1F23A

Contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
75
structure length
74
Chain Sequence
b'SGIVQQQNNLLRAIEAQQHLLQLTVWGTKQLQARLSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEKNEQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSMEMBRANE GLYCOPROTEIN
publication title Structural and functional analysis of the HIV gp41 core containing an Ile573 to Thr substitution: implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 74
sequence length 75
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f23A00
1I5YA 4JGSA 2X7RB 2EZPA 4N23A 1Y66A 3B77A 3K9AA 4FIPC 1JQ0A 1DF5A 2M7WA 3GWOA 4G2KA 1DLBA 3WFVA 1SZTA 1DF4A 4N21A 1QR9A 4JF3A 3M99B 1QCEA 1QR8A 5KA6A 2LP7A 3CP1A 3H01A 4JPRA 5CN0A 1JPXA 1I5XA 3P30A 2OT5A 1MOFA 3B8MA 1F23A 1MG1A 1QBZA 3B8NA 5HFLA 1ENVA 1K34A 5HFMA 4E2LA 2P6JA 5KA5A 1EBOA 2EBOA 1K33A 1Y4MA 5CMUA 4FJCC 5H9CA 4FK5C 2EZOA 3MHSC 3CYOA 3MHHC 2MK3A
chains in the Genus database with same CATH superfamily
4G27B 3HKEB 4HAMA 5LYJB 3JD1A 3ZS8C 1PL4A 3OUFA 4OX9O 3AG1B 3JARA 1V54B 4UB6Z 3QO8A 5B1NA 3G80A 2XNDG 1WA8A 2ZNJA 1XNRB 4DV0B 4PDLA 5IE9A 1VQ5V 2ZM6O 4X66O 1WB8A 2A7WA 1YTFB 3JD4A 2C2AA 1NI8A 1WNSA 5KA6A 2X6BA 1HDJA 5H6QA 2OT5A 3B40A 4IYIA 1KKDA 3ZN0A 1S3JA 3X2QC 2IH3C 2QKSA 3E8FA 2ZXWC 2Q68A 4D7SA 3U0ZA 4JI8B 2QGNA 1Z5WA 5IYBO 3UO3A 5E79Z 2B9ZA 3TGUH 1J5EB 4N21A 2QWQB 4LF9O 1S76D 4DV4O 2WLHA 3I5DA 2Q0OC 5L3CA 4RUEA 3T1YO 2OCHA 3JASB 3EXAA 2JRIA 2JS3A 1FXKC 5L3FA 2IM9A 3L75H 1BSMA 1XILA 2ADQB 2DE0X 4CS2A 1QR8A 4UUJC 4DR4O 3JARB 1COWG 1EN4A 4GCZA 3K79A 1GN6A 5B1BB 1HNWB 3L72H 3JD3A 3JAKA 1EZVH 4GX2A 1JMKC 1WA8B 2ITDC 5LHHA 4ZI7B 1RPRA 3NR7A 4OXSA 1K7DA 1J95A 3RWRD 3FFQA 1RSOA 3BY6A 4B3TB 3K04A 4X64B 1XL6A 1XBLA 1BE3H 1HNXB 4MVOA 1GM7A 2JJ1G 5FNVA 2EBOA 4B3SB 3G71V 4O4HA 1N8RW 3ABMB 3B2EE 2OCCC 1AI7A 3CCEV 5EZYA 3ASOC 4Z1VA 1G4YB 3EFFK 5C8YA 1H38A 4D6TH 3KKYA 1NH2B 1THZA 4NXNO 3LSSA 1SERA 3HKCA 4F4LA 3BABA 4LFCB 2EIKC 4GKKB 1K4CC 2QR4A 2RDCA 2E76B 4FLZA 4TSFG 2ZE8A 4UVCA 4WFBV 3CMEV 4KL1A 1QLEC 2Y48A 1N0JA 1Q8IA 4DK1A 2WWWA 2F93B 2AHYA 1US6A 4NTXA 1A32A 2CGNA 2A79B 3GWOA 1VARA 2GDSA 4L8JA 5BZBA 3A0HZ 3ICXA 3OR7C 4I55B 1E79G 4JI3O 1MOFA 3OTFA 3WG7C 1S5JA 3BRCA 2ETNA 3JAKB 2LGWA 4UCUA 3K5LA 1RM1B 4WFFA 3U11A 1N36B 2UXCO 1Q6IA 4H37A 2LW1A 4RWUA 2P67A 3RW0A 1FXKA 1FXVA 3L74H 4DW0A 1GO3F 1RSOB 2ZQMA 3CP1A 2BTOA 4CH4A 3OT7A 4U7OA 1P7GA 3LDCA 2GHYA 3CHXA 3DC6A 5FNVB 3TXQA 3ZHQA 1HP8A 4MTFA 4O4HB 3MD0A 2F43G 4TT3G 1TAEA 3K0GA 4H13B 3A0RA 5EZYB 2KKWA 4K35A 1UFIA 3W7TA 5C8YB 1YF2A 3WFVA 3T1HO 1BQ0A 5J2TA 3HKCB 4QIWF 4OX9B 2WLIB 4FZ1A 1R6TA 3CCJV 1GH6A 4ZBMA 4DUZO 1JVMA 1K33A 4LFAO 1AVMA 1WAZA 3BFRA 5FPOA 3X2QB 4GUNA 2CTPA 2ZM6B 2ZXWB 3QF7A 4X66B 4UFZA 1EFRG 4GX0A 5IYZA 4DW1A 4ZHQA 2UXDO 1AJNA 5JH7A 2M6YA 1OCRC 3BA9A 1VQ4V 3FYEB 3K5MA 1MNGA 2DYSC 1KC8W 2D2CB 4F6RA 5IWAO 4WCEV 1FXKB 1L1FA 1AI5A 1JFFA 2YI8A 2FB5A 4DR3O 4MVQA 4O4LA 3SJCC 5EBWC 5HFLA 1K34A 5ITZA 4LF9B 2JEUA 4I7ZB 3ZHRA 1SRYA 4X1YA 4DV4B 1SQGA 5D5QA 3MHSC 2AXTZ 3T1YB 3U10A 1URFA 1Q90D 2Q7EA 1NQTA 5LL6Y 3ZRWB 4R7CA 3JALA 5B1OA 5J2TB 2R70A 1XREA 4DR4B 1PNKA 5EC1C 1AJPA 5B3SC 4DV1O 3MHHC 3Q4HA 1JA8A 2OCCB 4EEQA 1Q3EA 4JI7O 1I94O 1FXHA 1R3LC 2WLLA 5CBHA 4NR1A 1M93A 2QE7G 2EIKB 5IYZB 4ZHQB 3J7AU 5HFMA 2GTAA 1Z2GA 5BXZA 5B1AC 5JH7B 5DEDA 1TA8A 1W59A 4LF6O 4FFKA 2FYUH 3OM3B 4DK0A 2Q7GA 4F6RB 3CB2A 3BCCH 1R6NA 1SF9A 1EZJA 4NXNB 1ZL8A 2A06H 4I0XA 1JFFB 3H01A 1K5QA 3VQWA 2PI5A 2EINC 4DR2O 1Q86W 1K5SA 4O4LB 4J80A 2DW4A 2ZIMA 1KP3A 4LR3A 5ITZB 5EC2C 2UUBO 4X1YB 3WG7B 1L8DA 1AI6A 4ABMA 2X6CA 3ZRSA 4BAYA 4RQEA 2E5LO 1JX9A 1DF4A 1U97A 3CD6V 4BIZA 2EILC 1CP9A 1Q82W 1IZ3A 3JALB 4NXMO 4JI3B 3CJHA 4DO2A 1OHHG 2XUMA 4BIOA 1YHQV 3F7VC 3Q4HB 2UXCB 3LSUA 1VF7A 3CRAA 4JI8O 3OMIB 2M7WA 2DQ3A 2WLLB 1SQFA 1YEWA 2BSKA 4LF8O 1XQ8A 1VQLV 3ZRXA 1D5AA 5LOVA 5EBLC 4IHJA 3CCQV 4JI2O 1RP3B 3RGBA 1EN5A 4EKWA 3ASNC 1VP7A 4NTWA 3E8BA 1XHXA 3T1HB 1NVPD 4DR7O 3KZIZ 4I0XB 1PP9H 3N27A 3SJAC 5KAFZ 4YJ2A 2DYRB 4DUZB 2QWOB 4PDMA 3LDDA 1KP2A 1WJZA 1VQPV 3J80N 2W6IG 2YI9A 3OMAB 4QGPA 1OV9A 4Z2WA 3JCZA 1AI4A 5JWPA 4J7KA 1HWYA 2Q0AA 1Y6XA 2QTSA 3CCSV 1SQXH 4FMTA 2QKAA 4UCRA 5IWAB 2RNBA 3KCXA 5IY5C 3P3PA 1KUQA 4YJ3A 4NTYA 2Q67A 4JPRA 1XL4A 2BSKB 4DR3B 2P06A 2RN9A 1H2KA 2CE4A 5LHGA 1IBMO 3R65A 3ZRVA 1FKAO 1GM9A 4CH3A 4CBCA 1KB9F 4LBEC 5LOVB 1CEZA 4QNHB 5B3SB 4UVAA 3CPWU 2Q8VA 3CE2A 2IW5A 4I9QA 4QPJA 1UPGA 1F4MA 3SPJA 1ZSPA 3G6BA 3ZHSA 1V55C 4DYLA 3ETGA 1OJHA 4ZKIA 3CCMV 1IX9A 1PL0A 4P2ZA 1JR9A 2YXHA 1S72V 3VQXA 1BMFG 3EVKA 4LF4O 3ZMUA 3H1LH 5B1AB 1M9NA 2FMLA 4YJ2B 3BVOA 4DV1B 2H3OA 1ZUQA 3BHPA 4JI7B 4LCUC 2KQXA 1E1RG 5IJ0A 1I94B 1LUWA 1FAFA 2Z3YA 3L9DA 1DTOA 1VQOV 2EINB 3T1CA 4CS3A 2N04A 4LF6B 1BS3A 3FKSG 3SYQA 4HBNA 5DM6V 1ZTEA 3ZJZA 3VQVA 2XT9A 4YJ3B 1JPXA 4IGGA 2EILB 3LUTB 4XBFA 4Q6GA 5GW7A 4RO2A 4DR2B 5KHGA 2DN9A 2UUBB 3E83A 3IFXA 3OR6C 4PDRA 1G1XB 1SA0A 2Q9LA 2XAQA 1FD9A 1SS3A 2LW7A 1E1QG 4MTXA 2E5LB 4RQFA 3OW2U 5C93A 3CXCU 4I4TB 4MTGA 2A3QA 1MG1A 2GSMB 1GKFA 4NXMB 2X6AA 5DN6G 3ZMVA 1AP5A 3LDEA 4MVUA 4LH7A 1TGOA 4IIJA 1TUBA 1Y76A 3TCUA 1V9PA 5LGTA 3ZHUA 1IBKO 2PYLA 5IJ0B 4QJFB 3ASNB 3B4SA 2AZ0A 4EB6A 5BR8O 3MDSA 3ZBHA 4LF8B 4AQYO 2WPDG 2XOKG 2MW2B 4TWKA 2NR5A 2ADPA 3WB2A 5KMGA 3AG3C 3KG2A 3H1IH 1MABG 2WSSG 4LF7O 3CCUV 5JJEB 1NTKH 1G6UA 4EFBA 4JI2B 1P7BA 5LA6A 2CDYA 4JI5O 2F23A 4X1IA 1QHTA 2EJ7A 1K3EA 2JIZG 4FZ0A 4PI0A 3N2KA 4X1KA 3RYCA 1QBZA 4DR7B 2W6JG 4TQFA 1H2NA 1R3KC 3R66A 1KD1W 1BGYH 4J7ZA 5LP6C 4FM0A 5LXTA 1MZEA 2E74B 1OCOB 1YIJV 3W7UA 1XMQO 3EHBB 4UV8A 1R3JC 4OPAA 1BQZA 3KCYA 3CSXA 1SA0B 1R73A 4I9WA 4GX1A 1FPOA 2YDEA 5IY5B 1FYJA 2Q4PA 2CH7A 4JV5O 2IU3A 5CBFA 1AR5A 3A8TA 5J2UA 2UXBO 3P3NA 4UCOA 4Z1MG 4IIJB 2LGQA 4DV3O 1TUBB 1QNMA 1Y76B 2QJ1A 4NB5A 2YIBD 1WPXA 3HKDA 4JYYA 2PYJA 5L3GA 2XTAA 3CEIA 4MVRA 3PN1A 4EB6B 2V7QG 5CA3A 2BE3A 4I50A 2F66C 2GUZA 2QM8A 1IBMB 3JSNA 4HNAA 5KMGB 2EIMB 3T2MA 3UCSC 3OD4A 3OAAG 3RYFA 5LA6B 1DF5A 2HR3A 4GYCB 1YDXA 4JASA 4X1IB 4LF5O 4BR6A 4MW3A 1M56C 2HJFC 5LMNO 4B08A 2OWOA 4LC1A 4TOIA 4FLUA 3N2KB 3AK3A 4X1KB 4CH6A 3AG4B 3RYCB 1YTFD 2Y0IA 4B3MO 4ZOLA 2CK3G 4LF4B 5LXTB 1NTMH 3K59A 5J9PC 3P32A 4PA6A 3SYAA 4J11A 1ZWIC 4X20A 4J42A 1AJQA 3S3WA 4K8ZA 2DQ0A 2E75B 1EN6A 2OTLV 2CH7B 2P22C 1M90W 4R6ZA 5LP6A 5J2UB 3CYOA 4FPPA 2IJHA 1YJ9V 3K3WA 1Y66A 4DR1O 2RCVA 3B77A 2P4VA 1H8EG 5H2FZ 2OTJV 2YIAA 4H44B 1L0NH 2CTWA 2FTKA 1GMGA 2EJRA 4I50B 1I7FA 1L0LH 3K08A 1O9HA 2GUZB 3H9VA 3ZN1A 5FPRA 3SPIA 1B6QA 4HNAB 3G6EV 1AP6A 3CC4V 1GN4A 3RYFB 3RVYA 1S5LZ 1SZTA 3K5OA 4JF3A 4FLYA 3RN4A 3THOA 2Q6AA 2Z5UA 1ENVA 4CC5A 1T5EA 1YCIA 4FVMA 1LR1A 2JDIG 4ZOLB 5CA1A 3ABTA 2KG7A 1FFTB 3AG3B 4JI6O 4JYBA 3SPHA 3SJBC 5KHKA 4FIPC 2FKXA 2PTMA 1VQKV 3ZHVA 1K92A 4PI2A 3QO7A 1IBKB 1ZX3A 4X20B 2DMXA 3RT3C 4YIPA 5BR8B 4AQYB 4MVSA 4WFGA 4DV5O 5LP6B 3AEIA 4ZIBA 2V4DA 2Y69C 1HW7A 4LF7B 3E8GA 2R9AA 2HG5C 1XI1A 2R72A 3C90A 2P90A 4OPHA 3IJ4A 4W4KA 4JI5B 3FYIB 4PA7A 3SR2C 1ORQC 5KHHA 2ZE5A 2HLDG 4YIOA 3O65A 3DSQA 4JYCA 2ZR2A 2IJJA 2CTRA 4X89A 5BMVA 1MSWD 4TUYA 2JS5A 4P30A 1XMQB 4KHPO 5LMUO 5B5EZ 2JGUA 4J7JA 4BW9A 3ASOB 4D7TA 2P4KA 4DV7B 1S77D 1YSCA 3I55V 1YJNV 5KHJA 4IT5A 1XHZA 4UV9A 1OCZC 5KA5A 2W0XA 4JV5B 1QVGU 2R9IA 2UXBB 5CA1B 2KG7B 2YSUB 1QLEB 2Q73A 1IXBA 2UU9O 4DV3B 4O4IA 1VF6C 2A0LA 4UCVA 1N34O 2KSDA 1M56B 3A0BZ 3WB0A 4O2BA 3ZMTA 4PELA 2ATKC 2EULA 3D8CA 3G4SV 1VQ7V 2HFEC 1Q7YW 2BTQA 1KU9A 1IVSA 2PY5A 1YJWV 5JJNB 3CRCA 2JVDA 3SJQC 4PV1B 1N32O 1YXBA 3CRMA 2F4VO 3FB8C 2IH1C 2WLMA 4LF5B 1B3QA 1I5XA 3P30A 4O2AA 5LMNB 1VQ6V 2E3CA 4B3MB 3K9SA 2EZOA 2Z0AA 1D2DA 4LWSA 4TUYB 3VOUA 3K58A 5EYPA 3CC7V 2FL4A 2QKCA 1LUVA 4K0KO 2LFSA 4TV9A 3J81N 4HZ3A 3PJSK 2Y4UA 4RUFA 3ABLC 1FJGO 2ODMA 2K1EA 1U96A 1QVFU 1JQ0A 3RVZA 2V1DA 4DR1B 3CWBH 2OYQA 4O4IB 3UT5A 3ML0A 4XDLA 3JSLA 3O9OA 1ZL8B 4BWAA 5JJJB 3ETQA 1HR0O 4MVMA 1KQSU 4O2BB 1OCRB 2PUSA 3FX7A 4X9QA 3SYOA 2JGDA 3SPGA 4B7KA 2DYSB 2BTQB 1XOUA 4MVZA 5JVDA 1AR1B 3ABUA 1QR9A 4GLXA 5JCOC 1K73W 4O2AB 1M1KW 5TISZ 1EBOA 4ICGA 3GVMA 3CJHB 1YI2V 3RBZA 1GK9A 4YY3O 5GTIZ 1WP7A 3CCRV 1VQNV 2Q69A 3QTCA 4JI6B 1K97A 4LWSB 3QO5A 1OCCC 2QWRB 2UUAO 1SQQH 1MA1A 4FLXA 5EYPB 5B1BC 3ZHTA 3IGAC 1JOYA 5D5PA 4TV9B 2YIBA 2Y0PA 3JYCA 3QG5A 1N33O 3STLC 1H2LA 1NR1A 2WA4A 4KXRA 4J10A 3OEEG 4DV5B 5BY1A 5JQGA 4IHJB 1SETA 1VMGA 3T4DA 4WFHA 1K9MW 2YXLA 1CXZB 3M7MX 4NKGB 3CMAV 3OMNB 4JI1O 3UT5B 2P5OA 5LBQA 4GZRB 2B1IA 5IJ9A 2L35A 5GTHZ 2HKOA 3SYCA 2N74A 2Q7HA 1OCZB 2YEVA 2G38A 3DGEA 1P49A 1KYOF 3FAVA 2JGDB 3LNMB 3OFNG 3D36C 3SYPA 4KHPB 4GKJO 2DWEC 5LMUB 4I5SA 3N2GA 4UCTA 5A9GA 5JVDB 1OZ0A 2F1MA 4F6EA 1VQ9V 1PPJH 4UCSA 5EK0A 2IBZH 2XAHA 3B8MA 2P6JA 4XDJA 1MSDA 1WLEA 2ZINA 4DUYO 1XDCA 3FB6C 5EBMC 3JD0A 1BCCH 2XAFA 2ZE6A 3OEHG 4G28B 4CZZA 2UU9B 3D3QA 2QM4A 4WFAV 2NN4A 1N34B 4LNUA 2ITCC 2QM7A 4LFBO 5JCOA 2CTQA 5K1XA 2WLKA 4H33A 2YICA 1LNQA 2WLNA 5EIBD 5F2VO 2EIJC 4X88A 2CGOA 1VQMV 3S3XA 4B3RO 1F4NA 4KFMA 4DR6O 5JQGB 2HVKC 2KB1A 3E2EA 1N32B 2ZCEA 1R3IC 2F4VB 1HNZO 2ZNIA 2O57A 1PD3A 1UJWB 1W0JG 5IJ9B 2HJDA 1XEQA 1ZAUA 1H2MA 2YEVB 3TJTA 3BA8A 4ZI7A 2OIEA 4J9ZB 3FAVB 3ABLB 3LSQA 3ETDA 2UXXA 3AK2A 1Q81W 1GTOA 2ZE7A 3N2GB 4FFBA 3ZEDA 1IDSA 4K0KB 1NT2B 2ZIOA 4KUMA 3STZC 4J9YB 1P4RA 1SESA 2VQFO 1BL8A 1WP8A 3SDLA 3ZIAG 1FJGB 5GONA 3D36A 1AILA 2UUCO 4DV6O 1GN3A 4G2KA 1SKVA 1NZ6A 1AR4A 2QEXV 3BPZA 4LNUB 1KMIZ 1EM1A 2XAJA 5IYCO 1HR0B 3I56V 2XHBA 1IXMA 4DXWA 4PDVA 1NS1A 1Q5OA 1H8HG 3FB5C 3CC2V 2BOCC 4PA4A 3IC7A 2IU0A 4I55A 1PM9A 3JD2A 5DECA 4DV7O 1OCCB 2JJ2G 3GB7C 1Y74A 3L71H 2VQEO 3FD9A 4TQDA 3OGIB 4JI0O 4FJCC 1QU7A 4O4JA 2QTOA 4YY3B 1NJIW 1KBHA 4PA9A 2UUAB 1IBLO 3M99B 1WN7A 3OTOO 4FFBB 1H2GA 1V55B 3K03A 2OIGA 5FL7G 4IYHA 4JTDB 2H94A 1TVKA 1MMMA 5H9CA 3SPCA 5KUMA 1N33B 2PI4A 2NLJC 4UVBA 4JZGA 1I0HA 3AG2C 3K57A 2AGAA 5GONB 4OGQB 2ZT9B 2VWKA 1BT8A 2WLIA 2Q5ZA 2ZDIC 1XMOO 1QQCA 1VQ8V 3CX5F 4MTOA 5CN0A 4JI1B 4FLTA 1P84F 4E2LA 2NNUA 2K9PA 4U3JA 3JAWA 1VEWA 4JI4O 1PNMA 3TK1A 2GV9A 4FK5C 4DV2O 1M57C 3ETEA 2X7RB 4R50A 1M4UA 3TETA 3WB1A 4GKJB 5H5NA 3OGCC 5B66Z 3HKBA 5KX5A 1M5IA 4K8XA 1Y74B 3QVNA 1PV0A 3GWKC 1O9GA 5CA0A 1PNLA 3IAYA 2QWPB 4B7EA 2F95B 5KLVH 4DUYB 3F7YC 1Q6HA 4O4JB 2EIJB 1JCHA 1NBMG 2HP8A 2QA4V 2DJVA 2IJKA 5E1AC 4JYAO 4CC6A 3CS5A 3HKDB 3SGIA 4LFBB 4UB8Z 2W0FC 3E89A 1MZFA 1TVKB 1FS0G 2ZKOA 4LP8A 3ZMZA 4B3RB 1AB3A 4DR6B 3HR0A 3ZRWA 2HHHO 5IT9N 4U3FH 3B09A 3JATA 1BHAA 3BEHA 1HNZB 2XAGA 5LGNA 4MW8A 4MSWC 1DGSA 1S5HC 3K06A 3C3TA 4GT1A 3JAWB 4U3JB 1NKDA 1JJOA 4U7NA 4JTCB 2ILMA 2YIDA 4AI8A 1GM8A 3E86A 4FLWA 5EIBC 1JJ2U 5A2QN 2ZDIA 4RAIA 4HYOA 3APQA 3HKBB 4JTAB 2YUAA 3BAAA 5KX5B 2DYRC 1NH2D 2B5UA 5CA0B 4GX5A 4W4LA 1SQBH 3A2FA 4YHHO 1QLNA 3DC5A 4LH6A 3UKMA 2LO1A 3W7SA 4H0LB 2VQFB 1K4DC 4CH5A 3CCVV 1F7YA 4WBNA 1XNQO 2BOBC 4PA3A 2PZSA 2UUCB 4DV6B 1Q6UA 4X65O 4PJ0Z 4DR5O 3AK1A 2DWDC 1YITV 1VF5B 2ZD9A 4IL6Z 3LNNA 1IURA 2LFRA 2RJZA 4X62O 4FM1A 2MK3A 1NVPB 1BZKA 1S0VA 1B04A 1Y67A 3UM7A 1SQVH 4YXWG 3QNEA 1WB7A 3JATB 1TUEB 4UXNA 2DOSA 3M8AA 2VQEB 5CMUA 4FM2A 2IJIA 5CBGA 4JI0B 5L3EA 1PKXA 2BCCH 4R8CA 2VS0A 3AG2B 2VRZA 5CB4A 4E4EA 1RPOA 4MS2A 2GBOA 5FLXN 2LP7A 2YXYA 1IBLB 3OTOB 4NVPA 4AILC 2CAZC 3E8HA 2N05A 3CRRA 5IYDO 3ZX6A 1H2SB 2D3OW 3D3IA 4AHCA 1ROPA 5H6RA 3APOA 1M57B 1Z5VA 4WBNB 1NU1H 2RQ6A 1XMOB 3HPLC 4C7UA 3ABKC 4PHZA 2X0LA 3VBBA 1XNRO 3NXSA 4DV0O 4JI4B 1SC5B 5KAIZ 4NYKA 4BW5A 4DV2B 5AG2A 3C3SA 4JAUA 5BMVB 2GTSA 1ZLZA 3AG1C 4P9OA 1XUQA 2VWJA 1DK1A 1V54C 1VIBA 1NTZH 3H1JH 1R6KA 3DXRA 3UO2A 1F23A 1SQPH 1WPBA 4DRXA 1RFYA 4A5UB 3E35A 4WF9V 2PF4E 3RYIA 3OUSA 3W7XA 3VQYA 3HB3B 2Y4TA 5L3BA 3ZMSA 2YS8A 4TV8A 2UXNA 1J5EO 1YZBA 1DLBA 2LJ2A 5CB4B 4QE9A 4JYAB 2JK5C 4L87A 2HVJC 3OE7G 4EFEA 3ZCCA 3JAMN 3F5TA 4J41A 1YVWA 2PGGA 2ZR3A 3DTUB 3MAQA 1GAXA 1X59A 2AHZA 3H1HH 2HHHB 1VF6A 1I08A 5IDJA 2AZ2A 4PD4F 2WA3A 1HNWO 3RYHA 5LHIA 1SZXA 4XDKA 1Y4MA 4LFAB 2QDOA 3L73H 2JEXA 2R9RB 1I5YA 3JCUZ 4JGSA 2Y69B 1FFXA 4B3TO 2LQTA 3IC9A 4X64O 1HNXO 4JZ2A 2XASA 1G8MA 1NR7A 1W0KG 3FB7C 2UXDB 3E22A 3DXRB 1OCOC 1N4CA 4B3SO 2ARHA 4DRXB 4YHHB 3RYIB 3HKEA 5LYJA 3CCLV 4N23A 4WFEA 3G67A 1XNQB 4JAAA 4TV8B 3AG7A 4LFCO 4GKKO 1CPYA 1B06A 4X65B 1W2BU 4JAVA 2WAMA 2AW9A 3H1KH 4Q20A 4DR5B 4BIUA 3K0DA 2QSAA 3K5NA 5KHIA 2EX3A 3ABMC 3RFRA 4QE7A 1KECA 2QWNB 4X62B 4MT8A 2B1GA 4I4TA 2A9HA 5K1PA 1N0NA 2L6LA 3TXSA 3CXHF 3B8NA 1R1BA 1K8AW 3RYHB 4X8AA 2EIMC 1GN2A 4CS4A 1AROP 3UQ8A 1N36O 3W7WA 2CUGA 1GRJA 1F51A 5LGUA 2EZPA 3WU2Z 3L70H 2RMKB 3K9AA 4K3AA 1D5NA 3CRQA 1FFXB 2YC0A 2WLJA 1QCEA 4P9PA 2P7TC 3AG4C 4KP4A 1BHBA 5KUKA 1X4TA 2HEPA 3E22B 4ASUG 3ABKB 5L3DA 2H8PC 1KKCA 1RM1C 3F5WC 3JASA 1Q43A 4FLVA 4QPKA 3T4ZA
chains in the Genus database with same CATH topology
4G27B 3AG2C 3E8GA 2HG5C 4EKWA 4HAMA 3JD1A 2P90A 3ASNC 3OUFA 2WLIA 3FYIB 2ZDIC 3AG1B 3E8BA 4PA7A 1VQ8V 4MTOA 1ORQC 5CN0A 1NVPD 2HLDG 1V54B 3QO8A 4E2LA 2NNUA 4JYCA 5B1NA 2ZR2A 1PNMA 2XNDG 3TK1A 2DYRB 2IJJA 4PDMA 3LDDA 1KP2A 4FK5C 4X89A 1VQPV 4PDLA 1MSWD 1VQ5V 4P30A 1M57C 3ETEA 2X7RB 4R50A 3TETA 2W6IG 3ASOB 1YTFB 3JD4A 2C2AA 3OMAB 3OGCC 1S77D 5KA6A 2X6BA 1YSCA 3I55V 1YJNV 3JCZA 5H6QA 1AI4A 2OT5A 4UV9A 1KKDA 1PNLA 1OCZC 5KA5A 1HWYA 3ZN0A 1S3JA 1QVGU 2R9IA 3X2QC 3F7YC 2IH3C 2QKSA 2EIJB 2YSUB 3E8FA 1JCHA 2ZXWC 3CCSV 1NBMG 2Q68A 2QA4V 1QLEB 4FMTA 2IJKA 5IYBO 5E1AC 2A0LA 4N21A 5IY5C 2Q67A 4JPRA 1XL4A 1S76D 1M56B 2WLHA 5LHGA 3R65A 3ZRVA 5L3CA 3ZMTA 1GM9A 4PELA 4CBCA 2W0FC 2ATKC 3E89A 4LBEC 4RUEA 3G4SV 2HFEC 1VQ7V 1CEZA 4QNHB 5B3SB 4UVAA 3CPWU 1FS0G 1Q7YW 4LP8A 3ZMZA 1FXKC 2IW5A 1YJWV 5L3FA 4QPJA 3ZRWA 3SJQC 1F4MA 3SPJA 1V55C 3ETGA 3FB8C 4ZKIA 3CCMV 2IH1C 2WLMA 1PL0A 1QR8A 4P2ZA 4UUJC 1BHAA 1I5XA 1COWG 3BEHA 3P30A 2XAGA 1S72V 4GCZA 3K79A 5LGNA 5B1BB 1BMFG 4MW8A 4MSWC 1S5HC 3JD3A 3K06A 3ZMUA 4GT1A 1VQ6V 5B1AB 1M9NA 1NKDA 4GX2A 2EZOA 4U7NA 4JTCB 2ITDC 5LHHA 1RPRA 4OXSA 1K7DA 1J95A 1GM8A 3VOUA 3E86A 4LCUC 1E1RG 3BY6A 3CC7V 3K04A 1JJ2U 1XL6A 2ZDIA 4MVOA 2Z3YA 4RAIA 4HYOA 4JTAB 1GM7A 2LFSA 2JJ1G 1DTOA 2DYRC 4HZ3A 1VQOV 1NH2D 2B5UA 2EINB 4GX5A 2EBOA 3T1CA 3PJSK 1QLNA 3G71V 3UKMA 1N8RW 3ABMB 2OCCC 3W7SA 1AI7A 4RUFA 3CCEV 3ABLC 1K4DC 2K1EA 3ASOC 3CCVV 3FKSG 3SYQA 1G4YB 3EFFK 1H38A 2BOBC 5DM6V 1NH2B 1THZA 1JQ0A 4PA3A 3LSSA 3RVZA 2V1DA 1QVFU 1SERA 4F4LA 3ZJZA 3ML0A 4XDLA 2EIKC 1JPXA 1K4CC 2EILB 3LUTB 2DWDC 1YITV 4XBFA 5GW7A 4RO2A 2ZD9A 4TSFG 4UVCA 4MVMA 1KQSU 2LFRA 4WFBV 1OCRB 3CMEV 3E83A 3IFXA 3SYOA 1QLEC 3OR6C 2Y48A 3SPGA 4PDRA 2MK3A 2DYSB 1NVPB 2XAQA 2WWWA 2AHYA 4MVZA 1S0VA 1E1QG 2A79B 1AR1B 3GWOA 3UM7A 3ABUA 4MTXA 4RQFA 5BZBA 3OW2U 1QR9A 5C93A 3OR7C 3CXCU 4MTGA 1E79G 4YXWG 1MOFA 3QNEA 1K73W 1MG1A 1TUEB 4UXNA 2GSMB 1GKFA 2X6AA 1M1KW 5DN6G 3ZMVA 1EBOA 3WG7C 1YI2V 5CMUA 3RBZA 3LDEA 4MVUA 1GK9A 2IJIA 5CBGA 1RM1B 4WFFA 5L3EA 3CCRV 1PKXA 4H37A 1VQNV 2Q69A 4R8CA 2P67A 3TCUA 3RW0A 1K97A 1FXKA 5LGTA 3QO5A 1FXVA 3AG2B 1OCCC 1GO3F 1RPOA 2ZQMA 4QJFB 3ASNB 4MS2A 2LP7A 3CP1A 5B1BC 3E8HA 3IGAC 4U7OA 1JOYA 2WPDG 2XOKG 2GHYA 3LDCA 4TWKA 3JYCA 5IYDO 3STLC 1NR1A 4MTFA 3AG3C 3KG2A 1MABG 2WSSG 3MD0A 2F43G 3OEEG 3CCUV 2D3OW 3D3IA 4TT3G 3K0GA 1SETA 1ROPA 1P7BA 5H6RA 3A0RA 3T4DA 4WFHA 3W7TA 1M57B 1K9MW 3WFVA 1K3EA 3CMAV 3OMNB 2JIZG 4QIWF 2WLIB 3HPLC 5LBQA 1QBZA 3ABKC 2B1IA 3CCJV 2W6JG 1R3KC 1KD1W 2HKOA 4ZBMA 2X0LA 1JVMA 3SYCA 3NXSA 3VBBA 1K33A 1OCZB 1OCOB 2YEVA 1YIJV 3DGEA 3W7UA 4BW5A 3EHBB 4UV8A 3X2QB 1R3JC 3LNMB 4JAUA 3OFNG 1R73A 2ZXWB 4I9WA 3SYPA 2DWEC 3AG1C 4I5SA 4GX1A 4P9OA 1OZ0A 1EFRG 1VQ9V 1V54C 4GX0A 5EK0A 5IY5B 1R6KA 1AJNA 2XAHA 3B8MA 1F23A 2P6JA 1OCRC 2IU3A 1WLEA 4XDJA 5CBFA 3E35A 4WF9V 3FYEB 1VQ4V 3FB6C 4Z1MG 2DYSC 3OUSA 3W7XA 5EBMC 3JD0A 1KC8W 3HB3B 5L3BA 3ZMSA 4WCEV 2UXNA 1FXKB 2XAFA 3OEHG 4G28B 4CZZA 1DLBA 1L1FA 1AI5A 1WPXA 4QE9A 4WFAV 2JK5C 2ITCC 5L3GA 4L87A 4MVQA 2HVJC 2QM7A 3OE7G 4MVRA 2V7QG 5EBWC 5CA3A 5HFLA 1K34A 2WLKA 3ZCCA 2JEUA 1SRYA 4H33A 1LNQA 2QM8A 2WLNA 2ZR3A 2EIJC 3MHSC 4X88A 1VQMV 2EIMB 3DTUB 3T2MA 1F4NA 4KFMA 3OAAG 2HVKC 2AHZA 2KB1A 1DF5A 2HR3A 1NQTA 4JASA 3E2EA 3ZRWB 4R7CA 1R3IC 4MW3A 5IDJA 5B1OA 1M56C 2HJFC 4LC1A 1PD3A 1UJWB 1PNKA 5EC1C 1YTFD 1W0JG 3AG4B 5LHIA 1AJPA 4XDKA 2CK3G 1Y4MA 5B3SC 2YEVB 2JEXA 3MHHC 2OCCB 4J9ZB 5J9PC 2R9RB 1I5YA 3ABLB 3P32A 3LSQA 4JGSA 2Y69B 3ETDA 4PA6A 2UXXA 1Q81W 1FXHA 1GTOA 1R3LC 2WLLA 2XASA 5CBHA 3SYAA 1G8MA 1ZWIC 2QE7G 1AJQA 1NR7A 1W0KG 2EIKB 2DQ0A 3FB7C 5HFMA 1OCOC 2OTLV 4KUMA 5B1AC 1M90W 4R6ZA 3STZC 4J9YB 1P4RA 1SESA 1BL8A 3CYOA 3OM3B 3ZIAG 4FPPA 2IJHA 3CCLV 1YJ9V 3K3WA 3D36A 4N23A 1Y66A 4WFEA 3B77A 4G2KA 1R6NA 1EZJA 2QEXV 1H8EG 1CPYA 3H01A 1K5QA 1W2BU 2PI5A 2EINC 4JAVA 1Q86W 2WAMA 1K5SA 2OTJV 2DW4A 4Q20A 4BIUA 3K0DA 2XAJA 1KP3A 2FTKA 1GMGA 5EC2C 3ABMC 2EJRA 3K08A 5IYCO 3I56V 4QE7A 3WG7B 1KECA 1IXMA 3ZN1A 4DXWA 1AI6A 4PDVA 3SPIA 4MT8A 1B6QA 2B1GA 2X6CA 3ZRSA 4BAYA 1H8HG 3FB5C 4RQEA 3CC2V 3G6EV 2BOCC 4PA4A 3IC7A 2IU0A 3CC4V 3JD2A 1JX9A 3RVYA 1SZTA 1DF4A 1OCCB 4JF3A 2A9HA 3CD6V 4BIZA 2EILC 1CP9A 2JJ2G 1Q82W 3GB7C 2Q6AA 3B8NA 2Z5UA 1ENVA 4DO2A 1OHHG 1K8AW 4X8AA 2EIMC 4FJCC 2JDIG 1AROP 3ABTA 1FFTB 3W7WA 1YHQV 2QTOA 1NJIW 3AG3B 3F7VC 4JYBA 1F51A 3SPHA 5LGUA 3OMIB 2EZPA 3K9AA 4FIPC 2M7WA 2DQ3A 4PA9A 1VQKV 1K92A 3QO7A 2WLLB 2WLJA 3M99B 1QCEA 4P9PA 2P7TC 3AG4C 1H2GA 1V55B 3K03A 4KP4A 5KUKA 1BHBA 5FL7G 1VQLV 3ZRXA 4ASUG 3ABKB 5L3DA 4JTDB 2H94A 2H8PC 4MVSA 4WFGA 3SPCA 5H9CA 5EBLC 1RM1C 3F5WC 5KUMA 3AEIA 2PI4A 2NLJC 3CCQV 2Y69C 4QPKA 4UVBA 3T4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Y A;  4JGS A;  2X7R B;  2EZP A;  4N23 A;  1Y66 A;  3B77 A;  3K9A A;  4FIP C;  1JQ0 A;  1DF5 A;  2M7W A;  3GWO A;  4G2K A;  1DLB A;  3WFV A;  1SZT A;  1DF4 A;  4N21 A;  1QR9 A;  4JF3 A;  3M99 B;  1QCE A;  1QR8 A;  5KA6 A;  2LP7 A;  3CP1 A;  3H01 A;  4JPR A;  5CN0 A;  1JPX A;  1I5X A;  3P30 A;  2OT5 A;  1MOF A;  3B8M A;  1F23 A;  1MG1 A;  1QBZ A;  3B8N A;  5HFL A;  1ENV A;  1K34 A;  5HFM A;  4E2L A;  2P6J A;  5KA5 A;  1EBO A;  2EBO A;  1K33 A;  1Y4M A;  5CMU A;  4FJC C;  5H9C A;  4FK5 C;  2EZO A;  3MHS C;  3CYO A;  3MHH C;  2MK3 A; 
#chains in the Genus database with same CATH topology
 4G27 B;  3HKE B;  4HAM A;  5LYJ B;  3JD1 A;  3ZS8 C;  1PL4 A;  3OUF A;  4OX9 O;  3AG1 B;  3JAR A;  1V54 B;  4UB6 Z;  3QO8 A;  5B1N A;  3G80 A;  2XND G;  1WA8 A;  2ZNJ A;  1XNR B;  4DV0 B;  4PDL A;  5IE9 A;  1VQ5 V;  2ZM6 O;  4X66 O;  1WB8 A;  2A7W A;  1YTF B;  3JD4 A;  2C2A A;  1NI8 A;  1WNS A;  5KA6 A;  2X6B A;  1HDJ A;  5H6Q A;  2OT5 A;  3B40 A;  4IYI A;  1KKD A;  3ZN0 A;  1S3J A;  3X2Q C;  2IH3 C;  2QKS A;  3E8F A;  2ZXW C;  2Q68 A;  4D7S A;  3U0Z A;  4JI8 B;  2QGN A;  1Z5W A;  5IYB O;  3UO3 A;  5E79 Z;  2B9Z A;  3TGU H;  1J5E B;  4N21 A;  2QWQ B;  4LF9 O;  1S76 D;  4DV4 O;  2WLH A;  3I5D A;  2Q0O C;  5L3C A;  4RUE A;  3T1Y O;  2OCH A;  3JAS B;  3EXA A;  2JRI A;  2JS3 A;  1FXK C;  5L3F A;  2IM9 A;  3L75 H;  1BSM A;  1XIL A;  2ADQ B;  2DE0 X;  4CS2 A;  1QR8 A;  4UUJ C;  4DR4 O;  3JAR B;  1COW G;  1EN4 A;  4GCZ A;  3K79 A;  1GN6 A;  5B1B B;  1HNW B;  3L72 H;  3JD3 A;  3JAK A;  1EZV H;  4GX2 A;  1JMK C;  1WA8 B;  2ITD C;  5LHH A;  4ZI7 B;  1RPR A;  3NR7 A;  4OXS A;  1K7D A;  1J95 A;  3RWR D;  3FFQ A;  1RSO A;  3BY6 A;  4B3T B;  3K04 A;  4X64 B;  1XL6 A;  1XBL A;  1BE3 H;  1HNX B;  4MVO A;  1GM7 A;  2JJ1 G;  5FNV A;  2EBO A;  4B3S B;  3G71 V;  4O4H A;  1N8R W;  3ABM B;  3B2E E;  2OCC C;  1AI7 A;  3CCE V;  5EZY A;  3ASO C;  4Z1V A;  1G4Y B;  3EFF K;  5C8Y A;  1H38 A;  4D6T H;  3KKY A;  1NH2 B;  1THZ A;  4NXN O;  3LSS A;  1SER A;  3HKC A;  4F4L A;  3BAB A;  4LFC B;  2EIK C;  4GKK B;  1K4C C;  2QR4 A;  2RDC A;  2E76 B;  4FLZ A;  4TSF G;  2ZE8 A;  4UVC A;  4WFB V;  3CME V;  4KL1 A;  1QLE C;  2Y48 A;  1N0J A;  1Q8I A;  4DK1 A;  2WWW A;  2F93 B;  2AHY A;  1US6 A;  4NTX A;  1A32 A;  2CGN A;  2A79 B;  3GWO A;  1VAR A;  2GDS A;  4L8J A;  5BZB A;  3A0H Z;  3ICX A;  3OR7 C;  4I55 B;  1E79 G;  4JI3 O;  1MOF A;  3OTF A;  3WG7 C;  1S5J A;  3BRC A;  2ETN A;  3JAK B;  2LGW A;  4UCU A;  3K5L A;  1RM1 B;  4WFF A;  3U11 A;  1N36 B;  2UXC O;  1Q6I A;  4H37 A;  2LW1 A;  4RWU A;  2P67 A;  3RW0 A;  1FXK A;  1FXV A;  3L74 H;  4DW0 A;  1GO3 F;  1RSO B;  2ZQM A;  3CP1 A;  2BTO A;  4CH4 A;  3OT7 A;  4U7O A;  1P7G A;  3LDC A;  2GHY A;  3CHX A;  3DC6 A;  5FNV B;  3TXQ A;  3ZHQ A;  1HP8 A;  4MTF A;  4O4H B;  3MD0 A;  2F43 G;  4TT3 G;  1TAE A;  3K0G A;  4H13 B;  3A0R A;  5EZY B;  2KKW A;  4K35 A;  1UFI A;  3W7T A;  5C8Y B;  1YF2 A;  3WFV A;  3T1H O;  1BQ0 A;  5J2T A;  3HKC B;  4QIW F;  4OX9 B;  2WLI B;  4FZ1 A;  1R6T A;  3CCJ V;  1GH6 A;  4ZBM A;  4DUZ O;  1JVM A;  1K33 A;  4LFA O;  1AVM A;  1WAZ A;  3BFR A;  5FPO A;  3X2Q B;  4GUN A;  2CTP A;  2ZM6 B;  2ZXW B;  3QF7 A;  4X66 B;  4UFZ A;  1EFR G;  4GX0 A;  5IYZ A;  4DW1 A;  4ZHQ A;  2UXD O;  1AJN A;  5JH7 A;  2M6Y A;  1OCR C;  3BA9 A;  1VQ4 V;  3FYE B;  3K5M A;  1MNG A;  2DYS C;  1KC8 W;  2D2C B;  4F6R A;  5IWA O;  4WCE V;  1FXK B;  1L1F A;  1AI5 A;  1JFF A;  2YI8 A;  2FB5 A;  4DR3 O;  4MVQ A;  4O4L A;  3SJC C;  5EBW C;  5HFL A;  1K34 A;  5ITZ A;  4LF9 B;  2JEU A;  4I7Z B;  3ZHR A;  1SRY A;  4X1Y A;  4DV4 B;  1SQG A;  5D5Q A;  3MHS C;  2AXT Z;  3T1Y B;  3U10 A;  1URF A;  1Q90 D;  2Q7E A;  1NQT A;  5LL6 Y;  3ZRW B;  4R7C A;  3JAL A;  5B1O A;  5J2T B;  2R70 A;  1XRE A;  4DR4 B;  1PNK A;  5EC1 C;  1AJP A;  5B3S C;  4DV1 O;  3MHH C;  3Q4H A;  1JA8 A;  2OCC B;  4EEQ A;  1Q3E A;  4JI7 O;  1I94 O;  1FXH A;  1R3L C;  2WLL A;  5CBH A;  4NR1 A;  1M93 A;  2QE7 G;  2EIK B;  5IYZ B;  4ZHQ B;  3J7A U;  5HFM A;  2GTA A;  1Z2G A;  5BXZ A;  5B1A C;  5JH7 B;  5DED A;  1TA8 A;  1W59 A;  4LF6 O;  4FFK A;  2FYU H;  3OM3 B;  4DK0 A;  2Q7G A;  4F6R B;  3CB2 A;  3BCC H;  1R6N A;  1SF9 A;  1EZJ A;  4NXN B;  1ZL8 A;  2A06 H;  4I0X A;  1JFF B;  3H01 A;  1K5Q A;  3VQW A;  2PI5 A;  2EIN C;  4DR2 O;  1Q86 W;  1K5S A;  4O4L B;  4J80 A;  2DW4 A;  2ZIM A;  1KP3 A;  4LR3 A;  5ITZ B;  5EC2 C;  2UUB O;  4X1Y B;  3WG7 B;  1L8D A;  1AI6 A;  4ABM A;  2X6C A;  3ZRS A;  4BAY A;  4RQE A;  2E5L O;  1JX9 A;  1DF4 A;  1U97 A;  3CD6 V;  4BIZ A;  2EIL C;  1CP9 A;  1Q82 W;  1IZ3 A;  3JAL B;  4NXM O;  4JI3 B;  3CJH A;  4DO2 A;  1OHH G;  2XUM A;  4BIO A;  1YHQ V;  3F7V C;  3Q4H B;  2UXC B;  3LSU A;  1VF7 A;  3CRA A;  4JI8 O;  3OMI B;  2M7W A;  2DQ3 A;  2WLL B;  1SQF A;  1YEW A;  2BSK A;  4LF8 O;  1XQ8 A;  1VQL V;  3ZRX A;  1D5A A;  5LOV A;  5EBL C;  4IHJ A;  3CCQ V;  4JI2 O;  1RP3 B;  3RGB A;  1EN5 A;  4EKW A;  3ASN C;  1VP7 A;  4NTW A;  3E8B A;  1XHX A;  3T1H B;  1NVP D;  4DR7 O;  3KZI Z;  4I0X B;  1PP9 H;  3N27 A;  3SJA C;  5KAF Z;  4YJ2 A;  2DYR B;  4DUZ B;  2QWO B;  4PDM A;  3LDD A;  1KP2 A;  1WJZ A;  1VQP V;  3J80 N;  2W6I G;  2YI9 A;  3OMA B;  4QGP A;  1OV9 A;  4Z2W A;  3JCZ A;  1AI4 A;  5JWP A;  4J7K A;  1HWY A;  2Q0A A;  1Y6X A;  2QTS A;  3CCS V;  1SQX H;  4FMT A;  2QKA A;  4UCR A;  5IWA B;  2RNB A;  3KCX A;  5IY5 C;  3P3P A;  1KUQ A;  4YJ3 A;  4NTY A;  2Q67 A;  4JPR A;  1XL4 A;  2BSK B;  4DR3 B;  2P06 A;  2RN9 A;  1H2K A;  2CE4 A;  5LHG A;  1IBM O;  3R65 A;  3ZRV A;  1FKA O;  1GM9 A;  4CH3 A;  4CBC A;  1KB9 F;  4LBE C;  5LOV B;  1CEZ A;  4QNH B;  5B3S B;  4UVA A;  3CPW U;  2Q8V A;  3CE2 A;  2IW5 A;  4I9Q A;  4QPJ A;  1UPG A;  1F4M A;  3SPJ A;  1ZSP A;  3G6B A;  3ZHS A;  1V55 C;  4DYL A;  3ETG A;  1OJH A;  4ZKI A;  3CCM V;  1IX9 A;  1PL0 A;  4P2Z A;  1JR9 A;  2YXH A;  1S72 V;  3VQX A;  1BMF G;  3EVK A;  4LF4 O;  3ZMU A;  3H1L H;  5B1A B;  1M9N A;  2FML A;  4YJ2 B;  3BVO A;  4DV1 B;  2H3O A;  1ZUQ A;  3BHP A;  4JI7 B;  4LCU C;  2KQX A;  1E1R G;  5IJ0 A;  1I94 B;  1LUW A;  1FAF A;  2Z3Y A;  3L9D A;  1DTO A;  1VQO V;  2EIN B;  3T1C A;  4CS3 A;  2N04 A;  4LF6 B;  1BS3 A;  3FKS G;  3SYQ A;  4HBN A;  5DM6 V;  1ZTE A;  3ZJZ A;  3VQV A;  2XT9 A;  4YJ3 B;  1JPX A;  4IGG A;  2EIL B;  3LUT B;  4XBF A;  4Q6G A;  5GW7 A;  4RO2 A;  4DR2 B;  5KHG A;  2DN9 A;  2UUB B;  3E83 A;  3IFX A;  3OR6 C;  4PDR A;  1G1X B;  1SA0 A;  2Q9L A;  2XAQ A;  1FD9 A;  1SS3 A;  2LW7 A;  1E1Q G;  4MTX A;  2E5L B;  4RQF A;  3OW2 U;  5C93 A;  3CXC U;  4I4T B;  4MTG A;  2A3Q A;  1MG1 A;  2GSM B;  1GKF A;  4NXM B;  2X6A A;  5DN6 G;  3ZMV A;  1AP5 A;  3LDE A;  4MVU A;  4LH7 A;  1TGO A;  4IIJ A;  1TUB A;  1Y76 A;  3TCU A;  1V9P A;  5LGT A;  3ZHU A;  1IBK O;  2PYL A;  5IJ0 B;  4QJF B;  3ASN B;  3B4S A;  2AZ0 A;  4EB6 A;  5BR8 O;  3MDS A;  3ZBH A;  4LF8 B;  4AQY O;  2WPD G;  2XOK G;  2MW2 B;  4TWK A;  2NR5 A;  2ADP A;  3WB2 A;  5KMG A;  3AG3 C;  3KG2 A;  3H1I H;  1MAB G;  2WSS G;  4LF7 O;  3CCU V;  5JJE B;  1NTK H;  1G6U A;  4EFB A;  4JI2 B;  1P7B A;  5LA6 A;  2CDY A;  4JI5 O;  2F23 A;  4X1I A;  1QHT A;  2EJ7 A;  1K3E A;  2JIZ G;  4FZ0 A;  4PI0 A;  3N2K A;  4X1K A;  3RYC A;  1QBZ A;  4DR7 B;  2W6J G;  4TQF A;  1H2N A;  1R3K C;  3R66 A;  1KD1 W;  1BGY H;  4J7Z A;  5LP6 C;  4FM0 A;  5LXT A;  1MZE A;  2E74 B;  1OCO B;  1YIJ V;  3W7U A;  1XMQ O;  3EHB B;  4UV8 A;  1R3J C;  4OPA A;  1BQZ A;  3KCY A;  3CSX A;  1SA0 B;  1R73 A;  4I9W A;  4GX1 A;  1FPO A;  2YDE A;  5IY5 B;  1FYJ A;  2Q4P A;  2CH7 A;  4JV5 O;  2IU3 A;  5CBF A;  1AR5 A;  3A8T A;  5J2U A;  2UXB O;  3P3N A;  4UCO A;  4Z1M G;  4IIJ B;  2LGQ A;  4DV3 O;  1TUB B;  1QNM A;  1Y76 B;  2QJ1 A;  4NB5 A;  2YIB D;  1WPX A;  3HKD A;  4JYY A;  2PYJ A;  5L3G A;  2XTA A;  3CEI A;  4MVR A;  3PN1 A;  4EB6 B;  2V7Q G;  5CA3 A;  2BE3 A;  4I50 A;  2F66 C;  2GUZ A;  2QM8 A;  1IBM B;  3JSN A;  4HNA A;  5KMG B;  2EIM B;  3T2M A;  3UCS C;  3OD4 A;  3OAA G;  3RYF A;  5LA6 B;  1DF5 A;  2HR3 A;  4GYC B;  1YDX A;  4JAS A;  4X1I B;  4LF5 O;  4BR6 A;  4MW3 A;  1M56 C;  2HJF C;  5LMN O;  4B08 A;  2OWO A;  4LC1 A;  4TOI A;  4FLU A;  3N2K B;  3AK3 A;  4X1K B;  4CH6 A;  3AG4 B;  3RYC B;  1YTF D;  2Y0I A;  4B3M O;  4ZOL A;  2CK3 G;  4LF4 B;  5LXT B;  1NTM H;  3K59 A;  5J9P C;  3P32 A;  4PA6 A;  3SYA A;  4J11 A;  1ZWI C;  4X20 A;  4J42 A;  1AJQ A;  3S3W A;  4K8Z A;  2DQ0 A;  2E75 B;  1EN6 A;  2OTL V;  2CH7 B;  2P22 C;  1M90 W;  4R6Z A;  5LP6 A;  5J2U B;  3CYO A;  4FPP A;  2IJH A;  1YJ9 V;  3K3W A;  1Y66 A;  4DR1 O;  2RCV A;  3B77 A;  2P4V A;  1H8E G;  5H2F Z;  2OTJ V;  2YIA A;  4H44 B;  1L0N H;  2CTW A;  2FTK A;  1GMG A;  2EJR A;  4I50 B;  1I7F A;  1L0L H;  3K08 A;  1O9H A;  2GUZ B;  3H9V A;  3ZN1 A;  5FPR A;  3SPI A;  1B6Q A;  4HNA B;  3G6E V;  1AP6 A;  3CC4 V;  1GN4 A;  3RYF B;  3RVY A;  1S5L Z;  1SZT A;  3K5O A;  4JF3 A;  4FLY A;  3RN4 A;  3THO A;  2Q6A A;  2Z5U A;  1ENV A;  4CC5 A;  1T5E A;  1YCI A;  4FVM A;  1LR1 A;  2JDI G;  4ZOL B;  5CA1 A;  3ABT A;  2KG7 A;  1FFT B;  3AG3 B;  4JI6 O;  4JYB A;  3SPH A;  3SJB C;  5KHK A;  4FIP C;  2FKX A;  2PTM A;  1VQK V;  3ZHV A;  1K92 A;  4PI2 A;  3QO7 A;  1IBK B;  1ZX3 A;  4X20 B;  2DMX A;  3RT3 C;  4YIP A;  5BR8 B;  4AQY B;  4MVS A;  4WFG A;  4DV5 O;  5LP6 B;  3AEI A;  4ZIB A;  2V4D A;  2Y69 C;  1HW7 A;  4LF7 B;  3E8G A;  2R9A A;  2HG5 C;  1XI1 A;  2R72 A;  3C90 A;  2P90 A;  4OPH A;  3IJ4 A;  4W4K A;  4JI5 B;  3FYI B;  4PA7 A;  3SR2 C;  1ORQ C;  5KHH A;  2ZE5 A;  2HLD G;  4YIO A;  3O65 A;  3DSQ A;  4JYC A;  2ZR2 A;  2IJJ A;  2CTR A;  4X89 A;  5BMV A;  1MSW D;  4TUY A;  2JS5 A;  4P30 A;  1XMQ B;  4KHP O;  5LMU O;  5B5E Z;  2JGU A;  4J7J A;  4BW9 A;  3ASO B;  4D7T A;  2P4K A;  4DV7 B;  1S77 D;  1YSC A;  3I55 V;  1YJN V;  5KHJ A;  4IT5 A;  1XHZ A;  4UV9 A;  1OCZ C;  5KA5 A;  2W0X A;  4JV5 B;  1QVG U;  2R9I A;  2UXB B;  5CA1 B;  2KG7 B;  2YSU B;  1QLE B;  2Q73 A;  1IXB A;  2UU9 O;  4DV3 B;  4O4I A;  1VF6 C;  2A0L A;  4UCV A;  1N34 O;  2KSD A;  1M56 B;  3A0B Z;  3WB0 A;  4O2B A;  3ZMT A;  4PEL A;  2ATK C;  2EUL A;  3D8C A;  3G4S V;  1VQ7 V;  2HFE C;  1Q7Y W;  2BTQ A;  1KU9 A;  1IVS A;  2PY5 A;  1YJW V;  5JJN B;  3CRC A;  2JVD A;  3SJQ C;  4PV1 B;  1N32 O;  1YXB A;  3CRM A;  2F4V O;  3FB8 C;  2IH1 C;  2WLM A;  4LF5 B;  1B3Q A;  1I5X A;  3P30 A;  4O2A A;  5LMN B;  1VQ6 V;  2E3C A;  4B3M B;  3K9S A;  2EZO A;  2Z0A A;  1D2D A;  4LWS A;  4TUY B;  3VOU A;  3K58 A;  5EYP A;  3CC7 V;  2FL4 A;  2QKC A;  1LUV A;  4K0K O;  2LFS A;  4TV9 A;  3J81 N;  4HZ3 A;  3PJS K;  2Y4U A;  4RUF A;  3ABL C;  1FJG O;  2ODM A;  2K1E A;  1U96 A;  1QVF U;  1JQ0 A;  3RVZ A;  2V1D A;  4DR1 B;  3CWB H;  2OYQ A;  4O4I B;  3UT5 A;  3ML0 A;  4XDL A;  3JSL A;  3O9O A;  1ZL8 B;  4BWA A;  5JJJ B;  3ETQ A;  1HR0 O;  4MVM A;  1KQS U;  4O2B B;  1OCR B;  2PUS A;  3FX7 A;  4X9Q A;  3SYO A;  2JGD A;  3SPG A;  4B7K A;  2DYS B;  2BTQ B;  1XOU A;  4MVZ A;  5JVD A;  1AR1 B;  3ABU A;  1QR9 A;  4GLX A;  5JCO C;  1K73 W;  4O2A B;  1M1K W;  5TIS Z;  1EBO A;  4ICG A;  3GVM A;  3CJH B;  1YI2 V;  3RBZ A;  1GK9 A;  4YY3 O;  5GTI Z;  1WP7 A;  3CCR V;  1VQN V;  2Q69 A;  3QTC A;  4JI6 B;  1K97 A;  4LWS B;  3QO5 A;  1OCC C;  2QWR B;  2UUA O;  1SQQ H;  1MA1 A;  4FLX A;  5EYP B;  5B1B C;  3ZHT A;  3IGA C;  1JOY A;  5D5P A;  4TV9 B;  2YIB A;  2Y0P A;  3JYC A;  3QG5 A;  1N33 O;  3STL C;  1H2L A;  1NR1 A;  2WA4 A;  4KXR A;  4J10 A;  3OEE G;  4DV5 B;  5BY1 A;  5JQG A;  4IHJ B;  1SET A;  1VMG A;  3T4D A;  4WFH A;  1K9M W;  2YXL A;  1CXZ B;  3M7M X;  4NKG B;  3CMA V;  3OMN B;  4JI1 O;  3UT5 B;  2P5O A;  5LBQ A;  4GZR B;  2B1I A;  5IJ9 A;  2L35 A;  5GTH Z;  2HKO A;  3SYC A;  2N74 A;  2Q7H A;  1OCZ B;  2YEV A;  2G38 A;  3DGE A;  1P49 A;  1KYO F;  3FAV A;  2JGD B;  3LNM B;  3OFN G;  3D36 C;  3SYP A;  4KHP B;  4GKJ O;  2DWE C;  5LMU B;  4I5S A;  3N2G A;  4UCT A;  5A9G A;  5JVD B;  1OZ0 A;  2F1M A;  4F6E A;  1VQ9 V;  1PPJ H;  4UCS A;  5EK0 A;  2IBZ H;  2XAH A;  3B8M A;  2P6J A;  4XDJ A;  1MSD A;  1WLE A;  2ZIN A;  4DUY O;  1XDC A;  3FB6 C;  5EBM C;  3JD0 A;  1BCC H;  2XAF A;  2ZE6 A;  3OEH G;  4G28 B;  4CZZ A;  2UU9 B;  3D3Q A;  2QM4 A;  4WFA V;  2NN4 A;  1N34 B;  4LNU A;  2ITC C;  2QM7 A;  4LFB O;  5JCO A;  2CTQ A;  5K1X A;  2WLK A;  4H33 A;  2YIC A;  1LNQ A;  2WLN A;  5EIB D;  5F2V O;  2EIJ C;  4X88 A;  2CGO A;  1VQM V;  3S3X A;  4B3R O;  1F4N A;  4KFM A;  4DR6 O;  5JQG B;  2HVK C;  2KB1 A;  3E2E A;  1N32 B;  2ZCE A;  1R3I C;  2F4V B;  1HNZ O;  2ZNI A;  2O57 A;  1PD3 A;  1UJW B;  1W0J G;  5IJ9 B;  2HJD A;  1XEQ A;  1ZAU A;  1H2M A;  2YEV B;  3TJT A;  3BA8 A;  4ZI7 A;  2OIE A;  4J9Z B;  3FAV B;  3ABL B;  3LSQ A;  3ETD A;  2UXX A;  3AK2 A;  1Q81 W;  1GTO A;  2ZE7 A;  3N2G B;  4FFB A;  3ZED A;  1IDS A;  4K0K B;  1NT2 B;  2ZIO A;  4KUM A;  3STZ C;  4J9Y B;  1P4R A;  1SES A;  2VQF O;  1BL8 A;  1WP8 A;  3SDL A;  3ZIA G;  1FJG B;  5GON A;  3D36 A;  1AIL A;  2UUC O;  4DV6 O;  1GN3 A;  4G2K A;  1SKV A;  1NZ6 A;  1AR4 A;  2QEX V;  3BPZ A;  4LNU B;  1KMI Z;  1EM1 A;  2XAJ A;  5IYC O;  1HR0 B;  3I56 V;  2XHB A;  1IXM A;  4DXW A;  4PDV A;  1NS1 A;  1Q5O A;  1H8H G;  3FB5 C;  3CC2 V;  2BOC C;  4PA4 A;  3IC7 A;  2IU0 A;  4I55 A;  1PM9 A;  3JD2 A;  5DEC A;  4DV7 O;  1OCC B;  2JJ2 G;  3GB7 C;  1Y74 A;  3L71 H;  2VQE O;  3FD9 A;  4TQD A;  3OGI B;  4JI0 O;  4FJC C;  1QU7 A;  4O4J A;  2QTO A;  4YY3 B;  1NJI W;  1KBH A;  4PA9 A;  2UUA B;  1IBL O;  3M99 B;  1WN7 A;  3OTO O;  4FFB B;  1H2G A;  1V55 B;  3K03 A;  2OIG A;  5FL7 G;  4IYH A;  4JTD B;  2H94 A;  1TVK A;  1MMM A;  5H9C A;  3SPC A;  5KUM A;  1N33 B;  2PI4 A;  2NLJ C;  4UVB A;  4JZG A;  1I0H A;  3AG2 C;  3K57 A;  2AGA A;  5GON B;  4OGQ B;  2ZT9 B;  2VWK A;  1BT8 A;  2WLI A;  2Q5Z A;  2ZDI C;  1XMO O;  1QQC A;  1VQ8 V;  3CX5 F;  4MTO A;  5CN0 A;  4JI1 B;  4FLT A;  1P84 F;  4E2L A;  2NNU A;  2K9P A;  4U3J A;  3JAW A;  1VEW A;  4JI4 O;  1PNM A;  3TK1 A;  2GV9 A;  4FK5 C;  4DV2 O;  1M57 C;  3ETE A;  2X7R B;  4R50 A;  1M4U A;  3TET A;  3WB1 A;  4GKJ B;  5H5N A;  3OGC C;  5B66 Z;  3HKB A;  5KX5 A;  1M5I A;  4K8X A;  1Y74 B;  3QVN A;  1PV0 A;  3GWK C;  1O9G A;  5CA0 A;  1PNL A;  3IAY A;  2QWP B;  4B7E A;  2F95 B;  5KLV H;  4DUY B;  3F7Y C;  1Q6H A;  4O4J B;  2EIJ B;  1JCH A;  1NBM G;  2HP8 A;  2QA4 V;  2DJV A;  2IJK A;  5E1A C;  4JYA O;  4CC6 A;  3CS5 A;  3HKD B;  3SGI A;  4LFB B;  4UB8 Z;  2W0F C;  3E89 A;  1MZF A;  1TVK B;  1FS0 G;  2ZKO A;  4LP8 A;  3ZMZ A;  4B3R B;  1AB3 A;  4DR6 B;  3HR0 A;  3ZRW A;  2HHH O;  5IT9 N;  4U3F H;  3B09 A;  3JAT A;  1BHA A;  3BEH A;  1HNZ B;  2XAG A;  5LGN A;  4MW8 A;  4MSW C;  1DGS A;  1S5H C;  3K06 A;  3C3T A;  4GT1 A;  3JAW B;  4U3J B;  1NKD A;  1JJO A;  4U7N A;  4JTC B;  2ILM A;  2YID A;  4AI8 A;  1GM8 A;  3E86 A;  4FLW A;  5EIB C;  1JJ2 U;  5A2Q N;  2ZDI A;  4RAI A;  4HYO A;  3APQ A;  3HKB B;  4JTA B;  2YUA A;  3BAA A;  5KX5 B;  2DYR C;  1NH2 D;  2B5U A;  5CA0 B;  4GX5 A;  4W4L A;  1SQB H;  3A2F A;  4YHH O;  1QLN A;  3DC5 A;  4LH6 A;  3UKM A;  2LO1 A;  3W7S A;  4H0L B;  2VQF B;  1K4D C;  4CH5 A;  3CCV V;  1F7Y A;  4WBN A;  1XNQ O;  2BOB C;  4PA3 A;  2PZS A;  2UUC B;  4DV6 B;  1Q6U A;  4X65 O;  4PJ0 Z;  4DR5 O;  3AK1 A;  2DWD C;  1YIT V;  1VF5 B;  2ZD9 A;  4IL6 Z;  3LNN A;  1IUR A;  2LFR A;  2RJZ A;  4X62 O;  4FM1 A;  2MK3 A;  1NVP B;  1BZK A;  1S0V A;  1B04 A;  1Y67 A;  3UM7 A;  1SQV H;  4YXW G;  3QNE A;  1WB7 A;  3JAT B;  1TUE B;  4UXN A;  2DOS A;  3M8A A;  2VQE B;  5CMU A;  4FM2 A;  2IJI A;  5CBG A;  4JI0 B;  5L3E A;  1PKX A;  2BCC H;  4R8C A;  2VS0 A;  3AG2 B;  2VRZ A;  5CB4 A;  4E4E A;  1RPO A;  4MS2 A;  2GBO A;  5FLX N;  2LP7 A;  2YXY A;  1IBL B;  3OTO B;  4NVP A;  4AIL C;  2CAZ C;  3E8H A;  2N05 A;  3CRR A;  5IYD O;  3ZX6 A;  1H2S B;  2D3O W;  3D3I A;  4AHC A;  1ROP A;  5H6R A;  3APO A;  1M57 B;  1Z5V A;  4WBN B;  1NU1 H;  2RQ6 A;  1XMO B;  3HPL C;  4C7U A;  3ABK C;  4PHZ A;  2X0L A;  3VBB A;  1XNR O;  3NXS A;  4DV0 O;  4JI4 B;  1SC5 B;  5KAI Z;  4NYK A;  4BW5 A;  4DV2 B;  5AG2 A;  3C3S A;  4JAU A;  5BMV B;  2GTS A;  1ZLZ A;  3AG1 C;  4P9O A;  1XUQ A;  2VWJ A;  1DK1 A;  1V54 C;  1VIB A;  1NTZ H;  3H1J H;  1R6K A;  3DXR A;  3UO2 A;  1F23 A;  1SQP H;  1WPB A;  4DRX A;  1RFY A;  4A5U B;  3E35 A;  4WF9 V;  2PF4 E;  3RYI A;  3OUS A;  3W7X A;  3VQY A;  3HB3 B;  2Y4T A;  5L3B A;  3ZMS A;  2YS8 A;  4TV8 A;  2UXN A;  1J5E O;  1YZB A;  1DLB A;  2LJ2 A;  5CB4 B;  4QE9 A;  4JYA B;  2JK5 C;  4L87 A;  2HVJ C;  3OE7 G;  4EFE A;  3ZCC A;  3JAM N;  3F5T A;  4J41 A;  1YVW A;  2PGG A;  2ZR3 A;  3DTU B;  3MAQ A;  1GAX A;  1X59 A;  2AHZ A;  3H1H H;  2HHH B;  1VF6 A;  1I08 A;  5IDJ A;  2AZ2 A;  4PD4 F;  2WA3 A;  1HNW O;  3RYH A;  5LHI A;  1SZX A;  4XDK A;  1Y4M A;  4LFA B;  2QDO A;  3L73 H;  2JEX A;  2R9R B;  1I5Y A;  3JCU Z;  4JGS A;  2Y69 B;  1FFX A;  4B3T O;  2LQT A;  3IC9 A;  4X64 O;  1HNX O;  4JZ2 A;  2XAS A;  1G8M A;  1NR7 A;  1W0K G;  3FB7 C;  2UXD B;  3E22 A;  3DXR B;  1OCO C;  1N4C A;  4B3S O;  2ARH A;  4DRX B;  4YHH B;  3RYI B;  3HKE A;  5LYJ A;  3CCL V;  4N23 A;  4WFE A;  3G67 A;  1XNQ B;  4JAA A;  4TV8 B;  3AG7 A;  4LFC O;  4GKK O;  1CPY A;  1B06 A;  4X65 B;  1W2B U;  4JAV A;  2WAM A;  2AW9 A;  3H1K H;  4Q20 A;  4DR5 B;  4BIU A;  3K0D A;  2QSA A;  3K5N A;  5KHI A;  2EX3 A;  3ABM C;  3RFR A;  4QE7 A;  1KEC A;  2QWN B;  4X62 B;  4MT8 A;  2B1G A;  4I4T A;  2A9H A;  5K1P A;  1N0N A;  2L6L A;  3TXS A;  3CXH F;  3B8N A;  1R1B A;  1K8A W;  3RYH B;  4X8A A;  2EIM C;  1GN2 A;  4CS4 A;  1ARO P;  3UQ8 A;  1N36 O;  3W7W A;  2CUG A;  1GRJ A;  1F51 A;  5LGU A;  2EZP A;  3WU2 Z;  3L70 H;  2RMK B;  3K9A A;  4K3A A;  1D5N A;  3CRQ A;  1FFX B;  2YC0 A;  2WLJ A;  1QCE A;  4P9P A;  2P7T C;  3AG4 C;  4KP4 A;  1BHB A;  5KUK A;  1X4T A;  2HEP A;  3E22 B;  4ASU G;  3ABK B;  5L3D A;  2H8P C;  1KKC A;  1RM1 C;  3F5W C;  3JAS A;  1Q43 A;  4FLV A;  4QPK A;  3T4Z A; 
#chains in the Genus database with same CATH homology
 4G27 B;  3AG2 C;  3E8G A;  2HG5 C;  4EKW A;  4HAM A;  3JD1 A;  2P90 A;  3ASN C;  3OUF A;  2WLI A;  3FYI B;  2ZDI C;  3AG1 B;  3E8B A;  4PA7 A;  1VQ8 V;  4MTO A;  1ORQ C;  5CN0 A;  1NVP D;  2HLD G;  1V54 B;  3QO8 A;  4E2L A;  2NNU A;  4JYC A;  5B1N A;  2ZR2 A;  1PNM A;  2XND G;  3TK1 A;  2DYR B;  2IJJ A;  4PDM A;  3LDD A;  1KP2 A;  4FK5 C;  4X89 A;  1VQP V;  4PDL A;  1MSW D;  1VQ5 V;  4P30 A;  1M57 C;  3ETE A;  2X7R B;  4R50 A;  3TET A;  2W6I G;  3ASO B;  1YTF B;  3JD4 A;  2C2A A;  3OMA B;  3OGC C;  1S77 D;  5KA6 A;  2X6B A;  1YSC A;  3I55 V;  1YJN V;  3JCZ A;  5H6Q A;  1AI4 A;  2OT5 A;  4UV9 A;  1KKD A;  1PNL A;  1OCZ C;  5KA5 A;  1HWY A;  3ZN0 A;  1S3J A;  1QVG U;  2R9I A;  3X2Q C;  3F7Y C;  2IH3 C;  2QKS A;  2EIJ B;  2YSU B;  3E8F A;  1JCH A;  2ZXW C;  3CCS V;  1NBM G;  2Q68 A;  2QA4 V;  1QLE B;  4FMT A;  2IJK A;  5IYB O;  5E1A C;  2A0L A;  4N21 A;  5IY5 C;  2Q67 A;  4JPR A;  1XL4 A;  1S76 D;  1M56 B;  2WLH A;  5LHG A;  3R65 A;  3ZRV A;  5L3C A;  3ZMT A;  1GM9 A;  4PEL A;  4CBC A;  2W0F C;  2ATK C;  3E89 A;  4LBE C;  4RUE A;  3G4S V;  2HFE C;  1VQ7 V;  1CEZ A;  4QNH B;  5B3S B;  4UVA A;  3CPW U;  1FS0 G;  1Q7Y W;  4LP8 A;  3ZMZ A;  1FXK C;  2IW5 A;  1YJW V;  5L3F A;  4QPJ A;  3ZRW A;  3SJQ C;  1F4M A;  3SPJ A;  1V55 C;  3ETG A;  3FB8 C;  4ZKI A;  3CCM V;  2IH1 C;  2WLM A;  1PL0 A;  1QR8 A;  4P2Z A;  4UUJ C;  1BHA A;  1I5X A;  1COW G;  3BEH A;  3P30 A;  2XAG A;  1S72 V;  4GCZ A;  3K79 A;  5LGN A;  5B1B B;  1BMF G;  4MW8 A;  4MSW C;  1S5H C;  3JD3 A;  3K06 A;  3ZMU A;  4GT1 A;  1VQ6 V;  5B1A B;  1M9N A;  1NKD A;  4GX2 A;  2EZO A;  4U7N A;  4JTC B;  2ITD C;  5LHH A;  1RPR A;  4OXS A;  1K7D A;  1J95 A;  1GM8 A;  3VOU A;  3E86 A;  4LCU C;  1E1R G;  3BY6 A;  3CC7 V;  3K04 A;  1JJ2 U;  1XL6 A;  2ZDI A;  4MVO A;  2Z3Y A;  4RAI A;  4HYO A;  4JTA B;  1GM7 A;  2LFS A;  2JJ1 G;  1DTO A;  2DYR C;  4HZ3 A;  1VQO V;  1NH2 D;  2B5U A;  2EIN B;  4GX5 A;  2EBO A;  3T1C A;  3PJS K;  1QLN A;  3G71 V;  3UKM A;  1N8R W;  3ABM B;  2OCC C;  3W7S A;  1AI7 A;  4RUF A;  3CCE V;  3ABL C;  1K4D C;  2K1E A;  3ASO C;  3CCV V;  3FKS G;  3SYQ A;  1G4Y B;  3EFF K;  1H38 A;  2BOB C;  5DM6 V;  1NH2 B;  1THZ A;  1JQ0 A;  4PA3 A;  3LSS A;  3RVZ A;  2V1D A;  1QVF U;  1SER A;  4F4L A;  3ZJZ A;  3ML0 A;  4XDL A;  2EIK C;  1JPX A;  1K4C C;  2EIL B;  3LUT B;  2DWD C;  1YIT V;  4XBF A;  5GW7 A;  4RO2 A;  2ZD9 A;  4TSF G;  4UVC A;  4MVM A;  1KQS U;  2LFR A;  4WFB V;  1OCR B;  3CME V;  3E83 A;  3IFX A;  3SYO A;  1QLE C;  3OR6 C;  2Y48 A;  3SPG A;  4PDR A;  2MK3 A;  2DYS B;  1NVP B;  2XAQ A;  2WWW A;  2AHY A;  4MVZ A;  1S0V A;  1E1Q G;  2A79 B;  1AR1 B;  3GWO A;  3UM7 A;  3ABU A;  4MTX A;  4RQF A;  5BZB A;  3OW2 U;  1QR9 A;  5C93 A;  3OR7 C;  3CXC U;  4MTG A;  1E79 G;  4YXW G;  1MOF A;  3QNE A;  1K73 W;  1MG1 A;  1TUE B;  4UXN A;  2GSM B;  1GKF A;  2X6A A;  1M1K W;  5DN6 G;  3ZMV A;  1EBO A;  3WG7 C;  1YI2 V;  5CMU A;  3RBZ A;  3LDE A;  4MVU A;  1GK9 A;  2IJI A;  5CBG A;  1RM1 B;  4WFF A;  5L3E A;  3CCR V;  1PKX A;  4H37 A;  1VQN V;  2Q69 A;  4R8C A;  2P67 A;  3TCU A;  3RW0 A;  1K97 A;  1FXK A;  5LGT A;  3QO5 A;  1FXV A;  3AG2 B;  1OCC C;  1GO3 F;  1RPO A;  2ZQM A;  4QJF B;  3ASN B;  4MS2 A;  2LP7 A;  3CP1 A;  5B1B C;  3E8H A;  3IGA C;  4U7O A;  1JOY A;  2WPD G;  2XOK G;  2GHY A;  3LDC A;  4TWK A;  3JYC A;  5IYD O;  3STL C;  1NR1 A;  4MTF A;  3AG3 C;  3KG2 A;  1MAB G;  2WSS G;  3MD0 A;  2F43 G;  3OEE G;  3CCU V;  2D3O W;  3D3I A;  4TT3 G;  3K0G A;  1SET A;  1ROP A;  1P7B A;  5H6R A;  3A0R A;  3T4D A;  4WFH A;  3W7T A;  1M57 B;  1K9M W;  3WFV A;  1K3E A;  3CMA V;  3OMN B;  2JIZ G;  4QIW F;  2WLI B;  3HPL C;  5LBQ A;  1QBZ A;  3ABK C;  2B1I A;  3CCJ V;  2W6J G;  1R3K C;  1KD1 W;  2HKO A;  4ZBM A;  2X0L A;  1JVM A;  3SYC A;  3NXS A;  3VBB A;  1K33 A;  1OCZ B;  1OCO B;  2YEV A;  1YIJ V;  3DGE A;  3W7U A;  4BW5 A;  3EHB B;  4UV8 A;  3X2Q B;  1R3J C;  3LNM B;  4JAU A;  3OFN G;  1R73 A;  2ZXW B;  4I9W A;  3SYP A;  2DWE C;  3AG1 C;  4I5S A;  4GX1 A;  4P9O A;  1OZ0 A;  1EFR G;  1VQ9 V;  1V54 C;  4GX0 A;  5EK0 A;  5IY5 B;  1R6K A;  1AJN A;  2XAH A;  3B8M A;  1F23 A;  2P6J A;  1OCR C;  2IU3 A;  1WLE A;  4XDJ A;  5CBF A;  3E35 A;  4WF9 V;  3FYE B;  1VQ4 V;  3FB6 C;  4Z1M G;  2DYS C;  3OUS A;  3W7X A;  5EBM C;  3JD0 A;  1KC8 W;  3HB3 B;  5L3B A;  3ZMS A;  4WCE V;  2UXN A;  1FXK B;  2XAF A;  3OEH G;  4G28 B;  4CZZ A;  1DLB A;  1L1F A;  1AI5 A;  1WPX A;  4QE9 A;  4WFA V;  2JK5 C;  2ITC C;  5L3G A;  4L87 A;  4MVQ A;  2HVJ C;  2QM7 A;  3OE7 G;  4MVR A;  2V7Q G;  5EBW C;  5CA3 A;  5HFL A;  1K34 A;  2WLK A;  3ZCC A;  2JEU A;  1SRY A;  4H33 A;  1LNQ A;  2QM8 A;  2WLN A;  2ZR3 A;  2EIJ C;  3MHS C;  4X88 A;  1VQM V;  2EIM B;  3DTU B;  3T2M A;  1F4N A;  4KFM A;  3OAA G;  2HVK C;  2AHZ A;  2KB1 A;  1DF5 A;  2HR3 A;  1NQT A;  4JAS A;  3E2E A;  3ZRW B;  4R7C A;  1R3I C;  4MW3 A;  5IDJ A;  5B1O A;  1M56 C;  2HJF C;  4LC1 A;  1PD3 A;  1UJW B;  1PNK A;  5EC1 C;  1YTF D;  1W0J G;  3AG4 B;  5LHI A;  1AJP A;  4XDK A;  2CK3 G;  1Y4M A;  5B3S C;  2YEV B;  2JEX A;  3MHH C;  2OCC B;  4J9Z B;  5J9P C;  2R9R B;  1I5Y A;  3ABL B;  3P32 A;  3LSQ A;  4JGS A;  2Y69 B;  3ETD A;  4PA6 A;  2UXX A;  1Q81 W;  1FXH A;  1GTO A;  1R3L C;  2WLL A;  2XAS A;  5CBH A;  3SYA A;  1G8M A;  1ZWI C;  2QE7 G;  1AJQ A;  1NR7 A;  1W0K G;  2EIK B;  2DQ0 A;  3FB7 C;  5HFM A;  1OCO C;  2OTL V;  4KUM A;  5B1A C;  1M90 W;  4R6Z A;  3STZ C;  4J9Y B;  1P4R A;  1SES A;  1BL8 A;  3CYO A;  3OM3 B;  3ZIA G;  4FPP A;  2IJH A;  3CCL V;  1YJ9 V;  3K3W A;  3D36 A;  4N23 A;  1Y66 A;  4WFE A;  3B77 A;  4G2K A;  1R6N A;  1EZJ A;  2QEX V;  1H8E G;  1CPY A;  3H01 A;  1K5Q A;  1W2B U;  2PI5 A;  2EIN C;  4JAV A;  1Q86 W;  2WAM A;  1K5S A;  2OTJ V;  2DW4 A;  4Q20 A;  4BIU A;  3K0D A;  2XAJ A;  1KP3 A;  2FTK A;  1GMG A;  5EC2 C;  3ABM C;  2EJR A;  3K08 A;  5IYC O;  3I56 V;  4QE7 A;  3WG7 B;  1KEC A;  1IXM A;  3ZN1 A;  4DXW A;  1AI6 A;  4PDV A;  3SPI A;  4MT8 A;  1B6Q A;  2B1G A;  2X6C A;  3ZRS A;  4BAY A;  1H8H G;  3FB5 C;  4RQE A;  3CC2 V;  3G6E V;  2BOC C;  4PA4 A;  3IC7 A;  2IU0 A;  3CC4 V;  3JD2 A;  1JX9 A;  3RVY A;  1SZT A;  1DF4 A;  1OCC B;  4JF3 A;  2A9H A;  3CD6 V;  4BIZ A;  2EIL C;  1CP9 A;  2JJ2 G;  1Q82 W;  3GB7 C;  2Q6A A;  3B8N A;  2Z5U A;  1ENV A;  4DO2 A;  1OHH G;  1K8A W;  4X8A A;  2EIM C;  4FJC C;  2JDI G;  1ARO P;  3ABT A;  1FFT B;  3W7W A;  1YHQ V;  2QTO A;  1NJI W;  3AG3 B;  3F7V C;  4JYB A;  1F51 A;  3SPH A;  5LGU A;  3OMI B;  2EZP A;  3K9A A;  4FIP C;  2M7W A;  2DQ3 A;  4PA9 A;  1VQK V;  1K92 A;  3QO7 A;  2WLL B;  2WLJ A;  3M99 B;  1QCE A;  4P9P A;  2P7T C;  3AG4 C;  1H2G A;  1V55 B;  3K03 A;  4KP4 A;  5KUK A;  1BHB A;  5FL7 G;  1VQL V;  3ZRX A;  4ASU G;  3ABK B;  5L3D A;  4JTD B;  2H94 A;  2H8P C;  4MVS A;  4WFG A;  3SPC A;  5H9C A;  5EBL C;  1RM1 C;  3F5W C;  5KUM A;  3AEI A;  2PI4 A;  2NLJ C;  3CCQ V;  2Y69 C;  4QPK A;  4UVB A;  3T4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...