1F23A

Contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
75
structure length
74
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGTKQLQARLSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEKNEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the HIV gp41 core containing an Ile573 to Thr substitution: implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords TRANSMEMBRANE GLYCOPROTEIN
total genus 30
structure length 74
sequence length 75
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f23A00
5CMUA 5HFLA 2EZPA 1JQ0A 2EZOA 4JPRA 2EBOA 1DF5A 1QBZA 1MOFA 3CYOA 1Y66A 5KA5A 1QR9A 1Y4MA 2P6JA 3MHSC 4FIPC 2OT5A 5H9CA 4N23A 4FJCC 3GWOA 3P30A 3B8MA 3MHHC 4JF3A 1MG1A 1K34A 5HFMA 3B77A 3M99B 4FK5C 4JGSA 4G2KA 1F23A 5CN0A 1JPXA 4N21A 3WFVA 1K33A 1I5YA 2MK3A 5KA6A 3H01A 1I5XA 2LP7A 1QCEA 1DF4A 3K9AA 3B8NA 1SZTA 1QR8A 3CP1A 2M7WA 1EBOA 1ENVA 4E2LA 2X7RB 1DLBA
chains in the Genus database with same CATH superfamily
2H3OA 1R3JC 1HNZO 1H2NA 1J5EO 4X66O 3K03A 1N36B 3ZEDA 3JCZA 1RPOA 3L74H 2IJJA 4PA9A 1S5LZ 5KHHA 5IJ0B 1BCCH 3AG2B 3HKCB 5BY1A 1JR9A 2CGNA 2ZR3A 3T1HO 4LWSA 4X88A 4MTOA 4B3SO 3IC7A 4LNUA 4A5UB 3OTOB 2P4VA 5BZBA 4DR4O 1MZEA 2BE3A 5H9CA 3RN4A 1ZSPA 1JVMA 1US6A 2QKSA 4PDVA 4QE7A 1JX9A 1VQ8V 2QM7A 3ZMVA 1FKAO 3ABUA 4OPAA 4DUZO 1R73A 4O4LA 1H2KA 1K8AW 2LW7A 3ZMTA 4FLTA 4JTDB 4PI0A 4RUFA 4H33A 4BAYA 2XASA 4J11A 4MS2A 4LF4B 4LFCB 2WWWA 3JCUZ 2EIJC 1RM1C 4E4EA 2VQFO 4B3SB 5IE9A 3E2EA 1KB9F 2A7WA 1WA8A 2WLNA 3BA9A 1VQ4V 3OEHG 2ZCEA 1Y74A 2HJFC 4O2BA 3MAQA 1GKFA 2XHBA 1XUQA 1I08A 1F4MA 2XAFA 3JARA 2ZE6A 4O4JB 4QNHB 1OCOC 3D3IA 4PDRA 1VQPV 3QTCA 5KUMA 1AJQA 2FB5A 2RN9A 4GX5A 4JI3O 3VBBA 2V7QG 3X2QB 3FYEB 2K9PA 4FFBA 2Y69B 1QR8A 3BY6A 3DXRB 1BHBA 5FL7G 4DO2A 2ZM6O 1SQQH 4UVBA 3K0GA 1WB8A 3UCSC 1AP6A 3SPJA 1FXKB 1YZBA 3AK2A 4WFBV 1XMOO 5JJNB 3OW2U 3C3TA 3H1HH 1J5EB 4GX0A 4LR3A 1K7DA 2ADQB 4JI1O 1BHAA 1N32B 1M9NA 4IYIA 3T1YO 5CB4B 1PP9H 2RJZA 1Q5OA 3U11A 4CH4A 1Q6UA 5KA5A 3E8BA 4TV9A 4DR3B 2UU9B 1OV9A 3NXSA 4ZOLB 2HVJC 2Q8VA 3U0ZA 3UT5B 1XDCA 1LNQA 2E75B 3JALB 3RYHB 2AGAA 3G6EV 5L3DA 2ZDIA 4UVAA 1GM8A 1Z5VA 4PA4A 2NR5A 4I9QA 4MVMA 1KKDA 2LFRA 5J9PC 4LF6B 4DV2B 1DF4A 1F4NA 3RW0A 1K4DC 1EBOA 3CJHA 2ADPA 1NTKH 1N8RW 4UV9A 2QTSA 1ZAUA 4ICGA 1Z2GA 2P22C 4PJ0Z 1YTFB 1NT2B 2R70A 3HKBB 3ICXA 1H8EG 5LBQA 4QPJA 1YTFD 3OMNB 2ZR2A 4MT8A 1N0JA 2Z3YA 3FX7A 5EYPA 4FLZA 4KXRA 4Z1MG 4X62O 5DECA 1XHZA 1VP7A 4QE9A 1D2DA 2ZXWB 3OE7G 4DUYB 2X0LA 4DV4B 3OGCC 2Q73A 4LF9B 4YIOA 4NTXA 4DR1B 1YVWA 2A9HA 2RQ6A 2GV9A 3T1CA 2HJDA 4XDLA 4YXWG 3L75H 4C7UA 3K79A 2GBOA 4LF7B 2QWRB 1R6TA 4X65O 2L35A 5IJ9A 3QO7A 2UXCO 2CTPA 3RYCB 4NTYA 1WPXA 2JVDA 1DK1A 1HP8A 3JAMN 2IW5A 1A32A 4O4IB 3APOA 1PNLA 1SQPH 2PTMA 4JI4B 1COWG 1BQ0A 1BQZA 5JCOC 2ZIOA 4DV6O 3FKSG 4LFBO 4ASUG 5DN6G 1I7FA 1HNWB 1IBLB 2QWNB 1P7BA 2WA3A 2IU0A 5KX5B 2EBOA 4F6RA 4DW1A 2OIEA 2YI8A 1XHXA 3M7MX 1V55B 3AK1A 3CJHB 4JI2B 1ORQC 5D5QA 1ZLZA 2QM4A 3ABKC 5LXTB 4P30A 3R66A 2Y4UA 3ABLC 4DR4B 4YHHB 3SPIA 4CS2A 2Q5ZA 4X66B 1H2LA 2BOBC 4W4LA 2VWKA 5B66Z 1I0HA 4J41A 1HR0B 4LFBB 4JF3A 1SF9A 4ZHQA 1GH6A 2HR3A 3SDLA 2QR4A 4P2ZA 4DV1O 2CH7B 4IT5A 2KSDA 5LGTA 5CBFA 4UVCA 1G8MA 2ZQMA 4Q20A 4GX1A 2OYQA 2YIAA 2OCCC 4GZRB 3RYIA 3H1JH 1VEWA 3OD4A 1VF6A 1PM9A 2Q7GA 2YIBD 3G80A 4DV0B 2KQXA 3ASOB 4YJ3A 3SPGA 2UXCB 4D6TH 1OCZB 1AR4A 3UKMA 1VQ7V 5LYJA 3QNEA 5JQGA 2WLIB 2JGUA 1W59A 5L3BA 4DR5O 4GYCB 5GTHZ 1GTOA 5IY5B 1PV0A 2WA4A 5BMVA 1VQKV 1BSMA 3K57A 4LP8A 1JFFB 4JAUA 1NTMH 3ZN0A 1XQ8A 5BMVB 2IH3C 1UFIA 1BL8A 3J81N 2FKXA 2ZKOA 1JQ0A 2LO1A 2DWEC 1EZVH 3A8TA 3JARB 1RFYA 3AG4B 4UXNA 3VQVA 1AI6A 3JYCA 4JI3B 4DRXA 2UXBO 1IDSA 2PUSA 2QJ1A 3B77A 4YJ3B 4IHJA 3KZIZ 3S3XA 2QTOA 3H01A 4NKGB 4YY3O 3CRAA 3E83A 3KCXA 2HKOA 1CP9A 3ZRVA 3P32A 4J7KA 5LL6Y 1W0JG 3E8GA 5EZYA 1QBZA 2Q69A 5LHGA 1AJPA 1Y66A 1WB7A 3TXQA 3AEIA 3G6BA 1NVPB 3E22B 5E79Z 3E86A 3BPZA 1J95A 4OX9B 2FTKA 3UT5A 1M5IA 4F6EA 5CA3A 3K58A 4KFMA 4CBCA 2AXTZ 1P7GA 2QGNA 4JASA 1T5EA 2Q9LA 2DE0X 4YY3B 5J2UA 3BRCA 5GONA 1UJWB 4KHPB 3T2MA 3F7YC 4IHJB 3LSUA 4DRXB 3TK1A 2WLMA 3K9AA 1B6QA 1IURA 1VQ5V 5IJ0A 1RM1B 2EIJB 3WG7B 1KD1W 2EZPA 2DWDC 5C8YA 4JPRA 3H9VA 3Q4HA 5EC1C 5LMUO 1KKCA 1QR9A 1H2MA 3OR7C 1S5JA 1L1FA 1NTZH 3EHBB 2VQEO 2F1MA 1EN4A 1XREA 4X89A 3HKEB 4O4HA 4DV7O 4O4JA 1NKDA 1Q43A 3H1KH 1KC8W 2WPDG 4OXSA 3QG5A 1GN2A 2YEVB 3L70H 1MMMA 4B3MO 2AW9A 1TGOA 2UXDO 2GUZB 4ZI7A 4LF8O 5CA1B 3ETQA 2GUZA 3CE2A 3ZHVA 2JGDB 4JYAB 1O9HA 1TUBA 4I50B 4MTFA 1S77D 1SQFA 4O2AA 1JMKC 4DV3B 4JI2O 2CH7A 1HDJA 2CUGA 3CEIA 1SQXH 5FNVA 1WNSA 1TUBB 4GCZA 1K5SA 2ZXWC 1BGYH 4PDMA 4LF7O 3AG4C 1ZL8B 2QKCA 2V4DA 3OMIB 2LGQA 4LF8B 5C8YB 4X1YB 3M8AA 2W6IG 2ITCC 2CAZC 1E79G 1FXVA 1ZTEA 3OT7A 2YEVA 4UB8Z 2HEPA 4NR1A 4LWSB 5IY5C 1SS3A 3B4SA 3L72H 3OEEG 3ZRXA 4PD4F 5J2UB 1KUQA 2DQ3A 1MZFA 2B9ZA 4UCVA 1H8HG 1R3KC 3AG1B 3QO8A 5A2QN 2QKAA 3RYFA 3ASOC 2YUAA 3ABTA 3W7SA 2Q0OC 4LCUC 2D3OW 5FLXN 4TT3G 2Y0PA 2XAQA 5HFMA 3DTUB 4JYBA 4ZKIA 2UUAB 1YJWV 2P67A 1JJOA 4YIPA 2EJ7A 3T1YB 1IBMB 1SESA 2GDSA 2EZOA 5L3GA 2JGDA 2VWJA 4FPPA 4XBFA 2PZSA 3ZHQA 1O9GA 5BR8B 4FM0A 4B7KA 2EULA 2LW1A 5D5PA 1QVGU 1TA8A 1KP2A 4CH5A 2BCCH 2UUCB 3BVOA 2P4KA 3N2KB 1SA0A 4NXMB 2YI9A 1FXKA 4MVUA 1AB3A 3P3NA 4O4HB 1VQMV 5LGNA 2OIGA 1QLEB 4FMTA 2DMXA 2EILB 3SYPA 2WLHA 1KMIZ 2UXBB 3DXRA 5KHIA 3ABKB 4MTXA 1JFFA 5EC2C 2LGWA 3G4SV 1CXZB 1GM9A 2R72A 4CZZA 5JQGB 5LHHA 5FPOA 1X59A 4BIOA 4B08A 3LDDA 2IJKA 1KBHA 2R9AA 5LP6A 3H1LH 2A06H 1U96A 4TOIA 3JD1A 4MVZA 3W7TA 2RNBA 1FFXA 4I55B 4TUYA 1FJGO 4JI6O 4J7ZA 2PYLA 1HW7A 3KKYA 4IIJB 2HLDG 4K35A 1OCZC 4X20B 2DQ0A 3VOUA 4X8AA 4HNAA 3CS5A 3HPLC 4LF9O 4O4LB 3T4ZA 3FD9A 5LYJB 1KQSU 1GRJA 3N2KA 4WFHA 2DW4A 1Y76B 1LUWA 1MABG 4RO2A 4ZOLA 4IYHA 5EZYB 5LMNB 2CK3G 2YSUB 2YXLA 2E74B 2IBZH 3E89A 2F23A 5CMUA 5DEDA 1WAZA 2R9RB 3UO3A 5KLVH 3OGIB 3ML0A 5K1XA 1YDXA 4FVMA 4FK5C 4RUEA 3O9OA 1WP8A 3IFXA 2F4VB 5BXZA 2CDYA 3A0BZ 3BAAA 2DYRC 2YC0A 2X7RB 2ODMA 3ZHSA 1AVMA 2ZE7A 1MNGA 3U10A 3CXCU 1XMQB 3IC9A 1JJ2U 1P4RA 2P90A 2F93B 2BTQB 4U3JB 2ATKC 3CRRA 3I56V 1VF5B 2Q7HA 3RFRA 3PN1A 4KP4A 4J9YB 3ASNB 3BEHA 2F43G 4UCRA 2ZE5A 4GKJB 3SJBC 2WLKA 2IM9A 4L8JA 4B3MB 3RYCA 2W0FC 2EINC 5IWAO 2CGOA 2CTQA 2BSKA 5H6QA 3RT3C 1MSDA 1Y74B 2K1EA 4JI5B 1K97A 4F6RB 4X1YA 2NNUA 4FLUA 4DR5B 3CWBH 4ZI7B 3WB2A 4ZIBA 3OUSA 3IGAC 5GTIZ 2QWOB 4Z1VA 2ZNIA 1RSOA 5FNVB 1Q82W 1FJGB 3QVNA 1XOUA 3CYOA 5EYPB 2E3CA 2V1DA 4GLXA 1LUVA 4B7EA 5EBWC 5IJ9B 1GO3F 4JYAO 1F23A 1G1XB 2RDCA 4KL1A 1GN4A 4DR1O 4GX2A 4MVOA 4JI5O 3L73H 2OTLV 4AHCA 1S3JA 3AK3A 2BSKB 2ZE8A 1MOFA 4X65B 3ETEA 3F5WC 3FYIB 3CCQV 1YCIA 4LF5B 3OMAB 4BW5A 3K59A 1GN3A 5GONB 4OPHA 1NU1H 4N21A 3BCCH 4JI8B 4NXNO 2W0XA 5TISZ 2ARHA 2Z0AA 3LDEA 4DV4O 3K04A 4TQFA 4TWKA 1YHQV 4I0XA 1VF7A 4EFBA 1IBLO 3ZIAG 4J9ZB 1UPGA 3ABMC 4DR2B 2WLIA 5IYCO 5K1PA 2E76B 3P3PA 3A2FA 1SA0B 2YXYA 4O4IA 4LFCO 1KU9A 1XI1A 4LBEC 4HAMA 3ZS8C 3I5DA 3AG3B 1AI5A 3A0RA 2UUBO 1CPYA 5J2TB 1PD3A 4G28B 4JI4O 2A0LA 2R9IA 4J7JA 4NTWA 5LA6A 5KHGA 2VS0A 3HR0A 2HHHO 3W7WA 1VMGA 3MHHC 4EB6A 2ITDC 2Y0IA 2B5UA 4NYKA 1Y76A 2X6BA 3JAKA 1GN6A 1AI7A 1XEQA 1K33A 1VF6C 4MVQA 4F4LA 1G6UA 3CC7V 1AJNA 2ZINA 2EIMC 2YICA 1R3IC 1B3QA 3N27A 4BIUA 2ZM6B 3AG2C 3K5NA 1JOYA 5BR8O 2QEXV 3EVKA 5JH7A 4H0LB 5CB4A 4AI8A 3LSSA 5IT9N 4XDJA 3GVMA 4LF5O 3W7XA 2EJRA 2PI4A 3ZHUA 1Q8IA 4DV1B 3QO5A 4NXNB 3KCYA 3AG3C 1EFRG 1QLEC 5F2VO 5JH7B 1WN7A 3D8CA 3JAWA 4JI7B 1ZL8A 3IAYA 1W0KG 4FFBB 4CH3A 4PV1B 3ABMB 1JA8A 3VQYA 4DR2O 2P06A 1NH2D 2HVKC 3FB7C 1LR1A 4LF6O 1M4UA 2WLLA 4ABMA 4X1KA 2E5LB 3WG7C 3OUFA 5L3EA 1TVKB 1XBLA 2F4VO 1THZA 3BFRA 4JI6B 2EX3A 1B04A 2QWPB 4WCEV 4DR6B 3JSNA 3CHXA 1KP3A 1SQBH 3ZCCA 4TQDA 3LSQA 3K3WA 3F7VC 1F51A 3CXHF 2NN4A 2G38A 4EKWA 4JI7O 1MA1A 3HKCA 4IL6Z 4HZ3A 1SZXA 1EZJA 3M99B 2IU3A 3FB5C 3HKEA 3CCEV 1QNMA 3OTOO 3I55V 4JTAB 3WB0A 1WPBA 5B1NA 2Q67A 4K8XA 2BOCC 4HYOA 2F95B 3THOA 3CB2A 3ZMSA 3HB3B 2X6CA 1YI2V 3O65A 3BABA 3JSLA 4LNUB 1NH2B 2XT9A 2Y4TA 3D36A 3GB7C 4LC1A 2UXXA 3NR7A 3FFQA 1CEZA 1FPOA 3K9SA 3FAVB 4LH7A 1Q86W 3H1IH 3B40A 4D7SA 3EFFK 1TAEA 3ASNC 2Q7EA 1GM7A 4HBNA 1YJ9V 3WB1A 1H2SB 3CCMV 1MG1A 2QSAA 1Q81W 2NLJC 3ETDA 3OFNG 2D2CB 3J80N 4UCOA 2WLLB 1HR0O 1ROPA 1XNRO 1PNMA 1IXBA 1SQVH 4BWAA 5KUKA 1K92A 1QVFU 2DYRB 1QLNA 4FZ0A 3K06A 4WBNB 4LFAB 4FM2A 3PJSK 3MHSC 3DSQA 3GWOA 4DW0A 1FFXB 2PI5A 4G2KA 1K9MW 4FZ1A 1VQNV 5CA0A 4DK0A 2EIKB 3BHPA 2QDOA 2IJHA 2JEUA 3MDSA 2JDIG 3QF7A 2HP8A 1SRYA 3TGUH 2VQEB 4I4TA 3ZRWB 1XNQB 1H2GA 1N34B 1G4YB 4MVRA 4G27B 4N23A 1NI8A 4WF9V 3APQA 4JI0B 5LP6C 1ZUQA 4NB5A 1VQOV 2OTJV 1YF2A 2UU9O 5C93A 2XAHA 3R65A 3JATB 3STZC 1DLBA 4WFGA 3CCUV 3K5OA 3EXAA 3UM7A 3K5LA 2Q0AA 2Q6AA 5A9GA 1WLEA 4BW9A 1K3EA 4K3AA 5H6RA 1N32O 3ZRSA 4B3RB 3OR6C 4YHHO 4PDLA 1SKVA 1Q7YW 1IBKO 1NBMG 2RCVA 4EB6B 1YSCA 4TV9B 3WFVA 2PF4E 1XNRB 4WFAV 5KHJA 2P7TC 5CA0B 3CRMA 5ITZA 4X1IA 5J2TA 4I5SA 1DF5A 1FXHA 3JD3A 3E35A 3JASA 4WFEA 2YIDA 5IYZA 1FFTB 2QA4V 4X20A 4E2LA 1XNQO 2CTRA 3L71H 2JJ1G 4JV5B 5LA6B 1E1RG 4XDKA 2ZNJA 3G71V 4IGGA 4DUZB 1PL4A 3N2GA 4UCUA 3C3SA 4RQFA 4OGQB 5LXTA 1D5NA 1IVSA 1OHHG 5LHIA 3LNMB 2P5OA 4WFFA 4DUYO 1L0NH 3SR2C 1XL6A 2EINB 4K0KO 3CC2V 1VIBA 1IX9A 2DYSB 3ZX6A 2EIMB 3TJTA 1IBKB 4U7NA 4KUMA 2JS3A 2UXNA 1BMFG 4JAAA 2B1IA 1N34O 1VQ9V 1HNWO 1N4CA 5B5EZ 5LGUA 3AG1C 2M7WA 1AROP 4O2AB 4CC5A 3VQWA 3CSXA 3SJQC 5KHKA 4GUNA 4GKKB 5CA1A 4UCTA 4KHPO 1I5YA 2JIZG 5KAFZ 3K0DA 4X9QA 4X64B 4DR7O 4B3TO 5EK0A 2UXDB 2QWQB 1M90W 1NS1A 3SJCC 2UUCO 4WBNA 1DGSA 1KECA 2FL4A 4MW3A 2QE7G 3CPWU 4FLWA 5JWPA 5B1BB 1WP7A 1K34A 1Y67A 2IJIA 4MTGA 3ABLB 4Z2WA 3FB6C 1EM1A 1QHTA 4J10A 4UB6Z 3CP1A 1AI4A 3DGEA 1L0LH 3Q4HB 1VARA 2XOKG 1FYJA 1V55C 4I9WA 3ZBHA 5JJEB 4PA6A 4TV8B 4Q6GA 4DR7B 4B3TB 2WAMA 2HFEC 5JJJB 3OTFA 4JI8O 4DV0O 3LDCA 1YIJV 1YITV 4JI1B 2Y48A 4DV3O 3RGBA 5LMUB 2XNDG 4AILC 3SJAC 3OM3B 1WJZA 2BTQA 5H5NA 5KX5A 4K8ZA 1FXKC 3S3WA 2XAGA 2LQTA 1W2BU 5B1AB 2P6JA 2LFSA 1YEWA 2AZ2A 3CCJV 4MVSA 4JZGA 2Y69C 5JCOA 5IYZB 3L9DA 3BA8A 2EILC 2CTWA 1URFA 3SYOA 5LMNO 1OCOB 1NZ6A 1Q6IA 1HWYA 1NVPD 2WLJA 2UUAO 4MSWC 2CE4A 4H13B 5L3CA 1EN5A 1L8DA 3A0HZ 4D7TA 4DV2O 1M93A 2Z5UA 5B1AC 1ZWIC 1MSWD 2LP7A 1FS0G 1Z5WA 1SZTA 2B1GA 3FB8C 2ETNA 3E8HA 3SYQA 1M56C 2OT5A 1E1QG 1EN6A 4J80A 3VQXA 4PI2A 4LH6A 1RPRA 2ZD9A 4JAVA 1GK9A 4R7CA 3UO2A 3CCSV 2E5LO 2OWOA 4U3FH 4RWUA 1YXBA 1D5AA 4TUYB 3HKBA 4I55A 4DYLA 3G67A 2KG7B 1SQGA 5LP6B 4OX9O 4RAIA 2ZIMA 5KMGA 4TSFG 1VQ6V 2N04A 2DYSC 1YJNV 1M57C 4FLVA 1XMOB 4YJ2A 4BR6A 2BTOA 2KB1A 4JV5O 1M1KW 2YIBA 4L87A 1BZKA 1XL4A 2PGGA 3B09A 5E1AC 4PELA 3WU2Z 2ZT9B 2GHYA 3F5TA 4DR3O 1Y6XA 2H94A 5LOVB 3E22A 1OZ0A 1Q90D 3K08A 3JD0A 5EBMC 2MK3A 1M56B 3RYFB 3CD6V 2M6YA 1N33O 5IYBO 4EEQA 3SYAA 1P49A 2C2AA 4AQYO 5CBGA 1DTOA 1NR1A 3B8MA 4UV8A 3ZMZA 1GMGA 1R1BA 4P9PA 3J7AU 1QQCA 4UCSA 1Q3EA 1SETA 3B8NA 1F7YA 3LNNA 2O57A 2OCCB 1NR7A 4NVPA 2LJ2A 4U3JA 3JATA 2W6JG 3D36C 2DOSA 3ZHTA 1HNXO 2PY5A 1Y4MA 1OCRC 4DV7B 5B3SC 4UFZA 2A3QA 3CRCA 4RQEA 1HNZB 4JYCA 5JVDB 3RVZA 4EFEA 2XUMA 5B1OA 4QJFB 1B06A 4AQYB 4K0KB 4I4TB 3ZRWA 1OCCC 1SERA 1H38A 4O2BB 4UUJC 4GKJO 4X64O 5AG2A 3SPCA 1IBMO 4FM1A 3CC4V 5IWAB 1V54C 1ZX3A 3IJ4A 3K5MA 1Q6HA 2VQFB 1HNXB 3RYIB 1TVKA 4FFKA 4GT1A 2L6LA 3ZN1A 2GTSA 2Q4PA 5FPRA 1BT8A 2GTAA 2JS5A 3SPHA 3CCVV 2JJ2G 1I94O 4GKKO 4QIWF 5L3FA 4I50A 4R8CA 1RSOB 3CMEV 4NXMO 4B3RO 4IIJA 3SGIA 3DC5A 2ILMA 3JAWB 1K4CC 4YJ2B 3UQ8A 4CC6A 2JRIA 4X62B 1FD9A 2Q68A 2QM8A 1AILA 3FAVA 4DV6B 3B2EE 1RP3B 2FYUH 1AR1B 5EBLC 1S76D 3RBZA 5H2FZ 3RWRD 2H8PC 3CCLV 4DV5B 1OJHA 4MW8A 1IZ3A 1K73W 5IYDO 1FAFA 3N2GB 5JVDA 3AG7A 2OCHA 1I5XA 1JCHA 2XTAA 1I94B 1AP5A 4PHZA 4QPKA 3GWKC 2YXHA 4H44B 2AHZA 4PA7A 4FIPC 4JZ2A 1TUEB 3JD2A 3W7UA 3RYHA 3JALA 4FJCC 5LOVA 2IH1C 3CCRV 5KAIZ 1U97A 1NJIW 3JAKB 3DC6A 2JEXA 3ZHRA 1P84F 1VQLV 3CX5F 2WSSG 3TETA 1BE3H 3D3QA 1V9PA 5ITZB 1BS3A 4FLXA 2AHYA 2UUBB 4FLYA 2MW2B 4I7ZB 5KMGB 5KA6A 1N0NA 1QCEA 1GAXA 4X1KB 1K5QA 5GW7A 3ZJZA 3ZMUA 1N36O 4U7OA 4CH6A 4HNAB 3HKDB 2AZ0A 4I0XB 3JASB 1PKXA 1PL0A 4JTCB 1AR5A 4LFAO 2N74A 3CMAV 3CRQA 2HG5C 1R6NA 2HHHB 3MD0A 1IXMA 4DV5O 1S72V 3RVYA 4W4KA 4TV8A 2KG7A 1X4TA 4R50A 2XAJA 2FMLA 1OCCB 3P30A 3LUTB 1WA8B 2PYJA 4H37A 2RMKB 4CS4A 2KKWA 3T4DA 4CS3A 2DN9A 4DK1A 1QU7A 4LF4O 2A79B 2JK5C 1R3LC 3SYCA 3T1HB 5IDJA 1XMQO 1NQTA 3HKDA 1V54B 1OCRB 2DJVA 2EIKC 3JD4A 5CBHA 3X2QC 2X6AA 4PA3A 2ZDIC 1KYOF 3TXSA 4ZHQB 2N05A 3C90A 1N33B 3KG2A 5CN0A 2GSMB 4P9OA 1SC5B 3E8FA 2VRZA 5DM6V 2YS8A 1ENVA 1R6KA 4JYYA 1S5HC 4BIZA 2YDEA 4X1IB 5HFLA 2F66C 3STLC 5B3SB 1S0VA 5EIBD 4J42A 4DR6O 1XILA 3ETGA 4ZBMA 3TCUA 4JGSA 4QGPA 1JPXA 1PNKA 3OAAG 4R6ZA 5EIBC 4JI0O 4DXWA 1M57B 1PPJH 5B1BC
chains in the Genus database with same CATH topology
1PD3A 1FXKC 4G28B 1R3JC 2A0LA 2XAGA 2R9IA 1W2BU 5B1AB 2P6JA 3K03A 2LFSA 1UJWB 3JCZA 3W7WA 1RPOA 3MHHC 2ITDC 2IJJA 3T2MA 4PA9A 3F7YC 3CCJV 2B5UA 4MVSA 2Y69C 2X6BA 1AI7A 1K33A 3TK1A 3AG2B 2WLMA 2ZR3A 3K9AA 1B6QA 4X88A 2EILC 4MTOA 1VQ5V 4MVQA 4F4LA 3SYOA 1RM1B 3IC7A 1OCOB 3CC7V 2EIJB 1HWYA 1AJNA 3WG7B 1KD1W 2EZPA 2DWDC 2EIMC 1NVPD 4JPRA 1R3IC 2WLJA 5EC1C 4MSWC 4BIUA 3AG2C 1JOYA 5L3CA 1QR9A 5BZBA 3OR7C 5H9CA 2QEXV 1JVMA 1L1FA 2QKSA 4PDVA 3EHBB 4QE7A 3LSSA 1JX9A 1VQ8V 2Z5UA 5B1AC 1ZWIC 1MSWD 2QM7A 4XDJA 3ZMVA 2LP7A 4X89A 3ABUA 1FS0G 1R73A 1SZTA 5B1BC 1K8AW 3ZMTA 2B1GA 3FB8C 1NKDA 3W7XA 4JTDB 2EJRA 2PI4A 3E8HA 1KC8W 2WPDG 4RUFA 4OXSA 4H33A 4BAYA 3QO5A 2XASA 2YEVB 3AG3C 4MS2A 1M56C 3SYQA 2OT5A 1EFRG 1QLEC 1E1QG 2WWWA 2EIJC 1RM1C 1RPRA 3E2EA 2ZD9A 4JAVA 1GK9A 4R7CA 3CCSV 2WLNA 1W0KG 3ABMB 1VQ4V 3OEHG 2HJFC 1NH2D 2HVKC 3FB7C 1GKFA 4MTFA 1S77D 2WLLA 1F4MA 4RAIA 2XAFA 4TSFG 1VQ6V 4QNHB 3WG7C 3OUFA 5L3EA 1OCOC 3D3IA 4PDRA 1VQPV 1THZA 5KUMA 1AJQA 2DYSC 1YJNV 4GCZA 4GX5A 3VBBA 1K5SA 1M57C 2V7QG 2ZXWC 4WCEV 4PDMA 3AG4C 3X2QB 3FYEB 3OMIB 1KP3A 2Y69B 1QR8A 3ZCCA 2KB1A 3BY6A 1M1KW 1BHBA 3LSQA 5FL7G 4DO2A 4L87A 3K3WA 3F7VC 1XL4A 1F51A 3K0GA 4UVBA 2W6IG 2ITCC 4EKWA 1E79G 1FXVA 5E1AC 4PELA 3SPJA 1FXKB 2GHYA 2YEVA 4WFBV 4HZ3A 1EZJA 2H94A 3M99B 1OZ0A 2IU3A 3K08A 5IY5C 3FB5C 3CCEV 3OW2U 3JD0A 5EBMC 2MK3A 3OEEG 1K7DA 4GX0A 3ZRXA 1M56B 3I55V 2DQ3A 1BHAA 4JTAB 1M9NA 3CD6V 1H8HG 5B1NA 2Q67A 1R3KC 2BOCC 4HYOA 5IYBO 3AG1B 3QO8A 3ASOC 3SYAA 5KA5A 3E8BA 2C2AA 3ZMSA 3ABTA 3W7SA 3HB3B 4LCUC 3NXSA 2X6CA 5CBGA 2D3OW 1YI2V 1DTOA 1NR1A 2HVJC 4TT3G 3B8MA 4UV8A 2XAQA 3ZMZA 5HFMA 1GMGA 3DTUB 4P9PA 4JYBA 4ZKIA 1NH2B 3D36A 1YJWV 2P67A 3GB7C 4LC1A 1LNQA 1SETA 3G6EV 3B8NA 2UXXA 2OCCB 1NR7A 1SESA 1CEZA 5L3DA 2EZOA 2W6JG 2ZDIA 5L3GA 1Q86W 4UVAA 4FPPA 1GM8A 4XBFA 3EFFK 1Y4MA 3ASNC 4PA4A 1GM7A 1OCRC 1YJ9V 5B3SC 4MVMA 3CCMV 2LFRA 1KKDA 1MG1A 5J9PC 4RQEA 1Q81W 2NLJC 3ETDA 1QVGU 3OFNG 4JYCA 1DF4A 3RVZA 1KP2A 2WLLB 1F4NA 5B1OA 1ROPA 3RW0A 1K4DC 4QJFB 1EBOA 1PNMA 1FXKA 4MVUA 3ZRWA 1OCCC 1SERA 1VQMV 5KUKA 5LGNA 1K92A 1N8RW 4UV9A 1QVFU 2DYRB 1QLNA 1QLEB 4FMTA 3K06A 2EILB 3SYPA 2WLHA 1H38A 1YTFB 3PJSK 3MHSC 4UUJC 3ABKB 4MTXA 3SPCA 3GWOA 3CC4V 1V54C 5EC2C 3G4SV 2PI5A 4G2KA 1H8EG 1K9MW 1VQNV 5LBQA 4QPJA 1YTFD 3OMNB 2EIKB 1GM9A 2ZR2A 4MT8A 4CZZA 2Z3YA 5LHHA 4GT1A 2IJHA 3ZN1A 2JEUA 4Z1MG 2JDIG 1SRYA 3LDDA 3ZRWB 2IJKA 3SPHA 3CCVV 1H2GA 4QE9A 2JJ2G 1G4YB 2ZXWB 4MVRA 3OE7G 4G27B 4QIWF 5L3FA 4N23A 2X0LA 4R8CA 4WF9V 3OGCC 3CMEV 3JD1A 4MVZA 3W7TA 2A9HA 1K4CC 1VQOV 3T1CA 2OTJV 4XDLA 4YXWG 3K79A 5C93A 2Q68A 2QM8A 2XAHA 3R65A 3STZC 1DLBA 4WFGA 3CCUV 2HLDG 1OCZC 1AR1B 5EBLC 3UM7A 3QO7A 2Q6AA 1S76D 3RBZA 2DQ0A 3VOUA 1WLEA 4X8AA 2H8PC 1K3EA 1WPXA 5H6RA 3ZRSA 3HPLC 3OR6C 3CCLV 2IW5A 4PDLA 3T4ZA 1PNLA 1KQSU 4MW8A 1Q7YW 1K73W 1NBMG 4WFHA 5IYDO 1YSCA 2DW4A 3WFVA 1MABG 4RO2A 1I5XA 1JCHA 1COWG 4WFAV 2CK3G 2P7TC 3FKSG 2YSUB 4QPKA 4ASUG 3E89A 5DN6G 5CMUA 1P7BA 4I5SA 2IU0A 2AHZA 2EBOA 1DF5A 1FXHA 2R9RB 3JD3A 4PA7A 4FIPC 3E35A 4WFEA 1TUEB 3JD2A 3W7UA 4FJCC 1V55B 2IH1C 3ML0A 3CCRV 1ORQC 4FK5C 4RUEA 3ABKC 1FFTB 1NJIW 3IFXA 4P30A 2JEXA 2QA4V 3ABLC 2DYRC 4E2LA 2X7RB 3SPIA 1VQLV 2WSSG 2JJ1G 3TETA 2BOBC 3CXCU 1E1RG 4XDKA 3G71V 1JJ2U 2AHYA 1P4RA 2P90A 4JF3A 2ATKC 3I56V 2HR3A 4KP4A 5KA6A 4J9YB 3ASNB 3BEHA 2F43G 4P2ZA 1QCEA 4RQFA 2WLKA 1OHHG 5LGTA 5LHIA 5CBFA 3LNMB 5GW7A 1K5QA 3ZMUA 3ZJZA 2W0FC 4UVCA 2EINC 4U7OA 4WFFA 1G8MA 2ZQMA 4Q20A 5H6QA 1XL6A 2EINB 4GX1A 2OCCC 3CC2V 2K1EA 1PKXA 1K97A 1PL0A 4JTCB 2DYSB 2EIMB 4U7NA 2NNUA 4KUMA 2UXNA 1BMFG 3CMAV 2B1IA 3OUSA 3IGAC 2HG5C 3ASOB 3SPGA 1VQ9V 1R6NA 1OCZB 3MD0A 1IXMA 5LGUA 3AG1C 2M7WA 3UKMA 1Q82W 1AROP 1VQ7V 1S72V 3RVYA 3QNEA 3CYOA 2WLIB 3SJQC 2V1DA 5L3BA 4R50A 2XAJA 1GTOA 5IY5B 1OCCB 3P30A 5EBWC 1VQKV 3LUTB 1GO3F 1F23A 4LP8A 4H37A 4JAUA 1I5YA 2JIZG 3T4DA 3ZN0A 3K0DA 4GX2A 5EK0A 2IH3C 4MVOA 2A79B 1BL8A 1R3LC 2JK5C 3SYCA 1M90W 5IDJA 1NQTA 2OTLV 1V54B 1OCRB 1S3JA 1JQ0A 2DWEC 2EIKC 3JD4A 5CBHA 1MOFA 3AG4B 4UXNA 3X2QC 2X6AA 4PA3A 2ZDIC 3ETEA 3F5WC 3FYIB 3CCQV 1KECA 4MW3A 1AI6A 2QE7G 3CPWU 3JYCA 3OMAB 5B1BB 4BW5A 1K34A 3B77A 2IJIA 3KG2A 5CN0A 4MTGA 3ABLB 4N21A 3FB6C 2GSMB 2QTOA 3H01A 4P9OA 3E8FA 5DM6V 3LDEA 3E83A 3CP1A 1ENVA 1R6KA 1CP9A 2HKOA 3K04A 4TWKA 1AI4A 1S5HC 3DGEA 3ZRVA 3P32A 4BIZA 1YHQV 5HFLA 2XOKG 1V55C 1W0JG 3E8GA 3STLC 5B3SB 1QBZA 1S0VA 2Q69A 3ZIAG 5LHGA 1AJPA 1Y66A 4J9ZB 3ABMC 4I9WA 4PA6A 2WLIA 5IYCO 3AEIA 3ETGA 1NVPB 4ZBMA 2WAMA 2HFEC 3TCUA 3LDCA 3E86A 1YIJV 4JGSA 1YITV 1J95A 2Y48A 1JPXA 1PNKA 3OAAG 4HAMA 4LBEC 2FTKA 2XNDG 4R6ZA 5CA3A 4DXWA 3AG3B 4KFMA 4CBCA 1AI5A 3A0RA 1M57B 1CPYA 4JASA 3OM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMU A;  5HFL A;  2EZP A;  1JQ0 A;  2EZO A;  4JPR A;  2EBO A;  1DF5 A;  1QBZ A;  1MOF A;  3CYO A;  1Y66 A;  5KA5 A;  1QR9 A;  1Y4M A;  2P6J A;  3MHS C;  4FIP C;  2OT5 A;  5H9C A;  4N23 A;  4FJC C;  3GWO A;  3P30 A;  3B8M A;  3MHH C;  4JF3 A;  1MG1 A;  1K34 A;  5HFM A;  3B77 A;  3M99 B;  4FK5 C;  4JGS A;  4G2K A;  1F23 A;  5CN0 A;  1JPX A;  4N21 A;  3WFV A;  1K33 A;  1I5Y A;  2MK3 A;  5KA6 A;  3H01 A;  1I5X A;  2LP7 A;  1QCE A;  1DF4 A;  3K9A A;  3B8N A;  1SZT A;  1QR8 A;  3CP1 A;  2M7W A;  1EBO A;  1ENV A;  4E2L A;  2X7R B;  1DLB A; 
#chains in the Genus database with same CATH topology
 2H3O A;  1R3J C;  1HNZ O;  1H2N A;  1J5E O;  4X66 O;  3K03 A;  1N36 B;  3ZED A;  3JCZ A;  1RPO A;  3L74 H;  2IJJ A;  4PA9 A;  1S5L Z;  5KHH A;  5IJ0 B;  1BCC H;  3AG2 B;  3HKC B;  5BY1 A;  1JR9 A;  2CGN A;  2ZR3 A;  3T1H O;  4LWS A;  4X88 A;  4MTO A;  4B3S O;  3IC7 A;  4LNU A;  4A5U B;  3OTO B;  2P4V A;  5BZB A;  4DR4 O;  1MZE A;  2BE3 A;  5H9C A;  3RN4 A;  1ZSP A;  1JVM A;  1US6 A;  2QKS A;  4PDV A;  4QE7 A;  1JX9 A;  1VQ8 V;  2QM7 A;  3ZMV A;  1FKA O;  3ABU A;  4OPA A;  4DUZ O;  1R73 A;  4O4L A;  1H2K A;  1K8A W;  2LW7 A;  3ZMT A;  4FLT A;  4JTD B;  4PI0 A;  4RUF A;  4H33 A;  4BAY A;  2XAS A;  4J11 A;  4MS2 A;  4LF4 B;  4LFC B;  2WWW A;  3JCU Z;  2EIJ C;  1RM1 C;  4E4E A;  2VQF O;  4B3S B;  5IE9 A;  3E2E A;  1KB9 F;  2A7W A;  1WA8 A;  2WLN A;  3BA9 A;  1VQ4 V;  3OEH G;  2ZCE A;  1Y74 A;  2HJF C;  4O2B A;  3MAQ A;  1GKF A;  2XHB A;  1XUQ A;  1I08 A;  1F4M A;  2XAF A;  3JAR A;  2ZE6 A;  4O4J B;  4QNH B;  1OCO C;  3D3I A;  4PDR A;  1VQP V;  3QTC A;  5KUM A;  1AJQ A;  2FB5 A;  2RN9 A;  4GX5 A;  4JI3 O;  3VBB A;  2V7Q G;  3X2Q B;  3FYE B;  2K9P A;  4FFB A;  2Y69 B;  1QR8 A;  3BY6 A;  3DXR B;  1BHB A;  5FL7 G;  4DO2 A;  2ZM6 O;  1SQQ H;  4UVB A;  3K0G A;  1WB8 A;  3UCS C;  1AP6 A;  3SPJ A;  1FXK B;  1YZB A;  3AK2 A;  4WFB V;  1XMO O;  5JJN B;  3OW2 U;  3C3T A;  3H1H H;  1J5E B;  4GX0 A;  4LR3 A;  1K7D A;  2ADQ B;  4JI1 O;  1BHA A;  1N32 B;  1M9N A;  4IYI A;  3T1Y O;  5CB4 B;  1PP9 H;  2RJZ A;  1Q5O A;  3U11 A;  4CH4 A;  1Q6U A;  5KA5 A;  3E8B A;  4TV9 A;  4DR3 B;  2UU9 B;  1OV9 A;  3NXS A;  4ZOL B;  2HVJ C;  2Q8V A;  3U0Z A;  3UT5 B;  1XDC A;  1LNQ A;  2E75 B;  3JAL B;  3RYH B;  2AGA A;  3G6E V;  5L3D A;  2ZDI A;  4UVA A;  1GM8 A;  1Z5V A;  4PA4 A;  2NR5 A;  4I9Q A;  4MVM A;  1KKD A;  2LFR A;  5J9P C;  4LF6 B;  4DV2 B;  1DF4 A;  1F4N A;  3RW0 A;  1K4D C;  1EBO A;  3CJH A;  2ADP A;  1NTK H;  1N8R W;  4UV9 A;  2QTS A;  1ZAU A;  4ICG A;  1Z2G A;  2P22 C;  4PJ0 Z;  1YTF B;  1NT2 B;  2R70 A;  3HKB B;  3ICX A;  1H8E G;  5LBQ A;  4QPJ A;  1YTF D;  3OMN B;  2ZR2 A;  4MT8 A;  1N0J A;  2Z3Y A;  3FX7 A;  5EYP A;  4FLZ A;  4KXR A;  4Z1M G;  4X62 O;  5DEC A;  1XHZ A;  1VP7 A;  4QE9 A;  1D2D A;  2ZXW B;  3OE7 G;  4DUY B;  2X0L A;  4DV4 B;  3OGC C;  2Q73 A;  4LF9 B;  4YIO A;  4NTX A;  4DR1 B;  1YVW A;  2A9H A;  2RQ6 A;  2GV9 A;  3T1C A;  2HJD A;  4XDL A;  4YXW G;  3L75 H;  4C7U A;  3K79 A;  2GBO A;  4LF7 B;  2QWR B;  1R6T A;  4X65 O;  2L35 A;  5IJ9 A;  3QO7 A;  2UXC O;  2CTP A;  3RYC B;  4NTY A;  1WPX A;  2JVD A;  1DK1 A;  1HP8 A;  3JAM N;  2IW5 A;  1A32 A;  4O4I B;  3APO A;  1PNL A;  1SQP H;  2PTM A;  4JI4 B;  1COW G;  1BQ0 A;  1BQZ A;  5JCO C;  2ZIO A;  4DV6 O;  3FKS G;  4LFB O;  4ASU G;  5DN6 G;  1I7F A;  1HNW B;  1IBL B;  2QWN B;  1P7B A;  2WA3 A;  2IU0 A;  5KX5 B;  2EBO A;  4F6R A;  4DW1 A;  2OIE A;  2YI8 A;  1XHX A;  3M7M X;  1V55 B;  3AK1 A;  3CJH B;  4JI2 B;  1ORQ C;  5D5Q A;  1ZLZ A;  2QM4 A;  3ABK C;  5LXT B;  4P30 A;  3R66 A;  2Y4U A;  3ABL C;  4DR4 B;  4YHH B;  3SPI A;  4CS2 A;  2Q5Z A;  4X66 B;  1H2L A;  2BOB C;  4W4L A;  2VWK A;  5B66 Z;  1I0H A;  4J41 A;  1HR0 B;  4LFB B;  4JF3 A;  1SF9 A;  4ZHQ A;  1GH6 A;  2HR3 A;  3SDL A;  2QR4 A;  4P2Z A;  4DV1 O;  2CH7 B;  4IT5 A;  2KSD A;  5LGT A;  5CBF A;  4UVC A;  1G8M A;  2ZQM A;  4Q20 A;  4GX1 A;  2OYQ A;  2YIA A;  2OCC C;  4GZR B;  3RYI A;  3H1J H;  1VEW A;  3OD4 A;  1VF6 A;  1PM9 A;  2Q7G A;  2YIB D;  3G80 A;  4DV0 B;  2KQX A;  3ASO B;  4YJ3 A;  3SPG A;  2UXC B;  4D6T H;  1OCZ B;  1AR4 A;  3UKM A;  1VQ7 V;  5LYJ A;  3QNE A;  5JQG A;  2WLI B;  2JGU A;  1W59 A;  5L3B A;  4DR5 O;  4GYC B;  5GTH Z;  1GTO A;  5IY5 B;  1PV0 A;  2WA4 A;  5BMV A;  1VQK V;  1BSM A;  3K57 A;  4LP8 A;  1JFF B;  4JAU A;  1NTM H;  3ZN0 A;  1XQ8 A;  5BMV B;  2IH3 C;  1UFI A;  1BL8 A;  3J81 N;  2FKX A;  2ZKO A;  1JQ0 A;  2LO1 A;  2DWE C;  1EZV H;  3A8T A;  3JAR B;  1RFY A;  3AG4 B;  4UXN A;  3VQV A;  1AI6 A;  3JYC A;  4JI3 B;  4DRX A;  2UXB O;  1IDS A;  2PUS A;  2QJ1 A;  3B77 A;  4YJ3 B;  4IHJ A;  3KZI Z;  3S3X A;  2QTO A;  3H01 A;  4NKG B;  4YY3 O;  3CRA A;  3E83 A;  3KCX A;  2HKO A;  1CP9 A;  3ZRV A;  3P32 A;  4J7K A;  5LL6 Y;  1W0J G;  3E8G A;  5EZY A;  1QBZ A;  2Q69 A;  5LHG A;  1AJP A;  1Y66 A;  1WB7 A;  3TXQ A;  3AEI A;  3G6B A;  1NVP B;  3E22 B;  5E79 Z;  3E86 A;  3BPZ A;  1J95 A;  4OX9 B;  2FTK A;  3UT5 A;  1M5I A;  4F6E A;  5CA3 A;  3K58 A;  4KFM A;  4CBC A;  2AXT Z;  1P7G A;  2QGN A;  4JAS A;  1T5E A;  2Q9L A;  2DE0 X;  4YY3 B;  5J2U A;  3BRC A;  5GON A;  1UJW B;  4KHP B;  3T2M A;  3F7Y C;  4IHJ B;  3LSU A;  4DRX B;  3TK1 A;  2WLM A;  3K9A A;  1B6Q A;  1IUR A;  1VQ5 V;  5IJ0 A;  1RM1 B;  2EIJ B;  3WG7 B;  1KD1 W;  2EZP A;  2DWD C;  5C8Y A;  4JPR A;  3H9V A;  3Q4H A;  5EC1 C;  5LMU O;  1KKC A;  1QR9 A;  1H2M A;  3OR7 C;  1S5J A;  1L1F A;  1NTZ H;  3EHB B;  2VQE O;  2F1M A;  1EN4 A;  1XRE A;  4X89 A;  3HKE B;  4O4H A;  4DV7 O;  4O4J A;  1NKD A;  1Q43 A;  3H1K H;  1KC8 W;  2WPD G;  4OXS A;  3QG5 A;  1GN2 A;  2YEV B;  3L70 H;  1MMM A;  4B3M O;  2AW9 A;  1TGO A;  2UXD O;  2GUZ B;  4ZI7 A;  4LF8 O;  5CA1 B;  3ETQ A;  2GUZ A;  3CE2 A;  3ZHV A;  2JGD B;  4JYA B;  1O9H A;  1TUB A;  4I50 B;  4MTF A;  1S77 D;  1SQF A;  4O2A A;  1JMK C;  4DV3 B;  4JI2 O;  2CH7 A;  1HDJ A;  2CUG A;  3CEI A;  1SQX H;  5FNV A;  1WNS A;  1TUB B;  4GCZ A;  1K5S A;  2ZXW C;  1BGY H;  4PDM A;  4LF7 O;  3AG4 C;  1ZL8 B;  2QKC A;  2V4D A;  3OMI B;  2LGQ A;  4LF8 B;  5C8Y B;  4X1Y B;  3M8A A;  2W6I G;  2ITC C;  2CAZ C;  1E79 G;  1FXV A;  1ZTE A;  3OT7 A;  2YEV A;  4UB8 Z;  2HEP A;  4NR1 A;  4LWS B;  5IY5 C;  1SS3 A;  3B4S A;  3L72 H;  3OEE G;  3ZRX A;  4PD4 F;  5J2U B;  1KUQ A;  2DQ3 A;  1MZF A;  2B9Z A;  4UCV A;  1H8H G;  1R3K C;  3AG1 B;  3QO8 A;  5A2Q N;  2QKA A;  3RYF A;  3ASO C;  2YUA A;  3ABT A;  3W7S A;  2Q0O C;  4LCU C;  2D3O W;  5FLX N;  4TT3 G;  2Y0P A;  2XAQ A;  5HFM A;  3DTU B;  4JYB A;  4ZKI A;  2UUA B;  1YJW V;  2P67 A;  1JJO A;  4YIP A;  2EJ7 A;  3T1Y B;  1IBM B;  1SES A;  2GDS A;  2EZO A;  5L3G A;  2JGD A;  2VWJ A;  4FPP A;  4XBF A;  2PZS A;  3ZHQ A;  1O9G A;  5BR8 B;  4FM0 A;  4B7K A;  2EUL A;  2LW1 A;  5D5P A;  1QVG U;  1TA8 A;  1KP2 A;  4CH5 A;  2BCC H;  2UUC B;  3BVO A;  2P4K A;  3N2K B;  1SA0 A;  4NXM B;  2YI9 A;  1FXK A;  4MVU A;  1AB3 A;  3P3N A;  4O4H B;  1VQM V;  5LGN A;  2OIG A;  1QLE B;  4FMT A;  2DMX A;  2EIL B;  3SYP A;  2WLH A;  1KMI Z;  2UXB B;  3DXR A;  5KHI A;  3ABK B;  4MTX A;  1JFF A;  5EC2 C;  2LGW A;  3G4S V;  1CXZ B;  1GM9 A;  2R72 A;  4CZZ A;  5JQG B;  5LHH A;  5FPO A;  1X59 A;  4BIO A;  4B08 A;  3LDD A;  2IJK A;  1KBH A;  2R9A A;  5LP6 A;  3H1L H;  2A06 H;  1U96 A;  4TOI A;  3JD1 A;  4MVZ A;  3W7T A;  2RNB A;  1FFX A;  4I55 B;  4TUY A;  1FJG O;  4JI6 O;  4J7Z A;  2PYL A;  1HW7 A;  3KKY A;  4IIJ B;  2HLD G;  4K35 A;  1OCZ C;  4X20 B;  2DQ0 A;  3VOU A;  4X8A A;  4HNA A;  3CS5 A;  3HPL C;  4LF9 O;  4O4L B;  3T4Z A;  3FD9 A;  5LYJ B;  1KQS U;  1GRJ A;  3N2K A;  4WFH A;  2DW4 A;  1Y76 B;  1LUW A;  1MAB G;  4RO2 A;  4ZOL A;  4IYH A;  5EZY B;  5LMN B;  2CK3 G;  2YSU B;  2YXL A;  2E74 B;  2IBZ H;  3E89 A;  2F23 A;  5CMU A;  5DED A;  1WAZ A;  2R9R B;  3UO3 A;  5KLV H;  3OGI B;  3ML0 A;  5K1X A;  1YDX A;  4FVM A;  4FK5 C;  4RUE A;  3O9O A;  1WP8 A;  3IFX A;  2F4V B;  5BXZ A;  2CDY A;  3A0B Z;  3BAA A;  2DYR C;  2YC0 A;  2X7R B;  2ODM A;  3ZHS A;  1AVM A;  2ZE7 A;  1MNG A;  3U10 A;  3CXC U;  1XMQ B;  3IC9 A;  1JJ2 U;  1P4R A;  2P90 A;  2F93 B;  2BTQ B;  4U3J B;  2ATK C;  3CRR A;  3I56 V;  1VF5 B;  2Q7H A;  3RFR A;  3PN1 A;  4KP4 A;  4J9Y B;  3ASN B;  3BEH A;  2F43 G;  4UCR A;  2ZE5 A;  4GKJ B;  3SJB C;  2WLK A;  2IM9 A;  4L8J A;  4B3M B;  3RYC A;  2W0F C;  2EIN C;  5IWA O;  2CGO A;  2CTQ A;  2BSK A;  5H6Q A;  3RT3 C;  1MSD A;  1Y74 B;  2K1E A;  4JI5 B;  1K97 A;  4F6R B;  4X1Y A;  2NNU A;  4FLU A;  4DR5 B;  3CWB H;  4ZI7 B;  3WB2 A;  4ZIB A;  3OUS A;  3IGA C;  5GTI Z;  2QWO B;  4Z1V A;  2ZNI A;  1RSO A;  5FNV B;  1Q82 W;  1FJG B;  3QVN A;  1XOU A;  3CYO A;  5EYP B;  2E3C A;  2V1D A;  4GLX A;  1LUV A;  4B7E A;  5EBW C;  5IJ9 B;  1GO3 F;  4JYA O;  1F23 A;  1G1X B;  2RDC A;  4KL1 A;  1GN4 A;  4DR1 O;  4GX2 A;  4MVO A;  4JI5 O;  3L73 H;  2OTL V;  4AHC A;  1S3J A;  3AK3 A;  2BSK B;  2ZE8 A;  1MOF A;  4X65 B;  3ETE A;  3F5W C;  3FYI B;  3CCQ V;  1YCI A;  4LF5 B;  3OMA B;  4BW5 A;  3K59 A;  1GN3 A;  5GON B;  4OPH A;  1NU1 H;  4N21 A;  3BCC H;  4JI8 B;  4NXN O;  2W0X A;  5TIS Z;  2ARH A;  2Z0A A;  3LDE A;  4DV4 O;  3K04 A;  4TQF A;  4TWK A;  1YHQ V;  4I0X A;  1VF7 A;  4EFB A;  1IBL O;  3ZIA G;  4J9Z B;  1UPG A;  3ABM C;  4DR2 B;  2WLI A;  5IYC O;  5K1P A;  2E76 B;  3P3P A;  3A2F A;  1SA0 B;  2YXY A;  4O4I A;  4LFC O;  1KU9 A;  1XI1 A;  4LBE C;  4HAM A;  3ZS8 C;  3I5D A;  3AG3 B;  1AI5 A;  3A0R A;  2UUB O;  1CPY A;  5J2T B;  1PD3 A;  4G28 B;  4JI4 O;  2A0L A;  2R9I A;  4J7J A;  4NTW A;  5LA6 A;  5KHG A;  2VS0 A;  3HR0 A;  2HHH O;  3W7W A;  1VMG A;  3MHH C;  4EB6 A;  2ITD C;  2Y0I A;  2B5U A;  4NYK A;  1Y76 A;  2X6B A;  3JAK A;  1GN6 A;  1AI7 A;  1XEQ A;  1K33 A;  1VF6 C;  4MVQ A;  4F4L A;  1G6U A;  3CC7 V;  1AJN A;  2ZIN A;  2EIM C;  2YIC A;  1R3I C;  1B3Q A;  3N27 A;  4BIU A;  2ZM6 B;  3AG2 C;  3K5N A;  1JOY A;  5BR8 O;  2QEX V;  3EVK A;  5JH7 A;  4H0L B;  5CB4 A;  4AI8 A;  3LSS A;  5IT9 N;  4XDJ A;  3GVM A;  4LF5 O;  3W7X A;  2EJR A;  2PI4 A;  3ZHU A;  1Q8I A;  4DV1 B;  3QO5 A;  4NXN B;  3KCY A;  3AG3 C;  1EFR G;  1QLE C;  5F2V O;  5JH7 B;  1WN7 A;  3D8C A;  3JAW A;  4JI7 B;  1ZL8 A;  3IAY A;  1W0K G;  4FFB B;  4CH3 A;  4PV1 B;  3ABM B;  1JA8 A;  3VQY A;  4DR2 O;  2P06 A;  1NH2 D;  2HVK C;  3FB7 C;  1LR1 A;  4LF6 O;  1M4U A;  2WLL A;  4ABM A;  4X1K A;  2E5L B;  3WG7 C;  3OUF A;  5L3E A;  1TVK B;  1XBL A;  2F4V O;  1THZ A;  3BFR A;  4JI6 B;  2EX3 A;  1B04 A;  2QWP B;  4WCE V;  4DR6 B;  3JSN A;  3CHX A;  1KP3 A;  1SQB H;  3ZCC A;  4TQD A;  3LSQ A;  3K3W A;  3F7V C;  1F51 A;  3CXH F;  2NN4 A;  2G38 A;  4EKW A;  4JI7 O;  1MA1 A;  3HKC A;  4IL6 Z;  4HZ3 A;  1SZX A;  1EZJ A;  3M99 B;  2IU3 A;  3FB5 C;  3HKE A;  3CCE V;  1QNM A;  3OTO O;  3I55 V;  4JTA B;  3WB0 A;  1WPB A;  5B1N A;  2Q67 A;  4K8X A;  2BOC C;  4HYO A;  2F95 B;  3THO A;  3CB2 A;  3ZMS A;  3HB3 B;  2X6C A;  1YI2 V;  3O65 A;  3BAB A;  3JSL A;  4LNU B;  1NH2 B;  2XT9 A;  2Y4T A;  3D36 A;  3GB7 C;  4LC1 A;  2UXX A;  3NR7 A;  3FFQ A;  1CEZ A;  1FPO A;  3K9S A;  3FAV B;  4LH7 A;  1Q86 W;  3H1I H;  3B40 A;  4D7S A;  3EFF K;  1TAE A;  3ASN C;  2Q7E A;  1GM7 A;  4HBN A;  1YJ9 V;  3WB1 A;  1H2S B;  3CCM V;  1MG1 A;  2QSA A;  1Q81 W;  2NLJ C;  3ETD A;  3OFN G;  2D2C B;  3J80 N;  4UCO A;  2WLL B;  1HR0 O;  1ROP A;  1XNR O;  1PNM A;  1IXB A;  1SQV H;  4BWA A;  5KUK A;  1K92 A;  1QVF U;  2DYR B;  1QLN A;  4FZ0 A;  3K06 A;  4WBN B;  4LFA B;  4FM2 A;  3PJS K;  3MHS C;  3DSQ A;  3GWO A;  4DW0 A;  1FFX B;  2PI5 A;  4G2K A;  1K9M W;  4FZ1 A;  1VQN V;  5CA0 A;  4DK0 A;  2EIK B;  3BHP A;  2QDO A;  2IJH A;  2JEU A;  3MDS A;  2JDI G;  3QF7 A;  2HP8 A;  1SRY A;  3TGU H;  2VQE B;  4I4T A;  3ZRW B;  1XNQ B;  1H2G A;  1N34 B;  1G4Y B;  4MVR A;  4G27 B;  4N23 A;  1NI8 A;  4WF9 V;  3APQ A;  4JI0 B;  5LP6 C;  1ZUQ A;  4NB5 A;  1VQO V;  2OTJ V;  1YF2 A;  2UU9 O;  5C93 A;  2XAH A;  3R65 A;  3JAT B;  3STZ C;  1DLB A;  4WFG A;  3CCU V;  3K5O A;  3EXA A;  3UM7 A;  3K5L A;  2Q0A A;  2Q6A A;  5A9G A;  1WLE A;  4BW9 A;  1K3E A;  4K3A A;  5H6R A;  1N32 O;  3ZRS A;  4B3R B;  3OR6 C;  4YHH O;  4PDL A;  1SKV A;  1Q7Y W;  1IBK O;  1NBM G;  2RCV A;  4EB6 B;  1YSC A;  4TV9 B;  3WFV A;  2PF4 E;  1XNR B;  4WFA V;  5KHJ A;  2P7T C;  5CA0 B;  3CRM A;  5ITZ A;  4X1I A;  5J2T A;  4I5S A;  1DF5 A;  1FXH A;  3JD3 A;  3E35 A;  3JAS A;  4WFE A;  2YID A;  5IYZ A;  1FFT B;  2QA4 V;  4X20 A;  4E2L A;  1XNQ O;  2CTR A;  3L71 H;  2JJ1 G;  4JV5 B;  5LA6 B;  1E1R G;  4XDK A;  2ZNJ A;  3G71 V;  4IGG A;  4DUZ B;  1PL4 A;  3N2G A;  4UCU A;  3C3S A;  4RQF A;  4OGQ B;  5LXT A;  1D5N A;  1IVS A;  1OHH G;  5LHI A;  3LNM B;  2P5O A;  4WFF A;  4DUY O;  1L0N H;  3SR2 C;  1XL6 A;  2EIN B;  4K0K O;  3CC2 V;  1VIB A;  1IX9 A;  2DYS B;  3ZX6 A;  2EIM B;  3TJT A;  1IBK B;  4U7N A;  4KUM A;  2JS3 A;  2UXN A;  1BMF G;  4JAA A;  2B1I A;  1N34 O;  1VQ9 V;  1HNW O;  1N4C A;  5B5E Z;  5LGU A;  3AG1 C;  2M7W A;  1ARO P;  4O2A B;  4CC5 A;  3VQW A;  3CSX A;  3SJQ C;  5KHK A;  4GUN A;  4GKK B;  5CA1 A;  4UCT A;  4KHP O;  1I5Y A;  2JIZ G;  5KAF Z;  3K0D A;  4X9Q A;  4X64 B;  4DR7 O;  4B3T O;  5EK0 A;  2UXD B;  2QWQ B;  1M90 W;  1NS1 A;  3SJC C;  2UUC O;  4WBN A;  1DGS A;  1KEC A;  2FL4 A;  4MW3 A;  2QE7 G;  3CPW U;  4FLW A;  5JWP A;  5B1B B;  1WP7 A;  1K34 A;  1Y67 A;  2IJI A;  4MTG A;  3ABL B;  4Z2W A;  3FB6 C;  1EM1 A;  1QHT A;  4J10 A;  4UB6 Z;  3CP1 A;  1AI4 A;  3DGE A;  1L0L H;  3Q4H B;  1VAR A;  2XOK G;  1FYJ A;  1V55 C;  4I9W A;  3ZBH A;  5JJE B;  4PA6 A;  4TV8 B;  4Q6G A;  4DR7 B;  4B3T B;  2WAM A;  2HFE C;  5JJJ B;  3OTF A;  4JI8 O;  4DV0 O;  3LDC A;  1YIJ V;  1YIT V;  4JI1 B;  2Y48 A;  4DV3 O;  3RGB A;  5LMU B;  2XND G;  4AIL C;  3SJA C;  3OM3 B;  1WJZ A;  2BTQ A;  5H5N A;  5KX5 A;  4K8Z A;  1FXK C;  3S3W A;  2XAG A;  2LQT A;  1W2B U;  5B1A B;  2P6J A;  2LFS A;  1YEW A;  2AZ2 A;  3CCJ V;  4MVS A;  4JZG A;  2Y69 C;  5JCO A;  5IYZ B;  3L9D A;  3BA8 A;  2EIL C;  2CTW A;  1URF A;  3SYO A;  5LMN O;  1OCO B;  1NZ6 A;  1Q6I A;  1HWY A;  1NVP D;  2WLJ A;  2UUA O;  4MSW C;  2CE4 A;  4H13 B;  5L3C A;  1EN5 A;  1L8D A;  3A0H Z;  4D7T A;  4DV2 O;  1M93 A;  2Z5U A;  5B1A C;  1ZWI C;  1MSW D;  2LP7 A;  1FS0 G;  1Z5W A;  1SZT A;  2B1G A;  3FB8 C;  2ETN A;  3E8H A;  3SYQ A;  1M56 C;  2OT5 A;  1E1Q G;  1EN6 A;  4J80 A;  3VQX A;  4PI2 A;  4LH6 A;  1RPR A;  2ZD9 A;  4JAV A;  1GK9 A;  4R7C A;  3UO2 A;  3CCS V;  2E5L O;  2OWO A;  4U3F H;  4RWU A;  1YXB A;  1D5A A;  4TUY B;  3HKB A;  4I55 A;  4DYL A;  3G67 A;  2KG7 B;  1SQG A;  5LP6 B;  4OX9 O;  4RAI A;  2ZIM A;  5KMG A;  4TSF G;  1VQ6 V;  2N04 A;  2DYS C;  1YJN V;  1M57 C;  4FLV A;  1XMO B;  4YJ2 A;  4BR6 A;  2BTO A;  2KB1 A;  4JV5 O;  1M1K W;  2YIB A;  4L87 A;  1BZK A;  1XL4 A;  2PGG A;  3B09 A;  5E1A C;  4PEL A;  3WU2 Z;  2ZT9 B;  2GHY A;  3F5T A;  4DR3 O;  1Y6X A;  2H94 A;  5LOV B;  3E22 A;  1OZ0 A;  1Q90 D;  3K08 A;  3JD0 A;  5EBM C;  2MK3 A;  1M56 B;  3RYF B;  3CD6 V;  2M6Y A;  1N33 O;  5IYB O;  4EEQ A;  3SYA A;  1P49 A;  2C2A A;  4AQY O;  5CBG A;  1DTO A;  1NR1 A;  3B8M A;  4UV8 A;  3ZMZ A;  1GMG A;  1R1B A;  4P9P A;  3J7A U;  1QQC A;  4UCS A;  1Q3E A;  1SET A;  3B8N A;  1F7Y A;  3LNN A;  2O57 A;  2OCC B;  1NR7 A;  4NVP A;  2LJ2 A;  4U3J A;  3JAT A;  2W6J G;  3D36 C;  2DOS A;  3ZHT A;  1HNX O;  2PY5 A;  1Y4M A;  1OCR C;  4DV7 B;  5B3S C;  4UFZ A;  2A3Q A;  3CRC A;  4RQE A;  1HNZ B;  4JYC A;  5JVD B;  3RVZ A;  4EFE A;  2XUM A;  5B1O A;  4QJF B;  1B06 A;  4AQY B;  4K0K B;  4I4T B;  3ZRW A;  1OCC C;  1SER A;  1H38 A;  4O2B B;  4UUJ C;  4GKJ O;  4X64 O;  5AG2 A;  3SPC A;  1IBM O;  4FM1 A;  3CC4 V;  5IWA B;  1V54 C;  1ZX3 A;  3IJ4 A;  3K5M A;  1Q6H A;  2VQF B;  1HNX B;  3RYI B;  1TVK A;  4FFK A;  4GT1 A;  2L6L A;  3ZN1 A;  2GTS A;  2Q4P A;  5FPR A;  1BT8 A;  2GTA A;  2JS5 A;  3SPH A;  3CCV V;  2JJ2 G;  1I94 O;  4GKK O;  4QIW F;  5L3F A;  4I50 A;  4R8C A;  1RSO B;  3CME V;  4NXM O;  4B3R O;  4IIJ A;  3SGI A;  3DC5 A;  2ILM A;  3JAW B;  1K4C C;  4YJ2 B;  3UQ8 A;  4CC6 A;  2JRI A;  4X62 B;  1FD9 A;  2Q68 A;  2QM8 A;  1AIL A;  3FAV A;  4DV6 B;  3B2E E;  1RP3 B;  2FYU H;  1AR1 B;  5EBL C;  1S76 D;  3RBZ A;  5H2F Z;  3RWR D;  2H8P C;  3CCL V;  4DV5 B;  1OJH A;  4MW8 A;  1IZ3 A;  1K73 W;  5IYD O;  1FAF A;  3N2G B;  5JVD A;  3AG7 A;  2OCH A;  1I5X A;  1JCH A;  2XTA A;  1I94 B;  1AP5 A;  4PHZ A;  4QPK A;  3GWK C;  2YXH A;  4H44 B;  2AHZ A;  4PA7 A;  4FIP C;  4JZ2 A;  1TUE B;  3JD2 A;  3W7U A;  3RYH A;  3JAL A;  4FJC C;  5LOV A;  2IH1 C;  3CCR V;  5KAI Z;  1U97 A;  1NJI W;  3JAK B;  3DC6 A;  2JEX A;  3ZHR A;  1P84 F;  1VQL V;  3CX5 F;  2WSS G;  3TET A;  1BE3 H;  3D3Q A;  1V9P A;  5ITZ B;  1BS3 A;  4FLX A;  2AHY A;  2UUB B;  4FLY A;  2MW2 B;  4I7Z B;  5KMG B;  5KA6 A;  1N0N A;  1QCE A;  1GAX A;  4X1K B;  1K5Q A;  5GW7 A;  3ZJZ A;  3ZMU A;  1N36 O;  4U7O A;  4CH6 A;  4HNA B;  3HKD B;  2AZ0 A;  4I0X B;  3JAS B;  1PKX A;  1PL0 A;  4JTC B;  1AR5 A;  4LFA O;  2N74 A;  3CMA V;  3CRQ A;  2HG5 C;  1R6N A;  2HHH B;  3MD0 A;  1IXM A;  4DV5 O;  1S72 V;  3RVY A;  4W4K A;  4TV8 A;  2KG7 A;  1X4T A;  4R50 A;  2XAJ A;  2FML A;  1OCC B;  3P30 A;  3LUT B;  1WA8 B;  2PYJ A;  4H37 A;  2RMK B;  4CS4 A;  2KKW A;  3T4D A;  4CS3 A;  2DN9 A;  4DK1 A;  1QU7 A;  4LF4 O;  2A79 B;  2JK5 C;  1R3L C;  3SYC A;  3T1H B;  5IDJ A;  1XMQ O;  1NQT A;  3HKD A;  1V54 B;  1OCR B;  2DJV A;  2EIK C;  3JD4 A;  5CBH A;  3X2Q C;  2X6A A;  4PA3 A;  2ZDI C;  1KYO F;  3TXS A;  4ZHQ B;  2N05 A;  3C90 A;  1N33 B;  3KG2 A;  5CN0 A;  2GSM B;  4P9O A;  1SC5 B;  3E8F A;  2VRZ A;  5DM6 V;  2YS8 A;  1ENV A;  1R6K A;  4JYY A;  1S5H C;  4BIZ A;  2YDE A;  4X1I B;  5HFL A;  2F66 C;  3STL C;  5B3S B;  1S0V A;  5EIB D;  4J42 A;  4DR6 O;  1XIL A;  3ETG A;  4ZBM A;  3TCU A;  4JGS A;  4QGP A;  1JPX A;  1PNK A;  3OAA G;  4R6Z A;  5EIB C;  4JI0 O;  4DXW A;  1M57 B;  1PPJ H;  5B1B C; 
#chains in the Genus database with same CATH homology
 1PD3 A;  1FXK C;  4G28 B;  1R3J C;  2A0L A;  2XAG A;  2R9I A;  1W2B U;  5B1A B;  2P6J A;  3K03 A;  2LFS A;  1UJW B;  3JCZ A;  3W7W A;  1RPO A;  3MHH C;  2ITD C;  2IJJ A;  3T2M A;  4PA9 A;  3F7Y C;  3CCJ V;  2B5U A;  4MVS A;  2Y69 C;  2X6B A;  1AI7 A;  1K33 A;  3TK1 A;  3AG2 B;  2WLM A;  2ZR3 A;  3K9A A;  1B6Q A;  4X88 A;  2EIL C;  4MTO A;  1VQ5 V;  4MVQ A;  4F4L A;  3SYO A;  1RM1 B;  3IC7 A;  1OCO B;  3CC7 V;  2EIJ B;  1HWY A;  1AJN A;  3WG7 B;  1KD1 W;  2EZP A;  2DWD C;  2EIM C;  1NVP D;  4JPR A;  1R3I C;  2WLJ A;  5EC1 C;  4MSW C;  4BIU A;  3AG2 C;  1JOY A;  5L3C A;  1QR9 A;  5BZB A;  3OR7 C;  5H9C A;  2QEX V;  1JVM A;  1L1F A;  2QKS A;  4PDV A;  3EHB B;  4QE7 A;  3LSS A;  1JX9 A;  1VQ8 V;  2Z5U A;  5B1A C;  1ZWI C;  1MSW D;  2QM7 A;  4XDJ A;  3ZMV A;  2LP7 A;  4X89 A;  3ABU A;  1FS0 G;  1R73 A;  1SZT A;  5B1B C;  1K8A W;  3ZMT A;  2B1G A;  3FB8 C;  1NKD A;  3W7X A;  4JTD B;  2EJR A;  2PI4 A;  3E8H A;  1KC8 W;  2WPD G;  4RUF A;  4OXS A;  4H33 A;  4BAY A;  3QO5 A;  2XAS A;  2YEV B;  3AG3 C;  4MS2 A;  1M56 C;  3SYQ A;  2OT5 A;  1EFR G;  1QLE C;  1E1Q G;  2WWW A;  2EIJ C;  1RM1 C;  1RPR A;  3E2E A;  2ZD9 A;  4JAV A;  1GK9 A;  4R7C A;  3CCS V;  2WLN A;  1W0K G;  3ABM B;  1VQ4 V;  3OEH G;  2HJF C;  1NH2 D;  2HVK C;  3FB7 C;  1GKF A;  4MTF A;  1S77 D;  2WLL A;  1F4M A;  4RAI A;  2XAF A;  4TSF G;  1VQ6 V;  4QNH B;  3WG7 C;  3OUF A;  5L3E A;  1OCO C;  3D3I A;  4PDR A;  1VQP V;  1THZ A;  5KUM A;  1AJQ A;  2DYS C;  1YJN V;  4GCZ A;  4GX5 A;  3VBB A;  1K5S A;  1M57 C;  2V7Q G;  2ZXW C;  4WCE V;  4PDM A;  3AG4 C;  3X2Q B;  3FYE B;  3OMI B;  1KP3 A;  2Y69 B;  1QR8 A;  3ZCC A;  2KB1 A;  3BY6 A;  1M1K W;  1BHB A;  3LSQ A;  5FL7 G;  4DO2 A;  4L87 A;  3K3W A;  3F7V C;  1XL4 A;  1F51 A;  3K0G A;  4UVB A;  2W6I G;  2ITC C;  4EKW A;  1E79 G;  1FXV A;  5E1A C;  4PEL A;  3SPJ A;  1FXK B;  2GHY A;  2YEV A;  4WFB V;  4HZ3 A;  1EZJ A;  2H94 A;  3M99 B;  1OZ0 A;  2IU3 A;  3K08 A;  5IY5 C;  3FB5 C;  3CCE V;  3OW2 U;  3JD0 A;  5EBM C;  2MK3 A;  3OEE G;  1K7D A;  4GX0 A;  3ZRX A;  1M56 B;  3I55 V;  2DQ3 A;  1BHA A;  4JTA B;  1M9N A;  3CD6 V;  1H8H G;  5B1N A;  2Q67 A;  1R3K C;  2BOC C;  4HYO A;  5IYB O;  3AG1 B;  3QO8 A;  3ASO C;  3SYA A;  5KA5 A;  3E8B A;  2C2A A;  3ZMS A;  3ABT A;  3W7S A;  3HB3 B;  4LCU C;  3NXS A;  2X6C A;  5CBG A;  2D3O W;  1YI2 V;  1DTO A;  1NR1 A;  2HVJ C;  4TT3 G;  3B8M A;  4UV8 A;  2XAQ A;  3ZMZ A;  5HFM A;  1GMG A;  3DTU B;  4P9P A;  4JYB A;  4ZKI A;  1NH2 B;  3D36 A;  1YJW V;  2P67 A;  3GB7 C;  4LC1 A;  1LNQ A;  1SET A;  3G6E V;  3B8N A;  2UXX A;  2OCC B;  1NR7 A;  1SES A;  1CEZ A;  5L3D A;  2EZO A;  2W6J G;  2ZDI A;  5L3G A;  1Q86 W;  4UVA A;  4FPP A;  1GM8 A;  4XBF A;  3EFF K;  1Y4M A;  3ASN C;  4PA4 A;  1GM7 A;  1OCR C;  1YJ9 V;  5B3S C;  4MVM A;  3CCM V;  2LFR A;  1KKD A;  1MG1 A;  5J9P C;  4RQE A;  1Q81 W;  2NLJ C;  3ETD A;  1QVG U;  3OFN G;  4JYC A;  1DF4 A;  3RVZ A;  1KP2 A;  2WLL B;  1F4N A;  5B1O A;  1ROP A;  3RW0 A;  1K4D C;  4QJF B;  1EBO A;  1PNM A;  1FXK A;  4MVU A;  3ZRW A;  1OCC C;  1SER A;  1VQM V;  5KUK A;  5LGN A;  1K92 A;  1N8R W;  4UV9 A;  1QVF U;  2DYR B;  1QLN A;  1QLE B;  4FMT A;  3K06 A;  2EIL B;  3SYP A;  2WLH A;  1H38 A;  1YTF B;  3PJS K;  3MHS C;  4UUJ C;  3ABK B;  4MTX A;  3SPC A;  3GWO A;  3CC4 V;  1V54 C;  5EC2 C;  3G4S V;  2PI5 A;  4G2K A;  1H8E G;  1K9M W;  1VQN V;  5LBQ A;  4QPJ A;  1YTF D;  3OMN B;  2EIK B;  1GM9 A;  2ZR2 A;  4MT8 A;  4CZZ A;  2Z3Y A;  5LHH A;  4GT1 A;  2IJH A;  3ZN1 A;  2JEU A;  4Z1M G;  2JDI G;  1SRY A;  3LDD A;  3ZRW B;  2IJK A;  3SPH A;  3CCV V;  1H2G A;  4QE9 A;  2JJ2 G;  1G4Y B;  2ZXW B;  4MVR A;  3OE7 G;  4G27 B;  4QIW F;  5L3F A;  4N23 A;  2X0L A;  4R8C A;  4WF9 V;  3OGC C;  3CME V;  3JD1 A;  4MVZ A;  3W7T A;  2A9H A;  1K4C C;  1VQO V;  3T1C A;  2OTJ V;  4XDL A;  4YXW G;  3K79 A;  5C93 A;  2Q68 A;  2QM8 A;  2XAH A;  3R65 A;  3STZ C;  1DLB A;  4WFG A;  3CCU V;  2HLD G;  1OCZ C;  1AR1 B;  5EBL C;  3UM7 A;  3QO7 A;  2Q6A A;  1S76 D;  3RBZ A;  2DQ0 A;  3VOU A;  1WLE A;  4X8A A;  2H8P C;  1K3E A;  1WPX A;  5H6R A;  3ZRS A;  3HPL C;  3OR6 C;  3CCL V;  2IW5 A;  4PDL A;  3T4Z A;  1PNL A;  1KQS U;  4MW8 A;  1Q7Y W;  1K73 W;  1NBM G;  4WFH A;  5IYD O;  1YSC A;  2DW4 A;  3WFV A;  1MAB G;  4RO2 A;  1I5X A;  1JCH A;  1COW G;  4WFA V;  2CK3 G;  2P7T C;  3FKS G;  2YSU B;  4QPK A;  4ASU G;  3E89 A;  5DN6 G;  5CMU A;  1P7B A;  4I5S A;  2IU0 A;  2AHZ A;  2EBO A;  1DF5 A;  1FXH A;  2R9R B;  3JD3 A;  4PA7 A;  4FIP C;  3E35 A;  4WFE A;  1TUE B;  3JD2 A;  3W7U A;  4FJC C;  1V55 B;  2IH1 C;  3ML0 A;  3CCR V;  1ORQ C;  4FK5 C;  4RUE A;  3ABK C;  1FFT B;  1NJI W;  3IFX A;  4P30 A;  2JEX A;  2QA4 V;  3ABL C;  2DYR C;  4E2L A;  2X7R B;  3SPI A;  1VQL V;  2WSS G;  2JJ1 G;  3TET A;  2BOB C;  3CXC U;  1E1R G;  4XDK A;  3G71 V;  1JJ2 U;  2AHY A;  1P4R A;  2P90 A;  4JF3 A;  2ATK C;  3I56 V;  2HR3 A;  4KP4 A;  5KA6 A;  4J9Y B;  3ASN B;  3BEH A;  2F43 G;  4P2Z A;  1QCE A;  4RQF A;  2WLK A;  1OHH G;  5LGT A;  5LHI A;  5CBF A;  3LNM B;  5GW7 A;  1K5Q A;  3ZMU A;  3ZJZ A;  2W0F C;  4UVC A;  2EIN C;  4U7O A;  4WFF A;  1G8M A;  2ZQM A;  4Q20 A;  5H6Q A;  1XL6 A;  2EIN B;  4GX1 A;  2OCC C;  3CC2 V;  2K1E A;  1PKX A;  1K97 A;  1PL0 A;  4JTC B;  2DYS B;  2EIM B;  4U7N A;  2NNU A;  4KUM A;  2UXN A;  1BMF G;  3CMA V;  2B1I A;  3OUS A;  3IGA C;  2HG5 C;  3ASO B;  3SPG A;  1VQ9 V;  1R6N A;  1OCZ B;  3MD0 A;  1IXM A;  5LGU A;  3AG1 C;  2M7W A;  3UKM A;  1Q82 W;  1ARO P;  1VQ7 V;  1S72 V;  3RVY A;  3QNE A;  3CYO A;  2WLI B;  3SJQ C;  2V1D A;  5L3B A;  4R50 A;  2XAJ A;  1GTO A;  5IY5 B;  1OCC B;  3P30 A;  5EBW C;  1VQK V;  3LUT B;  1GO3 F;  1F23 A;  4LP8 A;  4H37 A;  4JAU A;  1I5Y A;  2JIZ G;  3T4D A;  3ZN0 A;  3K0D A;  4GX2 A;  5EK0 A;  2IH3 C;  4MVO A;  2A79 B;  1BL8 A;  1R3L C;  2JK5 C;  3SYC A;  1M90 W;  5IDJ A;  1NQT A;  2OTL V;  1V54 B;  1OCR B;  1S3J A;  1JQ0 A;  2DWE C;  2EIK C;  3JD4 A;  5CBH A;  1MOF A;  3AG4 B;  4UXN A;  3X2Q C;  2X6A A;  4PA3 A;  2ZDI C;  3ETE A;  3F5W C;  3FYI B;  3CCQ V;  1KEC A;  4MW3 A;  1AI6 A;  2QE7 G;  3CPW U;  3JYC A;  3OMA B;  5B1B B;  4BW5 A;  1K34 A;  3B77 A;  2IJI A;  3KG2 A;  5CN0 A;  4MTG A;  3ABL B;  4N21 A;  3FB6 C;  2GSM B;  2QTO A;  3H01 A;  4P9O A;  3E8F A;  5DM6 V;  3LDE A;  3E83 A;  3CP1 A;  1ENV A;  1R6K A;  1CP9 A;  2HKO A;  3K04 A;  4TWK A;  1AI4 A;  1S5H C;  3DGE A;  3ZRV A;  3P32 A;  4BIZ A;  1YHQ V;  5HFL A;  2XOK G;  1V55 C;  1W0J G;  3E8G A;  3STL C;  5B3S B;  1QBZ A;  1S0V A;  2Q69 A;  3ZIA G;  5LHG A;  1AJP A;  1Y66 A;  4J9Z B;  3ABM C;  4I9W A;  4PA6 A;  2WLI A;  5IYC O;  3AEI A;  3ETG A;  1NVP B;  4ZBM A;  2WAM A;  2HFE C;  3TCU A;  3LDC A;  3E86 A;  1YIJ V;  4JGS A;  1YIT V;  1J95 A;  2Y48 A;  1JPX A;  1PNK A;  3OAA G;  4HAM A;  4LBE C;  2FTK A;  2XND G;  4R6Z A;  5CA3 A;  4DXW A;  3AG3 B;  4KFM A;  4CBC A;  1AI5 A;  3A0R A;  1M57 B;  1CPY A;  4JAS A;  3OM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...