;  3JAT A;  3U0Z A;  1YIT V;  1W2B U;  3FD9 A;  5LP6 B;  3BY6 A;  1H8H G;  2YIB D;  1YVW A;  1PL0 A;  4FMT A;  2X6B A;  3E8F A;  1P49 A;  3C90 A;  4I5S A;  2LFS A;  3H9V A;  4ZOL B;  1BQ0 A;  3JAW B;  1NZ6 A;  2L35 A;  3U11 A;  2PYL A;  2HHH O;  4JI4 B;  2NNU A;  5LBQ A;  5KLV H;  5EIB C;  3CCM V;  5J9P C;  3OUF A;  3RN4 A;  4CH4 A;  5IT9 N;  1QU7 A;  1D5N A;  1COW G;  5HFM A;  4GCZ A;  4TWK A;  3BA8 A;  4O2A A;  3DC6 A;  3OTO O;  1BQZ A;  3WB1 A;  1BS3 A;  4FLT A;  4DR4 O;  2ZNJ A;  4BIO A;  1BGY H;  1J5E O;  4GYC B;  1GO3 F;  1BE3 H;  1V54 C;  3AG3 B;  1K5Q A;  3M99 B;  1RSO B;  1MZF A;  3Q4H A;  3D3I A;  2CTQ A;  5DED A;  1Q82 W;  5LYJ B;  4NVP A;  5FPR A;  4X1K B;  1DGS A;  5KHG A;  2VRZ A;  4PV1 B;  2F66 C;  1I0H A;  4B7K A;  4B3R O;  2XAH A;  1X4T A;  1VIB A;  2ZXW B;  1OJH A;  3T4D A;  1CP9 A;  1WNS A;  2CTP A;  4R6Z A;  5H5N A;  2DN9 A;  1GN4 A;  4FPP A;  2QA4 V;  2QWR B;  4JI1 O;  3CRQ A;  3LDD A;  2QM4 A;  1D2D A;  1F4M A;  3OMI B;  2YI8 A;  4J41 A;  1VEW A;  2XTA A;  4R8C A;  1JX9 A;  3NXS A;  4QIW F;  1GM7 A;  1AIL A;  3HKE B;  4DV5 B;  2OCH A;  4UUJ C;  4BAY A;  4YHH O;  1SQP H;  4LFA O;  1M90 W;  1SC5 B;  5FNV A;  1TGO A;  4DR2 B;  1LUW A;  1OCR C;  3QTC A;  2Q6A A;  2ZE7 A;  1XNR B;  4U3J A;  1MZE A;  2WLL B;  4GKJ B;  5GTH Z;  3OR7 C;  1KBH A;  1BZK A;  1E1Q G;  3UT5 A;  3K04 A;  3H1H H;  2QDO A;  3SPC A;  2W0X A;  4QPJ A;  1P7B A;  5EZY B;  4OXS A;  3HKB B;  3WB2 A;  1QR8 A;  1AI5 A;  3E86 A;  3H01 A;  2DYS B;  4X66 B;  1I7F A;  4JI5 B;  4WFE A;  4FLV A;  1BSM A;  3ABK B;  5JVD A;  3TXQ A;  4ZI7 A;  2V1D A;  1YTF B;  1EN5 A;  2DJV A;  1H2M A;  4IT5 A;  4XDL A;  1YIJ V;  4YJ2 A;  4LF5 O;  1XRE A;  3JAS B;  4DRX B;  4K8Z A;  4G2K A;  1MSD A;  2FYU H;  1PPJ H;  2IBZ H;  2UUC O;  1UJW B;  2W6I G;  2QWP B;  4MVR A;  1WA8 A;  4MVZ A;  4DV3 O;  1Y6X A;  5EC2 C;  1WPX A;  3LSQ A;  1VQ4 V;  1JVM A;  1SZX A;  4MT8 A;  3CCR V;  3OMN B;  2IU3 A;  5KHI A;  2XAS A;  1OCC C;  1K5S A;  2JRI A;  3K79 A;  1B6Q A;  2F4V O;  1PKX A;  1YDX A;  1CPY A;  2R9I A;  1B04 A;  5ITZ B;  3TGU H;  4BW9 A;  1YCI A;  3D36 A;  1F7Y A;  4B3S B;  3ETG A;  3WG7 B;  1HNX O;  3RWR D;  1V55 B;  3JAM N;  1U96 A;  3L71 H;  2YIA A;  3LSU A;  5KX5 B;  4RQE A;  2UXN A;  1YHQ V;  3CCL V;  5CBG A;  2EZO A;  4TUY B;  4DYL A;  4LF4 B;  2R72 A;  3DGE A;  1HR0 O;  2AHZ A;  4UVA A;  2XUM A;  4D7S A;  4LNU A;  3T1Y B;  1VQ8 V;  1VQ5 V;  3QO5 A;  5J2T A;  2IJJ A;  1NBM G;  2MW2 B;  1JA8 A;  5JQG B;  4O2B A;  2JDI G;  4LFB O;  4FK5 C;  1XHZ A;  5LMN B;  1IBK B;  1DK1 A;  1VQO V;  1FXK B;  1Y4M A;  4EEQ A;  4X1Y A;  1ENV A;  2ZR2 A;  1SES A;  1WP7 A;  1AR4 A;  4JAV A;  1KEC A;  1IXM A;  2YDE A;  1BL8 A;  3K0G A;  3BFR A;  2UU9 O;  2N04 A;  5KAI Z;  1FAF A;  1PV0 A;  2QM8 A;  4JI6 B;  3ZIA G;  3RYC B;  3CE2 A;  4TV9 B;  1YXB A;  4I50 B;  4WFF A;  4NB5 A;  3RW0 A;  2VQF O;  1LR1 A;  4O4J B;  5L3D A;  3EHB B;  3B77 A;  1NJI W;  3OFN G;  2Q0A A;  1K34 A;  5KA5 A;  1YSC A;  1I5Y A;  1ZWI C;  2H94 A;  1ARO P;  3K57 A;  3CCV V;  2EIK C;  2CDY A;  3SJC C;  3K3W A;  2YEV B;  2F23 A;  1IBM B;  2YXH A;  4EFE A;  3RBZ A;  2EBO A;  3P30 A;  4FFK A;  1XEQ A;  2DYR B;  2UXD O;  4MS2 A;  2BE3 A;  2YUA A;  1FJG O;  3P3P A;  1N36 O;  1M5I A;  5CA0 A;  2ATK C;  2N05 A;  4F6R A;  1E1R G;  1KU9 A;  4HNA B;  3SPI A;  2YIC A;  4ZHQ B;  4EB6 A;  2GDS A;  2EIN C;  2P7T C;  1DF5 A;  2ITD C;  3W7T A;  1PM9 A;  3N2K B;  1ZX3 A;  1UPG A;  3M8A A;  2YC0 A;  4IIJ B;  3QF7 A;  1SQF A;  5BR8 B;  4BWA A;  4GKK B;  2YIB A;  3ABM C;  2XAG A;  2QE7 G;  4F6E A;  4O4L B;  1LNQ A;  1Y74 B;  3ASO B;  5IY5 B;  4PDR A;  4RQF A;  3B8N A;  5LHH A;  4MSW C;  4KHP O;  3BRC A;  1RPR A;  2PI4 A;  5CB4 A;  4I4T A;  4ZIB A;  3HKC B;  3SYA A;  1FKA O;  2PF4 E;  3N2G B;  1F51 A;  3L75 H;  3JAK B;  5IYB O;  1S5J A;  1AP5 A;  1SS3 A;  2F1M A;  4DUY B;  2L6L A;  5AG2 A;  3OW2 U;  4JYA O;  2YID A;  3SYP A;  2NN4 A;  3ETE A;  4J80 A;  5GON A;  3LSS A;  4JI3 O;  3DXR A;  4WFG A;  5JCO C;  3JD1 A;  2VWJ A;  2VWK A;  3FYE B;  2AZ0 A;  2YXL A;  1FXH A;  1HNW B;  2LW1 A;  1W59 A;  1Q6I A;  2CH7 A;  2QJ1 A;  4Z1V A;  1IUR A;  5KHK A;  1M56 C;  1L0L H;  3SJB C;  3W7W A;  1RPO A;  5LL6 Y;  2VQE O;  5CA1 A;  3ZX6 A;  3SYC A;  2LP7 A;  3G67 A;  1N0N A;  3RYH A;  1VF6 A;  2ZXW C;  1K97 A;  3L74 H;  4JZ2 A;  3JAL A;  5B1A B;  1O9G A;  4GLX A;  1EBO A;  1YTF D;  4X65 O;  2F95 B;  2OTJ V;  2KG7 A; 
#chains in the Genus database with same CATH homology
 4KXR A;  4W4K A;  4J10 A;  4IYI A;  4J41 A;  4J11 A;  4IYH A;  4J7K A;  3FX7 A;  2GTS A;  4J42 A;  2G38 A;  4J7J A;  4W4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...