2GTSA

Structure of protein of unknown function hp0062 from helicobacter pylori
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
VQMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein HP0062 from Helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein HP0062
total genus 33
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2gtsA00
4J7JA 4J7KA 4J41A 3FX7A 4J42A 4J10A 2G38A 2GTSA 4J11A 4KXRA 4W4LA 4IYHA 4W4KA 4IYIA
chains in the Genus database with same CATH superfamily
4JAAA 4UXNA 4ZKIA 2Q7GA 3K04A 3C3SA 3ZRXA 2CGNA 1NTZH 1B6QA 2NN4A 2ILMA 5J2UA 4O4HB 2PYJA 1IZ3A 3RYCB 2LW1A 5EZYB 4Q20A 1HR0B 1GM9A 5KHKA 4NR1A 3WG7B 3ML0A 3RYIB 3E8GA 3BEHA 1P7BA 4PA7A 4X1KB 5LOVB 1T5EA 1SERA 4DV7O 3LUTB 4DR7O 3AG3B 3K5LA 3AG1C 4J11A 3CEIA 3RGBA 1PL0A 5JCOA 4JI5O 1WP7A 4UCUA 4EB6A 4U7OA 5LHIA 1TGOA 1AP5A 4FFBA 4DR6B 3CC4V 3BRCA 1Y76A 2CK3G 3FB5C 4EEQA 1UJWB 3JSLA 5D5QA 1BT8A 3UO2A 1NTKH 4JI6O 3ZJZA 1GAXA 5LA6A 1THZA 2QM7A 4DXWA 1TUBA 1S5JA 4FZ0A 3UKMA 3T1HO 2ARHA 4LF6B 5F2VO 3ZX6A 5LP6B 1I94B 2FYUH 2WSSG 1YTFD 1B3QA 1M9NA 2R9RB 3B2EE 1F23A 5JJJB 4BAYA 2P5OA 5FPRA 4B3TB 2WLHA 2ZT9B 4NXNB 4I0XA 1SZTA 2UXCB 4KHPB 2EBOA 4UVBA 2E5LB 1BGYH 2QTSA 3CJHB 4I0XB 1CXZB 2QTOA 2IJHA 3D3QA 4ZI7A 3OM3B 4LFBB 4R50A 2AZ2A 1I94O 4JZGA 2DQ3A 3ABLB 1J5EO 2ZE7A 2ZIOA 3JD2A 2LW7A 5J2TB 2ITDC 5BY1A 3KZIZ 3H1HH 1B06A 1QVFU 2ZD9A 1YXBA 4DV3O 5CA0A 4N21A 3K3WA 4JI4O 5IY5B 1SQPH 4TV9B 5BXZA 1CEZA 4DV4O 2EILC 1NBMG 5A2QN 1EFRG 3MDSA 3K5OA 3VQVA 1ZLZA 3AG7A 5KMGA 5EIBD 4YIOA 5EBWC 1NZ6A 3IFXA 5IT9N 3OR6C 2WLLB 4DV0B 3E2EA 5CA3A 2IJIA 2NR5A 5JVDA 1KECA 5GW7A 3W7WA 1G6UA 5KA6A 4N23A 1H2SB 3OTFA 1MZFA 3MD0A 4MSWC 4WBNA 1F4MA 4MVOA 1NU1H 4GKKB 1Z5VA 3IGAC 3ZHQA 3BA8A 2OYQA 2IJKA 1V55C 4D6TH 5EIBC 2XTAA 4JYBA 1HDJA 3U11A 5L3DA 3JASA 5DEDA 3K58A 2Y4TA 4YJ2B 3UM7A 4TUYA 1YI2V 2HHHB 4B3SB 3QF7A 4LBEC 4DR4O 4X66B 4TQFA 2YICA 1EZJA 5HFLA 3L73H 4GT1A 2BE3A 4CH5A 1XMQO 3OD4A 5JJNB 1K5SA 4K0KO 2ZINA 1UFIA 2JGDA 5JH7A 5K1PA 1XILA 1FFXB 4P9OA 4DO2A 3BCCH 1NI8A 1R6KA 2QGNA 3KG2A 3OUSA 2CTRA 4NXMB 2A0LA 4JI7B 4LF7O 4JYAO 1YHQV 3RYIA 4J7KA 2WLJA 4ZOLA 2WAMA 1D5NA 3J81N 3IC7A 3JASB 3ABLC 2HR3A 4MTFA 3FD9A 3K5NA 1PP9H 1A32A 1AI7A 4JTDB 3IJ4A 3SJQC 1AR1B 3CYOA 1H2KA 4FM0A 1JJ2U 2LJ2A 4TWKA 4CH6A 4DYLA 4I55B 2VWKA 1VQ5V 1SQXH 1VQ6V 1TVKB 2Q5ZA 4F6RB 4DV1O 3K9AA 2K9PA 4ZI7B 1MOFA 3ZN0A 3HB3B 3TXSA 4FLTA 4O4LA 4ZBMA 1OZ0A 3L74H 5B66Z 1OCCC 1BSMA 3ZRWB 5KA5A 2JDIG 3OE7G 2Q67A 4LFCO 3K0DA 1M57B 5LYJA 1GM8A 4AI8A 1XDCA 1FS0G 1VQ7V 4E2LA 2E74B 3RVYA 2VQFO 3ICXA 4X64O 1GM7A 1JA8A 2XAHA 2YXLA 4FM1A 4G2KA 1S76D 4BW9A 1OCCB 1M56C 4LH7A 1URFA 2M6YA 4X66O 2CH7A 2BTOA 1R3LC 3WB2A 3S3WA 4GKJB 3CCEV 4F6RA 2RDCA 5B1BC 4JYCA 2UU9B 2WPDG 4JI1B 4OXSA 1RPRA 1DK1A 1AJQA 1BQ0A 1MNGA 3IAYA 4B7KA 3AG1B 4MVZA 2D2CB 1VARA 2XAGA 1HW7A 1US6A 1ZWIC 1VF6A 2H8PC 3H1LH 1VQ9V 1Q90D 2FTKA 3JAKA 2W0FC 4J10A 4X1KA 2UXDO 2EINC 3W7XA 3F7YC 3JATB 1RSOB 1P49A 4GZRB 1Q81W 2QE7G 2JJ2G 2F4VB 2Y0IA 3FAVB 2AW9A 2X6BA 3FB7C 4CS4A 4QJFB 4TQDA 3ZBHA 4DV4B 4DK1A 1OCOC 4PELA 1TUEB 4KFMA 5BMVB 2HJDA 4FLZA 4FLYA 2YS8A 1E79G 3VBBA 1N33B 5H2FZ 1AI5A 1MABG 1IDSA 2A3QA 1AB3A 1H2MA 2CAZC 5IJ9B 3CCJV 4UCSA 3K0GA 4X64B 3WU2Z 2QWPB 2P06A 4PA6A 1I08A 3B77A 5KX5B 2VQFB 1XQ8A 3G67A 2B5UA 3J80N 1JVMA 1SQBH 2XT9A 3ZCCA 1RSOA 3FAVA 3R66A 3HKCA 3K9SA 2QWNB 4H33A 3K06A 1S77D 3W7UA 3QVNA 1WNSA 2JGUA 3ETQA 3SYAA 3GWOA 3EVKA 4BIUA 1FPOA 4LFCB 4JI6B 1Q6IA 3D36A 3SPIA 4B08A 1QLNA 5B1BB 5LMUB 1KBHA 3JCUZ 4RWUA 4FZ1A 2EIMC 4LF9O 2JK5C 5KAIZ 5EC2C 4BIOA 5LMUO 2DMXA 2GTAA 3SYCA 1VF7A 2AHZA 1IBKB 1GK9A 1WB7A 1G8MA 3N2GB 1Q5OA 2KQXA 2PI5A 4WFFA 1I0HA 5AG2A 5EC1C 4EFEA 3HKCB 4XDKA 5BMVA 3SR2C 1V55B 4B7EA 4FLWA 1FJGB 1IBLO 4CZZA 1ENVA 1SA0B 3FYEB 4HBNA 4FLUA 3AG4B 5LBQA 2UXXA 4LF7B 4X1YB 4WFBV 1TUBB 1WPXA 4IYHA 4JPRA 1G1XB 1JPXA 5DM6V 4I5SA 2P7TC 2ZE5A 3OEHG 4WCEV 2P90A 1N36O 5CBHA 3D3IA 3ZS8C 1OCOB 1CPYA 1M4UA 3I5DA 3BHPA 4CC5A 2XUMA 5E1AC 2E76B 1TAEA 3CCRV 3CE2A 4UCVA 1Q82W 4YJ2A 1LNQA 3ASOC 5IWAB 3E22B 3HKEB 2E3CA 3OT7A 3S3XA 4QE7A 4O2BA 4BIZA 3F5TA 3C90A 4HNAA 2N05A 2UUCB 4X20A 3ZHUA 4JI0B 2EZPA 3CP1A 2OIGA 4WBNB 3LSSA 1NR1A 4NTWA 2PY5A 3U10A 2KSDA 1N0JA 2Y0PA 1OJHA 1VMGA 1VQOV 1KKCA 3BABA 4DRXA 2PYLA 4Z1MG 4JV5O 1R6TA 1EBOA 1NTMH 4ZIBA 2QR4A 4DV3B 4I4TB 1VQKV 2DWDC 3ZEDA 3N27A 2XAQA 4FFBB 4HNAB 3L71H 4JGSA 4NKGB 2YEVB 1ZL8B 4RUFA 3LDCA 2JS3A 2YEVA 4K8XA 1O9GA 3K5MA 3UO3A 1FXHA 5FNVB 4JI7O 2E5LO 4KHPO 1BS3A 5H5NA 1ROPA 5L3FA 4U3FH 3RN4A 1QLEB 1SZXA 2Q4PA 5B1AC 1YZBA 4K0KB 3ABUA 1WB8A 3T1YB 1XI1A 2NLJC 1L0LH 3AG4C 2DQ0A 2OCCB 5BR8O 1Q43A 2BSKB 1GN3A 3ASNC 2ZM6O 4MW8A 1SQFA 4B3RB 3P30A 4IIJB 2WLIB 3JAWA 2X6CA 1F51A 4PD4F 2LFRA 5B1AB 4MTXA 3A0HZ 3H01A 4UCTA 2Z5UA 4ZHQA 5LGUA 4H37A 3BY6A 5LA6B 4RQFA 2F43G 3ASNB 1HNWO 5CBGA 1AROP 3ASOB 3ABMB 1BCCH 5EYPA 3FB8C 4UVAA 1FFTB 4JV5B 2RNBA 4G27B 1R3JC 3CRCA 4FFKA 1OCRB 2JRIA 2GSMB 3CXCU 2V7QG 1NVPB 3FB6C 2Q69A 2IH3C 1ZX3A 5LOVA 4DR2B 2BOCC 1Y4MA 4OPHA 2YDEA 3QO8A 4U3JB 2O57A 1K3EA 3CJHA 3AEIA 4JI5B 1ZSPA 1S72V 1KP3A 4PA4A 1SKVA 1O9HA 5B5EZ 2LGQA 4UV8A 1XL4A 4FIPC 4GX0A 2A9HA 2UUCO 2VQEB 5CB4A 4FLXA 2IW5A 2CDYA 1WAZA 3AK3A 4JAUA 2XAJA 3RT3C 2QSAA 4QNHB 2OIEA 1H8EG 4PA3A 3VQWA 1HNWB 1U97A 4O4HA 3BA9A 3CRRA 2F23A 5E79Z 2OTLV 2W6JG 4KP4A 2Q0OC 5K1XA 1E1QG 4KUMA 1QBZA 1W0JG 2ZKOA 1XNRB 3VQXA 4TV8A 4JI1O 4J9YB 4JI3O 3OFNG 4L87A 3CMAV 1QCEA 2QDOA 5B3SC 1N32B 1BZKA 1M57C 3THOA 4DW1A 2UUBB 2BTQB 1Y67A 4PDRA 1YITV 3CCVV 4LP8A 2QKAA 1ZTEA 4A5UB 1KC8W 3HR0A 1PNMA 3Q4HB 3U0ZA 1M90W 1IBLB 1ORQC 5IJ0A 3HKBA 5CA1A 3MHSC 3DXRB 2OCCC 3JALA 4R7CA 4X20B 1M56B 3G4SV 4PDMA 4OX9B 3NR7A 5J2UB 1IBKO 3IC9A 4NB5A 3QG5A 3W7TA 2WA3A 3O65A 4PI2A 1COWG 1XUQA 4LR3A 1JFFB 4O2AB 4BW5A 1S3JA 5GTIZ 1JOYA 4KL1A 3RW0A 4J9ZB 4MW3A 1GKFA 2ZCEA 3JAWB 3CCMV 4DRXB 4X62B 1FYJA 2N74A 2VS0A 3ZHVA 3LNNA 1WN7A 4D7TA 5KAFZ 4DV7B 3PN1A 2AGAA 3RYHB 1NJIW 2WLIA 5KHIA 2RMKB 2V4DA 2JIZG 2EINB 3DXRA 3T4ZA 1OCRC 1DLBA 1F7YA 5JWPA 1L1FA 1VQPV 2HVKC 1QVGU 1D2DA 1LUVA 1SA0A 1LUWA 1AILA 2JJ1G 2UUBO 2YSUB 4O4IA 1IURA 3CRQA 3VOUA 3R65A 4DV6B 1KB9F 3RYCA 3FKSG 2CGOA 1HNXO 3EFFK 5IE9A 3J7AU 2AHYA 2QJ1A 1XMQB 4JTCB 2CTPA 3CHXA 2Q7HA 4UCOA 5CN0A 5KMGB 3TXQA 5LP6A 1KQSU 1HP8A 1NR7A 5LMNB 1N34O 1DF4A 2IBZH 5EK0A 3E35A 2PGGA 2HHHO 4MVQA 4B3SO 1SESA 3GVMA 1PL4A 2MW2B 2ZDIC 1FAFA 1JMKC 4X8AA 3HKEA 2KB1A 3QTCA 1R1BA 3P3PA 4DR6O 2GHYA 2ZE6A 5L3BA 3M99B 2AZ0A 4RUEA 3SDLA 5A9GA 3PJSK 2GDSA 3CWBH 2ETNA 1MG1A 4PA9A 2CTQA 2N04A 2IU0A 2Q6AA 4ZOLB 2ZIMA 1M1KW 5C8YA 1GH6A 4U3JA 4GUNA 2V1DA 2GUZB 3L9DA 1QHTA 1VQ8V 2CTWA 4I9QA 3B8MA 1NQTA 3RFRA 2LQTA 4GX2A 3KCYA 3H9VA 3DC6A 2EIMB 3LSUA 1YJNV 2DN9A 5J9PC 2XOKG 4LH6A 4IHJB 5CB4B 4ZHQB 2X0LA 4CH3A 1R3IC 2QEXV 4C7UA 2A79B 1GTOA 2YIBD 4OPAA 1J5EB 1YEWA 2Q8VA 4B3MB 1VEWA 4DUYB 3B8NA 1VQMV 4YJ3A 1KKDA 2ZE8A 1L0NH 5KUKA 4PDVA 1XNQO 3K57A 1NH2B 1B04A 5JVDB 2PUSA 1Q86W 4JI3B 1H2GA 4HAMA 3SYPA 2WLLA 4YY3O 3APQA 3RWRD 4AQYB 3ZRWA 5BZBA 5IYDO 2HVJC 5CMUA 4GLXA 3A8TA 2EIKB 1GN6A 4QIWF 2CE4A 3KCXA 4IHJA 5JQGA 1JCHA 3W7SA 1RPOA 5J2TA 1K4DC 2ZR3A 4MVUA 2MK3A 2GTSA 1UPGA 1GO3F 3L70H 2UXNA 2KG7B 3ZMTA 4EB6B 4X65O 1RM1B 1D5AA 1ZUQA 1XREA 2BSKA 4QPJA 4WFEA 1RP3B 4FLVA 4DR7B 1BE3H 1AR5A 1N0NA 3AK2A 1VF5B 3I56V 1K73W 2GBOA 2HFEC 5CA1B 4JTAB 4JI8O 2ZNIA 1PM9A 1BMFG 4XDJA 4LF5B 3K08A 1Q6UA 3CRMA 3K59A 5IWAO 4CS2A 5LHGA 2ODMA 2ATKC 2NNUA 4BWAA 4DR4B 5FNVA 4FK5C 1KD1W 4YXWG 4H44B 2HP8A 1J95A 4JI0O 5B1OA 2UUAO 4PI0A 3MAQA 4PJ0Z 1SRYA 4FPPA 3DGEA 1NH2D 1H38A 3OMIB 3E86A 2UUAB 3EHBB 5CBFA 2EJ7A 3CC7V 3HKDA 1PPJH 3OUFA 3ABKB 1I5XA 1YJ9V 3JARB 2R9AA 4JI2B 5LXTA 1H2LA 4I9WA 4PV1B 4LF5O 2IU3A 1QLEC 5FL7G 2YXHA 3CCUV 2VQEO 1N36B 2WLMA 1HNXB 1NS1A 2RJZA 3SPJA 2L6LA 1K33A 4DV2O 2P22C 4DV0O 2LFSA 5JH7B 2OCHA 4DV6O 2F1MA 3TJTA 4LFAO 5EBLC 4WFAV 2RN9A 4OGQB 4DR2O 3CCLV 2DE0X 5KX5A 1IVSA 3H1JH 4UCRA 5TISZ 1HWYA 4K8ZA 5DECA 3HKDB 2QKCA 4FJCC 5JJEB 1NT2B 4ASUG 3CMEV 1HNZB 2F95B 3B4SA 2AXTZ 3T1CA 2D3OW 3ABMC 3ZHTA 1ZL8A 1GRJA 4I4TA 3QNEA 3CD6V 5KHJA 2XHBA 1IBMO 5LHHA 5KHGA 2UU9O 3QO7A 2PF4E 2QWOB 2ZNJA 4NTYA 4QGPA 5IYZB 1BL8A 4LF4B 3SPGA 3RVZA 1XMOO 1XNQB 1KU9A 1QQCA 3SJCC 1YTFB 4H13B 2R9IA 5IYBO 3STZC 2WWWA 5BR8B 5ITZB 1SC5B 1YCIA 2EULA 1WPBA 4DR3B 3JATA 4DR3O 4FM2A 1SQQH 4FVMA 3G80A 4TV8B 4CH4A 4IT5A 2EX3A 1SETA 3ZMVA 4LWSA 2HLDG 4MVSA 2F66C 1PKXA 4TT3G 1N33O 1K5QA 4LF4O 4UVCA 3GB7C 1Y74A 5LGNA 3CC2V 3JARA 2YXYA 1KYOF 1Y76B 1XNRO 2LP7A 3DTUB 2FB5A 1P7GA 3A0BZ 3APOA 1WP8A 3WB1A 3VQYA 2FL4A 4JF3A 2B9ZA 1R3KC 5IYCO 5B3SB 1VP7A 4PHZA 1FXVA 2Q7EA 1V54B 3JD4A 1GMGA 4KXRA 2W6IG 1PD3A 1W59A 1VQLV 1I5YA 5L3EA 4J42A 1SF9A 1Q3EA 1X4TA 4AILC 2DJVA 4J7JA 2ZDIA 5KUMA 3TK1A 3JCZA 2PZSA 3B40A 2H3OA 3AK1A 2GUZA 4O4JA 1Y6XA 3N2KA 2Q73A 2XASA 4U7NA 2DOSA 3N2KB 1KP2A 4JZ2A 3F7VC 2QWQB 4W4KA 1WLEA 2Z3YA 4LF9B 4O4LB 2B1IA 3RYHA 1VQNV 1S5LZ 1K9MW 2P6JA 2F93B 3JD1A 5H9CA 1S0VA 4MVRA 3FYIB 2R70A 3C3TA 1L8DA 2PI4A 1Q6HA 4ICGA 1DF5A 5L3GA 5IJ9A 1IXMA 1N34B 1N8RW 2Q9LA 4X9QA 1BHBA 2M7WA 3EXAA 4O2AA 4AQYO 2X7RB 1XBLA 2VWJA 4IYIA 2CH7B 2HG5C 4UUJC 5B1NA 3B09A 2EIKC 2Y69C 3OW2U 3SYOA 3M7MX 2UXCO 4NXNO 4O4JB 3CX5F 1WA8B 5L3CA 1GN2A 4LC1A 3CSXA 3WG7C 2EZOA 1Y66A 1IXBA 4B3MO 1XEQA 3OAAG 3UQ8A 1FJGO 3CS5A 3AG3C 2JGDB 1OHHG 4MTGA 1QU7A 3UT5B 1XMOB 4EKWA 1EN4A 4X62O 3QO5A 4MT8A 2DYSC 5JQGB 3X2QC 3G71V 1FD9A 2YI9A 5EYPB 1EZVH 4DV1B 3OR7C 1FXKC 2ZXWC 3H1IH 3O9OA 2F4VO 1SQGA 2JVDA 2A06H 1H2NA 2K1EA 1FKAO 1ZAUA 1OCZB 1DTOA 2DYSB 1VF6C 3X2QB 2LGWA 1GN4A 2BCCH 3JALB 5LP6C 3TCUA 4LF8O 1Q7YW 4O4IB 3L75H 5EZYA 2XAFA 3P3NA 1W2BU 4Z2WA 1V9PA 1HR0O 1K7DA 1FFXA 1SQVH 3ABKC 1PNLA 4CS3A 3ZRSA 1N32O 1AI6A 2A7WA 2YI8A 1P4RA 3LDDA 3WB0A 3SPCA 2QM8A 5GONB 5LYJB 1YSCA 1VQ4V 5FLXN 4E4EA 4DUZO 4LF6O 2FKXA 3T2MA 3ETEA 3KKYA 4XDLA 4GKJO 2ADPA 4K3AA 3BFRA 2OT5A 4NTXA 2B1GA 3UCSC 4Z1VA 1QR9A 3JD0A 4J80A 4QE9A 1N4CA 2ZR2A 4YIPA 3MHHC 4IIJA 3CRAA 3LSQA 4K35A 4LNUA 3ZRVA 3ABTA 1MMMA 3LDEA 2VRZA 2EILB 4J7ZA 3M8AA 5GTHZ 4X89A 1QNMA 4HZ3A 5JCOC 3ETGA 4I50B 2YC0A 3AG2B 4RQEA 3FX7A 3H1KH 4I50A 5HFMA 2E75B 2Y4UA 1IBMB 5DN6G 1Z2GA 3JAKB 1M5IA 1R6NA 4JASA 1SS3A 1Z5WA 4JI4B 1CP9A 4YHHB 3OEEG 4DR5B 2C2AA 4LCUC 3WFVA 3A0RA 3SYQA 2HKOA 1EN5A 3L72H 4P30A 3D36C 3E22A 3HPLC 2HJFC 2R72A 1K97A 3TETA 2WLKA 4H0LB 4LFAB 1RM1C 3JAMN 3BVOA 3T4DA 4B3RO 4QPKA 1AI4A 1X59A 5GONA 4FMTA 5ITZA 3UT5A 5LMNO 1OCZC 4X1YA 3OTOB 4DV2B 2RQ6A 1EN6A 2KKWA 3E89A 4UV9A 2OTJV 3RYFA 5C8YB 2EJRA 4ABMA 4DV5B 4YY3B 3CB2A 2RCVA 4L8JA 1XL6A 1Q8IA 3RYFB 2EIJB 2GV9A 1AJPA 1W0KG 3G6EV 2JEXA 4JI2O 1M93A 4RAIA 3ZHRA 4JYYA 4YJ3B 1V54C 3D8CA 4GX1A 4O2BB 1EM1A 4XBFA 3LNMB 1KMIZ 3OMNB 3OGCC 4GYCB 1K92A 2G38A 4HYOA 1NKDA 3E83A 2W0XA 1TVKA 5D5PA 2EIJC 3T1HB 4R6ZA 3OGIB 4R8CA 4GKKO 1DGSA 3DC5A 4UB8Z 2QM4A 4DK0A 1QR8A 5KLVH 1JFFA 1BQZA 4YHHO 3ZN1A 4DR5O 2IJJA 3JD3A 2YIBA 4DR1B 4WF9V 4JI8B 1YDXA 4J41A 2DW4A 2P4VA 2IH1C 4JAVA 4PDLA 3ZMUA 4NYKA 3ZMZA 3ZMSA 5EBMC 3OMAB 3ZIAG 1WA8A 3AG2C 1F4NA 4JYAB 4X65B 1WJZA 2ITCC 3SPHA 5KHHA 2QKSA 2DYRB 3Q4HA 3K79A 1OV9A 1AJNA 4EFBA 5IDJA 1YJWV 2P67A 3P32A 3CXHF 2UXDB 4X1IB 4CC6A 4DR1O 4TSFG 2HEPA 2Y69B 2DWEC 1U96A 4GCZA 1YIJV 2PTMA 1S5HC 2ZQMA 2DYRC 4MVMA 2UXBO 4RO2A 4DUZB 1BHAA 3RBZA 1LR1A 3A2FA 4LFBO 1IX9A 1H8HG 3E8HA 2UXBB 2JEUA 2YIDA 3I55V 3CCQV 2OWOA 3JSNA 4BR6A 4LWSB 4WFGA 4LF8B 3HKBB 2BTQA 1MA1A 4DV5O 3TGUH 1K4CC 3CPWU 2JS5A 5IYZA 2QWRB 1FXKB 3SJAC 2ZXWB 3FFQA 4F6EA 1K34A 3OTOO 2LO1A 4X88A 2YIAA 4AHCA 1RFYA 2Y48A 1PNKA 4P2ZA 5H6RA 1R73A 1P84F 4TV9A 5H6QA 3BPZA 1MSDA 1PV0A 2YUAA 3STLC 1AVMA 2Q68A 5CA0B 4DW0A 4P9PA 1JX9A 2WLNA 4TUYB 1YF2A 3ETDA 1AR4A 2H94A 1K8AW 1JR9A 2Z0AA 1MSWD 1I7FA 1NVPD 1HNZO 2P4KA 1XOUA 4UB6Z 4X1IA 5LGTA 1MZEA 2Q0AA 4GX5A 3JYCA 3BAAA 5LL6Y 1KUQA 2ADQB 4IGGA 3CCSV 4MS2A 4MTOA 3SGIA 1XHZA 4I7ZB 5IJ0B 4TOIA 2L35A 1TA8A 1FXKA 4Q6GA 4OX9O 1AP6A 2X6AA 4NXMO 4UFZA 4D7SA 2ZM6B 4B3TO 1VIBA 5C93A 4W4LA 1JQ0A 3T1YO 1JJOA 4DUYO 3E8FA 3ZHSA 2IM9A 2XNDG 3SJBC 3F5WC 4CBCA 4WFHA 3GWKC 3E8BA 1G4YB 1XHXA 1YVWA 3G6BA 4NVPA 5LXTB 2FMLA 3DSQA 3N2GA 2KG7A 4I55A 4F4LA 2CUGA 3NXSA 1Y74B 2BOBC 2QA4V 4G28B 2WA4A 3K03A 4LNUB 1E1RG 4IL6Z 5FPOA 5IY5C
chains in the Genus database with same CATH topology
4J7JA 4J7KA 4J41A 3FX7A 4J42A 4J10A 2G38A 2GTSA 4J11A 4KXRA 4W4LA 4IYHA 4W4KA 4IYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7J A;  4J7K A;  4J41 A;  3FX7 A;  4J42 A;  4J10 A;  2G38 A;  2GTS A;  4J11 A;  4KXR A;  4W4L A;  4IYH A;  4W4K A;  4IYI A; 
#chains in the Genus database with same CATH topology
 4JAA A;  4UXN A;  4ZKI A;  2Q7G A;  3K04 A;  3C3S A;  3ZRX A;  2CGN A;  1NTZ H;  1B6Q A;  2NN4 A;  2ILM A;  5J2U A;  4O4H B;  2PYJ A;  1IZ3 A;  3RYC B;  2LW1 A;  5EZY B;  4Q20 A;  1HR0 B;  1GM9 A;  5KHK A;  4NR1 A;  3WG7 B;  3ML0 A;  3RYI B;  3E8G A;  3BEH A;  1P7B A;  4PA7 A;  4X1K B;  5LOV B;  1T5E A;  1SER A;  4DV7 O;  3LUT B;  4DR7 O;  3AG3 B;  3K5L A;  3AG1 C;  4J11 A;  3CEI A;  3RGB A;  1PL0 A;  5JCO A;  4JI5 O;  1WP7 A;  4UCU A;  4EB6 A;  4U7O A;  5LHI A;  1TGO A;  1AP5 A;  4FFB A;  4DR6 B;  3CC4 V;  3BRC A;  1Y76 A;  2CK3 G;  3FB5 C;  4EEQ A;  1UJW B;  3JSL A;  5D5Q A;  1BT8 A;  3UO2 A;  1NTK H;  4JI6 O;  3ZJZ A;  1GAX A;  5LA6 A;  1THZ A;  2QM7 A;  4DXW A;  1TUB A;  1S5J A;  4FZ0 A;  3UKM A;  3T1H O;  2ARH A;  4LF6 B;  5F2V O;  3ZX6 A;  5LP6 B;  1I94 B;  2FYU H;  2WSS G;  1YTF D;  1B3Q A;  1M9N A;  2R9R B;  3B2E E;  1F23 A;  5JJJ B;  4BAY A;  2P5O A;  5FPR A;  4B3T B;  2WLH A;  2ZT9 B;  4NXN B;  4I0X A;  1SZT A;  2UXC B;  4KHP B;  2EBO A;  4UVB A;  2E5L B;  1BGY H;  2QTS A;  3CJH B;  4I0X B;  1CXZ B;  2QTO A;  2IJH A;  3D3Q A;  4ZI7 A;  3OM3 B;  4LFB B;  4R50 A;  2AZ2 A;  1I94 O;  4JZG A;  2DQ3 A;  3ABL B;  1J5E O;  2ZE7 A;  2ZIO A;  3JD2 A;  2LW7 A;  5J2T B;  2ITD C;  5BY1 A;  3KZI Z;  3H1H H;  1B06 A;  1QVF U;  2ZD9 A;  1YXB A;  4DV3 O;  5CA0 A;  4N21 A;  3K3W A;  4JI4 O;  5IY5 B;  1SQP H;  4TV9 B;  5BXZ A;  1CEZ A;  4DV4 O;  2EIL C;  1NBM G;  5A2Q N;  1EFR G;  3MDS A;  3K5O A;  3VQV A;  1ZLZ A;  3AG7 A;  5KMG A;  5EIB D;  4YIO A;  5EBW C;  1NZ6 A;  3IFX A;  5IT9 N;  3OR6 C;  2WLL B;  4DV0 B;  3E2E A;  5CA3 A;  2IJI A;  2NR5 A;  5JVD A;  1KEC A;  5GW7 A;  3W7W A;  1G6U A;  5KA6 A;  4N23 A;  1H2S B;  3OTF A;  1MZF A;  3MD0 A;  4MSW C;  4WBN A;  1F4M A;  4MVO A;  1NU1 H;  4GKK B;  1Z5V A;  3IGA C;  3ZHQ A;  3BA8 A;  2OYQ A;  2IJK A;  1V55 C;  4D6T H;  5EIB C;  2XTA A;  4JYB A;  1HDJ A;  3U11 A;  5L3D A;  3JAS A;  5DED A;  3K58 A;  2Y4T A;  4YJ2 B;  3UM7 A;  4TUY A;  1YI2 V;  2HHH B;  4B3S B;  3QF7 A;  4LBE C;  4DR4 O;  4X66 B;  4TQF A;  2YIC A;  1EZJ A;  5HFL A;  3L73 H;  4GT1 A;  2BE3 A;  4CH5 A;  1XMQ O;  3OD4 A;  5JJN B;  1K5S A;  4K0K O;  2ZIN A;  1UFI A;  2JGD A;  5JH7 A;  5K1P A;  1XIL A;  1FFX B;  4P9O A;  4DO2 A;  3BCC H;  1NI8 A;  1R6K A;  2QGN A;  3KG2 A;  3OUS A;  2CTR A;  4NXM B;  2A0L A;  4JI7 B;  4LF7 O;  4JYA O;  1YHQ V;  3RYI A;  4J7K A;  2WLJ A;  4ZOL A;  2WAM A;  1D5N A;  3J81 N;  3IC7 A;  3JAS B;  3ABL C;  2HR3 A;  4MTF A;  3FD9 A;  3K5N A;  1PP9 H;  1A32 A;  1AI7 A;  4JTD B;  3IJ4 A;  3SJQ C;  1AR1 B;  3CYO A;  1H2K A;  4FM0 A;  1JJ2 U;  2LJ2 A;  4TWK A;  4CH6 A;  4DYL A;  4I55 B;  2VWK A;  1VQ5 V;  1SQX H;  1VQ6 V;  1TVK B;  2Q5Z A;  4F6R B;  4DV1 O;  3K9A A;  2K9P A;  4ZI7 B;  1MOF A;  3ZN0 A;  3HB3 B;  3TXS A;  4FLT A;  4O4L A;  4ZBM A;  1OZ0 A;  3L74 H;  5B66 Z;  1OCC C;  1BSM A;  3ZRW B;  5KA5 A;  2JDI G;  3OE7 G;  2Q67 A;  4LFC O;  3K0D A;  1M57 B;  5LYJ A;  1GM8 A;  4AI8 A;  1XDC A;  1FS0 G;  1VQ7 V;  4E2L A;  2E74 B;  3RVY A;  2VQF O;  3ICX A;  4X64 O;  1GM7 A;  1JA8 A;  2XAH A;  2YXL A;  4FM1 A;  4G2K A;  1S76 D;  4BW9 A;  1OCC B;  1M56 C;  4LH7 A;  1URF A;  2M6Y A;  4X66 O;  2CH7 A;  2BTO A;  1R3L C;  3WB2 A;  3S3W A;  4GKJ B;  3CCE V;  4F6R A;  2RDC A;  5B1B C;  4JYC A;  2UU9 B;  2WPD G;  4JI1 B;  4OXS A;  1RPR A;  1DK1 A;  1AJQ A;  1BQ0 A;  1MNG A;  3IAY A;  4B7K A;  3AG1 B;  4MVZ A;  2D2C B;  1VAR A;  2XAG A;  1HW7 A;  1US6 A;  1ZWI C;  1VF6 A;  2H8P C;  3H1L H;  1VQ9 V;  1Q90 D;  2FTK A;  3JAK A;  2W0F C;  4J10 A;  4X1K A;  2UXD O;  2EIN C;  3W7X A;  3F7Y C;  3JAT B;  1RSO B;  1P49 A;  4GZR B;  1Q81 W;  2QE7 G;  2JJ2 G;  2F4V B;  2Y0I A;  3FAV B;  2AW9 A;  2X6B A;  3FB7 C;  4CS4 A;  4QJF B;  4TQD A;  3ZBH A;  4DV4 B;  4DK1 A;  1OCO C;  4PEL A;  1TUE B;  4KFM A;  5BMV B;  2HJD A;  4FLZ A;  4FLY A;  2YS8 A;  1E79 G;  3VBB A;  1N33 B;  5H2F Z;  1AI5 A;  1MAB G;  1IDS A;  2A3Q A;  1AB3 A;  1H2M A;  2CAZ C;  5IJ9 B;  3CCJ V;  4UCS A;  3K0G A;  4X64 B;  3WU2 Z;  2QWP B;  2P06 A;  4PA6 A;  1I08 A;  3B77 A;  5KX5 B;  2VQF B;  1XQ8 A;  3G67 A;  2B5U A;  3J80 N;  1JVM A;  1SQB H;  2XT9 A;  3ZCC A;  1RSO A;  3FAV A;  3R66 A;  3HKC A;  3K9S A;  2QWN B;  4H33 A;  3K06 A;  1S77 D;  3W7U A;  3QVN A;  1WNS A;  2JGU A;  3ETQ A;  3SYA A;  3GWO A;  3EVK A;  4BIU A;  1FPO A;  4LFC B;  4JI6 B;  1Q6I A;  3D36 A;  3SPI A;  4B08 A;  1QLN A;  5B1B B;  5LMU B;  1KBH A;  3JCU Z;  4RWU A;  4FZ1 A;  2EIM C;  4LF9 O;  2JK5 C;  5KAI Z;  5EC2 C;  4BIO A;  5LMU O;  2DMX A;  2GTA A;  3SYC A;  1VF7 A;  2AHZ A;  1IBK B;  1GK9 A;  1WB7 A;  1G8M A;  3N2G B;  1Q5O A;  2KQX A;  2PI5 A;  4WFF A;  1I0H A;  5AG2 A;  5EC1 C;  4EFE A;  3HKC B;  4XDK A;  5BMV A;  3SR2 C;  1V55 B;  4B7E A;  4FLW A;  1FJG B;  1IBL O;  4CZZ A;  1ENV A;  1SA0 B;  3FYE B;  4HBN A;  4FLU A;  3AG4 B;  5LBQ A;  2UXX A;  4LF7 B;  4X1Y B;  4WFB V;  1TUB B;  1WPX A;  4IYH A;  4JPR A;  1G1X B;  1JPX A;  5DM6 V;  4I5S A;  2P7T C;  2ZE5 A;  3OEH G;  4WCE V;  2P90 A;  1N36 O;  5CBH A;  3D3I A;  3ZS8 C;  1OCO B;  1CPY A;  1M4U A;  3I5D A;  3BHP A;  4CC5 A;  2XUM A;  5E1A C;  2E76 B;  1TAE A;  3CCR V;  3CE2 A;  4UCV A;  1Q82 W;  4YJ2 A;  1LNQ A;  3ASO C;  5IWA B;  3E22 B;  3HKE B;  2E3C A;  3OT7 A;  3S3X A;  4QE7 A;  4O2B A;  4BIZ A;  3F5T A;  3C90 A;  4HNA A;  2N05 A;  2UUC B;  4X20 A;  3ZHU A;  4JI0 B;  2EZP A;  3CP1 A;  2OIG A;  4WBN B;  3LSS A;  1NR1 A;  4NTW A;  2PY5 A;  3U10 A;  2KSD A;  1N0J A;  2Y0P A;  1OJH A;  1VMG A;  1VQO V;  1KKC A;  3BAB A;  4DRX A;  2PYL A;  4Z1M G;  4JV5 O;  1R6T A;  1EBO A;  1NTM H;  4ZIB A;  2QR4 A;  4DV3 B;  4I4T B;  1VQK V;  2DWD C;  3ZED A;  3N27 A;  2XAQ A;  4FFB B;  4HNA B;  3L71 H;  4JGS A;  4NKG B;  2YEV B;  1ZL8 B;  4RUF A;  3LDC A;  2JS3 A;  2YEV A;  4K8X A;  1O9G A;  3K5M A;  3UO3 A;  1FXH A;  5FNV B;  4JI7 O;  2E5L O;  4KHP O;  1BS3 A;  5H5N A;  1ROP A;  5L3F A;  4U3F H;  3RN4 A;  1QLE B;  1SZX A;  2Q4P A;  5B1A C;  1YZB A;  4K0K B;  3ABU A;  1WB8 A;  3T1Y B;  1XI1 A;  2NLJ C;  1L0L H;  3AG4 C;  2DQ0 A;  2OCC B;  5BR8 O;  1Q43 A;  2BSK B;  1GN3 A;  3ASN C;  2ZM6 O;  4MW8 A;  1SQF A;  4B3R B;  3P30 A;  4IIJ B;  2WLI B;  3JAW A;  2X6C A;  1F51 A;  4PD4 F;  2LFR A;  5B1A B;  4MTX A;  3A0H Z;  3H01 A;  4UCT A;  2Z5U A;  4ZHQ A;  5LGU A;  4H37 A;  3BY6 A;  5LA6 B;  4RQF A;  2F43 G;  3ASN B;  1HNW O;  5CBG A;  1ARO P;  3ASO B;  3ABM B;  1BCC H;  5EYP A;  3FB8 C;  4UVA A;  1FFT B;  4JV5 B;  2RNB A;  4G27 B;  1R3J C;  3CRC A;  4FFK A;  1OCR B;  2JRI A;  2GSM B;  3CXC U;  2V7Q G;  1NVP B;  3FB6 C;  2Q69 A;  2IH3 C;  1ZX3 A;  5LOV A;  4DR2 B;  2BOC C;  1Y4M A;  4OPH A;  2YDE A;  3QO8 A;  4U3J B;  2O57 A;  1K3E A;  3CJH A;  3AEI A;  4JI5 B;  1ZSP A;  1S72 V;  1KP3 A;  4PA4 A;  1SKV A;  1O9H A;  5B5E Z;  2LGQ A;  4UV8 A;  1XL4 A;  4FIP C;  4GX0 A;  2A9H A;  2UUC O;  2VQE B;  5CB4 A;  4FLX A;  2IW5 A;  2CDY A;  1WAZ A;  3AK3 A;  4JAU A;  2XAJ A;  3RT3 C;  2QSA A;  4QNH B;  2OIE A;  1H8E G;  4PA3 A;  3VQW A;  1HNW B;  1U97 A;  4O4H A;  3BA9 A;  3CRR A;  2F23 A;  5E79 Z;  2OTL V;  2W6J G;  4KP4 A;  2Q0O C;  5K1X A;  1E1Q G;  4KUM A;  1QBZ A;  1W0J G;  2ZKO A;  1XNR B;  3VQX A;  4TV8 A;  4JI1 O;  4J9Y B;  4JI3 O;  3OFN G;  4L87 A;  3CMA V;  1QCE A;  2QDO A;  5B3S C;  1N32 B;  1BZK A;  1M57 C;  3THO A;  4DW1 A;  2UUB B;  2BTQ B;  1Y67 A;  4PDR A;  1YIT V;  3CCV V;  4LP8 A;  2QKA A;  1ZTE A;  4A5U B;  1KC8 W;  3HR0 A;  1PNM A;  3Q4H B;  3U0Z A;  1M90 W;  1IBL B;  1ORQ C;  5IJ0 A;  3HKB A;  5CA1 A;  3MHS C;  3DXR B;  2OCC C;  3JAL A;  4R7C A;  4X20 B;  1M56 B;  3G4S V;  4PDM A;  4OX9 B;  3NR7 A;  5J2U B;  1IBK O;  3IC9 A;  4NB5 A;  3QG5 A;  3W7T A;  2WA3 A;  3O65 A;  4PI2 A;  1COW G;  1XUQ A;  4LR3 A;  1JFF B;  4O2A B;  4BW5 A;  1S3J A;  5GTI Z;  1JOY A;  4KL1 A;  3RW0 A;  4J9Z B;  4MW3 A;  1GKF A;  2ZCE A;  3JAW B;  3CCM V;  4DRX B;  4X62 B;  1FYJ A;  2N74 A;  2VS0 A;  3ZHV A;  3LNN A;  1WN7 A;  4D7T A;  5KAF Z;  4DV7 B;  3PN1 A;  2AGA A;  3RYH B;  1NJI W;  2WLI A;  5KHI A;  2RMK B;  2V4D A;  2JIZ G;  2EIN B;  3DXR A;  3T4Z A;  1OCR C;  1DLB A;  1F7Y A;  5JWP A;  1L1F A;  1VQP V;  2HVK C;  1QVG U;  1D2D A;  1LUV A;  1SA0 A;  1LUW A;  1AIL A;  2JJ1 G;  2UUB O;  2YSU B;  4O4I A;  1IUR A;  3CRQ A;  3VOU A;  3R65 A;  4DV6 B;  1KB9 F;  3RYC A;  3FKS G;  2CGO A;  1HNX O;  3EFF K;  5IE9 A;  3J7A U;  2AHY A;  2QJ1 A;  1XMQ B;  4JTC B;  2CTP A;  3CHX A;  2Q7H A;  4UCO A;  5CN0 A;  5KMG B;  3TXQ A;  5LP6 A;  1KQS U;  1HP8 A;  1NR7 A;  5LMN B;  1N34 O;  1DF4 A;  2IBZ H;  5EK0 A;  3E35 A;  2PGG A;  2HHH O;  4MVQ A;  4B3S O;  1SES A;  3GVM A;  1PL4 A;  2MW2 B;  2ZDI C;  1FAF A;  1JMK C;  4X8A A;  3HKE A;  2KB1 A;  3QTC A;  1R1B A;  3P3P A;  4DR6 O;  2GHY A;  2ZE6 A;  5L3B A;  3M99 B;  2AZ0 A;  4RUE A;  3SDL A;  5A9G A;  3PJS K;  2GDS A;  3CWB H;  2ETN A;  1MG1 A;  4PA9 A;  2CTQ A;  2N04 A;  2IU0 A;  2Q6A A;  4ZOL B;  2ZIM A;  1M1K W;  5C8Y A;  1GH6 A;  4U3J A;  4GUN A;  2V1D A;  2GUZ B;  3L9D A;  1QHT A;  1VQ8 V;  2CTW A;  4I9Q A;  3B8M A;  1NQT A;  3RFR A;  2LQT A;  4GX2 A;  3KCY A;  3H9V A;  3DC6 A;  2EIM B;  3LSU A;  1YJN V;  2DN9 A;  5J9P C;  2XOK G;  4LH6 A;  4IHJ B;  5CB4 B;  4ZHQ B;  2X0L A;  4CH3 A;  1R3I C;  2QEX V;  4C7U A;  2A79 B;  1GTO A;  2YIB D;  4OPA A;  1J5E B;  1YEW A;  2Q8V A;  4B3M B;  1VEW A;  4DUY B;  3B8N A;  1VQM V;  4YJ3 A;  1KKD A;  2ZE8 A;  1L0N H;  5KUK A;  4PDV A;  1XNQ O;  3K57 A;  1NH2 B;  1B04 A;  5JVD B;  2PUS A;  1Q86 W;  4JI3 B;  1H2G A;  4HAM A;  3SYP A;  2WLL A;  4YY3 O;  3APQ A;  3RWR D;  4AQY B;  3ZRW A;  5BZB A;  5IYD O;  2HVJ C;  5CMU A;  4GLX A;  3A8T A;  2EIK B;  1GN6 A;  4QIW F;  2CE4 A;  3KCX A;  4IHJ A;  5JQG A;  1JCH A;  3W7S A;  1RPO A;  5J2T A;  1K4D C;  2ZR3 A;  4MVU A;  2MK3 A;  2GTS A;  1UPG A;  1GO3 F;  3L70 H;  2UXN A;  2KG7 B;  3ZMT A;  4EB6 B;  4X65 O;  1RM1 B;  1D5A A;  1ZUQ A;  1XRE A;  2BSK A;  4QPJ A;  4WFE A;  1RP3 B;  4FLV A;  4DR7 B;  1BE3 H;  1AR5 A;  1N0N A;  3AK2 A;  1VF5 B;  3I56 V;  1K73 W;  2GBO A;  2HFE C;  5CA1 B;  4JTA B;  4JI8 O;  2ZNI A;  1PM9 A;  1BMF G;  4XDJ A;  4LF5 B;  3K08 A;  1Q6U A;  3CRM A;  3K59 A;  5IWA O;  4CS2 A;  5LHG A;  2ODM A;  2ATK C;  2NNU A;  4BWA A;  4DR4 B;  5FNV A;  4FK5 C;  1KD1 W;  4YXW G;  4H44 B;  2HP8 A;  1J95 A;  4JI0 O;  5B1O A;  2UUA O;  4PI0 A;  3MAQ A;  4PJ0 Z;  1SRY A;  4FPP A;  3DGE A;  1NH2 D;  1H38 A;  3OMI B;  3E86 A;  2UUA B;  3EHB B;  5CBF A;  2EJ7 A;  3CC7 V;  3HKD A;  1PPJ H;  3OUF A;  3ABK B;  1I5X A;  1YJ9 V;  3JAR B;  2R9A A;  4JI2 B;  5LXT A;  1H2L A;  4I9W A;  4PV1 B;  4LF5 O;  2IU3 A;  1QLE C;  5FL7 G;  2YXH A;  3CCU V;  2VQE O;  1N36 B;  2WLM A;  1HNX B;  1NS1 A;  2RJZ A;  3SPJ A;  2L6L A;  1K33 A;  4DV2 O;  2P22 C;  4DV0 O;  2LFS A;  5JH7 B;  2OCH A;  4DV6 O;  2F1M A;  3TJT A;  4LFA O;  5EBL C;  4WFA V;  2RN9 A;  4OGQ B;  4DR2 O;  3CCL V;  2DE0 X;  5KX5 A;  1IVS A;  3H1J H;  4UCR A;  5TIS Z;  1HWY A;  4K8Z A;  5DEC A;  3HKD B;  2QKC A;  4FJC C;  5JJE B;  1NT2 B;  4ASU G;  3CME V;  1HNZ B;  2F95 B;  3B4S A;  2AXT Z;  3T1C A;  2D3O W;  3ABM C;  3ZHT A;  1ZL8 A;  1GRJ A;  4I4T A;  3QNE A;  3CD6 V;  5KHJ A;  2XHB A;  1IBM O;  5LHH A;  5KHG A;  2UU9 O;  3QO7 A;  2PF4 E;  2QWO B;  2ZNJ A;  4NTY A;  4QGP A;  5IYZ B;  1BL8 A;  4LF4 B;  3SPG A;  3RVZ A;  1XMO O;  1XNQ B;  1KU9 A;  1QQC A;  3SJC C;  1YTF B;  4H13 B;  2R9I A;  5IYB O;  3STZ C;  2WWW A;  5BR8 B;  5ITZ B;  1SC5 B;  1YCI A;  2EUL A;  1WPB A;  4DR3 B;  3JAT A;  4DR3 O;  4FM2 A;  1SQQ H;  4FVM A;  3G80 A;  4TV8 B;  4CH4 A;  4IT5 A;  2EX3 A;  1SET A;  3ZMV A;  4LWS A;  2HLD G;  4MVS A;  2F66 C;  1PKX A;  4TT3 G;  1N33 O;  1K5Q A;  4LF4 O;  4UVC A;  3GB7 C;  1Y74 A;  5LGN A;  3CC2 V;  3JAR A;  2YXY A;  1KYO F;  1Y76 B;  1XNR O;  2LP7 A;  3DTU B;  2FB5 A;  1P7G A;  3A0B Z;  3APO A;  1WP8 A;  3WB1 A;  3VQY A;  2FL4 A;  4JF3 A;  2B9Z A;  1R3K C;  5IYC O;  5B3S B;  1VP7 A;  4PHZ A;  1FXV A;  2Q7E A;  1V54 B;  3JD4 A;  1GMG A;  4KXR A;  2W6I G;  1PD3 A;  1W59 A;  1VQL V;  1I5Y A;  5L3E A;  4J42 A;  1SF9 A;  1Q3E A;  1X4T A;  4AIL C;  2DJV A;  4J7J A;  2ZDI A;  5KUM A;  3TK1 A;  3JCZ A;  2PZS A;  3B40 A;  2H3O A;  3AK1 A;  2GUZ A;  4O4J A;  1Y6X A;  3N2K A;  2Q73 A;  2XAS A;  4U7N A;  2DOS A;  3N2K B;  1KP2 A;  4JZ2 A;  3F7V C;  2QWQ B;  4W4K A;  1WLE A;  2Z3Y A;  4LF9 B;  4O4L B;  2B1I A;  3RYH A;  1VQN V;  1S5L Z;  1K9M W;  2P6J A;  2F93 B;  3JD1 A;  5H9C A;  1S0V A;  4MVR A;  3FYI B;  2R70 A;  3C3T A;  1L8D A;  2PI4 A;  1Q6H A;  4ICG A;  1DF5 A;  5L3G A;  5IJ9 A;  1IXM A;  1N34 B;  1N8R W;  2Q9L A;  4X9Q A;  1BHB A;  2M7W A;  3EXA A;  4O2A A;  4AQY O;  2X7R B;  1XBL A;  2VWJ A;  4IYI A;  2CH7 B;  2HG5 C;  4UUJ C;  5B1N A;  3B09 A;  2EIK C;  2Y69 C;  3OW2 U;  3SYO A;  3M7M X;  2UXC O;  4NXN O;  4O4J B;  3CX5 F;  1WA8 B;  5L3C A;  1GN2 A;  4LC1 A;  3CSX A;  3WG7 C;  2EZO A;  1Y66 A;  1IXB A;  4B3M O;  1XEQ A;  3OAA G;  3UQ8 A;  1FJG O;  3CS5 A;  3AG3 C;  2JGD B;  1OHH G;  4MTG A;  1QU7 A;  3UT5 B;  1XMO B;  4EKW A;  1EN4 A;  4X62 O;  3QO5 A;  4MT8 A;  2DYS C;  5JQG B;  3X2Q C;  3G71 V;  1FD9 A;  2YI9 A;  5EYP B;  1EZV H;  4DV1 B;  3OR7 C;  1FXK C;  2ZXW C;  3H1I H;  3O9O A;  2F4V O;  1SQG A;  2JVD A;  2A06 H;  1H2N A;  2K1E A;  1FKA O;  1ZAU A;  1OCZ B;  1DTO A;  2DYS B;  1VF6 C;  3X2Q B;  2LGW A;  1GN4 A;  2BCC H;  3JAL B;  5LP6 C;  3TCU A;  4LF8 O;  1Q7Y W;  4O4I B;  3L75 H;  5EZY A;  2XAF A;  3P3N A;  1W2B U;  4Z2W A;  1V9P A;  1HR0 O;  1K7D A;  1FFX A;  1SQV H;  3ABK C;  1PNL A;  4CS3 A;  3ZRS A;  1N32 O;  1AI6 A;  2A7W A;  2YI8 A;  1P4R A;  3LDD A;  3WB0 A;  3SPC A;  2QM8 A;  5GON B;  5LYJ B;  1YSC A;  1VQ4 V;  5FLX N;  4E4E A;  4DUZ O;  4LF6 O;  2FKX A;  3T2M A;  3ETE A;  3KKY A;  4XDL A;  4GKJ O;  2ADP A;  4K3A A;  3BFR A;  2OT5 A;  4NTX A;  2B1G A;  3UCS C;  4Z1V A;  1QR9 A;  3JD0 A;  4J80 A;  4QE9 A;  1N4C A;  2ZR2 A;  4YIP A;  3MHH C;  4IIJ A;  3CRA A;  3LSQ A;  4K35 A;  4LNU A;  3ZRV A;  3ABT A;  1MMM A;  3LDE A;  2VRZ A;  2EIL B;  4J7Z A;  3M8A A;  5GTH Z;  4X89 A;  1QNM A;  4HZ3 A;  5JCO C;  3ETG A;  4I50 B;  2YC0 A;  3AG2 B;  4RQE A;  3FX7 A;  3H1K H;  4I50 A;  5HFM A;  2E75 B;  2Y4U A;  1IBM B;  5DN6 G;  1Z2G A;  3JAK B;  1M5I A;  1R6N A;  4JAS A;  1SS3 A;  1Z5W A;  4JI4 B;  1CP9 A;  4YHH B;  3OEE G;  4DR5 B;  2C2A A;  4LCU C;  3WFV A;  3A0R A;  3SYQ A;  2HKO A;  1EN5 A;  3L72 H;  4P30 A;  3D36 C;  3E22 A;  3HPL C;  2HJF C;  2R72 A;  1K97 A;  3TET A;  2WLK A;  4H0L B;  4LFA B;  1RM1 C;  3JAM N;  3BVO A;  3T4D A;  4B3R O;  4QPK A;  1AI4 A;  1X59 A;  5GON A;  4FMT A;  5ITZ A;  3UT5 A;  5LMN O;  1OCZ C;  4X1Y A;  3OTO B;  4DV2 B;  2RQ6 A;  1EN6 A;  2KKW A;  3E89 A;  4UV9 A;  2OTJ V;  3RYF A;  5C8Y B;  2EJR A;  4ABM A;  4DV5 B;  4YY3 B;  3CB2 A;  2RCV A;  4L8J A;  1XL6 A;  1Q8I A;  3RYF B;  2EIJ B;  2GV9 A;  1AJP A;  1W0K G;  3G6E V;  2JEX A;  4JI2 O;  1M93 A;  4RAI A;  3ZHR A;  4JYY A;  4YJ3 B;  1V54 C;  3D8C A;  4GX1 A;  4O2B B;  1EM1 A;  4XBF A;  3LNM B;  1KMI Z;  3OMN B;  3OGC C;  4GYC B;  1K92 A;  2G38 A;  4HYO A;  1NKD A;  3E83 A;  2W0X A;  1TVK A;  5D5P A;  2EIJ C;  3T1H B;  4R6Z A;  3OGI B;  4R8C A;  4GKK O;  1DGS A;  3DC5 A;  4UB8 Z;  2QM4 A;  4DK0 A;  1QR8 A;  5KLV H;  1JFF A;  1BQZ A;  4YHH O;  3ZN1 A;  4DR5 O;  2IJJ A;  3JD3 A;  2YIB A;  4DR1 B;  4WF9 V;  4JI8 B;  1YDX A;  4J41 A;  2DW4 A;  2P4V A;  2IH1 C;  4JAV A;  4PDL A;  3ZMU A;  4NYK A;  3ZMZ A;  3ZMS A;  5EBM C;  3OMA B;  3ZIA G;  1WA8 A;  3AG2 C;  1F4N A;  4JYA B;  4X65 B;  1WJZ A;  2ITC C;  3SPH A;  5KHH A;  2QKS A;  2DYR B;  3Q4H A;  3K79 A;  1OV9 A;  1AJN A;  4EFB A;  5IDJ A;  1YJW V;  2P67 A;  3P32 A;  3CXH F;  2UXD B;  4X1I B;  4CC6 A;  4DR1 O;  4TSF G;  2HEP A;  2Y69 B;  2DWE C;  1U96 A;  4GCZ A;  1YIJ V;  2PTM A;  1S5H C;  2ZQM A;  2DYR C;  4MVM A;  2UXB O;  4RO2 A;  4DUZ B;  1BHA A;  3RBZ A;  1LR1 A;  3A2F A;  4LFB O;  1IX9 A;  1H8H G;  3E8H A;  2UXB B;  2JEU A;  2YID A;  3I55 V;  3CCQ V;  2OWO A;  3JSN A;  4BR6 A;  4LWS B;  4WFG A;  4LF8 B;  3HKB B;  2BTQ A;  1MA1 A;  4DV5 O;  3TGU H;  1K4C C;  3CPW U;  2JS5 A;  5IYZ A;  2QWR B;  1FXK B;  3SJA C;  2ZXW B;  3FFQ A;  4F6E A;  1K34 A;  3OTO O;  2LO1 A;  4X88 A;  2YIA A;  4AHC A;  1RFY A;  2Y48 A;  1PNK A;  4P2Z A;  5H6R A;  1R73 A;  1P84 F;  4TV9 A;  5H6Q A;  3BPZ A;  1MSD A;  1PV0 A;  2YUA A;  3STL C;  1AVM A;  2Q68 A;  5CA0 B;  4DW0 A;  4P9P A;  1JX9 A;  2WLN A;  4TUY B;  1YF2 A;  3ETD A;  1AR4 A;  2H94 A;  1K8A W;  1JR9 A;  2Z0A A;  1MSW D;  1I7F A;  1NVP D;  1HNZ O;  2P4K A;  1XOU A;  4UB6 Z;  4X1I A;  5LGT A;  1MZE A;  2Q0A A;  4GX5 A;  3JYC A;  3BAA A;  5LL6 Y;  1KUQ A;  2ADQ B;  4IGG A;  3CCS V;  4MS2 A;  4MTO A;  3SGI A;  1XHZ A;  4I7Z B;  5IJ0 B;  4TOI A;  2L35 A;  1TA8 A;  1FXK A;  4Q6G A;  4OX9 O;  1AP6 A;  2X6A A;  4NXM O;  4UFZ A;  4D7S A;  2ZM6 B;  4B3T O;  1VIB A;  5C93 A;  4W4L A;  1JQ0 A;  3T1Y O;  1JJO A;  4DUY O;  3E8F A;  3ZHS A;  2IM9 A;  2XND G;  3SJB C;  3F5W C;  4CBC A;  4WFH A;  3GWK C;  3E8B A;  1G4Y B;  1XHX A;  1YVW A;  3G6B A;  4NVP A;  5LXT B;  2FML A;  3DSQ A;  3N2G A;  2KG7 A;  4I55 A;  4F4L A;  2CUG A;  3NXS A;  1Y74 B;  2BOB C;  2QA4 V;  4G28 B;  2WA4 A;  3K03 A;  4LNU B;  1E1R G;  4IL6 Z;  5FPO A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 4J7J A;  4J7K A;  4J41 A;  3FX7 A;  4J42 A;  4J10 A;  2G38 A;  2GTS A;  4J11 A;  4KXR A;  4W4L A;  4IYH A;  4W4K A;  4IYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...