1K73W

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k73W00
2D3OW 3CXCU 3CCUV 1VQOV 1K8AW 1K73W 3CCMV 3CCRV 1N8RW 1KD1W 1VQ5V 1VQ9V 3I56V 1VQ6V 1W2BU 1NJIW 3CC4V 1M1KW 1VQNV 3CCVV 3CCJV 3G4SV 5DM6V 1VQMV 1YJWV 3CPWU 1VQ4V 1R73A 3CCQV 1Q86W 3CCLV 1YHQV 4WF9V 1YITV 2QA4V 1VQKV 1M90W 3CMAV 3I55V 1YIJV 1YJNV 1S72V 3G71V 3CC2V 3CMEV 1Q81W 3CC7V 1KC8W 3G6EV 1QVFU 4WFBV 1VQ8V 3CD6V 2QEXV 3OW2U 3CCSV 1JJ2U 1KQSU 1Q82W 2OTJV 1YJ9V 1QVGU 2OTLV 4WFAV 1VQPV 1K9MW 3CCEV 4WCEV 1Q7YW 1YI2V 1VQLV 1VQ7V
chains in the Genus database with same CATH superfamily
4LF7O 2QE7G 1J95A 5IYZA 3AG3C 2AHZA 3P30A 1ZSPA 1R3LC 1YCIA 3ZN1A 2DJVA 3TJTA 2PY5A 3G6EV 2ZDIA 2YIBD 2CH7A 1I94O 1E1RG 2ZINA 1RM1C 1M93A 4K8ZA 2XTAA 4JASA 4GX2A 3HKEA 1H38A 3M8AA 3A0HZ 2XASA 2QKSA 1SS3A 3CRMA 3MHSC 4OX9B 5KAIZ 3CCSV 1DF5A 1LNQA 1IURA 3SYCA 4I55B 3G80A 1PNLA 3ZMUA 3KKYA 4ZIBA 1K97A 1VQ9V 3NXSA 2NLJC 3K5MA 1R6KA 4FM1A 2A79B 4MVRA 1GN3A 1H8EG 1HDJA 1K33A 4GKKB 1YZBA 4OX9O 4DR1B 3F5WC 1NVPD 5EZYB 5KMGB 4Z1MG 4TSFG 1N33B 5CA1A 3Q4HB 4GT1A 1XOUA 4O4LA 1FFTB 2EINC 4X20B 4B3RB 1XILA 1WNSA 2OWOA 3QVNA 4EFBA 4NB5A 2NN4A 3N2GB 1EN5A 2N05A 2ZD9A 3P3NA 1S77D 3B2EE 1S0VA 3SJAC 1FAFA 1PD3A 3O65A 2YXHA 4GKKO 4DR1O 3D36C 1ORQC 4JPRA 1N33O 5EBWC 1BS3A 1QHTA 2IH1C 1FXHA 2ZNIA 4IHJA 1OCCB 1O9GA 1OCCC 3JSNA 3RBZA 3SJBC 1AR4A 1VQ5V 2WA4A 2EZPA 4X89A 1NJIW 2YIAA 4OGQB 3THOA 1N0JA 3ASOC 4MTOA 3HKBB 3JALB 1BQZA 1JMKC 1NVPB 2QTSA 1H2MA 1VF5B 1K9MW 2YXLA 3O9OA 4CC5A 2P7TC 2M7WA 4X1IB 3BPZA 4R50A 2YICA 4MTFA 1AR5A 5EZYA 5KMGA 3BY6A 1YIJV 3ABMB 3ABMC 3E8GA 3H1HH 1XUQA 4CZZA 3RVZA 3OGIB 1WB7A 3W7XA 3BRCA 1I08A 1K92A 2F43G 3OMIB 1M1KW 2F93B 1H2GA 2JGDB 4TUYA 4FLTA 3D36A 2PI5A 4LF4B 1WA8A 3P32A 4WBNB 5JVDA 2IJHA 3UCSC 1R3JC 1ZWIC 4O2BB 4QE7A 2KKWA 1VP7A 4JYCA 3ABKC 2WSSG 2ADPA 1OCZC 3X2QC 4DR6B 2WLHA 1DTOA 3HKBA 3JD1A 1HNZO 3JALA 4LF4O 3IAYA 5B1OA 2Y0IA 1KU9A 3UT5A 1WP7A 3ZMTA 3K0DA 4DW1A 3E22A 3SPJA 5LXTB 2HR3A 4HNAB 4CS2A 4NXNO 4DR6O 1K4DC 1YSCA 3W7UA 1SA0B 4PDVA 1IDSA 1GKFA 1SQGA 4DV5B 4X65B 3ETEA 1XMOB 4BIUA 3T1CA 3FB7C 3J80N 2HJDA 2E76B 3CD6V 1W59A 3OW2U 4P2ZA 5KHJA 1NKDA 5B1AB 3ZRXA 3CRQA 5JCOA 2JGDA 3AG1B 3AG1C 4ZOLB 2XAQA 4DV5O 4X65O 1KB9F 3PN1A 4JAUA 1XMOO 2EBOA 4JTCB 4JI4B 4PA6A 4CS3A 1SC5B 3H1IH 1H2SB 4LCUC 2Q0AA 5CA0B 3JD3A 3OE7G 5EBMC 1YJ9V 3K9SA 2DWDC 3B09A 3OTOB 5E79Z 3HKCB 1XL6A 3T4DA 5KLVH 3CP1A 4AI8A 4JI4O 3CCJV 3K06A 2HFEC 4U7OA 2E5LB 3CCLV 2UUBB 1M56B 5GTIZ 1RSOB 4JAVA 3ZRSA 2Y4UA 3C90A 5IJ9B 2UUAB 1QLNA 1SQPH 3OTOO 1XNRO 5LXTA 1VEWA 4HNAA 4JYAB 3CCEV 1I7FA 4R7CA 4CS4A 1AJNA 2EZOA 2JEUA 1PM9A 1EZVH 2EJRA 2ZKOA 1NI8A 1NTKH 5JJEB 3OUSA 2UUBO 3WG7B 5H2FZ 5LMUB 2KSDA 3R66A 2UUAO 3T2MA 2K9PA 4JYAO 4H44B 4CH6A 1SESA 2JS5A 2BTOA 5FPRA 4E4EA 1AP6A 4RQEA 2OCCC 1GN6A 3A0BZ 5CB4A 2LGWA 4X8AA 5LMUO 5LYJA 5LHIA 4MVUA 2Y4TA 4K35A 4FPPA 4QPKA 2PGGA 2ZXWB 2ZXWC 1N36B 5H6QA 2OYQA 4BW9A 2QSAA 5JJNB 4LWSA 1P49A 1XL4A 2UU9B 3CC7V 3CS5A 4P30A 4I50A 3QO7A 2A9HA 2X6BA 1SQXH 2AXTZ 1N36O 3N2KA 4RWUA 4X1YA 4LFAB 2P90A 4K3AA 2D2CB 5LGNA 2WLIB 4LH6A 3K57A 2F4VB 1AP5A 4FFBB 3GVMA 5LP6C 1JJOA 2Z0AA 3JCUZ 4BIZA 3D3IA 2UU9O 2P67A 1SKVA 1R6NA 4ASUG 4KP4A 4YHHO 4LC1A 3CE2A 4O4HA 4UUJC 4LFAO 3AG7A 3AEIA 3CYOA 4DV7B 2B1GA 3R65A 3CXCU 1K8AW 1Q3EA 4LFCB 3ZHSA 2F4VO 4R8CA 2X6CA 1DGSA 2DYRC 4JV5O 2AZ2A 3D8CA 5B3SC 2RDCA 4OPAA 2N04A 3D3QA 1YJWV 1NH2D 1M57B 2CE4A 2CTRA 5H6RA 4MS2A 2X6AA 4X9QA 3RYFB 4E2LA 2W6JG 4EB6B 2YIDA 4ZHQA 1HW7A 4LFBB 4DV7O 3N27A 4KXRA 1V55C 2JEXA 2YXYA 3OD4A 4U3FH 4DO2A 2IU0A 4DV1B 4O4JA 3FAVB 2LGQA 3K9AA 5LGTA 5JQGB 2LO1A 1SQVH 1KUQA 1CEZA 3S3XA 2UXCB 2LW7A 1QLEB 1JQ0A 2L35A 2WLLB 2WLIA 5KHKA 3ICXA 4DRXA 4DV1O 2OTJV 1GM7A 1K5QA 3E8HA 3UKMA 5LP6A 2GBOA 4DW0A 1GN4A 4FLUA 4J7KA 2K1EA 4NVPA 4WFHA 4KUMA 4O2AB 1NH2B 2VWKA 2UXCO 4JI8B 1FXKB 5JJJB 1GM9A 1XHZA 2Q6AA 1AILA 3RYCB 2EX3A 2LQTA 1MSDA 2PYJA 4J7JA 3CCMV 2P6JA 1PV0A 5EC2C 3B4SA 5IT9N 4B7KA 1TUBA 3JSLA 5IYZB 3ETDA 1NR1A 4PA7A 4JI8O 4EB6A 1P4RA 4IYHA 2ZIOA 1T5EA 1FXVA 3G67A 2HEPA 5H5NA 4JTAB 3F5TA 1PPJH 1F4NA 1GRJA 1VQ4V 5JQGA 1DK1A 1GAXA 2E75B 4JYBA 2Q8VA 2R72A 4B08A 1FD9A 3ZS8C 3HKEB 1K34A 1XMQO 3JAWA 4GZRB 3T1YB 3GWOA 1PP9H 1VQNV 2IU3A 3JD4A 4LF7B 2HKOA 4I0XB 1QU7A 4O2AA 2ITDC 5DEDA 4EEQA 4LF8B 1DLBA 4DR4B 2P06A 2UXNA 3ZN0A 3RYCA 1I0HA 3T1YO 5IWAB 1WP8A 3LSUA 1CP9A 2Y69C 5CA1B 5IY5C 1KBHA 4O4LB 3K79A 4JI2B 3AG3B 5FPOA 4DXWA 5C8YA 1OCRC 5ITZA 3BEHA 4LF8O 4DR4O 1VMGA 1Z5VA 1MA1A 3E8FA 4ZBMA 4B3TB 1S5LZ 4H0LB 5IWAO 4LR3A 5IE9A 1IXBA 1Q7YW 1Q90D 1URFA 5KHIA 4JI2O 1RM1B 4IHJB 1YDXA 5L3BA 2BCCH 2QWQB 2ZE7A 2X0LA 2P5OA 2QA4V 4B3TO 2XUMA 1ZL8A 1K5SA 3K58A 2ODMA 4J9YB 2QWPB 4YXWG 5KAFZ 3CC2V 1G8MA 4I0XA 4D7SA 4HAMA 1HNXB 4U7NA 2ZR2A 3MDSA 4O4IB 1MZFA 3CX5F 3I55V 5L3CA 2Q7HA 1HNWO 1GK9A 3QO8A 2EINB 3B8MA 2Q7GA 4I9WA 4X66B 3FX7A 1HNXO 2UXBB 2JK5C 1WJZA 2Q69A 4L87A 3DSQA 1Z2GA 3B8NA 4TUYB 4JI1B 2IH3C 4RQFA 1GO3F 3CMEV 2W6IG 5HFMA 1Q6HA 2FKXA 4DR2B 3JAKA 1WA8B 4X66O 3C3TA 5JVDB 2AZ0A 2UXBO 3GWKC 4IGGA 4UVAA 3SGIA 2PF4E 3AK3A 4JI1O 1Q86W 4GX0A 3ASOB 5BR8O 2XAHA 4DR2O 1Q82W 3UQ8A 4AILC 4WFAV 3UT5B 2QM7A 4W4KA 4B7EA 3EVKA 3UO2A 2WLMA 3I56V 3HPLC 3S3WA 3E22B 3SYQA 3H1JH 1W0KG 2QM4A 2LFSA 2ZIMA 2EIKB 4O4IA 2EIKC 3HKDB 1SRYA 3APQA 3HB3B 4NKGB 4MW3A 5EC1C 2Y0PA 2RQ6A 3FB5C 4LF6B 3L72H 3JD2A 5GONA 1MZEA 1AROP 4J80A 3ZHTA 2FMLA 1N32B 4BIOA 4KL1A 4MVZA 1QCEA 1OCOB 1OCOC 1KKCA 1S3JA 4DV0B 4DV6B 2HVJC 1F7YA 3CCQV 3H1LH 4QPJA 3FD9A 3STLC 1HNZB 4LF6O 2IJIA 1Y4MA 3CEIA 2ADQB 1N0NA 3L71H 3E8BA 3LUTB 4UCVA 1N32O 4CH4A 1RPOA 2L6LA 3ABKB 1VQ6V 1H2NA 1IBMB 2B1IA 4DV0O 2YEVB 3ETGA 4DV6O 1OCZB 4NXNB 3X2QB 3WFVA 4F6RA 1UPGA 5B1NA 3LNNA 1Y66A 2RN9A 3ZJZA 1N4CA 1U97A 1WPBA 2JS3A 1IBMO 2EIJB 3OEHG 2EIJC 3HKDA 2XAGA 4JZGA 4UVCA 4BR6A 5LBQA 2PZSA 3ETQA 3DGEA 3FB6C 3TGUH 1NR7A 4NTWA 1BE3H 4TOIA 1XQ8A 4PV1B 3ZHQA 3CRCA 3KG2A 5DECA 3ZMVA 2D3OW 1K73W 3A2FA 1MSWD 2PI4A 1Q6IA 2DE0X 1BCCH 1B06A 2FTKA 5CB4B 1GTOA 3K5NA 2F1MA 3GB7C 3SDLA 4DK1A 5LYJB 1ENVA 1S5HC 3OM3B 4X64B 3AG4C 1VQ7V 1JCHA 1ROPA 2YEVA 1XNRB 1N8RW 3RW0A 3RN4A 1KKDA 4DV2B 3QF7A 2X7RB 3BAAA 5J2UB 3W7TA 2DOSA 4WF9V 1XNQB 1Y67A 4UFZA 4LWSB 5E1AC 5H9CA 1AVMA 4DK0A 4X64O 4PHZA 5FLXN 3FFQA 4Z2WA 3FKSG 4I50B 4WFGA 3JYCA 3CCRV 1FPOA 4DV2O 3N2KB 1MABG 4X1YB 2IJKA 2DWEC 4WFEA 3E86A 1KMIZ 1XNQO 2XHBA 4CH3A 5BY1A 2QWRB 3OR7C 2GTAA 2ZQMA 1SF9A 4HBNA 4J10A 3U11A 4FLZA 1IBKO 1EN4A 1D5NA 3SYPA 4FMTA 5B1BC 4DR5B 3SJQC 4P9PA 2JRIA 4O4HB 1BZKA 4UCRA 1D2DA 4UV9A 2OCHA 3ZHVA 5CBGA 2OCCB 2VQFB 5BMVA 2YSUB 4TT3G 3J81N 4FZ0A 4XDJA 4W4LA 2P4KA 4XDKA 2ATKC 1YJNV 2ZCEA 1Q81W 4MTXA 3TXSA 3EHBB 3ZIAG 4DR5O 1BHAA 2VRZA 2FB5A 1AI7A 4ZHQB 2KG7A 2VQFO 2YI9A 5KHHA 1JPXA 1MMMA 4MW8A 5J2UA 3OR6C 3L9DA 4O4JB 1AI6A 3CMAV 5IYBO 1K3EA 2JDIG 3K0GA 4G28B 4YHHB 4FFKA 1KP2A 5BZBA 3DTUB 1E1QG 4DRXB 4DR3O 3MAQA 1Z5WA 1PNMA 5LP6B 2QTOA 4JV5B 2F95B 3K03A 4JI5B 4KHPB 1O9HA 1XBLA 3I5DA 1H2KA 2GUZB 1US6A 2CAZC 1ZTEA 5LL6Y 4R6ZA 1EBOA 2EIMB 2EIMC 3DC6A 2HVKC 4FK5C 1HP8A 2P4VA 1A32A 4NTXA 5K1PA 4MT8A 4CC6A 2DYRB 4C7UA 1ZLZA 1YEWA 1BMFG 5B3SB 4DR7B 4PA9A 4JI5O 3P3PA 1L0NH 1TUBB 4KHPO 2XNDG 2EULA 2HG5C 2QKCA 5A2QN 4UCTA 1FJGB 1WPXA 4X62B 3L70H 5KX5B 1VQPV 5D5PA 1SZTA 3CWBH 4LH7A 3ZHUA 1V55B 2YI8A 4TV8A 1RPRA 5LGUA 4DR7O 4Q20A 4GUNA 1VQMV 1PL0A 2F66C 1YHQV 1XDCA 1COWG 3FYIB 5B66Z 2F23A 4IIJA 1FJGO 3ZMSA 4X62O 3JARA 4H13B 4FLYA 3JAWB 3E89A 2JJ1G 2GHYA 1TUEB 3CHXA 3WB1A 2LP7A 2JVDA 4FLWA 5L3EA 3LDDA 4MVMA 3DXRA 3T4ZA 4QIWF 3RYHB 1B04A 3EXAA 2GUZA 3WB0A 1AB3A 4J7ZA 3ASNC 2YDEA 2RCVA 1FS0G 1R3IC 3DC5A 5IJ0A 2V4DA 5KA5A 4D7TA 3HR0A 1S5JA 1KD1W 3W7WA 2Q5ZA 1SQQH 3G4SV 3SR2C 2UXXA 5C8YB 2E3CA 1M90W 2IW5A 2Q73A 3CSXA 1R1BA 5ITZB 1KC8W 3E2EA 4UB6Z 2KQXA 5KX5A 4J11A 4GLXA 2BOBC 1XMQB 4J42A 3SPCA 2DN9A 2Q4PA 3TK1A 3U0ZA 5J9PC 3A8TA 4YY3B 2YUAA 2Q0OC 3LSQA 1YITV 1MOFA 5LMNB 1V54C 1EZJA 5EIBC 2Z5UA 4DV3B 1BSMA 1ZL8B 3L75H 3ZCCA 4NR1A 4PDMA 1Y76B 1XEQA 1Y74A 3OT7A 1PKXA 4RO2A 4G27B 1NZ6A 1LUWA 2MK3A 4YY3O 3RYHA 5K1XA 2KB1A 2ILMA 3AG2C 1RFYA 4K0KB 5LMNO 5JWPA 4X88A 1G4YB 4CH5A 4DV3O 5CN0A 3QG5A 4NTYA 1QVFU 1JFFA 1LUVA 1M4UA 4YJ3B 4I4TA 2Y69B 5IY5B 1W2BU 3RGBA 3AK1A 2R70A 2RMKB 3L73H 1WB8A 3SPIA 4H37A 4GCZA 4K0KO 1Q6UA 1XI1A 1NBMG 1OCRB 4XBFA 2PYLA 3TXQA 4TQDA 3ABLC 3STZC 3B77A 1SQBH 1GM8A 3QTCA 4PA3A 3JAKB 4JZ2A 5LHGA 2UXDB 4JI7B 1Q5OA 2GTSA 4ICGA 1WN7A 3VQWA 1NQTA 3ZHRA 2R9IA 4H33A 1R3KC 1Q8IA 3W7SA 3SPHA 3JATA 4XDLA 1Y76A 2UXDO 4JI7O 1HNWB 4DV4B 1EN6A 3NR7A 1AJPA 1XREA 4MSWC 4JI6B 2WPDG 2CGNA 1NTZH 2GSMB 5D5QA 5CBFA 2ZM6B 1H8HG 3B40A 3LNMB 4IYIA 3CRAA 1YF2A 4JF3A 4YJ3A 4DUZB 4JI3B 2DQ0A 2IM9A 4PD4F 4DV4O 4PJ0Z 2PUSA 4IT5A 2HHHB 1YVWA 5GONB 2XAFA 4LNUB 5KUMA 4JI6O 3CJHB 4ZKIA 4LF5B 5KUKA 1QBZA 1TVKA 2ZM6O 1Q43A 3SPGA 4JI0B 5EBLC 5LOVA 2A0LA 4U3JA 2ZE5A 4DUZO 5FL7G 5L3DA 3E35A 4JI3O 1B3QA 5BR8B 5CA0A 2HHHO 1H2LA 4UCSA 3LDEA 1N34B 1ZAUA 4LF5O 2QWNB 1L0LH 1P84F 1PNKA 3L74H 2QR4A 3CB2A 4UXNA 4JI0O 4PDRA 1IX9A 4QNHB 4F6RB 4PDLA 4TV9B 4B3RO 3SYAA 1EM1A 3MD0A 3UM7A 2QM8A 2Q7EA 1N34O 4K8XA 4PELA 1J5EB 3WU2Z 1BQ0A 2W0XA 1E79G 3SJCC 2NNUA 4YJ2B 4IL6Z 5JH7B 1YTFD 2CGOA 1G1XB 1PL4A 2ZE6A 4LP8A 4I55A 3QNEA 2G38A 2QWOB 4Q6GA 2O57A 4UCUA 3VQYA 1P7GA 2BE3A 4LNUA 1J5EO 4BWAA 1YI2V 2WA3A 3CJHA 1FYJA 2ITCC 5LHHA 3QO5A 1R73A 5L3FA 5B5EZ 3JCZA 4MVOA 4FVMA 1OHHG 2CDYA 3Q4HA 2YIBA 2FL4A 5AG2A 4X20A 1VF6C 2LJ2A 4FM2A 1L8DA 1JX9A 3K04A 4J41A 3ZBHA 3ZMZA 5F2VO 4PA4A 3N2GA 4D6TH 5JCOC 3TETA 2R9RB 2IJJA 3ZRVA 1JR9A 2AHYA 3RT3C 4EFEA 4TV9A 1V9PA 1YTFB 3OMAB 4EKWA 3F7YC 3UO3A 2XOKG 1JJ2U 1R6TA 1HR0B 5C93A 1S76D 5CMUA 1BL8A 1I5XA 2WLJA 3RVYA 1IBLB 3IFXA 2WAMA 1X4TA 4YJ2A 5JH7A 4G2KA 1FFXB 3KCXA 1MNGA 3BVOA 4FZ1A 4I9QA 1TAEA 2B9ZA 2BSKB 3OAAG 4HZ3A 3G71V 3IC7A 3IGAC 4JAAA 1HR0O 4FLVA 3KZIZ 1BHBA 2AW9A 3JAMN 1SQFA 2YC0A 1IBLO 2R9AA 2BOCC 2ARHA 2Q68A 4ABMA 3E83A 4MTGA 4X1IA 2VWJA 4RAIA 3RWRD 2OIEA 2QDOA 3CCVV 3M99B 3PJSK 4JYYA 3T1HB 2WLKA 5BMVB 1KP3A 2LFRA 1VF6A 4BAYA 3RYIB 3EFFK 2JJ2G 2Y48A 2HP8A 1TGOA 5B1AC 1HWYA 3AG4B 3K59A 3JASB 1QNMA 2KG7B 4YIOA 3VBBA 3T1HO 4P9OA 5FNVB 3ABTA 4WBNA 4NYKA 3OGCC 4O2BA 4RUEA 2HLDG 2OTLV 1IBKB 1NTMH 2DW4A 4N21A 3BABA 1TA8A 1QR9A 1AI5A 1FFXA 2CK3G 1AJQA 1F4MA 3APOA 4QJFB 3CPWU 2BSKA 4NXMB 1M56C 3LDCA 3KCYA 1LR1A 1XHXA 1VQ8V 5CA3A 1W0JG 1QVGU 4RUFA 3IJ4A 5B1BB 1SA0A 4GKJB 3K5LA 4MVSA 3FB8C 5TISZ 2A3QA 3LSSA 2E5LO 2H8PC 3A0RA 4NXMO 2A7WA 1EFRG 2M6YA 3WG7C 1THZA 2GDSA 5IDJA 1JVMA 3K08A 3C3SA 5KA6A 1GMGA 3RYIA 3RFRA 2Q9LA 2H3OA 4Z1VA 4MVQA 1FKAO 2QGNA 2Z3YA 4GKJO 3ML0A 3JASA 2N74A 5IYCO 4OPHA 2PTMA 4WCEV 4ZOLA 2VS0A 3OEEG 3CCUV 4B3SB 1CXZB 5FNVA 5BXZA 1SETA 3H1KH 3M7MX 3BFRA 4TV8B 4DR3B 2CTQA 2A06H 2NR5A 4BW5A 5KHGA 1AR1B 1UJWB 4F6EA 1IVSA 1M5IA 4PI0A 5EK0A 2V1DA 1QQCA 3VQXA 3HKCA 4IIJB 4B3SO 1BGYH 1KECA 1SERA 1JOYA 3JARB 4I7ZB 2ZE8A 4B3MB 1U96A 1RSOA 4UB8Z 3JD0A 5IJ9A 4GX5A 3DXRB 1VF7A 1G6UA 1RP3B 4FJCC 2QEXV 2ZR3A 4TQFA 1KQSU 3K3WA 4HYOA 5IJ0B 2V7QG 3MHHC 4AQYB 4B3MO 2JIZG 2EILB 2EILC 3FYEB 2Q67A 2AGAA 4LF9B 4X1KB 3BCCH 2UUCB 3SYOA 1P7BA 1Y6XA 4LBEC 1AI4A 4GX1A 1IZ3A 4TWKA 4JTDB 4DUYB 5A9GA 1D5AA 2BTQB 4AQYO 4PI2A 1WLEA 2P22C 4CBCA 3G6BA 4LF9O 5EYPB 1M57C 2ZT9B 2UUCO 1NT2B 1NU1H 4J9ZB 4ZI7B 2RJZA 2ZNJA 4DUYO 1OZ0A 4OXSA 4N23A 4LFCO 2XAJA 5J2TB 1B6QA 1VQOV 2VQEB 4QE9A 3ZRWB 2HJFC 4L8JA 2MW2B 3CXHF 1Y74B 1ZUQA 1L1FA 1WAZA 5EIBD 4LFBO 2H94A 3ASNB 1KYOF 4WFBV 1QLEC 4DYLA 1K4CC 1OV9A 2DQ3A 3OMNB 4I5SA 4FM0A 2VQEO 1JFFB 2CTPA 2QJ1A 4FFBA 4AHCA 1VIBA 4I4TB 3TCUA 4X1KA 5HFLA 5IYDO 5DM6V 2W0FC 1SZXA 3U10A 3F7VC 4GYCB 1GH6A 2WWWA 4A5UB 1FXKC 4FLXA 1DF4A 1MG1A 5LA6B 1IXMA 2IBZH 2BTQA 5DN6G 4UCOA 1F23A 1VQLV 2ETNA 2CTWA 3K5OA 5EYPA 3H9VA 4UVBA 2OIGA 3RYFA 4QGPA 4ZI7A 3OFNG 5GW7A 3BA9A 2C2AA 1V54B 3ZX6A 5J2TA 1JA8A 2ZDIC 5CBHA 4FIPC 4JGSA 2JGUA 4YIPA 2CH7B 3ZRWA 3ABUA 2FYUH 3FAVA 3JATB 5GTHZ 3ZEDA 1GN2A 3CRRA 1NS1A 3AG2B 1CPYA 2DYSB 2DYSC 3WB2A 1VQKV 1ZX3A 2WLLA 1K7DA 1YXBA 1F51A 2GV9A 2QKAA 4WFFA 2LW1A 4UV8A 2EJ7A 3OUFA 4KFMA 2YS8A 3CC4V 3J7AU 1BT8A 1M9NA 3BHPA 1I5YA 1OJHA 3IC9A 1QR8A 1FXKA 2CUGA 1TVKB 2WLNA 3VQVA 4F4LA 3BA8A 3OTFA 5L3GA 5LA6A 1S72V 2OT5A 2RNBA 3H01A 3ABLB 1VARA 5LOVB 2B5UA 3VOUA 4U3JB 1X59A 1UFIA 2E74B 3AK2A 1I94B 2XT9A 2DMXA
chains in the Genus database with same CATH topology
4WFGA 3JYCA 1V55C 2JEXA 4DO2A 3CCRV 2QE7G 1J95A 2IU0A 1MABG 2IJKA 3AG3C 2DWEC 2AHZA 2ITCC 3P30A 4WFEA 5LHHA 3E86A 3QO5A 3K9AA 1R73A 1R3LC 5L3FA 3JCZA 3ZN1A 4MVOA 5LGTA 3OR7C 2ZQMA 1OHHG 1CEZA 3G6EV 2ZDIA 1QLEB 1JQ0A 3SYPA 3ZMZA 1JX9A 3K04A 1E1RG 4FMTA 4PA4A 5B1BC 2WLLB 2WLIA 3SJQC 4P9PA 1RM1C 2OTJV 1GM7A 1K5QA 4UV9A 5CBGA 3E8HA 2OCCB 3UKMA 3TETA 2R9RB 2YSUB 2IJJA 4TT3G 3ZRVA 2AHYA 4JASA 4GX2A 4XDJA 2K1EA 1H38A 4WFHA 4KUMA 1NH2B 2XASA 4XDKA 2ATKC 2QKSA 1YTFB 1YJNV 1Q81W 1FXKB 3OMAB 4EKWA 3MHSC 4MTXA 3F7YC 1GM9A 3EHBB 3ZIAG 3CCSV 2XOKG 1DF5A 1LNQA 1JJ2U 3SYCA 1BHAA 2Q6AA 5C93A 1S76D 1AI7A 5CMUA 1PNLA 1I5XA 1BL8A 2WLJA 3RVYA 3ZMUA 1K97A 1VQ9V 3IFXA 2WAMA 3NXSA 2NLJC 2P6JA 3CCMV 1JPXA 5EC2C 1R6KA 4MW8A 3OR6C 2A79B 4G2KA 4MVRA 3ETDA 1NR1A 1H8EG 1AI6A 4PA7A 3OAAG 1K33A 1P4RA 3CMAV 5IYBO 4HZ3A 1K3EA 3F5WC 3G71V 1NVPD 3IC7A 3IGAC 2JDIG 4Z1MG 1BHBA 4TSFG 3K0GA 4G28B 4GT1A 2BOCC 1FFTB 2EINC 2Q68A 3E83A 1KP2A 1FXVA 4MTGA 5BZBA 4RAIA 4JTAB 3DTUB 1E1QG 2ZD9A 1F4NA 1S77D 3CCVV 3M99B 3PJSK 1S0VA 1VQ4V 1PNMA 2WLKA 1PD3A 2QTOA 4JYBA 1KP3A 3K03A 1ORQC 2LFRA 4BAYA 4JPRA 1K34A 5EBWC 3EFFK 2IH1C 1FXHA 2JJ2G 2Y48A 4R6ZA 1EBOA 5B1AC 2EIMB 1OCCB 2EIMC 1OCCC 3RBZA 1HWYA 3AG4B 3GWOA 2HVKC 4FK5C 1VQ5V 2EZPA 4X89A 1NJIW 3VBBA 1VQNV 2IU3A 3JD4A 4MT8A 2DYRB 2HKOA 1BMFG 5B3SB 4P9OA 4PA9A 3ABTA 2ITDC 3ASOC 2XNDG 4MTOA 3OGCC 4RUEA 2HG5C 1DLBA 2UXNA 3ZN0A 1NVPB 2HLDG 1WPXA 2OTLV 1VQPV 1K9MW 1CP9A 2Y69C 1SZTA 5IY5C 2DW4A 2P7TC 4N21A 1V55B 3K79A 1QR9A 2M7WA 1AI5A 1RPRA 5LGUA 3AG3B 4Q20A 2CK3G 1AJQA 1F4MA 4DXWA 4QJFB 4R50A 3CPWU 1VQMV 1OCRC 1PL0A 1M56C 4MTFA 1YHQV 3BEHA 3LDCA 1COWG 3BY6A 3FYIB 1YIJV 3ABMB 3ABMC 3E8GA 3E8FA 4ZBMA 4CZZA 3ZMSA 1VQ8V 3RVZA 5CA3A 1W0JG 1QVGU 4RUFA 5B1BB 1Q7YW 3W7XA 4MVSA 3E89A 3FB8C 1K92A 2GHYA 2JJ1G 1RM1B 2F43G 3OMIB 1TUEB 1M1KW 2LP7A 5L3BA 1H2GA 3LSSA 2H8PC 3A0RA 5L3EA 1EFRG 3WG7C 3LDDA 4MVMA 3D36A 3T4ZA 2X0LA 1THZA 4QIWF 5IDJA 1JVMA 3K08A 5KA6A 1GMGA 2PI5A 2QA4V 3ASNC 3P32A 2IJHA 1K5SA 1FS0G 1R3IC 1R3JC 1ZWIC 4MVQA 4QE7A 4J9YB 2Z3YA 3ML0A 5IYCO 4YXWG 5KA5A 4JYCA 4WCEV 3CC2V 3ABKC 3OEEG 3CCUV 1G8MA 1KD1W 2WSSG 3W7WA 1OCZC 3X2QC 4HAMA 1SETA 2WLHA 3G4SV 4U7NA 2ZR2A 1DTOA 2UXXA 3JD1A 4BW5A 1AR1B 1M90W 2IW5A 5B1OA 1UJWB 3I55V 5L3CA 1KC8W 3E2EA 5EK0A 2V1DA 1GK9A 3ZMTA 3K0DA 2BOBC 3QO8A 1KECA 1SERA 2EINB 3B8MA 4I9WA 3SPJA 3SPCA 1JOYA 2HR3A 1K4DC 1YSCA 3W7UA 2JK5C 4PDVA 3TK1A 2Q69A 4L87A 5J9PC 1GKFA 3ETEA 3B8NA 4BIUA 3JD0A 3FB7C 3T1CA 3LSQA 2IH3C 4RQFA 1MOFA 1YITV 4GX5A 1GO3F 3CMEV 2W6IG 1V54C 4FJCC 5HFMA 1EZJA 3CD6V 2Z5UA 2ZR3A 3OW2U 2QEXV 1KQSU 4P2ZA 1NKDA 3K3WA 4HYOA 5B1AB 3ZRXA 4UVAA 3ZCCA 2V7QG 4PDMA 3MHHC 3AG1B 3AG1C 1PKXA 2XAQA 2JIZG 4RO2A 4G27B 2EILB 2MK3A 2EILC 4JAUA 3FYEB 2EBOA 2Q67A 4JTCB 2KB1A 4PA6A 3AG2C 1Q86W 4GX0A 3ASOB 2XAHA 4LCUC 4X88A 1G4YB 3SYOA 1P7BA 4LBEC 5CN0A 1QVFU 3JD3A 1AI4A 4GX1A 3OE7G 1Q82W 5EBMC 1YJ9V 4TWKA 4JTDB 2DWDC 4WFAV 2QM7A 2Y69B 5IY5B 1XL6A 2WLMA 1WLEA 3I56V 1W2BU 3T4DA 3HPLC 4CBCA 3SYQA 3CP1A 3CCJV 1W0KG 3K06A 3SPIA 2LFSA 4H37A 4GCZA 2EIKB 2EIKC 2HFEC 1M57C 1NBMG 1OCRB 1SRYA 4U7OA 4XBFA 3CCLV 3HB3B 1M56B 4MW3A 5EC1C 4JAVA 3ZRSA 3ABLC 4J9ZB 3STZC 3FB5C 3JD2A 3B77A 1QLNA 1OZ0A 4OXSA 1GM8A 4N23A 4PA3A 1AROP 3CCEV 2XAJA 1B6QA 4R7CA 1AJNA 2EZOA 2JEUA 5LHGA 1VQOV 4QE9A 3ZRWB 2EJRA 4MVZA 1QCEA 1OCOB 2HJFC 1OCOC 1NQTA 1S3JA 3OUSA 2R9IA 3WG7B 2HVJC 4H33A 3CCQV 1L1FA 4QPJA 3STLC 1R3KC 2IJIA 2H94A 3ASNB 3T2MA 3W7SA 1Y4MA 4WFBV 1QLEC 1K4CC 3E8BA 2DQ3A 3SPHA 3LUTB 3OMNB 4I5SA 1SESA 4XDLA 1RPOA 3ABKB 1AJPA 4RQEA 1VQ6V 2OCCC 2B1IA 2YEVB 3ETGA 1OCZB 3TCUA 5HFLA 3X2QB 3WFVA 4MSWC 5IYDO 2WPDG 5DM6V 2W0FC 2GSMB 3F7VC 5CBFA 4X8AA 5B1NA 1H8HG 2WWWA 5LHIA 3LNMB 1FXKC 1DF4A 1MG1A 1Y66A 4MVUA 3ZJZA 1IXMA 4FPPA 4QPKA 4JF3A 2DQ0A 5DN6G 2ZXWB 2ZXWC 1F23A 1VQLV 2EIJB 3OEHG 2EIJC 2XAFA 5H6QA 5KUMA 2XAGA 4ZKIA 5KUKA 1QBZA 4UVCA 5LBQA 4UVBA 3SPGA 1XL4A 5EBLC 3OFNG 2A0LA 5GW7A 2C2AA 3DGEA 3FB6C 3CC7V 5FL7G 1V54B 3E35A 4P30A 5L3DA 3QO7A 2A9HA 2X6BA 1NR7A 2ZDIC 5CBHA 4FIPC 4JGSA 3ZRWA 3ABUA 3KG2A 3ZMVA 2D3OW 2P90A 3LDEA 1K73W 5LGNA 2WLIB 1MSWD 1PNKA 2PI4A 4UXNA 3AG2B 1CPYA 4PDRA 2DYSB 4BIZA 2DYSC 4QNHB 3D3IA 2P67A 4PDLA 1VQKV 2FTKA 1R6NA 1GTOA 4ASUG 4KP4A 3GB7C 2WLLA 3SYAA 1K7DA 4LC1A 3MD0A 1ENVA 1F51A 4UUJC 3UM7A 1S5HC 2QM8A 3OM3B 3AEIA 3AG4C 3CYOA 4WFFA 1VQ7V 2B1GA 1JCHA 1ROPA 2YEVA 3R65A 4UV8A 3CXCU 4PELA 1N8RW 1K8AW 3OUFA 4KFMA 4R8CA 3CC4V 3RW0A 2X6CA 2DYRC 1KKDA 1M9NA 1I5YA 1E79G 2X7RB 5B3SC 1YJWV 2NNUA 1NH2D 3W7TA 1M57B 1QR8A 1YTFD 1FXKA 4WF9V 5H6RA 2WLNA 4F4LA 4LP8A 4MS2A 5L3GA 2X6AA 4E2LA 1S72V 2OT5A 3H01A 2W6JG 5E1AC 3ABLB 5H9CA 3QNEA 2B5UA 3VOUA 3FKSG 1YI2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3O W;  3CXC U;  3CCU V;  1VQO V;  1K8A W;  1K73 W;  3CCM V;  3CCR V;  1N8R W;  1KD1 W;  1VQ5 V;  1VQ9 V;  3I56 V;  1VQ6 V;  1W2B U;  1NJI W;  3CC4 V;  1M1K W;  1VQN V;  3CCV V;  3CCJ V;  3G4S V;  5DM6 V;  1VQM V;  1YJW V;  3CPW U;  1VQ4 V;  1R73 A;  3CCQ V;  1Q86 W;  3CCL V;  1YHQ V;  4WF9 V;  1YIT V;  2QA4 V;  1VQK V;  1M90 W;  3CMA V;  3I55 V;  1YIJ V;  1YJN V;  1S72 V;  3G71 V;  3CC2 V;  3CME V;  1Q81 W;  3CC7 V;  1KC8 W;  3G6E V;  1QVF U;  4WFB V;  1VQ8 V;  3CD6 V;  2QEX V;  3OW2 U;  3CCS V;  1JJ2 U;  1KQS U;  1Q82 W;  2OTJ V;  1YJ9 V;  1QVG U;  2OTL V;  4WFA V;  1VQP V;  1K9M W;  3CCE V;  4WCE V;  1Q7Y W;  1YI2 V;  1VQL V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 4LF7 O;  2QE7 G;  1J95 A;  5IYZ A;  3AG3 C;  2AHZ A;  3P30 A;  1ZSP A;  1R3L C;  1YCI A;  3ZN1 A;  2DJV A;  3TJT A;  2PY5 A;  3G6E V;  2ZDI A;  2YIB D;  2CH7 A;  1I94 O;  1E1R G;  2ZIN A;  1RM1 C;  1M93 A;  4K8Z A;  2XTA A;  4JAS A;  4GX2 A;  3HKE A;  1H38 A;  3M8A A;  3A0H Z;  2XAS A;  2QKS A;  1SS3 A;  3CRM A;  3MHS C;  4OX9 B;  5KAI Z;  3CCS V;  1DF5 A;  1LNQ A;  1IUR A;  3SYC A;  4I55 B;  3G80 A;  1PNL A;  3ZMU A;  3KKY A;  4ZIB A;  1K97 A;  1VQ9 V;  3NXS A;  2NLJ C;  3K5M A;  1R6K A;  4FM1 A;  2A79 B;  4MVR A;  1GN3 A;  1H8E G;  1HDJ A;  1K33 A;  4GKK B;  1YZB A;  4OX9 O;  4DR1 B;  3F5W C;  1NVP D;  5EZY B;  5KMG B;  4Z1M G;  4TSF G;  1N33 B;  5CA1 A;  3Q4H B;  4GT1 A;  1XOU A;  4O4L A;  1FFT B;  2EIN C;  4X20 B;  4B3R B;  1XIL A;  1WNS A;  2OWO A;  3QVN A;  4EFB A;  4NB5 A;  2NN4 A;  3N2G B;  1EN5 A;  2N05 A;  2ZD9 A;  3P3N A;  1S77 D;  3B2E E;  1S0V A;  3SJA C;  1FAF A;  1PD3 A;  3O65 A;  2YXH A;  4GKK O;  4DR1 O;  3D36 C;  1ORQ C;  4JPR A;  1N33 O;  5EBW C;  1BS3 A;  1QHT A;  2IH1 C;  1FXH A;  2ZNI A;  4IHJ A;  1OCC B;  1O9G A;  1OCC C;  3JSN A;  3RBZ A;  3SJB C;  1AR4 A;  1VQ5 V;  2WA4 A;  2EZP A;  4X89 A;  1NJI W;  2YIA A;  4OGQ B;  3THO A;  1N0J A;  3ASO C;  4MTO A;  3HKB B;  3JAL B;  1BQZ A;  1JMK C;  1NVP B;  2QTS A;  1H2M A;  1VF5 B;  1K9M W;  2YXL A;  3O9O A;  4CC5 A;  2P7T C;  2M7W A;  4X1I B;  3BPZ A;  4R50 A;  2YIC A;  4MTF A;  1AR5 A;  5EZY A;  5KMG A;  3BY6 A;  1YIJ V;  3ABM B;  3ABM C;  3E8G A;  3H1H H;  1XUQ A;  4CZZ A;  3RVZ A;  3OGI B;  1WB7 A;  3W7X A;  3BRC A;  1I08 A;  1K92 A;  2F43 G;  3OMI B;  1M1K W;  2F93 B;  1H2G A;  2JGD B;  4TUY A;  4FLT A;  3D36 A;  2PI5 A;  4LF4 B;  1WA8 A;  3P32 A;  4WBN B;  5JVD A;  2IJH A;  3UCS C;  1R3J C;  1ZWI C;  4O2B B;  4QE7 A;  2KKW A;  1VP7 A;  4JYC A;  3ABK C;  2WSS G;  2ADP A;  1OCZ C;  3X2Q C;  4DR6 B;  2WLH A;  1DTO A;  3HKB A;  3JD1 A;  1HNZ O;  3JAL A;  4LF4 O;  3IAY A;  5B1O A;  2Y0I A;  1KU9 A;  3UT5 A;  1WP7 A;  3ZMT A;  3K0D A;  4DW1 A;  3E22 A;  3SPJ A;  5LXT B;  2HR3 A;  4HNA B;  4CS2 A;  4NXN O;  4DR6 O;  1K4D C;  1YSC A;  3W7U A;  1SA0 B;  4PDV A;  1IDS A;  1GKF A;  1SQG A;  4DV5 B;  4X65 B;  3ETE A;  1XMO B;  4BIU A;  3T1C A;  3FB7 C;  3J80 N;  2HJD A;  2E76 B;  3CD6 V;  1W59 A;  3OW2 U;  4P2Z A;  5KHJ A;  1NKD A;  5B1A B;  3ZRX A;  3CRQ A;  5JCO A;  2JGD A;  3AG1 B;  3AG1 C;  4ZOL B;  2XAQ A;  4DV5 O;  4X65 O;  1KB9 F;  3PN1 A;  4JAU A;  1XMO O;  2EBO A;  4JTC B;  4JI4 B;  4PA6 A;  4CS3 A;  1SC5 B;  3H1I H;  1H2S B;  4LCU C;  2Q0A A;  5CA0 B;  3JD3 A;  3OE7 G;  5EBM C;  1YJ9 V;  3K9S A;  2DWD C;  3B09 A;  3OTO B;  5E79 Z;  3HKC B;  1XL6 A;  3T4D A;  5KLV H;  3CP1 A;  4AI8 A;  4JI4 O;  3CCJ V;  3K06 A;  2HFE C;  4U7O A;  2E5L B;  3CCL V;  2UUB B;  1M56 B;  5GTI Z;  1RSO B;  4JAV A;  3ZRS A;  2Y4U A;  3C90 A;  5IJ9 B;  2UUA B;  1QLN A;  1SQP H;  3OTO O;  1XNR O;  5LXT A;  1VEW A;  4HNA A;  4JYA B;  3CCE V;  1I7F A;  4R7C A;  4CS4 A;  1AJN A;  2EZO A;  2JEU A;  1PM9 A;  1EZV H;  2EJR A;  2ZKO A;  1NI8 A;  1NTK H;  5JJE B;  3OUS A;  2UUB O;  3WG7 B;  5H2F Z;  5LMU B;  2KSD A;  3R66 A;  2UUA O;  3T2M A;  2K9P A;  4JYA O;  4H44 B;  4CH6 A;  1SES A;  2JS5 A;  2BTO A;  5FPR A;  4E4E A;  1AP6 A;  4RQE A;  2OCC C;  1GN6 A;  3A0B Z;  5CB4 A;  2LGW A;  4X8A A;  5LMU O;  5LYJ A;  5LHI A;  4MVU A;  2Y4T A;  4K35 A;  4FPP A;  4QPK A;  2PGG A;  2ZXW B;  2ZXW C;  1N36 B;  5H6Q A;  2OYQ A;  4BW9 A;  2QSA A;  5JJN B;  4LWS A;  1P49 A;  1XL4 A;  2UU9 B;  3CC7 V;  3CS5 A;  4P30 A;  4I50 A;  3QO7 A;  2A9H A;  2X6B A;  1SQX H;  2AXT Z;  1N36 O;  3N2K A;  4RWU A;  4X1Y A;  4LFA B;  2P90 A;  4K3A A;  2D2C B;  5LGN A;  2WLI B;  4LH6 A;  3K57 A;  2F4V B;  1AP5 A;  4FFB B;  3GVM A;  5LP6 C;  1JJO A;  2Z0A A;  3JCU Z;  4BIZ A;  3D3I A;  2UU9 O;  2P67 A;  1SKV A;  1R6N A;  4ASU G;  4KP4 A;  4YHH O;  4LC1 A;  3CE2 A;  4O4H A;  4UUJ C;  4LFA O;  3AG7 A;  3AEI A;  3CYO A;  4DV7 B;  2B1G A;  3R65 A;  3CXC U;  1K8A W;  1Q3E A;  4LFC B;  3ZHS A;  2F4V O;  4R8C A;  2X6C A;  1DGS A;  2DYR C;  4JV5 O;  2AZ2 A;  3D8C A;  5B3S C;  2RDC A;  4OPA A;  2N04 A;  3D3Q A;  1YJW V;  1NH2 D;  1M57 B;  2CE4 A;  2CTR A;  5H6R A;  4MS2 A;  2X6A A;  4X9Q A;  3RYF B;  4E2L A;  2W6J G;  4EB6 B;  2YID A;  4ZHQ A;  1HW7 A;  4LFB B;  4DV7 O;  3N27 A;  4KXR A;  1V55 C;  2JEX A;  2YXY A;  3OD4 A;  4U3F H;  4DO2 A;  2IU0 A;  4DV1 B;  4O4J A;  3FAV B;  2LGQ A;  3K9A A;  5LGT A;  5JQG B;  2LO1 A;  1SQV H;  1KUQ A;  1CEZ A;  3S3X A;  2UXC B;  2LW7 A;  1QLE B;  1JQ0 A;  2L35 A;  2WLL B;  2WLI A;  5KHK A;  3ICX A;  4DRX A;  4DV1 O;  2OTJ V;  1GM7 A;  1K5Q A;  3E8H A;  3UKM A;  5LP6 A;  2GBO A;  4DW0 A;  1GN4 A;  4FLU A;  4J7K A;  2K1E A;  4NVP A;  4WFH A;  4KUM A;  4O2A B;  1NH2 B;  2VWK A;  2UXC O;  4JI8 B;  1FXK B;  5JJJ B;  1GM9 A;  1XHZ A;  2Q6A A;  1AIL A;  3RYC B;  2EX3 A;  2LQT A;  1MSD A;  2PYJ A;  4J7J A;  3CCM V;  2P6J A;  1PV0 A;  5EC2 C;  3B4S A;  5IT9 N;  4B7K A;  1TUB A;  3JSL A;  5IYZ B;  3ETD A;  1NR1 A;  4PA7 A;  4JI8 O;  4EB6 A;  1P4R A;  4IYH A;  2ZIO A;  1T5E A;  1FXV A;  3G67 A;  2HEP A;  5H5N A;  4JTA B;  3F5T A;  1PPJ H;  1F4N A;  1GRJ A;  1VQ4 V;  5JQG A;  1DK1 A;  1GAX A;  2E75 B;  4JYB A;  2Q8V A;  2R72 A;  4B08 A;  1FD9 A;  3ZS8 C;  3HKE B;  1K34 A;  1XMQ O;  3JAW A;  4GZR B;  3T1Y B;  3GWO A;  1PP9 H;  1VQN V;  2IU3 A;  3JD4 A;  4LF7 B;  2HKO A;  4I0X B;  1QU7 A;  4O2A A;  2ITD C;  5DED A;  4EEQ A;  4LF8 B;  1DLB A;  4DR4 B;  2P06 A;  2UXN A;  3ZN0 A;  3RYC A;  1I0H A;  3T1Y O;  5IWA B;  1WP8 A;  3LSU A;  1CP9 A;  2Y69 C;  5CA1 B;  5IY5 C;  1KBH A;  4O4L B;  3K79 A;  4JI2 B;  3AG3 B;  5FPO A;  4DXW A;  5C8Y A;  1OCR C;  5ITZ A;  3BEH A;  4LF8 O;  4DR4 O;  1VMG A;  1Z5V A;  1MA1 A;  3E8F A;  4ZBM A;  4B3T B;  1S5L Z;  4H0L B;  5IWA O;  4LR3 A;  5IE9 A;  1IXB A;  1Q7Y W;  1Q90 D;  1URF A;  5KHI A;  4JI2 O;  1RM1 B;  4IHJ B;  1YDX A;  5L3B A;  2BCC H;  2QWQ B;  2ZE7 A;  2X0L A;  2P5O A;  2QA4 V;  4B3T O;  2XUM A;  1ZL8 A;  1K5S A;  3K58 A;  2ODM A;  4J9Y B;  2QWP B;  4YXW G;  5KAF Z;  3CC2 V;  1G8M A;  4I0X A;  4D7S A;  4HAM A;  1HNX B;  4U7N A;  2ZR2 A;  3MDS A;  4O4I B;  1MZF A;  3CX5 F;  3I55 V;  5L3C A;  2Q7H A;  1HNW O;  1GK9 A;  3QO8 A;  2EIN B;  3B8M A;  2Q7G A;  4I9W A;  4X66 B;  3FX7 A;  1HNX O;  2UXB B;  2JK5 C;  1WJZ A;  2Q69 A;  4L87 A;  3DSQ A;  1Z2G A;  3B8N A;  4TUY B;  4JI1 B;  2IH3 C;  4RQF A;  1GO3 F;  3CME V;  2W6I G;  5HFM A;  1Q6H A;  2FKX A;  4DR2 B;  3JAK A;  1WA8 B;  4X66 O;  3C3T A;  5JVD B;  2AZ0 A;  2UXB O;  3GWK C;  4IGG A;  4UVA A;  3SGI A;  2PF4 E;  3AK3 A;  4JI1 O;  1Q86 W;  4GX0 A;  3ASO B;  5BR8 O;  2XAH A;  4DR2 O;  1Q82 W;  3UQ8 A;  4AIL C;  4WFA V;  3UT5 B;  2QM7 A;  4W4K A;  4B7E A;  3EVK A;  3UO2 A;  2WLM A;  3I56 V;  3HPL C;  3S3W A;  3E22 B;  3SYQ A;  3H1J H;  1W0K G;  2QM4 A;  2LFS A;  2ZIM A;  2EIK B;  4O4I A;  2EIK C;  3HKD B;  1SRY A;  3APQ A;  3HB3 B;  4NKG B;  4MW3 A;  5EC1 C;  2Y0P A;  2RQ6 A;  3FB5 C;  4LF6 B;  3L72 H;  3JD2 A;  5GON A;  1MZE A;  1ARO P;  4J80 A;  3ZHT A;  2FML A;  1N32 B;  4BIO A;  4KL1 A;  4MVZ A;  1QCE A;  1OCO B;  1OCO C;  1KKC A;  1S3J A;  4DV0 B;  4DV6 B;  2HVJ C;  1F7Y A;  3CCQ V;  3H1L H;  4QPJ A;  3FD9 A;  3STL C;  1HNZ B;  4LF6 O;  2IJI A;  1Y4M A;  3CEI A;  2ADQ B;  1N0N A;  3L71 H;  3E8B A;  3LUT B;  4UCV A;  1N32 O;  4CH4 A;  1RPO A;  2L6L A;  3ABK B;  1VQ6 V;  1H2N A;  1IBM B;  2B1I A;  4DV0 O;  2YEV B;  3ETG A;  4DV6 O;  1OCZ B;  4NXN B;  3X2Q B;  3WFV A;  4F6R A;  1UPG A;  5B1N A;  3LNN A;  1Y66 A;  2RN9 A;  3ZJZ A;  1N4C A;  1U97 A;  1WPB A;  2JS3 A;  1IBM O;  2EIJ B;  3OEH G;  2EIJ C;  3HKD A;  2XAG A;  4JZG A;  4UVC A;  4BR6 A;  5LBQ A;  2PZS A;  3ETQ A;  3DGE A;  3FB6 C;  3TGU H;  1NR7 A;  4NTW A;  1BE3 H;  4TOI A;  1XQ8 A;  4PV1 B;  3ZHQ A;  3CRC A;  3KG2 A;  5DEC A;  3ZMV A;  2D3O W;  1K73 W;  3A2F A;  1MSW D;  2PI4 A;  1Q6I A;  2DE0 X;  1BCC H;  1B06 A;  2FTK A;  5CB4 B;  1GTO A;  3K5N A;  2F1M A;  3GB7 C;  3SDL A;  4DK1 A;  5LYJ B;  1ENV A;  1S5H C;  3OM3 B;  4X64 B;  3AG4 C;  1VQ7 V;  1JCH A;  1ROP A;  2YEV A;  1XNR B;  1N8R W;  3RW0 A;  3RN4 A;  1KKD A;  4DV2 B;  3QF7 A;  2X7R B;  3BAA A;  5J2U B;  3W7T A;  2DOS A;  4WF9 V;  1XNQ B;  1Y67 A;  4UFZ A;  4LWS B;  5E1A C;  5H9C A;  1AVM A;  4DK0 A;  4X64 O;  4PHZ A;  5FLX N;  3FFQ A;  4Z2W A;  3FKS G;  4I50 B;  4WFG A;  3JYC A;  3CCR V;  1FPO A;  4DV2 O;  3N2K B;  1MAB G;  4X1Y B;  2IJK A;  2DWE C;  4WFE A;  3E86 A;  1KMI Z;  1XNQ O;  2XHB A;  4CH3 A;  5BY1 A;  2QWR B;  3OR7 C;  2GTA A;  2ZQM A;  1SF9 A;  4HBN A;  4J10 A;  3U11 A;  4FLZ A;  1IBK O;  1EN4 A;  1D5N A;  3SYP A;  4FMT A;  5B1B C;  4DR5 B;  3SJQ C;  4P9P A;  2JRI A;  4O4H B;  1BZK A;  4UCR A;  1D2D A;  4UV9 A;  2OCH A;  3ZHV A;  5CBG A;  2OCC B;  2VQF B;  5BMV A;  2YSU B;  4TT3 G;  3J81 N;  4FZ0 A;  4XDJ A;  4W4L A;  2P4K A;  4XDK A;  2ATK C;  1YJN V;  2ZCE A;  1Q81 W;  4MTX A;  3TXS A;  3EHB B;  3ZIA G;  4DR5 O;  1BHA A;  2VRZ A;  2FB5 A;  1AI7 A;  4ZHQ B;  2KG7 A;  2VQF O;  2YI9 A;  5KHH A;  1JPX A;  1MMM A;  4MW8 A;  5J2U A;  3OR6 C;  3L9D A;  4O4J B;  1AI6 A;  3CMA V;  5IYB O;  1K3E A;  2JDI G;  3K0G A;  4G28 B;  4YHH B;  4FFK A;  1KP2 A;  5BZB A;  3DTU B;  1E1Q G;  4DRX B;  4DR3 O;  3MAQ A;  1Z5W A;  1PNM A;  5LP6 B;  2QTO A;  4JV5 B;  2F95 B;  3K03 A;  4JI5 B;  4KHP B;  1O9H A;  1XBL A;  3I5D A;  1H2K A;  2GUZ B;  1US6 A;  2CAZ C;  1ZTE A;  5LL6 Y;  4R6Z A;  1EBO A;  2EIM B;  2EIM C;  3DC6 A;  2HVK C;  4FK5 C;  1HP8 A;  2P4V A;  1A32 A;  4NTX A;  5K1P A;  4MT8 A;  4CC6 A;  2DYR B;  4C7U A;  1ZLZ A;  1YEW A;  1BMF G;  5B3S B;  4DR7 B;  4PA9 A;  4JI5 O;  3P3P A;  1L0N H;  1TUB B;  4KHP O;  2XND G;  2EUL A;  2HG5 C;  2QKC A;  5A2Q N;  4UCT A;  1FJG B;  1WPX A;  4X62 B;  3L70 H;  5KX5 B;  1VQP V;  5D5P A;  1SZT A;  3CWB H;  4LH7 A;  3ZHU A;  1V55 B;  2YI8 A;  4TV8 A;  1RPR A;  5LGU A;  4DR7 O;  4Q20 A;  4GUN A;  1VQM V;  1PL0 A;  2F66 C;  1YHQ V;  1XDC A;  1COW G;  3FYI B;  5B66 Z;  2F23 A;  4IIJ A;  1FJG O;  3ZMS A;  4X62 O;  3JAR A;  4H13 B;  4FLY A;  3JAW B;  3E89 A;  2JJ1 G;  2GHY A;  1TUE B;  3CHX A;  3WB1 A;  2LP7 A;  2JVD A;  4FLW A;  5L3E A;  3LDD A;  4MVM A;  3DXR A;  3T4Z A;  4QIW F;  3RYH B;  1B04 A;  3EXA A;  2GUZ A;  3WB0 A;  1AB3 A;  4J7Z A;  3ASN C;  2YDE A;  2RCV A;  1FS0 G;  1R3I C;  3DC5 A;  5IJ0 A;  2V4D A;  5KA5 A;  4D7T A;  3HR0 A;  1S5J A;  1KD1 W;  3W7W A;  2Q5Z A;  1SQQ H;  3G4S V;  3SR2 C;  2UXX A;  5C8Y B;  2E3C A;  1M90 W;  2IW5 A;  2Q73 A;  3CSX A;  1R1B A;  5ITZ B;  1KC8 W;  3E2E A;  4UB6 Z;  2KQX A;  5KX5 A;  4J11 A;  4GLX A;  2BOB C;  1XMQ B;  4J42 A;  3SPC A;  2DN9 A;  2Q4P A;  3TK1 A;  3U0Z A;  5J9P C;  3A8T A;  4YY3 B;  2YUA A;  2Q0O C;  3LSQ A;  1YIT V;  1MOF A;  5LMN B;  1V54 C;  1EZJ A;  5EIB C;  2Z5U A;  4DV3 B;  1BSM A;  1ZL8 B;  3L75 H;  3ZCC A;  4NR1 A;  4PDM A;  1Y76 B;  1XEQ A;  1Y74 A;  3OT7 A;  1PKX A;  4RO2 A;  4G27 B;  1NZ6 A;  1LUW A;  2MK3 A;  4YY3 O;  3RYH A;  5K1X A;  2KB1 A;  2ILM A;  3AG2 C;  1RFY A;  4K0K B;  5LMN O;  5JWP A;  4X88 A;  1G4Y B;  4CH5 A;  4DV3 O;  5CN0 A;  3QG5 A;  4NTY A;  1QVF U;  1JFF A;  1LUV A;  1M4U A;  4YJ3 B;  4I4T A;  2Y69 B;  5IY5 B;  1W2B U;  3RGB A;  3AK1 A;  2R70 A;  2RMK B;  3L73 H;  1WB8 A;  3SPI A;  4H37 A;  4GCZ A;  4K0K O;  1Q6U A;  1XI1 A;  1NBM G;  1OCR B;  4XBF A;  2PYL A;  3TXQ A;  4TQD A;  3ABL C;  3STZ C;  3B77 A;  1SQB H;  1GM8 A;  3QTC A;  4PA3 A;  3JAK B;  4JZ2 A;  5LHG A;  2UXD B;  4JI7 B;  1Q5O A;  2GTS A;  4ICG A;  1WN7 A;  3VQW A;  1NQT A;  3ZHR A;  2R9I A;  4H33 A;  1R3K C;  1Q8I A;  3W7S A;  3SPH A;  3JAT A;  4XDL A;  1Y76 A;  2UXD O;  4JI7 O;  1HNW B;  4DV4 B;  1EN6 A;  3NR7 A;  1AJP A;  1XRE A;  4MSW C;  4JI6 B;  2WPD G;  2CGN A;  1NTZ H;  2GSM B;  5D5Q A;  5CBF A;  2ZM6 B;  1H8H G;  3B40 A;  3LNM B;  4IYI A;  3CRA A;  1YF2 A;  4JF3 A;  4YJ3 A;  4DUZ B;  4JI3 B;  2DQ0 A;  2IM9 A;  4PD4 F;  4DV4 O;  4PJ0 Z;  2PUS A;  4IT5 A;  2HHH B;  1YVW A;  5GON B;  2XAF A;  4LNU B;  5KUM A;  4JI6 O;  3CJH B;  4ZKI A;  4LF5 B;  5KUK A;  1QBZ A;  1TVK A;  2ZM6 O;  1Q43 A;  3SPG A;  4JI0 B;  5EBL C;  5LOV A;  2A0L A;  4U3J A;  2ZE5 A;  4DUZ O;  5FL7 G;  5L3D A;  3E35 A;  4JI3 O;  1B3Q A;  5BR8 B;  5CA0 A;  2HHH O;  1H2L A;  4UCS A;  3LDE A;  1N34 B;  1ZAU A;  4LF5 O;  2QWN B;  1L0L H;  1P84 F;  1PNK A;  3L74 H;  2QR4 A;  3CB2 A;  4UXN A;  4JI0 O;  4PDR A;  1IX9 A;  4QNH B;  4F6R B;  4PDL A;  4TV9 B;  4B3R O;  3SYA A;  1EM1 A;  3MD0 A;  3UM7 A;  2QM8 A;  2Q7E A;  1N34 O;  4K8X A;  4PEL A;  1J5E B;  3WU2 Z;  1BQ0 A;  2W0X A;  1E79 G;  3SJC C;  2NNU A;  4YJ2 B;  4IL6 Z;  5JH7 B;  1YTF D;  2CGO A;  1G1X B;  1PL4 A;  2ZE6 A;  4LP8 A;  4I55 A;  3QNE A;  2G38 A;  2QWO B;  4Q6G A;  2O57 A;  4UCU A;  3VQY A;  1P7G A;  2BE3 A;  4LNU A;  1J5E O;  4BWA A;  1YI2 V;  2WA3 A;  3CJH A;  1FYJ A;  2ITC C;  5LHH A;  3QO5 A;  1R73 A;  5L3F A;  5B5E Z;  3JCZ A;  4MVO A;  4FVM A;  1OHH G;  2CDY A;  3Q4H A;  2YIB A;  2FL4 A;  5AG2 A;  4X20 A;  1VF6 C;  2LJ2 A;  4FM2 A;  1L8D A;  1JX9 A;  3K04 A;  4J41 A;  3ZBH A;  3ZMZ A;  5F2V O;  4PA4 A;  3N2G A;  4D6T H;  5JCO C;  3TET A;  2R9R B;  2IJJ A;  3ZRV A;  1JR9 A;  2AHY A;  3RT3 C;  4EFE A;  4TV9 A;  1V9P A;  1YTF B;  3OMA B;  4EKW A;  3F7Y C;  3UO3 A;  2XOK G;  1JJ2 U;  1R6T A;  1HR0 B;  5C93 A;  1S76 D;  5CMU A;  1BL8 A;  1I5X A;  2WLJ A;  3RVY A;  1IBL B;  3IFX A;  2WAM A;  1X4T A;  4YJ2 A;  5JH7 A;  4G2K A;  1FFX B;  3KCX A;  1MNG A;  3BVO A;  4FZ1 A;  4I9Q A;  1TAE A;  2B9Z A;  2BSK B;  3OAA G;  4HZ3 A;  3G71 V;  3IC7 A;  3IGA C;  4JAA A;  1HR0 O;  4FLV A;  3KZI Z;  1BHB A;  2AW9 A;  3JAM N;  1SQF A;  2YC0 A;  1IBL O;  2R9A A;  2BOC C;  2ARH A;  2Q68 A;  4ABM A;  3E83 A;  4MTG A;  4X1I A;  2VWJ A;  4RAI A;  3RWR D;  2OIE A;  2QDO A;  3CCV V;  3M99 B;  3PJS K;  4JYY A;  3T1H B;  2WLK A;  5BMV B;  1KP3 A;  2LFR A;  1VF6 A;  4BAY A;  3RYI B;  3EFF K;  2JJ2 G;  2Y48 A;  2HP8 A;  1TGO A;  5B1A C;  1HWY A;  3AG4 B;  3K59 A;  3JAS B;  1QNM A;  2KG7 B;  4YIO A;  3VBB A;  3T1H O;  4P9O A;  5FNV B;  3ABT A;  4WBN A;  4NYK A;  3OGC C;  4O2B A;  4RUE A;  2HLD G;  2OTL V;  1IBK B;  1NTM H;  2DW4 A;  4N21 A;  3BAB A;  1TA8 A;  1QR9 A;  1AI5 A;  1FFX A;  2CK3 G;  1AJQ A;  1F4M A;  3APO A;  4QJF B;  3CPW U;  2BSK A;  4NXM B;  1M56 C;  3LDC A;  3KCY A;  1LR1 A;  1XHX A;  1VQ8 V;  5CA3 A;  1W0J G;  1QVG U;  4RUF A;  3IJ4 A;  5B1B B;  1SA0 A;  4GKJ B;  3K5L A;  4MVS A;  3FB8 C;  5TIS Z;  2A3Q A;  3LSS A;  2E5L O;  2H8P C;  3A0R A;  4NXM O;  2A7W A;  1EFR G;  2M6Y A;  3WG7 C;  1THZ A;  2GDS A;  5IDJ A;  1JVM A;  3K08 A;  3C3S A;  5KA6 A;  1GMG A;  3RYI A;  3RFR A;  2Q9L A;  2H3O A;  4Z1V A;  4MVQ A;  1FKA O;  2QGN A;  2Z3Y A;  4GKJ O;  3ML0 A;  3JAS A;  2N74 A;  5IYC O;  4OPH A;  2PTM A;  4WCE V;  4ZOL A;  2VS0 A;  3OEE G;  3CCU V;  4B3S B;  1CXZ B;  5FNV A;  5BXZ A;  1SET A;  3H1K H;  3M7M X;  3BFR A;  4TV8 B;  4DR3 B;  2CTQ A;  2A06 H;  2NR5 A;  4BW5 A;  5KHG A;  1AR1 B;  1UJW B;  4F6E A;  1IVS A;  1M5I A;  4PI0 A;  5EK0 A;  2V1D A;  1QQC A;  3VQX A;  3HKC A;  4IIJ B;  4B3S O;  1BGY H;  1KEC A;  1SER A;  1JOY A;  3JAR B;  4I7Z B;  2ZE8 A;  4B3M B;  1U96 A;  1RSO A;  4UB8 Z;  3JD0 A;  5IJ9 A;  4GX5 A;  3DXR B;  1VF7 A;  1G6U A;  1RP3 B;  4FJC C;  2QEX V;  2ZR3 A;  4TQF A;  1KQS U;  3K3W A;  4HYO A;  5IJ0 B;  2V7Q G;  3MHH C;  4AQY B;  4B3M O;  2JIZ G;  2EIL B;  2EIL C;  3FYE B;  2Q67 A;  2AGA A;  4LF9 B;  4X1K B;  3BCC H;  2UUC B;  3SYO A;  1P7B A;  1Y6X A;  4LBE C;  1AI4 A;  4GX1 A;  1IZ3 A;  4TWK A;  4JTD B;  4DUY B;  5A9G A;  1D5A A;  2BTQ B;  4AQY O;  4PI2 A;  1WLE A;  2P22 C;  4CBC A;  3G6B A;  4LF9 O;  5EYP B;  1M57 C;  2ZT9 B;  2UUC O;  1NT2 B;  1NU1 H;  4J9Z B;  4ZI7 B;  2RJZ A;  2ZNJ A;  4DUY O;  1OZ0 A;  4OXS A;  4N23 A;  4LFC O;  2XAJ A;  5J2T B;  1B6Q A;  1VQO V;  2VQE B;  4QE9 A;  3ZRW B;  2HJF C;  4L8J A;  2MW2 B;  3CXH F;  1Y74 B;  1ZUQ A;  1L1F A;  1WAZ A;  5EIB D;  4LFB O;  2H94 A;  3ASN B;  1KYO F;  4WFB V;  1QLE C;  4DYL A;  1K4C C;  1OV9 A;  2DQ3 A;  3OMN B;  4I5S A;  4FM0 A;  2VQE O;  1JFF B;  2CTP A;  2QJ1 A;  4FFB A;  4AHC A;  1VIB A;  4I4T B;  3TCU A;  4X1K A;  5HFL A;  5IYD O;  5DM6 V;  2W0F C;  1SZX A;  3U10 A;  3F7V C;  4GYC B;  1GH6 A;  2WWW A;  4A5U B;  1FXK C;  4FLX A;  1DF4 A;  1MG1 A;  5LA6 B;  1IXM A;  2IBZ H;  2BTQ A;  5DN6 G;  4UCO A;  1F23 A;  1VQL V;  2ETN A;  2CTW A;  3K5O A;  5EYP A;  3H9V A;  4UVB A;  2OIG A;  3RYF A;  4QGP A;  4ZI7 A;  3OFN G;  5GW7 A;  3BA9 A;  2C2A A;  1V54 B;  3ZX6 A;  5J2T A;  1JA8 A;  2ZDI C;  5CBH A;  4FIP C;  4JGS A;  2JGU A;  4YIP A;  2CH7 B;  3ZRW A;  3ABU A;  2FYU H;  3FAV A;  3JAT B;  5GTH Z;  3ZED A;  1GN2 A;  3CRR A;  1NS1 A;  3AG2 B;  1CPY A;  2DYS B;  2DYS C;  3WB2 A;  1VQK V;  1ZX3 A;  2WLL A;  1K7D A;  1YXB A;  1F51 A;  2GV9 A;  2QKA A;  4WFF A;  2LW1 A;  4UV8 A;  2EJ7 A;  3OUF A;  4KFM A;  2YS8 A;  3CC4 V;  3J7A U;  1BT8 A;  1M9N A;  3BHP A;  1I5Y A;  1OJH A;  3IC9 A;  1QR8 A;  1FXK A;  2CUG A;  1TVK B;  2WLN A;  3VQV A;  4F4L A;  3BA8 A;  3OTF A;  5L3G A;  5LA6 A;  1S72 V;  2OT5 A;  2RNB A;  3H01 A;  3ABL B;  1VAR A;  5LOV B;  2B5U A;  3VOU A;  4U3J B;  1X59 A;  1UFI A;  2E74 B;  3AK2 A;  1I94 B;  2XT9 A;  2DMX A; 
#chains in the Genus database with same CATH homology
 4WFG A;  3JYC A;  1V55 C;  2JEX A;  4DO2 A;  3CCR V;  2QE7 G;  1J95 A;  2IU0 A;  1MAB G;  2IJK A;  3AG3 C;  2DWE C;  2AHZ A;  2ITC C;  3P30 A;  4WFE A;  5LHH A;  3E86 A;  3QO5 A;  3K9A A;  1R73 A;  1R3L C;  5L3F A;  3JCZ A;  3ZN1 A;  4MVO A;  5LGT A;  3OR7 C;  2ZQM A;  1OHH G;  1CEZ A;  3G6E V;  2ZDI A;  1QLE B;  1JQ0 A;  3SYP A;  3ZMZ A;  1JX9 A;  3K04 A;  1E1R G;  4FMT A;  4PA4 A;  5B1B C;  2WLL B;  2WLI A;  3SJQ C;  4P9P A;  1RM1 C;  2OTJ V;  1GM7 A;  1K5Q A;  4UV9 A;  5CBG A;  3E8H A;  2OCC B;  3UKM A;  3TET A;  2R9R B;  2YSU B;  2IJJ A;  4TT3 G;  3ZRV A;  2AHY A;  4JAS A;  4GX2 A;  4XDJ A;  2K1E A;  1H38 A;  4WFH A;  4KUM A;  1NH2 B;  2XAS A;  4XDK A;  2ATK C;  2QKS A;  1YTF B;  1YJN V;  1Q81 W;  1FXK B;  3OMA B;  4EKW A;  3MHS C;  4MTX A;  3F7Y C;  1GM9 A;  3EHB B;  3ZIA G;  3CCS V;  2XOK G;  1DF5 A;  1LNQ A;  1JJ2 U;  3SYC A;  1BHA A;  2Q6A A;  5C93 A;  1S76 D;  1AI7 A;  5CMU A;  1PNL A;  1I5X A;  1BL8 A;  2WLJ A;  3RVY A;  3ZMU A;  1K97 A;  1VQ9 V;  3IFX A;  2WAM A;  3NXS A;  2NLJ C;  2P6J A;  3CCM V;  1JPX A;  5EC2 C;  1R6K A;  4MW8 A;  3OR6 C;  2A79 B;  4G2K A;  4MVR A;  3ETD A;  1NR1 A;  1H8E G;  1AI6 A;  4PA7 A;  3OAA G;  1K33 A;  1P4R A;  3CMA V;  5IYB O;  4HZ3 A;  1K3E A;  3F5W C;  3G71 V;  1NVP D;  3IC7 A;  3IGA C;  2JDI G;  4Z1M G;  1BHB A;  4TSF G;  3K0G A;  4G28 B;  4GT1 A;  2BOC C;  1FFT B;  2EIN C;  2Q68 A;  3E83 A;  1KP2 A;  1FXV A;  4MTG A;  5BZB A;  4RAI A;  4JTA B;  3DTU B;  1E1Q G;  2ZD9 A;  1F4N A;  1S77 D;  3CCV V;  3M99 B;  3PJS K;  1S0V A;  1VQ4 V;  1PNM A;  2WLK A;  1PD3 A;  2QTO A;  4JYB A;  1KP3 A;  3K03 A;  1ORQ C;  2LFR A;  4BAY A;  4JPR A;  1K34 A;  5EBW C;  3EFF K;  2IH1 C;  1FXH A;  2JJ2 G;  2Y48 A;  4R6Z A;  1EBO A;  5B1A C;  2EIM B;  1OCC B;  2EIM C;  1OCC C;  3RBZ A;  1HWY A;  3AG4 B;  3GWO A;  2HVK C;  4FK5 C;  1VQ5 V;  2EZP A;  4X89 A;  1NJI W;  3VBB A;  1VQN V;  2IU3 A;  3JD4 A;  4MT8 A;  2DYR B;  2HKO A;  1BMF G;  5B3S B;  4P9O A;  4PA9 A;  3ABT A;  2ITD C;  3ASO C;  2XND G;  4MTO A;  3OGC C;  4RUE A;  2HG5 C;  1DLB A;  2UXN A;  3ZN0 A;  1NVP B;  2HLD G;  1WPX A;  2OTL V;  1VQP V;  1K9M W;  1CP9 A;  2Y69 C;  1SZT A;  5IY5 C;  2DW4 A;  2P7T C;  4N21 A;  1V55 B;  3K79 A;  1QR9 A;  2M7W A;  1AI5 A;  1RPR A;  5LGU A;  3AG3 B;  4Q20 A;  2CK3 G;  1AJQ A;  1F4M A;  4DXW A;  4QJF B;  4R50 A;  3CPW U;  1VQM V;  1OCR C;  1PL0 A;  1M56 C;  4MTF A;  1YHQ V;  3BEH A;  3LDC A;  1COW G;  3BY6 A;  3FYI B;  1YIJ V;  3ABM B;  3ABM C;  3E8G A;  3E8F A;  4ZBM A;  4CZZ A;  3ZMS A;  1VQ8 V;  3RVZ A;  5CA3 A;  1W0J G;  1QVG U;  4RUF A;  5B1B B;  1Q7Y W;  3W7X A;  4MVS A;  3E89 A;  3FB8 C;  1K92 A;  2GHY A;  2JJ1 G;  1RM1 B;  2F43 G;  3OMI B;  1TUE B;  1M1K W;  2LP7 A;  5L3B A;  1H2G A;  3LSS A;  2H8P C;  3A0R A;  5L3E A;  1EFR G;  3WG7 C;  3LDD A;  4MVM A;  3D36 A;  3T4Z A;  2X0L A;  1THZ A;  4QIW F;  5IDJ A;  1JVM A;  3K08 A;  5KA6 A;  1GMG A;  2PI5 A;  2QA4 V;  3ASN C;  3P32 A;  2IJH A;  1K5S A;  1FS0 G;  1R3I C;  1R3J C;  1ZWI C;  4MVQ A;  4QE7 A;  4J9Y B;  2Z3Y A;  3ML0 A;  5IYC O;  4YXW G;  5KA5 A;  4JYC A;  4WCE V;  3CC2 V;  3ABK C;  3OEE G;  3CCU V;  1G8M A;  1KD1 W;  2WSS G;  3W7W A;  1OCZ C;  3X2Q C;  4HAM A;  1SET A;  2WLH A;  3G4S V;  4U7N A;  2ZR2 A;  1DTO A;  2UXX A;  3JD1 A;  4BW5 A;  1AR1 B;  1M90 W;  2IW5 A;  5B1O A;  1UJW B;  3I55 V;  5L3C A;  1KC8 W;  3E2E A;  5EK0 A;  2V1D A;  1GK9 A;  3ZMT A;  3K0D A;  2BOB C;  3QO8 A;  1KEC A;  1SER A;  2EIN B;  3B8M A;  4I9W A;  3SPJ A;  3SPC A;  1JOY A;  2HR3 A;  1K4D C;  1YSC A;  3W7U A;  2JK5 C;  4PDV A;  3TK1 A;  2Q69 A;  4L87 A;  5J9P C;  1GKF A;  3ETE A;  3B8N A;  4BIU A;  3JD0 A;  3FB7 C;  3T1C A;  3LSQ A;  2IH3 C;  4RQF A;  1MOF A;  1YIT V;  4GX5 A;  1GO3 F;  3CME V;  2W6I G;  1V54 C;  4FJC C;  5HFM A;  1EZJ A;  3CD6 V;  2Z5U A;  2ZR3 A;  3OW2 U;  2QEX V;  1KQS U;  4P2Z A;  1NKD A;  3K3W A;  4HYO A;  5B1A B;  3ZRX A;  4UVA A;  3ZCC A;  2V7Q G;  4PDM A;  3MHH C;  3AG1 B;  3AG1 C;  1PKX A;  2XAQ A;  2JIZ G;  4RO2 A;  4G27 B;  2EIL B;  2MK3 A;  2EIL C;  4JAU A;  3FYE B;  2EBO A;  2Q67 A;  4JTC B;  2KB1 A;  4PA6 A;  3AG2 C;  1Q86 W;  4GX0 A;  3ASO B;  2XAH A;  4LCU C;  4X88 A;  1G4Y B;  3SYO A;  1P7B A;  4LBE C;  5CN0 A;  1QVF U;  3JD3 A;  1AI4 A;  4GX1 A;  3OE7 G;  1Q82 W;  5EBM C;  1YJ9 V;  4TWK A;  4JTD B;  2DWD C;  4WFA V;  2QM7 A;  2Y69 B;  5IY5 B;  1XL6 A;  2WLM A;  1WLE A;  3I56 V;  1W2B U;  3T4D A;  3HPL C;  4CBC A;  3SYQ A;  3CP1 A;  3CCJ V;  1W0K G;  3K06 A;  3SPI A;  2LFS A;  4H37 A;  4GCZ A;  2EIK B;  2EIK C;  2HFE C;  1M57 C;  1NBM G;  1OCR B;  1SRY A;  4U7O A;  4XBF A;  3CCL V;  3HB3 B;  1M56 B;  4MW3 A;  5EC1 C;  4JAV A;  3ZRS A;  3ABL C;  4J9Z B;  3STZ C;  3FB5 C;  3JD2 A;  3B77 A;  1QLN A;  1OZ0 A;  4OXS A;  1GM8 A;  4N23 A;  4PA3 A;  1ARO P;  3CCE V;  2XAJ A;  1B6Q A;  4R7C A;  1AJN A;  2EZO A;  2JEU A;  5LHG A;  1VQO V;  4QE9 A;  3ZRW B;  2EJR A;  4MVZ A;  1QCE A;  1OCO B;  2HJF C;  1OCO C;  1NQT A;  1S3J A;  3OUS A;  2R9I A;  3WG7 B;  2HVJ C;  4H33 A;  3CCQ V;  1L1F A;  4QPJ A;  3STL C;  1R3K C;  2IJI A;  2H94 A;  3ASN B;  3T2M A;  3W7S A;  1Y4M A;  4WFB V;  1QLE C;  1K4C C;  3E8B A;  2DQ3 A;  3SPH A;  3LUT B;  3OMN B;  4I5S A;  1SES A;  4XDL A;  1RPO A;  3ABK B;  1AJP A;  4RQE A;  1VQ6 V;  2OCC C;  2B1I A;  2YEV B;  3ETG A;  1OCZ B;  3TCU A;  5HFL A;  3X2Q B;  3WFV A;  4MSW C;  5IYD O;  2WPD G;  5DM6 V;  2W0F C;  2GSM B;  3F7V C;  5CBF A;  4X8A A;  5B1N A;  1H8H G;  2WWW A;  5LHI A;  3LNM B;  1FXK C;  1DF4 A;  1MG1 A;  1Y66 A;  4MVU A;  3ZJZ A;  1IXM A;  4FPP A;  4QPK A;  4JF3 A;  2DQ0 A;  5DN6 G;  2ZXW B;  2ZXW C;  1F23 A;  1VQL V;  2EIJ B;  3OEH G;  2EIJ C;  2XAF A;  5H6Q A;  5KUM A;  2XAG A;  4ZKI A;  5KUK A;  1QBZ A;  4UVC A;  5LBQ A;  4UVB A;  3SPG A;  1XL4 A;  5EBL C;  3OFN G;  2A0L A;  5GW7 A;  2C2A A;  3DGE A;  3FB6 C;  3CC7 V;  5FL7 G;  1V54 B;  3E35 A;  4P30 A;  5L3D A;  3QO7 A;  2A9H A;  2X6B A;  1NR7 A;  2ZDI C;  5CBH A;  4FIP C;  4JGS A;  3ZRW A;  3ABU A;  3KG2 A;  3ZMV A;  2D3O W;  2P90 A;  3LDE A;  1K73 W;  5LGN A;  2WLI B;  1MSW D;  1PNK A;  2PI4 A;  4UXN A;  3AG2 B;  1CPY A;  4PDR A;  2DYS B;  4BIZ A;  2DYS C;  4QNH B;  3D3I A;  2P67 A;  4PDL A;  1VQK V;  2FTK A;  1R6N A;  1GTO A;  4ASU G;  4KP4 A;  3GB7 C;  2WLL A;  3SYA A;  1K7D A;  4LC1 A;  3MD0 A;  1ENV A;  1F51 A;  4UUJ C;  3UM7 A;  1S5H C;  2QM8 A;  3OM3 B;  3AEI A;  3AG4 C;  3CYO A;  4WFF A;  1VQ7 V;  2B1G A;  1JCH A;  1ROP A;  2YEV A;  3R65 A;  4UV8 A;  3CXC U;  4PEL A;  1N8R W;  1K8A W;  3OUF A;  4KFM A;  4R8C A;  3CC4 V;  3RW0 A;  2X6C A;  2DYR C;  1KKD A;  1M9N A;  1I5Y A;  1E79 G;  2X7R B;  5B3S C;  1YJW V;  2NNU A;  1NH2 D;  3W7T A;  1M57 B;  1QR8 A;  1YTF D;  1FXK A;  4WF9 V;  5H6R A;  2WLN A;  4F4L A;  4LP8 A;  4MS2 A;  5L3G A;  2X6A A;  4E2L A;  1S72 V;  2OT5 A;  3H01 A;  2W6J G;  5E1A C;  3ABL B;  5H9C A;  3QNE A;  2B5U A;  3VOU A;  3FKS G;  1YI2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...