1F23A

Contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
75
structure length
74
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGTKQLQARLSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEKNEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords TRANSMEMBRANE GLYCOPROTEIN
publication title Structural and functional analysis of the HIV gp41 core containing an Ile573 to Thr substitution: implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 30
structure length 74
sequence length 75
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f23A00
1MG1A 1DF4A 3B8NA 5KA6A 5CMUA 4G2KA 3M99B 4E2LA 5CN0A 2EZPA 3CP1A 3K9AA 5KA5A 1MOFA 4FIPC 1JQ0A 1K33A 4N21A 2LP7A 3MHSC 1QBZA 4FJCC 5H9CA 1I5YA 2X7RB 4N23A 1EBOA 1DLBA 1I5XA 2OT5A 2EZOA 4FK5C 3H01A 4JF3A 1QR8A 1JPXA 1Y4MA 2P6JA 1Y66A 2EBOA 1SZTA 3B8MA 1K34A 3B77A 3P30A 5HFMA 4JGSA 2M7WA 1ENVA 1F23A 1DF5A 3GWOA 2MK3A 3MHHC 1QR9A 4JPRA 3WFVA 1QCEA 3CYOA 5HFLA
chains in the Genus database with same CATH superfamily
4JI2O 1HNZB 2BE3A 2CK3G 4DV6O 3WG7C 2HLDG 5EBLC 3K5NA 1XL4A 1R6NA 3AG1C 1L0NH 2ITCC 3CXHF 1AP6A 2FB5A 3OW2U 4J7ZA 5EBMC 1SQXH 1YCIA 5DEDA 2YC0A 2AXTZ 5C8YB 3P3PA 4JI8B 4JF3A 1UPGA 3IC7A 3TXQA 5KX5B 2JK5C 4YY3B 1D2DA 4I0XA 1FFXA 1EN6A 2EIKB 1AJNA 2Q4PA 4G2KA 4X66B 3D3IA 1EN5A 4FPPA 1M57C 4JI5B 4Z2WA 5B3SB 4RAIA 3T1HO 3TETA 1VF7A 2XOKG 3OT7A 4DR6O 2G38A 2RNBA 3RN4A 3JAWB 5D5PA 2QDOA 1V55B 1XNRB 2UXNA 1IVSA 1KUQA 5IJ0B 2UUBB 2PF4E 4GT1A 2R9RB 4QGPA 5LL6Y 1IZ3A 4NXNB 1I5XA 2UU9B 1JX9A 5L3DA 3ABMC 3ZMSA 1KC8W 1IBMB 3FB6C 1WPXA 2ADQB 3TJTA 2YICA 2D3OW 1Q6HA 2QM8A 4D7SA 3OEEG 3KZIZ 2IJIA 4NR1A 1S5HC 4DR3O 3SDLA 4H37A 1NR7A 2Q7HA 1JMKC 1FFTB 1BMFG 4GKKB 2DYRB 3T1YB 4MS2A 3ZS8C 1PV0A 2VQEO 2EZPA 3OMIB 1HR0O 1VIBA 1FXVA 1HP8A 4TV9A 2E74B 5JWPA 1W0KG 3SYAA 2X7RB 4YIOA 1GMGA 4BAYA 1TUBB 1TVKB 3G71V 4I7ZB 1S76D 2ZE6A 1IURA 2H8PC 2JS3A 4NXMO 3DTUB 3HKDB 5AG2A 4JI2B 1BSMA 5EC1C 1KKCA 2YI9A 3KKYA 4DV6B 2ODMA 3HKEB 4Q6GA 3CC2V 2GTAA 3ASOC 5B1OA 2Q67A 4ZHQA 2EIJC 4B3RO 2AZ0A 4LFAO 4CC6A 4WF9V 3ZRXA 2Q68A 3B8NA 1S5LZ 2YXYA 3FYEB 2B1IA 2EX3A 2FMLA 2BSKA 1XI1A 3M7MX 1D5NA 3FKSG 3JASA 2BTQA 3LSSA 1WP8A 1JA8A 2Q0OC 3JYCA 4P9PA 2WPDG 2LFSA 5KMGB 1XMOO 3GWKC 2ARHA 3NR7A 3K5LA 3T1HB 4LBEC 4UCTA 4B7EA 4DR6B 1F51A 2LGQA 1DF4A 4GKJO 4F6RA 3QO5A 4LF8O 1HDJA 4HBNA 4QIWF 1N0NA 1VQ6V 4H13B 1GK9A 3CCEV 1K5SA 2A79B 3ABKC 4JTDB 3L9DA 5B1AB 4DR4O 5JJNB 4A5UB 3P32A 3JD1A 3O9OA 4JAUA 5BXZA 1T5EA 3BFRA 4E4EA 4JTAB 3ZBHA 3AG4B 1HW7A 4TQFA 4AHCA 3FAVB 1B3QA 3EXAA 4D7TA 1MSWD 1E1QG 1VQMV 2AZ2A 1PM9A 3ZJZA 4B3MO 4DW0A 1XILA 1NKDA 1JFFA 4UCUA 1E79G 3ASNC 2GSMB 4PDVA 2Q7EA 1THZA 4JI0O 3LSQA 4BIUA 1AJPA 2P90A 3ZN0A 1VQ5V 5BY1A 3VQWA 4FLYA 2VQEB 3CCVV 2F4VO 1HR0B 2Y69B 3K5OA 3RVZA 1QLEB 3T4DA 4DR5O 2QWQB 1BQ0A 1GO3F 1MZEA 4CC5A 2IBZH 2EJRA 1OV9A 4DK1A 2W0XA 4JYBA 2XAHA 5H2FZ 1AI7A 4N21A 1YI2V 2UUCO 3MHSC 3OUSA 3CX5F 2JS5A 1H38A 4B7KA 4X64O 4RQEA 4DV1O 5KAFZ 4NXMB 4L87A 2X6AA 1YITV 4PA7A 5K1XA 1LR1A 4G27B 1OCZC 5EYPB 1Q7YW 2MK3A 3HPLC 1MA1A 1XMQO 3K06A 4JI4B 2UXCO 5JJEB 3RYFB 1N34O 5L3CA 3HKBA 4B3RB 3K3WA 2YIAA 3JAKB 3DSQA 5CA3A 4X1KA 1URFA 5JQGA 4WCEV 4TT3G 4QJFB 3E8GA 3B8MA 2ZR3A 1M56B 4LWSB 4IGGA 4XDLA 3ZMVA 3MHHC 1IBKO 4X9QA 5IT9N 3IAYA 2FYUH 4IHJA 4MTXA 4IIJB 3CCSV 3JD4A 5KA5A 1K33A 1X4TA 1KP3A 3JCUZ 1ORQC 4UV8A 4GKJB 2GBOA 4LF8B 4X1IA 4AI8A 4LF9B 1SC5B 3JALA 3IC9A 1GN3A 5BZBA 5IJ9A 4OPHA 4LNUA 5CBGA 3L73H 4DR4B 2QKSA 1NH2B 1PP9H 2R9AA 1Z5WA 4DR7O 3ABLB 3BPZA 3SJBC 2N05A 2R9IA 5DM6V 4WBNB 3BVOA 4Z1MG 1S0VA 5LXTA 3QTCA 2PZSA 1I5YA 4TQDA 2ITDC 3OM3B 4JV5O 2CTQA 3E8BA 1EM1A 2OWOA 4KHPO 1I08A 4W4LA 1RSOA 4DUZB 3AG2B 3FYIB 3A0HZ 3ZMTA 1KYOF 2Q0AA 4FLUA 5KHJA 2EINB 1DGSA 2VQFO 2KSDA 4DV0O 2ZDIA 3CE2A 1XHZA 4JI0B 1DK1A 2QJ1A 3DC5A 2WLMA 2LFRA 3OMNB 1YVWA 2IM9A 5FLXN 1DF5A 1P49A 4I4TB 3CYOA 4R6ZA 4DRXB 2XUMA 2ZNJA 3J81N 5IWAO 1YHQV 1VQNV 4X62O 1JQ0A 3P3NA 3QNEA 3RWRD 5IYZA 4DR2O 2YDEA 2ZIMA 1IX9A 4PDLA 1TUEB 2RMKB 1Y4MA 2P06A 2UUCB 2EILB 4L8JA 3BCCH 4PJ0Z 2CGOA 4XDKA 4YJ3A 4JI6O 2HJFC 2WA4A 4ZI7A 1XMQB 2UXCB 1BGYH 1KMIZ 3STLC 2FTKA 1JR9A 2GUZA 3OGIB 4TUYA 3HR0A 1QQCA 2IJHA 1J95A 2BOCC 1SQVH 4JPRA 3UT5A 1HNWO 2N74A 4BIZA 3WG7B 2Y0PA 3AG1B 5LA6A 3CMEV 1KECA 1OCOC 2NNUA 1RPOA 2QEXV 3AG3C 4JYCA 4LFCB 1O9HA 3GWOA 5H6QA 4K3AA 1M57B 1NS1A 3SPCA 1XNQO 3I5DA 2LQTA 1US6A 2YEVB 2JEUA 1YJNV 3A0BZ 1D5AA 1YTFB 4DR7B 1NTMH 2VRZA 2P22C 2W6JG 2Z0AA 4UB6Z 1P7GA 4TV8B 4JV5B 2BOBC 3K58A 4UCOA 1J5EO 3T2MA 2Q5ZA 1AVMA 4KHPB 2A06H 1LUVA 2QTSA 2ZT9B 4EB6A 4J11A 5BMVA 2IU3A 4LCUC 1CPYA 4MW3A 4MVQA 3ABMB 1R6KA 3N2GB 2WLIB 4IYIA 4JI3O 4FLVA 2VQFB 3CCLV 4DV0B 4LFBO 1QR9A 3STZC 4JASA 3RYHB 3JATB 2CTRA 2YI8A 2KQXA 1H2GA 1Y67A 4BIOA 1G8MA 1YDXA 1K3EA 4O4HB 3FAVA 4O2BA 4ICGA 2KG7B 2Y4UA 5IWAB 4KP4A 5LHHA 2DWEC 4YJ2A 4X62B 4GX2A 4O4JA 1K73W 4DR2B 1ZTEA 5LGNA 1FXKA 4FZ1A 1VQ9V 3OEHG 3H9VA 3DXRA 5GTIZ 5CB4B 1AILA 3B40A 3NXSA 1VMGA 2H3OA 2QWPB 3W7TA 2XASA 3UCSC 4G28B 5IDJA 3UO2A 5EBWC 2V1DA 1KP2A 3CPWU 5JH7A 2CTPA 4JI6B 1SRYA 2X6BA 5CBHA 3FB5C 3UO3A 3HKCB 2PTMA 4GLXA 1G4YB 5LYJA 1U96A 1MABG 3ETGA 4JAAA 1S5JA 1XQ8A 1MZFA 4W4KA 5CMUA 4E2LA 3AK1A 1HWYA 4F6EA 3E22A 1N8RW 3EVKA 1JVMA 1GH6A 4OGQB 2HEPA 1H2KA 1M9NA 3QO8A 1TGOA 4OX9O 1HNWB 3E83A 5LHGA 5GONB 1DLBA 1OCRC 5LOVA 2EZOA 3ASOB 4MTOA 2EIJB 3RYIB 4JGSA 1WAZA 4F4LA 4YXWG 2W0FC 2LJ2A 4FFBB 4X1YA 4ZKIA 3OTFA 4NTYA 3APOA 3G6BA 2WSSG 3OFNG 4RUEA 2ZE5A 2DMXA 2Q69A 2FL4A 4O4LB 2AHZA 4LF5O 3MDSA 2XHBA 1Y76A 1P84F 5KA6A 3CP1A 1KKDA 4DUYO 4Q20A 2XNDG 1J5EB 5JCOA 2HVKC 3ABKB 1SA0B 2DWDC 5ITZB 3MAQA 2DQ0A 2WLJA 1VF6A 3L75H 4FM0A 4UXNA 4QE7A 4XBFA 2RN9A 1JPXA 4K0KB 1SZTA 3CCUV 4JAVA 1GM8A 2ZM6O 2R70A 2FKXA 3G80A 1MSDA 3EFFK 4JI3B 1W0JG 3M99B 3L70H 3RYCB 4LFBB 3VQYA 4UV9A 5EIBD 3K59A 2OTLV 1AR1B 4JYAO 1QVGU 3WU2Z 3QVNA 5KUMA 1K4CC 1WP7A 5EZYB 1JJOA 1N32O 4R7CA 3IJ4A 3ASNB 2RJZA 3F7VC 4LC1A 3CCQV 3VQVA 1R3LC 3TGUH 3C3SA 5FNVA 1E1RG 4RWUA 2WA3A 2XT9A 2MW2B 5KHIA 1N4CA 1NJIW 3CRRA 3K04A 1G1XB 1YIJV 4ASUG 3OR6C 2CE4A 5EIBC 3D36A 4I9QA 1W2BU 5DN6G 2F1MA 4UCVA 1I0HA 3D8CA 2RCVA 3K9SA 2CDYA 2WLLB 3GB7C 5EC2C 2F95B 5B5EZ 4DK0A 4CZZA 1P7BA 2ATKC 4DR1O 1WB8A 3ML0A 1FPOA 1ZSPA 1OCZB 3BABA 4OX9B 2B5UA 1NVPD 2ADPA 2HP8A 2NN4A 3ZMZA 1YXBA 2ZXWC 1FKAO 1YF2A 2ZDIC 3ICXA 3OAAG 2ZCEA 3BY6A 4DO2A 1AR4A 4X65O 3AK3A 5J2UA 1DTOA 1V54C 5CA0B 4X20B 5JVDB 1LUWA 5HFMA 1K34A 1VF5B 2QE7G 3CD6V 1ZL8A 2QWNB 2P4VA 3S3WA 5F2VO 4J9YB 2CH7A 1ZWIC 3A8TA 5IY5C 3OD4A 3CJHA 1AI4A 1R73A 4P30A 4ZOLB 3Q4HA 4DUYB 4FLWA 5J2TA 5B1BC 2OCCB 4O4IA 5LP6A 3JARB 2L35A 4DR3B 3ZRWA 4KL1A 5TISZ 3WFVA 1B04A 4QPKA 3QG5A 5L3EA 3W7SA 1XL6A 2ZM6B 5CA1A 4O2AA 1FAFA 3OMAB 1FXHA 1WNSA 3SPJA 4MVOA 3ZHSA 3DC6A 4JYAB 1Y74A 4MW8A 1BE3H 2NR5A 1GTOA 3OUFA 1XBLA 1Q81W 4J7JA 5LMNO 1Y6XA 3IFXA 4CS4A 3EHBB 4I0XB 4I5SA 1FFXB 2H94A 4IT5A 1R3KC 4MTFA 1BHBA 3E2EA 1AJQA 4I55A 4XDJA 2OIGA 2Y48A 2JEXA 2Z3YA 3OE7G 4J80A 3RYHA 4LFAB 4FM1A 2X0LA 1SQBH 1AB3A 3WB1A 2LW7A 1QR8A 1WA8A 4LR3A 4UUJC 3N2KA 2JGDA 4DR1B 1K4DC 5B66Z 3ZEDA 1ZX3A 5IYDO 3D3QA 1MG1A 4GYCB 3TXSA 1XMOB 3BHPA 3E86A 4HNAA 4I50B 1NQTA 2PI5A 2ZE8A 3KCYA 5FPRA 3I55V 4K35A 2EIMC 4X65B 1ZLZA 2JJ2G 2DE0X 3LDDA 1H8EG 4MSWC 4DXWA 4FLTA 1L8DA 5C8YA 2JRIA 1BS3A 1HNXO 2DN9A 2WAMA 2PYLA 1OCOB 4PI0A 5KX5A 2PUSA 1SQFA 1SQQH 2GHYA 2QM7A 2VWKA 3AG3B 3CB2A 3TK1A 4BWAA 1FXKC 3JD3A 3PN1A 2P6JA 3FFQA 1CEZA 5D5QA 1SZXA 4TV9B 5LBQA 4B3MB 1Q43A 1L0LH 4WFGA 2ZR2A 2VWJA 1Q6IA 1F7YA 3JAWA 4FJCC 2EJ7A 4JTCB 3X2QC 5IJ0A 4RUFA 1XHXA 3CRQA 2PI4A 3I56V 2M6YA 2F4VB 3APQA 1PKXA 2HR3A 2IH1C 4DR5B 1WPBA 3THOA 1Q90D 2Q73A 4MVRA 4KUMA 4ZHQB 1A32A 1R1BA 4DV5O 1EBOA 2Q9LA 3KCXA 5LMNB 3A2FA 3CC7V 2P7TC 2AHYA 2BSKB 4UB8Z 3CXCU 2DYSC 1COWG 4X64B 3JASB 4CH5A 2BTQB 4DV1B 3H1KH 2VS0A 3ZHQA 4Z1VA 3SYOA 1N33O 4FIPC 4DYLA 3ZHUA 3BRCA 2E5LO 4PV1B 1N34B 5EK0A 1VQKV 3CRMA 4ZBMA 4FK5C 1NH2D 4F6RB 3SYQA 4WFEA 4X8AA 1K7DA 1SQPH 1OJHA 3SPIA 1ZUQA 1WJZA 4CBCA 5CBFA 1SS3A 1TAEA 2XAGA 3BEHA 5FPOA 5JCOC 1PNLA 1TUBA 1TVKA 1XEQA 2EULA 1Q5OA 4JI8O 1IBKB 1VF6C 1GRJA 4MTGA 2QKAA 1LNQA 3W7XA 2EBOA 3HKDA 4X66O 2DJVA 1GN4A 3AG7A 1R3JC 3LSUA 3ZRSA 3ZMUA 4NYKA 3BA8A 3HKEA 3FX7A 4CH3A 4DV3O 1RM1C 3ZHVA 4D6TH 4PA4A 1HNXB 5L3FA 1OCRB 1SQGA 4X89A 1RFYA 3RT3C 1BL8A 1G6UA 5KUKA 1KD1W 5FL7G 3B4SA 5KMGA 1AR5A 5DECA 2B1GA 4PELA 1MOFA 1BHAA 1RP3B 4UVAA 4LF6O 1YEWA 3D36C 1X59A 1AP5A 3B77A 3P30A 3OR7C 3M8AA 2K9PA 4GX1A 4MVZA 3VOUA 1S72V 1R6TA 3J80N 2A3QA 3HB3B 5CA0A 4EFBA 3CSXA 1QCEA 4MVMA 1Q3EA 3SJQC 4J10A 4PA6A 2RQ6A 1QHTA 3T1YO 5K1PA 5LGTA 2GV9A 3U11A 3R65A 3SR2C 3K79A 4J7KA 1KBHA 1BZKA 3HKBB 3FD9A 2PYJA 4X1KB 1B06A 1IBLO 5JQGB 4OPAA 1P4RA 2F43G 2V7QG 3U10A 1OZ0A 2LGWA 3SYCA 2CTWA 2AW9A 4IHJB 3QF7A 4PHZA 4TOIA 4U7NA 2QWRB 4U3FH 2B9ZA 1H8HG 4CH4A 2IH3C 2QGNA 2BTOA 1YTFD 4K8XA 4X1IB 4R8CA 2P67A 4B08A 3JD2A 3JALB 3ABTA 1GM9A 1PNMA 3SPGA 5IJ9B 1OCCC 5L3BA 4LNUB 5LP6C 2WLHA 3BA9A 3RW0A 4DV4O 1EZJA 3K57A 4QNHB 2V4DA 5LXTB 5HFLA 1VQ7V 5JJJB 5CN0A 2JIZG 2QSAA 3E35A 1W59A 5EYPA 1FYJA 1XNQB 4DV3B 3RYFA 3L71H 1RSOB 4LP8A 1CXZB 1V9PA 3JAKA 2ZXWB 4X88A 3U0ZA 1N36O 4BW9A 4IYHA 1ROPA 1XUQA 3CCJV 4LF7O 4LWSA 5BR8O 2WLKA 1CP9A 4HAMA 1V54B 1VQOV 2QTOA 4H0LB 2YIBA 4IIJA 4I50A 2E76B 3VQXA 2YXLA 1QVFU 1F23A 4LF6B 5KLVH 5IYZB 2HJDA 5IY5B 1Q86W 2ZQMA 2UXBO 1NVPB 1JJ2U 3C3TA 4NTXA 1VQ8V 4FFKA 2XAFA 2E75B 5A2QN 2UXDO 5L3GA 2DOSA 5B1BB 3G4SV 4YJ3B 1N0JA 3J7AU 4WFHA 4WBNA 2M7WA 4UCSA 3TCUA 3QO7A 4ZI7B 3LNNA 2CUGA 1GN6A 4JI1O 1O9GA 3C90A 2GUZB 5KHGA 3RBZA 4TUYB 1JCHA 2IJKA 4FZ0A 4MVSA 1IBLB 2A9HA 5E1AC 3UT5B 1M93A 2OTJV 5LA6B 4PD4F 4QPJA 1VQLV 2IW5A 2F93B 3LNMB 1I94O 2EIKC 3L74H 4LH7A 1VQ4V 4I4TA 3N27A 3BAAA 5B3SC 4DRXA 1NBMG 3CHXA 4JYYA 1K97A 4JI4O 4PI2A 2N04A 4TWKA 4P2ZA 4CH6A 4J42A 2UUAO 1FJGO 2ZE7A 4DV4B 1V55C 2OYQA 2NLJC 3K9AA 3G6EV 2C2AA 2WLNA 2Q8VA 3F5WC 4HYOA 2XAQA 3A0RA 3G67A 2PY5A 3ZIAG 2Z5UA 2UXXA 2KKWA 4CS3A 3OTOO 5LMUO 2K1EA 4EB6B 5BMVB 4U3JB 3WB0A 5LGUA 3IGAC 4LF5B 3ZRVA 1YJ9V 4LF9O 1N36B 3JD0A 2QM4A 1QBZA 4LF7B 4J41A 3CWBH 5BR8B 2EIMB 2RDCA 2ZNIA 1NR1A 1TA8A 2DYRC 1GAXA 3K0GA 4R50A 2D2CB 4O2BB 3JCZA 1IXBA 2R72A 2YXHA 4YJ2B 4O4JB 2ZKOA 3FB8C 4AQYO 2OIEA 1FXKB 3S3XA 1ZAUA 2UXBB 2ETNA 2YEVA 4IL6Z 3DXRB 4J9ZB 4FM2A 2CAZC 4DUZO 2E3CA 4BW5A 2A7WA 2JDIG 4GX5A 2UXDB 4YHHO 3ZX6A 5JH7B 1N32B 3T4ZA 4TV8A 1S3JA 4B3SO 4JI1B 3CRAA 3LDEA 3X2QB 5LYJB 1AROP 5IYCO 5C93A 2Y4TA 4PA3A 3E22B 3E89A 1NT2B 3RFRA 2P4KA 3JAMN 4U7OA 1RPRA 5H6RA 4EFEA 2AGAA 3N2GA 1Q8IA 2WLIA 5LOVB 2QA4V 4K8ZA 1MNGA 3JATA 1Z5VA 3B2EE 2QWOB 1I94B 1GM7A 3CRCA 3JSNA 1PPJH 4QE9A 2DYSB 1Y66A 4DV7O 1PNKA 4C7UA 1VQPV 4X1YB 4O4HA 2JVDA 2PGGA 4UVCA 2KG7A 3OGCC 1SF9A 4WFFA 3K5MA 3ETDA 2UUAB 1K8AW 2HHHO 5E79Z 3UM7A 1FJGB 4ABMA 1YSCA 1Y76B 2HFEC 4NTWA 5CB4A 1U97A 1PL4A 3DGEA 1NTZH 4EEQA 5B1AC 1BCCH 1SESA 1IDSA 3CCRV 3H1JH 3K08A 3CC4V 2Q7GA 3AG4C 3K0DA 4NB5A 1AI6A 3HKCA 3OTOB 1OHHG 5LMUB 4LF4O 4DV2O 4LFCO 5H9CA 3B09A 3RGBA 1F4NA 2WWWA 4PA9A 1IXMA 2OCHA 4JI7O 3FB7C 2Q6AA 2OCCC 1I7FA 4NKGB 1XOUA 4JZ2A 5GONA 4B3TO 1GKFA 1BQZA 1RM1B 1YJWV 3RYIA 1KU9A 4FFBA 4EKWA 1K92A 2KB1A 1WB7A 2BCCH 2Y69C 4GUNA 2F66C 1YZBA 4AQYB 1S77D 1QLEC 4GX0A 5FNVB 4UFZA 3W7UA 2X6CA 1M4UA 3F7YC 4O4LA 3CMAV 3F5TA 2P5OA 1XDCA 1NTKH 4DW1A 4YHHB 3WB2A 4FLZA 1VARA 2ILMA 3SJAC 4FVMA 3H01A 4B3SB 1SKVA 1UJWB 2YIBD 4PDMA 2JGUA 1Q82W 4KXRA 4MT8A 3SPHA 1VEWA 1SA0A 2DQ3A 5ITZA 2Y0IA 3E8HA 1H2SB 2LW1A 3H1LH 4YIPA 4LH6A 3O65A 4TSFG 1SETA 1F4MA 3AK2A 3ETEA 2OT5A 3ETQA 3JSLA 4NVPA 3RYCA 3W7WA 1H2MA 1HNZO 1K9MW 4H33A 2ZD9A 1UFIA 3R66A 1K5QA 3PJSK 3SJCC 1PL0A 5KAIZ 1M56C 5B1NA 1M1KW 3KG2A 5J2UB 4DV7B 5EZYA 5LHIA 3ZHTA 3K03A 2LP7A 1M5IA 3GVMA 2DW4A 1BT8A 1ZL8B 4YY3O 4H44B 3L72H 1NZ6A 2HHHB 2LO1A 3CS5A 2CH7B 3MD0A 2GDSA 2ZINA 3LDCA 5GTHZ 4JI5O 3ZCCA 1NU1H 3CJHB 1KQSU 4CS2A 4ZIBA 1XREA 1Q6UA 4RO2A 3Q4HB 2QKCA 4RQFA 5KHHA 1H2NA 5J2TB 1OCCB 3ABLC 3LUTB 4O4IB 5LP6B 1JFFB 3T1CA 4UVBA 3ZRWB 2YSUB 1Z2GA 4FLXA 3ABUA 2W6IG 4LF4B 1XNRO 4DV2B 2HKOA 4I9WA 2WLLA 3SYPA 1AI5A 5CA1B 4O2AB 1ENVA 1VP7A 1M90W 4HZ3A 4KFMA 4GCZA 3ZHRA 2UUBO 4WFAV 2QR4A 5KHKA 4JI7B 5A9GA 2L6LA 5GW7A 1FD9A 4NXNO 1PD3A 3AG2C 4AILC 2UU9O 2HVJC 2XAJA 4B3TB 2XTAA 1EFRG 5IYBO 1Y74B 4N23A 4BR6A 2EINC 3SGIA 1KB9F 5H5NA 1IBMO 4OXSA 2IJJA 3H1IH 3CEIA 3E8FA 4FMTA 1WN7A 1MMMA 4X20A 1QLNA 5JVDA 2ZIOA 1H2LA 2O57A 3UKMA 2A0LA 4K0KO 1JOYA 1SERA 2HG5C 4MVUA 4GKKO 4U3JA 4I55B 1EN4A 4P9OA 3H1HH 2CGNA 2JJ1G 1B6QA 3RVYA 2GTSA 4UCRA 4ZOLA 2EILC 4DV5B 1QU7A 1GN2A 1FS0G 2IU0A 2F23A 4JZGA 3AEIA 1QNMA 2YUAA 4WFBV 5J9PC 1EZVH 2YIDA 1R3IC 3JARA 4GZRB 1WA8B 3N2KB 3CCMV 2JGDB 3VBBA 1WLEA 2YS8A 1L1FA 1N33B 1NI8A 5IE9A 3ZN1A 4PDRA 4HNAB 3UQ8A 2E5LB
chains in the Genus database with same CATH topology
4XDJA 3LNMB 4XDKA 2CK3G 2Y48A 2EIKC 2HJFC 2JEXA 2Z3YA 3WG7C 2HLDG 5EBLC 1XL4A 1VQ4V 3OE7G 1R6NA 3AG1C 2ITCC 3OW2U 5EBMC 5B3SC 2X0LA 3STLC 2FTKA 1NBMG 1K97A 4JF3A 1QR8A 4TWKA 4P2ZA 3IC7A 4UUJC 2JK5C 1K4DC 2IJHA 1J95A 2BOCC 4JPRA 5IYDO 1MG1A 2EIKB 1AJNA 4BIZA 4G2KA 1V55C 3WG7B 2NLJC 3D3IA 4FPPA 1M57C 3K9AA 3AG1B 3E86A 3G6EV 2C2AA 2WLNA 3CMEV 3F5WC 1NQTA 1KECA 1OCOC 5B3SB 2NNUA 4RAIA 4HYOA 2XAQA 2PI5A 1RPOA 3I55V 2QEXV 3TETA 3AG3C 2XOKG 3A0RA 4JYCA 3ZIAG 2Z5UA 2EIMC 2JJ2G 2UXXA 3GWOA 3LDDA 1H8EG 4MSWC 4DXWA 5H6QA 1V55B 2K1EA 2UXNA 1M57B 3SPCA 5LGUA 2WAMA 3IGAC 1OCOB 2YEVB 3ZRVA 1YJ9V 2JEUA 3JD0A 4GT1A 2R9RB 1YJNV 2GHYA 1QBZA 2QM7A 3AG3B 1YTFB 3TK1A 1I5XA 1FXKC 2EIMB 3JD3A 1JX9A 2P6JA 5L3DA 2W6JG 3ABMC 1NR1A 3ZMSA 1CEZA 1KC8W 2DYRC 2BOBC 3K0GA 4R50A 5LBQA 4WFGA 3FB6C 3JCZA 1WPXA 2ZR2A 3T2MA 2D3OW 2QM8A 3OEEG 4FJCC 3FB8C 2IJIA 1FXKB 1S5HC 2IU3A 4JTCB 4H37A 1NR7A 1CPYA 4LCUC 4MW3A 3ABMB 2YEVA 1FFTB 4MVQA 3X2QC 1BMFG 1R6KA 4J9ZB 4RUFA 2WLIB 2PI4A 4BW5A 2DYRB 3CCLV 3I56V 2JDIG 4GX5A 1QR9A 3STZC 4JASA 4MS2A 1PKXA 2HR3A 2EZPA 1H2GA 3OMIB 2IH1C 3T4ZA 1FXVA 1S3JA 4MVRA 1G8MA 4KUMA 1K3EA 3X2QB 3LDEA 1W0KG 3SYAA 2X7RB 1AROP 5IYCO 5C93A 4KP4A 1EBOA 1GMGA 5LHHA 2DWEC 3CC7V 4GX2A 1K73W 4BAYA 2P7TC 2AHYA 4PA3A 3CXCU 3E89A 2DYSC 1COWG 5LGNA 3G71V 1FXKA 1VQ9V 1S76D 3OEHG 4U7OA 1RPRA 5H6RA 3NXSA 2WLIA 3SYOA 2H8PC 3W7TA 2XASA 2QA4V 3DTUB 4FIPC 4G28B 5IDJA 5EBWC 2V1DA 1KP2A 5EC1C 3CPWU 1GM7A 5EK0A 1SRYA 1VQKV 4ZBMA 4QE9A 4FK5C 2X6BA 2DYSB 3FB5C 5CBHA 1NH2D 1Y66A 3CC2V 1PNKA 3SYQA 5B1OA 3ASOC 1VQPV 2Q67A 4WFEA 4X8AA 2EIJC 1K7DA 4UVCA 1G4YB 3SPIA 3OGCC 1MABG 3ETGA 4WFFA 4CBCA 5CBFA 4WF9V 3ZRXA 2Q68A 2XAGA 3B8NA 3BEHA 5CMUA 3FYEB 4E2LA 2B1IA 3ETDA 1HWYA 1PNLA 1N8RW 1JVMA 1K8AW 3FKSG 3UM7A 1M9NA 3QO8A 4MTGA 1YSCA 3LSSA 2HFEC 4P9PA 3E83A 3JYCA 1LNQA 5LHGA 2WPDG 2LFSA 1DLBA 1OCRC 2EZOA 3ASOB 3DGEA 4MTOA 3W7XA 2EBOA 2EIJB 5B1AC 4JGSA 1R3JC 4LBEC 4F4LA 1SESA 4YXWG 3ZRSA 3ZMUA 3CCRV 3K08A 2W0FC 1F51A 3CC4V 1DF4A 3AG4C 3K0DA 1AI6A 3QO5A 4ZKIA 1RM1C 1OHHG 4QIWF 1VQ6V 4PA4A 5H9CA 3CCEV 1GK9A 2WSSG 3OFNG 1K5SA 1OCRB 2A79B 1F4NA 4RUEA 5L3FA 2WWWA 3ABKC 4JTDB 2Q69A 4PA9A 1IXMA 4X89A 5B1AB 2AHZA 1BL8A 3P32A 3JD1A 4JAUA 3FB7C 2Q6AA 4JTAB 5KUKA 1KD1W 2OCCC 3AG4B 5FL7G 1GKFA 5KA6A 1RM1B 2B1GA 1YJWV 3CP1A 1KKDA 4PELA 4Q20A 1MOFA 1MSWD 1BHAA 2XNDG 4UVAA 1E1QG 1VQMV 2HVKC 3ABKB 2DWDC 4EKWA 1K92A 2KB1A 2DQ0A 3ZJZA 2WLJA 4UXNA 2Y69C 4QE7A 4XBFA 1JPXA 1NKDA 1SZTA 3CCUV 3B77A 3P30A 3OR7C 4JAVA 1S77D 1QLEC 4GX0A 1GM8A 4GX1A 4MVZA 3VOUA 1S72V 3HB3B 3W7UA 1QCEA 2X6CA 1E79G 3ASNC 3EFFK 3F7YC 1W0JG 3M99B 2GSMB 4MVMA 4PDVA 3CMAV 1THZA 3SJQC 3LSQA 4UV9A 4BIUA 1AJPA 2P90A 3ZN0A 4PA6A 1VQ5V 3CCVV 2OTLV 2Y69B 5LGTA 1AR1B 3RVZA 3R65A 1QVGU 5KUMA 3H01A 3K79A 1K4CC 1QLEB 1UJWB 4PDMA 4R7CA 3T4DA 1Q82W 4MT8A 3SPHA 3ASNB 2DQ3A 3F7VC 4LC1A 3CCQV 3E8HA 1R3LC 1GO3F 1P4RA 2F43G 2V7QG 1OZ0A 2EJRA 4JYBA 2XAHA 4TSFG 1E1RG 1AI7A 4N21A 1YI2V 3SYCA 3MHSC 3OUSA 1SETA 1F4MA 1H38A 4RQEA 3ETEA 2OT5A 1NJIW 4L87A 3K04A 3W7WA 4U7NA 2X6AA 1YIJV 1YITV 4PA7A 1K9MW 4ASUG 4H33A 3OR6C 4G27B 1OCZC 1H8HG 2ZD9A 1K5QA 2IH3C 3D36A 2MK3A 3PJSK 1Q7YW 1PL0A 3HPLC 1M56C 5B1NA 3K06A 1W2BU 1M1KW 5DN6G 1YTFD 3KG2A 4R8CA 2P67A 5L3CA 5LHIA 3K3WA 3GB7C 2WLLB 3JD2A 3ABTA 1GM9A 3K03A 5EC2C 1PNMA 2LP7A 3SPGA 5CA3A 1OCCC 5L3BA 2DW4A 4CZZA 1P7BA 2ATKC 3ML0A 4WCEV 2WLHA 1OCZB 4TT3G 4QJFB 3RW0A 3E8GA 3B8MA 2ZR3A 3MD0A 1M56B 2B5UA 1NVPD 3LDCA 1EZJA 4QNHB 4XDLA 3ZMVA 3ZCCA 3MHHC 3ZMZA 1KQSU 2ZXWC 5HFLA 1VQ7V 4MTXA 4RO2A 5CN0A 2JIZG 3CCSV 3E35A 2ZDIC 3JD4A 4RQFA 5KA5A 1OCCB 3OAAG 3ABLC 1K33A 3BY6A 4DO2A 1KP3A 1ORQC 3LUTB 4UV8A 3T1CA 4UVBA 3ZRWB 2YSUB 1DTOA 1V54C 3ABUA 2W6IG 2HKOA 4I9WA 2WLLA 5BZBA 4LP8A 3SYPA 5HFMA 1K34A 1AI5A 2ZXWB 2QE7G 1ENVA 4X88A 1M90W 4HZ3A 4KFMA 4GCZA 3CD6V 4WFAV 1ROPA 5CBGA 2QKSA 1NH2B 4J9YB 3CCJV 5GW7A 1ZWIC 5IY5C 3ABLB 1PD3A 3AG2C 2WLKA 2HVJC 1AI4A 1CP9A 2R9IA 2XAJA 4HAMA 5DM6V 1EFRG 1V54B 4Z1MG 1VQOV 1S0VA 1R73A 4P30A 5IYBO 1I5YA 2QTOA 4N23A 2ITDC 3OM3B 2EINC 4OXSA 3E8BA 5B1BC 1QVFU 2IJJA 2OCCB 1F23A 3E8FA 4FMTA 3ZRWA 3WFVA 5IY5B 4QPKA 1Q86W 1QLNA 5L3EA 3W7SA 1XL6A 2ZQMA 3AG2B 1NVPB 3FYIB 3ZMTA 1JJ2U 3UKMA 1JOYA 2A0LA 1SERA 2HG5C 2EINB 1VQ8V 4MVUA 2XAFA 3OMAB 2ZDIA 1FXHA 4P9OA 5L3GA 5B1BB 3G4SV 2WLMA 3SPJA 2LFRA 3OMNB 2JJ1G 4MVOA 1B6QA 3RVYA 4WFHA 2M7WA 1DF5A 2EILC 3TCUA 3QO7A 4MW8A 1GTOA 1FS0G 3CYOA 4R6ZA 2IU0A 3OUFA 3AEIA 3RBZA 1Q81W 4WFBV 5J9PC 1JCHA 1YHQV 1VQNV 2IJKA 1R3IC 1JQ0A 3IFXA 3QNEA 4MVSA 2A9HA 3CCMV 3VBBA 5E1AC 3EHBB 1WLEA 4I5SA 4PDLA 1L1FA 1TUEB 2OTJV 2H94A 1Y4MA 1R3KC 2EILB 4MTFA 3ZN1A 4PDRA 1BHBA 3E2EA 4QPJA 1VQLV 1AJQA 2IW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  1DF4 A;  3B8N A;  5KA6 A;  5CMU A;  4G2K A;  3M99 B;  4E2L A;  5CN0 A;  2EZP A;  3CP1 A;  3K9A A;  5KA5 A;  1MOF A;  4FIP C;  1JQ0 A;  1K33 A;  4N21 A;  2LP7 A;  3MHS C;  1QBZ A;  4FJC C;  5H9C A;  1I5Y A;  2X7R B;  4N23 A;  1EBO A;  1DLB A;  1I5X A;  2OT5 A;  2EZO A;  4FK5 C;  3H01 A;  4JF3 A;  1QR8 A;  1JPX A;  1Y4M A;  2P6J A;  1Y66 A;  2EBO A;  1SZT A;  3B8M A;  1K34 A;  3B77 A;  3P30 A;  5HFM A;  4JGS A;  2M7W A;  1ENV A;  1F23 A;  1DF5 A;  3GWO A;  2MK3 A;  3MHH C;  1QR9 A;  4JPR A;  3WFV A;  1QCE A;  3CYO A;  5HFL A; 
#chains in the Genus database with same CATH topology
 4JI2 O;  1HNZ B;  2BE3 A;  2CK3 G;  4DV6 O;  3WG7 C;  2HLD G;  5EBL C;  3K5N A;  1XL4 A;  1R6N A;  3AG1 C;  1L0N H;  2ITC C;  3CXH F;  1AP6 A;  2FB5 A;  3OW2 U;  4J7Z A;  5EBM C;  1SQX H;  1YCI A;  5DED A;  2YC0 A;  2AXT Z;  5C8Y B;  3P3P A;  4JI8 B;  4JF3 A;  1UPG A;  3IC7 A;  3TXQ A;  5KX5 B;  2JK5 C;  4YY3 B;  1D2D A;  4I0X A;  1FFX A;  1EN6 A;  2EIK B;  1AJN A;  2Q4P A;  4G2K A;  4X66 B;  3D3I A;  1EN5 A;  4FPP A;  1M57 C;  4JI5 B;  4Z2W A;  5B3S B;  4RAI A;  3T1H O;  3TET A;  1VF7 A;  2XOK G;  3OT7 A;  4DR6 O;  2G38 A;  2RNB A;  3RN4 A;  3JAW B;  5D5P A;  2QDO A;  1V55 B;  1XNR B;  2UXN A;  1IVS A;  1KUQ A;  5IJ0 B;  2UUB B;  2PF4 E;  4GT1 A;  2R9R B;  4QGP A;  5LL6 Y;  1IZ3 A;  4NXN B;  1I5X A;  2UU9 B;  1JX9 A;  5L3D A;  3ABM C;  3ZMS A;  1KC8 W;  1IBM B;  3FB6 C;  1WPX A;  2ADQ B;  3TJT A;  2YIC A;  2D3O W;  1Q6H A;  2QM8 A;  4D7S A;  3OEE G;  3KZI Z;  2IJI A;  4NR1 A;  1S5H C;  4DR3 O;  3SDL A;  4H37 A;  1NR7 A;  2Q7H A;  1JMK C;  1FFT B;  1BMF G;  4GKK B;  2DYR B;  3T1Y B;  4MS2 A;  3ZS8 C;  1PV0 A;  2VQE O;  2EZP A;  3OMI B;  1HR0 O;  1VIB A;  1FXV A;  1HP8 A;  4TV9 A;  2E74 B;  5JWP A;  1W0K G;  3SYA A;  2X7R B;  4YIO A;  1GMG A;  4BAY A;  1TUB B;  1TVK B;  3G71 V;  4I7Z B;  1S76 D;  2ZE6 A;  1IUR A;  2H8P C;  2JS3 A;  4NXM O;  3DTU B;  3HKD B;  5AG2 A;  4JI2 B;  1BSM A;  5EC1 C;  1KKC A;  2YI9 A;  3KKY A;  4DV6 B;  2ODM A;  3HKE B;  4Q6G A;  3CC2 V;  2GTA A;  3ASO C;  5B1O A;  2Q67 A;  4ZHQ A;  2EIJ C;  4B3R O;  2AZ0 A;  4LFA O;  4CC6 A;  4WF9 V;  3ZRX A;  2Q68 A;  3B8N A;  1S5L Z;  2YXY A;  3FYE B;  2B1I A;  2EX3 A;  2FML A;  2BSK A;  1XI1 A;  3M7M X;  1D5N A;  3FKS G;  3JAS A;  2BTQ A;  3LSS A;  1WP8 A;  1JA8 A;  2Q0O C;  3JYC A;  4P9P A;  2WPD G;  2LFS A;  5KMG B;  1XMO O;  3GWK C;  2ARH A;  3NR7 A;  3K5L A;  3T1H B;  4LBE C;  4UCT A;  4B7E A;  4DR6 B;  1F51 A;  2LGQ A;  1DF4 A;  4GKJ O;  4F6R A;  3QO5 A;  4LF8 O;  1HDJ A;  4HBN A;  4QIW F;  1N0N A;  1VQ6 V;  4H13 B;  1GK9 A;  3CCE V;  1K5S A;  2A79 B;  3ABK C;  4JTD B;  3L9D A;  5B1A B;  4DR4 O;  5JJN B;  4A5U B;  3P32 A;  3JD1 A;  3O9O A;  4JAU A;  5BXZ A;  1T5E A;  3BFR A;  4E4E A;  4JTA B;  3ZBH A;  3AG4 B;  1HW7 A;  4TQF A;  4AHC A;  3FAV B;  1B3Q A;  3EXA A;  4D7T A;  1MSW D;  1E1Q G;  1VQM V;  2AZ2 A;  1PM9 A;  3ZJZ A;  4B3M O;  4DW0 A;  1XIL A;  1NKD A;  1JFF A;  4UCU A;  1E79 G;  3ASN C;  2GSM B;  4PDV A;  2Q7E A;  1THZ A;  4JI0 O;  3LSQ A;  4BIU A;  1AJP A;  2P90 A;  3ZN0 A;  1VQ5 V;  5BY1 A;  3VQW A;  4FLY A;  2VQE B;  3CCV V;  2F4V O;  1HR0 B;  2Y69 B;  3K5O A;  3RVZ A;  1QLE B;  3T4D A;  4DR5 O;  2QWQ B;  1BQ0 A;  1GO3 F;  1MZE A;  4CC5 A;  2IBZ H;  2EJR A;  1OV9 A;  4DK1 A;  2W0X A;  4JYB A;  2XAH A;  5H2F Z;  1AI7 A;  4N21 A;  1YI2 V;  2UUC O;  3MHS C;  3OUS A;  3CX5 F;  2JS5 A;  1H38 A;  4B7K A;  4X64 O;  4RQE A;  4DV1 O;  5KAF Z;  4NXM B;  4L87 A;  2X6A A;  1YIT V;  4PA7 A;  5K1X A;  1LR1 A;  4G27 B;  1OCZ C;  5EYP B;  1Q7Y W;  2MK3 A;  3HPL C;  1MA1 A;  1XMQ O;  3K06 A;  4JI4 B;  2UXC O;  5JJE B;  3RYF B;  1N34 O;  5L3C A;  3HKB A;  4B3R B;  3K3W A;  2YIA A;  3JAK B;  3DSQ A;  5CA3 A;  4X1K A;  1URF A;  5JQG A;  4WCE V;  4TT3 G;  4QJF B;  3E8G A;  3B8M A;  2ZR3 A;  1M56 B;  4LWS B;  4IGG A;  4XDL A;  3ZMV A;  3MHH C;  1IBK O;  4X9Q A;  5IT9 N;  3IAY A;  2FYU H;  4IHJ A;  4MTX A;  4IIJ B;  3CCS V;  3JD4 A;  5KA5 A;  1K33 A;  1X4T A;  1KP3 A;  3JCU Z;  1ORQ C;  4UV8 A;  4GKJ B;  2GBO A;  4LF8 B;  4X1I A;  4AI8 A;  4LF9 B;  1SC5 B;  3JAL A;  3IC9 A;  1GN3 A;  5BZB A;  5IJ9 A;  4OPH A;  4LNU A;  5CBG A;  3L73 H;  4DR4 B;  2QKS A;  1NH2 B;  1PP9 H;  2R9A A;  1Z5W A;  4DR7 O;  3ABL B;  3BPZ A;  3SJB C;  2N05 A;  2R9I A;  5DM6 V;  4WBN B;  3BVO A;  4Z1M G;  1S0V A;  5LXT A;  3QTC A;  2PZS A;  1I5Y A;  4TQD A;  2ITD C;  3OM3 B;  4JV5 O;  2CTQ A;  3E8B A;  1EM1 A;  2OWO A;  4KHP O;  1I08 A;  4W4L A;  1RSO A;  4DUZ B;  3AG2 B;  3FYI B;  3A0H Z;  3ZMT A;  1KYO F;  2Q0A A;  4FLU A;  5KHJ A;  2EIN B;  1DGS A;  2VQF O;  2KSD A;  4DV0 O;  2ZDI A;  3CE2 A;  1XHZ A;  4JI0 B;  1DK1 A;  2QJ1 A;  3DC5 A;  2WLM A;  2LFR A;  3OMN B;  1YVW A;  2IM9 A;  5FLX N;  1DF5 A;  1P49 A;  4I4T B;  3CYO A;  4R6Z A;  4DRX B;  2XUM A;  2ZNJ A;  3J81 N;  5IWA O;  1YHQ V;  1VQN V;  4X62 O;  1JQ0 A;  3P3N A;  3QNE A;  3RWR D;  5IYZ A;  4DR2 O;  2YDE A;  2ZIM A;  1IX9 A;  4PDL A;  1TUE B;  2RMK B;  1Y4M A;  2P06 A;  2UUC B;  2EIL B;  4L8J A;  3BCC H;  4PJ0 Z;  2CGO A;  4XDK A;  4YJ3 A;  4JI6 O;  2HJF C;  2WA4 A;  4ZI7 A;  1XMQ B;  2UXC B;  1BGY H;  1KMI Z;  3STL C;  2FTK A;  1JR9 A;  2GUZ A;  3OGI B;  4TUY A;  3HR0 A;  1QQC A;  2IJH A;  1J95 A;  2BOC C;  1SQV H;  4JPR A;  3UT5 A;  1HNW O;  2N74 A;  4BIZ A;  3WG7 B;  2Y0P A;  3AG1 B;  5LA6 A;  3CME V;  1KEC A;  1OCO C;  2NNU A;  1RPO A;  2QEX V;  3AG3 C;  4JYC A;  4LFC B;  1O9H A;  3GWO A;  5H6Q A;  4K3A A;  1M57 B;  1NS1 A;  3SPC A;  1XNQ O;  3I5D A;  2LQT A;  1US6 A;  2YEV B;  2JEU A;  1YJN V;  3A0B Z;  1D5A A;  1YTF B;  4DR7 B;  1NTM H;  2VRZ A;  2P22 C;  2W6J G;  2Z0A A;  4UB6 Z;  1P7G A;  4TV8 B;  4JV5 B;  2BOB C;  3K58 A;  4UCO A;  1J5E O;  3T2M A;  2Q5Z A;  1AVM A;  4KHP B;  2A06 H;  1LUV A;  2QTS A;  2ZT9 B;  4EB6 A;  4J11 A;  5BMV A;  2IU3 A;  4LCU C;  1CPY A;  4MW3 A;  4MVQ A;  3ABM B;  1R6K A;  3N2G B;  2WLI B;  4IYI A;  4JI3 O;  4FLV A;  2VQF B;  3CCL V;  4DV0 B;  4LFB O;  1QR9 A;  3STZ C;  4JAS A;  3RYH B;  3JAT B;  2CTR A;  2YI8 A;  2KQX A;  1H2G A;  1Y67 A;  4BIO A;  1G8M A;  1YDX A;  1K3E A;  4O4H B;  3FAV A;  4O2B A;  4ICG A;  2KG7 B;  2Y4U A;  5IWA B;  4KP4 A;  5LHH A;  2DWE C;  4YJ2 A;  4X62 B;  4GX2 A;  4O4J A;  1K73 W;  4DR2 B;  1ZTE A;  5LGN A;  1FXK A;  4FZ1 A;  1VQ9 V;  3OEH G;  3H9V A;  3DXR A;  5GTI Z;  5CB4 B;  1AIL A;  3B40 A;  3NXS A;  1VMG A;  2H3O A;  2QWP B;  3W7T A;  2XAS A;  3UCS C;  4G28 B;  5IDJ A;  3UO2 A;  5EBW C;  2V1D A;  1KP2 A;  3CPW U;  5JH7 A;  2CTP A;  4JI6 B;  1SRY A;  2X6B A;  5CBH A;  3FB5 C;  3UO3 A;  3HKC B;  2PTM A;  4GLX A;  1G4Y B;  5LYJ A;  1U96 A;  1MAB G;  3ETG A;  4JAA A;  1S5J A;  1XQ8 A;  1MZF A;  4W4K A;  5CMU A;  4E2L A;  3AK1 A;  1HWY A;  4F6E A;  3E22 A;  1N8R W;  3EVK A;  1JVM A;  1GH6 A;  4OGQ B;  2HEP A;  1H2K A;  1M9N A;  3QO8 A;  1TGO A;  4OX9 O;  1HNW B;  3E83 A;  5LHG A;  5GON B;  1DLB A;  1OCR C;  5LOV A;  2EZO A;  3ASO B;  4MTO A;  2EIJ B;  3RYI B;  4JGS A;  1WAZ A;  4F4L A;  4YXW G;  2W0F C;  2LJ2 A;  4FFB B;  4X1Y A;  4ZKI A;  3OTF A;  4NTY A;  3APO A;  3G6B A;  2WSS G;  3OFN G;  4RUE A;  2ZE5 A;  2DMX A;  2Q69 A;  2FL4 A;  4O4L B;  2AHZ A;  4LF5 O;  3MDS A;  2XHB A;  1Y76 A;  1P84 F;  5KA6 A;  3CP1 A;  1KKD A;  4DUY O;  4Q20 A;  2XND G;  1J5E B;  5JCO A;  2HVK C;  3ABK B;  1SA0 B;  2DWD C;  5ITZ B;  3MAQ A;  2DQ0 A;  2WLJ A;  1VF6 A;  3L75 H;  4FM0 A;  4UXN A;  4QE7 A;  4XBF A;  2RN9 A;  1JPX A;  4K0K B;  1SZT A;  3CCU V;  4JAV A;  1GM8 A;  2ZM6 O;  2R70 A;  2FKX A;  3G80 A;  1MSD A;  3EFF K;  4JI3 B;  1W0J G;  3M99 B;  3L70 H;  3RYC B;  4LFB B;  3VQY A;  4UV9 A;  5EIB D;  3K59 A;  2OTL V;  1AR1 B;  4JYA O;  1QVG U;  3WU2 Z;  3QVN A;  5KUM A;  1K4C C;  1WP7 A;  5EZY B;  1JJO A;  1N32 O;  4R7C A;  3IJ4 A;  3ASN B;  2RJZ A;  3F7V C;  4LC1 A;  3CCQ V;  3VQV A;  1R3L C;  3TGU H;  3C3S A;  5FNV A;  1E1R G;  4RWU A;  2WA3 A;  2XT9 A;  2MW2 B;  5KHI A;  1N4C A;  1NJI W;  3CRR A;  3K04 A;  1G1X B;  1YIJ V;  4ASU G;  3OR6 C;  2CE4 A;  5EIB C;  3D36 A;  4I9Q A;  1W2B U;  5DN6 G;  2F1M A;  4UCV A;  1I0H A;  3D8C A;  2RCV A;  3K9S A;  2CDY A;  2WLL B;  3GB7 C;  5EC2 C;  2F95 B;  5B5E Z;  4DK0 A;  4CZZ A;  1P7B A;  2ATK C;  4DR1 O;  1WB8 A;  3ML0 A;  1FPO A;  1ZSP A;  1OCZ B;  3BAB A;  4OX9 B;  2B5U A;  1NVP D;  2ADP A;  2HP8 A;  2NN4 A;  3ZMZ A;  1YXB A;  2ZXW C;  1FKA O;  1YF2 A;  2ZDI C;  3ICX A;  3OAA G;  2ZCE A;  3BY6 A;  4DO2 A;  1AR4 A;  4X65 O;  3AK3 A;  5J2U A;  1DTO A;  1V54 C;  5CA0 B;  4X20 B;  5JVD B;  1LUW A;  5HFM A;  1K34 A;  1VF5 B;  2QE7 G;  3CD6 V;  1ZL8 A;  2QWN B;  2P4V A;  3S3W A;  5F2V O;  4J9Y B;  2CH7 A;  1ZWI C;  3A8T A;  5IY5 C;  3OD4 A;  3CJH A;  1AI4 A;  1R73 A;  4P30 A;  4ZOL B;  3Q4H A;  4DUY B;  4FLW A;  5J2T A;  5B1B C;  2OCC B;  4O4I A;  5LP6 A;  3JAR B;  2L35 A;  4DR3 B;  3ZRW A;  4KL1 A;  5TIS Z;  3WFV A;  1B04 A;  4QPK A;  3QG5 A;  5L3E A;  3W7S A;  1XL6 A;  2ZM6 B;  5CA1 A;  4O2A A;  1FAF A;  3OMA B;  1FXH A;  1WNS A;  3SPJ A;  4MVO A;  3ZHS A;  3DC6 A;  4JYA B;  1Y74 A;  4MW8 A;  1BE3 H;  2NR5 A;  1GTO A;  3OUF A;  1XBL A;  1Q81 W;  4J7J A;  5LMN O;  1Y6X A;  3IFX A;  4CS4 A;  3EHB B;  4I0X B;  4I5S A;  1FFX B;  2H94 A;  4IT5 A;  1R3K C;  4MTF A;  1BHB A;  3E2E A;  1AJQ A;  4I55 A;  4XDJ A;  2OIG A;  2Y48 A;  2JEX A;  2Z3Y A;  3OE7 G;  4J80 A;  3RYH A;  4LFA B;  4FM1 A;  2X0L A;  1SQB H;  1AB3 A;  3WB1 A;  2LW7 A;  1QR8 A;  1WA8 A;  4LR3 A;  4UUJ C;  3N2K A;  2JGD A;  4DR1 B;  1K4D C;  5B66 Z;  3ZED A;  1ZX3 A;  5IYD O;  3D3Q A;  1MG1 A;  4GYC B;  3TXS A;  1XMO B;  3BHP A;  3E86 A;  4HNA A;  4I50 B;  1NQT A;  2PI5 A;  2ZE8 A;  3KCY A;  5FPR A;  3I55 V;  4K35 A;  2EIM C;  4X65 B;  1ZLZ A;  2JJ2 G;  2DE0 X;  3LDD A;  1H8E G;  4MSW C;  4DXW A;  4FLT A;  1L8D A;  5C8Y A;  2JRI A;  1BS3 A;  1HNX O;  2DN9 A;  2WAM A;  2PYL A;  1OCO B;  4PI0 A;  5KX5 A;  2PUS A;  1SQF A;  1SQQ H;  2GHY A;  2QM7 A;  2VWK A;  3AG3 B;  3CB2 A;  3TK1 A;  4BWA A;  1FXK C;  3JD3 A;  3PN1 A;  2P6J A;  3FFQ A;  1CEZ A;  5D5Q A;  1SZX A;  4TV9 B;  5LBQ A;  4B3M B;  1Q43 A;  1L0L H;  4WFG A;  2ZR2 A;  2VWJ A;  1Q6I A;  1F7Y A;  3JAW A;  4FJC C;  2EJ7 A;  4JTC B;  3X2Q C;  5IJ0 A;  4RUF A;  1XHX A;  3CRQ A;  2PI4 A;  3I56 V;  2M6Y A;  2F4V B;  3APQ A;  1PKX A;  2HR3 A;  2IH1 C;  4DR5 B;  1WPB A;  3THO A;  1Q90 D;  2Q73 A;  4MVR A;  4KUM A;  4ZHQ B;  1A32 A;  1R1B A;  4DV5 O;  1EBO A;  2Q9L A;  3KCX A;  5LMN B;  3A2F A;  3CC7 V;  2P7T C;  2AHY A;  2BSK B;  4UB8 Z;  3CXC U;  2DYS C;  1COW G;  4X64 B;  3JAS B;  4CH5 A;  2BTQ B;  4DV1 B;  3H1K H;  2VS0 A;  3ZHQ A;  4Z1V A;  3SYO A;  1N33 O;  4FIP C;  4DYL A;  3ZHU A;  3BRC A;  2E5L O;  4PV1 B;  1N34 B;  5EK0 A;  1VQK V;  3CRM A;  4ZBM A;  4FK5 C;  1NH2 D;  4F6R B;  3SYQ A;  4WFE A;  4X8A A;  1K7D A;  1SQP H;  1OJH A;  3SPI A;  1ZUQ A;  1WJZ A;  4CBC A;  5CBF A;  1SS3 A;  1TAE A;  2XAG A;  3BEH A;  5FPO A;  5JCO C;  1PNL A;  1TUB A;  1TVK A;  1XEQ A;  2EUL A;  1Q5O A;  4JI8 O;  1IBK B;  1VF6 C;  1GRJ A;  4MTG A;  2QKA A;  1LNQ A;  3W7X A;  2EBO A;  3HKD A;  4X66 O;  2DJV A;  1GN4 A;  3AG7 A;  1R3J C;  3LSU A;  3ZRS A;  3ZMU A;  4NYK A;  3BA8 A;  3HKE A;  3FX7 A;  4CH3 A;  4DV3 O;  1RM1 C;  3ZHV A;  4D6T H;  4PA4 A;  1HNX B;  5L3F A;  1OCR B;  1SQG A;  4X89 A;  1RFY A;  3RT3 C;  1BL8 A;  1G6U A;  5KUK A;  1KD1 W;  5FL7 G;  3B4S A;  5KMG A;  1AR5 A;  5DEC A;  2B1G A;  4PEL A;  1MOF A;  1BHA A;  1RP3 B;  4UVA A;  4LF6 O;  1YEW A;  3D36 C;  1X59 A;  1AP5 A;  3B77 A;  3P30 A;  3OR7 C;  3M8A A;  2K9P A;  4GX1 A;  4MVZ A;  3VOU A;  1S72 V;  1R6T A;  3J80 N;  2A3Q A;  3HB3 B;  5CA0 A;  4EFB A;  3CSX A;  1QCE A;  4MVM A;  1Q3E A;  3SJQ C;  4J10 A;  4PA6 A;  2RQ6 A;  1QHT A;  3T1Y O;  5K1P A;  5LGT A;  2GV9 A;  3U11 A;  3R65 A;  3SR2 C;  3K79 A;  4J7K A;  1KBH A;  1BZK A;  3HKB B;  3FD9 A;  2PYJ A;  4X1K B;  1B06 A;  1IBL O;  5JQG B;  4OPA A;  1P4R A;  2F43 G;  2V7Q G;  3U10 A;  1OZ0 A;  2LGW A;  3SYC A;  2CTW A;  2AW9 A;  4IHJ B;  3QF7 A;  4PHZ A;  4TOI A;  4U7N A;  2QWR B;  4U3F H;  2B9Z A;  1H8H G;  4CH4 A;  2IH3 C;  2QGN A;  2BTO A;  1YTF D;  4K8X A;  4X1I B;  4R8C A;  2P67 A;  4B08 A;  3JD2 A;  3JAL B;  3ABT A;  1GM9 A;  1PNM A;  3SPG A;  5IJ9 B;  1OCC C;  5L3B A;  4LNU B;  5LP6 C;  2WLH A;  3BA9 A;  3RW0 A;  4DV4 O;  1EZJ A;  3K57 A;  4QNH B;  2V4D A;  5LXT B;  5HFL A;  1VQ7 V;  5JJJ B;  5CN0 A;  2JIZ G;  2QSA A;  3E35 A;  1W59 A;  5EYP A;  1FYJ A;  1XNQ B;  4DV3 B;  3RYF A;  3L71 H;  1RSO B;  4LP8 A;  1CXZ B;  1V9P A;  3JAK A;  2ZXW B;  4X88 A;  3U0Z A;  1N36 O;  4BW9 A;  4IYH A;  1ROP A;  1XUQ A;  3CCJ V;  4LF7 O;  4LWS A;  5BR8 O;  2WLK A;  1CP9 A;  4HAM A;  1V54 B;  1VQO V;  2QTO A;  4H0L B;  2YIB A;  4IIJ A;  4I50 A;  2E76 B;  3VQX A;  2YXL A;  1QVF U;  1F23 A;  4LF6 B;  5KLV H;  5IYZ B;  2HJD A;  5IY5 B;  1Q86 W;  2ZQM A;  2UXB O;  1NVP B;  1JJ2 U;  3C3T A;  4NTX A;  1VQ8 V;  4FFK A;  2XAF A;  2E75 B;  5A2Q N;  2UXD O;  5L3G A;  2DOS A;  5B1B B;  3G4S V;  4YJ3 B;  1N0J A;  3J7A U;  4WFH A;  4WBN A;  2M7W A;  4UCS A;  3TCU A;  3QO7 A;  4ZI7 B;  3LNN A;  2CUG A;  1GN6 A;  4JI1 O;  1O9G A;  3C90 A;  2GUZ B;  5KHG A;  3RBZ A;  4TUY B;  1JCH A;  2IJK A;  4FZ0 A;  4MVS A;  1IBL B;  2A9H A;  5E1A C;  3UT5 B;  1M93 A;  2OTJ V;  5LA6 B;  4PD4 F;  4QPJ A;  1VQL V;  2IW5 A;  2F93 B;  3LNM B;  1I94 O;  2EIK C;  3L74 H;  4LH7 A;  1VQ4 V;  4I4T A;  3N27 A;  3BAA A;  5B3S C;  4DRX A;  1NBM G;  3CHX A;  4JYY A;  1K97 A;  4JI4 O;  4PI2 A;  2N04 A;  4TWK A;  4P2Z A;  4CH6 A;  4J42 A;  2UUA O;  1FJG O;  2ZE7 A;  4DV4 B;  1V55 C;  2OYQ A;  2NLJ C;  3K9A A;  3G6E V;  2C2A A;  2WLN A;  2Q8V A;  3F5W C;  4HYO A;  2XAQ A;  3A0R A;  3G67 A;  2PY5 A;  3ZIA G;  2Z5U A;  2UXX A;  2KKW A;  4CS3 A;  3OTO O;  5LMU O;  2K1E A;  4EB6 B;  5BMV B;  4U3J B;  3WB0 A;  5LGU A;  3IGA C;  4LF5 B;  3ZRV A;  1YJ9 V;  4LF9 O;  1N36 B;  3JD0 A;  2QM4 A;  1QBZ A;  4LF7 B;  4J41 A;  3CWB H;  5BR8 B;  2EIM B;  2RDC A;  2ZNI A;  1NR1 A;  1TA8 A;  2DYR C;  1GAX A;  3K0G A;  4R50 A;  2D2C B;  4O2B B;  3JCZ A;  1IXB A;  2R72 A;  2YXH A;  4YJ2 B;  4O4J B;  2ZKO A;  3FB8 C;  4AQY O;  2OIE A;  1FXK B;  3S3X A;  1ZAU A;  2UXB B;  2ETN A;  2YEV A;  4IL6 Z;  3DXR B;  4J9Z B;  4FM2 A;  2CAZ C;  4DUZ O;  2E3C A;  4BW5 A;  2A7W A;  2JDI G;  4GX5 A;  2UXD B;  4YHH O;  3ZX6 A;  5JH7 B;  1N32 B;  3T4Z A;  4TV8 A;  1S3J A;  4B3S O;  4JI1 B;  3CRA A;  3LDE A;  3X2Q B;  5LYJ B;  1ARO P;  5IYC O;  5C93 A;  2Y4T A;  4PA3 A;  3E22 B;  3E89 A;  1NT2 B;  3RFR A;  2P4K A;  3JAM N;  4U7O A;  1RPR A;  5H6R A;  4EFE A;  2AGA A;  3N2G A;  1Q8I A;  2WLI A;  5LOV B;  2QA4 V;  4K8Z A;  1MNG A;  3JAT A;  1Z5V A;  3B2E E;  2QWO B;  1I94 B;  1GM7 A;  3CRC A;  3JSN A;  1PPJ H;  4QE9 A;  2DYS B;  1Y66 A;  4DV7 O;  1PNK A;  4C7U A;  1VQP V;  4X1Y B;  4O4H A;  2JVD A;  2PGG A;  4UVC A;  2KG7 A;  3OGC C;  1SF9 A;  4WFF A;  3K5M A;  3ETD A;  2UUA B;  1K8A W;  2HHH O;  5E79 Z;  3UM7 A;  1FJG B;  4ABM A;  1YSC A;  1Y76 B;  2HFE C;  4NTW A;  5CB4 A;  1U97 A;  1PL4 A;  3DGE A;  1NTZ H;  4EEQ A;  5B1A C;  1BCC H;  1SES A;  1IDS A;  3CCR V;  3H1J H;  3K08 A;  3CC4 V;  2Q7G A;  3AG4 C;  3K0D A;  4NB5 A;  1AI6 A;  3HKC A;  3OTO B;  1OHH G;  5LMU B;  4LF4 O;  4DV2 O;  4LFC O;  5H9C A;  3B09 A;  3RGB A;  1F4N A;  2WWW A;  4PA9 A;  1IXM A;  2OCH A;  4JI7 O;  3FB7 C;  2Q6A A;  2OCC C;  1I7F A;  4NKG B;  1XOU A;  4JZ2 A;  5GON A;  4B3T O;  1GKF A;  1BQZ A;  1RM1 B;  1YJW V;  3RYI A;  1KU9 A;  4FFB A;  4EKW A;  1K92 A;  2KB1 A;  1WB7 A;  2BCC H;  2Y69 C;  4GUN A;  2F66 C;  1YZB A;  4AQY B;  1S77 D;  1QLE C;  4GX0 A;  5FNV B;  4UFZ A;  3W7U A;  2X6C A;  1M4U A;  3F7Y C;  4O4L A;  3CMA V;  3F5T A;  2P5O A;  1XDC A;  1NTK H;  4DW1 A;  4YHH B;  3WB2 A;  4FLZ A;  1VAR A;  2ILM A;  3SJA C;  4FVM A;  3H01 A;  4B3S B;  1SKV A;  1UJW B;  2YIB D;  4PDM A;  2JGU A;  1Q82 W;  4KXR A;  4MT8 A;  3SPH A;  1VEW A;  1SA0 A;  2DQ3 A;  5ITZ A;  2Y0I A;  3E8H A;  1H2S B;  2LW1 A;  3H1L H;  4YIP A;  4LH6 A;  3O65 A;  4TSF G;  1SET A;  1F4M A;  3AK2 A;  3ETE A;  2OT5 A;  3ETQ A;  3JSL A;  4NVP A;  3RYC A;  3W7W A;  1H2M A;  1HNZ O;  1K9M W;  4H33 A;  2ZD9 A;  1UFI A;  3R66 A;  1K5Q A;  3PJS K;  3SJC C;  1PL0 A;  5KAI Z;  1M56 C;  5B1N A;  1M1K W;  3KG2 A;  5J2U B;  4DV7 B;  5EZY A;  5LHI A;  3ZHT A;  3K03 A;  2LP7 A;  1M5I A;  3GVM A;  2DW4 A;  1BT8 A;  1ZL8 B;  4YY3 O;  4H44 B;  3L72 H;  1NZ6 A;  2HHH B;  2LO1 A;  3CS5 A;  2CH7 B;  3MD0 A;  2GDS A;  2ZIN A;  3LDC A;  5GTH Z;  4JI5 O;  3ZCC A;  1NU1 H;  3CJH B;  1KQS U;  4CS2 A;  4ZIB A;  1XRE A;  1Q6U A;  4RO2 A;  3Q4H B;  2QKC A;  4RQF A;  5KHH A;  1H2N A;  5J2T B;  1OCC B;  3ABL C;  3LUT B;  4O4I B;  5LP6 B;  1JFF B;  3T1C A;  4UVB A;  3ZRW B;  2YSU B;  1Z2G A;  4FLX A;  3ABU A;  2W6I G;  4LF4 B;  1XNR O;  4DV2 B;  2HKO A;  4I9W A;  2WLL A;  3SYP A;  1AI5 A;  5CA1 B;  4O2A B;  1ENV A;  1VP7 A;  1M90 W;  4HZ3 A;  4KFM A;  4GCZ A;  3ZHR A;  2UUB O;  4WFA V;  2QR4 A;  5KHK A;  4JI7 B;  5A9G A;  2L6L A;  5GW7 A;  1FD9 A;  4NXN O;  1PD3 A;  3AG2 C;  4AIL C;  2UU9 O;  2HVJ C;  2XAJ A;  4B3T B;  2XTA A;  1EFR G;  5IYB O;  1Y74 B;  4N23 A;  4BR6 A;  2EIN C;  3SGI A;  1KB9 F;  5H5N A;  1IBM O;  4OXS A;  2IJJ A;  3H1I H;  3CEI A;  3E8F A;  4FMT A;  1WN7 A;  1MMM A;  4X20 A;  1QLN A;  5JVD A;  2ZIO A;  1H2L A;  2O57 A;  3UKM A;  2A0L A;  4K0K O;  1JOY A;  1SER A;  2HG5 C;  4MVU A;  4GKK O;  4U3J A;  4I55 B;  1EN4 A;  4P9O A;  3H1H H;  2CGN A;  2JJ1 G;  1B6Q A;  3RVY A;  2GTS A;  4UCR A;  4ZOL A;  2EIL C;  4DV5 B;  1QU7 A;  1GN2 A;  1FS0 G;  2IU0 A;  2F23 A;  4JZG A;  3AEI A;  1QNM A;  2YUA A;  4WFB V;  5J9P C;  1EZV H;  2YID A;  1R3I C;  3JAR A;  4GZR B;  1WA8 B;  3N2K B;  3CCM V;  2JGD B;  3VBB A;  1WLE A;  2YS8 A;  1L1F A;  1N33 B;  1NI8 A;  5IE9 A;  3ZN1 A;  4PDR A;  4HNA B;  3UQ8 A;  2E5L B; 
#chains in the Genus database with same CATH homology
 4XDJ A;  3LNM B;  4XDK A;  2CK3 G;  2Y48 A;  2EIK C;  2HJF C;  2JEX A;  2Z3Y A;  3WG7 C;  2HLD G;  5EBL C;  1XL4 A;  1VQ4 V;  3OE7 G;  1R6N A;  3AG1 C;  2ITC C;  3OW2 U;  5EBM C;  5B3S C;  2X0L A;  3STL C;  2FTK A;  1NBM G;  1K97 A;  4JF3 A;  1QR8 A;  4TWK A;  4P2Z A;  3IC7 A;  4UUJ C;  2JK5 C;  1K4D C;  2IJH A;  1J95 A;  2BOC C;  4JPR A;  5IYD O;  1MG1 A;  2EIK B;  1AJN A;  4BIZ A;  4G2K A;  1V55 C;  3WG7 B;  2NLJ C;  3D3I A;  4FPP A;  1M57 C;  3K9A A;  3AG1 B;  3E86 A;  3G6E V;  2C2A A;  2WLN A;  3CME V;  3F5W C;  1NQT A;  1KEC A;  1OCO C;  5B3S B;  2NNU A;  4RAI A;  4HYO A;  2XAQ A;  2PI5 A;  1RPO A;  3I55 V;  2QEX V;  3TET A;  3AG3 C;  2XOK G;  3A0R A;  4JYC A;  3ZIA G;  2Z5U A;  2EIM C;  2JJ2 G;  2UXX A;  3GWO A;  3LDD A;  1H8E G;  4MSW C;  4DXW A;  5H6Q A;  1V55 B;  2K1E A;  2UXN A;  1M57 B;  3SPC A;  5LGU A;  2WAM A;  3IGA C;  1OCO B;  2YEV B;  3ZRV A;  1YJ9 V;  2JEU A;  3JD0 A;  4GT1 A;  2R9R B;  1YJN V;  2GHY A;  1QBZ A;  2QM7 A;  3AG3 B;  1YTF B;  3TK1 A;  1I5X A;  1FXK C;  2EIM B;  3JD3 A;  1JX9 A;  2P6J A;  5L3D A;  2W6J G;  3ABM C;  1NR1 A;  3ZMS A;  1CEZ A;  1KC8 W;  2DYR C;  2BOB C;  3K0G A;  4R50 A;  5LBQ A;  4WFG A;  3FB6 C;  3JCZ A;  1WPX A;  2ZR2 A;  3T2M A;  2D3O W;  2QM8 A;  3OEE G;  4FJC C;  3FB8 C;  2IJI A;  1FXK B;  1S5H C;  2IU3 A;  4JTC B;  4H37 A;  1NR7 A;  1CPY A;  4LCU C;  4MW3 A;  3ABM B;  2YEV A;  1FFT B;  4MVQ A;  3X2Q C;  1BMF G;  1R6K A;  4J9Z B;  4RUF A;  2WLI B;  2PI4 A;  4BW5 A;  2DYR B;  3CCL V;  3I56 V;  2JDI G;  4GX5 A;  1QR9 A;  3STZ C;  4JAS A;  4MS2 A;  1PKX A;  2HR3 A;  2EZP A;  1H2G A;  3OMI B;  2IH1 C;  3T4Z A;  1FXV A;  1S3J A;  4MVR A;  1G8M A;  4KUM A;  1K3E A;  3X2Q B;  3LDE A;  1W0K G;  3SYA A;  2X7R B;  1ARO P;  5IYC O;  5C93 A;  4KP4 A;  1EBO A;  1GMG A;  5LHH A;  2DWE C;  3CC7 V;  4GX2 A;  1K73 W;  4BAY A;  2P7T C;  2AHY A;  4PA3 A;  3CXC U;  3E89 A;  2DYS C;  1COW G;  5LGN A;  3G71 V;  1FXK A;  1VQ9 V;  1S76 D;  3OEH G;  4U7O A;  1RPR A;  5H6R A;  3NXS A;  2WLI A;  3SYO A;  2H8P C;  3W7T A;  2XAS A;  2QA4 V;  3DTU B;  4FIP C;  4G28 B;  5IDJ A;  5EBW C;  2V1D A;  1KP2 A;  5EC1 C;  3CPW U;  1GM7 A;  5EK0 A;  1SRY A;  1VQK V;  4ZBM A;  4QE9 A;  4FK5 C;  2X6B A;  2DYS B;  3FB5 C;  5CBH A;  1NH2 D;  1Y66 A;  3CC2 V;  1PNK A;  3SYQ A;  5B1O A;  3ASO C;  1VQP V;  2Q67 A;  4WFE A;  4X8A A;  2EIJ C;  1K7D A;  4UVC A;  1G4Y B;  3SPI A;  3OGC C;  1MAB G;  3ETG A;  4WFF A;  4CBC A;  5CBF A;  4WF9 V;  3ZRX A;  2Q68 A;  2XAG A;  3B8N A;  3BEH A;  5CMU A;  3FYE B;  4E2L A;  2B1I A;  3ETD A;  1HWY A;  1PNL A;  1N8R W;  1JVM A;  1K8A W;  3FKS G;  3UM7 A;  1M9N A;  3QO8 A;  4MTG A;  1YSC A;  3LSS A;  2HFE C;  4P9P A;  3E83 A;  3JYC A;  1LNQ A;  5LHG A;  2WPD G;  2LFS A;  1DLB A;  1OCR C;  2EZO A;  3ASO B;  3DGE A;  4MTO A;  3W7X A;  2EBO A;  2EIJ B;  5B1A C;  4JGS A;  1R3J C;  4LBE C;  4F4L A;  1SES A;  4YXW G;  3ZRS A;  3ZMU A;  3CCR V;  3K08 A;  2W0F C;  1F51 A;  3CC4 V;  1DF4 A;  3AG4 C;  3K0D A;  1AI6 A;  3QO5 A;  4ZKI A;  1RM1 C;  1OHH G;  4QIW F;  1VQ6 V;  4PA4 A;  5H9C A;  3CCE V;  1GK9 A;  2WSS G;  3OFN G;  1K5S A;  1OCR B;  2A79 B;  1F4N A;  4RUE A;  5L3F A;  2WWW A;  3ABK C;  4JTD B;  2Q69 A;  4PA9 A;  1IXM A;  4X89 A;  5B1A B;  2AHZ A;  1BL8 A;  3P32 A;  3JD1 A;  4JAU A;  3FB7 C;  2Q6A A;  4JTA B;  5KUK A;  1KD1 W;  2OCC C;  3AG4 B;  5FL7 G;  1GKF A;  5KA6 A;  1RM1 B;  2B1G A;  1YJW V;  3CP1 A;  1KKD A;  4PEL A;  4Q20 A;  1MOF A;  1MSW D;  1BHA A;  2XND G;  4UVA A;  1E1Q G;  1VQM V;  2HVK C;  3ABK B;  2DWD C;  4EKW A;  1K92 A;  2KB1 A;  2DQ0 A;  3ZJZ A;  2WLJ A;  4UXN A;  2Y69 C;  4QE7 A;  4XBF A;  1JPX A;  1NKD A;  1SZT A;  3CCU V;  3B77 A;  3P30 A;  3OR7 C;  4JAV A;  1S77 D;  1QLE C;  4GX0 A;  1GM8 A;  4GX1 A;  4MVZ A;  3VOU A;  1S72 V;  3HB3 B;  3W7U A;  1QCE A;  2X6C A;  1E79 G;  3ASN C;  3EFF K;  3F7Y C;  1W0J G;  3M99 B;  2GSM B;  4MVM A;  4PDV A;  3CMA V;  1THZ A;  3SJQ C;  3LSQ A;  4UV9 A;  4BIU A;  1AJP A;  2P90 A;  3ZN0 A;  4PA6 A;  1VQ5 V;  3CCV V;  2OTL V;  2Y69 B;  5LGT A;  1AR1 B;  3RVZ A;  3R65 A;  1QVG U;  5KUM A;  3H01 A;  3K79 A;  1K4C C;  1QLE B;  1UJW B;  4PDM A;  4R7C A;  3T4D A;  1Q82 W;  4MT8 A;  3SPH A;  3ASN B;  2DQ3 A;  3F7V C;  4LC1 A;  3CCQ V;  3E8H A;  1R3L C;  1GO3 F;  1P4R A;  2F43 G;  2V7Q G;  1OZ0 A;  2EJR A;  4JYB A;  2XAH A;  4TSF G;  1E1R G;  1AI7 A;  4N21 A;  1YI2 V;  3SYC A;  3MHS C;  3OUS A;  1SET A;  1F4M A;  1H38 A;  4RQE A;  3ETE A;  2OT5 A;  1NJI W;  4L87 A;  3K04 A;  3W7W A;  4U7N A;  2X6A A;  1YIJ V;  1YIT V;  4PA7 A;  1K9M W;  4ASU G;  4H33 A;  3OR6 C;  4G27 B;  1OCZ C;  1H8H G;  2ZD9 A;  1K5Q A;  2IH3 C;  3D36 A;  2MK3 A;  3PJS K;  1Q7Y W;  1PL0 A;  3HPL C;  1M56 C;  5B1N A;  3K06 A;  1W2B U;  1M1K W;  5DN6 G;  1YTF D;  3KG2 A;  4R8C A;  2P67 A;  5L3C A;  5LHI A;  3K3W A;  3GB7 C;  2WLL B;  3JD2 A;  3ABT A;  1GM9 A;  3K03 A;  5EC2 C;  1PNM A;  2LP7 A;  3SPG A;  5CA3 A;  1OCC C;  5L3B A;  2DW4 A;  4CZZ A;  1P7B A;  2ATK C;  3ML0 A;  4WCE V;  2WLH A;  1OCZ B;  4TT3 G;  4QJF B;  3RW0 A;  3E8G A;  3B8M A;  2ZR3 A;  3MD0 A;  1M56 B;  2B5U A;  1NVP D;  3LDC A;  1EZJ A;  4QNH B;  4XDL A;  3ZMV A;  3ZCC A;  3MHH C;  3ZMZ A;  1KQS U;  2ZXW C;  5HFL A;  1VQ7 V;  4MTX A;  4RO2 A;  5CN0 A;  2JIZ G;  3CCS V;  3E35 A;  2ZDI C;  3JD4 A;  4RQF A;  5KA5 A;  1OCC B;  3OAA G;  3ABL C;  1K33 A;  3BY6 A;  4DO2 A;  1KP3 A;  1ORQ C;  3LUT B;  4UV8 A;  3T1C A;  4UVB A;  3ZRW B;  2YSU B;  1DTO A;  1V54 C;  3ABU A;  2W6I G;  2HKO A;  4I9W A;  2WLL A;  5BZB A;  4LP8 A;  3SYP A;  5HFM A;  1K34 A;  1AI5 A;  2ZXW B;  2QE7 G;  1ENV A;  4X88 A;  1M90 W;  4HZ3 A;  4KFM A;  4GCZ A;  3CD6 V;  4WFA V;  1ROP A;  5CBG A;  2QKS A;  1NH2 B;  4J9Y B;  3CCJ V;  5GW7 A;  1ZWI C;  5IY5 C;  3ABL B;  1PD3 A;  3AG2 C;  2WLK A;  2HVJ C;  1AI4 A;  1CP9 A;  2R9I A;  2XAJ A;  4HAM A;  5DM6 V;  1EFR G;  1V54 B;  4Z1M G;  1VQO V;  1S0V A;  1R73 A;  4P30 A;  5IYB O;  1I5Y A;  2QTO A;  4N23 A;  2ITD C;  3OM3 B;  2EIN C;  4OXS A;  3E8B A;  5B1B C;  1QVF U;  2IJJ A;  2OCC B;  1F23 A;  3E8F A;  4FMT A;  3ZRW A;  3WFV A;  5IY5 B;  4QPK A;  1Q86 W;  1QLN A;  5L3E A;  3W7S A;  1XL6 A;  2ZQM A;  3AG2 B;  1NVP B;  3FYI B;  3ZMT A;  1JJ2 U;  3UKM A;  1JOY A;  2A0L A;  1SER A;  2HG5 C;  2EIN B;  1VQ8 V;  4MVU A;  2XAF A;  3OMA B;  2ZDI A;  1FXH A;  4P9O A;  5L3G A;  5B1B B;  3G4S V;  2WLM A;  3SPJ A;  2LFR A;  3OMN B;  2JJ1 G;  4MVO A;  1B6Q A;  3RVY A;  4WFH A;  2M7W A;  1DF5 A;  2EIL C;  3TCU A;  3QO7 A;  4MW8 A;  1GTO A;  1FS0 G;  3CYO A;  4R6Z A;  2IU0 A;  3OUF A;  3AEI A;  3RBZ A;  1Q81 W;  4WFB V;  5J9P C;  1JCH A;  1YHQ V;  1VQN V;  2IJK A;  1R3I C;  1JQ0 A;  3IFX A;  3QNE A;  4MVS A;  2A9H A;  3CCM V;  3VBB A;  5E1A C;  3EHB B;  1WLE A;  4I5S A;  4PDL A;  1L1F A;  1TUE B;  2OTJ V;  2H94 A;  1Y4M A;  1R3K C;  2EIL B;  4MTF A;  3ZN1 A;  4PDR A;  1BHB A;  3E2E A;  4QPJ A;  1VQL V;  1AJQ A;  2IW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...