2GTSA

Structure of protein of unknown function hp0062 from helicobacter pylori
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
VQMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein HP0062
publication title Hypothetical protein HP0062 from Helicobacter pylori
rcsb
source organism Helicobacter pylori
total genus 33
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2gtsA00
4IYHA 4J7JA 2GTSA 4IYIA 4J42A 4KXRA 4J41A 4W4KA 4W4LA 4J10A 2G38A 3FX7A 4J11A 4J7KA
chains in the Genus database with same CATH superfamily
4B3TB 2LW1A 4WFAV 1YF2A 5EYPA 1LUVA 1JVMA 4FZ0A 1DF5A 2WSSG 3DSQA 1AP5A 1QBZA 3M99B 5IWAO 2ZNJA 5KHKA 2F95B 2KKWA 2QJ1A 3HKDB 4NVPA 4AQYO 2QEXV 2ZXWB 3L74H 1FJGO 4F6RA 3CJHB 2N05A 1FYJA 2EIMC 3ZN0A 2JRIA 1NR1A 3ZIAG 2CUGA 5GONB 5EC1C 4DR3B 1FAFA 5KHIA 4NR1A 4MT8A 3AG4B 4CC6A 2R9IA 3QF7A 1EZVH 5KHGA 3N2GA 2UXNA 1BQ0A 3CX5F 2Y69B 1E1RG 4MVQA 4OXSA 2HVKC 1R73A 3WB2A 4DV3O 2JS3A 1H38A 1Q82W 4F6EA 2KG7B 4K0KB 2WLLA 4NXMO 1TUBB 4CBCA 5KHJA 5EZYA 3FYIB 1B04A 1AI7A 1XMOB 5L3BA 2ZT9B 5H9CA 4JI5B 5EBMC 1WNSA 3SPIA 1LUWA 1BS3A 3OGIB 2IBZH 4IHJA 2DWEC 3OFNG 1XNQO 2ITCC 3LNMB 5KX5A 3ZBHA 2P67A 2QR4A 5EBLC 2WPDG 1N36O 1QVFU 1M9NA 1J95A 4X65B 3BFRA 4R50A 4Q20A 4ICGA 3CB2A 4DW1A 4H33A 4X66B 3RFRA 3UO3A 4FLTA 2QWRB 1HNZO 2UU9O 1CPYA 1SA0A 4MVSA 1OCZB 3VQVA 4JV5B 1KP3A 3MD0A 3ZHTA 1IBKB 1NVPD 2CH7A 3QNEA 5LMNB 1RFYA 3OTOB 1ZTEA 5LP6A 4O4LA 1VQ8V 4E2LA 4DV5O 1KU9A 4HAMA 1JCHA 3ZMTA 5B1NA 3AG4C 4UVAA 3N2KA 4LF6B 3UT5B 2QKCA 3BY6A 3UO2A 1NVPB 2A79B 5IYCO 2H94A 2Z5UA 5CA3A 2ZE7A 2IM9A 2OT5A 1TVKA 3J81N 4LWSA 4YY3O 2FTKA 4DV7O 5IJ9B 5KMGA 3SPCA 4JGSA 1KKDA 2ZDIC 4KHPO 5JH7A 4DV6B 1QU7A 1VP7A 4Z2WA 5AG2A 4DV2O 2DMXA 2OTJV 1FXKC 1EZJA 3AG2C 3RYIA 1QR9A 1XREA 4DR7B 4JI2O 2WLKA 2CTWA 1VQNV 2ILMA 1K92A 3HKBA 4WF9V 4AI8A 4FFBA 3SDLA 3JD2A 3OMAB 2Q68A 3B4SA 4Z1VA 4IL6Z 3CS5A 1K97A 4GKKB 1GN6A 4DR2B 1SQVH 1XDCA 5E79Z 2HJFC 3DTUB 2Q73A 4K8ZA 3TXQA 5GTHZ 4QIWF 2HJDA 1OCZC 2YIBA 3B8MA 3D36A 2YEVA 3I55V 1Z5WA 1PNLA 2UXDO 1L8DA 3IJ4A 4RQEA 4DXWA 2UUBB 3B8NA 5IY5B 3E8BA 3FD9A 3T1CA 3F5TA 3SYOA 5FNVB 1NS1A 2LP7A 4NXNO 1N0JA 1QR8A 4UV8A 2ARHA 2UXCB 4WFFA 1JQ0A 1F51A 2YXLA 2CE4A 2L35A 4WBNB 2BTQB 3QO5A 3J7AU 4LFBB 1QHTA 2IH3C 4DR4O 2XAHA 1AI5A 1JR9A 4FLUA 3JARA 1Q90D 4FK5C 5DEDA 1YZBA 4I0XA 3ZMVA 4DV1O 1CEZA 1GN3A 1US6A 4BR6A 1I5YA 1AR4A 1W0JG 4B3MO 3ETEA 4B3SB 2EIJC 1Y76B 2VQFO 4DV0O 5IWAB 5KA5A 3JAWA 2QM4A 1FKAO 3ZRWA 3MAQA 2CTPA 2IJIA 2EJRA 4B08A 3MHSC 2R70A 5JCOA 3T2MA 1Y67A 4QJFB 4XDJA 4F6RB 3ZHQA 2JJ1G 3CCSV 1F4NA 4J80A 2W6JG 2HP8A 4YJ3B 3AG3B 2ZINA 3VQXA 2W0FC 3IFXA 3BA9A 2X6AA 1AI4A 1Y6XA 3SJAC 4O4IA 3UM7A 1HR0O 2QTOA 3I5DA 4O4JA 3QVNA 3CPWU 2A0LA 4JZGA 3ASNB 2VRZA 1AVMA 3LSQA 4JI4O 2JEXA 2HR3A 4JI0O 1H8HG 3ABUA 5IY5C 1M4UA 2WLLB 3OMIB 1CP9A 4TQFA 3E2EA 3PJSK 3FKSG 5EZYB 1IX9A 5B1AC 2RDCA 2DQ3A 2F93B 1R3KC 1YEWA 1NBMG 4CS3A 2ZKOA 4X1KB 1N36B 3SJCC 3OD4A 2B5UA 3FX7A 1R3JC 1RM1B 2AZ0A 3LNNA 4LFCO 4RO2A 4WFGA 3LSUA 1GN4A 4TQDA 1JPXA 3H1JH 3X2QB 2OCCC 5EC2C 4LF5O 3BHPA 4ZOLA 5JVDA 4H37A 5DN6G 1IBMB 4JI6O 4HNAA 1P49A 1SA0B 2M7WA 3JATA 1YI2V 3ZHUA 4O2AB 3DC5A 2PYJA 1FFTB 1YSCA 1OJHA 2GUZA 5H2FZ 4YIOA 1NTMH 3L71H 2CH7B 3ZN1A 5CN0A 5CA0A 2HVJC 3JALA 1K4DC 1W2BU 2P6JA 3CCMV 2Q7GA 2Q8VA 3OW2U 3HKCA 1V54B 1G4YB 3N2KB 3WG7B 1N32O 4P9OA 4PA4A 5KHHA 4X89A 3APQA 4LF7O 4JYAO 5GW7A 1NR7A 1TVKB 2JGDA 4NYKA 4JF3A 5LXTA 4I4TA 4DV2B 2EINB 2FMLA 4J41A 2WLJA 2ODMA 3JAKA 3L75H 1HNXO 3H1LH 4ZKIA 1N33O 4PA9A 1KKCA 3JCZA 3SR2C 3RYCA 4MVMA 3TCUA 5C8YB 2P22C 5H5NA 5JH7B 4JI3O 2HLDG 4PA3A 1P84F 3GVMA 1NZ6A 3CCVV 4EB6A 3CCJV 2GDSA 4TV8A 2XOKG 4R6ZA 2CGNA 4X1YA 3OR6C 1SQPH 3RT3C 1XL4A 1KC8W 2JK5C 4FFBB 3CXHF 5DECA 4RUEA 4JTDB 3L72H 1XMQB 1N34O 2H8PC 1WN7A 4PI2A 2FB5A 2CTQA 3LUTB 4OX9O 2WLIA 2XTAA 1S77D 3X2QC 1PKXA 3CC4V 1O9GA 4AHCA 1D5NA 1OZ0A 3CRCA 3RN4A 4B7EA 1I7FA 2D2CB 4J7KA 1TA8A 2PI5A 1Q6UA 1S5JA 2ITDC 4BWAA 2AHZA 1VQPV 1S72V 2X0LA 1B06A 2MK3A 1W0KG 1XQ8A 1VQKV 2AW9A 4JAVA 1NH2D 3T1YB 4DK1A 4GT1A 3Q4HA 1J5EO 5LMUB 4O4HA 4TUYA 3E86A 1XNRB 4MVUA 1SQQH 5CBHA 1K34A 4ZHQB 1VQ7V 1QLEB 1EBOA 3WG7C 2FKXA 1I94B 3VQWA 4JTCB 4X1IA 1NH2B 3JARB 1ZL8B 2BOBC 1Y66A 2W6IG 5BMVB 3JYCA 2CAZC 4KUMA 1IBLO 1AB3A 4FZ1A 1VQ5V 4I50A 1WLEA 3RYHB 2EINC 2XASA 3ETQA 2PUSA 1SESA 4LFAO 4J7ZA 2EZOA 4U3FH 3D3QA 2Y0PA 3CMAV 4JAAA 4DO2A 4LF9O 5JJEB 3OUFA 5EBWC 1KB9F 5L3GA 4YHHO 1MZFA 3CHXA 1IDSA 1MG1A 2F66C 2Q9LA 3ZHSA 1Q6HA 5H6RA 3TGUH 2UXBO 1NKDA 4HZ3A 5BXZA 1G8MA 1JFFA 2P4VA 3GWKC 4N21A 2PI4A 3VBBA 4XDKA 4DUZB 2AGAA 2OIEA 2WAMA 3EXAA 2PY5A 2NN4A 4ZIBA 2HEPA 2JS5A 3SYQA 4LNUB 4GLXA 2HG5C 2QSAA 1SKVA 1PP9H 3M8AA 2EIKB 2Q0OC 4X62B 3MHHC 3CCEV 3E8FA 4O4IB 4TOIA 4YJ2A 4JI7O 4JYYA 3T1HB 1VMGA 2DYRB 1M57C 1TAEA 5BR8B 3G4SV 4TV9A 3RVZA 3KCXA 4X64O 5CB4B 1ZLZA 3ZHVA 5LBQA 1GTOA 2O57A 2Q0AA 3CSXA 2F23A 1BL8A 5E1AC 2AZ2A 3ZHRA 1V55C 1M93A 2DYSC 1XHZA 3K03A 1EN5A 2OIGA 5LHIA 5IYDO 4DR1O 3STZC 1AILA 3JAMN 1BCCH 4J9ZB 3G71V 3E35A 2HHHB 1WAZA 4JI6B 3K0GA 1H2MA 2YI8A 4QE9A 3QTCA 4FLZA 4DV4O 2QE7G 3EVKA 5LOVA 2DN9A 2UUCO 2ZIOA 2XAJA 4PV1B 4HNAB 4FIPC 3UCSC 4ABMA 3D3IA 2PYLA 4FLXA 2R72A 5KAFZ 3FB6C 3SYCA 4P30A 4LBEC 2V4DA 3H1HH 1VF6C 5IJ0A 1HDJA 2GV9A 4UFZA 4LF4B 3R65A 4B3RB 4JI8O 4MSWC 2H3OA 4TSFG 1HWYA 4DR5B 5TISZ 2EIKC 2E75B 4C7UA 3K5NA 5LA6B 4X9QA 2X6CA 1OHHG 2DE0X 2ZXWC 2IJKA 3C3SA 1SQXH 5B3SB 2JGDB 2Z3YA 4I4TB 4CH6A 1AR1B 3ABLB 1MSDA 2PZSA 4PJ0Z 2E5LO 3RYCB 2QWOB 4LF8O 1BHAA 1ZAUA 4CC5A 4I55A 4D7TA 2ZE8A 3G80A 2Y69C 3ZS8C 4QNHB 4W4KA 4X1YB 1HNWO 1KECA 3CYOA 2W0XA 1AP6A 4LH7A 4RWUA 1H2LA 3ZCCA 1H2GA 3AG1B 4UVBA 1GK9A 1TUEB 1I0HA 4DUYB 1SQFA 3H1IH 3G6BA 4JI1B 2WLIB 1JJOA 1ZWIC 3ZRSA 3ZMSA 3G6EV 2HKOA 1PPJH 2F4VO 3ABKB 1K3EA 2PTMA 5B66Z 3NR7A 5IYZB 2LO1A 3APOA 4ZI7A 2QGNA 1QVGU 3JD0A 3FB5C 2YI9A 5CMUA 2QDOA 2YC0A 3ICXA 4MVOA 5LGTA 4J42A 3RYFA 4O4HB 4TUYB 3FB7C 1D2DA 5J2TA 3KG2A 4PDVA 3E22A 1Q6IA 1BGYH 4IIJA 1PNMA 4X88A 2QWNB 4AILC 3W7TA 2CGOA 4X1IB 1MZEA 2V7QG 2P06A 4MW8A 1FXHA 4GZRB 2LGWA 2EBOA 3J80N 1Q8IA 2Q7EA 2A06H 3M7MX 1TGOA 1ENVA 4IGGA 5DM6V 2VQEB 2QKAA 2A3QA 1YVWA 2UXBB 4MTGA 2RN9A 4PHZA 4YIPA 3L9DA 4BIZA 3JD3A 3UQ8A 1R3LC 2BSKA 5EK0A 5HFMA 1CXZB 1H2NA 2WA3A 1ZUQA 3WB0A 5CA1B 4W4LA 4X20A 2P5OA 2ZM6O 1HW7A 4Z1MG 3K08A 3K59A 4AQYB 3K06A 5LYJA 4LC1A 3TK1A 3K04A 2GBOA 3VOUA 5EYPB 1FJGB 1P7BA 2WLMA 4NB5A 1PL0A 2GTAA 2G38A 2Y4TA 1ZX3A 3JCUZ 5A2QN 3K3WA 1X59A 2K1EA 1RSOA 5C93A 1YJWV 2V1DA 3JSLA 4I5SA 5CBGA 2RJZA 1E79G 1VF5B 3OGCC 3HKEA 2JJ2G 1NU1H 3JD1A 3CEIA 3C90A 4CH4A 4G2KA 4TV9B 3CE2A 2XAQA 4FLWA 5L3FA 4DV3B 5JJNB 2OTLV 2LW7A 3N2GB 4NXMB 4GX0A 1MOFA 3ZEDA 2UUAO 2Q5ZA 4P9PA 3ASOB 4CS4A 3HKDA 4B3TO 2E74B 4I9QA 3ZMUA 3JASA 3A0BZ 4BW5A 3K57A 1XNQB 4NTYA 5J9PC 3B40A 5BZBA 3W7UA 1UJWB 4IHJB 4QPKA 2MW2B 1RP3B 3ETDA 1K7DA 5KX5B 1G1XB 1JA8A 3ETGA 1PV0A 4MW3A 3WFVA 1HNZB 2UU9B 4UCSA 4DR3O 1QNMA 3FFQA 5EIBD 3A0HZ 3B09A 4BW9A 3LDEA 4P2ZA 2Q69A 1U96A 3G67A 2LFSA 2KG7A 2ZDIA 2ZNIA 1TUBA 2BE3A 3CWBH 1FFXA 2QTSA 2EILB 1R6KA 1FXKA 4IT5A 3E8HA 2VWJA 4DV5B 1LR1A 4K0KO 3K5MA 1NTKH 1XHXA 3W7XA 2B1IA 1OCRB 2E5LB 4LF8B 1U97A 1IURA 3ZRXA 3ZX6A 1XMOO 5ITZA 1M56B 3AG3C 5LP6B 4O4LB 1VQ9V 1GN2A 1K5SA 4FM1A 4JI5O 4UV9A 4FPPA 3EHBB 2NNUA 4QPJA 4YY3B 4DV7B 3F7YC 5L3EA 4CH3A 5KAIZ 2IU3A 2WA4A 4E4EA 4PI0A 1Y74A 4O2BA 4YXWG 4KHPB 3SYAA 3OTFA 3F7VC 4LWSB 3ASNC 1XUQA 4B7KA 4X65O 3ASOC 3B77A 4JI2B 3CRQA 1G6UA 5KMGB 2EJ7A 4X66O 4DYLA 1AJQA 4UB6Z 2QKSA 1BZKA 1WP8A 4UCRA 4XDLA 3RYIB 4JZ2A 1IBKO 5B1BB 1OCCB 1OCOB 3THOA 3STLC 1K73W 4FFKA 3HKBB 3W7SA 3OTOO 3UT5A 1RM1C 1SQGA 1P7GA 4PDRA 1URFA 2YIBD 2XNDG 3N27A 3FB8C 1LNQA 1L0LH 4LF6O 2UXDB 4DRXA 3CC2V 1B6QA 2EX3A 3SPHA 2VWKA 1V9PA 2JVDA 5LGNA 2YEVB 5J2TB 4I9WA 4NXNB 4RUFA 1SRYA 4R7CA 3SJQC 5FLXN 4DV6O 1NJIW 4R8CA 4DR4B 1QLNA 4U7OA 2ATKC 4TT3G 5IE9A 1VQ4V 5LP6C 3P30A 4PD4F 3QO8A 3P3NA 1VQMV 3OE7G 4DR7O 3K58A 4GCZA 1H2KA 4DV1B 4XBFA 1V54C 4UCUA 3JD4A 2N74A 3CD6V 4FM0A 4B3MB 1THZA 5IYBO 2VQFB 4DV0B 4RAIA 2OCHA 2BSKB 4I0XB 1GM8A 3HR0A 4GKKO 4DR2O 2N04A 5J2UA 2LQTA 3GWOA 4X20B 1UPGA 3WU2Z 3IAYA 1ROPA 4JAUA 2GHYA 3JAWB 4UUJC 5FNVA 4WCEV 3ZRWB 2ZR2A 1VF7A 4J10A 4N23A 4OPAA 1KQSU 4MVRA 2JGUA 1DLBA 3CCRV 4HYOA 2UUBO 1OCOC 2BTQA 3WB1A 4EKWA 1AJPA 3ZMZA 5L3DA 1IXBA 4MTXA 2UXCO 1F4MA 3BPZA 5B1OA 2QWPB 1Q7YW 1QCEA 1HR0B 4BIUA 4L87A 3HKEB 2ZR3A 1WB7A 4LFBO 4G27B 1YTFD 5D5QA 4JI4B 1GM7A 4GX1A 1Y76A 1WPXA 4JI0B 1M5IA 5JQGA 3D36C 4O4JB 2Z0AA 4TWKA 3FYEB 4B3SO 3K0DA 1Z5VA 1Q3EA 1YTFB 2OYQA 2PF4E 2RNBA 2P90A 4K8XA 3JASB 3DXRA 1K9MW 5FPRA 3K9AA 3ABMB 2F1MA 2YUAA 4YJ3A 4UCVA 4LFCB 1BHBA 1DF4A 1QLEC 2DJVA 3RBZA 1JMKC 1RPRA 1Q86W 1HP8A 1GRJA 1BQZA 4LF5B 3AK1A 4D7SA 2DQ0A 5HFLA 2NLJC 3SJBC 4D6TH 1F7YA 1S0VA 2EZPA 1KUQA 2RMKB 2OWOA 2DWDC 1YIJV 1B3QA 4ZOLB 4UCTA 3CRMA 5JVDB 4I7ZB 1YJ9V 1VARA 3K9SA 5KUKA 5GTIZ 3H1KH 1K4CC 1KBHA 1S3JA 1FFXB 3JATB 3CCLV 1IZ3A 1FXKB 3CRRA 3CCUV 1GO3F 5JCOC 3AG2B 2BOCC 2YICA 2GUZB 3ABTA 3T4ZA 4X1KA 1SF9A 3H01A 3TETA 2L6LA 4BAYA 1N32B 5CA0B 4OPHA 5ITZB 4LF7B 4JYAB 3A0RA 2FL4A 3JALB 1BE3H 3T4DA 1BT8A 3HKCB 4LCUC 2DOSA 5L3CA 1L0NH 1HNXB 1BSMA 1N33B 1Y74B 4O2BB 2DYRC 4K3AA 4JI3B 1KYOF 1XILA 4J9YB 4LR3A 1KMIZ 5A9GA 5LXTB 3BVOA 3JAKB 4UXNA 4O2AA 2UXXA 1Q81W 4WFEA 1WJZA 1IXMA 3LDDA 1YITV 1IBMO 1EM1A 3SYPA 1KP2A 3AG7A 3LSSA 2IH1C 3ABMC 1N34B 4EB6B 4TV8B 2YXHA 1H8EG 5JJJB 1I08A 4JPRA 4OX9B 4MTFA 4RQFA 2ETNA 1WP7A 2GSMB 5F2VO 1AROP 2F43G 4GX5A 2YIDA 2WLNA 4ZBMA 3W7WA 3ML0A 3E8GA 1WA8A 3CP1A 1Z2GA 5LL6Y 1Q43A 1EN4A 5LGUA 1VQ6V 4OGQB 3A2FA 1P4RA 1YDXA 5LHGA 1AR5A 4DRXB 2CK3G 1FD9A 1K8AW 2EIJB 1DTOA 1R3IC 5C8YA 4EFBA 4EEQA 1R6NA 1VQOV 2HFEC 2B1GA 4WFHA 4F4LA 1J5EB 1FS0G 2Q67A 4JYBA 4DK0A 4PA7A 1MSWD 4MVZA 1MA1A 3PN1A 3K5OA 3Q4HB 2ZE6A 1F23A 1GH6A 2ZE5A 2NR5A 1IBLB 1Q5OA 2VS0A 2IW5A 3KZIZ 1IVSA 4LFAB 1SC5B 2XAGA 1XMQO 4UVCA 1R1BA 1MABG 4LF9B 4FVMA 5B3SC 1I5XA 2RCVA 1SERA 4I50B 3H9VA 2JDIG 2KQXA 3ABLC 4YHHB 5J2UB 2R9RB 2LJ2A 3OMNB 3BCCH 1JOYA 3K5LA 2A9HA 3UKMA 3TXSA 1E1QG 3L73H 1SETA 3C3TA 4J11A 1EFRG 4DR6O 5B1AB 4DW0A 2ZIMA 2QM8A 4LP8A 3DGEA 4ZHQA 1JFFB 2LFRA 3P32A 3AG1C 3T1YO 5FPOA 1SQBH 2WWWA 5LMUO 4KP4A 1Y4MA 1ZL8A 3FAVA 5BMVA 1XNRO 2CDYA 4CH5A 4FJCC 4JI7B 4PDLA 4KL1A 1JX9A 3RYHA 3OAAG 4GKJO 1I94O 1PM9A 2OCCB 3QO7A 3ABKC 4YJ2B 4ASUG 5JQGB 2K9PA 5K1XA 4X64B 1JJ2U 4U7NA 3O65A 3O9OA 2R9AA 3BRCA 1XL6A 1XOUA 3S3XA 4BIOA 4U3JA 4HBNA 1VF6A 4A5UB 3DXRB 1AI6A 3DC6A 4DR1B 5IDJA 4GYCB 4H13B 2E3CA 1MMMA 2IJJA 4LNUA 2XHBA 5LHHA 2IJHA 4DV4B 2ZCEA 4DUZO 5BY1A 3SPJA 2LGQA 1XBLA 3E83A 2UUCB 3R66A 4PELA 4X8AA 1S5LZ 1X4TA 1NI8A 4FMTA 3AK2A 3CJHA 4IYHA 3F5WC 3TJTA 1PD3A 5GONA 4H44B 3I56V 4KFMA 2GTSA 4K35A 3U0ZA 5LOVB 4UB8Z 4X62O 1L1FA 4NTXA 3BABA 1W59A 3T1HO 5CB4A 1ZSPA 1UFIA 3JSNA 2P4KA 5BR8O 4JI8B 1R6TA 1GKFA 1O9HA 2JEUA 5IJ0B 1PNKA 4WFBV 3IGAC 1N4CA 1MNGA 4GX2A 2CTRA 1VQLV 1S76D 4JTAB 3CXCU 3IC9A 1YCIA 1KD1W 1PL4A 4FM2A 1EN6A 3AEIA 3OEEG 4GUNA 3CC7V 1RPOA 1WPBA 3OEHG 4NTWA 1DK1A 2QM7A 2D3OW 3D8CA 2HHHO 2E76B 1YHQV 1AJNA 3BEHA 4MS2A 4QGPA 1VEWA 1SS3A 1HNWB 3L70H 4MTOA 1M1KW 2P7TC 1T5EA 2JIZG 1WB8A 4I55B 3U11A 3CMEV 3KCYA 3P3PA 3RW0A 2DW4A 3BAAA 1M90W 1XI1A 4IYIA 2Y48A 1DGSA 2B9ZA 2IU0A 2YSUB 1A32A 4LF4O 2AHYA 3RWRD 2C2AA 2M6YA 5LA6A 4CZZA 1H2SB 1SZTA 4B3RO 2YS8A 2Q7HA 2F4VB 4JV5O 1WA8B 1VIBA 5IT9N 4DR5O 3OR7C 5FL7G 2XUMA 4NKGB 1YXBA 3MDSA 4EFEA 2WLHA 3OM3B 3OUSA 5LMNO 2XAFA 3VQYA 3S3WA 1FPOA 2Y4UA 3CCQV 2A7WA 2ZD9A 1COWG 1NTZH 4PA6A 4ZI7B 5KUMA 3IC7A 1FXVA 5IJ9A 1ORQC 2ADQB 2QWQB 2EULA 5K1PA 3RYFB 1D5AA 2YXYA 1NT2B 2EILC 3BA8A 4CS2A 3E22B 5EIBC 4IIJB 3GB7C 4L8JA 2AXTZ 3RGBA 1GM9A 3OT7A 3A8TA 4J7JA 4JYCA 2BTOA 5KA6A 1NQTA 3LDCA 1OCRC 2XT9A 4DUYO 3ZJZA 2RQ6A 4JI1O 4UCOA 1M56C 4G28B 2Q6AA 4LH6A 2EIMB 4KXRA 1M57B 4H0LB 3ZRVA 5IYZA 5D5PA 1BMFG 3SGIA 1YJNV 4DR6B 5H6QA 1N0NA 1S5HC 4FLYA 2Y0IA 4JASA 2ZM6B 4Q6GA 4FLVA 1OV9A 2PGGA 2ZQMA 3CRAA 2KB1A 3EFFK 5KLVH 3AK3A 3RVYA 3HB3B 3QG5A 1GAXA 3SPGA 4GKJB 1V55B 2KSDA 2DYSB 3KKYA 3NXSA 3B2EE 1K5QA 1XEQA 3U10A 5LYJB 3FAVB 3HPLC 2YIAA 2X7RB 2ADPA 5B5EZ 5B1BC 4WBNA 1OCCC 4QE7A 5JWPA 1K33A 2QA4V 2Q4PA 2FYUH 1RSOB 1N8RW 1QQCA 1SZXA 1GMGA 2YDEA 3E89A 5CBFA 2VQEO 4U3JB 2UUAB 2X6BA 5CA1A 4PDMA 2BCCH 3K79A
chains in the Genus database with same CATH topology
4IYHA 4J7JA 2GTSA 4IYIA 4J42A 4KXRA 4J41A 4W4KA 4W4LA 4J10A 2G38A 3FX7A 4J11A 4J7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYH A;  4J7J A;  2GTS A;  4IYI A;  4J42 A;  4KXR A;  4J41 A;  4W4K A;  4W4L A;  4J10 A;  2G38 A;  3FX7 A;  4J11 A;  4J7K A; 
#chains in the Genus database with same CATH topology
 4B3T B;  2LW1 A;  4WFA V;  1YF2 A;  5EYP A;  1LUV A;  1JVM A;  4FZ0 A;  1DF5 A;  2WSS G;  3DSQ A;  1AP5 A;  1QBZ A;  3M99 B;  5IWA O;  2ZNJ A;  5KHK A;  2F95 B;  2KKW A;  2QJ1 A;  3HKD B;  4NVP A;  4AQY O;  2QEX V;  2ZXW B;  3L74 H;  1FJG O;  4F6R A;  3CJH B;  2N05 A;  1FYJ A;  2EIM C;  3ZN0 A;  2JRI A;  1NR1 A;  3ZIA G;  2CUG A;  5GON B;  5EC1 C;  4DR3 B;  1FAF A;  5KHI A;  4NR1 A;  4MT8 A;  3AG4 B;  4CC6 A;  2R9I A;  3QF7 A;  1EZV H;  5KHG A;  3N2G A;  2UXN A;  1BQ0 A;  3CX5 F;  2Y69 B;  1E1R G;  4MVQ A;  4OXS A;  2HVK C;  1R73 A;  3WB2 A;  4DV3 O;  2JS3 A;  1H38 A;  1Q82 W;  4F6E A;  2KG7 B;  4K0K B;  2WLL A;  4NXM O;  1TUB B;  4CBC A;  5KHJ A;  5EZY A;  3FYI B;  1B04 A;  1AI7 A;  1XMO B;  5L3B A;  2ZT9 B;  5H9C A;  4JI5 B;  5EBM C;  1WNS A;  3SPI A;  1LUW A;  1BS3 A;  3OGI B;  2IBZ H;  4IHJ A;  2DWE C;  3OFN G;  1XNQ O;  2ITC C;  3LNM B;  5KX5 A;  3ZBH A;  2P67 A;  2QR4 A;  5EBL C;  2WPD G;  1N36 O;  1QVF U;  1M9N A;  1J95 A;  4X65 B;  3BFR A;  4R50 A;  4Q20 A;  4ICG A;  3CB2 A;  4DW1 A;  4H33 A;  4X66 B;  3RFR A;  3UO3 A;  4FLT A;  2QWR B;  1HNZ O;  2UU9 O;  1CPY A;  1SA0 A;  4MVS A;  1OCZ B;  3VQV A;  4JV5 B;  1KP3 A;  3MD0 A;  3ZHT A;  1IBK B;  1NVP D;  2CH7 A;  3QNE A;  5LMN B;  1RFY A;  3OTO B;  1ZTE A;  5LP6 A;  4O4L A;  1VQ8 V;  4E2L A;  4DV5 O;  1KU9 A;  4HAM A;  1JCH A;  3ZMT A;  5B1N A;  3AG4 C;  4UVA A;  3N2K A;  4LF6 B;  3UT5 B;  2QKC A;  3BY6 A;  3UO2 A;  1NVP B;  2A79 B;  5IYC O;  2H94 A;  2Z5U A;  5CA3 A;  2ZE7 A;  2IM9 A;  2OT5 A;  1TVK A;  3J81 N;  4LWS A;  4YY3 O;  2FTK A;  4DV7 O;  5IJ9 B;  5KMG A;  3SPC A;  4JGS A;  1KKD A;  2ZDI C;  4KHP O;  5JH7 A;  4DV6 B;  1QU7 A;  1VP7 A;  4Z2W A;  5AG2 A;  4DV2 O;  2DMX A;  2OTJ V;  1FXK C;  1EZJ A;  3AG2 C;  3RYI A;  1QR9 A;  1XRE A;  4DR7 B;  4JI2 O;  2WLK A;  2CTW A;  1VQN V;  2ILM A;  1K92 A;  3HKB A;  4WF9 V;  4AI8 A;  4FFB A;  3SDL A;  3JD2 A;  3OMA B;  2Q68 A;  3B4S A;  4Z1V A;  4IL6 Z;  3CS5 A;  1K97 A;  4GKK B;  1GN6 A;  4DR2 B;  1SQV H;  1XDC A;  5E79 Z;  2HJF C;  3DTU B;  2Q73 A;  4K8Z A;  3TXQ A;  5GTH Z;  4QIW F;  2HJD A;  1OCZ C;  2YIB A;  3B8M A;  3D36 A;  2YEV A;  3I55 V;  1Z5W A;  1PNL A;  2UXD O;  1L8D A;  3IJ4 A;  4RQE A;  4DXW A;  2UUB B;  3B8N A;  5IY5 B;  3E8B A;  3FD9 A;  3T1C A;  3F5T A;  3SYO A;  5FNV B;  1NS1 A;  2LP7 A;  4NXN O;  1N0J A;  1QR8 A;  4UV8 A;  2ARH A;  2UXC B;  4WFF A;  1JQ0 A;  1F51 A;  2YXL A;  2CE4 A;  2L35 A;  4WBN B;  2BTQ B;  3QO5 A;  3J7A U;  4LFB B;  1QHT A;  2IH3 C;  4DR4 O;  2XAH A;  1AI5 A;  1JR9 A;  4FLU A;  3JAR A;  1Q90 D;  4FK5 C;  5DED A;  1YZB A;  4I0X A;  3ZMV A;  4DV1 O;  1CEZ A;  1GN3 A;  1US6 A;  4BR6 A;  1I5Y A;  1AR4 A;  1W0J G;  4B3M O;  3ETE A;  4B3S B;  2EIJ C;  1Y76 B;  2VQF O;  4DV0 O;  5IWA B;  5KA5 A;  3JAW A;  2QM4 A;  1FKA O;  3ZRW A;  3MAQ A;  2CTP A;  2IJI A;  2EJR A;  4B08 A;  3MHS C;  2R70 A;  5JCO A;  3T2M A;  1Y67 A;  4QJF B;  4XDJ A;  4F6R B;  3ZHQ A;  2JJ1 G;  3CCS V;  1F4N A;  4J80 A;  2W6J G;  2HP8 A;  4YJ3 B;  3AG3 B;  2ZIN A;  3VQX A;  2W0F C;  3IFX A;  3BA9 A;  2X6A A;  1AI4 A;  1Y6X A;  3SJA C;  4O4I A;  3UM7 A;  1HR0 O;  2QTO A;  3I5D A;  4O4J A;  3QVN A;  3CPW U;  2A0L A;  4JZG A;  3ASN B;  2VRZ A;  1AVM A;  3LSQ A;  4JI4 O;  2JEX A;  2HR3 A;  4JI0 O;  1H8H G;  3ABU A;  5IY5 C;  1M4U A;  2WLL B;  3OMI B;  1CP9 A;  4TQF A;  3E2E A;  3PJS K;  3FKS G;  5EZY B;  1IX9 A;  5B1A C;  2RDC A;  2DQ3 A;  2F93 B;  1R3K C;  1YEW A;  1NBM G;  4CS3 A;  2ZKO A;  4X1K B;  1N36 B;  3SJC C;  3OD4 A;  2B5U A;  3FX7 A;  1R3J C;  1RM1 B;  2AZ0 A;  3LNN A;  4LFC O;  4RO2 A;  4WFG A;  3LSU A;  1GN4 A;  4TQD A;  1JPX A;  3H1J H;  3X2Q B;  2OCC C;  5EC2 C;  4LF5 O;  3BHP A;  4ZOL A;  5JVD A;  4H37 A;  5DN6 G;  1IBM B;  4JI6 O;  4HNA A;  1P49 A;  1SA0 B;  2M7W A;  3JAT A;  1YI2 V;  3ZHU A;  4O2A B;  3DC5 A;  2PYJ A;  1FFT B;  1YSC A;  1OJH A;  2GUZ A;  5H2F Z;  4YIO A;  1NTM H;  3L71 H;  2CH7 B;  3ZN1 A;  5CN0 A;  5CA0 A;  2HVJ C;  3JAL A;  1K4D C;  1W2B U;  2P6J A;  3CCM V;  2Q7G A;  2Q8V A;  3OW2 U;  3HKC A;  1V54 B;  1G4Y B;  3N2K B;  3WG7 B;  1N32 O;  4P9O A;  4PA4 A;  5KHH A;  4X89 A;  3APQ A;  4LF7 O;  4JYA O;  5GW7 A;  1NR7 A;  1TVK B;  2JGD A;  4NYK A;  4JF3 A;  5LXT A;  4I4T A;  4DV2 B;  2EIN B;  2FML A;  4J41 A;  2WLJ A;  2ODM A;  3JAK A;  3L75 H;  1HNX O;  3H1L H;  4ZKI A;  1N33 O;  4PA9 A;  1KKC A;  3JCZ A;  3SR2 C;  3RYC A;  4MVM A;  3TCU A;  5C8Y B;  2P22 C;  5H5N A;  5JH7 B;  4JI3 O;  2HLD G;  4PA3 A;  1P84 F;  3GVM A;  1NZ6 A;  3CCV V;  4EB6 A;  3CCJ V;  2GDS A;  4TV8 A;  2XOK G;  4R6Z A;  2CGN A;  4X1Y A;  3OR6 C;  1SQP H;  3RT3 C;  1XL4 A;  1KC8 W;  2JK5 C;  4FFB B;  3CXH F;  5DEC A;  4RUE A;  4JTD B;  3L72 H;  1XMQ B;  1N34 O;  2H8P C;  1WN7 A;  4PI2 A;  2FB5 A;  2CTQ A;  3LUT B;  4OX9 O;  2WLI A;  2XTA A;  1S77 D;  3X2Q C;  1PKX A;  3CC4 V;  1O9G A;  4AHC A;  1D5N A;  1OZ0 A;  3CRC A;  3RN4 A;  4B7E A;  1I7F A;  2D2C B;  4J7K A;  1TA8 A;  2PI5 A;  1Q6U A;  1S5J A;  2ITD C;  4BWA A;  2AHZ A;  1VQP V;  1S72 V;  2X0L A;  1B06 A;  2MK3 A;  1W0K G;  1XQ8 A;  1VQK V;  2AW9 A;  4JAV A;  1NH2 D;  3T1Y B;  4DK1 A;  4GT1 A;  3Q4H A;  1J5E O;  5LMU B;  4O4H A;  4TUY A;  3E86 A;  1XNR B;  4MVU A;  1SQQ H;  5CBH A;  1K34 A;  4ZHQ B;  1VQ7 V;  1QLE B;  1EBO A;  3WG7 C;  2FKX A;  1I94 B;  3VQW A;  4JTC B;  4X1I A;  1NH2 B;  3JAR B;  1ZL8 B;  2BOB C;  1Y66 A;  2W6I G;  5BMV B;  3JYC A;  2CAZ C;  4KUM A;  1IBL O;  1AB3 A;  4FZ1 A;  1VQ5 V;  4I50 A;  1WLE A;  3RYH B;  2EIN C;  2XAS A;  3ETQ A;  2PUS A;  1SES A;  4LFA O;  4J7Z A;  2EZO A;  4U3F H;  3D3Q A;  2Y0P A;  3CMA V;  4JAA A;  4DO2 A;  4LF9 O;  5JJE B;  3OUF A;  5EBW C;  1KB9 F;  5L3G A;  4YHH O;  1MZF A;  3CHX A;  1IDS A;  1MG1 A;  2F66 C;  2Q9L A;  3ZHS A;  1Q6H A;  5H6R A;  3TGU H;  2UXB O;  1NKD A;  4HZ3 A;  5BXZ A;  1G8M A;  1JFF A;  2P4V A;  3GWK C;  4N21 A;  2PI4 A;  3VBB A;  4XDK A;  4DUZ B;  2AGA A;  2OIE A;  2WAM A;  3EXA A;  2PY5 A;  2NN4 A;  4ZIB A;  2HEP A;  2JS5 A;  3SYQ A;  4LNU B;  4GLX A;  2HG5 C;  2QSA A;  1SKV A;  1PP9 H;  3M8A A;  2EIK B;  2Q0O C;  4X62 B;  3MHH C;  3CCE V;  3E8F A;  4O4I B;  4TOI A;  4YJ2 A;  4JI7 O;  4JYY A;  3T1H B;  1VMG A;  2DYR B;  1M57 C;  1TAE A;  5BR8 B;  3G4S V;  4TV9 A;  3RVZ A;  3KCX A;  4X64 O;  5CB4 B;  1ZLZ A;  3ZHV A;  5LBQ A;  1GTO A;  2O57 A;  2Q0A A;  3CSX A;  2F23 A;  1BL8 A;  5E1A C;  2AZ2 A;  3ZHR A;  1V55 C;  1M93 A;  2DYS C;  1XHZ A;  3K03 A;  1EN5 A;  2OIG A;  5LHI A;  5IYD O;  4DR1 O;  3STZ C;  1AIL A;  3JAM N;  1BCC H;  4J9Z B;  3G71 V;  3E35 A;  2HHH B;  1WAZ A;  4JI6 B;  3K0G A;  1H2M A;  2YI8 A;  4QE9 A;  3QTC A;  4FLZ A;  4DV4 O;  2QE7 G;  3EVK A;  5LOV A;  2DN9 A;  2UUC O;  2ZIO A;  2XAJ A;  4PV1 B;  4HNA B;  4FIP C;  3UCS C;  4ABM A;  3D3I A;  2PYL A;  4FLX A;  2R72 A;  5KAF Z;  3FB6 C;  3SYC A;  4P30 A;  4LBE C;  2V4D A;  3H1H H;  1VF6 C;  5IJ0 A;  1HDJ A;  2GV9 A;  4UFZ A;  4LF4 B;  3R65 A;  4B3R B;  4JI8 O;  4MSW C;  2H3O A;  4TSF G;  1HWY A;  4DR5 B;  5TIS Z;  2EIK C;  2E75 B;  4C7U A;  3K5N A;  5LA6 B;  4X9Q A;  2X6C A;  1OHH G;  2DE0 X;  2ZXW C;  2IJK A;  3C3S A;  1SQX H;  5B3S B;  2JGD B;  2Z3Y A;  4I4T B;  4CH6 A;  1AR1 B;  3ABL B;  1MSD A;  2PZS A;  4PJ0 Z;  2E5L O;  3RYC B;  2QWO B;  4LF8 O;  1BHA A;  1ZAU A;  4CC5 A;  4I55 A;  4D7T A;  2ZE8 A;  3G80 A;  2Y69 C;  3ZS8 C;  4QNH B;  4W4K A;  4X1Y B;  1HNW O;  1KEC A;  3CYO A;  2W0X A;  1AP6 A;  4LH7 A;  4RWU A;  1H2L A;  3ZCC A;  1H2G A;  3AG1 B;  4UVB A;  1GK9 A;  1TUE B;  1I0H A;  4DUY B;  1SQF A;  3H1I H;  3G6B A;  4JI1 B;  2WLI B;  1JJO A;  1ZWI C;  3ZRS A;  3ZMS A;  3G6E V;  2HKO A;  1PPJ H;  2F4V O;  3ABK B;  1K3E A;  2PTM A;  5B66 Z;  3NR7 A;  5IYZ B;  2LO1 A;  3APO A;  4ZI7 A;  2QGN A;  1QVG U;  3JD0 A;  3FB5 C;  2YI9 A;  5CMU A;  2QDO A;  2YC0 A;  3ICX A;  4MVO A;  5LGT A;  4J42 A;  3RYF A;  4O4H B;  4TUY B;  3FB7 C;  1D2D A;  5J2T A;  3KG2 A;  4PDV A;  3E22 A;  1Q6I A;  1BGY H;  4IIJ A;  1PNM A;  4X88 A;  2QWN B;  4AIL C;  3W7T A;  2CGO A;  4X1I B;  1MZE A;  2V7Q G;  2P06 A;  4MW8 A;  1FXH A;  4GZR B;  2LGW A;  2EBO A;  3J80 N;  1Q8I A;  2Q7E A;  2A06 H;  3M7M X;  1TGO A;  1ENV A;  4IGG A;  5DM6 V;  2VQE B;  2QKA A;  2A3Q A;  1YVW A;  2UXB B;  4MTG A;  2RN9 A;  4PHZ A;  4YIP A;  3L9D A;  4BIZ A;  3JD3 A;  3UQ8 A;  1R3L C;  2BSK A;  5EK0 A;  5HFM A;  1CXZ B;  1H2N A;  2WA3 A;  1ZUQ A;  3WB0 A;  5CA1 B;  4W4L A;  4X20 A;  2P5O A;  2ZM6 O;  1HW7 A;  4Z1M G;  3K08 A;  3K59 A;  4AQY B;  3K06 A;  5LYJ A;  4LC1 A;  3TK1 A;  3K04 A;  2GBO A;  3VOU A;  5EYP B;  1FJG B;  1P7B A;  2WLM A;  4NB5 A;  1PL0 A;  2GTA A;  2G38 A;  2Y4T A;  1ZX3 A;  3JCU Z;  5A2Q N;  3K3W A;  1X59 A;  2K1E A;  1RSO A;  5C93 A;  1YJW V;  2V1D A;  3JSL A;  4I5S A;  5CBG A;  2RJZ A;  1E79 G;  1VF5 B;  3OGC C;  3HKE A;  2JJ2 G;  1NU1 H;  3JD1 A;  3CEI A;  3C90 A;  4CH4 A;  4G2K A;  4TV9 B;  3CE2 A;  2XAQ A;  4FLW A;  5L3F A;  4DV3 B;  5JJN B;  2OTL V;  2LW7 A;  3N2G B;  4NXM B;  4GX0 A;  1MOF A;  3ZED A;  2UUA O;  2Q5Z A;  4P9P A;  3ASO B;  4CS4 A;  3HKD A;  4B3T O;  2E74 B;  4I9Q A;  3ZMU A;  3JAS A;  3A0B Z;  4BW5 A;  3K57 A;  1XNQ B;  4NTY A;  5J9P C;  3B40 A;  5BZB A;  3W7U A;  1UJW B;  4IHJ B;  4QPK A;  2MW2 B;  1RP3 B;  3ETD A;  1K7D A;  5KX5 B;  1G1X B;  1JA8 A;  3ETG A;  1PV0 A;  4MW3 A;  3WFV A;  1HNZ B;  2UU9 B;  4UCS A;  4DR3 O;  1QNM A;  3FFQ A;  5EIB D;  3A0H Z;  3B09 A;  4BW9 A;  3LDE A;  4P2Z A;  2Q69 A;  1U96 A;  3G67 A;  2LFS A;  2KG7 A;  2ZDI A;  2ZNI A;  1TUB A;  2BE3 A;  3CWB H;  1FFX A;  2QTS A;  2EIL B;  1R6K A;  1FXK A;  4IT5 A;  3E8H A;  2VWJ A;  4DV5 B;  1LR1 A;  4K0K O;  3K5M A;  1NTK H;  1XHX A;  3W7X A;  2B1I A;  1OCR B;  2E5L B;  4LF8 B;  1U97 A;  1IUR A;  3ZRX A;  3ZX6 A;  1XMO O;  5ITZ A;  1M56 B;  3AG3 C;  5LP6 B;  4O4L B;  1VQ9 V;  1GN2 A;  1K5S A;  4FM1 A;  4JI5 O;  4UV9 A;  4FPP A;  3EHB B;  2NNU A;  4QPJ A;  4YY3 B;  4DV7 B;  3F7Y C;  5L3E A;  4CH3 A;  5KAI Z;  2IU3 A;  2WA4 A;  4E4E A;  4PI0 A;  1Y74 A;  4O2B A;  4YXW G;  4KHP B;  3SYA A;  3OTF A;  3F7V C;  4LWS B;  3ASN C;  1XUQ A;  4B7K A;  4X65 O;  3ASO C;  3B77 A;  4JI2 B;  3CRQ A;  1G6U A;  5KMG B;  2EJ7 A;  4X66 O;  4DYL A;  1AJQ A;  4UB6 Z;  2QKS A;  1BZK A;  1WP8 A;  4UCR A;  4XDL A;  3RYI B;  4JZ2 A;  1IBK O;  5B1B B;  1OCC B;  1OCO B;  3THO A;  3STL C;  1K73 W;  4FFK A;  3HKB B;  3W7S A;  3OTO O;  3UT5 A;  1RM1 C;  1SQG A;  1P7G A;  4PDR A;  1URF A;  2YIB D;  2XND G;  3N27 A;  3FB8 C;  1LNQ A;  1L0L H;  4LF6 O;  2UXD B;  4DRX A;  3CC2 V;  1B6Q A;  2EX3 A;  3SPH A;  2VWK A;  1V9P A;  2JVD A;  5LGN A;  2YEV B;  5J2T B;  4I9W A;  4NXN B;  4RUF A;  1SRY A;  4R7C A;  3SJQ C;  5FLX N;  4DV6 O;  1NJI W;  4R8C A;  4DR4 B;  1QLN A;  4U7O A;  2ATK C;  4TT3 G;  5IE9 A;  1VQ4 V;  5LP6 C;  3P30 A;  4PD4 F;  3QO8 A;  3P3N A;  1VQM V;  3OE7 G;  4DR7 O;  3K58 A;  4GCZ A;  1H2K A;  4DV1 B;  4XBF A;  1V54 C;  4UCU A;  3JD4 A;  2N74 A;  3CD6 V;  4FM0 A;  4B3M B;  1THZ A;  5IYB O;  2VQF B;  4DV0 B;  4RAI A;  2OCH A;  2BSK B;  4I0X B;  1GM8 A;  3HR0 A;  4GKK O;  4DR2 O;  2N04 A;  5J2U A;  2LQT A;  3GWO A;  4X20 B;  1UPG A;  3WU2 Z;  3IAY A;  1ROP A;  4JAU A;  2GHY A;  3JAW B;  4UUJ C;  5FNV A;  4WCE V;  3ZRW B;  2ZR2 A;  1VF7 A;  4J10 A;  4N23 A;  4OPA A;  1KQS U;  4MVR A;  2JGU A;  1DLB A;  3CCR V;  4HYO A;  2UUB O;  1OCO C;  2BTQ A;  3WB1 A;  4EKW A;  1AJP A;  3ZMZ A;  5L3D A;  1IXB A;  4MTX A;  2UXC O;  1F4M A;  3BPZ A;  5B1O A;  2QWP B;  1Q7Y W;  1QCE A;  1HR0 B;  4BIU A;  4L87 A;  3HKE B;  2ZR3 A;  1WB7 A;  4LFB O;  4G27 B;  1YTF D;  5D5Q A;  4JI4 B;  1GM7 A;  4GX1 A;  1Y76 A;  1WPX A;  4JI0 B;  1M5I A;  5JQG A;  3D36 C;  4O4J B;  2Z0A A;  4TWK A;  3FYE B;  4B3S O;  3K0D A;  1Z5V A;  1Q3E A;  1YTF B;  2OYQ A;  2PF4 E;  2RNB A;  2P90 A;  4K8X A;  3JAS B;  3DXR A;  1K9M W;  5FPR A;  3K9A A;  3ABM B;  2F1M A;  2YUA A;  4YJ3 A;  4UCV A;  4LFC B;  1BHB A;  1DF4 A;  1QLE C;  2DJV A;  3RBZ A;  1JMK C;  1RPR A;  1Q86 W;  1HP8 A;  1GRJ A;  1BQZ A;  4LF5 B;  3AK1 A;  4D7S A;  2DQ0 A;  5HFL A;  2NLJ C;  3SJB C;  4D6T H;  1F7Y A;  1S0V A;  2EZP A;  1KUQ A;  2RMK B;  2OWO A;  2DWD C;  1YIJ V;  1B3Q A;  4ZOL B;  4UCT A;  3CRM A;  5JVD B;  4I7Z B;  1YJ9 V;  1VAR A;  3K9S A;  5KUK A;  5GTI Z;  3H1K H;  1K4C C;  1KBH A;  1S3J A;  1FFX B;  3JAT B;  3CCL V;  1IZ3 A;  1FXK B;  3CRR A;  3CCU V;  1GO3 F;  5JCO C;  3AG2 B;  2BOC C;  2YIC A;  2GUZ B;  3ABT A;  3T4Z A;  4X1K A;  1SF9 A;  3H01 A;  3TET A;  2L6L A;  4BAY A;  1N32 B;  5CA0 B;  4OPH A;  5ITZ B;  4LF7 B;  4JYA B;  3A0R A;  2FL4 A;  3JAL B;  1BE3 H;  3T4D A;  1BT8 A;  3HKC B;  4LCU C;  2DOS A;  5L3C A;  1L0N H;  1HNX B;  1BSM A;  1N33 B;  1Y74 B;  4O2B B;  2DYR C;  4K3A A;  4JI3 B;  1KYO F;  1XIL A;  4J9Y B;  4LR3 A;  1KMI Z;  5A9G A;  5LXT B;  3BVO A;  3JAK B;  4UXN A;  4O2A A;  2UXX A;  1Q81 W;  4WFE A;  1WJZ A;  1IXM A;  3LDD A;  1YIT V;  1IBM O;  1EM1 A;  3SYP A;  1KP2 A;  3AG7 A;  3LSS A;  2IH1 C;  3ABM C;  1N34 B;  4EB6 B;  4TV8 B;  2YXH A;  1H8E G;  5JJJ B;  1I08 A;  4JPR A;  4OX9 B;  4MTF A;  4RQF A;  2ETN A;  1WP7 A;  2GSM B;  5F2V O;  1ARO P;  2F43 G;  4GX5 A;  2YID A;  2WLN A;  4ZBM A;  3W7W A;  3ML0 A;  3E8G A;  1WA8 A;  3CP1 A;  1Z2G A;  5LL6 Y;  1Q43 A;  1EN4 A;  5LGU A;  1VQ6 V;  4OGQ B;  3A2F A;  1P4R A;  1YDX A;  5LHG A;  1AR5 A;  4DRX B;  2CK3 G;  1FD9 A;  1K8A W;  2EIJ B;  1DTO A;  1R3I C;  5C8Y A;  4EFB A;  4EEQ A;  1R6N A;  1VQO V;  2HFE C;  2B1G A;  4WFH A;  4F4L A;  1J5E B;  1FS0 G;  2Q67 A;  4JYB A;  4DK0 A;  4PA7 A;  1MSW D;  4MVZ A;  1MA1 A;  3PN1 A;  3K5O A;  3Q4H B;  2ZE6 A;  1F23 A;  1GH6 A;  2ZE5 A;  2NR5 A;  1IBL B;  1Q5O A;  2VS0 A;  2IW5 A;  3KZI Z;  1IVS A;  4LFA B;  1SC5 B;  2XAG A;  1XMQ O;  4UVC A;  1R1B A;  1MAB G;  4LF9 B;  4FVM A;  5B3S C;  1I5X A;  2RCV A;  1SER A;  4I50 B;  3H9V A;  2JDI G;  2KQX A;  3ABL C;  4YHH B;  5J2U B;  2R9R B;  2LJ2 A;  3OMN B;  3BCC H;  1JOY A;  3K5L A;  2A9H A;  3UKM A;  3TXS A;  1E1Q G;  3L73 H;  1SET A;  3C3T A;  4J11 A;  1EFR G;  4DR6 O;  5B1A B;  4DW0 A;  2ZIM A;  2QM8 A;  4LP8 A;  3DGE A;  4ZHQ A;  1JFF B;  2LFR A;  3P32 A;  3AG1 C;  3T1Y O;  5FPO A;  1SQB H;  2WWW A;  5LMU O;  4KP4 A;  1Y4M A;  1ZL8 A;  3FAV A;  5BMV A;  1XNR O;  2CDY A;  4CH5 A;  4FJC C;  4JI7 B;  4PDL A;  4KL1 A;  1JX9 A;  3RYH A;  3OAA G;  4GKJ O;  1I94 O;  1PM9 A;  2OCC B;  3QO7 A;  3ABK C;  4YJ2 B;  4ASU G;  5JQG B;  2K9P A;  5K1X A;  4X64 B;  1JJ2 U;  4U7N A;  3O65 A;  3O9O A;  2R9A A;  3BRC A;  1XL6 A;  1XOU A;  3S3X A;  4BIO A;  4U3J A;  4HBN A;  1VF6 A;  4A5U B;  3DXR B;  1AI6 A;  3DC6 A;  4DR1 B;  5IDJ A;  4GYC B;  4H13 B;  2E3C A;  1MMM A;  2IJJ A;  4LNU A;  2XHB A;  5LHH A;  2IJH A;  4DV4 B;  2ZCE A;  4DUZ O;  5BY1 A;  3SPJ A;  2LGQ A;  1XBL A;  3E83 A;  2UUC B;  3R66 A;  4PEL A;  4X8A A;  1S5L Z;  1X4T A;  1NI8 A;  4FMT A;  3AK2 A;  3CJH A;  4IYH A;  3F5W C;  3TJT A;  1PD3 A;  5GON A;  4H44 B;  3I56 V;  4KFM A;  2GTS A;  4K35 A;  3U0Z A;  5LOV B;  4UB8 Z;  4X62 O;  1L1F A;  4NTX A;  3BAB A;  1W59 A;  3T1H O;  5CB4 A;  1ZSP A;  1UFI A;  3JSN A;  2P4K A;  5BR8 O;  4JI8 B;  1R6T A;  1GKF A;  1O9H A;  2JEU A;  5IJ0 B;  1PNK A;  4WFB V;  3IGA C;  1N4C A;  1MNG A;  4GX2 A;  2CTR A;  1VQL V;  1S76 D;  4JTA B;  3CXC U;  3IC9 A;  1YCI A;  1KD1 W;  1PL4 A;  4FM2 A;  1EN6 A;  3AEI A;  3OEE G;  4GUN A;  3CC7 V;  1RPO A;  1WPB A;  3OEH G;  4NTW A;  1DK1 A;  2QM7 A;  2D3O W;  3D8C A;  2HHH O;  2E76 B;  1YHQ V;  1AJN A;  3BEH A;  4MS2 A;  4QGP A;  1VEW A;  1SS3 A;  1HNW B;  3L70 H;  4MTO A;  1M1K W;  2P7T C;  1T5E A;  2JIZ G;  1WB8 A;  4I55 B;  3U11 A;  3CME V;  3KCY A;  3P3P A;  3RW0 A;  2DW4 A;  3BAA A;  1M90 W;  1XI1 A;  4IYI A;  2Y48 A;  1DGS A;  2B9Z A;  2IU0 A;  2YSU B;  1A32 A;  4LF4 O;  2AHY A;  3RWR D;  2C2A A;  2M6Y A;  5LA6 A;  4CZZ A;  1H2S B;  1SZT A;  4B3R O;  2YS8 A;  2Q7H A;  2F4V B;  4JV5 O;  1WA8 B;  1VIB A;  5IT9 N;  4DR5 O;  3OR7 C;  5FL7 G;  2XUM A;  4NKG B;  1YXB A;  3MDS A;  4EFE A;  2WLH A;  3OM3 B;  3OUS A;  5LMN O;  2XAF A;  3VQY A;  3S3W A;  1FPO A;  2Y4U A;  3CCQ V;  2A7W A;  2ZD9 A;  1COW G;  1NTZ H;  4PA6 A;  4ZI7 B;  5KUM A;  3IC7 A;  1FXV A;  5IJ9 A;  1ORQ C;  2ADQ B;  2QWQ B;  2EUL A;  5K1P A;  3RYF B;  1D5A A;  2YXY A;  1NT2 B;  2EIL C;  3BA8 A;  4CS2 A;  3E22 B;  5EIB C;  4IIJ B;  3GB7 C;  4L8J A;  2AXT Z;  3RGB A;  1GM9 A;  3OT7 A;  3A8T A;  4J7J A;  4JYC A;  2BTO A;  5KA6 A;  1NQT A;  3LDC A;  1OCR C;  2XT9 A;  4DUY O;  3ZJZ A;  2RQ6 A;  4JI1 O;  4UCO A;  1M56 C;  4G28 B;  2Q6A A;  4LH6 A;  2EIM B;  4KXR A;  1M57 B;  4H0L B;  3ZRV A;  5IYZ A;  5D5P A;  1BMF G;  3SGI A;  1YJN V;  4DR6 B;  5H6Q A;  1N0N A;  1S5H C;  4FLY A;  2Y0I A;  4JAS A;  2ZM6 B;  4Q6G A;  4FLV A;  1OV9 A;  2PGG A;  2ZQM A;  3CRA A;  2KB1 A;  3EFF K;  5KLV H;  3AK3 A;  3RVY A;  3HB3 B;  3QG5 A;  1GAX A;  3SPG A;  4GKJ B;  1V55 B;  2KSD A;  2DYS B;  3KKY A;  3NXS A;  3B2E E;  1K5Q A;  1XEQ A;  3U10 A;  5LYJ B;  3FAV B;  3HPL C;  2YIA A;  2X7R B;  2ADP A;  5B5E Z;  5B1B C;  4WBN A;  1OCC C;  4QE7 A;  5JWP A;  1K33 A;  2QA4 V;  2Q4P A;  2FYU H;  1RSO B;  1N8R W;  1QQC A;  1SZX A;  1GMG A;  2YDE A;  3E89 A;  5CBF A;  2VQE O;  4U3J B;  2UUA B;  2X6B A;  5CA1 A;  4PDM A;  2BCC H;  3K79 A; 
#chains in the Genus database with same CATH homology
 4IYH A;  4J7J A;  2GTS A;  4IYI A;  4J42 A;  4KXR A;  4J41 A;  4W4K A;  4W4L A;  4J10 A;  2G38 A;  3FX7 A;  4J11 A;  4J7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...