4B3SO

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3sO00
4DR2O 1N36O 2HHHO 1IBLO 1XNQO 4YY3O 4JI6O 4DV6O 1D2DA 2UXDO 4LF4O 4JV5O 4AQYO 2UXCO 1FKAO 2VQEO 4DR3O 4JI0O 1YZBA 3RT3C 4DV7O 1DK1A 4DUZO 1NS1A 3JAMN 1N32O 1XNRO 4X62O 4DR7O 1N34O 4X66O 4DUYO 3F5TA 4LF7O 5LMUO 4LFAO 4DV5O 1FYJA 5IWAO 4DV0O 2UUCO 2ZM6O 1R1BA 4LF5O 5LMNO 5LL6Y 1HNWO 5A2QN 2E5LO 3O65A 1FJGO 4JI3O 4OPAA 4YHHO 4LFCO 1HNZO 1XMOO 1HNXO 2N74A 4DV3O 2DOSA 3T1HO 4JI7O 4NXNO 1R6TA 4KHPO 5BXZA 3T1YO 1HR0O 4K0KO 4JI2O 4DR4O 1F7YA 4X65O 4B3TO 4B3MO 1XEQA 2UU9O 1AB3A 4X64O 1KUQA 4DR1O 4DR5O 4JI5O 2AGAA 3J7AU 3M8AA 1XMQO 2FKXA 4LFBO 5FLXN 3J81N 4JI8O 1X59A 5BR8O 3OTOO 2UUBO 1N33O 5BY1A 1IBMO 1AILA 4OPHA 2JRIA 2Z0AA 3R66A 1I94O 4JI1O 4B3RO 2VQFO 3J80N 4DV2O 4NXMO 4DV1O 4GKJO 4LF8O 4GKKO 2ZKOA 4LF9O 2UUAO 2DJVA 4JI4O 1G1XB 2F4VO 4DR6O 4JYAO 1A32A 4LF6O 4OX9O 4DV4O 4B3SO 5H5NA 4A5UB 5IT9N 2LW7A 2UXBO 1IBKO 1J5EO 3SDLA
chains in the Genus database with same CATH superfamily
4IYHA 1DTOA 4I0XB 1K97A 4GT1A 4B3MB 4DV6O 1KB9F 4ZOLA 4K8XA 3FB5C 3LUTB 2DQ0A 4FPPA 4AILC 5KUMA 2IW5A 1HP8A 3G80A 2HR3A 4ZOLB 5E79Z 5D5QA 4JGSA 3IAYA 1K73W 1NS1A 1KD1W 2QM4A 1JR9A 1XNRO 4FZ0A 1J5EB 4DV5O 3OFNG 2UUCO 1BHAA 1JX9A 4X1KA 3K9SA 4NXMB 2LQTA 3HR0A 4X1KB 1O9GA 3VQXA 3K59A 1XMOO 2ZCEA 1TUBA 4JI7O 3ABLB 5EIBD 3THOA 1YCIA 3ABKC 4CH4A 1TUBB 1IBKB 1H2KA 3OMNB 3UM7A 2WWWA 1XQ8A 1XHXA 1QR9A 4P30A 1XEQA 1ZSPA 4JAUA 2YEVB 3EHBB 4JI3B 2HVKC 5CBGA 2F43G 5B1AC 3OTOO 2BOCC 4H44B 2UUBO 1HWYA 1VEWA 3LNNA 1OHHG 4O2AA 1IDSA 3ZHTA 2XAGA 4X1IB 5H6QA 1IXBA 4O2AB 1Q82W 4GKJO 2HJDA 1MA1A 3SGIA 3UCSC 2EIKC 3H1JH 3JD1A 1YI2V 3H01A 5LMNB 4O4IA 1RM1B 3CC7V 2F4VO 3AK2A 1EN6A 1QNMA 3OUSA 5KA6A 4O4IB 1S76D 1H2GA 5DECA 2XASA 2LW7A 1GM9A 1YHQV 5HFLA 5B5EZ 1W2BU 1KC8W 3E8BA 3L70H 1AP6A 1N36O 2B5UA 3ZHQA 2QKAA 1K4DC 3RBZA 3BCCH 3EVKA 1JOYA 2ZR2A 1N0NA 5KHIA 1PP9H 2LGWA 2EINC 1DF4A 1ZLZA 3OTFA 3P32A 2ZINA 1SQGA 3ZJZA 3OW2U 2VQFB 3CD6V 2PYLA 5KUKA 4I9QA 1V55B 3AK3A 1NTZH 2UXDB 2YXHA 4ZHQB 2Q0OC 1SA0A 3CMAV 3JARA 1HNZO 4PV1B 2B1IA 1U96A 2DMXA 3AEIA 3BY6A 3S3WA 1SA0B 4FM1A 5BXZA 3JARB 2YXLA 3OE7G 2WSSG 2KG7A 2FYUH 2ODMA 4U7NA 4YXWG 1CXZB 2IJIA 4PI0A 2GV9A 4QE9A 1P7GA 2A9HA 1WP7A 3ABMC 2BSKA 4CBCA 4JI8O 3H1HH 2BSKB 2XAHA 2Z0AA 2ZXWB 4X1YA 3DSQA 1VQPV 4UUJC 1OCCC 1FS0G 1VQMV 1AI4A 5BZBA 2OT5A 4DV2O 3JCZA 4GCZA 2Q7HA 4X1YB 4DR1B 1FFTB 2OCCB 4DRXA 1XMQB 5J2TA 3MHHC 3K5MA 2K9PA 4DRXB 2R9IA 4E4EA 3QNEA 1OCOC 1WNSA 1J5EO 1Q6HA 2DYSC 4DW0A 2CTPA 1RSOA 3D3IA 1D2DA 4O4HA 3ZRSA 2YC0A 3WB0A 3ASNB 4AQYO 4N23A 1RSOB 1ORQC 4O4HB 3ZRXA 3ZN0A 4GX0A 3ZN1A 3JAMN 2JEUA 1YSCA 3STLC 3FAVB 4QPKA 1K5SA 1QHTA 4OXSA 1IURA 2QWRB 3AG1B 1S77D 5JJEB 1WB8A 4WFEA 2EX3A 4JI3O 4JI4B 2CGOA 2N74A 3FKSG 4LF6B 4U7OA 4NXNO 2CE4A 1PM9A 2HKOA 2XUMA 3IC9A 4PHZA 4CS2A 1US6A 2PYJA 3IGAC 2HEPA 3ABLC 5L3CA 1M4UA 1BE3H 2QE7G 5L3FA 4UCRA 3LDCA 2EIMB 4LNUA 4DR3B 1QLEB 1E79G 4IGGA 4CH5A 3CMEV 2CDYA 4G28B 3PJSK 4DUZB 1IBMO 2O57A 4LNUB 2CAZC 3JASA 1M90W 4YIOA 2ETNA 2LFRA 3CHXA 4JI1O 4DUYB 1R73A 1YEWA 3BA9A 1V9PA 5CA3A 2WPDG 4LR3A 4DR5B 2VRZA 4CS3A 5JCOA 1YJ9V 4GLXA 1YDXA 3A0RA 1WA8A 2A3QA 2Q8VA 2BE3A 4UCVA 1XUQA 1WA8B 1SQPH 2QM8A 4PD4F 1OCZB 2AZ0A 2UXDO 1YVWA 3K06A 4BIZA 2QTSA 4JI5B 2OCHA 1SETA 4BIUA 4JI0O 5EK0A 3JALA 1M5IA 3HKEA 1DK1A 1JVMA 5KA5A 2R9AA 3TXQA 2R70A 3JALB 3HKEB 1Q6IA 2LO1A 4WFHA 4LH7A 4LC1A 5LBQA 4LF8B 3L71H 2OYQA 1JA8A 1SZTA 3K3WA 4J7KA 3CP1A 3K0DA 2E5LO 4P9OA 4BIOA 1P49A 3FD9A 3RFRA 2W0XA 4HBNA 3O9OA 3IC7A 4B3SB 1M9NA 5JWPA 1V55C 2QJ1A 1NJIW 2OTLV 3CSXA 1QQCA 4CH6A 3D36A 3N27A 4D6TH 1L0NH 2F95B 1B6QA 5KAFZ 1Q5OA 4DR1O 4DV6B 3UKMA 4UV9A 1XMQO 2XOKG 2ZE6A 4I7ZB 3J81N 5KHJA 2L35A 2EJ7A 2QWNB 1XNRB 5KMGA 1BZKA 4DV5B 3FB7C 3JYCA 1PV0A 4MVQA 2UUCB 2KQXA 4FLWA 5KMGB 2XNDG 3E35A 4FLVA 2Q7GA 1G1XB 4JYYA 4QIWF 4FLTA 4WF9V 5JJJB 2EBOA 2Q67A 4JI7B 3T1CA 4FFKA 2WAMA 1NR1A 3AG4B 1BSMA 3ZMUA 2OTJV 4MVOA 1S3JA 4TT3G 3DXRB 2DWDC 2GTSA 3FYIB 4DYLA 1XBLA 4XDJA 1XOUA 2ZT9B 2QGNA 1PNLA 1O9HA 4DR6B 3OM3B 4XDKA 3G6EV 4ICGA 3F5WC 2M6YA 4O2BB 3E83A 4PJ0Z 3OTOB 1JQ0A 2UUBB 4JZGA 1LNQA 3R65A 2L6LA 3CCJV 1VQ8V 2HJFC 2UXBB 1MZEA 2HHHB 5FNVA 4YY3B 4GKJB 3AG3B 3RVYA 4LF5O 1ROPA 4PA4A 3CJHA 1NU1H 1GN2A 2F4VB 2ZDIC 4FK5C 3DTUB 4NTXA 3M7MX 2HG5C 4X62B 2WLLA 1MZFA 1K5QA 1FFXB 4TV9A 2WLLB 4MTFA 3FB8C 4J7ZA 1KQSU 2PF4E 1F4MA 4DR5O 3OEEG 4TV9B 5IYDO 3CCMV 4X20A 4NTWA 5C93A 1YTFD 2P4VA 3JD4A 3W7WA 1AILA 4X20B 1DF5A 1UJWB 3OMAB 3CXHF 2EIMC 4BAYA 1TAEA 2RDCA 3K08A 2Y69C 4G27B 3TXSA 3SYPA 2UUAO 4LCUC 1K8AW 2H94A 1PKXA 4PI2A 1A32A 3L75H 1SQXH 4EFBA 1G6UA 3CCLV 2JS5A 2QEXV 4DR2O 4P2ZA 5DEDA 5KX5A 3K5LA 1IBLO 4MSWC 3FX7A 1RP3B 1B06A 1VF6A 5KX5B 4TWKA 4U3JA 4UVBA 4WBNA 1W59A 2QKSA 3P30A 1I5XA 1OCZC 1BHBA 4U3JB 1VQKV 4UCTA 5L3GA 2WLMA 1Q90D 1OCRB 3TK1A 3X2QB 4DV2B 1I5YA 2ZM6O 2D3OW 1M56B 1FJGO 4JYBA 1SERA 2OWOA 3CE2A 1H2MA 1Q8IA 4D7TA 2ZIOA 2A79B 4I5SA 4EKWA 1JCHA 3N2KA 3OUFA 2RNBA 4PA6A 3UQ8A 1S0VA 3HB3B 3N2KB 1VQ5V 2ZNJA 5LYJA 2HVJC 4QNHB 5K1XA 1R3JC 3AG7A 2RN9A 1HNWB 3E86A 5LYJB 4AQYB 1YITV 5GTIZ 1GN3A 5EYPA 3RYFA 4YJ3A 2JGUA 3SYOA 2JRIA 3R66A 5EYPB 3RYFB 3K57A 4YJ3B 4JI2B 4K8ZA 1KKDA 1SQBH 1T5EA 4PDMA 4E2LA 2ARHA 4LH6A 4FMTA 1S72V 3LSSA 1FAFA 2E76B 4BR6A 4DR6O 3RW0A 3ZMVA 4Z2WA 3IJ4A 4GYCB 5J9PC 4I55A 4DV4O 4NXNB 4QGPA 1VMGA 3KG2A 1XREA 2UXBO 4B3RB 5F2VO 2KB1A 2HHHO 4EFEA 4J10A 4YY3O 3E8HA 3ABTA 3K0GA 3OR7C 1VF5B 1AR5A 5B1OA 4JAAA 1IBMB 3CCUV 4X62O 1FD9A 4LF7O 4JI1B 5IWAO 3ABUA 3A0BZ 4ZIBA 2DE0X 1HDJA 4JV5B 3U10A 3RN4A 2WA4A 4GX5A 2K1EA 1NKDA 2YICA 3I55V 3RGBA 2YIBD 1AI5A 5CB4A 2JJ1G 3SPJA 5IE9A 5B3SB 3RYIA 4W4KA 3AG2B 3OGCC 3RYIB 4NTYA 4JI0B 1IZ3A 1X4TA 3SPGA 1Y74A 1AROP 3ETGA 4OPHA 1FXHA 1DLBA 1Y74B 2BTQA 1KBHA 2X7RB 2NNUA 1KU9A 3OR6C 2KG7B 2E5LB 1VP7A 3B8NA 1IVSA 2V1DA 3ASOB 1PNMA 3OD4A 3U0ZA 2Q0AA 2Q73A 5CA0A 1G4YB 2P67A 1L1FA 1XI1A 5L3DA 4DK0A 4HAMA 1XNQO 2IU3A 5CA0B 3F7YC 1PPJH 2VQEO 2Q9LA 2ZD9A 2JEXA 3ETQA 4B7KA 2E3CA 1R3IC 1D5NA 2QKCA 2FB5A 1N32O 5J2TB 2G38A 2DYRC 3D8CA 1K7DA 4UCSA 3CRRA 1FXVA 2B1GA 2JDIG 4L87A 4LF4B 5LL6Y 2ZE8A 4FLZA 1HNWO 2BTOA 1S5HC 2EIJB 5JH7A 2IBZH 1OCRC 2ZQMA 3T1HO 3B77A 3X2QC 5IJ9A 3ICXA 2FMLA 1Q7YW 1TA8A 3WG7B 4DR7B 1SC5B 5JH7B 1M56C 4JI2O 4DW1A 4H13B 5KHHA 4MVMA 2ZE5A 1N0JA 3HKBA 3M99B 4KL1A 5LP6A 4IL6Z 3DC5A 1NBMG 4J9YB 3HKBB 3CS5A 4FFBA 4OGQB 2ITDC 1N33O 1GN4A 5LP6B 4MTGA 2YIBA 3JD3A 5KHGA 1P7BA 4FFBB 1QCEA 2N04A 4B3RO 2CUGA 4TQDA 1J95A 3ZX6A 3KZIZ 3W7UA 4R7CA 4LF5B 2Z5UA 1SQVH 3ZIAG 1KP2A 2H3OA 2Q6AA 4XDLA 4J42A 4DXWA 1Z2GA 3K5NA 2LP7A 4ZI7A 2IH3C 1M93A 1KMIZ 3APQA 3HKDA 3SYQA 3CCEV 4JPRA 1QR8A 4ZI7B 4FM2A 3T2MA 4P9PA 3HKDB 4LBEC 1AJPA 3G67A 3JASB 2F1MA 4J7JA 3QG5A 1ENVA 4KUMA 3CRMA 2AZ2A 4JV5O 2EULA 4ASUG 4UV8A 3JCUZ 2EJRA 3RT3C 2GSMB 2WLIA 1F4NA 5EBLC 1AP5A 2ZR3A 1F51A 2WLIB 2X6CA 1MMMA 2GTAA 1H38A 5LMUO 1RM1C 1K9MW 3A2FA 3K58A 1FXKA 2UXXA 5KLVH 1GN6A 1PD3A 2UUAB 1FXKB 1TGOA 4Z1MG 4MS2A 3I56V 5LGNA 3RYCA 1R6TA 1S5LZ 4N21A 5L3BA 1HW7A 4RAIA 4X66B 3MDSA 3HKCA 3RYCB 3JSNA 1SS3A 1MOFA 3CEIA 4DR2B 2AXTZ 3ZMSA 4X65O 4F6RA 3BRCA 1IBLB 1JFFA 3HKCB 1H2LA 4X64O 1YIJV 3I5DA 3H1IH 1MABG 4GUNA 2Y4TA 1JFFB 1WP8A 1Y4MA 4CH3A 1W0KG 4XBFA 3SPIA 4WFBV 2RMKB 4ABMA 1L8DA 3L74H 3AG2C 1DGSA 5CA1A 4ZBMA 2IU0A 1I94O 3C3SA 3C90A 4X8AA 5CA1B 5D5PA 1D5AA 2ZM6B 1M1KW 1SRYA 2F93B 5CBHA 1TUEB 4FLYA 1FJGB 2JK5C 4TSFG 3CWBH 4CS4A 3G6BA 3K04A 4UFZA 1Q3EA 1GRJA 3P3NA 4A5UB 4NB5A 2YSUB 1UPGA 5H9CA 3ABKB 1R6NA 4JI6O 1EZJA 3FFQA 3ASOC 4LF4O 1F23A 5B1BB 4BW9A 3ZMTA 2WLHA 2ZXWC 4B08A 3IFXA 3OAAG 4JTAB 3SYAA 5EIBC 1EFRG 1MNGA 5K1PA 3DC6A 2XAQA 1SQQH 2R72A 4DR7O 1YJWV 1SF9A 2OCCC 4NYKA 3KCYA 3OT7A 3D3QA 1Q81W 2NR5A 1GK9A 4NKGB 3BHPA 2BCCH 4NVPA 1RFYA 3CCVV 4TUYA 5IYZA 1SZXA 3ZRVA 4DO2A 3O65A 2V7QG 3CYOA 3CB2A 3B2EE 1S5JA 3PN1A 3HPLC 4CC6A 4TUYB 4DV4B 2EIKB 3GWKC 4PDVA 4Q6GA 4X89A 3S3XA 2P7TC 4UVAA 4WFFA 4X88A 4GZRB 4UB8Z 1BL8A 3WB2A 2IM9A 4LP8A 3JATA 2EIJC 3ASNC 2H8PC 5E1AC 4DR4O 1ZWIC 3APOA 1WAZA 2Y0IA 2Q69A 3JATB 1VQ9V 3WG7C 1CEZA 4YHHB 1HNXB 2PY5A 5FNVB 1NT2B 4W4LA 1IX9A 5LHHA 2P22C 3CJHB 1KECA 4J80A 2HP8A 4TOIA 3AG1C 4LWSA 5GONA 2EINB 4LF7B 5IWAB 1XDCA 2F23A 2PZSA 5KHKA 1R6KA 4DV1O 3LSUA 5LHIA 2GDSA 4GKKO 1E1RG 3BVOA 3W7TA 5B1NA 1JMKC 2M7WA 5LXTA 5BMVA 3T4ZA 5ITZA 5BR8B 1AI7A 4JTDB 5LXTB 4PA9A 5BMVB 5ITZB 1NQTA 2UXNA 3JAWA 3JD0A 3ML0A 3SDLA 4F6EA 1LR1A 1GTOA 2YDEA 1QLEC 3UO3A 1K4CC 2PGGA 2XAJA 3JAWB 3TCUA 4LF9B 2QSAA 2Y0PA 1MG1A 2UXCO 4JYAB 4FM0A 2A06H 4TV8A 3K03A 1MSDA 4JYCA 1N34O 4TV8B 4X66O 3ABMB 4LFAO 1FYJA 1VIBA 4DV0O 2ZE7A 1COWG 4NR1A 3QO7A 5LOVA 3F7VC 5JCOC 2ADPA 4I50A 4X9QA 2W6IG 2EZPA 5LOVB 2WLKA 2ZNIA 3A0HZ 4HYOA 4I50B 5IJ0A 1Z5VA 1MSWD 1GM7A 1NTKH 4PA3A 4WBNB 4K0KO 5FL7G 4PDLA 3SJCC 1VQLV 1GAXA 1F7YA 3TETA 1EZVH 2CGNA 2EZOA 5FPOA 1XNQB 1YF2A 1R3KC 2LJ2A 2DYSB 4MW3A 1Y76A 5AG2A 4LFBO 2VQEB 3ZMZA 1AI6A 1Y76B 4YJ2A 1N32B 2QM7A 2ILMA 4JF3A 2MW2B 2RQ6A 3AK1A 3CCRV 3EXAA 2X6AA 5JJNB 4YJ2B 3ETDA 4L8JA 1K33A 2ZKOA 2YXYA 2DWEC 1PL4A 1LUVA 3EFFK 4D7SA 3VQWA 4IIJA 3ZRWA 2HLDG 3T1HB 2ADQB 4IIJB 3ZRWB 5IT9N 3G4SV 4UB6Z 3D36C 4HNAA 2GBOA 4PA7A 4O4JA 2QDOA 2OIEA 2KKWA 4HNAB 1QBZA 3G71V 2EILB 4O4JB 2PI5A 3KKYA 1VF7A 2B9ZA 4WFAV 5EBWC 3SJQC 1N33B 1U97A 1QVFU 2DQ3A 5B1BC 4I55B 3K79A 2E75B 1H2NA 4KFMA 2YEVA 2CK3G 3C3TA 3OEHG 1YTFB 2WLNA 1URFA 2CH7A 5A2QN 1K34A 4YHHO 5IYCO 3AG4C 1HNXO 2CH7B 2DOSA 3OGIB 5LGUA 4PDRA 1OV9A 4X1IA 1WPBA 1FPOA 3E2EA 1P84F 3NR7A 3ZHUA 2NLJC 3E89A 3BEHA 3JAKA 4H0LB 3A8TA 1JJOA 3H9VA 1P4RA 3J7AU 3JAKB 3M8AA 2FKXA 3B09A 1W0JG 4YIPA 5BR8O 3RWRD 1YJNV 3DGEA 2PTMA 2A7WA 3AG3C 1HR0B 2YUAA 2P90A 5LMUB 1L0LH 1WLEA 3N2GA 3GVMA 4FVMA 2Q7EA 4EEQA 5CB4B 1AVMA 4RO2A 4LF9O 1Q6UA 3N2GB 4JZ2A 3GB7C 2ITCC 4AI8A 4Z1VA 4J41A 1BMFG 4JYAO 2BOBC 2QTOA 2Z3YA 2D2CB 2NN4A 3ETEA 4G2KA 4Q20A 1AJNA 4FLXA 4ZHQA 1K3EA 3QO5A 4MVZA 4C7UA 5IY5B 3TJTA 3E8GA 1EM1A 4X65B 1RPOA 5EC2C 4X64B 1NTMH 2BTQB 4CZZA 3ZHSA 1XILA 1QU7A 4OX9B 2CTWA 3ZS8C 3H1KH 5B66Z 4DV7O 3SPCA 1NZ6A 4IHJA 1PNKA 1Y66A 4H33A 1I94B 3W7SA 1EBOA 4IHJB 2Q5ZA 4BWAA 2AHYA 4F4LA 1YXBA 1BGYH 2VS0A 3MHSC 3L9DA 3QO8A 1OJHA 4IT5A 1AJQA 4OPAA 3BFRA 1M57B 2GUZA 3LSQA 4PELA 1WB7A 5J2UA 5JVDA 4R6ZA 1KYOF 3CRAA 3L73H 3SJBC 4QE7A 2GUZB 3ZBHA 4HZ3A 5CBFA 1EN5A 5J2UB 5JVDB 1I7FA 3RYHA 1SQFA 3KCXA 4B3MO 2AW9A 1AB3A 4MVSA 1VF6C 4JI6B 2X6BA 2PI4A 4LFCB 3RYHB 1VQ6V 2WLJA 1VQOV 3MAQA 4DV3B 2QR4A 4U3FH 1X59A 3BPZA 4GX1A 1NH2D 5IDJA 4I4TA 3T1YB 4AHCA 1OZ0A 5EZYA 5IJ9B 2Y48A 1NI8A 4I4TB 4NXMO 2P6JA 5EZYB 4H37A 2IJKA 2ATKC 4R50A 3STZC 4O4LA 3FAVA 2LGQA 2ZDIA 3BABA 1IBKO 5H2FZ 4O4LB 1ZAUA 4DR4B 4UVCA 1LUWA 1GO3F 1ZL8A 4B7EA 4FIPC 1BQ0A 1ZL8B 5KAIZ 3SR2C 1B04A 3QTCA 1UFIA 4FZ1A 2EILC 1VQ4V 3B8MA 1CPYA 4K3AA 4DV1B 2CTRA 1R1BA 3CC2V 4GKKB 5LMNO 2W6JG 1V54B 2QA4V 2Y69B 3FYEB 4CC5A 1AR4A 1JPXA 5CN0A 4JAVA 1TVKA 3ZHRA 4EB6A 1HR0O 4J11A 2RCVA 3CCQV 1ZTEA 5EBMC 2X0LA 3SJAC 3CRCA 1TVKB 4EB6B 2ZIMA 1XL4A 2JJ2G 2YS8A 2AGAA 3FB6C 5GTHZ 2C2AA 1N4CA 2UXCB 1B3QA 1SESA 5FLXN 4WCEV 4KHPB 4QPJA 5BY1A 2JS3A 1K92A 1EN4A 2RJZA 1R3LC 3JD2A 5A9GA 1VARA 1N34B 4LFAB 2VQFO 2Q68A 3QVNA 3J80N 4DV0B 1Q86W 4B3TB 1Z5WA 3ZHVA 2UU9B 1GKFA 5FPRA 1NVPD 2XTAA 3CC4V 4F6RB 1PL0A 4OX9O 4MVRA 5B3SC 1GM8A 2AHZA 2HFEC 3VBBA 3Q4HA 1G8MA 4RUEA 4RWUA 4MTOA 4K0KB 1Y6XA 5L3EA 3NXSA 3TGUH 3Q4HB 1NH2B 2JIZG 4MVUA 1CP9A 2XT9A 1Q43A 1Y67A 2LFSA 2QWQB 1WN7A 4LFBB 3MD0A 2W0FC 2DN9A 2VWJA 5IY5C 1GH6A 1E1QG 3QF7A 1WJZA 2FTKA 2Q4PA 3W7XA 1I0HA 5LA6A 1VQ7V 4LFCO 4MTXA 2VWKA 4DV3O 3LDDA 5LA6B 3CCSV 3CPWU 3LDEA 3T1YO 3JSLA 5B1AB 2KSDA 3WB1A 2A0LA 2F66C 3L72H 1M57C 2PUSA 2DW4A 4WFGA 3K5OA 4RUFA 3SPHA 1XMOB 1KP3A 2WA3A 3BA8A 4IYIA 5DN6G 2E74B 3DXRA 5IYZB 5JQGA 1N8RW 1BCCH 1KKCA 3WFVA 1ZX3A 3H1LH 1AR1B 5JQGB 3BAAA 3B40A 4MT8A 1NR7A 1GMGA 5LHGA 1H8HG 4O2BA 2YIAA 4I9WA 5H6RA 4JI4O 4RQFA 4LF6O 2IH1C 4UXNA 1H8EG 5C8YA 5H5NA 2QWOB 2P4KA 3VOUA 4K35A 1I08A 5C8YB 4ZKIA 3T4DA 4KXRA 4LWSB 3E22A 5GONB 5LP6C 1FKAO 4DR3O 1YZBA 1WPXA 3CRQA 3E22B 1FFXA 4DUZO 3K9AA 1NVPB 3GWOA 4DUYO 3E8FA 3F5TA 3UT5A 4RQEA 1BQZA 5IYBO 1JJ2U 1N36B 3U11A 1QVGU 3CX5F 1BT8A 3SYCA 2YI9A 1QLNA 1XL6A 3UT5B 2FL4A 2QWPB 2YIDA 4JASA 1RPRA 2N05A 5GW7A 3VQVA 4KP4A 4UCUA 4DK1A 3WU2Z 2P5OA 4KHPO 2GHYA 2LW1A 4FJCC 2Y4UA 1SKVA 4UCOA 4J9ZB 5HFMA 2JGDA 2R9RB 1V54C 3RVZA 5CMUA 3OMIB 4B3TO 2UU9O 2JGDB 1KUQA 2V4DA 4JI5O 3LNMB 1OCCB 1HNZB 1BS3A 1H2SB 2CTQA 4GX2A 2JVDA 1ZUQA 4DV7B 4BW5A 1XHZA 4QJFB 2XAFA 3VQYA 4TQFA 3CXCU 4JTCB 5LGTA 1FXKC 3UO2A 2OIGA 5IJ0B 2XHBA 4LF8O 5DM6V 3B4SA 4MW8A 5TISZ 1THZA 1OCOB 2DJVA 3ZCCA 2DYRB 5EC1C 2IJHA 4JI8B 2IJJA 4B3SO 3P3PA 3ZEDA 2MK3A 4R8CA 2P06A 4I0XA 1IXMA 2YI8A 4FLUA 1VQNV
chains in the Genus database with same CATH topology
4DR2O 1N36O 2HHHO 1IBLO 1XNQO 4YY3O 4JI6O 4DV6O 1D2DA 2UXDO 4LF4O 4JV5O 4AQYO 2UXCO 1FKAO 2VQEO 4DR3O 4JI0O 1YZBA 3RT3C 4DV7O 1DK1A 4DUZO 1NS1A 3JAMN 1N32O 1XNRO 4X62O 4DR7O 1N34O 4X66O 4DUYO 3F5TA 4LF7O 5LMUO 4LFAO 4DV5O 1FYJA 5IWAO 4DV0O 2UUCO 2ZM6O 1R1BA 4LF5O 5LMNO 5LL6Y 1HNWO 5A2QN 2E5LO 3O65A 1FJGO 4JI3O 4OPAA 4YHHO 4LFCO 1HNZO 1XMOO 1HNXO 2N74A 4DV3O 2DOSA 3T1HO 4JI7O 4NXNO 1R6TA 4KHPO 5BXZA 3T1YO 1HR0O 4K0KO 4JI2O 4DR4O 1F7YA 4X65O 4B3TO 4B3MO 1XEQA 2UU9O 1AB3A 4X64O 1KUQA 4DR1O 4DR5O 4JI5O 2AGAA 3J7AU 3M8AA 1XMQO 2FKXA 4LFBO 5FLXN 3J81N 4JI8O 1X59A 5BR8O 3OTOO 2UUBO 1N33O 5BY1A 1IBMO 1AILA 4OPHA 2JRIA 2Z0AA 3R66A 1I94O 4JI1O 4B3RO 2VQFO 3J80N 4DV2O 4NXMO 4DV1O 4GKJO 4LF8O 4GKKO 2ZKOA 4LF9O 2UUAO 2DJVA 4JI4O 1G1XB 2F4VO 4DR6O 4JYAO 1A32A 4LF6O 4OX9O 4DV4O 4B3SO 5H5NA 4A5UB 5IT9N 2LW7A 2UXBO 1IBKO 1J5EO 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 O;  1N36 O;  2HHH O;  1IBL O;  1XNQ O;  4YY3 O;  4JI6 O;  4DV6 O;  1D2D A;  2UXD O;  4LF4 O;  4JV5 O;  4AQY O;  2UXC O;  1FKA O;  2VQE O;  4DR3 O;  4JI0 O;  1YZB A;  3RT3 C;  4DV7 O;  1DK1 A;  4DUZ O;  1NS1 A;  3JAM N;  1N32 O;  1XNR O;  4X62 O;  4DR7 O;  1N34 O;  4X66 O;  4DUY O;  3F5T A;  4LF7 O;  5LMU O;  4LFA O;  4DV5 O;  1FYJ A;  5IWA O;  4DV0 O;  2UUC O;  2ZM6 O;  1R1B A;  4LF5 O;  5LMN O;  5LL6 Y;  1HNW O;  5A2Q N;  2E5L O;  3O65 A;  1FJG O;  4JI3 O;  4OPA A;  4YHH O;  4LFC O;  1HNZ O;  1XMO O;  1HNX O;  2N74 A;  4DV3 O;  2DOS A;  3T1H O;  4JI7 O;  4NXN O;  1R6T A;  4KHP O;  5BXZ A;  3T1Y O;  1HR0 O;  4K0K O;  4JI2 O;  4DR4 O;  1F7Y A;  4X65 O;  4B3T O;  4B3M O;  1XEQ A;  2UU9 O;  1AB3 A;  4X64 O;  1KUQ A;  4DR1 O;  4DR5 O;  4JI5 O;  2AGA A;  3J7A U;  3M8A A;  1XMQ O;  2FKX A;  4LFB O;  5FLX N;  3J81 N;  4JI8 O;  1X59 A;  5BR8 O;  3OTO O;  2UUB O;  1N33 O;  5BY1 A;  1IBM O;  1AIL A;  4OPH A;  2JRI A;  2Z0A A;  3R66 A;  1I94 O;  4JI1 O;  4B3R O;  2VQF O;  3J80 N;  4DV2 O;  4NXM O;  4DV1 O;  4GKJ O;  4LF8 O;  4GKK O;  2ZKO A;  4LF9 O;  2UUA O;  2DJV A;  4JI4 O;  1G1X B;  2F4V O;  4DR6 O;  4JYA O;  1A32 A;  4LF6 O;  4OX9 O;  4DV4 O;  4B3S O;  5H5N A;  4A5U B;  5IT9 N;  2LW7 A;  2UXB O;  1IBK O;  1J5E O;  3SDL A; 
#chains in the Genus database with same CATH topology
 4IYH A;  1DTO A;  4I0X B;  1K97 A;  4GT1 A;  4B3M B;  4DV6 O;  1KB9 F;  4ZOL A;  4K8X A;  3FB5 C;  3LUT B;  2DQ0 A;  4FPP A;  4AIL C;  5KUM A;  2IW5 A;  1HP8 A;  3G80 A;  2HR3 A;  4ZOL B;  5E79 Z;  5D5Q A;  4JGS A;  3IAY A;  1K73 W;  1NS1 A;  1KD1 W;  2QM4 A;  1JR9 A;  1XNR O;  4FZ0 A;  1J5E B;  4DV5 O;  3OFN G;  2UUC O;  1BHA A;  1JX9 A;  4X1K A;  3K9S A;  4NXM B;  2LQT A;  3HR0 A;  4X1K B;  1O9G A;  3VQX A;  3K59 A;  1XMO O;  2ZCE A;  1TUB A;  4JI7 O;  3ABL B;  5EIB D;  3THO A;  1YCI A;  3ABK C;  4CH4 A;  1TUB B;  1IBK B;  1H2K A;  3OMN B;  3UM7 A;  2WWW A;  1XQ8 A;  1XHX A;  1QR9 A;  4P30 A;  1XEQ A;  1ZSP A;  4JAU A;  2YEV B;  3EHB B;  4JI3 B;  2HVK C;  5CBG A;  2F43 G;  5B1A C;  3OTO O;  2BOC C;  4H44 B;  2UUB O;  1HWY A;  1VEW A;  3LNN A;  1OHH G;  4O2A A;  1IDS A;  3ZHT A;  2XAG A;  4X1I B;  5H6Q A;  1IXB A;  4O2A B;  1Q82 W;  4GKJ O;  2HJD A;  1MA1 A;  3SGI A;  3UCS C;  2EIK C;  3H1J H;  3JD1 A;  1YI2 V;  3H01 A;  5LMN B;  4O4I A;  1RM1 B;  3CC7 V;  2F4V O;  3AK2 A;  1EN6 A;  1QNM A;  3OUS A;  5KA6 A;  4O4I B;  1S76 D;  1H2G A;  5DEC A;  2XAS A;  2LW7 A;  1GM9 A;  1YHQ V;  5HFL A;  5B5E Z;  1W2B U;  1KC8 W;  3E8B A;  3L70 H;  1AP6 A;  1N36 O;  2B5U A;  3ZHQ A;  2QKA A;  1K4D C;  3RBZ A;  3BCC H;  3EVK A;  1JOY A;  2ZR2 A;  1N0N A;  5KHI A;  1PP9 H;  2LGW A;  2EIN C;  1DF4 A;  1ZLZ A;  3OTF A;  3P32 A;  2ZIN A;  1SQG A;  3ZJZ A;  3OW2 U;  2VQF B;  3CD6 V;  2PYL A;  5KUK A;  4I9Q A;  1V55 B;  3AK3 A;  1NTZ H;  2UXD B;  2YXH A;  4ZHQ B;  2Q0O C;  1SA0 A;  3CMA V;  3JAR A;  1HNZ O;  4PV1 B;  2B1I A;  1U96 A;  2DMX A;  3AEI A;  3BY6 A;  3S3W A;  1SA0 B;  4FM1 A;  5BXZ A;  3JAR B;  2YXL A;  3OE7 G;  2WSS G;  2KG7 A;  2FYU H;  2ODM A;  4U7N A;  4YXW G;  1CXZ B;  2IJI A;  4PI0 A;  2GV9 A;  4QE9 A;  1P7G A;  2A9H A;  1WP7 A;  3ABM C;  2BSK A;  4CBC A;  4JI8 O;  3H1H H;  2BSK B;  2XAH A;  2Z0A A;  2ZXW B;  4X1Y A;  3DSQ A;  1VQP V;  4UUJ C;  1OCC C;  1FS0 G;  1VQM V;  1AI4 A;  5BZB A;  2OT5 A;  4DV2 O;  3JCZ A;  4GCZ A;  2Q7H A;  4X1Y B;  4DR1 B;  1FFT B;  2OCC B;  4DRX A;  1XMQ B;  5J2T A;  3MHH C;  3K5M A;  2K9P A;  4DRX B;  2R9I A;  4E4E A;  3QNE A;  1OCO C;  1WNS A;  1J5E O;  1Q6H A;  2DYS C;  4DW0 A;  2CTP A;  1RSO A;  3D3I A;  1D2D A;  4O4H A;  3ZRS A;  2YC0 A;  3WB0 A;  3ASN B;  4AQY O;  4N23 A;  1RSO B;  1ORQ C;  4O4H B;  3ZRX A;  3ZN0 A;  4GX0 A;  3ZN1 A;  3JAM N;  2JEU A;  1YSC A;  3STL C;  3FAV B;  4QPK A;  1K5S A;  1QHT A;  4OXS A;  1IUR A;  2QWR B;  3AG1 B;  1S77 D;  5JJE B;  1WB8 A;  4WFE A;  2EX3 A;  4JI3 O;  4JI4 B;  2CGO A;  2N74 A;  3FKS G;  4LF6 B;  4U7O A;  4NXN O;  2CE4 A;  1PM9 A;  2HKO A;  2XUM A;  3IC9 A;  4PHZ A;  4CS2 A;  1US6 A;  2PYJ A;  3IGA C;  2HEP A;  3ABL C;  5L3C A;  1M4U A;  1BE3 H;  2QE7 G;  5L3F A;  4UCR A;  3LDC A;  2EIM B;  4LNU A;  4DR3 B;  1QLE B;  1E79 G;  4IGG A;  4CH5 A;  3CME V;  2CDY A;  4G28 B;  3PJS K;  4DUZ B;  1IBM O;  2O57 A;  4LNU B;  2CAZ C;  3JAS A;  1M90 W;  4YIO A;  2ETN A;  2LFR A;  3CHX A;  4JI1 O;  4DUY B;  1R73 A;  1YEW A;  3BA9 A;  1V9P A;  5CA3 A;  2WPD G;  4LR3 A;  4DR5 B;  2VRZ A;  4CS3 A;  5JCO A;  1YJ9 V;  4GLX A;  1YDX A;  3A0R A;  1WA8 A;  2A3Q A;  2Q8V A;  2BE3 A;  4UCV A;  1XUQ A;  1WA8 B;  1SQP H;  2QM8 A;  4PD4 F;  1OCZ B;  2AZ0 A;  2UXD O;  1YVW A;  3K06 A;  4BIZ A;  2QTS A;  4JI5 B;  2OCH A;  1SET A;  4BIU A;  4JI0 O;  5EK0 A;  3JAL A;  1M5I A;  3HKE A;  1DK1 A;  1JVM A;  5KA5 A;  2R9A A;  3TXQ A;  2R70 A;  3JAL B;  3HKE B;  1Q6I A;  2LO1 A;  4WFH A;  4LH7 A;  4LC1 A;  5LBQ A;  4LF8 B;  3L71 H;  2OYQ A;  1JA8 A;  1SZT A;  3K3W A;  4J7K A;  3CP1 A;  3K0D A;  2E5L O;  4P9O A;  4BIO A;  1P49 A;  3FD9 A;  3RFR A;  2W0X A;  4HBN A;  3O9O A;  3IC7 A;  4B3S B;  1M9N A;  5JWP A;  1V55 C;  2QJ1 A;  1NJI W;  2OTL V;  3CSX A;  1QQC A;  4CH6 A;  3D36 A;  3N27 A;  4D6T H;  1L0N H;  2F95 B;  1B6Q A;  5KAF Z;  1Q5O A;  4DR1 O;  4DV6 B;  3UKM A;  4UV9 A;  1XMQ O;  2XOK G;  2ZE6 A;  4I7Z B;  3J81 N;  5KHJ A;  2L35 A;  2EJ7 A;  2QWN B;  1XNR B;  5KMG A;  1BZK A;  4DV5 B;  3FB7 C;  3JYC A;  1PV0 A;  4MVQ A;  2UUC B;  2KQX A;  4FLW A;  5KMG B;  2XND G;  3E35 A;  4FLV A;  2Q7G A;  1G1X B;  4JYY A;  4QIW F;  4FLT A;  4WF9 V;  5JJJ B;  2EBO A;  2Q67 A;  4JI7 B;  3T1C A;  4FFK A;  2WAM A;  1NR1 A;  3AG4 B;  1BSM A;  3ZMU A;  2OTJ V;  4MVO A;  1S3J A;  4TT3 G;  3DXR B;  2DWD C;  2GTS A;  3FYI B;  4DYL A;  1XBL A;  4XDJ A;  1XOU A;  2ZT9 B;  2QGN A;  1PNL A;  1O9H A;  4DR6 B;  3OM3 B;  4XDK A;  3G6E V;  4ICG A;  3F5W C;  2M6Y A;  4O2B B;  3E83 A;  4PJ0 Z;  3OTO B;  1JQ0 A;  2UUB B;  4JZG A;  1LNQ A;  3R65 A;  2L6L A;  3CCJ V;  1VQ8 V;  2HJF C;  2UXB B;  1MZE A;  2HHH B;  5FNV A;  4YY3 B;  4GKJ B;  3AG3 B;  3RVY A;  4LF5 O;  1ROP A;  4PA4 A;  3CJH A;  1NU1 H;  1GN2 A;  2F4V B;  2ZDI C;  4FK5 C;  3DTU B;  4NTX A;  3M7M X;  2HG5 C;  4X62 B;  2WLL A;  1MZF A;  1K5Q A;  1FFX B;  4TV9 A;  2WLL B;  4MTF A;  3FB8 C;  4J7Z A;  1KQS U;  2PF4 E;  1F4M A;  4DR5 O;  3OEE G;  4TV9 B;  5IYD O;  3CCM V;  4X20 A;  4NTW A;  5C93 A;  1YTF D;  2P4V A;  3JD4 A;  3W7W A;  1AIL A;  4X20 B;  1DF5 A;  1UJW B;  3OMA B;  3CXH F;  2EIM C;  4BAY A;  1TAE A;  2RDC A;  3K08 A;  2Y69 C;  4G27 B;  3TXS A;  3SYP A;  2UUA O;  4LCU C;  1K8A W;  2H94 A;  1PKX A;  4PI2 A;  1A32 A;  3L75 H;  1SQX H;  4EFB A;  1G6U A;  3CCL V;  2JS5 A;  2QEX V;  4DR2 O;  4P2Z A;  5DED A;  5KX5 A;  3K5L A;  1IBL O;  4MSW C;  3FX7 A;  1RP3 B;  1B06 A;  1VF6 A;  5KX5 B;  4TWK A;  4U3J A;  4UVB A;  4WBN A;  1W59 A;  2QKS A;  3P30 A;  1I5X A;  1OCZ C;  1BHB A;  4U3J B;  1VQK V;  4UCT A;  5L3G A;  2WLM A;  1Q90 D;  1OCR B;  3TK1 A;  3X2Q B;  4DV2 B;  1I5Y A;  2ZM6 O;  2D3O W;  1M56 B;  1FJG O;  4JYB A;  1SER A;  2OWO A;  3CE2 A;  1H2M A;  1Q8I A;  4D7T A;  2ZIO A;  2A79 B;  4I5S A;  4EKW A;  1JCH A;  3N2K A;  3OUF A;  2RNB A;  4PA6 A;  3UQ8 A;  1S0V A;  3HB3 B;  3N2K B;  1VQ5 V;  2ZNJ A;  5LYJ A;  2HVJ C;  4QNH B;  5K1X A;  1R3J C;  3AG7 A;  2RN9 A;  1HNW B;  3E86 A;  5LYJ B;  4AQY B;  1YIT V;  5GTI Z;  1GN3 A;  5EYP A;  3RYF A;  4YJ3 A;  2JGU A;  3SYO A;  2JRI A;  3R66 A;  5EYP B;  3RYF B;  3K57 A;  4YJ3 B;  4JI2 B;  4K8Z A;  1KKD A;  1SQB H;  1T5E A;  4PDM A;  4E2L A;  2ARH A;  4LH6 A;  4FMT A;  1S72 V;  3LSS A;  1FAF A;  2E76 B;  4BR6 A;  4DR6 O;  3RW0 A;  3ZMV A;  4Z2W A;  3IJ4 A;  4GYC B;  5J9P C;  4I55 A;  4DV4 O;  4NXN B;  4QGP A;  1VMG A;  3KG2 A;  1XRE A;  2UXB O;  4B3R B;  5F2V O;  2KB1 A;  2HHH O;  4EFE A;  4J10 A;  4YY3 O;  3E8H A;  3ABT A;  3K0G A;  3OR7 C;  1VF5 B;  1AR5 A;  5B1O A;  4JAA A;  1IBM B;  3CCU V;  4X62 O;  1FD9 A;  4LF7 O;  4JI1 B;  5IWA O;  3ABU A;  3A0B Z;  4ZIB A;  2DE0 X;  1HDJ A;  4JV5 B;  3U10 A;  3RN4 A;  2WA4 A;  4GX5 A;  2K1E A;  1NKD A;  2YIC A;  3I55 V;  3RGB A;  2YIB D;  1AI5 A;  5CB4 A;  2JJ1 G;  3SPJ A;  5IE9 A;  5B3S B;  3RYI A;  4W4K A;  3AG2 B;  3OGC C;  3RYI B;  4NTY A;  4JI0 B;  1IZ3 A;  1X4T A;  3SPG A;  1Y74 A;  1ARO P;  3ETG A;  4OPH A;  1FXH A;  1DLB A;  1Y74 B;  2BTQ A;  1KBH A;  2X7R B;  2NNU A;  1KU9 A;  3OR6 C;  2KG7 B;  2E5L B;  1VP7 A;  3B8N A;  1IVS A;  2V1D A;  3ASO B;  1PNM A;  3OD4 A;  3U0Z A;  2Q0A A;  2Q73 A;  5CA0 A;  1G4Y B;  2P67 A;  1L1F A;  1XI1 A;  5L3D A;  4DK0 A;  4HAM A;  1XNQ O;  2IU3 A;  5CA0 B;  3F7Y C;  1PPJ H;  2VQE O;  2Q9L A;  2ZD9 A;  2JEX A;  3ETQ A;  4B7K A;  2E3C A;  1R3I C;  1D5N A;  2QKC A;  2FB5 A;  1N32 O;  5J2T B;  2G38 A;  2DYR C;  3D8C A;  1K7D A;  4UCS A;  3CRR A;  1FXV A;  2B1G A;  2JDI G;  4L87 A;  4LF4 B;  5LL6 Y;  2ZE8 A;  4FLZ A;  1HNW O;  2BTO A;  1S5H C;  2EIJ B;  5JH7 A;  2IBZ H;  1OCR C;  2ZQM A;  3T1H O;  3B77 A;  3X2Q C;  5IJ9 A;  3ICX A;  2FML A;  1Q7Y W;  1TA8 A;  3WG7 B;  4DR7 B;  1SC5 B;  5JH7 B;  1M56 C;  4JI2 O;  4DW1 A;  4H13 B;  5KHH A;  4MVM A;  2ZE5 A;  1N0J A;  3HKB A;  3M99 B;  4KL1 A;  5LP6 A;  4IL6 Z;  3DC5 A;  1NBM G;  4J9Y B;  3HKB B;  3CS5 A;  4FFB A;  4OGQ B;  2ITD C;  1N33 O;  1GN4 A;  5LP6 B;  4MTG A;  2YIB A;  3JD3 A;  5KHG A;  1P7B A;  4FFB B;  1QCE A;  2N04 A;  4B3R O;  2CUG A;  4TQD A;  1J95 A;  3ZX6 A;  3KZI Z;  3W7U A;  4R7C A;  4LF5 B;  2Z5U A;  1SQV H;  3ZIA G;  1KP2 A;  2H3O A;  2Q6A A;  4XDL A;  4J42 A;  4DXW A;  1Z2G A;  3K5N A;  2LP7 A;  4ZI7 A;  2IH3 C;  1M93 A;  1KMI Z;  3APQ A;  3HKD A;  3SYQ A;  3CCE V;  4JPR A;  1QR8 A;  4ZI7 B;  4FM2 A;  3T2M A;  4P9P A;  3HKD B;  4LBE C;  1AJP A;  3G67 A;  3JAS B;  2F1M A;  4J7J A;  3QG5 A;  1ENV A;  4KUM A;  3CRM A;  2AZ2 A;  4JV5 O;  2EUL A;  4ASU G;  4UV8 A;  3JCU Z;  2EJR A;  3RT3 C;  2GSM B;  2WLI A;  1F4N A;  5EBL C;  1AP5 A;  2ZR3 A;  1F51 A;  2WLI B;  2X6C A;  1MMM A;  2GTA A;  1H38 A;  5LMU O;  1RM1 C;  1K9M W;  3A2F A;  3K58 A;  1FXK A;  2UXX A;  5KLV H;  1GN6 A;  1PD3 A;  2UUA B;  1FXK B;  1TGO A;  4Z1M G;  4MS2 A;  3I56 V;  5LGN A;  3RYC A;  1R6T A;  1S5L Z;  4N21 A;  5L3B A;  1HW7 A;  4RAI A;  4X66 B;  3MDS A;  3HKC A;  3RYC B;  3JSN A;  1SS3 A;  1MOF A;  3CEI A;  4DR2 B;  2AXT Z;  3ZMS A;  4X65 O;  4F6R A;  3BRC A;  1IBL B;  1JFF A;  3HKC B;  1H2L A;  4X64 O;  1YIJ V;  3I5D A;  3H1I H;  1MAB G;  4GUN A;  2Y4T A;  1JFF B;  1WP8 A;  1Y4M A;  4CH3 A;  1W0K G;  4XBF A;  3SPI A;  4WFB V;  2RMK B;  4ABM A;  1L8D A;  3L74 H;  3AG2 C;  1DGS A;  5CA1 A;  4ZBM A;  2IU0 A;  1I94 O;  3C3S A;  3C90 A;  4X8A A;  5CA1 B;  5D5P A;  1D5A A;  2ZM6 B;  1M1K W;  1SRY A;  2F93 B;  5CBH A;  1TUE B;  4FLY A;  1FJG B;  2JK5 C;  4TSF G;  3CWB H;  4CS4 A;  3G6B A;  3K04 A;  4UFZ A;  1Q3E A;  1GRJ A;  3P3N A;  4A5U B;  4NB5 A;  2YSU B;  1UPG A;  5H9C A;  3ABK B;  1R6N A;  4JI6 O;  1EZJ A;  3FFQ A;  3ASO C;  4LF4 O;  1F23 A;  5B1B B;  4BW9 A;  3ZMT A;  2WLH A;  2ZXW C;  4B08 A;  3IFX A;  3OAA G;  4JTA B;  3SYA A;  5EIB C;  1EFR G;  1MNG A;  5K1P A;  3DC6 A;  2XAQ A;  1SQQ H;  2R72 A;  4DR7 O;  1YJW V;  1SF9 A;  2OCC C;  4NYK A;  3KCY A;  3OT7 A;  3D3Q A;  1Q81 W;  2NR5 A;  1GK9 A;  4NKG B;  3BHP A;  2BCC H;  4NVP A;  1RFY A;  3CCV V;  4TUY A;  5IYZ A;  1SZX A;  3ZRV A;  4DO2 A;  3O65 A;  2V7Q G;  3CYO A;  3CB2 A;  3B2E E;  1S5J A;  3PN1 A;  3HPL C;  4CC6 A;  4TUY B;  4DV4 B;  2EIK B;  3GWK C;  4PDV A;  4Q6G A;  4X89 A;  3S3X A;  2P7T C;  4UVA A;  4WFF A;  4X88 A;  4GZR B;  4UB8 Z;  1BL8 A;  3WB2 A;  2IM9 A;  4LP8 A;  3JAT A;  2EIJ C;  3ASN C;  2H8P C;  5E1A C;  4DR4 O;  1ZWI C;  3APO A;  1WAZ A;  2Y0I A;  2Q69 A;  3JAT B;  1VQ9 V;  3WG7 C;  1CEZ A;  4YHH B;  1HNX B;  2PY5 A;  5FNV B;  1NT2 B;  4W4L A;  1IX9 A;  5LHH A;  2P22 C;  3CJH B;  1KEC A;  4J80 A;  2HP8 A;  4TOI A;  3AG1 C;  4LWS A;  5GON A;  2EIN B;  4LF7 B;  5IWA B;  1XDC A;  2F23 A;  2PZS A;  5KHK A;  1R6K A;  4DV1 O;  3LSU A;  5LHI A;  2GDS A;  4GKK O;  1E1R G;  3BVO A;  3W7T A;  5B1N A;  1JMK C;  2M7W A;  5LXT A;  5BMV A;  3T4Z A;  5ITZ A;  5BR8 B;  1AI7 A;  4JTD B;  5LXT B;  4PA9 A;  5BMV B;  5ITZ B;  1NQT A;  2UXN A;  3JAW A;  3JD0 A;  3ML0 A;  3SDL A;  4F6E A;  1LR1 A;  1GTO A;  2YDE A;  1QLE C;  3UO3 A;  1K4C C;  2PGG A;  2XAJ A;  3JAW B;  3TCU A;  4LF9 B;  2QSA A;  2Y0P A;  1MG1 A;  2UXC O;  4JYA B;  4FM0 A;  2A06 H;  4TV8 A;  3K03 A;  1MSD A;  4JYC A;  1N34 O;  4TV8 B;  4X66 O;  3ABM B;  4LFA O;  1FYJ A;  1VIB A;  4DV0 O;  2ZE7 A;  1COW G;  4NR1 A;  3QO7 A;  5LOV A;  3F7V C;  5JCO C;  2ADP A;  4I50 A;  4X9Q A;  2W6I G;  2EZP A;  5LOV B;  2WLK A;  2ZNI A;  3A0H Z;  4HYO A;  4I50 B;  5IJ0 A;  1Z5V A;  1MSW D;  1GM7 A;  1NTK H;  4PA3 A;  4WBN B;  4K0K O;  5FL7 G;  4PDL A;  3SJC C;  1VQL V;  1GAX A;  1F7Y A;  3TET A;  1EZV H;  2CGN A;  2EZO A;  5FPO A;  1XNQ B;  1YF2 A;  1R3K C;  2LJ2 A;  2DYS B;  4MW3 A;  1Y76 A;  5AG2 A;  4LFB O;  2VQE B;  3ZMZ A;  1AI6 A;  1Y76 B;  4YJ2 A;  1N32 B;  2QM7 A;  2ILM A;  4JF3 A;  2MW2 B;  2RQ6 A;  3AK1 A;  3CCR V;  3EXA A;  2X6A A;  5JJN B;  4YJ2 B;  3ETD A;  4L8J A;  1K33 A;  2ZKO A;  2YXY A;  2DWE C;  1PL4 A;  1LUV A;  3EFF K;  4D7S A;  3VQW A;  4IIJ A;  3ZRW A;  2HLD G;  3T1H B;  2ADQ B;  4IIJ B;  3ZRW B;  5IT9 N;  3G4S V;  4UB6 Z;  3D36 C;  4HNA A;  2GBO A;  4PA7 A;  4O4J A;  2QDO A;  2OIE A;  2KKW A;  4HNA B;  1QBZ A;  3G71 V;  2EIL B;  4O4J B;  2PI5 A;  3KKY A;  1VF7 A;  2B9Z A;  4WFA V;  5EBW C;  3SJQ C;  1N33 B;  1U97 A;  1QVF U;  2DQ3 A;  5B1B C;  4I55 B;  3K79 A;  2E75 B;  1H2N A;  4KFM A;  2YEV A;  2CK3 G;  3C3T A;  3OEH G;  1YTF B;  2WLN A;  1URF A;  2CH7 A;  5A2Q N;  1K34 A;  4YHH O;  5IYC O;  3AG4 C;  1HNX O;  2CH7 B;  2DOS A;  3OGI B;  5LGU A;  4PDR A;  1OV9 A;  4X1I A;  1WPB A;  1FPO A;  3E2E A;  1P84 F;  3NR7 A;  3ZHU A;  2NLJ C;  3E89 A;  3BEH A;  3JAK A;  4H0L B;  3A8T A;  1JJO A;  3H9V A;  1P4R A;  3J7A U;  3JAK B;  3M8A A;  2FKX A;  3B09 A;  1W0J G;  4YIP A;  5BR8 O;  3RWR D;  1YJN V;  3DGE A;  2PTM A;  2A7W A;  3AG3 C;  1HR0 B;  2YUA A;  2P90 A;  5LMU B;  1L0L H;  1WLE A;  3N2G A;  3GVM A;  4FVM A;  2Q7E A;  4EEQ A;  5CB4 B;  1AVM A;  4RO2 A;  4LF9 O;  1Q6U A;  3N2G B;  4JZ2 A;  3GB7 C;  2ITC C;  4AI8 A;  4Z1V A;  4J41 A;  1BMF G;  4JYA O;  2BOB C;  2QTO A;  2Z3Y A;  2D2C B;  2NN4 A;  3ETE A;  4G2K A;  4Q20 A;  1AJN A;  4FLX A;  4ZHQ A;  1K3E A;  3QO5 A;  4MVZ A;  4C7U A;  5IY5 B;  3TJT A;  3E8G A;  1EM1 A;  4X65 B;  1RPO A;  5EC2 C;  4X64 B;  1NTM H;  2BTQ B;  4CZZ A;  3ZHS A;  1XIL A;  1QU7 A;  4OX9 B;  2CTW A;  3ZS8 C;  3H1K H;  5B66 Z;  4DV7 O;  3SPC A;  1NZ6 A;  4IHJ A;  1PNK A;  1Y66 A;  4H33 A;  1I94 B;  3W7S A;  1EBO A;  4IHJ B;  2Q5Z A;  4BWA A;  2AHY A;  4F4L A;  1YXB A;  1BGY H;  2VS0 A;  3MHS C;  3L9D A;  3QO8 A;  1OJH A;  4IT5 A;  1AJQ A;  4OPA A;  3BFR A;  1M57 B;  2GUZ A;  3LSQ A;  4PEL A;  1WB7 A;  5J2U A;  5JVD A;  4R6Z A;  1KYO F;  3CRA A;  3L73 H;  3SJB C;  4QE7 A;  2GUZ B;  3ZBH A;  4HZ3 A;  5CBF A;  1EN5 A;  5J2U B;  5JVD B;  1I7F A;  3RYH A;  1SQF A;  3KCX A;  4B3M O;  2AW9 A;  1AB3 A;  4MVS A;  1VF6 C;  4JI6 B;  2X6B A;  2PI4 A;  4LFC B;  3RYH B;  1VQ6 V;  2WLJ A;  1VQO V;  3MAQ A;  4DV3 B;  2QR4 A;  4U3F H;  1X59 A;  3BPZ A;  4GX1 A;  1NH2 D;  5IDJ A;  4I4T A;  3T1Y B;  4AHC A;  1OZ0 A;  5EZY A;  5IJ9 B;  2Y48 A;  1NI8 A;  4I4T B;  4NXM O;  2P6J A;  5EZY B;  4H37 A;  2IJK A;  2ATK C;  4R50 A;  3STZ C;  4O4L A;  3FAV A;  2LGQ A;  2ZDI A;  3BAB A;  1IBK O;  5H2F Z;  4O4L B;  1ZAU A;  4DR4 B;  4UVC A;  1LUW A;  1GO3 F;  1ZL8 A;  4B7E A;  4FIP C;  1BQ0 A;  1ZL8 B;  5KAI Z;  3SR2 C;  1B04 A;  3QTC A;  1UFI A;  4FZ1 A;  2EIL C;  1VQ4 V;  3B8M A;  1CPY A;  4K3A A;  4DV1 B;  2CTR A;  1R1B A;  3CC2 V;  4GKK B;  5LMN O;  2W6J G;  1V54 B;  2QA4 V;  2Y69 B;  3FYE B;  4CC5 A;  1AR4 A;  1JPX A;  5CN0 A;  4JAV A;  1TVK A;  3ZHR A;  4EB6 A;  1HR0 O;  4J11 A;  2RCV A;  3CCQ V;  1ZTE A;  5EBM C;  2X0L A;  3SJA C;  3CRC A;  1TVK B;  4EB6 B;  2ZIM A;  1XL4 A;  2JJ2 G;  2YS8 A;  2AGA A;  3FB6 C;  5GTH Z;  2C2A A;  1N4C A;  2UXC B;  1B3Q A;  1SES A;  5FLX N;  4WCE V;  4KHP B;  4QPJ A;  5BY1 A;  2JS3 A;  1K92 A;  1EN4 A;  2RJZ A;  1R3L C;  3JD2 A;  5A9G A;  1VAR A;  1N34 B;  4LFA B;  2VQF O;  2Q68 A;  3QVN A;  3J80 N;  4DV0 B;  1Q86 W;  4B3T B;  1Z5W A;  3ZHV A;  2UU9 B;  1GKF A;  5FPR A;  1NVP D;  2XTA A;  3CC4 V;  4F6R B;  1PL0 A;  4OX9 O;  4MVR A;  5B3S C;  1GM8 A;  2AHZ A;  2HFE C;  3VBB A;  3Q4H A;  1G8M A;  4RUE A;  4RWU A;  4MTO A;  4K0K B;  1Y6X A;  5L3E A;  3NXS A;  3TGU H;  3Q4H B;  1NH2 B;  2JIZ G;  4MVU A;  1CP9 A;  2XT9 A;  1Q43 A;  1Y67 A;  2LFS A;  2QWQ B;  1WN7 A;  4LFB B;  3MD0 A;  2W0F C;  2DN9 A;  2VWJ A;  5IY5 C;  1GH6 A;  1E1Q G;  3QF7 A;  1WJZ A;  2FTK A;  2Q4P A;  3W7X A;  1I0H A;  5LA6 A;  1VQ7 V;  4LFC O;  4MTX A;  2VWK A;  4DV3 O;  3LDD A;  5LA6 B;  3CCS V;  3CPW U;  3LDE A;  3T1Y O;  3JSL A;  5B1A B;  2KSD A;  3WB1 A;  2A0L A;  2F66 C;  3L72 H;  1M57 C;  2PUS A;  2DW4 A;  4WFG A;  3K5O A;  4RUF A;  3SPH A;  1XMO B;  1KP3 A;  2WA3 A;  3BA8 A;  4IYI A;  5DN6 G;  2E74 B;  3DXR A;  5IYZ B;  5JQG A;  1N8R W;  1BCC H;  1KKC A;  3WFV A;  1ZX3 A;  3H1L H;  1AR1 B;  5JQG B;  3BAA A;  3B40 A;  4MT8 A;  1NR7 A;  1GMG A;  5LHG A;  1H8H G;  4O2B A;  2YIA A;  4I9W A;  5H6R A;  4JI4 O;  4RQF A;  4LF6 O;  2IH1 C;  4UXN A;  1H8E G;  5C8Y A;  5H5N A;  2QWO B;  2P4K A;  3VOU A;  4K35 A;  1I08 A;  5C8Y B;  4ZKI A;  3T4D A;  4KXR A;  4LWS B;  3E22 A;  5GON B;  5LP6 C;  1FKA O;  4DR3 O;  1YZB A;  1WPX A;  3CRQ A;  3E22 B;  1FFX A;  4DUZ O;  3K9A A;  1NVP B;  3GWO A;  4DUY O;  3E8F A;  3F5T A;  3UT5 A;  4RQE A;  1BQZ A;  5IYB O;  1JJ2 U;  1N36 B;  3U11 A;  1QVG U;  3CX5 F;  1BT8 A;  3SYC A;  2YI9 A;  1QLN A;  1XL6 A;  3UT5 B;  2FL4 A;  2QWP B;  2YID A;  4JAS A;  1RPR A;  2N05 A;  5GW7 A;  3VQV A;  4KP4 A;  4UCU A;  4DK1 A;  3WU2 Z;  2P5O A;  4KHP O;  2GHY A;  2LW1 A;  4FJC C;  2Y4U A;  1SKV A;  4UCO A;  4J9Z B;  5HFM A;  2JGD A;  2R9R B;  1V54 C;  3RVZ A;  5CMU A;  3OMI B;  4B3T O;  2UU9 O;  2JGD B;  1KUQ A;  2V4D A;  4JI5 O;  3LNM B;  1OCC B;  1HNZ B;  1BS3 A;  1H2S B;  2CTQ A;  4GX2 A;  2JVD A;  1ZUQ A;  4DV7 B;  4BW5 A;  1XHZ A;  4QJF B;  2XAF A;  3VQY A;  4TQF A;  3CXC U;  4JTC B;  5LGT A;  1FXK C;  3UO2 A;  2OIG A;  5IJ0 B;  2XHB A;  4LF8 O;  5DM6 V;  3B4S A;  4MW8 A;  5TIS Z;  1THZ A;  1OCO B;  2DJV A;  3ZCC A;  2DYR B;  5EC1 C;  2IJH A;  4JI8 B;  2IJJ A;  4B3S O;  3P3P A;  3ZED A;  2MK3 A;  4R8C A;  2P06 A;  4I0X A;  1IXM A;  2YI8 A;  4FLU A;  1VQN V; 
#chains in the Genus database with same CATH homology
 4DR2 O;  1N36 O;  2HHH O;  1IBL O;  1XNQ O;  4YY3 O;  4JI6 O;  4DV6 O;  1D2D A;  2UXD O;  4LF4 O;  4JV5 O;  4AQY O;  2UXC O;  1FKA O;  2VQE O;  4DR3 O;  4JI0 O;  1YZB A;  3RT3 C;  4DV7 O;  1DK1 A;  4DUZ O;  1NS1 A;  3JAM N;  1N32 O;  1XNR O;  4X62 O;  4DR7 O;  1N34 O;  4X66 O;  4DUY O;  3F5T A;  4LF7 O;  5LMU O;  4LFA O;  4DV5 O;  1FYJ A;  5IWA O;  4DV0 O;  2UUC O;  2ZM6 O;  1R1B A;  4LF5 O;  5LMN O;  5LL6 Y;  1HNW O;  5A2Q N;  2E5L O;  3O65 A;  1FJG O;  4JI3 O;  4OPA A;  4YHH O;  4LFC O;  1HNZ O;  1XMO O;  1HNX O;  2N74 A;  4DV3 O;  2DOS A;  3T1H O;  4JI7 O;  4NXN O;  1R6T A;  4KHP O;  5BXZ A;  3T1Y O;  1HR0 O;  4K0K O;  4JI2 O;  4DR4 O;  1F7Y A;  4X65 O;  4B3T O;  4B3M O;  1XEQ A;  2UU9 O;  1AB3 A;  4X64 O;  1KUQ A;  4DR1 O;  4DR5 O;  4JI5 O;  2AGA A;  3J7A U;  3M8A A;  1XMQ O;  2FKX A;  4LFB O;  5FLX N;  3J81 N;  4JI8 O;  1X59 A;  5BR8 O;  3OTO O;  2UUB O;  1N33 O;  5BY1 A;  1IBM O;  1AIL A;  4OPH A;  2JRI A;  2Z0A A;  3R66 A;  1I94 O;  4JI1 O;  4B3R O;  2VQF O;  3J80 N;  4DV2 O;  4NXM O;  4DV1 O;  4GKJ O;  4LF8 O;  4GKK O;  2ZKO A;  4LF9 O;  2UUA O;  2DJV A;  4JI4 O;  1G1X B;  2F4V O;  4DR6 O;  4JYA O;  1A32 A;  4LF6 O;  4OX9 O;  4DV4 O;  4B3S O;  5H5N A;  4A5U B;  5IT9 N;  2LW7 A;  2UXB O;  1IBK O;  1J5E O;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...