1K73W

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k73W00
2OTJV 3I55V 4WCEV 1S72V 3CXCU 4WFBV 1YITV 1K73W 3CCMV 1VQKV 1YJNV 1N8RW 1VQ6V 3CC7V 1K8AW 3CC2V 1VQLV 1KD1W 1VQMV 1VQ5V 2QA4V 3CCLV 1Q81W 1Q86W 3G6EV 1KQSU 3G4SV 3CCVV 1QVGU 4WFAV 1YJ9V 4WF9V 3CCUV 1KC8W 2D3OW 1YHQV 1R73A 1M90W 1YI2V 3CMAV 3CMEV 1VQ7V 2OTLV 3CCQV 1K9MW 1M1KW 1VQPV 1YJWV 1Q7YW 3CCRV 1YIJV 1W2BU 1JJ2U 3CPWU 5DM6V 3CC4V 1VQNV 3CD6V 1NJIW 1Q82W 3I56V 1VQ4V 2QEXV 1QVFU 3OW2U 3G71V 3CCEV 1VQ9V 1VQ8V 3CCSV 1VQOV 3CCJV
chains in the Genus database with same CATH superfamily
1JFFB 3K0GA 2BTOA 2LGQA 4HZ3A 2HJFC 4JV5O 3OUFA 1QVGU 5LP6C 3RYHB 5B1OA 1NS1A 2N04A 4K35A 4UB8Z 2WWWA 3LSSA 2ETNA 3G67A 2BTQA 5EYPB 3CRMA 1HNWO 1N36B 1J5EO 3AG3B 3CX5F 3I55V 1B3QA 4WCEV 5JJJB 4DV5B 3A0BZ 3QTCA 2P90A 1Y4MA 4UCTA 1TGOA 2ZE6A 2HVJC 3K9SA 1ZLZA 4OXSA 4ABMA 5LHIA 4GKJO 2PY5A 5L3GA 1I5YA 1A32A 3UKMA 1YJWV 4KHPO 4N21A 4DR2O 5LOVB 4OGQB 1H2SB 3O65A 1R3LC 3FX7A 2CTPA 4PA7A 3JD4A 1VQ6V 2JEXA 4LP8A 3N27A 1B04A 5CA1B 4EFBA 2DMXA 5BZBA 4NR1A 3ZRWA 1EN5A 3OTFA 1OV9A 5LP6A 2XAGA 3N2GA 1PM9A 4E2LA 1K4DC 2H94A 2EZOA 5KMGA 1XMQO 3U11A 3HR0A 4H44B 1VIBA 1N0NA 3OMNB 4PV1B 1OCCC 3L72H 4PA6A 4DV5O 5D5PA 4O4JA 3ZRWB 1GN2A 4R7CA 4MW3A 5LP6B 1G1XB 3N2GB 1KU9A 4JAVA 1FPOA 3BABA 4O2BA 3DC5A 2VS0A 4LF8O 4E4EA 1VARA 1SZXA 4MVOA 4JI4B 2QA4V 1NH2D 2UXXA 2Q69A 2CTWA 4WF9V 4XDKA 1D5AA 3WFVA 1KMIZ 3S3WA 3L74H 1JCHA 2YXHA 2RMKB 1DTOA 4I5SA 2KG7A 2AW9A 3ABLC 3CRQA 4U7NA 2QWOB 3CCEV 2YXYA 5TISZ 1QHTA 1S5LZ 2HP8A 4WBNA 1UJWB 2DQ0A 4UV8A 2ITDC 3AK3A 2X6BA 3JASB 5EZYA 2KG7B 2ILMA 1ORQC 2Q68A 4R8CA 4JI6O 2DYRB 5ITZB 4DRXA 3P30A 4OX9B 1L8DA 4J7JA 4MTGA 1T5EA 3AK1A 4WBNB 5D5QA 3CCMV 4JYAB 1FXKB 1OCCB 2ZE7A 2FMLA 3ABKC 5HFMA 2JJ1G 4JYBA 2HHHB 2Z5UA 4G2KA 4O4LB 4DRXB 2Q6AA 4J7ZA 2A9HA 1KP2A 2CK3G 4XDJA 3E8FA 2ZINA 2LO1A 3N2KA 4DR5B 2DOSA 2ITCC 3ETDA 4LR3A 5GTIZ 5IJ0A 4JASA 4O4IA 1BSMA 4QJFB 2OCHA 5IE9A 4MVUA 1GTOA 3ABLB 4IL6Z 5IJ0B 2IJIA 3AG2C 4X64B 5JJEB 2FKXA 2HEPA 3K08A 4CS3A 4JYAO 1BQ0A 3OGIB 2E75B 4JGSA 1MMMA 4NB5A 3M7MX 1ENVA 3UM7A 2OTLV 1FXVA 2HHHO 5L3FA 1AROP 4DR4B 2ZXWC 1ZAUA 2F23A 1I5XA 1BL8A 2XOKG 1WB8A 1Q90D 4DR6O 2E5LB 3J80N 5E79Z 5F2VO 4UCOA 1P7GA 1KQSU 3OD4A 3ABKB 2CE4A 3AG1C 2Z0AA 2R9AA 2PUSA 1WB7A 1KKDA 1WP7A 2NR5A 4LFAB 4DV4B 3TGUH 3EHBB 2IBZH 4BW9A 4DR3B 1XL4A 2CTQA 1EN6A 2XNDG 1S3JA 4X64O 3H1IH 3LDCA 3M8AA 3DXRA 2JS5A 3SYCA 1BCCH 2Q67A 3HKEB 3RW0A 1NTKH 3APOA 3BPZA 2R70A 3RYFA 5B5EZ 5LBQA 2EIMC 3DTUB 1YJNV 3JD2A 4FLVA 2JGDB 4IYIA 2IU3A 3DXRB 3F5WC 3X2QB 1YTFB 2AHYA 1RP3B 2E5LO 4U7OA 4JF3A 1SRYA 1S76D 1I94B 4L8JA 4CH3A 1Q7YW 5GONB 5K1PA 4I0XA 4UB6Z 1Q82W 3T4DA 3MHHC 3VOUA 5LMUB 5B1NA 4DV4O 2XASA 3QO7A 1S72V 1MABG 4DR3O 1NTZH 4NTXA 4J80A 4F4LA 2ODMA 1WN7A 1K5QA 1COWG 5H2FZ 2GUZA 3HB3B 2R72A 1E1RG 3AG1B 4O2AA 4X1IA 4I0XB 1PNMA 3PJSK 1UPGA 3UO2A 3ZHSA 1XNQB 4ZIBA 4PHZA 2R9IA 3E35A 4HYOA 3E22A 4MW8A 4PI0A 4LF7B 1W0JG 4X66O 2QJ1A 2UUBB 4K0KB 3KCYA 2QWNB 4JI8O 3ZMUA 2DW4A 3D8CA 3P32A 4TQFA 4O2AB 2XAJA 4H37A 4Z1VA 1F7YA 1I94O 4J9YB 4LF6O 1WPXA 2PI5A 3QF7A 3SPGA 4DV3B 1NJIW 1HR0B 2JIZG 3BVOA 3K9AA 4UCSA 4LC1A 1CPYA 2F4VO 1TUBB 4J42A 5LMUO 1BS3A 3JATA 3L71H 5JVDB 2X7RB 1MSDA 4I50A 3BHPA 2N74A 2RN9A 3IAYA 4DV0B 2YICA 2YI9A 3E86A 4IIJA 4RUFA 4X89A 1Y66A 4FIPC 5IWAB 1MA1A 2HVKC 5KAFZ 2A7WA 1XNQO 1WLEA 3AK2A 4FFBA 4FK5C 2V1DA 2JRIA 4NXMB 2GV9A 3SYQA 2WLIA 2ZQMA 3HKDA 3ZBHA 1RFYA 4TUYA 3ABMC 4UCVA 2OIGA 3E89A 1TA8A 5EC1C 4X1KA 3K5LA 4TWKA 5C8YA 3T1HB 4YHHO 5CBFA 4DV3O 1IBMB 4JI3B 2WLIB 2KQXA 4TV9B 3HKDB 5K1XA 4R50A 4TUYB 4RO2A 2BCCH 4DV0O 2YDEA 2QWQB 1PL4A 1BHBA 2ADPA 2Q0OC 4FJCC 4G27B 1KKCA 1OCRC 3RYIA 2UUAB 3FB5C 4JTCB 2A06H 2JJ2G 4NXMO 1QR9A 2QSAA 2OYQA 2M6YA 1XDCA 4B7KA 3BA9A 1Y76B 3CJHB 3FB6C 5LXTA 3OTOB 4CH4A 4EKWA 4A5UB 1M1KW 3TETA 3OR7C 1SERA 1GKFA 2YS8A 1M56B 2PYLA 3RYIB 1P49A 4X20A 1WP8A 4JAAA 1NTMH 1VQLV 3SYOA 3H01A 3MDSA 1AI7A 5GTHZ 1N32O 2QDOA 5LXTB 2LQTA 4JI5B 1BT8A 3K79A 4I55A 1Q6UA 1X59A 4EFEA 1WA8A 3WB1A 2ZNIA 4ZI7A 2HFEC 3KG2A 4YIPA 3VQWA 3CC2V 5FLXN 4B3SO 1BMFG 5L3CA 3G4SV 2W6IG 4FLZA 3M99B 4I55B 4W4KA 2NNUA 1JJOA 2PZSA 1IX9A 3LNNA 3OTOO 5J9PC 1DGSA 1U97A 1J5EB 5B66Z 3UO3A 1Q3EA 1OCRB 2A79B 1FFXA 3CRAA 3FB8C 2P4VA 3VBBA 5KA6A 1SQVH 4LF4B 5CBGA 5IYDO 4CH5A 4LF5O 5IT9N 3QVNA 5KHHA 2LW1A 1HWYA 3JALA 4MVZA 4D6TH 2QKCA 1YCIA 4FPPA 1GM7A 2BSKA 3D36C 3KKYA 3RWRD 4GKJB 3VQYA 4FFKA 3KZIZ 3QO5A 4DR2B 1XREA 3RYCA 3CC4V 1FS0G 2ARHA 1ZSPA 1VQ9V 4MVSA 5J2UB 4LF9O 4I9QA 2QWPB 3A8TA 2AXTZ 5H6RA 1K8AW 2FL4A 2W6JG 4NVPA 2Y0IA 2BSKB 1TVKA 3FD9A 2F43G 5BXZA 1FD9A 4JZGA 4F6RA 2WSSG 5CN0A 1XMQB 2UUCO 2GDSA 3W7TA 3CCJV 5CBHA 2WPDG 5EIBD 3THOA 3ZHTA 4RUEA 1H2GA 3AG4C 4IT5A 1TVKB 4LF4O 3WG7C 1AJNA 1YJ9V 2EIKC 4ZHQA 1AVMA 4F6RB 4FM0A 2ZM6B 1FJGB 3D36A 2F1MA 2BTQB 3TXQA 2FYUH 4LF8B 1Q43A 3FFQA 3E83A 4CS4A 4UCUA 3NR7A 3VQXA 3SYAA 1K33A 1EFRG 3RFRA 1AR1B 4UXNA 5DM6V 1H2LA 1K5SA 2BOBC 2OCCB 4D7SA 4U3FH 2X6CA 5L3DA 2QM7A 4BIUA 3ASNC 3CXCU 3CC7V 2YUAA 2PF4E 4I9WA 3FKSG 3I5DA 2ZE8A 4O4HA 1QU7A 1AP6A 1KC8W 4JI6B 1IDSA 5BR8O 4DV2O 5KMGB 2ZM6O 1FJGO 1RSOA 2EJRA 3ZCCA 5CB4A 2IJJA 3IGAC 2KKWA 2HKOA 4O4HB 4O4JB 1QR8A 1AR4A 1S5HC 2IJHA 1L1FA 1IXMA 3WG7B 2EIKB 5JQGA 2EIJC 2Q73A 3RGBA 1K97A 3JCUZ 1RSOB 5DECA 4X65B 4LH7A 4O2BB 1D5NA 3CHXA 5LMNO 2CTRA 5BMVA 4ZBMA 1GN4A 2O57A 1U96A 3ETQA 2ZNJA 1M4UA 4P2ZA 5JQGB 3B8NA 1W59A 1MNGA 1BQZA 3FB7C 5KHGA 4FLXA 4PD4F 3L73H 5A2QN 2VRZA 5BMVB 4JI0B 3GB7C 3CXHF 3B8MA 2LFSA 4WFBV 2LP7A 3WU2Z 4PA4A 2XTAA 4JPRA 1DF4A 3H1LH 1XQ8A 3G6EV 3B77A 5EZYB 2QR4A 5LHGA 3EVKA 3ASOC 1R6TA 1H2KA 4GKKO 1I08A 1K34A 1HNZB 2ATKC 2VQEO 5H5NA 5LHHA 3A0RA 4X65O 4DR6B 2ZDIC 1AR5A 3AEIA 2BE3A 2XT9A 1PD3A 1F51A 5LL6Y 3RVZA 1N4CA 1I7FA 2ZIMA 1HW7A 4ZKIA 3F7YC 4WFGA 1YI2V 3RVYA 2EIJB 3FAVA 3FYEB 1GN6A 2QTSA 2QTOA 2Q0AA 3N2KB 4KP4A 4BIOA 1NQTA 4JTDB 2IJKA 4B3TO 4O4IB 2EILC 4JI0O 1GAXA 2WA4A 2QM4A 4PDVA 2EZPA 4K8ZA 2F95B 2YIBD 3H9VA 3K06A 3B2EE 2M7WA 1PNLA 1OZ0A 1HNZO 2IH3C 3SR2C 4XBFA 4HNAA 4Q20A 2UU9B 2VWJA 4ICGA 3DGEA 2YEVA 3R66A 2ZDIA 4H13B 1R6KA 3AG7A 4DV7B 2VWKA 4QE9A 1MG1A 5A9GA 3CMEV 1IBLO 1V55C 2B5UA 3S3XA 5JJNB 1KP3A 2PTMA 5IY5C 5JWPA 5IYZA 4PA3A 2WA3A 3A0HZ 2YEVB 2L35A 3LDDA 3UT5A 5DN6G 1OHHG 1X4TA 3DC6A 4AQYO 1R73A 3G6BA 4MTXA 5JCOC 1SQFA 2WLHA 4DV6B 2Y48A 2GTAA 5KAIZ 3DSQA 1GN3A 4WFFA 4X66B 4JI1O 1JOYA 3KCXA 1PNKA 2P67A 4JI8B 2EILB 3AG2B 2UU9O 4FZ1A 3TJTA 1KECA 1N33B 3SYPA 1M93A 4TV8A 4DV7O 1ROPA 2EX3A 4LF6B 1JMKC 2ZKOA 1XL6A 3RYFB 4FLTA 2F4VB 2E74B 4NTYA 1B06A 2W0XA 1NI8A 2ZXWB 3TXSA 1L0NH 1Y6XA 1SQXH 2GSMB 4GT1A 3EXAA 1LNQA 4GX5A 4UVBA 1M5IA 3ZMSA 3B09A 5KLVH 5J2TA 5IYBO 3K03A 3E2EA 3H1JH 5L3BA 1VQ7V 3MD0A 1YF2A 1VMGA 3CCRV 2DYSC 2EBOA 5JCOA 1V55B 4FLWA 4NYKA 4DV6O 1VQ4V 1RM1C 1N34O 4TQDA 5IY5B 3RT3C 4CS2A 2AHZA 1XNRB 1EBOA 4R6ZA 1VQ5V 1QQCA 3A2FA 4YJ3A 2GUZB 5LA6A 5J2TB 3GWOA 3EFFK 2YIAA 5IDJA 1JVMA 3CCUV 5B1BC 1N33O 4X1IB 3CE2A 4JYYA 4UUJC 4CH6A 3BAAA 1WAZA 4JI7O 3L75H 5GW7A 4UFZA 3E22B 4YHHB 1VF6C 2HR3A 3W7UA 2AGAA 3T1YO 2OTJV 2RJZA 2EIMB 2LW7A 3T1CA 2WLLA 5LA6B 4QPJA 3STZC 3LUTB 3CCLV 3TK1A 1QNMA 4J41A 1NU1H 3PN1A 2XAQA 5CA0A 3T2MA 1SQPH 3K5OA 1V54C 1K9MW 4YJ2A 3L70H 1S77D 3SJCC 1GMGA 1CP9A 3OM3B 2IM9A 3JATB 5H6QA 2WLLB 4I50B 2JVDA 1H2MA 3SJBC 5CA0B 1H38A 3ZMZA 1NT2B 1XNRO 4DUYB 1SS3A 1PKXA 3MHSC 1YXBA 4J11A 2DWEC 4IIJB 1GM9A 4DUZB 1NVPB 3LSQA 4FFBB 1AP5A 3BA8A 2KB1A 1DF5A 1NZ6A 1VF6A 4KUMA 1KYOF 1QLNA 2GBOA 1N32B 1IBKO 1VP7A 1AB3A 1Q81W 1LR1A 5KHIA 2GTSA 2LFRA 4GLXA 2OWOA 1YHQV 1ZWIC 5B1BB 4X1KB 4U3JA 1XMOB 4LH6A 5C8YB 3VQVA 1KBHA 3IC9A 2HJDA 4BW5A 1TUEB 1XOUA 1TAEA 2YSUB 4EB6A 1N8RW 4NXNB 1IZ3A 4B3SB 4UVCA 3OE7G 3IJ4A 2Q7GA 3HKCA 2Q8VA 2Y69C 2LJ2A 1YEWA 4DUYO 5IJ9A 1LUVA 1JPXA 4XDLA 2UXBO 5EBLC 3L9DA 2FTKA 4DUZO 3SJQC 2CGNA 1R3IC 4EB6B 3U10A 1JR9A 1WPBA 1Y67A 4IYHA 3HKCB 1BZKA 4TSFG 4LF5B 3SJAC 4LFBO 1KD1W 4B08A 5IJ9B 1NR7A 2XAFA 3K58A 1DLBA 2UXNA 3ABMB 4LWSA 2CH7A 1XBLA 1ZX3A 2WLKA 2E76B 4QGPA 4X62B 3GWKC 1NKDA 4MS2A 1QVFU 4X20B 1XMOO 4LF9B 3CCSV 3D3QA 3ICXA 1Q5OA 4RQEA 3ZN1A 4X9QA 2A3QA 1O9GA 4PDLA 5FNVA 1S0VA 1OCZC 3JARA 4NXNO 2L6LA 3MAQA 3ZN0A 5C93A 2VQFB 2P5OA 4LWSB 2CH7B 3JD0A 2R9RB 3JAKA 4RWUA 5KA5A 1VF7A 3CYOA 5EC2C 3K3WA 3SGIA 1WA8B 2ADQB 2UUCB 5KUKA 1G6UA 4ZI7B 2WLMA 1Z5VA 3JARB 4BIZA 1V9PA 3ZS8C 3W7SA 1JX9A 2Y69B 2E3CA 3O9OA 1AJQA 1HNXB 5LYJA 1FYJA 1EZVH 3OMIB 1YZBA 3J81N 1ZL8A 5CA3A 4FLYA 4LBEC 2N05A 4FM2A 1R3JC 3BCCH 1HDJA 2YXLA 4X62O 2D2CB 4DR7B 2YIDA 1XILA 2F66C 1FFXB 4MVQA 3H1HH 4B3MO 1R6NA 3APQA 1IVSA 4MVRA 3JALB 4OPHA 2Q7EA 3E8GA 2PGGA 3T4ZA 5BY1A 1AILA 2UXDB 1VF5B 1ZL8B 2VQFO 1NR1A 3CMAV 3RYCB 3CCQV 1JJ2U 2Q4PA 4F6EA 5EYPA 4GCZA 4PA9A 4I7ZB 2DWDC 1OJHA 2V4DA 2P6JA 1HP8A 1P84F 2Y4TA 1Q86W 1OCZB 2IH1C 2H3OA 2GHYA 5BR8B 1W0KG 4DV2B 4LCUC 3ZHRA 1HNXO 1GH6A 3OMAB 1YIJV 3QO8A 5LOVA 4JAUA 2B9ZA 1MSWD 4DR7O 3JAMN 4FVMA 1FFTB 4G28B 4LNUA 1L0LH 5E1AC 4ZHQB 4GX2A 4DO2A 2DQ3A 4H0LB 5CA1A 2HG5C 1M90W 3CB2A 2ZE5A 2UXDO 5KX5A 2W0FC 1BE3H 2HLDG 2WLJA 3ETGA 5LMNB 4YXWG 2CAZC 3CEIA 1BHAA 4IHJA 2K1EA 1WJZA 1YTFD 2Q7HA 3CSXA 4LNUB 3ZIAG 3ABUA 4MTOA 1Q6HA 2DYRC 5KX5B 4NTWA 2Z3YA 1OCOC 3K59A 4DW1A 3F5TA 2B1GA 1XHZA 4Q6GA 3SPCA 4IHJB 1FXKC 1N36O 1I0HA 4UCRA 1F4MA 4X8AA 2QKAA 1THZA 3K57A 3AG4B 4KL1A 1IURA 4FZ0A 4GKKB 1FXHA 2VQEB 1K7DA 2JDIG 2CGOA 1KB9F 5CB4B 1GRJA 2EULA 4EEQA 3UQ8A 2NN4A 2F93B 3RN4A 1JQ0A 2X0LA 4NKGB 2P4KA 5FL7G 4X88A 3LSUA 3HKBA 4KXRA 3JASA 1VQPV 4ASUG 4QIWF 3CPWU 1Q6IA 4UV9A 3G80A 5ITZA 3K0DA 3G71V 4B3TB 4H33A 1GO3F 2CDYA 1YITV 3OEHG 1VQKV 5LGNA 4BR6A 3ASNB 1FXKA 5B1AC 4B3RB 3HKBB 5FPOA 2AZ2A 4CC5A 1SQGA 4O4LA 1OCOB 4MT8A 2H8PC 2YC0A 4PJ0Z 5KHJA 5JH7A 2KSDA 1MZFA 2QGNA 5EIBC 4W4LA 2OIEA 1J95A 1IXBA 4JI4O 3JSLA 3SDLA 1NVPD 3JAWA 1IBLB 3ZRSA 1PL0A 3JYCA 3W7WA 2JK5C 5JH7B 3K5NA 3P3NA 1PPJH 2ZR3A 2P06A 1AI4A 4J7KA 4JI2B 3WB0A 4AQYB 3JAWB 4DYLA 3ZHUA 4B3RO 3ZRXA 1URFA 1SA0A 1Z5WA 3FAVB 1N0JA 3CD6V 1W2BU 4AILC 1VQNV 2QWRB 3SPHA 5EBWC 4OX9O 4JI1B 2MK3A 1SQBH 4J10A 4C7UA 1F4NA 1DK1A 1YDXA 1B6QA 3X2QC 3K04A 4PDRA 2EINC 3ML0A 4PI2A 5B1AB 3UCSC 1SA0B 4B7EA 1GM8A 4DR1B 1E79G 5EK0A 1R3KC 1XHXA 3ASOB 4Z1MG 1R1BA 1PV0A 1AJPA 4HNAB 3W7XA 4DR5O 1CEZA 1QBZA 4AHCA 1SF9A 4GZRB 5H9CA 2JEUA 4TOIA 2G38A 4JI2O 1SQQH 4GYCB 1GK9A 3STLC 1EZJA 4K3AA 4DV1B 1KUQA 3C3SA 4IGGA 3HKEA 4X1YA 2CUGA 3CRRA 4K8XA 2QEXV 5EBMC 1N34B 5LGTA 5IYZB 1K92A 2V7QG 4FM1A 4MSWC 2UXCB 2JGDA 3UT5B 5L3EA 2XUMA 1VEWA 2QKSA 3TCUA 3ZMTA 4OPAA 3ZX6A 3P3PA 1XEQA 2OT5A 4X1YB 1Z2GA 4JI7B 4YY3B 4DR1O 5LGUA 2RNBA 5GONA 3I56V 4MTFA 4DR4O 2P22C 3T1YB 4RAIA 1NBMG 3ZHVA 3R65A 2MW2B 2EINB 4CZZA 3BFRA 2QE7G 3C90A 3OUSA 2RQ6A 2XAHA 4TV8B 2A0LA 4DW0A 3BY6A 4P9PA 4DV1O 4LFAO 3CCVV 4UVAA 4DXWA 3ETEA 1G8MA 4WFEA 1YVWA 3OFNG 1PP9H 1VQMV 4I4TA 4BWAA 2WAMA 2UXCO 3K5MA 4LFCB 4FLUA 1NH2B 2JGUA 3Q4HA 4CC6A 2Y4UA 4YY3O 3WB2A 2QM8A 5KHKA 1M57C 1EM1A 3F7VC 1XI1A 1S5JA 1H2NA 3B4SA 1TUBA 2K9PA 1IBKB 4I4TB 4YJ3B 5JVDA 3B40A 3CP1A 2YI8A 1BGYH 1QCEA 2X6AA 4PDMA 3Q4HB 4KFMA 4GX0A 5HFLA 2BOCC 4RQFA 2JS3A 2RCVA 3QG5A 1K4CC 3OGCC 4JZ2A 1XUQA 3ABTA 4HBNA 3C3TA 2AZ0A 2UXBB 4YJ2B 3U0ZA 4LFCO 1M56C 3BRCA 4PELA 1US6A 2DYSB 1G4YB 1E1QG 1D2DA 1K73W 4LFBB 1RM1B 4LF7O 2C2AA 2UUBO 1FAFA 3QNEA 1RPRA 4TV9A 1Y74A 4K0KO 2ZCEA 1MZEA 3HPLC 4QNHB 4DK1A 1SZTA 1AI6A 3OAAG 4Z2WA 1SETA 4GX1A 2DN9A 4ZOLA 2YIBA 1HR0O 1M57B 4L87A 1VQOV 4BAYA 1Y74B 3OEEG 1ZUQA 3LDEA 4J9ZB 3J7AU 1H8HG 1EN4A 5B3SC 2P7TC 2ZR2A 3CRCA 4D7TA 3OR6C 1Y76A 3CJHA 5FPRA 4HAMA 4U3JB 3ZRVA 5CMUA 4ZOLB 1FKAO 1YSCA 1V54B 3LNMB 5IWAO 2NLJC 3NXSA 3IFXA 4P9OA 2ZIOA 3CWBH 1JA8A 1QLEC 4CBCA 3RBZA 3E8BA 1CXZB 3ZMVA 1K3EA 1SKVA 3ZJZA 1H8EG 2FB5A 1O9HA 2PI4A 5AG2A 3T1HO 1IBMO 4B3MB 2ZD9A 1P7BA 2Y0PA 4JTAB 4JI3O 2WLNA 4P30A 4WFAV 1SESA 2D3OW 3GVMA 4AI8A 3ZHQA 2EJ7A 4QPKA 3SPIA 1F23A 3JD1A 3OT7A 4TT3G 3OW2U 2RDCA 3AG3C 5FNVB 4JV5B 2UUAO 1AI5A 1P4RA 2LGWA 3BEHA 3E8HA 2XHBA 5B3SB 2DJVA 3IC7A 3JAKB 3JCZA 1UFIA 4YIOA 5IYCO 3H1KH 3FYIB 4JYCA 4GUNA 1WNSA 1HNWB 5DEDA 2Q5ZA 3JSNA 3CS5A 4FMTA 1VQ8V 4N23A 2IW5A 1SC5B 1RPOA 3SPJA 5J2UA 1M9NA 2DE0X 1JFFA 2IU0A 4QE7A 2PYJA 4MVMA 1Q8IA 2Q9LA 4DK0A 5KUMA 2B1IA 1QLEB 5LYJB 1ZTEA 4KHPB 3D3IA 3ZEDA 4JI5O 3RYHA 2ZT9B 1LUWA 2OCCC 4WFHA 1MOFA 3JD3A
chains in the Genus database with same CATH topology
1JOYA 1PNKA 3K0GA 1YITV 2P67A 2WLIB 3OEHG 5LGNA 1VQKV 2EILB 3AG2B 3ASNB 1FXKA 4HZ3A 2HJFC 4R50A 5B1AC 1KECA 3OUFA 1QVGU 4RO2A 3SYPA 5B1OA 1ROPA 2WWWA 1OCOB 3LSSA 4MT8A 1XL6A 1BHBA 4FJCC 2H8PC 4G27B 1OCRC 2ZXWB 3AG3B 3I55V 4WCEV 2GSMB 4GT1A 1LNQA 4GX5A 4UVBA 3FB5C 1J95A 4JTCB 2JJ2G 2P90A 1QR9A 1Y4MA 3ZMSA 2HVJC 4OXSA 5LHIA 5IYBO 1NVPD 3K03A 3E2EA 3FB6C 5L3BA 1VQ7V 3MD0A 3ZRSA 1PL0A 4EKWA 1M1KW 5L3GA 1I5YA 3UKMA 1YJWV 3TETA 3OR7C 3JYCA 3W7WA 3CCRV 1GKFA 2JK5C 2DYSC 2EBOA 1SERA 4N21A 1V55B 1M56B 1VQ4V 1RM1C 1R3LC 2ZR3A 1AI4A 5IY5B 4PA7A 2AHZA 3JD4A 1VQ6V 2JEXA 1EBOA 1VQLV 4R6ZA 3SYOA 3H01A 4LP8A 1VQ5V 1AI7A 3GWOA 3EFFK 3ZRXA 5IDJA 1JVMA 3CCUV 5B1BC 5BZBA 3ZRWA 4UUJC 3K79A 2XAGA 3CD6V 1W2BU 1VQNV 5GW7A 3SPHA 5EBWC 4E2LA 2MK3A 1K4DC 2H94A 2HR3A 2EZOA 1F4NA 3W7UA 2OTJV 2HFEC 2EIMB 3KG2A 1B6QA 3OMNB 3T1CA 3X2QC 2WLLA 3K04A 4PDRA 3CC2V 1OCCC 2EINC 4QPJA 3ML0A 4PA6A 3LUTB 3STZC 3CCLV 1BMFG 5B1AB 3TK1A 5L3CA 3G4SV 2W6IG 2XAQA 3M99B 3ZRWB 4R7CA 1GM8A 4MW3A 3T2MA 1E79G 2NNUA 5EK0A 1R3KC 1V54C 1K9MW 4JAVA 3ASOB 1S77D 5J9PC 1GMGA 4Z1MG 1CP9A 3OM3B 1AJPA 5H6QA 1OCRB 2WLLB 3W7XA 1CEZA 1QBZA 2A79B 3FB8C 3VBBA 5KA6A 5CBGA 5IYDO 4MVOA 5H9CA 2JEUA 2QA4V 1NH2D 1H38A 3ZMZA 1HWYA 1PKXA 3MHSC 4MVZA 2UXXA 2Q69A 4WF9V 4XDKA 1GK9A 4FPPA 1GM7A 3WFVA 2DWEC 3STLC 1EZJA 1GM9A 1JCHA 1DTOA 4I5SA 3QO5A 1NVPB 3CC4V 1FS0G 3ABLC 4U7NA 3LSQA 2QEXV 5EBMC 5LGTA 1K92A 3CCEV 1VQ9V 4MVSA 2KB1A 2V7QG 1DF5A 4KUMA 5H6RA 1UJWB 1QLNA 1K8AW 2DQ0A 4MSWC 4UV8A 2W6JG 2ITDC 5L3EA 1Q81W 2QKSA 2X6BA 3TCUA 2LFRA 3ZMTA 1YHQV 2OT5A 1ZWIC 1ORQC 5B1BB 2F43G 2Q68A 4R8CA 2DYRB 5LGUA 3P30A 2WSSG 5CN0A 4MTGA 3I56V 4MTFA 3W7TA 3CCJV 5CBHA 2WPDG 4BW5A 1TUEB 4RAIA 1NBMG 2YSUB 3CCMV 1N8RW 3R65A 4RUEA 1FXKB 1H2GA 3AG4C 4UVCA 1OCCB 2EINB 3OE7G 4CZZA 2QE7G 3ABKC 2Y69C 5HFMA 3OUSA 3WG7C 1AJNA 1YJ9V 2JJ1G 2EIKC 2XAHA 2A0LA 4JYBA 3BY6A 2Z5UA 4G2KA 1JPXA 2Q6AA 4XDLA 2A9HA 4P9PA 5EBLC 1KP2A 2CK3G 3D36A 3E8FA 4XDJA 2FTKA 3SJQC 1R3IC 3CCVV 4UVAA 4DXWA 3ETEA 1G8MA 2ITCC 3ETDA 4WFEA 3E83A 4TSFG 4JASA 3OFNG 1KD1W 1VQMV 4QJFB 2WAMA 1NR7A 2XAFA 1DLBA 1NH2B 2UXNA 3SYAA 3ABMB 1K33A 4MVUA 1EFRG 2WLKA 1AR1B 4UXNA 1NKDA 1GTOA 5DM6V 4MS2A 2QM8A 1QVFU 1K5SA 2BOBC 2OCCB 3ABLB 1M57C 2X6CA 3F7VC 3CCSV 4RQEA 5L3DA 3ZN1A 2IJIA 2QM7A 4BIUA 3AG2C 3ASNC 3CXCU 3CC7V 4PDLA 1S0VA 3K08A 1OCZC 3FKSG 4I9WA 3CP1A 4JGSA 3ZN0A 5C93A 1QCEA 2X6AA 1KC8W 4PDMA 4KFMA 3JD0A 2R9RB 1ENVA 3UM7A 5KA5A 1FXVA 3CYOA 5EC2C 2OTLV 3K3WA 5L3FA 1AROP 4GX0A 2ZXWC 5HFLA 5KUKA 2BOCC 4RQFA 2WLMA 2EJRA 3ZCCA 1I5XA 1BL8A 2XOKG 4BIZA 2IJJA 1K4CC 3IGAC 3OGCC 2HKOA 1QR8A 3W7SA 1KQSU 1S5HC 2IJHA 1L1FA 1JX9A 3ABTA 3ABKB 2Y69B 3AG1C 1IXMA 1AJQA 3WG7B 2EIKB 2EIJC 3OMIB 1KKDA 1M56C 5CA3A 1K97A 4PELA 4LBEC 1R3JC 3EHBB 2DYSB 1G4YB 1E1QG 4MVQA 1K73W 1XL4A 1RM1B 4ZBMA 2C2AA 2XNDG 1R6NA 3QNEA 1S3JA 1RPRA 4MVRA 3LDCA 3E8GA 3HPLC 4QNHB 4P2ZA 3T4ZA 3SYCA 3B8NA 2Q67A 1SZTA 1AI6A 1NR1A 3OAAG 3CMAV 1SETA 4GX1A 3RW0A 3CCQV 3FB7C 1JJ2U 5LBQA 2EIMC 1M57B 4L87A 1VQOV 3GB7C 3B8MA 4GCZA 4PA9A 2LFSA 4BAYA 3DTUB 4WFBV 3OEEG 2LP7A 1YJNV 2DWDC 3JD2A 4PA4A 4JPRA 2IU3A 2P6JA 3LDEA 4J9ZB 1DF4A 3F5WC 1H8HG 3X2QB 2AHYA 1YTFB 1Q86W 1OCZB 5B3SC 2IH1C 2P7TC 4U7OA 3G6EV 2GHYA 1SRYA 2ZR2A 3B77A 4JF3A 1S76D 3OR6C 5LHGA 1W0KG 4HAMA 3ZRVA 3ASOC 4LCUC 5CMUA 1Q7YW 1K34A 3OMAB 1YIJV 1YSCA 1V54B 3LNMB 2ATKC 3QO8A 1Q82W 3T4DA 3MHHC 3VOUA 5LHHA 2NLJC 4JAUA 5B1NA 3NXSA 3IFXA 3A0RA 2XASA 1MSWD 3QO7A 1S72V 1MABG 2ZDIC 3AEIA 1PD3A 1F51A 4P9OA 4F4LA 1FFTB 4G28B 3RVZA 1K5QA 1COWG 1QLEC 4CBCA 5E1AC 4GX2A 3RBZA 3HB3B 3E8BA 4DO2A 2DQ3A 1E1RG 3AG1B 3ZMVA 2HG5C 4ZKIA 1K3EA 3F7YC 4WFGA 1YI2V 1M90W 3RVYA 3ZJZA 1PNMA 3PJSK 1H8EG 2EIJB 3FYEB 2W0FC 2QTOA 2HLDG 2WLJA 4KP4A 2R9IA 3E35A 4HYOA 2PI4A 4MW8A 3ETGA 1NQTA 4YXWG 4JTDB 2IJKA 1W0JG 1BHAA 2EILC 2K1EA 1YTFD 2ZD9A 1P7BA 4JTAB 2WLNA 3ZMUA 3ZIAG 2DW4A 3P32A 4P30A 4PDVA 3ABUA 2EZPA 2XAJA 4H33A 4WFAV 1SESA 4H37A 4MTOA 2D3OW 2DYRC 2Z3YA 1OCOC 4J9YB 4QPKA 3K06A 3SPIA 2M7WA 1PNLA 1WPXA 1OZ0A 1F23A 2B1GA 3SPGA 2PI5A 3JD1A 1NJIW 4TT3G 3OW2U 2JIZG 3K9AA 3AG3C 4LC1A 1CPYA 3SPCA 2IH3C 1FXKC 4XBFA 4Q20A 1F4MA 2X7RB 4X8AA 1AI5A 1P4RA 1THZA 3BEHA 3E8HA 3DGEA 2YEVA 3AG4B 2ZDIA 5B3SB 1R6KA 3IC7A 3JCZA 4QE9A 5IYCO 3E86A 3FYIB 1MG1A 3CMEV 4RUFA 1FXHA 4JYCA 4X89A 1Y66A 4FIPC 1V55C 1K7DA 2JDIG 2HVKC 2B5UA 1KP3A 4FMTA 1VQ8V 1WLEA 5IY5C 4N23A 2IW5A 4FK5C 1RPOA 3SPJA 4PA3A 2V1DA 1M9NA 2YEVB 2IU0A 4QE7A 3SYQA 4MVMA 2WLIA 2ZQMA 1JQ0A 2X0LA 3LDDA 5DN6G 1OHHG 5KUMA 2B1IA 1QLEB 3ABMC 4X88A 5FL7G 1R73A 4MTXA 3D3IA 2WLHA 3E89A 1VQPV 5EC1C 4ASUG 2OCCC 2Y48A 4QIWF 3CPWU 4WFHA 4UV9A 1MOFA 3JD3A 4TWKA 3K0DA 4WFFA 3G71V 5CBFA 1GO3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ V;  3I55 V;  4WCE V;  1S72 V;  3CXC U;  4WFB V;  1YIT V;  1K73 W;  3CCM V;  1VQK V;  1YJN V;  1N8R W;  1VQ6 V;  3CC7 V;  1K8A W;  3CC2 V;  1VQL V;  1KD1 W;  1VQM V;  1VQ5 V;  2QA4 V;  3CCL V;  1Q81 W;  1Q86 W;  3G6E V;  1KQS U;  3G4S V;  3CCV V;  1QVG U;  4WFA V;  1YJ9 V;  4WF9 V;  3CCU V;  1KC8 W;  2D3O W;  1YHQ V;  1R73 A;  1M90 W;  1YI2 V;  3CMA V;  3CME V;  1VQ7 V;  2OTL V;  3CCQ V;  1K9M W;  1M1K W;  1VQP V;  1YJW V;  1Q7Y W;  3CCR V;  1YIJ V;  1W2B U;  1JJ2 U;  3CPW U;  5DM6 V;  3CC4 V;  1VQN V;  3CD6 V;  1NJI W;  1Q82 W;  3I56 V;  1VQ4 V;  2QEX V;  1QVF U;  3OW2 U;  3G71 V;  3CCE V;  1VQ9 V;  1VQ8 V;  3CCS V;  1VQO V;  3CCJ V; 
#chains in the Genus database with same CATH topology
 1JFF B;  3K0G A;  2BTO A;  2LGQ A;  4HZ3 A;  2HJF C;  4JV5 O;  3OUF A;  1QVG U;  5LP6 C;  3RYH B;  5B1O A;  1NS1 A;  2N04 A;  4K35 A;  4UB8 Z;  2WWW A;  3LSS A;  2ETN A;  3G67 A;  2BTQ A;  5EYP B;  3CRM A;  1HNW O;  1N36 B;  1J5E O;  3AG3 B;  3CX5 F;  3I55 V;  1B3Q A;  4WCE V;  5JJJ B;  4DV5 B;  3A0B Z;  3QTC A;  2P90 A;  1Y4M A;  4UCT A;  1TGO A;  2ZE6 A;  2HVJ C;  3K9S A;  1ZLZ A;  4OXS A;  4ABM A;  5LHI A;  4GKJ O;  2PY5 A;  5L3G A;  1I5Y A;  1A32 A;  3UKM A;  1YJW V;  4KHP O;  4N21 A;  4DR2 O;  5LOV B;  4OGQ B;  1H2S B;  3O65 A;  1R3L C;  3FX7 A;  2CTP A;  4PA7 A;  3JD4 A;  1VQ6 V;  2JEX A;  4LP8 A;  3N27 A;  1B04 A;  5CA1 B;  4EFB A;  2DMX A;  5BZB A;  4NR1 A;  3ZRW A;  1EN5 A;  3OTF A;  1OV9 A;  5LP6 A;  2XAG A;  3N2G A;  1PM9 A;  4E2L A;  1K4D C;  2H94 A;  2EZO A;  5KMG A;  1XMQ O;  3U11 A;  3HR0 A;  4H44 B;  1VIB A;  1N0N A;  3OMN B;  4PV1 B;  1OCC C;  3L72 H;  4PA6 A;  4DV5 O;  5D5P A;  4O4J A;  3ZRW B;  1GN2 A;  4R7C A;  4MW3 A;  5LP6 B;  1G1X B;  3N2G B;  1KU9 A;  4JAV A;  1FPO A;  3BAB A;  4O2B A;  3DC5 A;  2VS0 A;  4LF8 O;  4E4E A;  1VAR A;  1SZX A;  4MVO A;  4JI4 B;  2QA4 V;  1NH2 D;  2UXX A;  2Q69 A;  2CTW A;  4WF9 V;  4XDK A;  1D5A A;  3WFV A;  1KMI Z;  3S3W A;  3L74 H;  1JCH A;  2YXH A;  2RMK B;  1DTO A;  4I5S A;  2KG7 A;  2AW9 A;  3ABL C;  3CRQ A;  4U7N A;  2QWO B;  3CCE V;  2YXY A;  5TIS Z;  1QHT A;  1S5L Z;  2HP8 A;  4WBN A;  1UJW B;  2DQ0 A;  4UV8 A;  2ITD C;  3AK3 A;  2X6B A;  3JAS B;  5EZY A;  2KG7 B;  2ILM A;  1ORQ C;  2Q68 A;  4R8C A;  4JI6 O;  2DYR B;  5ITZ B;  4DRX A;  3P30 A;  4OX9 B;  1L8D A;  4J7J A;  4MTG A;  1T5E A;  3AK1 A;  4WBN B;  5D5Q A;  3CCM V;  4JYA B;  1FXK B;  1OCC B;  2ZE7 A;  2FML A;  3ABK C;  5HFM A;  2JJ1 G;  4JYB A;  2HHH B;  2Z5U A;  4G2K A;  4O4L B;  4DRX B;  2Q6A A;  4J7Z A;  2A9H A;  1KP2 A;  2CK3 G;  4XDJ A;  3E8F A;  2ZIN A;  2LO1 A;  3N2K A;  4DR5 B;  2DOS A;  2ITC C;  3ETD A;  4LR3 A;  5GTI Z;  5IJ0 A;  4JAS A;  4O4I A;  1BSM A;  4QJF B;  2OCH A;  5IE9 A;  4MVU A;  1GTO A;  3ABL B;  4IL6 Z;  5IJ0 B;  2IJI A;  3AG2 C;  4X64 B;  5JJE B;  2FKX A;  2HEP A;  3K08 A;  4CS3 A;  4JYA O;  1BQ0 A;  3OGI B;  2E75 B;  4JGS A;  1MMM A;  4NB5 A;  3M7M X;  1ENV A;  3UM7 A;  2OTL V;  1FXV A;  2HHH O;  5L3F A;  1ARO P;  4DR4 B;  2ZXW C;  1ZAU A;  2F23 A;  1I5X A;  1BL8 A;  2XOK G;  1WB8 A;  1Q90 D;  4DR6 O;  2E5L B;  3J80 N;  5E79 Z;  5F2V O;  4UCO A;  1P7G A;  1KQS U;  3OD4 A;  3ABK B;  2CE4 A;  3AG1 C;  2Z0A A;  2R9A A;  2PUS A;  1WB7 A;  1KKD A;  1WP7 A;  2NR5 A;  4LFA B;  4DV4 B;  3TGU H;  3EHB B;  2IBZ H;  4BW9 A;  4DR3 B;  1XL4 A;  2CTQ A;  1EN6 A;  2XND G;  1S3J A;  4X64 O;  3H1I H;  3LDC A;  3M8A A;  3DXR A;  2JS5 A;  3SYC A;  1BCC H;  2Q67 A;  3HKE B;  3RW0 A;  1NTK H;  3APO A;  3BPZ A;  2R70 A;  3RYF A;  5B5E Z;  5LBQ A;  2EIM C;  3DTU B;  1YJN V;  3JD2 A;  4FLV A;  2JGD B;  4IYI A;  2IU3 A;  3DXR B;  3F5W C;  3X2Q B;  1YTF B;  2AHY A;  1RP3 B;  2E5L O;  4U7O A;  4JF3 A;  1SRY A;  1S76 D;  1I94 B;  4L8J A;  4CH3 A;  1Q7Y W;  5GON B;  5K1P A;  4I0X A;  4UB6 Z;  1Q82 W;  3T4D A;  3MHH C;  3VOU A;  5LMU B;  5B1N A;  4DV4 O;  2XAS A;  3QO7 A;  1S72 V;  1MAB G;  4DR3 O;  1NTZ H;  4NTX A;  4J80 A;  4F4L A;  2ODM A;  1WN7 A;  1K5Q A;  1COW G;  5H2F Z;  2GUZ A;  3HB3 B;  2R72 A;  1E1R G;  3AG1 B;  4O2A A;  4X1I A;  4I0X B;  1PNM A;  3PJS K;  1UPG A;  3UO2 A;  3ZHS A;  1XNQ B;  4ZIB A;  4PHZ A;  2R9I A;  3E35 A;  4HYO A;  3E22 A;  4MW8 A;  4PI0 A;  4LF7 B;  1W0J G;  4X66 O;  2QJ1 A;  2UUB B;  4K0K B;  3KCY A;  2QWN B;  4JI8 O;  3ZMU A;  2DW4 A;  3D8C A;  3P32 A;  4TQF A;  4O2A B;  2XAJ A;  4H37 A;  4Z1V A;  1F7Y A;  1I94 O;  4J9Y B;  4LF6 O;  1WPX A;  2PI5 A;  3QF7 A;  3SPG A;  4DV3 B;  1NJI W;  1HR0 B;  2JIZ G;  3BVO A;  3K9A A;  4UCS A;  4LC1 A;  1CPY A;  2F4V O;  1TUB B;  4J42 A;  5LMU O;  1BS3 A;  3JAT A;  3L71 H;  5JVD B;  2X7R B;  1MSD A;  4I50 A;  3BHP A;  2N74 A;  2RN9 A;  3IAY A;  4DV0 B;  2YIC A;  2YI9 A;  3E86 A;  4IIJ A;  4RUF A;  4X89 A;  1Y66 A;  4FIP C;  5IWA B;  1MA1 A;  2HVK C;  5KAF Z;  2A7W A;  1XNQ O;  1WLE A;  3AK2 A;  4FFB A;  4FK5 C;  2V1D A;  2JRI A;  4NXM B;  2GV9 A;  3SYQ A;  2WLI A;  2ZQM A;  3HKD A;  3ZBH A;  1RFY A;  4TUY A;  3ABM C;  4UCV A;  2OIG A;  3E89 A;  1TA8 A;  5EC1 C;  4X1K A;  3K5L A;  4TWK A;  5C8Y A;  3T1H B;  4YHH O;  5CBF A;  4DV3 O;  1IBM B;  4JI3 B;  2WLI B;  2KQX A;  4TV9 B;  3HKD B;  5K1X A;  4R50 A;  4TUY B;  4RO2 A;  2BCC H;  4DV0 O;  2YDE A;  2QWQ B;  1PL4 A;  1BHB A;  2ADP A;  2Q0O C;  4FJC C;  4G27 B;  1KKC A;  1OCR C;  3RYI A;  2UUA B;  3FB5 C;  4JTC B;  2A06 H;  2JJ2 G;  4NXM O;  1QR9 A;  2QSA A;  2OYQ A;  2M6Y A;  1XDC A;  4B7K A;  3BA9 A;  1Y76 B;  3CJH B;  3FB6 C;  5LXT A;  3OTO B;  4CH4 A;  4EKW A;  4A5U B;  1M1K W;  3TET A;  3OR7 C;  1SER A;  1GKF A;  2YS8 A;  1M56 B;  2PYL A;  3RYI B;  1P49 A;  4X20 A;  1WP8 A;  4JAA A;  1NTM H;  1VQL V;  3SYO A;  3H01 A;  3MDS A;  1AI7 A;  5GTH Z;  1N32 O;  2QDO A;  5LXT B;  2LQT A;  4JI5 B;  1BT8 A;  3K79 A;  4I55 A;  1Q6U A;  1X59 A;  4EFE A;  1WA8 A;  3WB1 A;  2ZNI A;  4ZI7 A;  2HFE C;  3KG2 A;  4YIP A;  3VQW A;  3CC2 V;  5FLX N;  4B3S O;  1BMF G;  5L3C A;  3G4S V;  2W6I G;  4FLZ A;  3M99 B;  4I55 B;  4W4K A;  2NNU A;  1JJO A;  2PZS A;  1IX9 A;  3LNN A;  3OTO O;  5J9P C;  1DGS A;  1U97 A;  1J5E B;  5B66 Z;  3UO3 A;  1Q3E A;  1OCR B;  2A79 B;  1FFX A;  3CRA A;  3FB8 C;  2P4V A;  3VBB A;  5KA6 A;  1SQV H;  4LF4 B;  5CBG A;  5IYD O;  4CH5 A;  4LF5 O;  5IT9 N;  3QVN A;  5KHH A;  2LW1 A;  1HWY A;  3JAL A;  4MVZ A;  4D6T H;  2QKC A;  1YCI A;  4FPP A;  1GM7 A;  2BSK A;  3D36 C;  3KKY A;  3RWR D;  4GKJ B;  3VQY A;  4FFK A;  3KZI Z;  3QO5 A;  4DR2 B;  1XRE A;  3RYC A;  3CC4 V;  1FS0 G;  2ARH A;  1ZSP A;  1VQ9 V;  4MVS A;  5J2U B;  4LF9 O;  4I9Q A;  2QWP B;  3A8T A;  2AXT Z;  5H6R A;  1K8A W;  2FL4 A;  2W6J G;  4NVP A;  2Y0I A;  2BSK B;  1TVK A;  3FD9 A;  2F43 G;  5BXZ A;  1FD9 A;  4JZG A;  4F6R A;  2WSS G;  5CN0 A;  1XMQ B;  2UUC O;  2GDS A;  3W7T A;  3CCJ V;  5CBH A;  2WPD G;  5EIB D;  3THO A;  3ZHT A;  4RUE A;  1H2G A;  3AG4 C;  4IT5 A;  1TVK B;  4LF4 O;  3WG7 C;  1AJN A;  1YJ9 V;  2EIK C;  4ZHQ A;  1AVM A;  4F6R B;  4FM0 A;  2ZM6 B;  1FJG B;  3D36 A;  2F1M A;  2BTQ B;  3TXQ A;  2FYU H;  4LF8 B;  1Q43 A;  3FFQ A;  3E83 A;  4CS4 A;  4UCU A;  3NR7 A;  3VQX A;  3SYA A;  1K33 A;  1EFR G;  3RFR A;  1AR1 B;  4UXN A;  5DM6 V;  1H2L A;  1K5S A;  2BOB C;  2OCC B;  4D7S A;  4U3F H;  2X6C A;  5L3D A;  2QM7 A;  4BIU A;  3ASN C;  3CXC U;  3CC7 V;  2YUA A;  2PF4 E;  4I9W A;  3FKS G;  3I5D A;  2ZE8 A;  4O4H A;  1QU7 A;  1AP6 A;  1KC8 W;  4JI6 B;  1IDS A;  5BR8 O;  4DV2 O;  5KMG B;  2ZM6 O;  1FJG O;  1RSO A;  2EJR A;  3ZCC A;  5CB4 A;  2IJJ A;  3IGA C;  2KKW A;  2HKO A;  4O4H B;  4O4J B;  1QR8 A;  1AR4 A;  1S5H C;  2IJH A;  1L1F A;  1IXM A;  3WG7 B;  2EIK B;  5JQG A;  2EIJ C;  2Q73 A;  3RGB A;  1K97 A;  3JCU Z;  1RSO B;  5DEC A;  4X65 B;  4LH7 A;  4O2B B;  1D5N A;  3CHX A;  5LMN O;  2CTR A;  5BMV A;  4ZBM A;  1GN4 A;  2O57 A;  1U96 A;  3ETQ A;  2ZNJ A;  1M4U A;  4P2Z A;  5JQG B;  3B8N A;  1W59 A;  1MNG A;  1BQZ A;  3FB7 C;  5KHG A;  4FLX A;  4PD4 F;  3L73 H;  5A2Q N;  2VRZ A;  5BMV B;  4JI0 B;  3GB7 C;  3CXH F;  3B8M A;  2LFS A;  4WFB V;  2LP7 A;  3WU2 Z;  4PA4 A;  2XTA A;  4JPR A;  1DF4 A;  3H1L H;  1XQ8 A;  3G6E V;  3B77 A;  5EZY B;  2QR4 A;  5LHG A;  3EVK A;  3ASO C;  1R6T A;  1H2K A;  4GKK O;  1I08 A;  1K34 A;  1HNZ B;  2ATK C;  2VQE O;  5H5N A;  5LHH A;  3A0R A;  4X65 O;  4DR6 B;  2ZDI C;  1AR5 A;  3AEI A;  2BE3 A;  2XT9 A;  1PD3 A;  1F51 A;  5LL6 Y;  3RVZ A;  1N4C A;  1I7F A;  2ZIM A;  1HW7 A;  4ZKI A;  3F7Y C;  4WFG A;  1YI2 V;  3RVY A;  2EIJ B;  3FAV A;  3FYE B;  1GN6 A;  2QTS A;  2QTO A;  2Q0A A;  3N2K B;  4KP4 A;  4BIO A;  1NQT A;  4JTD B;  2IJK A;  4B3T O;  4O4I B;  2EIL C;  4JI0 O;  1GAX A;  2WA4 A;  2QM4 A;  4PDV A;  2EZP A;  4K8Z A;  2F95 B;  2YIB D;  3H9V A;  3K06 A;  3B2E E;  2M7W A;  1PNL A;  1OZ0 A;  1HNZ O;  2IH3 C;  3SR2 C;  4XBF A;  4HNA A;  4Q20 A;  2UU9 B;  2VWJ A;  4ICG A;  3DGE A;  2YEV A;  3R66 A;  2ZDI A;  4H13 B;  1R6K A;  3AG7 A;  4DV7 B;  2VWK A;  4QE9 A;  1MG1 A;  5A9G A;  3CME V;  1IBL O;  1V55 C;  2B5U A;  3S3X A;  5JJN B;  1KP3 A;  2PTM A;  5IY5 C;  5JWP A;  5IYZ A;  4PA3 A;  2WA3 A;  3A0H Z;  2YEV B;  2L35 A;  3LDD A;  3UT5 A;  5DN6 G;  1OHH G;  1X4T A;  3DC6 A;  4AQY O;  1R73 A;  3G6B A;  4MTX A;  5JCO C;  1SQF A;  2WLH A;  4DV6 B;  2Y48 A;  2GTA A;  5KAI Z;  3DSQ A;  1GN3 A;  4WFF A;  4X66 B;  4JI1 O;  1JOY A;  3KCX A;  1PNK A;  2P67 A;  4JI8 B;  2EIL B;  3AG2 B;  2UU9 O;  4FZ1 A;  3TJT A;  1KEC A;  1N33 B;  3SYP A;  1M93 A;  4TV8 A;  4DV7 O;  1ROP A;  2EX3 A;  4LF6 B;  1JMK C;  2ZKO A;  1XL6 A;  3RYF B;  4FLT A;  2F4V B;  2E74 B;  4NTY A;  1B06 A;  2W0X A;  1NI8 A;  2ZXW B;  3TXS A;  1L0N H;  1Y6X A;  1SQX H;  2GSM B;  4GT1 A;  3EXA A;  1LNQ A;  4GX5 A;  4UVB A;  1M5I A;  3ZMS A;  3B09 A;  5KLV H;  5J2T A;  5IYB O;  3K03 A;  3E2E A;  3H1J H;  5L3B A;  1VQ7 V;  3MD0 A;  1YF2 A;  1VMG A;  3CCR V;  2DYS C;  2EBO A;  5JCO A;  1V55 B;  4FLW A;  4NYK A;  4DV6 O;  1VQ4 V;  1RM1 C;  1N34 O;  4TQD A;  5IY5 B;  3RT3 C;  4CS2 A;  2AHZ A;  1XNR B;  1EBO A;  4R6Z A;  1VQ5 V;  1QQC A;  3A2F A;  4YJ3 A;  2GUZ B;  5LA6 A;  5J2T B;  3GWO A;  3EFF K;  2YIA A;  5IDJ A;  1JVM A;  3CCU V;  5B1B C;  1N33 O;  4X1I B;  3CE2 A;  4JYY A;  4UUJ C;  4CH6 A;  3BAA A;  1WAZ A;  4JI7 O;  3L75 H;  5GW7 A;  4UFZ A;  3E22 B;  4YHH B;  1VF6 C;  2HR3 A;  3W7U A;  2AGA A;  3T1Y O;  2OTJ V;  2RJZ A;  2EIM B;  2LW7 A;  3T1C A;  2WLL A;  5LA6 B;  4QPJ A;  3STZ C;  3LUT B;  3CCL V;  3TK1 A;  1QNM A;  4J41 A;  1NU1 H;  3PN1 A;  2XAQ A;  5CA0 A;  3T2M A;  1SQP H;  3K5O A;  1V54 C;  1K9M W;  4YJ2 A;  3L70 H;  1S77 D;  3SJC C;  1GMG A;  1CP9 A;  3OM3 B;  2IM9 A;  3JAT B;  5H6Q A;  2WLL B;  4I50 B;  2JVD A;  1H2M A;  3SJB C;  5CA0 B;  1H38 A;  3ZMZ A;  1NT2 B;  1XNR O;  4DUY B;  1SS3 A;  1PKX A;  3MHS C;  1YXB A;  4J11 A;  2DWE C;  4IIJ B;  1GM9 A;  4DUZ B;  1NVP B;  3LSQ A;  4FFB B;  1AP5 A;  3BA8 A;  2KB1 A;  1DF5 A;  1NZ6 A;  1VF6 A;  4KUM A;  1KYO F;  1QLN A;  2GBO A;  1N32 B;  1IBK O;  1VP7 A;  1AB3 A;  1Q81 W;  1LR1 A;  5KHI A;  2GTS A;  2LFR A;  4GLX A;  2OWO A;  1YHQ V;  1ZWI C;  5B1B B;  4X1K B;  4U3J A;  1XMO B;  4LH6 A;  5C8Y B;  3VQV A;  1KBH A;  3IC9 A;  2HJD A;  4BW5 A;  1TUE B;  1XOU A;  1TAE A;  2YSU B;  4EB6 A;  1N8R W;  4NXN B;  1IZ3 A;  4B3S B;  4UVC A;  3OE7 G;  3IJ4 A;  2Q7G A;  3HKC A;  2Q8V A;  2Y69 C;  2LJ2 A;  1YEW A;  4DUY O;  5IJ9 A;  1LUV A;  1JPX A;  4XDL A;  2UXB O;  5EBL C;  3L9D A;  2FTK A;  4DUZ O;  3SJQ C;  2CGN A;  1R3I C;  4EB6 B;  3U10 A;  1JR9 A;  1WPB A;  1Y67 A;  4IYH A;  3HKC B;  1BZK A;  4TSF G;  4LF5 B;  3SJA C;  4LFB O;  1KD1 W;  4B08 A;  5IJ9 B;  1NR7 A;  2XAF A;  3K58 A;  1DLB A;  2UXN A;  3ABM B;  4LWS A;  2CH7 A;  1XBL A;  1ZX3 A;  2WLK A;  2E76 B;  4QGP A;  4X62 B;  3GWK C;  1NKD A;  4MS2 A;  1QVF U;  4X20 B;  1XMO O;  4LF9 B;  3CCS V;  3D3Q A;  3ICX A;  1Q5O A;  4RQE A;  3ZN1 A;  4X9Q A;  2A3Q A;  1O9G A;  4PDL A;  5FNV A;  1S0V A;  1OCZ C;  3JAR A;  4NXN O;  2L6L A;  3MAQ A;  3ZN0 A;  5C93 A;  2VQF B;  2P5O A;  4LWS B;  2CH7 B;  3JD0 A;  2R9R B;  3JAK A;  4RWU A;  5KA5 A;  1VF7 A;  3CYO A;  5EC2 C;  3K3W A;  3SGI A;  1WA8 B;  2ADQ B;  2UUC B;  5KUK A;  1G6U A;  4ZI7 B;  2WLM A;  1Z5V A;  3JAR B;  4BIZ A;  1V9P A;  3ZS8 C;  3W7S A;  1JX9 A;  2Y69 B;  2E3C A;  3O9O A;  1AJQ A;  1HNX B;  5LYJ A;  1FYJ A;  1EZV H;  3OMI B;  1YZB A;  3J81 N;  1ZL8 A;  5CA3 A;  4FLY A;  4LBE C;  2N05 A;  4FM2 A;  1R3J C;  3BCC H;  1HDJ A;  2YXL A;  4X62 O;  2D2C B;  4DR7 B;  2YID A;  1XIL A;  2F66 C;  1FFX B;  4MVQ A;  3H1H H;  4B3M O;  1R6N A;  3APQ A;  1IVS A;  4MVR A;  3JAL B;  4OPH A;  2Q7E A;  3E8G A;  2PGG A;  3T4Z A;  5BY1 A;  1AIL A;  2UXD B;  1VF5 B;  1ZL8 B;  2VQF O;  1NR1 A;  3CMA V;  3RYC B;  3CCQ V;  1JJ2 U;  2Q4P A;  4F6E A;  5EYP A;  4GCZ A;  4PA9 A;  4I7Z B;  2DWD C;  1OJH A;  2V4D A;  2P6J A;  1HP8 A;  1P84 F;  2Y4T A;  1Q86 W;  1OCZ B;  2IH1 C;  2H3O A;  2GHY A;  5BR8 B;  1W0K G;  4DV2 B;  4LCU C;  3ZHR A;  1HNX O;  1GH6 A;  3OMA B;  1YIJ V;  3QO8 A;  5LOV A;  4JAU A;  2B9Z A;  1MSW D;  4DR7 O;  3JAM N;  4FVM A;  1FFT B;  4G28 B;  4LNU A;  1L0L H;  5E1A C;  4ZHQ B;  4GX2 A;  4DO2 A;  2DQ3 A;  4H0L B;  5CA1 A;  2HG5 C;  1M90 W;  3CB2 A;  2ZE5 A;  2UXD O;  5KX5 A;  2W0F C;  1BE3 H;  2HLD G;  2WLJ A;  3ETG A;  5LMN B;  4YXW G;  2CAZ C;  3CEI A;  1BHA A;  4IHJ A;  2K1E A;  1WJZ A;  1YTF D;  2Q7H A;  3CSX A;  4LNU B;  3ZIA G;  3ABU A;  4MTO A;  1Q6H A;  2DYR C;  5KX5 B;  4NTW A;  2Z3Y A;  1OCO C;  3K59 A;  4DW1 A;  3F5T A;  2B1G A;  1XHZ A;  4Q6G A;  3SPC A;  4IHJ B;  1FXK C;  1N36 O;  1I0H A;  4UCR A;  1F4M A;  4X8A A;  2QKA A;  1THZ A;  3K57 A;  3AG4 B;  4KL1 A;  1IUR A;  4FZ0 A;  4GKK B;  1FXH A;  2VQE B;  1K7D A;  2JDI G;  2CGO A;  1KB9 F;  5CB4 B;  1GRJ A;  2EUL A;  4EEQ A;  3UQ8 A;  2NN4 A;  2F93 B;  3RN4 A;  1JQ0 A;  2X0L A;  4NKG B;  2P4K A;  5FL7 G;  4X88 A;  3LSU A;  3HKB A;  4KXR A;  3JAS A;  1VQP V;  4ASU G;  4QIW F;  3CPW U;  1Q6I A;  4UV9 A;  3G80 A;  5ITZ A;  3K0D A;  3G71 V;  4B3T B;  4H33 A;  1GO3 F;  2CDY A;  1YIT V;  3OEH G;  1VQK V;  5LGN A;  4BR6 A;  3ASN B;  1FXK A;  5B1A C;  4B3R B;  3HKB B;  5FPO A;  2AZ2 A;  4CC5 A;  1SQG A;  4O4L A;  1OCO B;  4MT8 A;  2H8P C;  2YC0 A;  4PJ0 Z;  5KHJ A;  5JH7 A;  2KSD A;  1MZF A;  2QGN A;  5EIB C;  4W4L A;  2OIE A;  1J95 A;  1IXB A;  4JI4 O;  3JSL A;  3SDL A;  1NVP D;  3JAW A;  1IBL B;  3ZRS A;  1PL0 A;  3JYC A;  3W7W A;  2JK5 C;  5JH7 B;  3K5N A;  3P3N A;  1PPJ H;  2ZR3 A;  2P06 A;  1AI4 A;  4J7K A;  4JI2 B;  3WB0 A;  4AQY B;  3JAW B;  4DYL A;  3ZHU A;  4B3R O;  3ZRX A;  1URF A;  1SA0 A;  1Z5W A;  3FAV B;  1N0J A;  3CD6 V;  1W2B U;  4AIL C;  1VQN V;  2QWR B;  3SPH A;  5EBW C;  4OX9 O;  4JI1 B;  2MK3 A;  1SQB H;  4J10 A;  4C7U A;  1F4N A;  1DK1 A;  1YDX A;  1B6Q A;  3X2Q C;  3K04 A;  4PDR A;  2EIN C;  3ML0 A;  4PI2 A;  5B1A B;  3UCS C;  1SA0 B;  4B7E A;  1GM8 A;  4DR1 B;  1E79 G;  5EK0 A;  1R3K C;  1XHX A;  3ASO B;  4Z1M G;  1R1B A;  1PV0 A;  1AJP A;  4HNA B;  3W7X A;  4DR5 O;  1CEZ A;  1QBZ A;  4AHC A;  1SF9 A;  4GZR B;  5H9C A;  2JEU A;  4TOI A;  2G38 A;  4JI2 O;  1SQQ H;  4GYC B;  1GK9 A;  3STL C;  1EZJ A;  4K3A A;  4DV1 B;  1KUQ A;  3C3S A;  4IGG A;  3HKE A;  4X1Y A;  2CUG A;  3CRR A;  4K8X A;  2QEX V;  5EBM C;  1N34 B;  5LGT A;  5IYZ B;  1K92 A;  2V7Q G;  4FM1 A;  4MSW C;  2UXC B;  2JGD A;  3UT5 B;  5L3E A;  2XUM A;  1VEW A;  2QKS A;  3TCU A;  3ZMT A;  4OPA A;  3ZX6 A;  3P3P A;  1XEQ A;  2OT5 A;  4X1Y B;  1Z2G A;  4JI7 B;  4YY3 B;  4DR1 O;  5LGU A;  2RNB A;  5GON A;  3I56 V;  4MTF A;  4DR4 O;  2P22 C;  3T1Y B;  4RAI A;  1NBM G;  3ZHV A;  3R65 A;  2MW2 B;  2EIN B;  4CZZ A;  3BFR A;  2QE7 G;  3C90 A;  3OUS A;  2RQ6 A;  2XAH A;  4TV8 B;  2A0L A;  4DW0 A;  3BY6 A;  4P9P A;  4DV1 O;  4LFA O;  3CCV V;  4UVA A;  4DXW A;  3ETE A;  1G8M A;  4WFE A;  1YVW A;  3OFN G;  1PP9 H;  1VQM V;  4I4T A;  4BWA A;  2WAM A;  2UXC O;  3K5M A;  4LFC B;  4FLU A;  1NH2 B;  2JGU A;  3Q4H A;  4CC6 A;  2Y4U A;  4YY3 O;  3WB2 A;  2QM8 A;  5KHK A;  1M57 C;  1EM1 A;  3F7V C;  1XI1 A;  1S5J A;  1H2N A;  3B4S A;  1TUB A;  2K9P A;  1IBK B;  4I4T B;  4YJ3 B;  5JVD A;  3B40 A;  3CP1 A;  2YI8 A;  1BGY H;  1QCE A;  2X6A A;  4PDM A;  3Q4H B;  4KFM A;  4GX0 A;  5HFL A;  2BOC C;  4RQF A;  2JS3 A;  2RCV A;  3QG5 A;  1K4C C;  3OGC C;  4JZ2 A;  1XUQ A;  3ABT A;  4HBN A;  3C3T A;  2AZ0 A;  2UXB B;  4YJ2 B;  3U0Z A;  4LFC O;  1M56 C;  3BRC A;  4PEL A;  1US6 A;  2DYS B;  1G4Y B;  1E1Q G;  1D2D A;  1K73 W;  4LFB B;  1RM1 B;  4LF7 O;  2C2A A;  2UUB O;  1FAF A;  3QNE A;  1RPR A;  4TV9 A;  1Y74 A;  4K0K O;  2ZCE A;  1MZE A;  3HPL C;  4QNH B;  4DK1 A;  1SZT A;  1AI6 A;  3OAA G;  4Z2W A;  1SET A;  4GX1 A;  2DN9 A;  4ZOL A;  2YIB A;  1HR0 O;  1M57 B;  4L87 A;  1VQO V;  4BAY A;  1Y74 B;  3OEE G;  1ZUQ A;  3LDE A;  4J9Z B;  3J7A U;  1H8H G;  1EN4 A;  5B3S C;  2P7T C;  2ZR2 A;  3CRC A;  4D7T A;  3OR6 C;  1Y76 A;  3CJH A;  5FPR A;  4HAM A;  4U3J B;  3ZRV A;  5CMU A;  4ZOL B;  1FKA O;  1YSC A;  1V54 B;  3LNM B;  5IWA O;  2NLJ C;  3NXS A;  3IFX A;  4P9O A;  2ZIO A;  3CWB H;  1JA8 A;  1QLE C;  4CBC A;  3RBZ A;  3E8B A;  1CXZ B;  3ZMV A;  1K3E A;  1SKV A;  3ZJZ A;  1H8E G;  2FB5 A;  1O9H A;  2PI4 A;  5AG2 A;  3T1H O;  1IBM O;  4B3M B;  2ZD9 A;  1P7B A;  2Y0P A;  4JTA B;  4JI3 O;  2WLN A;  4P30 A;  4WFA V;  1SES A;  2D3O W;  3GVM A;  4AI8 A;  3ZHQ A;  2EJ7 A;  4QPK A;  3SPI A;  1F23 A;  3JD1 A;  3OT7 A;  4TT3 G;  3OW2 U;  2RDC A;  3AG3 C;  5FNV B;  4JV5 B;  2UUA O;  1AI5 A;  1P4R A;  2LGW A;  3BEH A;  3E8H A;  2XHB A;  5B3S B;  2DJV A;  3IC7 A;  3JAK B;  3JCZ A;  1UFI A;  4YIO A;  5IYC O;  3H1K H;  3FYI B;  4JYC A;  4GUN A;  1WNS A;  1HNW B;  5DED A;  2Q5Z A;  3JSN A;  3CS5 A;  4FMT A;  1VQ8 V;  4N23 A;  2IW5 A;  1SC5 B;  1RPO A;  3SPJ A;  5J2U A;  1M9N A;  2DE0 X;  1JFF A;  2IU0 A;  4QE7 A;  2PYJ A;  4MVM A;  1Q8I A;  2Q9L A;  4DK0 A;  5KUM A;  2B1I A;  1QLE B;  5LYJ B;  1ZTE A;  4KHP B;  3D3I A;  3ZED A;  4JI5 O;  3RYH A;  2ZT9 B;  1LUW A;  2OCC C;  4WFH A;  1MOF A;  3JD3 A; 
#chains in the Genus database with same CATH homology
 1JOY A;  1PNK A;  3K0G A;  1YIT V;  2P67 A;  2WLI B;  3OEH G;  5LGN A;  1VQK V;  2EIL B;  3AG2 B;  3ASN B;  1FXK A;  4HZ3 A;  2HJF C;  4R50 A;  5B1A C;  1KEC A;  3OUF A;  1QVG U;  4RO2 A;  3SYP A;  5B1O A;  1ROP A;  2WWW A;  1OCO B;  3LSS A;  4MT8 A;  1XL6 A;  1BHB A;  4FJC C;  2H8P C;  4G27 B;  1OCR C;  2ZXW B;  3AG3 B;  3I55 V;  4WCE V;  2GSM B;  4GT1 A;  1LNQ A;  4GX5 A;  4UVB A;  3FB5 C;  1J95 A;  4JTC B;  2JJ2 G;  2P90 A;  1QR9 A;  1Y4M A;  3ZMS A;  2HVJ C;  4OXS A;  5LHI A;  5IYB O;  1NVP D;  3K03 A;  3E2E A;  3FB6 C;  5L3B A;  1VQ7 V;  3MD0 A;  3ZRS A;  1PL0 A;  4EKW A;  1M1K W;  5L3G A;  1I5Y A;  3UKM A;  1YJW V;  3TET A;  3OR7 C;  3JYC A;  3W7W A;  3CCR V;  1GKF A;  2JK5 C;  2DYS C;  2EBO A;  1SER A;  4N21 A;  1V55 B;  1M56 B;  1VQ4 V;  1RM1 C;  1R3L C;  2ZR3 A;  1AI4 A;  5IY5 B;  4PA7 A;  2AHZ A;  3JD4 A;  1VQ6 V;  2JEX A;  1EBO A;  1VQL V;  4R6Z A;  3SYO A;  3H01 A;  4LP8 A;  1VQ5 V;  1AI7 A;  3GWO A;  3EFF K;  3ZRX A;  5IDJ A;  1JVM A;  3CCU V;  5B1B C;  5BZB A;  3ZRW A;  4UUJ C;  3K79 A;  2XAG A;  3CD6 V;  1W2B U;  1VQN V;  5GW7 A;  3SPH A;  5EBW C;  4E2L A;  2MK3 A;  1K4D C;  2H94 A;  2HR3 A;  2EZO A;  1F4N A;  3W7U A;  2OTJ V;  2HFE C;  2EIM B;  3KG2 A;  1B6Q A;  3OMN B;  3T1C A;  3X2Q C;  2WLL A;  3K04 A;  4PDR A;  3CC2 V;  1OCC C;  2EIN C;  4QPJ A;  3ML0 A;  4PA6 A;  3LUT B;  3STZ C;  3CCL V;  1BMF G;  5B1A B;  3TK1 A;  5L3C A;  3G4S V;  2W6I G;  2XAQ A;  3M99 B;  3ZRW B;  4R7C A;  1GM8 A;  4MW3 A;  3T2M A;  1E79 G;  2NNU A;  5EK0 A;  1R3K C;  1V54 C;  1K9M W;  4JAV A;  3ASO B;  1S77 D;  5J9P C;  1GMG A;  4Z1M G;  1CP9 A;  3OM3 B;  1AJP A;  5H6Q A;  1OCR B;  2WLL B;  3W7X A;  1CEZ A;  1QBZ A;  2A79 B;  3FB8 C;  3VBB A;  5KA6 A;  5CBG A;  5IYD O;  4MVO A;  5H9C A;  2JEU A;  2QA4 V;  1NH2 D;  1H38 A;  3ZMZ A;  1HWY A;  1PKX A;  3MHS C;  4MVZ A;  2UXX A;  2Q69 A;  4WF9 V;  4XDK A;  1GK9 A;  4FPP A;  1GM7 A;  3WFV A;  2DWE C;  3STL C;  1EZJ A;  1GM9 A;  1JCH A;  1DTO A;  4I5S A;  3QO5 A;  1NVP B;  3CC4 V;  1FS0 G;  3ABL C;  4U7N A;  3LSQ A;  2QEX V;  5EBM C;  5LGT A;  1K92 A;  3CCE V;  1VQ9 V;  4MVS A;  2KB1 A;  2V7Q G;  1DF5 A;  4KUM A;  5H6R A;  1UJW B;  1QLN A;  1K8A W;  2DQ0 A;  4MSW C;  4UV8 A;  2W6J G;  2ITD C;  5L3E A;  1Q81 W;  2QKS A;  2X6B A;  3TCU A;  2LFR A;  3ZMT A;  1YHQ V;  2OT5 A;  1ZWI C;  1ORQ C;  5B1B B;  2F43 G;  2Q68 A;  4R8C A;  2DYR B;  5LGU A;  3P30 A;  2WSS G;  5CN0 A;  4MTG A;  3I56 V;  4MTF A;  3W7T A;  3CCJ V;  5CBH A;  2WPD G;  4BW5 A;  1TUE B;  4RAI A;  1NBM G;  2YSU B;  3CCM V;  1N8R W;  3R65 A;  4RUE A;  1FXK B;  1H2G A;  3AG4 C;  4UVC A;  1OCC B;  2EIN B;  3OE7 G;  4CZZ A;  2QE7 G;  3ABK C;  2Y69 C;  5HFM A;  3OUS A;  3WG7 C;  1AJN A;  1YJ9 V;  2JJ1 G;  2EIK C;  2XAH A;  2A0L A;  4JYB A;  3BY6 A;  2Z5U A;  4G2K A;  1JPX A;  2Q6A A;  4XDL A;  2A9H A;  4P9P A;  5EBL C;  1KP2 A;  2CK3 G;  3D36 A;  3E8F A;  4XDJ A;  2FTK A;  3SJQ C;  1R3I C;  3CCV V;  4UVA A;  4DXW A;  3ETE A;  1G8M A;  2ITC C;  3ETD A;  4WFE A;  3E83 A;  4TSF G;  4JAS A;  3OFN G;  1KD1 W;  1VQM V;  4QJF B;  2WAM A;  1NR7 A;  2XAF A;  1DLB A;  1NH2 B;  2UXN A;  3SYA A;  3ABM B;  1K33 A;  4MVU A;  1EFR G;  2WLK A;  1AR1 B;  4UXN A;  1NKD A;  1GTO A;  5DM6 V;  4MS2 A;  2QM8 A;  1QVF U;  1K5S A;  2BOB C;  2OCC B;  3ABL B;  1M57 C;  2X6C A;  3F7V C;  3CCS V;  4RQE A;  5L3D A;  3ZN1 A;  2IJI A;  2QM7 A;  4BIU A;  3AG2 C;  3ASN C;  3CXC U;  3CC7 V;  4PDL A;  1S0V A;  3K08 A;  1OCZ C;  3FKS G;  4I9W A;  3CP1 A;  4JGS A;  3ZN0 A;  5C93 A;  1QCE A;  2X6A A;  1KC8 W;  4PDM A;  4KFM A;  3JD0 A;  2R9R B;  1ENV A;  3UM7 A;  5KA5 A;  1FXV A;  3CYO A;  5EC2 C;  2OTL V;  3K3W A;  5L3F A;  1ARO P;  4GX0 A;  2ZXW C;  5HFL A;  5KUK A;  2BOC C;  4RQF A;  2WLM A;  2EJR A;  3ZCC A;  1I5X A;  1BL8 A;  2XOK G;  4BIZ A;  2IJJ A;  1K4C C;  3IGA C;  3OGC C;  2HKO A;  1QR8 A;  3W7S A;  1KQS U;  1S5H C;  2IJH A;  1L1F A;  1JX9 A;  3ABT A;  3ABK B;  2Y69 B;  3AG1 C;  1IXM A;  1AJQ A;  3WG7 B;  2EIK B;  2EIJ C;  3OMI B;  1KKD A;  1M56 C;  5CA3 A;  1K97 A;  4PEL A;  4LBE C;  1R3J C;  3EHB B;  2DYS B;  1G4Y B;  1E1Q G;  4MVQ A;  1K73 W;  1XL4 A;  1RM1 B;  4ZBM A;  2C2A A;  2XND G;  1R6N A;  3QNE A;  1S3J A;  1RPR A;  4MVR A;  3LDC A;  3E8G A;  3HPL C;  4QNH B;  4P2Z A;  3T4Z A;  3SYC A;  3B8N A;  2Q67 A;  1SZT A;  1AI6 A;  1NR1 A;  3OAA G;  3CMA V;  1SET A;  4GX1 A;  3RW0 A;  3CCQ V;  3FB7 C;  1JJ2 U;  5LBQ A;  2EIM C;  1M57 B;  4L87 A;  1VQO V;  3GB7 C;  3B8M A;  4GCZ A;  4PA9 A;  2LFS A;  4BAY A;  3DTU B;  4WFB V;  3OEE G;  2LP7 A;  1YJN V;  2DWD C;  3JD2 A;  4PA4 A;  4JPR A;  2IU3 A;  2P6J A;  3LDE A;  4J9Z B;  1DF4 A;  3F5W C;  1H8H G;  3X2Q B;  2AHY A;  1YTF B;  1Q86 W;  1OCZ B;  5B3S C;  2IH1 C;  2P7T C;  4U7O A;  3G6E V;  2GHY A;  1SRY A;  2ZR2 A;  3B77 A;  4JF3 A;  1S76 D;  3OR6 C;  5LHG A;  1W0K G;  4HAM A;  3ZRV A;  3ASO C;  4LCU C;  5CMU A;  1Q7Y W;  1K34 A;  3OMA B;  1YIJ V;  1YSC A;  1V54 B;  3LNM B;  2ATK C;  3QO8 A;  1Q82 W;  3T4D A;  3MHH C;  3VOU A;  5LHH A;  2NLJ C;  4JAU A;  5B1N A;  3NXS A;  3IFX A;  3A0R A;  2XAS A;  1MSW D;  3QO7 A;  1S72 V;  1MAB G;  2ZDI C;  3AEI A;  1PD3 A;  1F51 A;  4P9O A;  4F4L A;  1FFT B;  4G28 B;  3RVZ A;  1K5Q A;  1COW G;  1QLE C;  4CBC A;  5E1A C;  4GX2 A;  3RBZ A;  3HB3 B;  3E8B A;  4DO2 A;  2DQ3 A;  1E1R G;  3AG1 B;  3ZMV A;  2HG5 C;  4ZKI A;  1K3E A;  3F7Y C;  4WFG A;  1YI2 V;  1M90 W;  3RVY A;  3ZJZ A;  1PNM A;  3PJS K;  1H8E G;  2EIJ B;  3FYE B;  2W0F C;  2QTO A;  2HLD G;  2WLJ A;  4KP4 A;  2R9I A;  3E35 A;  4HYO A;  2PI4 A;  4MW8 A;  3ETG A;  1NQT A;  4YXW G;  4JTD B;  2IJK A;  1W0J G;  1BHA A;  2EIL C;  2K1E A;  1YTF D;  2ZD9 A;  1P7B A;  4JTA B;  2WLN A;  3ZMU A;  3ZIA G;  2DW4 A;  3P32 A;  4P30 A;  4PDV A;  3ABU A;  2EZP A;  2XAJ A;  4H33 A;  4WFA V;  1SES A;  4H37 A;  4MTO A;  2D3O W;  2DYR C;  2Z3Y A;  1OCO C;  4J9Y B;  4QPK A;  3K06 A;  3SPI A;  2M7W A;  1PNL A;  1WPX A;  1OZ0 A;  1F23 A;  2B1G A;  3SPG A;  2PI5 A;  3JD1 A;  1NJI W;  4TT3 G;  3OW2 U;  2JIZ G;  3K9A A;  3AG3 C;  4LC1 A;  1CPY A;  3SPC A;  2IH3 C;  1FXK C;  4XBF A;  4Q20 A;  1F4M A;  2X7R B;  4X8A A;  1AI5 A;  1P4R A;  1THZ A;  3BEH A;  3E8H A;  3DGE A;  2YEV A;  3AG4 B;  2ZDI A;  5B3S B;  1R6K A;  3IC7 A;  3JCZ A;  4QE9 A;  5IYC O;  3E86 A;  3FYI B;  1MG1 A;  3CME V;  4RUF A;  1FXH A;  4JYC A;  4X89 A;  1Y66 A;  4FIP C;  1V55 C;  1K7D A;  2JDI G;  2HVK C;  2B5U A;  1KP3 A;  4FMT A;  1VQ8 V;  1WLE A;  5IY5 C;  4N23 A;  2IW5 A;  4FK5 C;  1RPO A;  3SPJ A;  4PA3 A;  2V1D A;  1M9N A;  2YEV B;  2IU0 A;  4QE7 A;  3SYQ A;  4MVM A;  2WLI A;  2ZQM A;  1JQ0 A;  2X0L A;  3LDD A;  5DN6 G;  1OHH G;  5KUM A;  2B1I A;  1QLE B;  3ABM C;  4X88 A;  5FL7 G;  1R73 A;  4MTX A;  3D3I A;  2WLH A;  3E89 A;  1VQP V;  5EC1 C;  4ASU G;  2OCC C;  2Y48 A;  4QIW F;  3CPW U;  4WFH A;  4UV9 A;  1MOF A;  3JD3 A;  4TWK A;  3K0D A;  4WFF A;  3G71 V;  5CBF A;  1GO3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...