1K73W

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k73W00
1VQLV 1YJNV 1S72V 1Q82W 4WFBV 3CXCU 3CCVV 1JJ2U 3CMAV 1VQ5V 3G4SV 1K8AW 1VQ9V 3CD6V 3I55V 3CCLV 1VQ4V 3G71V 3CCSV 2QA4V 1K9MW 3CCQV 1KD1W 2QEXV 3CCUV 1QVGU 1YI2V 3CCMV 3CCRV 1VQ7V 1K73W 1N8RW 3CC4V 1YIJV 3CPWU 1R73A 4WF9V 1YJ9V 1YITV 1KQSU 2OTLV 1Q7YW 1W2BU 1M90W 1VQOV 1VQMV 1VQ8V 1VQPV 1KC8W 3CC2V 1Q86W 1YHQV 1VQ6V 2OTJV 4WCEV 2D3OW 4WFAV 1VQNV 3OW2U 3CC7V 5DM6V 1QVFU 1VQKV 3CCJV 1M1KW 3G6EV 1YJWV 3CMEV 3CCEV 3I56V 1NJIW 1Q81W
chains in the Genus database with same CATH superfamily
3HKBA 3H1KH 2LP7A 3OR6C 2HFEC 3H01A 2R9IA 4PA6A 5CN0A 1AP5A 2QDOA 1V54C 3UT5A 5CA3A 1HDJA 2FTKA 2ZE5A 1QQCA 2ZQMA 5FNVB 4IIJA 1VQ6V 1ORQC 3OW2U 1PV0A 4H33A 4X65O 2OCHA 1QR8A 4MS2A 1JVMA 1V9PA 2W0XA 2HHHB 1M57B 3QO5A 5JQGB 1R6NA 1OJHA 1NTMH 3HKCA 2DYRC 2YI9A 3A8TA 2P22C 3CC2V 2FB5A 1R3JC 2Q73A 4J42A 3K57A 3OGIB 1A32A 4ZHQA 2ZDIC 4J7ZA 1ZUQA 1PNMA 1WPXA 4FLWA 2VQEO 1SQBH 1S5HC 4X66O 1YIJV 4WF9V 2FL4A 3FX7A 4WBNB 5EYPA 4IYIA 4R50A 2WLJA 2Q68A 1J5EO 5LMNO 3STLC 5CB4A 1VF6C 2QM7A 1HR0O 4R6ZA 3T1HB 4LF8O 3LDDA 5LYJA 1SQVH 1FYJA 3I55V 2E74B 2QEXV 2UUBO 1SQGA 4YJ3A 4DR1O 1FPOA 1XMQB 3LSSA 3A0HZ 5IE9A 3ABLB 3DXRA 5JH7A 3OE7G 5CBGA 1FXVA 1W0KG 3C3SA 4TQFA 4DR4B 2VQFB 3APOA 1VP7A 1PPJH 1KYOF 4Z1MG 1I7FA 5ITZB 1NH2D 4ICGA 3EXAA 1P7GA 5KHGA 3K0DA 1FFTB 4LR3A 2DE0X 3K5LA 1QBZA 5EZYA 2Q9LA 3SPHA 1I08A 4IHJB 3SJCC 5B3SB 3HPLC 4O4LA 4PDLA 1SQXH 3H1LH 4JAAA 3W7WA 2LGQA 2HG5C 4K8XA 2CTPA 1Q6IA 4B3TB 4E4EA 2VRZA 1XL4A 2ZCEA 3AG4C 2DYSB 2PY5A 4I5SA 1JR9A 1PKXA 1TVKB 3SPCA 3K79A 4X1IB 4GYCB 4XDLA 3K58A 4JI8O 3G6EV 3JAKB 3N2KA 3GB7C 3AG7A 1GAXA 2DQ0A 1KP3A 2LW1A 1K8AW 4I50A 4LF5O 3CEIA 1Q5OA 2F4VB 1GRJA 2QJ1A 4B3RB 4JZ2A 2D2CB 4TOIA 2IM9A 1FXKC 4X1KA 2YDEA 3P3NA 2O57A 3VBBA 1S0VA 3HKDB 5BR8B 2OTJV 3ZN0A 1PNKA 1GM7A 1AB3A 3SDLA 1CP9A 1DF4A 1IDSA 1RM1B 1SERA 5LL6Y 1YJ9V 5IYCO 1MZFA 4Q20A 1FFXB 3K0GA 3W7TA 4AQYO 1AR5A 3RYCB 4NB5A 1OV9A 4TSFG 1H2KA 2F66C 1Q3EA 3CCVV 2DW4A 4FLTA 1TGOA 5H2FZ 5IY5C 2LJ2A 4PA3A 1V55C 4MT8A 4JI3B 2KKWA 3T2MA 5LOVA 2CH7B 3T1YB 5LXTA 5F2VO 4NKGB 1OCRC 5LP6C 4DV4B 2B1GA 3Q4HA 1N33O 2CDYA 1OZ0A 1J95A 4FJCC 3CXCU 1BS3A 4DW1A 2JIZG 1XNRB 3K04A 4EB6B 1P7BA 1YITV 1FXHA 3ABMC 4XDKA 5A9GA 2EIMB 3OEHG 3SJQC 4IGGA 3E8GA 3RFRA 3CC7V 1TA8A 5JJEB 1HNXB 2HEPA 2YSUB 4JGSA 5BMVA 4C7UA 2ZNIA 2WLMA 2N05A 4U7NA 4FMTA 1K4DC 2F93B 4BWAA 2BTQA 2V7QG 4DV6O 1B04A 1VEWA 2Q8VA 5DEDA 4WFEA 1XNQO 3AG2B 4B3MO 2QWNB 4DW0A 1YJWV 4HYOA 4JI7B 4QPKA 1AP6A 2Y48A 1COWG 5CA1B 2YEVB 5LHGA 1NI8A 2AHZA 4P9PA 4OX9B 4X20A 1BGYH 2L6LA 3BPZA 3THOA 4DXWA 1JJ2U 2JS5A 1MOFA 3B8NA 3N2GA 4MVQA 5KHHA 2AZ2A 3HR0A 3QF7A 1KKCA 4O4HB 4RWUA 2VWKA 1HNWO 4I55B 4UV9A 2WLIA 4L87A 3QTCA 3CCEV 3JSLA 4DUYB 4B3RO 5J2TA 1R6KA 3CRRA 2JJ2G 3ZRVA 3BAAA 2OCCC 2BTOA 4RUFA 1ZAUA 3W7UA 2RMKB 4ZOLA 4X1YB 2YIBD 1VIBA 4JASA 3ABTA 1NBMG 4J9YB 1EZJA 5CBHA 3F7YC 2EX3A 1I0HA 2Y4TA 1GMGA 2FMLA 2WSSG 2H94A 3ICXA 3ZHQA 3DC5A 4TT3G 2E5LO 1I94O 4ZBMA 2CUGA 4KFMA 4NXNO 2CGNA 3VOUA 3CJHA 4DV0B 1YI2V 3ZHRA 1R73A 3S3WA 3OD4A 5LGTA 2QSAA 5GW7A 3IJ4A 4NTXA 3PJSK 1SKVA 4EFEA 3J80N 1ZL8B 5KHIA 1D2DA 4O2BA 3IAYA 1BHAA 4OGQB 2EJ7A 3QO8A 4FM1A 4FZ1A 2N04A 3SYCA 2OIGA 4FLZA 4X65B 5KMGA 4QIWF 1VQ7V 2ADPA 3BHPA 3JSNA 4TV8A 4BR6A 2X6AA 5DN6G 4O4IB 5KUMA 4F6RB 1OHHG 2Z5UA 1WAZA 4I7ZB 4EEQA 3L72H 5C93A 4CBCA 3LDEA 5A2QN 3K9AA 3CCSV 3EVKA 4P2ZA 3L70H 1JQ0A 2OWOA 1WB8A 3AG3B 3E8HA 1M90W 1DGSA 5FPRA 2VQEB 1U97A 3F5WC 4O2AB 4X89A 1VQPV 2P6JA 4FFKA 1M4UA 4YIPA 3OUSA 4X66B 4TUYB 5LGUA 3JYCA 1M1KW 1IURA 1OCZB 1BCCH 2C2AA 1J5EB 1MSWD 5LMNB 4H44B 2P06A 1XMOO 3H1JH 2LGWA 5EIBD 3JCUZ 1GK9A 3RWRD 2RJZA 4LNUB 1KB9F 4GUNA 4B3SO 2CAZC 3L71H 1URFA 4JI0O 3BRCA 3JATB 4LF8B 4K35A 1NR7A 2IW5A 4A5UB 2NR5A 4DV7O 2UUBB 2PZSA 1W0JG 4DR1B 1O9HA 3ASNC 4WBNA 3AG1C 3R66A 4N21A 2E75B 1YJNV 1AR4A 4NXMO 3IFXA 3ZRWB 2Q6AA 2DJVA 4YJ2B 3T4ZA 3T4DA 4KUMA 2ILMA 4BIUA 4QGPA 4IL6Z 1YEWA 2P67A 2JGDA 3ZRXA 4GX2A 2Q0AA 4MVOA 2ZM6O 1WB7A 4CH3A 1IX9A 1Y67A 4LF4O 2YIBA 4FPPA 5LBQA 3G6BA 3P30A 3CD6V 2IJKA 4I9WA 1EN4A 3MD0A 3X2QB 3A0RA 1KQSU 1Y74A 1F23A 4GLXA 4DUZO 4X9QA 1CEZA 1SZXA 1MA1A 4PJ0Z 5IJ9A 2IU3A 3M7MX 4LFAO 1M93A 1R3LC 4CS4A 4BW9A 3E83A 2F95B 4Z1VA 4JI8B 4DK0A 1N8RW 3FB8C 4PELA 3OMNB 4WFHA 4LF5B 4JYCA 5B1AC 3K59A 2VS0A 2H3OA 3HB3B 1TVKA 1N32O 4W4LA 3CRMA 4DV3O 1JMKC 5KX5B 3ZRSA 3RYIA 4PV1B 1M9NA 1SETA 2QWRB 2RNBA 2RN9A 2M7WA 1S3JA 4GX1A 2EILC 3ABKB 1OCOB 2UUCO 2ZE6A 4BAYA 4I0XB 2IU0A 2XUMA 1WA8A 1DTOA 2EIKC 1NS1A 3HKDA 2XAFA 4AQYB 5IT9N 4UVBA 2GUZA 2XAJA 5CA0B 2QKAA 5H9CA 1RPRA 1K73W 1TUBB 5C8YA 2Q4PA 1P49A 3RW0A 4JI4O 2IH3C 3H1IH 3RYFA 5D5QA 1X4TA 2KG7A 2HR3A 1K92A 1US6A 3ZMTA 3SGIA 4QE9A 4IYHA 2YI8A 5GTHZ 1N33B 4P30A 1D5NA 1YCIA 4ASUG 5FL7G 1ZTEA 4JPRA 2YIAA 2ODMA 3JD0A 1N36O 1EFRG 1SQFA 5BXZA 2WLNA 3A2FA 5L3DA 2WPDG 3BY6A 4FM0A 3CHXA 5D5PA 3ZEDA 4CZZA 1HW7A 2W6IG 3R65A 4DK1A 1GN3A 1GTOA 4O4JB 4FLVA 4TQDA 4AILC 1SA0B 2DOSA 3UO3A 1HNZO 3JALA 3M99B 1KP2A 3FB6C 3CCJV 1Q6UA 2X6BA 2CE4A 2JEXA 4UB8Z 2UXCO 4DR3O 4U3JA 4DV6B 1VQ5V 2XAGA 1XNQB 4B3MB 1L1FA 5H6RA 3MDSA 2OT5A 4UCUA 3FAVA 3C3TA 3K5NA 2CK3G 3OUFA 1IVSA 2XAHA 4PA7A 5LHHA 3E8BA 2XNDG 1PL4A 4L8JA 3OM3B 3LSUA 2YC0A 4QPJA 2GHYA 1ROPA 1VQ9V 1M57C 4QJFB 5L3FA 2GDSA 2ZXWB 5IY5B 5EBWC 4DRXA 2XAQA 1QR9A 2HKOA 3TJTA 4CH4A 3SYAA 2EULA 4H37A 2EIJC 1Q86W 4GZRB 1XBLA 3D36A 4H0LB 1IXMA 1MZEA 3FB5C 4EKWA 1XILA 1HWYA 3DGEA 1NJIW 4UXNA 1FJGO 1Y76A 2CTWA 3TK1A 1HNWB 3ZCCA 4I4TA 4U7OA 1XOUA 1Q43A 1SF9A 4OXSA 1VQ4V 3P32A 1N34O 1CXZB 1KKDA 1SS3A 2X7RB 4JZGA 2JVDA 1EBOA 5TISZ 4YY3O 2EINB 2LO1A 1LNQA 1AILA 1PP9H 3K06A 3JAWB 3ZHVA 2R70A 3BABA 2B9ZA 3ZMZA 2E5LB 4IIJB 1I94B 4GKKO 3ABLC 1QCEA 4NXNB 5GONB 5IDJA 1AI5A 5IYZA 5KLVH 3K08A 1LR1A 1YTFB 1P4RA 2BOCC 2X0LA 2DQ3A 1QLEB 4YXWG 3RVYA 3ZN1A 1AI7A 1NTZH 3HKCB 1KD1W 3U0ZA 3CXHF 2R9RB 5KA6A 4LBEC 4CH6A 3E86A 3VQWA 2K9PA 4LFBO 4ZHQB 5L3CA 3U11A 3WB0A 1AJPA 3SYOA 1AVMA 2Y69B 1IBMO 2NNUA 4J10A 3W7SA 2EZPA 3FFQA 3IGAC 2JEUA 5EYPB 3E35A 2YUAA 3ZMSA 4PDRA 4G27B 3OT7A 4DR7O 5CB4B 2KB1A 4TV9A 1RSOA 3F7VC 4HBNA 1R3KC 4LC1A 2JJ1G 2WLLA 5EBMC 2UUAO 4F6RA 5LYJB 4HNAB 2YXLA 1OCCB 5B1NA 1LUWA 3JASA 4YJ3B 4UCTA 3LUTB 1TAEA 1KU9A 2OCCB 1BQZA 4CC6A 5JH7B 1XMOB 1Q8IA 3B09A 4IT5A 4X62B 4B3SB 3E8FA 4UB6Z 4JI0B 3WB1A 5B1OA 4O2AA 4G28B 4DO2A 1AROP 1B6QA 4DV7B 1JJOA 1RM1C 3ZX6A 3AK2A 5EZYB 1VF5B 1PL0A 1SC5B 5EIBC 5LMUO 3PN1A 4LNUA 2QM8A 4NXMB 4K0KO 3JATA 3CS5A 1WLEA 1H2MA 4LWSA 3UCSC 4UCSA 2WAMA 1XEQA 1I5YA 1AR1B 4JYBA 2XASA 1JFFA 2ZM6B 3L74H 1FD9A 4LF4B 3D8CA 4MVRA 2EZOA 3LDCA 4LF9O 3ZRWA 3G67A 3N2KB 1L0LH 3OTOB 3OMIB 4LP8A 2HJFC 4WCEV 3CRCA 2KSDA 4YJ2A 3TXQA 4I50B 4FFBA 3RT3C 2W0FC 4JI2O 3B2EE 3JD1A 1NVPB 4Z2WA 5LA6A 2HVKC 4DUZB 1JOYA 3OGCC 4NTWA 4X1KB 3OMAB 4LFAB 1MG1A 3E22A 5IJ0A 2EIMC 3UM7A 4BIOA 2XTAA 3H1HH 1E1RG 4JYYA 4FK5C 4X64O 1Q6HA 3EFFK 3MHSC 5IWAO 4YHHO 3ZJZA 2YS8A 2ATKC 2ZIOA 3G4SV 4PA9A 1N32B 4DV3B 3NR7A 1G8MA 1IBKO 2Q0OC 3L75H 4YIOA 1VMGA 3GWKC 3AG2C 1X59A 4DR5O 1VQ8V 2HVJC 3VQXA 5J2UB 4QE7A 1JPXA 3ZS8C 5IYDO 1XI1A 3K5MA 1WP7A 3WFVA 2UUCB 5LOVB 4E2LA 1NTKH 3ML0A 3D36C 2GTAA 5KX5A 3WG7B 4D6TH 3CC4V 2PGGA 4ZI7B 1KECA 3Q4HB 4ZIBA 2ZR3A 3SJAC 4LCUC 4JYAO 2PF4E 4I0XA 4BIZA 5FNVA 4PA4A 4JI4B 4FZ0A 2A06H 4UV8A 4JAVA 2HLDG 3O9OA 4J11A 1P84F 1MABG 5CBFA 2N74A 2OTLV 1H2GA 4X8AA 1DK1A 1BQ0A 4MTXA 4ZKIA 4QNHB 1HP8A 1NH2B 3CP1A 5JQGA 3LNMB 3RYHB 2A3QA 4F4LA 2XT9A 5B66Z 3ASOB 1N36B 1F51A 2WWWA 1GO3F 3BA8A 1F4MA 5B1BB 2BTQB 4JTDB 1WJZA 4X62O 4J41A 1YTFD 5GTIZ 3OFNG 1N4CA 1UPGA 4OPAA 3CX5F 1EZVH 1NZ6A 2R72A 1BT8A 4MSWC 1YF2A 3QNEA 1HNZB 4OPHA 1BMFG 2AW9A 2F23A 3LSQA 1KBHA 4X20B 2UXCB 1SQQH 4DR3B 1V54B 4RUEA 3JD4A 1KMIZ 3AK3A 4MW3A 4MTGA 4O4JA 1DF5A 4PHZA 4RO2A 4DR6O 3N2GB 1XL6A 2V4DA 3CWBH 3U10A 4XBFA 2QE7G 3SPGA 2EIKB 3FB7C 4WFBV 5LGNA 2BSKB 2HP8A 5JCOC 3OTOO 1M56C 2QM4A 1WPBA 2UXXA 3D3IA 4UVCA 5ITZA 5J2TB 2A79B 3MAQA 3IC9A 2XHBA 2DYRB 5E1AC 1IBLO 3EHBB 3KCYA 4UFZA 2A7WA 3P3PA 4LF6O 4ZOLB 2EBOA 1WNSA 3ZMVA 4IHJA 3KKYA 2GTSA 5AG2A 3DSQA 3NXSA 3BVOA 3AG3C 1K33A 3RBZA 1BSMA 1L0NH 5EC1C 1FJGB 3CRQA 1N34B 1YHQV 4FLUA 3S3XA 4NR1A 2Q7HA 3HKEB 4YY3B 4X1IA 3B4SA 1JCHA 1JA8A 4UCOA 3JAKA 2QA4V 3CCUV 3QO7A 3W7XA 1S76D 2IBZH 5LHIA 3TETA 1Q7YW 5KA5A 1S5LZ 4DV5O 1G4YB 4GKJO 2RCVA 4KHPO 1H8EG 1YSCA 4GKKB 5EC2C 2X6CA 3JARB 1H2NA 3WB2A 3I56V 5KMGB 2ZINA 1NKDA 4GT1A 4KP4A 4TV8B 4ABMA 4R7CA 3ZBHA 4X88A 3JAWA 2ETNA 1ZLZA 4NTYA 1L8DA 3OEEG 2K1EA 1K97A 4RQFA 3IC7A 2Q5ZA 1Y4MA 1NVPD 2Q7GA 3OTFA 2H8PC 1N0NA 3DC6A 1NQTA 3TCUA 5JJJB 4DV2O 1QU7A 1G1XB 4JI1O 5GONA 1PD3A 2QWPB 4Q6GA 1E79G 3FKSG 5K1XA 1O9GA 4LFBB 3GVMA 1FFXA 2BCCH 3X2QC 3T1CA 3RYCA 2QWOB 4J7JA 1IBMB 1KUQA 1NU1H 3ZIAG 4J7KA 3AG4B 1PM9A 5JJNB 1D5AA 2AHYA 3TXSA 2CH7A 2EIJB 5H6QA 4DR7B 1BHBA 5JVDB 2UXDO 2AZ0A 1GN6A 2UUAB 1BL8A 1Y66A 2QKSA 1Z2GA 4H13B 3CCMV 1XQ8A 1ZSPA 3MHHC 3RN4A 4FLXA 4JI6B 2PI5A 3AK1A 1FXKB 1YVWA 4EB6A 3DTUB 4FVMA 3WU2Z 5KHJA 3ETEA 4K8ZA 4G2KA 4JI5O 2ITDC 4HNAA 1S77D 3CCLV 1FKAO 1BE3H 3CYOA 3ABKC 1OCOC 1GN4A 1FS0G 2JGDB 5EK0A 2P90A 3UO2A 2B1IA 4MTOA 2PUSA 1XHXA 1K4CC 2FYUH 2ZNJA 5DM6V 1QHTA 5LMUB 5J9PC 3A0BZ 3KCXA 3QG5A 4K0KB 4NYKA 3CMAV 4JV5O 1Y74B 1AJNA 2L35A 4JF3A 3CCRV 2NN4A 5CMUA 5IJ9B 1V55B 3ETGA 3STZC 4UVAA 2IJIA 2Z3YA 4WFFA 5BZBA 1YZBA 5CA1A 1OCRB 2YEVA 2LW7A 5LP6B 2W6JG 4LF9B 2M6YA 2JDIG 3BEHA 2DWEC 1XREA 4N23A 3J81N 4JI2B 1QVGU 2B5UA 2Y0PA 3D3QA 4LFCO 1ENVA 4LH7A 2OIEA 1VQOV 3ABMB 3HKBB 3SPIA 2RQ6A 3BA9A 4PDMA 3RYIB 4MW8A 1MNGA 1RPOA 4O4HA 2P4VA 3UT5B 4I55A 2UXBO 4GX5A 2G38A 3G71V 4X64B 5L3EA 5IWAB 4YHHB 2UU9O 5FLXN 4B08A 3ZMUA 4JTCB 4DR2O 1WA8B 4X1YA 2HJDA 3I5DA 2GUZB 1QVFU 4PD4F 1IBKB 4P9OA 2QTSA 4DR5B 5KUKA 1G6UA 5C8YB 2CTRA 3RVZA 1EN5A 3H9VA 1K9MW 2YIDA 4CS2A 4F6EA 3VQYA 3RYFB 5B3SC 2KG7B 2ZT9B 1VQMV 3SPJA 3G80A 1M5IA 3JD2A 4FIPC 3CCQV 1R3IC 2HHHO 3UKMA 5J2UA 2ZXWC 1JX9A 4LF7B 3KZIZ 2DWDC 4I9QA 1ZL8A 3LNNA 2DYSC 4JYAB 2Q69A 4KXRA 2OYQA 1DLBA 4HAMA 4JTAB 2ZE8A 3SYQA 2F43G 3QVNA 1ZWIC 1VARA 5L3GA 3ZHUA 1GM9A 5JCOA 4ZI7A 1EM1A 4TWKA 4O4IA 5EBLC 1R1BA 1RFYA 3K5OA 3BCCH 2A9HA 1Q82W 1TUEB 2WLKA 4FLYA 2IJJA 1XUQA 4MTFA 1F7YA 3JALB 4JI6O 1WP8A 2LQTA 3M8AA 3DXRB 3E2EA 4MVZA 2EINC 3O65A 1H8HG 5KHKA 2QR4A 2LFSA 3T1HO 4U3JB 5JWPA 1VQNV 2NLJC 4CS3A 1F4NA 3JAMN 1XMQO 1YXBA 3FYEB 3JCZA 3RYHA 1RP3B 4D7TA 4TUYA 1B06A 4B7EA 3FAVB 2P4KA 3ZHTA 3CE2A 3UQ8A 3GWOA 4O4LB 1Z5WA 1K5QA 2GSMB 4KL1A 1KC8W 4DR4O 1Q90D 2VQFO 1K7DA 3AEIA 2ZR2A 1QLEC 1GH6A 4U3FH 1S72V 2IJHA 1FAFA 4DRXB 4DR6B 2BOBC 2EJRA 1XHZA 2P5OA 2RDCA 1SESA 2BE3A 1Y76B 2Y69C 5KAFZ 4J9ZB 4B3TO 1UJWB 4I4TB 4WFAV 2UXNA 1EN6A 1Z5VA 2MK3A 4BW5A 2PTMA 1VQLV 1H2SB 2YICA 4PDVA 1T5EA 2KQXA 1IBLB 1QNMA 1AI6A 4J80A 4LF6B 2Q67A 2BSKA 1K5SA 2ADQB 3FYIB 4GX0A 2MW2B 3N27A 4PI2A 1OCCC 2P7TC 3ZHSA 4NVPA 1U96A 2F4VO 3CB2A 4XDJA 4JAUA 3VQVA 2PYJA 4RQEA 3K03A 4CH5A 2ZE7A 5BR8O 5IYZB 5HFMA 2JGUA 2ZDIA 4EFBA 2QWQB 4LH6A 1VQKV 4UCRA 3ASNB 3KG2A 2VWJA 4DV1B 3J7AU 4DV5B 3AG1B 4GKJB 4KHPB 4RAIA 1K3EA 1YDXA 1SZTA 2Z0AA 5LXTB 3HKEA 3BFRA 4UUJC 5K1PA 1VF6A 2QGNA 5DECA 2CGOA 4HZ3A 4MVSA 4FM2A 4LF7O 4JI3O 3T1YO 1ZX3A 4DV2B 3JARA 2DN9A 4B7KA 4WFGA 4JI1B 4TV9B 1RSOB 4DV4O 4AHCA 2DMXA 2WLLB 2ZIMA 3F5TA 1M56B 3K3WA 1W2BU 1AJQA 2Y4UA 3CSXA 5CA0A 1MSDA 1E1QG 3JASB 1TUBA 2E76B 1NR1A 1H2LA 1VF7A 2IH1C 5BMVB 2JS3A 2YXYA 1WN7A 3FD9A 1XNRO 1PNLA 2FKXA 4DYLA 3SJBC 1GKFA 2ZKOA 2E3CA 2QKCA 4GCZA 2UXDB 1LUVA 4PI0A 1IZ3A 5KAIZ 3CPWU 2YXHA 2ITCC 1S5JA 1HNXO 2Q7EA 1IXBA 2WLHA 1UFIA 3K9SA 5B1AB 3RGBA 1B3QA 3SR2C 4R8CA 1THZA 5JVDA 3CRAA 1HR0B 3B77A 1SQPH 2R9AA 3B8MA 4MVUA 4JI5B 5HFLA 4LWSB 1GN2A 1I5XA 4JI7O 5BY1A 2EILB 2D3OW 1MMMA 1SA0A 1JFFB 3CMEV 1NT2B 2ARHA 1FXKA 3ETDA 2A0LA 2QTOA 3WG7C 1W59A 1XDCA 5IYBO 1QLNA 4UCVA 4OX9O 2PI4A 2CTQA 5B5EZ 3L9DA 4FFBB 4JV5B 1Y6XA 2WLIB 5FPOA 5LA6B 4MVMA 5E79Z 2XOKG 2WA4A 3OAAG 1K34A 1BZKA 2JRIA 5L3BA 1GM8A 1Q81W 3E22B 2Y0IA 1R6TA 3B40A 3OR7C 3SYPA 5IJ0B 2V1DA 4W4KA 3E89A 4K3AA 3C90A 1N0JA 3JD3A 4DUYO 3L73H 2JK5C 4CC5A 2GBOA 1SRYA 4LFCB 2F1MA 3ASOC 1OCZC 4AI8A 3TGUH 3CJHB 3ETQA 2LFRA 4D7SA 5B1BC 5H5NA 5LP6A 1H38A 3APQA 2GV9A 2UXBB 2AGAA 4DV1O 1AI4A 3ABUA 4O2BB 2UU9B 1CPYA 2PYLA 2ZD9A 4DR2B 4DV0O 2WA3A 2AXTZ
chains in the Genus database with same CATH topology
1AROP 2DWEC 1B6QA 2LP7A 3OR6C 1RM1C 2HFEC 3H01A 2R9IA 3LDEA 4PA6A 5CN0A 3K9AA 3CCSV 1V54C 4N23A 1PL0A 4P2ZA 1QVGU 2B5UA 5CA3A 1JQ0A 1ENVA 3AG3B 2FTKA 3E8HA 1M90W 2ZQMA 1VQOV 3F5WC 2QM8A 1VQPV 4X89A 2P6JA 3ABMB 1VQ6V 1ORQC 3SPIA 3OUSA 4PDMA 1WLEA 5LGUA 3OW2U 3JYCA 4MW8A 1RPOA 2WAMA 1M1KW 4H33A 1I5YA 1AR1B 1OCZB 2C2AA 1MSWD 1QR8A 4JYBA 2XASA 4GX5A 4MS2A 1JVMA 3G71V 1GK9A 5L3EA 1M57B 3QO5A 4MVRA 1R6NA 3ZMUA 4JTCB 2EZOA 1NR7A 3LDCA 2IW5A 2DYRC 3ZRWA 3CC2V 1R3JC 3OMIB 4LP8A 1W0JG 2HJFC 4WCEV 3ASNC 3AG1C 2W0FC 1QVFU 4P9OA 3JD1A 1NVPB 4N21A 2ZDIC 2HVKC 1JOYA 1YJNV 5KUKA 3OGCC 1PNMA 3RVZA 1WPXA 3OMAB 1K9MW 3IFXA 1MG1A 3ZRWB 1S5HC 1YIJV 2Q6AA 4WF9V 3T4ZA 3T4DA 4KUMA 2EIMC 3UM7A 4R50A 4BIUA 5B3SC 2WLJA 1VQMV 2Q68A 3SPJA 1E1RG 3STLC 4FK5C 2P67A 3ZRXA 4GX2A 2QM7A 3EFFK 3MHSC 4MVOA 4R6ZA 3JD2A 4FIPC 3CCQV 1R3IC 3ZJZA 3UKMA 2ATKC 4FPPA 5LBQA 3P30A 3G4SV 3LDDA 2ZXWC 1JX9A 3CD6V 2IJKA 4PA9A 3I55V 4I9WA 2DWDC 2DYSC 2QEXV 2Q69A 3MD0A 3X2QB 3A0RA 1DLBA 4HAMA 1G8MA 4JTAB 1KQSU 3LSSA 3SYQA 2F43G 1F23A 1ZWIC 3AG2C 5L3GA 1GM9A 1VQ8V 1CEZA 2HVJC 3ABLB 4QE7A 3OE7G 5CBGA 2IU3A 4TWKA 1FXVA 1JPXA 5EBLC 5IYDO 1W0KG 1R3LC 3WFVA 2A9HA 1Q82W 1TUEB 2WLKA 4E2LA 3ML0A 2IJJA 3E83A 4MTFA 4CBCA 4Z1MG 1NH2D 3WG7B 3CC4V 1N8RW 3K0DA 3FB8C 1FFTB 3E2EA 1KECA 2EINC 4MVZA 4PELA 1H8HG 3OMNB 1QBZA 4WFHA 2LFSA 4JYCA 2ZR3A 5B1AC 3SPHA 5B3SB 3HPLC 4PDLA 3HB3B 1VQNV 3W7WA 2NLJC 4LCUC 2HG5C 1F4NA 4BIZA 4PA4A 3FYEB 3JCZA 3ZRSA 1M9NA 1SETA 4UV8A 4JAVA 1XL4A 2HLDG 2M7WA 3AG4C 1MABG 5CBFA 2DYSB 3GWOA 1H2GA 4I5SA 2OTLV 4X8AA 1PKXA 1S3JA 4GX1A 2EILC 3ABKB 1OCOB 4MTXA 3SPCA 4QNHB 1K5QA 2GSMB 3K79A 4BAYA 4ZKIA 1NH2B 3CP1A 1KC8W 1K7DA 3AEIA 2ZR2A 3LNMB 4XDLA 2IU0A 1QLEC 4F4LA 1DTOA 2EIKC 3G6EV 3GB7C 3ASOB 1S72V 2IJHA 2XAFA 2DQ0A 1KP3A 1F51A 2WWWA 4UVBA 1GO3F 1K8AW 2XAJA 2BOBC 1F4MA 5H9CA 2EJRA 5B1BB 1RPRA 4JTDB 1K73W 1YTFD 1FXKC 3OFNG 3RW0A 1SESA 3VBBA 1S0VA 2Y69C 4J9ZB 2OTJV 1UJWB 4WFAV 2UXNA 3ZN0A 1PNKA 1GM7A 2IH3C 4MSWC 2MK3A 4BW5A 3QNEA 1CP9A 2HR3A 1VQLV 1K92A 4PDVA 3ZMTA 1BMFG 1DF4A 4QE9A 3LSQA 1AI6A 1RM1B 2Q67A 1SERA 1K5SA 1YJ9V 1V54B 3FYIB 4GX0A 5IYCO 4RUEA 3JD4A 4P30A 4Q20A 4ASUG 5FL7G 4MW3A 4JPRA 4MTGA 3JD0A 1DF5A 3K0GA 3W7TA 1OCCC 4RO2A 1EFRG 2P7TC 1XL6A 4TSFG 4XDJA 4XBFA 4JAUA 2WLNA 2QE7G 3SPGA 2EIKB 3FB7C 5L3DA 2WPDG 4WFBV 3CCVV 2DW4A 5LGNA 3BY6A 4RQEA 5IY5C 3K03A 4CZZA 4PA3A 2W6IG 3R65A 1V55C 4MT8A 1GTOA 3T2MA 1M56C 5HFMA 2ZDIA 2UXXA 3D3IA 4UVCA 1OCRC 2A79B 3M99B 1KP2A 2B1GA 2DYRB 3FB6C 5E1AC 1VQKV 3EHBB 2X6BA 3CCJV 2JEXA 3ASNB 3KG2A 2EBOA 1OZ0A 1J95A 3ZMVA 3AG1B 4FJCC 3CXCU 1VQ5V 2XAGA 4RAIA 3NXSA 1K3EA 2JIZG 1SZTA 3AG3C 4UUJC 1L1FA 5H6RA 1K33A 3RBZA 5EC1C 2OT5A 3K04A 1P7BA 1YITV 1FXHA 3ABMC 4HZ3A 4MVSA 4XDKA 1YHQV 2EIMB 3OEHG 3SJQC 2CK3G 3OUFA 3E8GA 2XAHA 4PA7A 5LHHA 3CC7V 3E8BA 2XNDG 3OM3B 4QPJA 2YSUB 2GHYA 4JGSA 1ROPA 1VQ9V 1JCHA 1M57C 4QJFB 4WFGA 5L3FA 2QA4V 2ZXWB 5IY5B 3CCUV 3QO7A 5EBWC 2WLLB 3W7XA 1S76D 5LHIA 2XAQA 3TETA 1QR9A 2WLMA 2HKOA 1Q7YW 1M56B 3K3WA 4U7NA 1W2BU 1AJQA 4FMTA 5KA5A 1K4DC 3SYAA 4H37A 2EIJC 1E1QG 1G4YB 2V7QG 1Q86W 3D36A 1H8EG 4WFEA 1NR1A 1IXMA 1YSCA 3AG2B 3FB5C 5EC2C 4EKWA 2IH1C 2X6CA 1HWYA 3DGEA 1YJWV 1PNLA 4HYOA 3I56V 1NJIW 4UXNA 1NKDA 4GT1A 4KP4A 3TK1A 4R7CA 3ZCCA 4X88A 1GKFA 4U7OA 4OXSA 1VQ4V 4GCZA 3P32A 1KKDA 4QPKA 2Y48A 3OEEG 1COWG 3CPWU 2K1EA 1K97A 2X7RB 2YEVB 4RQFA 3IC7A 5LHGA 1EBOA 2ITCC 1Y4MA 1NVPD 2H8PC 2AHZA 2EINB 4P9PA 1NQTA 3TCUA 2WLHA 5B1AB 1LNQA 3K06A 1PD3A 1E79G 3FKSG 4DXWA 1JJ2U 4R8CA 1THZA 3X2QC 1MOFA 3B8NA 3T1CA 4MVQA 3B77A 3ZMZA 3ZIAG 3B8MA 4MVUA 3AG4B 5HFLA 3ABLC 1QCEA 5IDJA 1I5XA 2AHYA 1AI5A 2EIJB 2EILB 5H6QA 2D3OW 3K08A 1BHBA 1YTFB 4UV9A 2WLIA 1P4RA 4L87A 3CMEV 3CCEV 1FXKA 2BOCC 2X0LA 2DQ3A 3ETDA 1QLEB 1R6KA 2JJ2G 3ZRVA 2A0LA 4YXWG 3RVYA 2QTOA 3WG7C 3ZN1A 2OCCC 1AI7A 1BL8A 4RUFA 3W7UA 1Y66A 1KD1W 5IYBO 1QLNA 2QKSA 2PI4A 3CCMV 4JASA 2R9RB 5KA6A 3ABTA 1NBMG 4J9YB 4LBEC 3MHHC 1EZJA 3E86A 5CBHA 2WLIB 3F7YC 2PI5A 4MVMA 5L3CA 1FXKB 2XOKG 1GMGA 1AJPA 3OAAG 3SYOA 2WSSG 1K34A 2H94A 2Y69B 5L3BA 1GM8A 2NNUA 3DTUB 3W7SA 4TT3G 1Q81W 2EZPA 3ETEA 4ZBMA 4G2KA 3IGAC 2ITDC 4KFMA 3OR7C 3SYPA 1S77D 2JEUA 3CCLV 2V1DA 3E35A 3VOUA 3ZMSA 4PDRA 3CYOA 4G27B 1YI2V 3E89A 3ABKC 1OCOC 1R73A 1FS0G 2KB1A 3F7VC 3JD3A 1R3KC 5LGTA 5EK0A 2JK5C 2P90A 4LC1A 2JJ1G 2B1IA 2WLLA 4MTOA 5GW7A 5EBMC 1SRYA 3ASOC 3PJSK 1OCZC 1K4CC 5DM6V 1OCCB 5J9PC 5B1NA 2LFRA 1BHAA 3CMAV 5B1BC 3LUTB 3QO8A 1H38A 1AJNA 3SYCA 2OCCB 4QIWF 4JF3A 1VQ7V 3CCRV 5CMUA 2X6AA 5DN6G 5KUMA 1V55B 3ETGA 1OHHG 2Z5UA 3STZC 4UVAA 2IJIA 2Z3YA 1AI4A 4WFFA 3ABUA 5BZBA 3E8FA 5C93A 1OCRB 2YEVA 1CPYA 2W6JG 2ZD9A 5B1OA 4G28B 2JDIG 3BEHA 4DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL V;  1YJN V;  1S72 V;  1Q82 W;  4WFB V;  3CXC U;  3CCV V;  1JJ2 U;  3CMA V;  1VQ5 V;  3G4S V;  1K8A W;  1VQ9 V;  3CD6 V;  3I55 V;  3CCL V;  1VQ4 V;  3G71 V;  3CCS V;  2QA4 V;  1K9M W;  3CCQ V;  1KD1 W;  2QEX V;  3CCU V;  1QVG U;  1YI2 V;  3CCM V;  3CCR V;  1VQ7 V;  1K73 W;  1N8R W;  3CC4 V;  1YIJ V;  3CPW U;  1R73 A;  4WF9 V;  1YJ9 V;  1YIT V;  1KQS U;  2OTL V;  1Q7Y W;  1W2B U;  1M90 W;  1VQO V;  1VQM V;  1VQ8 V;  1VQP V;  1KC8 W;  3CC2 V;  1Q86 W;  1YHQ V;  1VQ6 V;  2OTJ V;  4WCE V;  2D3O W;  4WFA V;  1VQN V;  3OW2 U;  3CC7 V;  5DM6 V;  1QVF U;  1VQK V;  3CCJ V;  1M1K W;  3G6E V;  1YJW V;  3CME V;  3CCE V;  3I56 V;  1NJI W;  1Q81 W; 
#chains in the Genus database with same CATH topology
 3HKB A;  3H1K H;  2LP7 A;  3OR6 C;  2HFE C;  3H01 A;  2R9I A;  4PA6 A;  5CN0 A;  1AP5 A;  2QDO A;  1V54 C;  3UT5 A;  5CA3 A;  1HDJ A;  2FTK A;  2ZE5 A;  1QQC A;  2ZQM A;  5FNV B;  4IIJ A;  1VQ6 V;  1ORQ C;  3OW2 U;  1PV0 A;  4H33 A;  4X65 O;  2OCH A;  1QR8 A;  4MS2 A;  1JVM A;  1V9P A;  2W0X A;  2HHH B;  1M57 B;  3QO5 A;  5JQG B;  1R6N A;  1OJH A;  1NTM H;  3HKC A;  2DYR C;  2YI9 A;  3A8T A;  2P22 C;  3CC2 V;  2FB5 A;  1R3J C;  2Q73 A;  4J42 A;  3K57 A;  3OGI B;  1A32 A;  4ZHQ A;  2ZDI C;  4J7Z A;  1ZUQ A;  1PNM A;  1WPX A;  4FLW A;  2VQE O;  1SQB H;  1S5H C;  4X66 O;  1YIJ V;  4WF9 V;  2FL4 A;  3FX7 A;  4WBN B;  5EYP A;  4IYI A;  4R50 A;  2WLJ A;  2Q68 A;  1J5E O;  5LMN O;  3STL C;  5CB4 A;  1VF6 C;  2QM7 A;  1HR0 O;  4R6Z A;  3T1H B;  4LF8 O;  3LDD A;  5LYJ A;  1SQV H;  1FYJ A;  3I55 V;  2E74 B;  2QEX V;  2UUB O;  1SQG A;  4YJ3 A;  4DR1 O;  1FPO A;  1XMQ B;  3LSS A;  3A0H Z;  5IE9 A;  3ABL B;  3DXR A;  5JH7 A;  3OE7 G;  5CBG A;  1FXV A;  1W0K G;  3C3S A;  4TQF A;  4DR4 B;  2VQF B;  3APO A;  1VP7 A;  1PPJ H;  1KYO F;  4Z1M G;  1I7F A;  5ITZ B;  1NH2 D;  4ICG A;  3EXA A;  1P7G A;  5KHG A;  3K0D A;  1FFT B;  4LR3 A;  2DE0 X;  3K5L A;  1QBZ A;  5EZY A;  2Q9L A;  3SPH A;  1I08 A;  4IHJ B;  3SJC C;  5B3S B;  3HPL C;  4O4L A;  4PDL A;  1SQX H;  3H1L H;  4JAA A;  3W7W A;  2LGQ A;  2HG5 C;  4K8X A;  2CTP A;  1Q6I A;  4B3T B;  4E4E A;  2VRZ A;  1XL4 A;  2ZCE A;  3AG4 C;  2DYS B;  2PY5 A;  4I5S A;  1JR9 A;  1PKX A;  1TVK B;  3SPC A;  3K79 A;  4X1I B;  4GYC B;  4XDL A;  3K58 A;  4JI8 O;  3G6E V;  3JAK B;  3N2K A;  3GB7 C;  3AG7 A;  1GAX A;  2DQ0 A;  1KP3 A;  2LW1 A;  1K8A W;  4I50 A;  4LF5 O;  3CEI A;  1Q5O A;  2F4V B;  1GRJ A;  2QJ1 A;  4B3R B;  4JZ2 A;  2D2C B;  4TOI A;  2IM9 A;  1FXK C;  4X1K A;  2YDE A;  3P3N A;  2O57 A;  3VBB A;  1S0V A;  3HKD B;  5BR8 B;  2OTJ V;  3ZN0 A;  1PNK A;  1GM7 A;  1AB3 A;  3SDL A;  1CP9 A;  1DF4 A;  1IDS A;  1RM1 B;  1SER A;  5LL6 Y;  1YJ9 V;  5IYC O;  1MZF A;  4Q20 A;  1FFX B;  3K0G A;  3W7T A;  4AQY O;  1AR5 A;  3RYC B;  4NB5 A;  1OV9 A;  4TSF G;  1H2K A;  2F66 C;  1Q3E A;  3CCV V;  2DW4 A;  4FLT A;  1TGO A;  5H2F Z;  5IY5 C;  2LJ2 A;  4PA3 A;  1V55 C;  4MT8 A;  4JI3 B;  2KKW A;  3T2M A;  5LOV A;  2CH7 B;  3T1Y B;  5LXT A;  5F2V O;  4NKG B;  1OCR C;  5LP6 C;  4DV4 B;  2B1G A;  3Q4H A;  1N33 O;  2CDY A;  1OZ0 A;  1J95 A;  4FJC C;  3CXC U;  1BS3 A;  4DW1 A;  2JIZ G;  1XNR B;  3K04 A;  4EB6 B;  1P7B A;  1YIT V;  1FXH A;  3ABM C;  4XDK A;  5A9G A;  2EIM B;  3OEH G;  3SJQ C;  4IGG A;  3E8G A;  3RFR A;  3CC7 V;  1TA8 A;  5JJE B;  1HNX B;  2HEP A;  2YSU B;  4JGS A;  5BMV A;  4C7U A;  2ZNI A;  2WLM A;  2N05 A;  4U7N A;  4FMT A;  1K4D C;  2F93 B;  4BWA A;  2BTQ A;  2V7Q G;  4DV6 O;  1B04 A;  1VEW A;  2Q8V A;  5DED A;  4WFE A;  1XNQ O;  3AG2 B;  4B3M O;  2QWN B;  4DW0 A;  1YJW V;  4HYO A;  4JI7 B;  4QPK A;  1AP6 A;  2Y48 A;  1COW G;  5CA1 B;  2YEV B;  5LHG A;  1NI8 A;  2AHZ A;  4P9P A;  4OX9 B;  4X20 A;  1BGY H;  2L6L A;  3BPZ A;  3THO A;  4DXW A;  1JJ2 U;  2JS5 A;  1MOF A;  3B8N A;  3N2G A;  4MVQ A;  5KHH A;  2AZ2 A;  3HR0 A;  3QF7 A;  1KKC A;  4O4H B;  4RWU A;  2VWK A;  1HNW O;  4I55 B;  4UV9 A;  2WLI A;  4L87 A;  3QTC A;  3CCE V;  3JSL A;  4DUY B;  4B3R O;  5J2T A;  1R6K A;  3CRR A;  2JJ2 G;  3ZRV A;  3BAA A;  2OCC C;  2BTO A;  4RUF A;  1ZAU A;  3W7U A;  2RMK B;  4ZOL A;  4X1Y B;  2YIB D;  1VIB A;  4JAS A;  3ABT A;  1NBM G;  4J9Y B;  1EZJ A;  5CBH A;  3F7Y C;  2EX3 A;  1I0H A;  2Y4T A;  1GMG A;  2FML A;  2WSS G;  2H94 A;  3ICX A;  3ZHQ A;  3DC5 A;  4TT3 G;  2E5L O;  1I94 O;  4ZBM A;  2CUG A;  4KFM A;  4NXN O;  2CGN A;  3VOU A;  3CJH A;  4DV0 B;  1YI2 V;  3ZHR A;  1R73 A;  3S3W A;  3OD4 A;  5LGT A;  2QSA A;  5GW7 A;  3IJ4 A;  4NTX A;  3PJS K;  1SKV A;  4EFE A;  3J80 N;  1ZL8 B;  5KHI A;  1D2D A;  4O2B A;  3IAY A;  1BHA A;  4OGQ B;  2EJ7 A;  3QO8 A;  4FM1 A;  4FZ1 A;  2N04 A;  3SYC A;  2OIG A;  4FLZ A;  4X65 B;  5KMG A;  4QIW F;  1VQ7 V;  2ADP A;  3BHP A;  3JSN A;  4TV8 A;  4BR6 A;  2X6A A;  5DN6 G;  4O4I B;  5KUM A;  4F6R B;  1OHH G;  2Z5U A;  1WAZ A;  4I7Z B;  4EEQ A;  3L72 H;  5C93 A;  4CBC A;  3LDE A;  5A2Q N;  3K9A A;  3CCS V;  3EVK A;  4P2Z A;  3L70 H;  1JQ0 A;  2OWO A;  1WB8 A;  3AG3 B;  3E8H A;  1M90 W;  1DGS A;  5FPR A;  2VQE B;  1U97 A;  3F5W C;  4O2A B;  4X89 A;  1VQP V;  2P6J A;  4FFK A;  1M4U A;  4YIP A;  3OUS A;  4X66 B;  4TUY B;  5LGU A;  3JYC A;  1M1K W;  1IUR A;  1OCZ B;  1BCC H;  2C2A A;  1J5E B;  1MSW D;  5LMN B;  4H44 B;  2P06 A;  1XMO O;  3H1J H;  2LGW A;  5EIB D;  3JCU Z;  1GK9 A;  3RWR D;  2RJZ A;  4LNU B;  1KB9 F;  4GUN A;  4B3S O;  2CAZ C;  3L71 H;  1URF A;  4JI0 O;  3BRC A;  3JAT B;  4LF8 B;  4K35 A;  1NR7 A;  2IW5 A;  4A5U B;  2NR5 A;  4DV7 O;  2UUB B;  2PZS A;  1W0J G;  4DR1 B;  1O9H A;  3ASN C;  4WBN A;  3AG1 C;  3R66 A;  4N21 A;  2E75 B;  1YJN V;  1AR4 A;  4NXM O;  3IFX A;  3ZRW B;  2Q6A A;  2DJV A;  4YJ2 B;  3T4Z A;  3T4D A;  4KUM A;  2ILM A;  4BIU A;  4QGP A;  4IL6 Z;  1YEW A;  2P67 A;  2JGD A;  3ZRX A;  4GX2 A;  2Q0A A;  4MVO A;  2ZM6 O;  1WB7 A;  4CH3 A;  1IX9 A;  1Y67 A;  4LF4 O;  2YIB A;  4FPP A;  5LBQ A;  3G6B A;  3P30 A;  3CD6 V;  2IJK A;  4I9W A;  1EN4 A;  3MD0 A;  3X2Q B;  3A0R A;  1KQS U;  1Y74 A;  1F23 A;  4GLX A;  4DUZ O;  4X9Q A;  1CEZ A;  1SZX A;  1MA1 A;  4PJ0 Z;  5IJ9 A;  2IU3 A;  3M7M X;  4LFA O;  1M93 A;  1R3L C;  4CS4 A;  4BW9 A;  3E83 A;  2F95 B;  4Z1V A;  4JI8 B;  4DK0 A;  1N8R W;  3FB8 C;  4PEL A;  3OMN B;  4WFH A;  4LF5 B;  4JYC A;  5B1A C;  3K59 A;  2VS0 A;  2H3O A;  3HB3 B;  1TVK A;  1N32 O;  4W4L A;  3CRM A;  4DV3 O;  1JMK C;  5KX5 B;  3ZRS A;  3RYI A;  4PV1 B;  1M9N A;  1SET A;  2QWR B;  2RNB A;  2RN9 A;  2M7W A;  1S3J A;  4GX1 A;  2EIL C;  3ABK B;  1OCO B;  2UUC O;  2ZE6 A;  4BAY A;  4I0X B;  2IU0 A;  2XUM A;  1WA8 A;  1DTO A;  2EIK C;  1NS1 A;  3HKD A;  2XAF A;  4AQY B;  5IT9 N;  4UVB A;  2GUZ A;  2XAJ A;  5CA0 B;  2QKA A;  5H9C A;  1RPR A;  1K73 W;  1TUB B;  5C8Y A;  2Q4P A;  1P49 A;  3RW0 A;  4JI4 O;  2IH3 C;  3H1I H;  3RYF A;  5D5Q A;  1X4T A;  2KG7 A;  2HR3 A;  1K92 A;  1US6 A;  3ZMT A;  3SGI A;  4QE9 A;  4IYH A;  2YI8 A;  5GTH Z;  1N33 B;  4P30 A;  1D5N A;  1YCI A;  4ASU G;  5FL7 G;  1ZTE A;  4JPR A;  2YIA A;  2ODM A;  3JD0 A;  1N36 O;  1EFR G;  1SQF A;  5BXZ A;  2WLN A;  3A2F A;  5L3D A;  2WPD G;  3BY6 A;  4FM0 A;  3CHX A;  5D5P A;  3ZED A;  4CZZ A;  1HW7 A;  2W6I G;  3R65 A;  4DK1 A;  1GN3 A;  1GTO A;  4O4J B;  4FLV A;  4TQD A;  4AIL C;  1SA0 B;  2DOS A;  3UO3 A;  1HNZ O;  3JAL A;  3M99 B;  1KP2 A;  3FB6 C;  3CCJ V;  1Q6U A;  2X6B A;  2CE4 A;  2JEX A;  4UB8 Z;  2UXC O;  4DR3 O;  4U3J A;  4DV6 B;  1VQ5 V;  2XAG A;  1XNQ B;  4B3M B;  1L1F A;  5H6R A;  3MDS A;  2OT5 A;  4UCU A;  3FAV A;  3C3T A;  3K5N A;  2CK3 G;  3OUF A;  1IVS A;  2XAH A;  4PA7 A;  5LHH A;  3E8B A;  2XND G;  1PL4 A;  4L8J A;  3OM3 B;  3LSU A;  2YC0 A;  4QPJ A;  2GHY A;  1ROP A;  1VQ9 V;  1M57 C;  4QJF B;  5L3F A;  2GDS A;  2ZXW B;  5IY5 B;  5EBW C;  4DRX A;  2XAQ A;  1QR9 A;  2HKO A;  3TJT A;  4CH4 A;  3SYA A;  2EUL A;  4H37 A;  2EIJ C;  1Q86 W;  4GZR B;  1XBL A;  3D36 A;  4H0L B;  1IXM A;  1MZE A;  3FB5 C;  4EKW A;  1XIL A;  1HWY A;  3DGE A;  1NJI W;  4UXN A;  1FJG O;  1Y76 A;  2CTW A;  3TK1 A;  1HNW B;  3ZCC A;  4I4T A;  4U7O A;  1XOU A;  1Q43 A;  1SF9 A;  4OXS A;  1VQ4 V;  3P32 A;  1N34 O;  1CXZ B;  1KKD A;  1SS3 A;  2X7R B;  4JZG A;  2JVD A;  1EBO A;  5TIS Z;  4YY3 O;  2EIN B;  2LO1 A;  1LNQ A;  1AIL A;  1PP9 H;  3K06 A;  3JAW B;  3ZHV A;  2R70 A;  3BAB A;  2B9Z A;  3ZMZ A;  2E5L B;  4IIJ B;  1I94 B;  4GKK O;  3ABL C;  1QCE A;  4NXN B;  5GON B;  5IDJ A;  1AI5 A;  5IYZ A;  5KLV H;  3K08 A;  1LR1 A;  1YTF B;  1P4R A;  2BOC C;  2X0L A;  2DQ3 A;  1QLE B;  4YXW G;  3RVY A;  3ZN1 A;  1AI7 A;  1NTZ H;  3HKC B;  1KD1 W;  3U0Z A;  3CXH F;  2R9R B;  5KA6 A;  4LBE C;  4CH6 A;  3E86 A;  3VQW A;  2K9P A;  4LFB O;  4ZHQ B;  5L3C A;  3U11 A;  3WB0 A;  1AJP A;  3SYO A;  1AVM A;  2Y69 B;  1IBM O;  2NNU A;  4J10 A;  3W7S A;  2EZP A;  3FFQ A;  3IGA C;  2JEU A;  5EYP B;  3E35 A;  2YUA A;  3ZMS A;  4PDR A;  4G27 B;  3OT7 A;  4DR7 O;  5CB4 B;  2KB1 A;  4TV9 A;  1RSO A;  3F7V C;  4HBN A;  1R3K C;  4LC1 A;  2JJ1 G;  2WLL A;  5EBM C;  2UUA O;  4F6R A;  5LYJ B;  4HNA B;  2YXL A;  1OCC B;  5B1N A;  1LUW A;  3JAS A;  4YJ3 B;  4UCT A;  3LUT B;  1TAE A;  1KU9 A;  2OCC B;  1BQZ A;  4CC6 A;  5JH7 B;  1XMO B;  1Q8I A;  3B09 A;  4IT5 A;  4X62 B;  4B3S B;  3E8F A;  4UB6 Z;  4JI0 B;  3WB1 A;  5B1O A;  4O2A A;  4G28 B;  4DO2 A;  1ARO P;  1B6Q A;  4DV7 B;  1JJO A;  1RM1 C;  3ZX6 A;  3AK2 A;  5EZY B;  1VF5 B;  1PL0 A;  1SC5 B;  5EIB C;  5LMU O;  3PN1 A;  4LNU A;  2QM8 A;  4NXM B;  4K0K O;  3JAT A;  3CS5 A;  1WLE A;  1H2M A;  4LWS A;  3UCS C;  4UCS A;  2WAM A;  1XEQ A;  1I5Y A;  1AR1 B;  4JYB A;  2XAS A;  1JFF A;  2ZM6 B;  3L74 H;  1FD9 A;  4LF4 B;  3D8C A;  4MVR A;  2EZO A;  3LDC A;  4LF9 O;  3ZRW A;  3G67 A;  3N2K B;  1L0L H;  3OTO B;  3OMI B;  4LP8 A;  2HJF C;  4WCE V;  3CRC A;  2KSD A;  4YJ2 A;  3TXQ A;  4I50 B;  4FFB A;  3RT3 C;  2W0F C;  4JI2 O;  3B2E E;  3JD1 A;  1NVP B;  4Z2W A;  5LA6 A;  2HVK C;  4DUZ B;  1JOY A;  3OGC C;  4NTW A;  4X1K B;  3OMA B;  4LFA B;  1MG1 A;  3E22 A;  5IJ0 A;  2EIM C;  3UM7 A;  4BIO A;  2XTA A;  3H1H H;  1E1R G;  4JYY A;  4FK5 C;  4X64 O;  1Q6H A;  3EFF K;  3MHS C;  5IWA O;  4YHH O;  3ZJZ A;  2YS8 A;  2ATK C;  2ZIO A;  3G4S V;  4PA9 A;  1N32 B;  4DV3 B;  3NR7 A;  1G8M A;  1IBK O;  2Q0O C;  3L75 H;  4YIO A;  1VMG A;  3GWK C;  3AG2 C;  1X59 A;  4DR5 O;  1VQ8 V;  2HVJ C;  3VQX A;  5J2U B;  4QE7 A;  1JPX A;  3ZS8 C;  5IYD O;  1XI1 A;  3K5M A;  1WP7 A;  3WFV A;  2UUC B;  5LOV B;  4E2L A;  1NTK H;  3ML0 A;  3D36 C;  2GTA A;  5KX5 A;  3WG7 B;  4D6T H;  3CC4 V;  2PGG A;  4ZI7 B;  1KEC A;  3Q4H B;  4ZIB A;  2ZR3 A;  3SJA C;  4LCU C;  4JYA O;  2PF4 E;  4I0X A;  4BIZ A;  5FNV A;  4PA4 A;  4JI4 B;  4FZ0 A;  2A06 H;  4UV8 A;  4JAV A;  2HLD G;  3O9O A;  4J11 A;  1P84 F;  1MAB G;  5CBF A;  2N74 A;  2OTL V;  1H2G A;  4X8A A;  1DK1 A;  1BQ0 A;  4MTX A;  4ZKI A;  4QNH B;  1HP8 A;  1NH2 B;  3CP1 A;  5JQG A;  3LNM B;  3RYH B;  2A3Q A;  4F4L A;  2XT9 A;  5B66 Z;  3ASO B;  1N36 B;  1F51 A;  2WWW A;  1GO3 F;  3BA8 A;  1F4M A;  5B1B B;  2BTQ B;  4JTD B;  1WJZ A;  4X62 O;  4J41 A;  1YTF D;  5GTI Z;  3OFN G;  1N4C A;  1UPG A;  4OPA A;  3CX5 F;  1EZV H;  1NZ6 A;  2R72 A;  1BT8 A;  4MSW C;  1YF2 A;  3QNE A;  1HNZ B;  4OPH A;  1BMF G;  2AW9 A;  2F23 A;  3LSQ A;  1KBH A;  4X20 B;  2UXC B;  1SQQ H;  4DR3 B;  1V54 B;  4RUE A;  3JD4 A;  1KMI Z;  3AK3 A;  4MW3 A;  4MTG A;  4O4J A;  1DF5 A;  4PHZ A;  4RO2 A;  4DR6 O;  3N2G B;  1XL6 A;  2V4D A;  3CWB H;  3U10 A;  4XBF A;  2QE7 G;  3SPG A;  2EIK B;  3FB7 C;  4WFB V;  5LGN A;  2BSK B;  2HP8 A;  5JCO C;  3OTO O;  1M56 C;  2QM4 A;  1WPB A;  2UXX A;  3D3I A;  4UVC A;  5ITZ A;  5J2T B;  2A79 B;  3MAQ A;  3IC9 A;  2XHB A;  2DYR B;  5E1A C;  1IBL O;  3EHB B;  3KCY A;  4UFZ A;  2A7W A;  3P3P A;  4LF6 O;  4ZOL B;  2EBO A;  1WNS A;  3ZMV A;  4IHJ A;  3KKY A;  2GTS A;  5AG2 A;  3DSQ A;  3NXS A;  3BVO A;  3AG3 C;  1K33 A;  3RBZ A;  1BSM A;  1L0N H;  5EC1 C;  1FJG B;  3CRQ A;  1N34 B;  1YHQ V;  4FLU A;  3S3X A;  4NR1 A;  2Q7H A;  3HKE B;  4YY3 B;  4X1I A;  3B4S A;  1JCH A;  1JA8 A;  4UCO A;  3JAK A;  2QA4 V;  3CCU V;  3QO7 A;  3W7X A;  1S76 D;  2IBZ H;  5LHI A;  3TET A;  1Q7Y W;  5KA5 A;  1S5L Z;  4DV5 O;  1G4Y B;  4GKJ O;  2RCV A;  4KHP O;  1H8E G;  1YSC A;  4GKK B;  5EC2 C;  2X6C A;  3JAR B;  1H2N A;  3WB2 A;  3I56 V;  5KMG B;  2ZIN A;  1NKD A;  4GT1 A;  4KP4 A;  4TV8 B;  4ABM A;  4R7C A;  3ZBH A;  4X88 A;  3JAW A;  2ETN A;  1ZLZ A;  4NTY A;  1L8D A;  3OEE G;  2K1E A;  1K97 A;  4RQF A;  3IC7 A;  2Q5Z A;  1Y4M A;  1NVP D;  2Q7G A;  3OTF A;  2H8P C;  1N0N A;  3DC6 A;  1NQT A;  3TCU A;  5JJJ B;  4DV2 O;  1QU7 A;  1G1X B;  4JI1 O;  5GON A;  1PD3 A;  2QWP B;  4Q6G A;  1E79 G;  3FKS G;  5K1X A;  1O9G A;  4LFB B;  3GVM A;  1FFX A;  2BCC H;  3X2Q C;  3T1C A;  3RYC A;  2QWO B;  4J7J A;  1IBM B;  1KUQ A;  1NU1 H;  3ZIA G;  4J7K A;  3AG4 B;  1PM9 A;  5JJN B;  1D5A A;  2AHY A;  3TXS A;  2CH7 A;  2EIJ B;  5H6Q A;  4DR7 B;  1BHB A;  5JVD B;  2UXD O;  2AZ0 A;  1GN6 A;  2UUA B;  1BL8 A;  1Y66 A;  2QKS A;  1Z2G A;  4H13 B;  3CCM V;  1XQ8 A;  1ZSP A;  3MHH C;  3RN4 A;  4FLX A;  4JI6 B;  2PI5 A;  3AK1 A;  1FXK B;  1YVW A;  4EB6 A;  3DTU B;  4FVM A;  3WU2 Z;  5KHJ A;  3ETE A;  4K8Z A;  4G2K A;  4JI5 O;  2ITD C;  4HNA A;  1S77 D;  3CCL V;  1FKA O;  1BE3 H;  3CYO A;  3ABK C;  1OCO C;  1GN4 A;  1FS0 G;  2JGD B;  5EK0 A;  2P90 A;  3UO2 A;  2B1I A;  4MTO A;  2PUS A;  1XHX A;  1K4C C;  2FYU H;  2ZNJ A;  5DM6 V;  1QHT A;  5LMU B;  5J9P C;  3A0B Z;  3KCX A;  3QG5 A;  4K0K B;  4NYK A;  3CMA V;  4JV5 O;  1Y74 B;  1AJN A;  2L35 A;  4JF3 A;  3CCR V;  2NN4 A;  5CMU A;  5IJ9 B;  1V55 B;  3ETG A;  3STZ C;  4UVA A;  2IJI A;  2Z3Y A;  4WFF A;  5BZB A;  1YZB A;  5CA1 A;  1OCR B;  2YEV A;  2LW7 A;  5LP6 B;  2W6J G;  4LF9 B;  2M6Y A;  2JDI G;  3BEH A;  2DWE C;  1XRE A;  4N23 A;  3J81 N;  4JI2 B;  1QVG U;  2B5U A;  2Y0P A;  3D3Q A;  4LFC O;  1ENV A;  4LH7 A;  2OIE A;  1VQO V;  3ABM B;  3HKB B;  3SPI A;  2RQ6 A;  3BA9 A;  4PDM A;  3RYI B;  4MW8 A;  1MNG A;  1RPO A;  4O4H A;  2P4V A;  3UT5 B;  4I55 A;  2UXB O;  4GX5 A;  2G38 A;  3G71 V;  4X64 B;  5L3E A;  5IWA B;  4YHH B;  2UU9 O;  5FLX N;  4B08 A;  3ZMU A;  4JTC B;  4DR2 O;  1WA8 B;  4X1Y A;  2HJD A;  3I5D A;  2GUZ B;  1QVF U;  4PD4 F;  1IBK B;  4P9O A;  2QTS A;  4DR5 B;  5KUK A;  1G6U A;  5C8Y B;  2CTR A;  3RVZ A;  1EN5 A;  3H9V A;  1K9M W;  2YID A;  4CS2 A;  4F6E A;  3VQY A;  3RYF B;  5B3S C;  2KG7 B;  2ZT9 B;  1VQM V;  3SPJ A;  3G80 A;  1M5I A;  3JD2 A;  4FIP C;  3CCQ V;  1R3I C;  2HHH O;  3UKM A;  5J2U A;  2ZXW C;  1JX9 A;  4LF7 B;  3KZI Z;  2DWD C;  4I9Q A;  1ZL8 A;  3LNN A;  2DYS C;  4JYA B;  2Q69 A;  4KXR A;  2OYQ A;  1DLB A;  4HAM A;  4JTA B;  2ZE8 A;  3SYQ A;  2F43 G;  3QVN A;  1ZWI C;  1VAR A;  5L3G A;  3ZHU A;  1GM9 A;  5JCO A;  4ZI7 A;  1EM1 A;  4TWK A;  4O4I A;  5EBL C;  1R1B A;  1RFY A;  3K5O A;  3BCC H;  2A9H A;  1Q82 W;  1TUE B;  2WLK A;  4FLY A;  2IJJ A;  1XUQ A;  4MTF A;  1F7Y A;  3JAL B;  4JI6 O;  1WP8 A;  2LQT A;  3M8A A;  3DXR B;  3E2E A;  4MVZ A;  2EIN C;  3O65 A;  1H8H G;  5KHK A;  2QR4 A;  2LFS A;  3T1H O;  4U3J B;  5JWP A;  1VQN V;  2NLJ C;  4CS3 A;  1F4N A;  3JAM N;  1XMQ O;  1YXB A;  3FYE B;  3JCZ A;  3RYH A;  1RP3 B;  4D7T A;  4TUY A;  1B06 A;  4B7E A;  3FAV B;  2P4K A;  3ZHT A;  3CE2 A;  3UQ8 A;  3GWO A;  4O4L B;  1Z5W A;  1K5Q A;  2GSM B;  4KL1 A;  1KC8 W;  4DR4 O;  1Q90 D;  2VQF O;  1K7D A;  3AEI A;  2ZR2 A;  1QLE C;  1GH6 A;  4U3F H;  1S72 V;  2IJH A;  1FAF A;  4DRX B;  4DR6 B;  2BOB C;  2EJR A;  1XHZ A;  2P5O A;  2RDC A;  1SES A;  2BE3 A;  1Y76 B;  2Y69 C;  5KAF Z;  4J9Z B;  4B3T O;  1UJW B;  4I4T B;  4WFA V;  2UXN A;  1EN6 A;  1Z5V A;  2MK3 A;  4BW5 A;  2PTM A;  1VQL V;  1H2S B;  2YIC A;  4PDV A;  1T5E A;  2KQX A;  1IBL B;  1QNM A;  1AI6 A;  4J80 A;  4LF6 B;  2Q67 A;  2BSK A;  1K5S A;  2ADQ B;  3FYI B;  4GX0 A;  2MW2 B;  3N27 A;  4PI2 A;  1OCC C;  2P7T C;  3ZHS A;  4NVP A;  1U96 A;  2F4V O;  3CB2 A;  4XDJ A;  4JAU A;  3VQV A;  2PYJ A;  4RQE A;  3K03 A;  4CH5 A;  2ZE7 A;  5BR8 O;  5IYZ B;  5HFM A;  2JGU A;  2ZDI A;  4EFB A;  2QWQ B;  4LH6 A;  1VQK V;  4UCR A;  3ASN B;  3KG2 A;  2VWJ A;  4DV1 B;  3J7A U;  4DV5 B;  3AG1 B;  4GKJ B;  4KHP B;  4RAI A;  1K3E A;  1YDX A;  1SZT A;  2Z0A A;  5LXT B;  3HKE A;  3BFR A;  4UUJ C;  5K1P A;  1VF6 A;  2QGN A;  5DEC A;  2CGO A;  4HZ3 A;  4MVS A;  4FM2 A;  4LF7 O;  4JI3 O;  3T1Y O;  1ZX3 A;  4DV2 B;  3JAR A;  2DN9 A;  4B7K A;  4WFG A;  4JI1 B;  4TV9 B;  1RSO B;  4DV4 O;  4AHC A;  2DMX A;  2WLL B;  2ZIM A;  3F5T A;  1M56 B;  3K3W A;  1W2B U;  1AJQ A;  2Y4U A;  3CSX A;  5CA0 A;  1MSD A;  1E1Q G;  3JAS B;  1TUB A;  2E76 B;  1NR1 A;  1H2L A;  1VF7 A;  2IH1 C;  5BMV B;  2JS3 A;  2YXY A;  1WN7 A;  3FD9 A;  1XNR O;  1PNL A;  2FKX A;  4DYL A;  3SJB C;  1GKF A;  2ZKO A;  2E3C A;  2QKC A;  4GCZ A;  2UXD B;  1LUV A;  4PI0 A;  1IZ3 A;  5KAI Z;  3CPW U;  2YXH A;  2ITC C;  1S5J A;  1HNX O;  2Q7E A;  1IXB A;  2WLH A;  1UFI A;  3K9S A;  5B1A B;  3RGB A;  1B3Q A;  3SR2 C;  4R8C A;  1THZ A;  5JVD A;  3CRA A;  1HR0 B;  3B77 A;  1SQP H;  2R9A A;  3B8M A;  4MVU A;  4JI5 B;  5HFL A;  4LWS B;  1GN2 A;  1I5X A;  4JI7 O;  5BY1 A;  2EIL B;  2D3O W;  1MMM A;  1SA0 A;  1JFF B;  3CME V;  1NT2 B;  2ARH A;  1FXK A;  3ETD A;  2A0L A;  2QTO A;  3WG7 C;  1W59 A;  1XDC A;  5IYB O;  1QLN A;  4UCV A;  4OX9 O;  2PI4 A;  2CTQ A;  5B5E Z;  3L9D A;  4FFB B;  4JV5 B;  1Y6X A;  2WLI B;  5FPO A;  5LA6 B;  4MVM A;  5E79 Z;  2XOK G;  2WA4 A;  3OAA G;  1K34 A;  1BZK A;  2JRI A;  5L3B A;  1GM8 A;  1Q81 W;  3E22 B;  2Y0I A;  1R6T A;  3B40 A;  3OR7 C;  3SYP A;  5IJ0 B;  2V1D A;  4W4K A;  3E89 A;  4K3A A;  3C90 A;  1N0J A;  3JD3 A;  4DUY O;  3L73 H;  2JK5 C;  4CC5 A;  2GBO A;  1SRY A;  4LFC B;  2F1M A;  3ASO C;  1OCZ C;  4AI8 A;  3TGU H;  3CJH B;  3ETQ A;  2LFR A;  4D7S A;  5B1B C;  5H5N A;  5LP6 A;  1H38 A;  3APQ A;  2GV9 A;  2UXB B;  2AGA A;  4DV1 O;  1AI4 A;  3ABU A;  4O2B B;  2UU9 B;  1CPY A;  2PYL A;  2ZD9 A;  4DR2 B;  4DV0 O;  2WA3 A;  2AXT Z; 
#chains in the Genus database with same CATH homology
 1ARO P;  2DWE C;  1B6Q A;  2LP7 A;  3OR6 C;  1RM1 C;  2HFE C;  3H01 A;  2R9I A;  3LDE A;  4PA6 A;  5CN0 A;  3K9A A;  3CCS V;  1V54 C;  4N23 A;  1PL0 A;  4P2Z A;  1QVG U;  2B5U A;  5CA3 A;  1JQ0 A;  1ENV A;  3AG3 B;  2FTK A;  3E8H A;  1M90 W;  2ZQM A;  1VQO V;  3F5W C;  2QM8 A;  1VQP V;  4X89 A;  2P6J A;  3ABM B;  1VQ6 V;  1ORQ C;  3SPI A;  3OUS A;  4PDM A;  1WLE A;  5LGU A;  3OW2 U;  3JYC A;  4MW8 A;  1RPO A;  2WAM A;  1M1K W;  4H33 A;  1I5Y A;  1AR1 B;  1OCZ B;  2C2A A;  1MSW D;  1QR8 A;  4JYB A;  2XAS A;  4GX5 A;  4MS2 A;  1JVM A;  3G71 V;  1GK9 A;  5L3E A;  1M57 B;  3QO5 A;  4MVR A;  1R6N A;  3ZMU A;  4JTC B;  2EZO A;  1NR7 A;  3LDC A;  2IW5 A;  2DYR C;  3ZRW A;  3CC2 V;  1R3J C;  3OMI B;  4LP8 A;  1W0J G;  2HJF C;  4WCE V;  3ASN C;  3AG1 C;  2W0F C;  1QVF U;  4P9O A;  3JD1 A;  1NVP B;  4N21 A;  2ZDI C;  2HVK C;  1JOY A;  1YJN V;  5KUK A;  3OGC C;  1PNM A;  3RVZ A;  1WPX A;  3OMA B;  1K9M W;  3IFX A;  1MG1 A;  3ZRW B;  1S5H C;  1YIJ V;  2Q6A A;  4WF9 V;  3T4Z A;  3T4D A;  4KUM A;  2EIM C;  3UM7 A;  4R50 A;  4BIU A;  5B3S C;  2WLJ A;  1VQM V;  2Q68 A;  3SPJ A;  1E1R G;  3STL C;  4FK5 C;  2P67 A;  3ZRX A;  4GX2 A;  2QM7 A;  3EFF K;  3MHS C;  4MVO A;  4R6Z A;  3JD2 A;  4FIP C;  3CCQ V;  1R3I C;  3ZJZ A;  3UKM A;  2ATK C;  4FPP A;  5LBQ A;  3P30 A;  3G4S V;  3LDD A;  2ZXW C;  1JX9 A;  3CD6 V;  2IJK A;  4PA9 A;  3I55 V;  4I9W A;  2DWD C;  2DYS C;  2QEX V;  2Q69 A;  3MD0 A;  3X2Q B;  3A0R A;  1DLB A;  4HAM A;  1G8M A;  4JTA B;  1KQS U;  3LSS A;  3SYQ A;  2F43 G;  1F23 A;  1ZWI C;  3AG2 C;  5L3G A;  1GM9 A;  1VQ8 V;  1CEZ A;  2HVJ C;  3ABL B;  4QE7 A;  3OE7 G;  5CBG A;  2IU3 A;  4TWK A;  1FXV A;  1JPX A;  5EBL C;  5IYD O;  1W0K G;  1R3L C;  3WFV A;  2A9H A;  1Q82 W;  1TUE B;  2WLK A;  4E2L A;  3ML0 A;  2IJJ A;  3E83 A;  4MTF A;  4CBC A;  4Z1M G;  1NH2 D;  3WG7 B;  3CC4 V;  1N8R W;  3K0D A;  3FB8 C;  1FFT B;  3E2E A;  1KEC A;  2EIN C;  4MVZ A;  4PEL A;  1H8H G;  3OMN B;  1QBZ A;  4WFH A;  2LFS A;  4JYC A;  2ZR3 A;  5B1A C;  3SPH A;  5B3S B;  3HPL C;  4PDL A;  3HB3 B;  1VQN V;  3W7W A;  2NLJ C;  4LCU C;  2HG5 C;  1F4N A;  4BIZ A;  4PA4 A;  3FYE B;  3JCZ A;  3ZRS A;  1M9N A;  1SET A;  4UV8 A;  4JAV A;  1XL4 A;  2HLD G;  2M7W A;  3AG4 C;  1MAB G;  5CBF A;  2DYS B;  3GWO A;  1H2G A;  4I5S A;  2OTL V;  4X8A A;  1PKX A;  1S3J A;  4GX1 A;  2EIL C;  3ABK B;  1OCO B;  4MTX A;  3SPC A;  4QNH B;  1K5Q A;  2GSM B;  3K79 A;  4BAY A;  4ZKI A;  1NH2 B;  3CP1 A;  1KC8 W;  1K7D A;  3AEI A;  2ZR2 A;  3LNM B;  4XDL A;  2IU0 A;  1QLE C;  4F4L A;  1DTO A;  2EIK C;  3G6E V;  3GB7 C;  3ASO B;  1S72 V;  2IJH A;  2XAF A;  2DQ0 A;  1KP3 A;  1F51 A;  2WWW A;  4UVB A;  1GO3 F;  1K8A W;  2XAJ A;  2BOB C;  1F4M A;  5H9C A;  2EJR A;  5B1B B;  1RPR A;  4JTD B;  1K73 W;  1YTF D;  1FXK C;  3OFN G;  3RW0 A;  1SES A;  3VBB A;  1S0V A;  2Y69 C;  4J9Z B;  2OTJ V;  1UJW B;  4WFA V;  2UXN A;  3ZN0 A;  1PNK A;  1GM7 A;  2IH3 C;  4MSW C;  2MK3 A;  4BW5 A;  3QNE A;  1CP9 A;  2HR3 A;  1VQL V;  1K92 A;  4PDV A;  3ZMT A;  1BMF G;  1DF4 A;  4QE9 A;  3LSQ A;  1AI6 A;  1RM1 B;  2Q67 A;  1SER A;  1K5S A;  1YJ9 V;  1V54 B;  3FYI B;  4GX0 A;  5IYC O;  4RUE A;  3JD4 A;  4P30 A;  4Q20 A;  4ASU G;  5FL7 G;  4MW3 A;  4JPR A;  4MTG A;  3JD0 A;  1DF5 A;  3K0G A;  3W7T A;  1OCC C;  4RO2 A;  1EFR G;  2P7T C;  1XL6 A;  4TSF G;  4XDJ A;  4XBF A;  4JAU A;  2WLN A;  2QE7 G;  3SPG A;  2EIK B;  3FB7 C;  5L3D A;  2WPD G;  4WFB V;  3CCV V;  2DW4 A;  5LGN A;  3BY6 A;  4RQE A;  5IY5 C;  3K03 A;  4CZZ A;  4PA3 A;  2W6I G;  3R65 A;  1V55 C;  4MT8 A;  1GTO A;  3T2M A;  1M56 C;  5HFM A;  2ZDI A;  2UXX A;  3D3I A;  4UVC A;  1OCR C;  2A79 B;  3M99 B;  1KP2 A;  2B1G A;  2DYR B;  3FB6 C;  5E1A C;  1VQK V;  3EHB B;  2X6B A;  3CCJ V;  2JEX A;  3ASN B;  3KG2 A;  2EBO A;  1OZ0 A;  1J95 A;  3ZMV A;  3AG1 B;  4FJC C;  3CXC U;  1VQ5 V;  2XAG A;  4RAI A;  3NXS A;  1K3E A;  2JIZ G;  1SZT A;  3AG3 C;  4UUJ C;  1L1F A;  5H6R A;  1K33 A;  3RBZ A;  5EC1 C;  2OT5 A;  3K04 A;  1P7B A;  1YIT V;  1FXH A;  3ABM C;  4HZ3 A;  4MVS A;  4XDK A;  1YHQ V;  2EIM B;  3OEH G;  3SJQ C;  2CK3 G;  3OUF A;  3E8G A;  2XAH A;  4PA7 A;  5LHH A;  3CC7 V;  3E8B A;  2XND G;  3OM3 B;  4QPJ A;  2YSU B;  2GHY A;  4JGS A;  1ROP A;  1VQ9 V;  1JCH A;  1M57 C;  4QJF B;  4WFG A;  5L3F A;  2QA4 V;  2ZXW B;  5IY5 B;  3CCU V;  3QO7 A;  5EBW C;  2WLL B;  3W7X A;  1S76 D;  5LHI A;  2XAQ A;  3TET A;  1QR9 A;  2WLM A;  2HKO A;  1Q7Y W;  1M56 B;  3K3W A;  4U7N A;  1W2B U;  1AJQ A;  4FMT A;  5KA5 A;  1K4D C;  3SYA A;  4H37 A;  2EIJ C;  1E1Q G;  1G4Y B;  2V7Q G;  1Q86 W;  3D36 A;  1H8E G;  4WFE A;  1NR1 A;  1IXM A;  1YSC A;  3AG2 B;  3FB5 C;  5EC2 C;  4EKW A;  2IH1 C;  2X6C A;  1HWY A;  3DGE A;  1YJW V;  1PNL A;  4HYO A;  3I56 V;  1NJI W;  4UXN A;  1NKD A;  4GT1 A;  4KP4 A;  3TK1 A;  4R7C A;  3ZCC A;  4X88 A;  1GKF A;  4U7O A;  4OXS A;  1VQ4 V;  4GCZ A;  3P32 A;  1KKD A;  4QPK A;  2Y48 A;  3OEE G;  1COW G;  3CPW U;  2K1E A;  1K97 A;  2X7R B;  2YEV B;  4RQF A;  3IC7 A;  5LHG A;  1EBO A;  2ITC C;  1Y4M A;  1NVP D;  2H8P C;  2AHZ A;  2EIN B;  4P9P A;  1NQT A;  3TCU A;  2WLH A;  5B1A B;  1LNQ A;  3K06 A;  1PD3 A;  1E79 G;  3FKS G;  4DXW A;  1JJ2 U;  4R8C A;  1THZ A;  3X2Q C;  1MOF A;  3B8N A;  3T1C A;  4MVQ A;  3B77 A;  3ZMZ A;  3ZIA G;  3B8M A;  4MVU A;  3AG4 B;  5HFL A;  3ABL C;  1QCE A;  5IDJ A;  1I5X A;  2AHY A;  1AI5 A;  2EIJ B;  2EIL B;  5H6Q A;  2D3O W;  3K08 A;  1BHB A;  1YTF B;  4UV9 A;  2WLI A;  1P4R A;  4L87 A;  3CME V;  3CCE V;  1FXK A;  2BOC C;  2X0L A;  2DQ3 A;  3ETD A;  1QLE B;  1R6K A;  2JJ2 G;  3ZRV A;  2A0L A;  4YXW G;  3RVY A;  2QTO A;  3WG7 C;  3ZN1 A;  2OCC C;  1AI7 A;  1BL8 A;  4RUF A;  3W7U A;  1Y66 A;  1KD1 W;  5IYB O;  1QLN A;  2QKS A;  2PI4 A;  3CCM V;  4JAS A;  2R9R B;  5KA6 A;  3ABT A;  1NBM G;  4J9Y B;  4LBE C;  3MHH C;  1EZJ A;  3E86 A;  5CBH A;  2WLI B;  3F7Y C;  2PI5 A;  4MVM A;  5L3C A;  1FXK B;  2XOK G;  1GMG A;  1AJP A;  3OAA G;  3SYO A;  2WSS G;  1K34 A;  2H94 A;  2Y69 B;  5L3B A;  1GM8 A;  2NNU A;  3DTU B;  3W7S A;  4TT3 G;  1Q81 W;  2EZP A;  3ETE A;  4ZBM A;  4G2K A;  3IGA C;  2ITD C;  4KFM A;  3OR7 C;  3SYP A;  1S77 D;  2JEU A;  3CCL V;  2V1D A;  3E35 A;  3VOU A;  3ZMS A;  4PDR A;  3CYO A;  4G27 B;  1YI2 V;  3E89 A;  3ABK C;  1OCO C;  1R73 A;  1FS0 G;  2KB1 A;  3F7V C;  3JD3 A;  1R3K C;  5LGT A;  5EK0 A;  2JK5 C;  2P90 A;  4LC1 A;  2JJ1 G;  2B1I A;  2WLL A;  4MTO A;  5GW7 A;  5EBM C;  1SRY A;  3ASO C;  3PJS K;  1OCZ C;  1K4C C;  5DM6 V;  1OCC B;  5J9P C;  5B1N A;  2LFR A;  1BHA A;  3CMA V;  5B1B C;  3LUT B;  3QO8 A;  1H38 A;  1AJN A;  3SYC A;  2OCC B;  4QIW F;  4JF3 A;  1VQ7 V;  3CCR V;  5CMU A;  2X6A A;  5DN6 G;  5KUM A;  1V55 B;  3ETG A;  1OHH G;  2Z5U A;  3STZ C;  4UVA A;  2IJI A;  2Z3Y A;  1AI4 A;  4WFF A;  3ABU A;  5BZB A;  3E8F A;  5C93 A;  1OCR B;  2YEV A;  1CPY A;  2W6J G;  2ZD9 A;  5B1O A;  4G28 B;  2JDI G;  3BEH A;  4DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...