1M4UA

Crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
199
Chain Sequence
b'MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone Morphogenetic Protein-7
publication title Structural Basis of BMP Signalling Inhibition by the Cystine Knot Protein Noggin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 35
structure length 199
sequence length 206
ec nomenclature
pdb deposition date 2002-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.520 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m4uA02
2.10.90.10 Mainly Beta Ribbon Cystine Knot Cytokines, subunit B Cystine-knot cytokines 1m4uA01
5HI4A 1AGQA 1ES7A 2TGIA 4FAOA 2R52A 4GLNE 5E4GA 5HHVA 1ZKZA 1WWWV 5BQBA 1MJVA 2X1WA 3SEKB 1DZ7A 5F3HI 1FZVA 2FJGV 1HCNA 1SG1A 2QR0C 5HHCA 4KXZA 4HR9A 1QFWB 1BMPA 5F3BC 1BNDB 1KTZA 1BJ1V 5BQ8B 2P6AA 5FV1V 1TGKA 2ARVA 2QJ9A 4BV4L 4ZBNA 1TFGA 1KLCA 1MKGA 5BQEA 4EDXV 1E9JA 4EC7A 1XWDB 2ASKA 3B4VA 1NYSB 2V5EB 1B98A 3BUKA 1HCFA 3V6BA 5BQ8D 2B0UA 3JVFA 3BMPA 5HK5E 1RV6V 3MJGA 1HD4A 1AOCA 1CZ8V 3MJKA 5HK5A 3V2AA 1REUA 1WQ9B 1VPFA 1B8MA 1MKKA 4UI2B 4QAFC 4GLSE 1FL7A 4UHYA 4MPLA 4ZFFC 4UHZA 4QHUC 4KZNA 4UI0A 4EDWV 5JZ7A 2VXSA 2ARPA 3EVSB 1M4UL 3BK3A 1HRPB 4UI1A 3RJRA 3FUBB 4MQWA 4EAXA 1JPYA 5BQEB 1NT3A 1VPPV 1M4UA 1SGFB 1WQ8A 1NYUB 2IFGE 5HHXA 3EO1C 1PDGA 1QFWA 4X1JA 4HSAA 1KATW 2GYRA 4HQXA 1B8MB 2QJBA 2R53A 1QTYR 2H62A 5HI3A 1FL7B 4AY9A 1B8KA 1HCNB 4LXRJ 1LXIA 1TZIV 3QTKA 1BTGA 4WPBA 2XV7A 1LX5A 2GOOA 2XACA 2FJHV 4LXSJ 4MIDA 4QCIC 4MQWB 2C7WA 5FV2V 4EFVA 5BPUA 2QJAA 2IM9A 1TGJA 2PJYA 3S1KV 5BQCA 4KV5A 1BETA 2VWEA 3IJ2A 5AEJA 1BNDA 2H64A 3QB4A 2GH0C 2GYZA 2KD3A 1S4YB 5BQ8A 2QCQA 5HHDA 2VPFA 4YCGC 1HRPA 1FLTV 1KLAA 3HH2A 3S1BV 1WAQA 1XWDA 3KFDA 4AY9B 3BDYV 3P9WA 5HI5A 2QCWA 1TZHV 4HQUA 4XPJA 2X1XE 1REWA 1WQ9A 3E07A 2BHKA 4YCIC 2GNNA 4N1DA
chains in the Genus database with same CATH superfamily
1L1FA 4Z1MG 3RYCA 1H2GA 1OCOB 3J7AU 3CC7V 5CN0A 5IY5B 3VQYA 2IH3C 2Q68A 3D36A 1HCNA 3CRCA 1FFXB 1K5SA 4PHZA 5C8YA 4LF9O 3L72H 2WA4A 5IJ9B 4XDKA 1T5EA 4X64O 1JVMA 5A9GA 3IJ4A 1OCCB 2M7WA 3JARB 4GX5A 4MVUA 4LF8B 1WNSA 1AR1B 1HWYA 1VPFA 4I4TB 2XUMA 1VF6C 4DV4B 4G27B 2QR4A 1EN5A 1U97A 5LMUO 2LW1A 1NJIW 3E89A 3CCJV 3ABMC 3G4SV 4JI5O 3ASNB 1SQGA 4DV5O 4DK1A 1I7FA 2DW4A 4NXNB 4BIOA 4FLXA 5KUMA 1B6QA 3JAKA 4GX0A 5EBMC 1E1RG 3TXSA 3OEHG 2IFGE 1Q81W 1PDGA 2XT9A 2V4DA 4X88A 3ZMTA 4FLUA 1IBKB 3KZIZ 4N23A 4ZOLA 1YEWA 1NVPB 2N74A 5JWPA 2Q4PA 2ZR3A 3ZRSA 4WBNB 4WPBA 3HKEA 2DOSA 1M9NA 3L74H 4MTXA 2KKWA 2A0LA 4WCEV 4JI8O 1W2BU 2ZE5A 2CTRA 2GHYA 2Z5UA 5BPUA 4P2ZA 1TUBA 2VWKA 4YIOA 2QJ1A 3C90A 4DUZB 4FM1A 5HFLA 3SYCA 2VWEA 4PA6A 4UXNA 1X59A 2GYZA 3FB6C 4JZ2A 3WG7B 2IJHA 1S72V 1BMFG 2PY5A 4LWSA 2WWWA 4KUMA 5DN6G 4UCRA 4FAOA 1ES7A 4HNAA 3WFVA 1M56C 4YJ3B 3AG7A 1K92A 1J5EB 1MJVA 2K1EA 3L9DA 3CJHB 1E79G 4YHHO 3JALA 4NXMB 4LF5O 1ZX3A 1B06A 3JD4A 2OIEA 3JD0A 2E76B 2JJ1G 1G4YB 5J2TB 4JYBA 3UQ8A 5B1NA 4GKKB 5BQEA 3MHHC 2AZ0A 1XWDB 3CRQA 2YIDA 1HNXB 1N8RW 3ZHVA 4L8JA 3JATB 3UKMA 1BL8A 3TK1A 1FXKC 5GW7A 3RGBA 4EDWV 5JZ7A 3K04A 1VF7A 5BZBA 1VQ8V 5K1XA 4MVMA 4H13B 4UCSA 2CUGA 2Q7EA 3RT3C 4LH6A 4DV1B 5JCOC 4B7KA 4H33A 1K4CC 4FM0A 4HAMA 3EO1C 1FYJA 2Y48A 4R8CA 4KL1A 1N32O 2UXXA 1EFRG 2GYRA 4U3JA 1B8MB 1BT8A 3BA8A 5HI3A 2CDYA 1I08A 2PZSA 1OZ0A 5B5EZ 2IH1C 1HNWB 4KXRA 2DQ0A 1GN2A 1YSCA 5CMUA 1VQ9V 1Y6XA 4MS2A 1SQBH 4ZI7A 5BQCA 4I0XB 4IYIA 3W7TA 1I0HA 2KSDA 3E35A 3CYOA 3OTOO 3S1BV 2ETNA 4CBCA 2LFRA 3B2EE 1AILA 4HQUA 3ABMB 4B3RO 3A0HZ 2QKSA 4WFGA 3SGIA 3OAAG 1ZKZA 1WWWV 1GTOA 2NNUA 2A06H 4LF6B 1XL6A 4HR9A 2QKCA 4D6TH 2QDOA 2AHZA 3BVOA 2R9AA 4PA4A 1BJ1V 4MVSA 4B08A 1QNMA 1XMOO 4ZBNA 4MSWC 1KLCA 1Q90D 2JVDA 5KMGA 4FLYA 3V6BA 1JFFA 5HK5E 1HD4A 2QGNA 2YSUB 1CP9A 1FPOA 3RYFA 1Y76B 4X1YA 2ODMA 4UHYA 2ZINA 1K33A 4TT3G 3B8NA 4JI1O 1R3LC 1SQFA 2YEVB 1M4UL 1X4TA 3QVNA 3S3XA 3K0GA 3STLC 1RP3B 4UI1A 4ZBMA 1D5AA 1AP6A 4EFBA 4DR5B 2LGWA 3MD0A 5IYCO 3K0DA 4X89A 3JSNA 1R6TA 3FYIB 3JAWA 4N21A 2VRZA 4LFCO 1CXZB 4YXWG 3AG2C 3TGUH 1BHBA 1GN4A 1YXBA 2EJRA 1LUWA 1WN7A 1TA8A 5JVDB 1M56B 3K06A 4H0LB 1ENVA 1EM1A 1XNQB 2JS5A 3ZCCA 3QG5A 3WB0A 2EJ7A 3OEEG 1BS3A 3I5DA 2ZCEA 4JI6B 2RDCA 5KX5B 1K73W 1DF4A 1FXHA 1WB7A 1KMIZ 4GKJO 4QPJA 1VQPV 5H5NA 1BETA 3O65A 4B3TO 4WF9V 1K3EA 3G6EV 4JV5B 4I7ZB 5LA6A 1HRPA 1PPJH 2HJFC 3RYIB 1FXKB 4X20A 5L3CA 3G80A 1MMMA 2F1MA 4NYKA 3TJTA 2VWJA 2OTLV 2P7TC 2WLKA 2FB5A 5E4GA 5IE9A 4JI0B 1RPRA 1IXBA 4WFFA 1H8HG 1FD9A 2GBOA 4K35A 3OTFA 2W6JG 2YDEA 4CH3A 1TGKA 4O4HB 5IYDO 2ADPA 5BR8B 4X9QA 1RV6V 5LHIA 1XEQA 1PP9H 4UCVA 3CB2A 1Q5OA 1Z5VA 1SESA 1XMQO 2QKAA 5B66Z 5IJ0A 2YC0A 4BWAA 4DR2O 3F5TA 1BHAA 4LR3A 1F23A 4B3SO 1YITV 5FNVB 3P30A 3Q4HB 1YVWA 3OUSA 3E8GA 3K9AA 2ZM6B 3FUBB 2DYSC 1SZXA 1M90W 4IIJA 4UUJC 2QA4V 1WQ8A 4K8ZA 1PD3A 3ABKC 2FL4A 1P7BA 2HHHO 3ZIAG 1GKFA 1KATW 1WPXA 4JI4O 4TUYA 4TV9B 4LFAB 3OR6C 2CTPA 4FZ0A 4LCUC 2WA3A 4UB6Z 4X1KB 4DK0A 4K8XA 3L70H 4BW5A 2GTAA 2NLJC 1KQSU 4LBEC 3CCQV 4YY3O 4J9ZB 5CA1A 2P6JA 2B5UA 2LQTA 3QB4A 5EZYA 1S4YB 5JH7A 3CCUV 4KHPO 4TSFG 4I55B 2EIMC 3KFDA 4AY9B 4FM2A 3W7WA 2BSKA 1YHQV 4BR6A 4DR6B 2HVKC 3G71V 1VQ6V 2EINC 1WA8A 4GLNE 5HHVA 4AHCA 5JJJB 1Q82W 1WJZA 3I55V 4F6RA 4MTOA 1ZLZA 1LNQA 1E1QG 1QLEC 3EVKA 2HJDA 1NZ6A 3EXAA 4JPRA 4DR4B 3QTCA 1PV0A 2Y0IA 5JQGB 4J11A 5LMNB 2P6AA 3AG2B 1RFYA 2UXCB 3M7MX 2WLIB 5C93A 3BUKA 3H1JH 5B1BB 3MJGA 3MJKA 4MW3A 1WQ9B 1ZL8B 1EZJA 1YTFB 2F66C 1VF5B 3CRMA 1SRYA 3SYAA 2VXSA 2L6LA 2RCVA 3EVSB 2CTQA 1MABG 2P90A 2GSMB 1DGSA 1WP8A 3RJRA 2X6AA 3ZMZA 3KG2A 3JAMN 4X65B 1VPPV 1R3IC 4K0KO 5HHXA 1FFXA 3T1YB 3E8FA 2IBZH 4HSAA 1ZWIC 4CS2A 2R53A 1R3JC 2ZQMA 5IJ9A 2H62A 2MW2B 3ML0A 4I50A 4EFEA 3F7YC 3CX5F 4OPHA 1R6NA 4LXRJ 3HKDB 2XAHA 1BTGA 1YI2V 2XV7A 1K5QA 3K9SA 1EZVH 1WPBA 3ICXA 3JARA 3E22B 4LP8A 1AI6A 3OM3B 1OHHG 5JJNB 3D36C 1PM9A 1H8EG 4QNHB 4GZRB 4DR3O 2KG7A 1Y74A 3JD3A 2KD3A 2OT5A 4JYYA 5J2UB 3HKBB 4E4EA 2W0XA 2X7RB 1N34O 2WLMA 5JJEB 3AG3B 2EZOA 4ABMA 2BTOA 3QF7A 1OCZC 4FPPA 2UUBB 3CE2A 3N2KB 4RQEA 5HI4A 3CWBH 4EB6B 1Y66A 5BQBA 1I94B 2X1WA 1IBLO 2DYSB 3BAAA 1IXMA 1XDCA 1NKDA 3ABKB 3SJBC 3ETGA 5KHIA 2ZE8A 1K34A 2YI8A 5FL7G 5IYBO 1Q3EA 1E9JA 3K57A 3FD9A 4Z2WA 4UVAA 4EC7A 3UO2A 3B4VA 5KHHA 4LF9B 2IJKA 3FFQA 4R50A 4X64B 1REUA 5ITZB 1AR4A 3L73H 5GONB 1V54C 4MVZA 5CBFA 2ADQB 2AHYA 1IBMO 2LGQA 1Z5WA 5LMUB 4DR1O 4FFBB 3WB1A 4ICGA 3DC6A 2HR3A 2O57A 3AK2A 4JI5B 2XOKG 4DV5B 1SETA 4J9YB 4FLWA 2EIMB 2JRIA 1SGFB 1SA0A 3STZC 3CJHA 3WU2Z 4CC5A 4O4LB 2VS0A 1S0VA 3JD2A 2Q8VA 3ZRVA 4R6ZA 3E8HA 3CXHF 5J2TA 5DEDA 2OCHA 1B8KA 3BY6A 2WLNA 4BIUA 4G28B 4YJ2A 4NTWA 1QLEB 2P22C 2HEPA 3DGEA 4TWKA 3JATA 3CRRA 2Z0AA 1K97A 2G38A 1XNRO 2V1DA 4JYCA 1NH2D 4JI8B 3S1KV 3CCVV 4KV5A 4F6EA 3T4DA 5IT9N 1BNDA 2Z3YA 2GH0C 5KLVH 4NTYA 2CGOA 5LOVB 1HDJA 3FX7A 2F23A 4JTDB 1COWG 4DR7O 4OX9O 1HP8A 4LF4O 4O2BB 1TZHV 3KKYA 2A79B 2GNNA 1XUQA 1K9MW 3ABLC 2A9HA 2Q0OC 1P84F 3BPZA 1SS3A 1ORQC 2BTQB 5H6QA 1QU7A 1DZ7A 3BA9A 1SKVA 5KHJA 5HHCA 2EX3A 4KXZA 3N2GA 5FPOA 3D3IA 1N0NA 5B1OA 4YHHB 3T1HO 2WLLB 4JTAB 5IWAO 4LF5B 3QNEA 3ZHQA 1LUVA 1XOUA 3CEIA 1HCFA 5BQ8D 1G8MA 3RW0A 1QR8A 4GUNA 3RYHB 2Y0PA 4W4LA 1XQ8A 1MKKA 3VQXA 2WLJA 2ZE6A 4J7ZA 4DV3O 1SZTA 3ASOC 2JJ2G 4UHZA 4Q20A 3CSXA 3SJCC 2ZD9A 2Q6AA 4LF7O 3JCZA 4GYCB 1FJGO 1FKAO 4XDLA 3SDLA 1AJQA 2W0FC 1OV9A 3CP1A 2Q67A 1D2DA 2N05A 1NR1A 4LFBO 1MSWD 3OMIB 2BE3A 1L0NH 3LSSA 1OCZB 1HR0O 5IDJA 1KU9A 1NU1H 4JTCB 4DRXB 1B04A 1N32B 4X62O 1DTOA 1GMGA 4F4LA 4X1IA 4JI2O 3JASA 4D7TA 5L3FA 4KP4A 4C7UA 3D8CA 5EYPA 3QO7A 1R3KC 2RNBA 4Z1VA 1BZKA 4QGPA 5CBHA 1Q86W 1PNLA 1AROP 1M1KW 3A2FA 2Q0AA 4ZHQA 3FB8C 2IM9A 3IAYA 2PJYA 4NB5A 5LHHA 1VQMV 2LJ2A 4QIWF 2NN4A 2IJIA 3A0RA 5BQ8A 4UVBA 3DXRA 1IX9A 3TXQA 1V9PA 4DV6O 1V54B 4ZOLB 3SYOA 5KHGA 4FJCC 3ABTA 2D2CB 2QWOB 3OTOB 3EHBB 4N1DA 4CS4A 1DK1A 4B3RB 2XAJA 1RPOA 5JVDA 1TUBB 2GDSA 1KC8W 4PDRA 3BEHA 1VQ7V 4PDVA 1HW7A 2R70A 4EDXV 1CPYA 4LWSB 1XMOB 2NR5A 1QQCA 4X8AA 2UUCO 1NTZH 2UU9O 1WAZA 2JIZG 4HNAB 2FMLA 1AI4A 1FL7A 2R9IA 2EIJC 2EULA 5BMVA 4KZNA 3ZJZA 3JALB 2ZDIA 3K5OA 3VQWA 3LDCA 4JI1B 4UV9A 5KAFZ 4J10A 1EBOA 3HKCA 5LGNA 5BQEB 1M57C 2WPDG 3JD1A 1ROPA 4PA3A 5EK0A 4RUFA 3F7VC 1FXVA 5JCOA 2XHBA 1QTYR 3ABLB 2ZE7A 2YUAA 2H3OA 3O9OA 4NTXA 3CMAV 4LFCB 4NR1A 4O4HA 1GM8A 3QTKA 1VQOV 1LX5A 4FLZA 3P3NA 4WFAV 1L8DA 2DJVA 3F5WC 5A2QN 3FAVB 4U3FH 3X2QC 5EBWC 2H8PC 4MVOA 4PA9A 4JI7O 4O4JA 3CD6V 2XAFA 5AEJA 3Q4HA 1O9HA 1S5JA 4GKJB 2QCQA 3SPGA 1L0LH 2ITCC 4IGGA 4U3JB 2JGDB 2VPFA 1KECA 4JI3O 4YCGC 2K9PA 3CCLV 1GAXA 4B3TB 4LNUB 1GM9A 3ASOB 4MTGA 1NR7A 4UB8Z 4TV8B 3UT5A 1R1BA 2ITDC 4PDLA 4WFEA 1JOYA 4ZI7B 1Q7YW 1F4MA 1JPXA 4J7JA 1SERA 5L3BA 2Y69C 3P3PA 1W0JG 2E75B 4X1KA 4NVPA 4DW0A 5LGTA 1S5LZ 1NBMG 3CXCU 3BMPA 1MOFA 4PI0A 2CE4A 2DYRC 4ZKIA 4JGSA 1N36O 2KQXA 1BCCH 4UI2B 4IHJB 4OXSA 5CB4A 4QAFC 1YJNV 5IYZB 1XMQB 2P5OA 3FKSG 3SR2C 5D5PA 3ZRWB 3CCSV 3IC7A 4DR2B 5L3GA 3THOA 3CCRV 3MHSC 3SPJA 1VIBA 4B3SB 2ZXWC 4MQWA 2RJZA 2E3CA 1KBHA 1JCHA 1QVFU 5KMGB 4GCZA 3CC4V 1NYUB 1JFFB 3RYFB 2QWQB 4L87A 4DV2O 3E2EA 4X1JA 4P30A 4DV0O 4X1YB 5B3SC 4RWUA 4DV7O 1OJHA 2GUZB 5AG2A 1QVGU 2HHHB 2PI5A 2HG5C 3N27A 3U10A 2PUSA 4JI4B 1HNZO 4GT1A 5BXZA 3JYCA 2UUAO 1ZL8A 2N04A 2FJHV 4RAIA 3RN4A 5LP6A 2B9ZA 4X66O 1JX9A 5KA6A 3JAWB 3S3WA 1KD1W 4YY3B 5H6RA 5GTHZ 4JF3A 4B3MO 4KHPB 1LR1A 2ZNJA 2YIBD 1N33O 2EIJB 1R6KA 2AXTZ 2OYQA 2ZIOA 2FTKA 5FPRA 1K7DA 3H9VA 3UM7A 2HLDG 2CH7A 4J41A 3K3WA 1U96A 1N0JA 1EN6A 1RSOA 1WP7A 1PNKA 4FVMA 3UCSC 3ZHRA 2VQFO 1NT2B 1FZVA 2FJGV 1M57B 2QR0C 4I5SA 4Q6GA 1KKDA 3G67A 4MVQA 1H38A 1THZA 1OCOC 2ASKA 1NYSB 1B98A 1MA1A 2PYLA 3ETEA 4TQFA 3T1CA 5B1AC 4PDMA 4X20B 2L35A 1VQLV 1YCIA 1MG1A 4GX2A 5J2UA 2XASA 3HKBA 5BY1A 4JAVA 4ZFFC 3SPIA 2OCCC 4KFMA 3HB3B 1IVSA 3X2QB 3M8AA 1TVKB 1VMGA 2P4KA 2A3QA 3LSUA 1PNMA 1W59A 1EN4A 3DTUB 5LGUA 3RVZA 1R73A 5H2FZ 4AQYO 4D7SA 3BRCA 2OWOA 1AI7A 3J81N 4JYAO 4OGQB 3VOUA 1P7GA 3OGCC 2YIBA 1JMKC 4K0KB 2OTJV 3I56V 3CS5A 3K5MA 1GM7A 5CA0A 2YI9A 4DYLA 1FS0G 3D3QA 2VQEB 1ZAUA 1NVPD 2QTSA 2Y69B 2UXBO 2JDIG 3L75H 4J80A 4UFZA 5GONA 2C7WA 4IIJB 2HVJC 1KYOF 2ARHA 3H1HH 4HBNA 1Y4MA 3ZHUA 2UXDO 2DYRB 5HHDA 4FFBA 1JA8A 4DR3B 1KLAA 2VQEO 2E5LO 1PL0A 4TUYB 2LO1A 3B4SA 1A32A 3OD4A 1BSMA 1VQKV 3OUFA 5EIBD 2F4VO 1N34B 3LDDA 5HK5A 3U11A 4O4LA 1AGQA 3G6BA 4I4TA 2AGAA 3NXSA 3GWKC 1IDSA 3BABA 3CC2V 5F3HI 1S76D 3LNNA 1TAEA 1SG1A 5CA1B 1QFWB 1AP5A 1IBLB 2WLHA 1BMPA 4UCOA 1G1XB 1NTKH 5EZYB 5JH7B 3VBBA 3A8TA 1NQTA 5EC1C 5B3SB 5KHKA 2GTSA 2QWRB 1GH6A 4JAAA 3MDSA 1YJWV 3ZN1A 1ZSPA 3K79A 1OCRC 4IL6Z 2M6YA 4FMTA 4GLXA 3L71H 4WBNA 3C3SA 4O4IB 3C3TA 4JZGA 1IBMB 3PJSK 4GX1A 4DR1B 2YXYA 3BHPA 2BTQA 2IU0A 1GK9A 2P06A 1PL4A 4DUYO 2DWEC 2ZR2A 3ETQA 1AR5A 4IYHA 2WSSG 4NKGB 2QJBA 1I5YA 3E83A 2RQ6A 2WLLA 4I9WA 4MW8A 2H94A 1P4RA 3IC9A 2F93B 3RWRD 3FB5C 3ZMUA 1UPGA 1G6UA 1US6A 3RYHA 3SPHA 4YJ3A 2EILC 5FV2V 3APQA 4FIPC 1J95A 4TQDA 5B1AB 4DXWA 1XNRB 1Q43A 2EINB 4FLVA 1AI5A 1RM1C 5LYJB 4PA7A 1XWDA 4I50B 1XBLA 3AG4C 4DR5O 2OCCB 3VQVA 4DR7B 4XPJA 4OX9B 1REWA 4O2AB 5K1PA 4LF4B 3R65A 3T4ZA 2DN9A 3IFXA 4DRXA 2F43G 3OR7C 2KG7B 2D3OW 5F3BC 1Y74B 3J80N 4PV1B 1VARA 1MZEA 3T1HB 4LF8O 2DWDC 5IWAB 3H01A 3JVFA 1F51A 1QLNA 4DV4O 3V2AA 1DF5A 3OFNG 4AILC 1SQQH 4P9OA 1B8MA 4OPAA 3AG1C 1V55C 3ZMSA 1S3JA 1GN6A 3SJQC 1BGYH 4DV3B 5LXTB 3B8MA 3EFFK 3BK3A 2BCCH 1FAFA 1S5HC 4NXNO 1BQ0A 3W7SA 4LF7B 4PI2A 1FJGB 2EIKC 4PELA 4DO2A 2BOCC 1IBKO 3E8BA 2XAQA 3DSQA 2ZKOA 4LFBB 4IT5A 4I0XA 2CGNA 3E86A 3RYCB 1XI1A 3NR7A 4HZ3A 1VF6A 3OW2U 1Y67A 1HCNB 5H9CA 1HR0B 4FLTA 1LXIA 1TZIV 5GTIZ 3ZS8C 4X62B 5C8YB 4JI2B 2XACA 2MK3A 4FFKA 3TCUA 3A0BZ 4DUZO 2XTAA 3K03A 1VP7A 1SA0B 2EBOA 1QCEA 1XHXA 2QWNB 4UCUA 1KKCA 1WAQA 1OCRB 5KAIZ 1MSDA 1F4NA 4DV6B 2X1XE 3E07A 2BHKA 3APOA 3SYPA 4YJ2B 1J5EO 1Y76A 2TGIA 1PKXA 4NXMO 3OE7G 2JEXA 3JAKB 3LUTB 4H44B 2Q69A 2ZDIC 4DW1A 1AJNA 3P32A 2YEVA 4U7OA 2JEUA 2Y4UA 4GKKO 1BNDB 1AB3A 4FK5C 1HNXO 3JCUZ 3FAVA 1MKGA 1GO3F 3HKEB 1JJOA 2FYUH 2Y4TA 2B1GA 4UVCA 1F7YA 4AI8A 1YDXA 2JGDA 2UUCB 2Q7HA 1TUEB 4LNUA 2EILB 5L3DA 2UU9B 3ZHTA 1BE3H 3N2GB 1N4CA 4CZZA 2V7QG 4DV1O 5KX5A 3B77A 4TV8A 1JPYA 1NT3A 1RM1B 2FKXA 4CH6A 3AG4B 1P49A 3WB2A 5L3EA 3PN1A 3H1LH 2BOBC 4MVRA 3K5LA 2GV9A 5DM6V 1HNWO 3RYIA 2R9RB 1FXKA 5FLXN 3ABUA 1QHTA 2PTMA 1H2SB 2QTOA 2LW7A 2ILMA 3OMNB 1NH2B 4CH4A 4IHJA 3JSLA 4R7CA 2W6IG 3OGIB 5D5QA 4EFVA 5IYZA 5LL6Y 1TGJA 3RVYA 2X6BA 2QM8A 2HP8A 3IJ2A 3ZRWA 2H64A 4A5UB 1BQZA 4JI7B 1XREA 2HFEC 4K3AA 3BCCH 2PYJA 3AG1B 1V55B 3P9WA 5HI5A 4X1IB 4JI3B 2QCWA 3JASB 3AEIA 4HYOA 5EYPB 2CTWA 2CK3G 5TISZ 4LF6O 1YIJV 2GUZA 2AW9A 4QE7A 5LHGA 4ZHQB 1QBZA 4CS3A 2EIKB 5FNVA 1URFA 2QSAA 2XNDG 4FZ1A 5HFMA 2PGGA 4XDJA 5LBQA 1KTZA 5BQ8B 3DXRB 5FV1V 2QJ9A 5DECA 1TFGA 1CEZA 2V5EB 1QR9A 1DLBA 2QEXV 3W7XA 1VQ4V 2X6CA 5CBGA 3K59A 1NI8A 4TV9A 1N36B 4MPLA 3OT7A 3DC5A 3KCYA 1GRJA 5B1BC 2IU3A 4ZIBA 1FFTB 1H2LA 3K5NA 2PF4E 3CPWU 1YTFD 5LP6C 2YXHA 5CA3A 5E1AC 5EC2C 4ASUG 1W0KG 4EKWA 2YIAA 3U0ZA 3ZMVA 5E79Z 1XNQO 4I55A 4MT8A 3BFRA 3RBZA 4DV2B 1ZTEA 1FL7B 4AY9A 3AK1A 4DV0B 4EEQA 5BMVB 1S77D 4DV7B 2DQ3A 3GWOA 1KUQA 5F2VO 4JI6O 1WLEA 4LC1A 2GOOA 1NS1A 2XAGA 3GVMA 1HNZB 4QCIC 2Q7GA 3FB7C 1Q6HA 3HKCB 3CCMV 2UUAB 3LNMB 3OMAB 4LH7A 5KA5A 4JV5O 1XHZA 1TVKA 2QE7G 3R66A 4X66B 3SJAC 5JQGA 1AVMA 1FLTV 4U7NA 2Q5ZA 2WLIA 4J42A 1SF9A 4B3MB 3B09A 4G2KA 1WQ9A 1N33B 4JI0O 2LP7A 1SQPH 3SPCA 2P4VA 1B3QA 2R72A 2P67A 2UXNA 1TGOA 3AG3C 4O4JB 2Q73A 2VQFB 1Q6UA 5BR8O 2ARVA 2IW5A 1IURA 4UV8A 4PJ0Z 2QM7A 1H2NA 1AOCA 2WAMA 2JS3A 4RO2A 4BW9A 1SQXH 2OIGA 2ZT9B 2X0LA 2QM4A 3CCEV 1H2KA 2IJJA 3UT5B 4GLSE 4QHUC 3CRAA 3HKDA 2B1IA 2ZM6O 2DE0X 3SYQA 2ARPA 4CH5A 4WFHA 3E22A 5LA6B 1HRPB 1SQVH 1ZUQA 3CMEV 4EAXA 1KP2A 1Z2GA 5IY5C 3RFRA 4YIPA 1M4UA 2ATKC 2A7WA 2EZPA 1MZFA 1KB9F 1QFWA 4MTFA 1JJ2U 3QO8A 4LFAO 4AQYB 3ZN0A 4QJFB 4JYAB 1UJWB 5CB4B 4E2LA 3M99B 3LDEA 1OCCC 2YXLA 1K4DC 1D5NA 3N2KA 3KCXA 4LXSJ 4EB6A 4MQWB 4P9PA 4QE9A 2UXBB 2ZIMA 3UO3A 3ASNC 3ZHSA 2AZ2A 3GB7C 1YZBA 3K08A 4O4IA 3W7UA 5IJ0B 2ZNIA 3B40A 4DR6O 2UXDB 4RUEA 1I5XA 3CHXA 4WFBV 2E5LB 3ZRXA 5ITZA 1H2MA 1WB8A 1KP3A 1UFIA 2R52A 2F4VB 3QO5A 1VQ5V 4TOIA 3MAQA 3SEKB 5LP6B 4DR4O 4H37A 4JAUA 1M5IA 5LMNO 1AJPA 3K58A 4UCTA 3TETA 2CAZC 1GN3A 1VQNV 3LSQA 2UXCO 1XILA 1YJ9V 3HR0A 4PD4F 4BV4L 2Q9LA 2HKOA 2JGUA 2B0UA 1CZ8V 5J9PC 1Q6IA 1VEWA 5EIBC 2YS8A 3WG7C 2ZXWB 4JASA 2CH7B 1RSOB 2RMKB 5LYJA 1IZ3A 1YF2A 4UI0A 4I9QA 4O2AA 5KUKA 4X65O 1NTMH 1XL4A 3H1IH 3T1YO 2BSKB 3ZBHA 2E74B 4BAYA 1WA8B 3AK3A 2RN9A 2YICA 4HQXA 4DUYB 5LOVA 4RQFA 4QPKA 2DMXA 5EBLC 1K8AW 4BIZA 1M93A 1SC5B 4F6RB 2C2AA 2QWPB 4O2BA 1JR9A 2KB1A 2PI4A 3ZX6A 3H1KH 4W4KA 2JK5C 4MIDA 1Q8IA 3IGAC 4B7EA 4CC6A 3ZEDA 2LFSA 3HPLC 3ETDA 2QJAA 3T2MA 5LXTA 1JQ0A 2F95B 1O9GA 3HH2A 4XBFA 3FYEB 2UUBO 3BDYV 5CA0B 1MNGA 1I94O 4YCIC 4J7KA
chains in the Genus database with same CATH topology
2TGIA 4TV8B 3UT5A 4GLNE 5HHVA 3RYCA 4AHCA 5JJJB 3JAKB 3VQYA 4ZI7B 1HCNA 4F6RA 1FFXB 4PHZA 4DR4B 1BNDB 3QTCA 4X1KA 5C8YA 5JQGB 4NVPA 5LMNB 5IJ9B 2P6AA 1T5EA 1MKGA 2UXCB 3M7MX 3BUKA 3HKEB 1JJOA 3BMPA 3MJGA 4PI0A 3MJKA 1WQ9B 3JARB 4LF8B 1WNSA 1VPFA 4I4TB 4UI2B 4IHJB 4DV4B 4QAFC 5CB4A 2UUCB 2Q7HA 4LNUA 5IYZB 2UU9B 2F66C 1XMQB 2P5OA 3SR2C 5D5PA 2VXSA 3EVSB 3N2GB 4DR2B 3THOA 1SQGA 1DGSA 4B3SB 4DK1A 3RJRA 5KX5A 1I7FA 4MQWA 4TV8A 1JPYA 4NXNB 2RJZA 4FLXA 1NT3A 4X65B 2E3CA 3JAKA 1VPPV 5KMGB 4CH6A 1NYUB 1JFFB 2IFGE 1P49A 5HHXA 3WB2A 1FFXA 3T1YB 1PDGA 3RYFB 3PN1A 4X1JA 4HSAA 2V4DA 4FLUA 4X1YB 4CS2A 1IBKB 2R53A 3K5LA 5IJ9A 2GV9A 4ZOLA 1YEWA 2H62A 3RYIA 4I50A 2HHHB 4EFEA 4LXRJ 3U10A 2PUSA 4WBNB 3HKDB 4JI4B 3HKEA 1BTGA 4WPBA 1QHTA 2XV7A 2PTMA 1H2SB 1WPBA 3ICXA 3JARA 3E22B 2FJHV 4CH4A 2KKWA 4IHJA 3JSLA 5JJNB 5LP6A 5D5QA 4EFVA 5BPUA 1TUBA 2VWKA 5IYZA 2QJ1A 1TGJA 4DUZB 4FM1A 2VWEA 3IJ2A 3JAWB 2H64A 2KD3A 2GYZA 4YY3B 4JI7B 5J2UB 3HKBB 4KHPB 2PYJA 2PY5A 2ZNJA 3P9WA 2YIBD 4X1IB 4JI3B 2QCWA 5HI5A 5JJEB 3JASB 2OYQA 2BTOA 3QF7A 2ZIOA 2UUBB 5EYPB 5FPRA 4UCRA 3N2KB 5HI4A 4FAOA 1ES7A 4HNAA 4EB6B 4YJ3B 5BQBA 1RSOA 1J5EB 1I94B 1MJVA 2X1WA 4FVMA 4ZHQB 1NT2B 4CS3A 1FZVA 2FJGV 5FNVA 3BAAA 3JALA 4NXMB 2QR0C 2PGGA 4Q6GA 3SJBC 1KTZA 5KHIA 5BQ8B 5J2TB 2YI8A 3UQ8A 2QJ9A 5FV1V 1Q3EA 4GKKB 1TFGA 1E9JA 3K57A 5BQEA 4EC7A 1XWDB 2ASKA 3B4VA 5KHHA 4LF9B 1NYSB 1B98A 2V5EB 2PYLA 1HNXB 4TQFA 3FFQA 4X64B 1REUA 4X20B 5ITZB 4L8JA 3JATB 5GONB 3K59A 5J2UA 3HKBA 4ZFFC 4TV9A 1N36B 4MPLA 3RGBA 4EDWV 1TVKB 5JZ7A 4ZIBA 1VF7A 1Z5WA 5LMUB 4FFBB 3K5NA 3WB1A 5K1XA 4UCSA 5LP6C 4JI5B 2Q7EA 4DV5B 4FLWA 4LH6A 4DV1B 1SGFB 5JCOC 1SA0A 4D7SA 3BRCA 2OWOA 4FM0A 3EO1C 4CC5A 4O4LB 2YIAA 2YIBA 1JMKC 4KL1A 3U0ZA 4K0KB 2GYRA 4U3JA 1B8MB 4I55A 3BA8A 5J2TA 3K5MA 5HI3A 4DV2B 1FL7B 4AY9A 5CA0A 2YI9A 4DV0B 2PZSA 4EEQA 1B8KA 5BMVB 4DV7B 1HNWB 2VQEB 1ZAUA 4YJ2A 2P22C 2HEPA 2GOOA 4UFZA 3JATA 1HNZB 5GONA 4QCIC 2Q7GA 2C7WA 3HKCB 4IIJB 2UUAB 4LH7A 4ZI7A 1XHZA 4JI8B 3S1KV 5BQCA 1TVKA 4KV5A 4HBNA 4X66B 1BNDA 3SJAC 2GH0C 5HHDA 4FFBA 5JQGA 4DR3B 5LOVB 1FLTV 1KLAA 4TUYB 3S1BV 4O2BB 3B2EE 5EIBD 1TZHV 4HQUA 1N34B 4B3MB 1WQ9A 5HK5A 3U11A 4O4LA 2GNNA 1N33B 1AGQA 4I4TA 3SGIA 3BPZA 1ZKZA 1WWWV 2BTQB 2R72A 3BABA 1DZ7A 5F3HI 4LF6B 3BA9A 3LNNA 1SKVA 1TAEA 5KHJA 1SG1A 1TGOA 5CA1B 5HHCA 2EX3A 4O4JB 3N2GA 5FPOA 1QFWB 1IBLB 1BMPA 4HR9A 4KXZA 4UCOA 2R9AA 2VQFB 5EZYB 1BJ1V 4B08A 5JH7B 4YHHB 4LF5B 2ARVA 4ZBNA 5KHKA 1KLCA 2JVDA 5KMGA 4FLYA 1HCFA 3V6BA 5BQ8D 1JFFA 5HK5E 1HD4A 1AOCA 4BW9A 3RYFA 3RYHB 2QM4A 4X1YA 1XQ8A 1MKKA 3VQXA 3UT5B 4GLSE 4UHYA 4UHZA 2ZINA 3CSXA 3SJCC 4QHUC 4GLXA 4GYCB 3HKDA 4WBNA 1SQFA 2ARPA 1M4UL 4O4IB 1X4TA 4CH5A 3E22A 5LA6B 1HRPB 4UI1A 1D5AA 1IBMB 4EAXA 4EFBA 4DR1B 3BHPA 3RFRA 2BTQA 1M4UA 3JSNA 3JAWA 3ETQA 1QFWA 4AQYB 4JYAB 2QJBA 1KU9A 2RQ6A 5CB4B 4DRXB 1WN7A 1TA8A 1B04A 2F93B 5JVDB 3RWRD 1N32B 4X1IA 1XNQB 3JASA 4D7TA 2YXLA 2JS5A 1G6UA 3QG5A 5EYPA 3WB0A 3N2KA 3RYHA 4LXSJ 2ZCEA 4JI6B 4EB6A 5KX5B 4YJ3A 4MQWB 3A2FA 5FV2V 2Q0AA 4ZHQA 2UXBB 1KMIZ 2ZIMA 2IM9A 3IAYA 2PJYA 4TQDA 1BETA 1XNRB 4O4IA 1Q43A 4JV5B 5BQ8A 5LA6A 1HRPA 5IJ0B 2ZNIA 1V9PA 4FLVA 4ZOLB 5LYJB 5KHGA 2UXDB 1XWDA 3RYIB 4I50B 3CHXA 3OTOB 2E5LB 3VQVA 4DR7B 4XPJA 4OX9B 1REWA 4O2AB 4X20A 5K1PA 5ITZA 2F1MA 4LF4B 2VWJA 4N1DA 4CS4A 2R52A 5E4GA 2F4VB 4B3RB 4TOIA 3MAQA 3SEKB 5LP6B 4DRXA 4JI0B 5JVDA 1M5IA 1TUBB 3K58A 4UCTA 2CAZC 5F3BC 1HW7A 3OTFA 2R70A 4CH3A 1TGKA 4BV4L 4EDXV 2JGUA 4O4HB 3T1HB 1XMOB 2B0UA 5IWAB 5BR8B 3JVFA 1RV6V 1QQCA 1CZ8V 3V2AA 4AILC 4UCVA 3CB2A 1Q5OA 1Z5VA 5EIBC 1B8MA 4HNAB 5IJ0A 1FL7A 4BWAA 5LYJA 4LR3A 5BMVA 4KZNA 4UI0A 4DV3B 5FNVB 3JALB 5LXTB 4I9QA 3BK3A 3K5OA 3VQWA 4O2AA 4JI1B 4LF7B 2ZM6B 4PI2A 3FUBB 1FJGB 3HKCA 4IIJA 5BQEB 1WQ8A 4K8ZA 3DSQA 4LFBB 5JCOA 1KATW 4HQXA 4DUYB 5LOVA 2XHBA 3RYCB 1QTYR 1XI1A 4TUYA 4TV9B 4LFCB 4LFAB 1M93A 1HCNB 4F6RB 1HR0B 4FLTA 4O2BA 1LXIA 4O4HA 1TZIV 3QTKA 1LX5A 4FLZA 3ZS8C 4X62B 4X1KB 4DK0A 5C8YB 4K8XA 4JI2B 1L8DA 2XACA 4MIDA 1Q8IA 4CC6A 3ZEDA 2QJAA 5CA1A 1SA0B 4O4JA 5AEJA 1XHXA 5LXTA 1O9HA 3QB4A 1S5JA 5EZYA 4GKJB 1S4YB 5JH7A 2QCQA 2VPFA 4YCGC 4U3JB 4UCUA 2F95B 1O9GA 4I55B 3HH2A 4B3TB 4LNUB 1WAQA 3KFDA 4AY9B 3BDYV 5CA0B 4FM2A 4DR6B 4DV6B 2X1XE 3E07A 2BHKA 4YCIC 4YJ2B 4DR5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI4 A;  1AGQ A;  1ES7 A;  2TGI A;  4FAO A;  2R52 A;  4GLN E;  5E4G A;  5HHV A;  1ZKZ A;  1WWW V;  5BQB A;  1MJV A;  2X1W A;  3SEK B;  1DZ7 A;  5F3H I;  1FZV A;  2FJG V;  1HCN A;  1SG1 A;  2QR0 C;  5HHC A;  4KXZ A;  4HR9 A;  1QFW B;  1BMP A;  5F3B C;  1BND B;  1KTZ A;  1BJ1 V;  5BQ8 B;  2P6A A;  5FV1 V;  1TGK A;  2ARV A;  2QJ9 A;  4BV4 L;  4ZBN A;  1TFG A;  1KLC A;  1MKG A;  5BQE A;  4EDX V;  1E9J A;  4EC7 A;  1XWD B;  2ASK A;  3B4V A;  1NYS B;  2V5E B;  1B98 A;  3BUK A;  1HCF A;  3V6B A;  5BQ8 D;  2B0U A;  3JVF A;  3BMP A;  5HK5 E;  1RV6 V;  3MJG A;  1HD4 A;  1AOC A;  1CZ8 V;  3MJK A;  5HK5 A;  3V2A A;  1REU A;  1WQ9 B;  1VPF A;  1B8M A;  1MKK A;  4UI2 B;  4QAF C;  4GLS E;  1FL7 A;  4UHY A;  4MPL A;  4ZFF C;  4UHZ A;  4QHU C;  4KZN A;  4UI0 A;  4EDW V;  5JZ7 A;  2VXS A;  2ARP A;  3EVS B;  1M4U L;  3BK3 A;  1HRP B;  4UI1 A;  3RJR A;  3FUB B;  4MQW A;  4EAX A;  1JPY A;  5BQE B;  1NT3 A;  1VPP V;  1M4U A;  1SGF B;  1WQ8 A;  1NYU B;  2IFG E;  5HHX A;  3EO1 C;  1PDG A;  1QFW A;  4X1J A;  4HSA A;  1KAT W;  2GYR A;  4HQX A;  1B8M B;  2QJB A;  2R53 A;  1QTY R;  2H62 A;  5HI3 A;  1FL7 B;  4AY9 A;  1B8K A;  1HCN B;  4LXR J;  1LXI A;  1TZI V;  3QTK A;  1BTG A;  4WPB A;  2XV7 A;  1LX5 A;  2GOO A;  2XAC A;  2FJH V;  4LXS J;  4MID A;  4QCI C;  4MQW B;  2C7W A;  5FV2 V;  4EFV A;  5BPU A;  2QJA A;  2IM9 A;  1TGJ A;  2PJY A;  3S1K V;  5BQC A;  4KV5 A;  1BET A;  2VWE A;  3IJ2 A;  5AEJ A;  1BND A;  2H64 A;  3QB4 A;  2GH0 C;  2GYZ A;  2KD3 A;  1S4Y B;  5BQ8 A;  2QCQ A;  5HHD A;  2VPF A;  4YCG C;  1HRP A;  1FLT V;  1KLA A;  3HH2 A;  3S1B V;  1WAQ A;  1XWD A;  3KFD A;  4AY9 B;  3BDY V;  3P9W A;  5HI5 A;  2QCW A;  1TZH V;  4HQU A;  4XPJ A;  2X1X E;  1REW A;  1WQ9 A;  3E07 A;  2BHK A;  4YCI C;  2GNN A;  4N1D A; 
#chains in the Genus database with same CATH topology
 1L1F A;  4Z1M G;  3RYC A;  1H2G A;  1OCO B;  3J7A U;  3CC7 V;  5CN0 A;  5IY5 B;  3VQY A;  2IH3 C;  2Q68 A;  3D36 A;  1HCN A;  3CRC A;  1FFX B;  1K5S A;  4PHZ A;  5C8Y A;  4LF9 O;  3L72 H;  2WA4 A;  5IJ9 B;  4XDK A;  1T5E A;  4X64 O;  1JVM A;  5A9G A;  3IJ4 A;  1OCC B;  2M7W A;  3JAR B;  4GX5 A;  4MVU A;  4LF8 B;  1WNS A;  1AR1 B;  1HWY A;  1VPF A;  4I4T B;  2XUM A;  1VF6 C;  4DV4 B;  4G27 B;  2QR4 A;  1EN5 A;  1U97 A;  5LMU O;  2LW1 A;  1NJI W;  3E89 A;  3CCJ V;  3ABM C;  3G4S V;  4JI5 O;  3ASN B;  1SQG A;  4DV5 O;  4DK1 A;  1I7F A;  2DW4 A;  4NXN B;  4BIO A;  4FLX A;  5KUM A;  1B6Q A;  3JAK A;  4GX0 A;  5EBM C;  1E1R G;  3TXS A;  3OEH G;  2IFG E;  1Q81 W;  1PDG A;  2XT9 A;  2V4D A;  4X88 A;  3ZMT A;  4FLU A;  1IBK B;  3KZI Z;  4N23 A;  4ZOL A;  1YEW A;  1NVP B;  2N74 A;  5JWP A;  2Q4P A;  2ZR3 A;  3ZRS A;  4WBN B;  4WPB A;  3HKE A;  2DOS A;  1M9N A;  3L74 H;  4MTX A;  2KKW A;  2A0L A;  4WCE V;  4JI8 O;  1W2B U;  2ZE5 A;  2CTR A;  2GHY A;  2Z5U A;  5BPU A;  4P2Z A;  1TUB A;  2VWK A;  4YIO A;  2QJ1 A;  3C90 A;  4DUZ B;  4FM1 A;  5HFL A;  3SYC A;  2VWE A;  4PA6 A;  4UXN A;  1X59 A;  2GYZ A;  3FB6 C;  4JZ2 A;  3WG7 B;  2IJH A;  1S72 V;  1BMF G;  2PY5 A;  4LWS A;  2WWW A;  4KUM A;  5DN6 G;  4UCR A;  4FAO A;  1ES7 A;  4HNA A;  3WFV A;  1M56 C;  4YJ3 B;  3AG7 A;  1K92 A;  1J5E B;  1MJV A;  2K1E A;  3L9D A;  3CJH B;  1E79 G;  4YHH O;  3JAL A;  4NXM B;  4LF5 O;  1ZX3 A;  1B06 A;  3JD4 A;  2OIE A;  3JD0 A;  2E76 B;  2JJ1 G;  1G4Y B;  5J2T B;  4JYB A;  3UQ8 A;  5B1N A;  4GKK B;  5BQE A;  3MHH C;  2AZ0 A;  1XWD B;  3CRQ A;  2YID A;  1HNX B;  1N8R W;  3ZHV A;  4L8J A;  3JAT B;  3UKM A;  1BL8 A;  3TK1 A;  1FXK C;  5GW7 A;  3RGB A;  4EDW V;  5JZ7 A;  3K04 A;  1VF7 A;  5BZB A;  1VQ8 V;  5K1X A;  4MVM A;  4H13 B;  4UCS A;  2CUG A;  2Q7E A;  3RT3 C;  4LH6 A;  4DV1 B;  5JCO C;  4B7K A;  4H33 A;  1K4C C;  4FM0 A;  4HAM A;  3EO1 C;  1FYJ A;  2Y48 A;  4R8C A;  4KL1 A;  1N32 O;  2UXX A;  1EFR G;  2GYR A;  4U3J A;  1B8M B;  1BT8 A;  3BA8 A;  5HI3 A;  2CDY A;  1I08 A;  2PZS A;  1OZ0 A;  5B5E Z;  2IH1 C;  1HNW B;  4KXR A;  2DQ0 A;  1GN2 A;  1YSC A;  5CMU A;  1VQ9 V;  1Y6X A;  4MS2 A;  1SQB H;  4ZI7 A;  5BQC A;  4I0X B;  4IYI A;  3W7T A;  1I0H A;  2KSD A;  3E35 A;  3CYO A;  3OTO O;  3S1B V;  2ETN A;  4CBC A;  2LFR A;  3B2E E;  1AIL A;  4HQU A;  3ABM B;  4B3R O;  3A0H Z;  2QKS A;  4WFG A;  3SGI A;  3OAA G;  1ZKZ A;  1WWW V;  1GTO A;  2NNU A;  2A06 H;  4LF6 B;  1XL6 A;  4HR9 A;  2QKC A;  4D6T H;  2QDO A;  2AHZ A;  3BVO A;  2R9A A;  4PA4 A;  1BJ1 V;  4MVS A;  4B08 A;  1QNM A;  1XMO O;  4ZBN A;  4MSW C;  1KLC A;  1Q90 D;  2JVD A;  5KMG A;  4FLY A;  3V6B A;  1JFF A;  5HK5 E;  1HD4 A;  2QGN A;  2YSU B;  1CP9 A;  1FPO A;  3RYF A;  1Y76 B;  4X1Y A;  2ODM A;  4UHY A;  2ZIN A;  1K33 A;  4TT3 G;  3B8N A;  4JI1 O;  1R3L C;  1SQF A;  2YEV B;  1M4U L;  1X4T A;  3QVN A;  3S3X A;  3K0G A;  3STL C;  1RP3 B;  4UI1 A;  4ZBM A;  1D5A A;  1AP6 A;  4EFB A;  4DR5 B;  2LGW A;  3MD0 A;  5IYC O;  3K0D A;  4X89 A;  3JSN A;  1R6T A;  3FYI B;  3JAW A;  4N21 A;  2VRZ A;  4LFC O;  1CXZ B;  4YXW G;  3AG2 C;  3TGU H;  1BHB A;  1GN4 A;  1YXB A;  2EJR A;  1LUW A;  1WN7 A;  1TA8 A;  5JVD B;  1M56 B;  3K06 A;  4H0L B;  1ENV A;  1EM1 A;  1XNQ B;  2JS5 A;  3ZCC A;  3QG5 A;  3WB0 A;  2EJ7 A;  3OEE G;  1BS3 A;  3I5D A;  2ZCE A;  4JI6 B;  2RDC A;  5KX5 B;  1K73 W;  1DF4 A;  1FXH A;  1WB7 A;  1KMI Z;  4GKJ O;  4QPJ A;  1VQP V;  5H5N A;  1BET A;  3O65 A;  4B3T O;  4WF9 V;  1K3E A;  3G6E V;  4JV5 B;  4I7Z B;  5LA6 A;  1HRP A;  1PPJ H;  2HJF C;  3RYI B;  1FXK B;  4X20 A;  5L3C A;  3G80 A;  1MMM A;  2F1M A;  4NYK A;  3TJT A;  2VWJ A;  2OTL V;  2P7T C;  2WLK A;  2FB5 A;  5E4G A;  5IE9 A;  4JI0 B;  1RPR A;  1IXB A;  4WFF A;  1H8H G;  1FD9 A;  2GBO A;  4K35 A;  3OTF A;  2W6J G;  2YDE A;  4CH3 A;  1TGK A;  4O4H B;  5IYD O;  2ADP A;  5BR8 B;  4X9Q A;  1RV6 V;  5LHI A;  1XEQ A;  1PP9 H;  4UCV A;  3CB2 A;  1Q5O A;  1Z5V A;  1SES A;  1XMQ O;  2QKA A;  5B66 Z;  5IJ0 A;  2YC0 A;  4BWA A;  4DR2 O;  3F5T A;  1BHA A;  4LR3 A;  1F23 A;  4B3S O;  1YIT V;  5FNV B;  3P30 A;  3Q4H B;  1YVW A;  3OUS A;  3E8G A;  3K9A A;  2ZM6 B;  3FUB B;  2DYS C;  1SZX A;  1M90 W;  4IIJ A;  4UUJ C;  2QA4 V;  1WQ8 A;  4K8Z A;  1PD3 A;  3ABK C;  2FL4 A;  1P7B A;  2HHH O;  3ZIA G;  1GKF A;  1KAT W;  1WPX A;  4JI4 O;  4TUY A;  4TV9 B;  4LFA B;  3OR6 C;  2CTP A;  4FZ0 A;  4LCU C;  2WA3 A;  4UB6 Z;  4X1K B;  4DK0 A;  4K8X A;  3L70 H;  4BW5 A;  2GTA A;  2NLJ C;  1KQS U;  4LBE C;  3CCQ V;  4YY3 O;  4J9Z B;  5CA1 A;  2P6J A;  2B5U A;  2LQT A;  3QB4 A;  5EZY A;  1S4Y B;  5JH7 A;  3CCU V;  4KHP O;  4TSF G;  4I55 B;  2EIM C;  3KFD A;  4AY9 B;  4FM2 A;  3W7W A;  2BSK A;  1YHQ V;  4BR6 A;  4DR6 B;  2HVK C;  3G71 V;  1VQ6 V;  2EIN C;  1WA8 A;  4GLN E;  5HHV A;  4AHC A;  5JJJ B;  1Q82 W;  1WJZ A;  3I55 V;  4F6R A;  4MTO A;  1ZLZ A;  1LNQ A;  1E1Q G;  1QLE C;  3EVK A;  2HJD A;  1NZ6 A;  3EXA A;  4JPR A;  4DR4 B;  3QTC A;  1PV0 A;  2Y0I A;  5JQG B;  4J11 A;  5LMN B;  2P6A A;  3AG2 B;  1RFY A;  2UXC B;  3M7M X;  2WLI B;  5C93 A;  3BUK A;  3H1J H;  5B1B B;  3MJG A;  3MJK A;  4MW3 A;  1WQ9 B;  1ZL8 B;  1EZJ A;  1YTF B;  2F66 C;  1VF5 B;  3CRM A;  1SRY A;  3SYA A;  2VXS A;  2L6L A;  2RCV A;  3EVS B;  2CTQ A;  1MAB G;  2P90 A;  2GSM B;  1DGS A;  1WP8 A;  3RJR A;  2X6A A;  3ZMZ A;  3KG2 A;  3JAM N;  4X65 B;  1VPP V;  1R3I C;  4K0K O;  5HHX A;  1FFX A;  3T1Y B;  3E8F A;  2IBZ H;  4HSA A;  1ZWI C;  4CS2 A;  2R53 A;  1R3J C;  2ZQM A;  5IJ9 A;  2H62 A;  2MW2 B;  3ML0 A;  4I50 A;  4EFE A;  3F7Y C;  3CX5 F;  4OPH A;  1R6N A;  4LXR J;  3HKD B;  2XAH A;  1BTG A;  1YI2 V;  2XV7 A;  1K5Q A;  3K9S A;  1EZV H;  1WPB A;  3ICX A;  3JAR A;  3E22 B;  4LP8 A;  1AI6 A;  3OM3 B;  1OHH G;  5JJN B;  3D36 C;  1PM9 A;  1H8E G;  4QNH B;  4GZR B;  4DR3 O;  2KG7 A;  1Y74 A;  3JD3 A;  2KD3 A;  2OT5 A;  4JYY A;  5J2U B;  3HKB B;  4E4E A;  2W0X A;  2X7R B;  1N34 O;  2WLM A;  5JJE B;  3AG3 B;  2EZO A;  4ABM A;  2BTO A;  3QF7 A;  1OCZ C;  4FPP A;  2UUB B;  3CE2 A;  3N2K B;  4RQE A;  5HI4 A;  3CWB H;  4EB6 B;  1Y66 A;  5BQB A;  1I94 B;  2X1W A;  1IBL O;  2DYS B;  3BAA A;  1IXM A;  1XDC A;  1NKD A;  3ABK B;  3SJB C;  3ETG A;  5KHI A;  2ZE8 A;  1K34 A;  2YI8 A;  5FL7 G;  5IYB O;  1Q3E A;  1E9J A;  3K57 A;  3FD9 A;  4Z2W A;  4UVA A;  4EC7 A;  3UO2 A;  3B4V A;  5KHH A;  4LF9 B;  2IJK A;  3FFQ A;  4R50 A;  4X64 B;  1REU A;  5ITZ B;  1AR4 A;  3L73 H;  5GON B;  1V54 C;  4MVZ A;  5CBF A;  2ADQ B;  2AHY A;  1IBM O;  2LGQ A;  1Z5W A;  5LMU B;  4DR1 O;  4FFB B;  3WB1 A;  4ICG A;  3DC6 A;  2HR3 A;  2O57 A;  3AK2 A;  4JI5 B;  2XOK G;  4DV5 B;  1SET A;  4J9Y B;  4FLW A;  2EIM B;  2JRI A;  1SGF B;  1SA0 A;  3STZ C;  3CJH A;  3WU2 Z;  4CC5 A;  4O4L B;  2VS0 A;  1S0V A;  3JD2 A;  2Q8V A;  3ZRV A;  4R6Z A;  3E8H A;  3CXH F;  5J2T A;  5DED A;  2OCH A;  1B8K A;  3BY6 A;  2WLN A;  4BIU A;  4G28 B;  4YJ2 A;  4NTW A;  1QLE B;  2P22 C;  2HEP A;  3DGE A;  4TWK A;  3JAT A;  3CRR A;  2Z0A A;  1K97 A;  2G38 A;  1XNR O;  2V1D A;  4JYC A;  1NH2 D;  4JI8 B;  3S1K V;  3CCV V;  4KV5 A;  4F6E A;  3T4D A;  5IT9 N;  1BND A;  2Z3Y A;  2GH0 C;  5KLV H;  4NTY A;  2CGO A;  5LOV B;  1HDJ A;  3FX7 A;  2F23 A;  4JTD B;  1COW G;  4DR7 O;  4OX9 O;  1HP8 A;  4LF4 O;  4O2B B;  1TZH V;  3KKY A;  2A79 B;  2GNN A;  1XUQ A;  1K9M W;  3ABL C;  2A9H A;  2Q0O C;  1P84 F;  3BPZ A;  1SS3 A;  1ORQ C;  2BTQ B;  5H6Q A;  1QU7 A;  1DZ7 A;  3BA9 A;  1SKV A;  5KHJ A;  5HHC A;  2EX3 A;  4KXZ A;  3N2G A;  5FPO A;  3D3I A;  1N0N A;  5B1O A;  4YHH B;  3T1H O;  2WLL B;  4JTA B;  5IWA O;  4LF5 B;  3QNE A;  3ZHQ A;  1LUV A;  1XOU A;  3CEI A;  1HCF A;  5BQ8 D;  1G8M A;  3RW0 A;  1QR8 A;  4GUN A;  3RYH B;  2Y0P A;  4W4L A;  1XQ8 A;  1MKK A;  3VQX A;  2WLJ A;  2ZE6 A;  4J7Z A;  4DV3 O;  1SZT A;  3ASO C;  2JJ2 G;  4UHZ A;  4Q20 A;  3CSX A;  3SJC C;  2ZD9 A;  2Q6A A;  4LF7 O;  3JCZ A;  4GYC B;  1FJG O;  1FKA O;  4XDL A;  3SDL A;  1AJQ A;  2W0F C;  1OV9 A;  3CP1 A;  2Q67 A;  1D2D A;  2N05 A;  1NR1 A;  4LFB O;  1MSW D;  3OMI B;  2BE3 A;  1L0N H;  3LSS A;  1OCZ B;  1HR0 O;  5IDJ A;  1KU9 A;  1NU1 H;  4JTC B;  4DRX B;  1B04 A;  1N32 B;  4X62 O;  1DTO A;  1GMG A;  4F4L A;  4X1I A;  4JI2 O;  3JAS A;  4D7T A;  5L3F A;  4KP4 A;  4C7U A;  3D8C A;  5EYP A;  3QO7 A;  1R3K C;  2RNB A;  4Z1V A;  1BZK A;  4QGP A;  5CBH A;  1Q86 W;  1PNL A;  1ARO P;  1M1K W;  3A2F A;  2Q0A A;  4ZHQ A;  3FB8 C;  2IM9 A;  3IAY A;  2PJY A;  4NB5 A;  5LHH A;  1VQM V;  2LJ2 A;  4QIW F;  2NN4 A;  2IJI A;  3A0R A;  5BQ8 A;  4UVB A;  3DXR A;  1IX9 A;  3TXQ A;  1V9P A;  4DV6 O;  1V54 B;  4ZOL B;  3SYO A;  5KHG A;  4FJC C;  3ABT A;  2D2C B;  2QWO B;  3OTO B;  3EHB B;  4N1D A;  4CS4 A;  1DK1 A;  4B3R B;  2XAJ A;  1RPO A;  5JVD A;  1TUB B;  2GDS A;  1KC8 W;  4PDR A;  3BEH A;  1VQ7 V;  4PDV A;  1HW7 A;  2R70 A;  4EDX V;  1CPY A;  4LWS B;  1XMO B;  2NR5 A;  1QQC A;  4X8A A;  2UUC O;  1NTZ H;  2UU9 O;  1WAZ A;  2JIZ G;  4HNA B;  2FML A;  1AI4 A;  1FL7 A;  2R9I A;  2EIJ C;  2EUL A;  5BMV A;  4KZN A;  3ZJZ A;  3JAL B;  2ZDI A;  3K5O A;  3VQW A;  3LDC A;  4JI1 B;  4UV9 A;  5KAF Z;  4J10 A;  1EBO A;  3HKC A;  5LGN A;  5BQE B;  1M57 C;  2WPD G;  3JD1 A;  1ROP A;  4PA3 A;  5EK0 A;  4RUF A;  3F7V C;  1FXV A;  5JCO A;  2XHB A;  1QTY R;  3ABL B;  2ZE7 A;  2YUA A;  2H3O A;  3O9O A;  4NTX A;  3CMA V;  4LFC B;  4NR1 A;  4O4H A;  1GM8 A;  3QTK A;  1VQO V;  1LX5 A;  4FLZ A;  3P3N A;  4WFA V;  1L8D A;  2DJV A;  3F5W C;  5A2Q N;  3FAV B;  4U3F H;  3X2Q C;  5EBW C;  2H8P C;  4MVO A;  4PA9 A;  4JI7 O;  4O4J A;  3CD6 V;  2XAF A;  5AEJ A;  3Q4H A;  1O9H A;  1S5J A;  4GKJ B;  2QCQ A;  3SPG A;  1L0L H;  2ITC C;  4IGG A;  4U3J B;  2JGD B;  2VPF A;  1KEC A;  4JI3 O;  4YCG C;  2K9P A;  3CCL V;  1GAX A;  4B3T B;  4LNU B;  1GM9 A;  3ASO B;  4MTG A;  1NR7 A;  4UB8 Z;  4TV8 B;  3UT5 A;  1R1B A;  2ITD C;  4PDL A;  4WFE A;  1JOY A;  4ZI7 B;  1Q7Y W;  1F4M A;  1JPX A;  4J7J A;  1SER A;  5L3B A;  2Y69 C;  3P3P A;  1W0J G;  2E75 B;  4X1K A;  4NVP A;  4DW0 A;  5LGT A;  1S5L Z;  1NBM G;  3CXC U;  3BMP A;  1MOF A;  4PI0 A;  2CE4 A;  2DYR C;  4ZKI A;  4JGS A;  1N36 O;  2KQX A;  1BCC H;  4UI2 B;  4IHJ B;  4OXS A;  5CB4 A;  4QAF C;  1YJN V;  5IYZ B;  1XMQ B;  2P5O A;  3FKS G;  3SR2 C;  5D5P A;  3ZRW B;  3CCS V;  3IC7 A;  4DR2 B;  5L3G A;  3THO A;  3CCR V;  3MHS C;  3SPJ A;  1VIB A;  4B3S B;  2ZXW C;  4MQW A;  2RJZ A;  2E3C A;  1KBH A;  1JCH A;  1QVF U;  5KMG B;  4GCZ A;  3CC4 V;  1NYU B;  1JFF B;  3RYF B;  2QWQ B;  4L87 A;  4DV2 O;  3E2E A;  4X1J A;  4P30 A;  4DV0 O;  4X1Y B;  5B3S C;  4RWU A;  4DV7 O;  1OJH A;  2GUZ B;  5AG2 A;  1QVG U;  2HHH B;  2PI5 A;  2HG5 C;  3N27 A;  3U10 A;  2PUS A;  4JI4 B;  1HNZ O;  4GT1 A;  5BXZ A;  3JYC A;  2UUA O;  1ZL8 A;  2N04 A;  2FJH V;  4RAI A;  3RN4 A;  5LP6 A;  2B9Z A;  4X66 O;  1JX9 A;  5KA6 A;  3JAW B;  3S3W A;  1KD1 W;  4YY3 B;  5H6R A;  5GTH Z;  4JF3 A;  4B3M O;  4KHP B;  1LR1 A;  2ZNJ A;  2YIB D;  1N33 O;  2EIJ B;  1R6K A;  2AXT Z;  2OYQ A;  2ZIO A;  2FTK A;  5FPR A;  1K7D A;  3H9V A;  3UM7 A;  2HLD G;  2CH7 A;  4J41 A;  3K3W A;  1U96 A;  1N0J A;  1EN6 A;  1RSO A;  1WP7 A;  1PNK A;  4FVM A;  3UCS C;  3ZHR A;  2VQF O;  1NT2 B;  1FZV A;  2FJG V;  1M57 B;  2QR0 C;  4I5S A;  4Q6G A;  1KKD A;  3G67 A;  4MVQ A;  1H38 A;  1THZ A;  1OCO C;  2ASK A;  1NYS B;  1B98 A;  1MA1 A;  2PYL A;  3ETE A;  4TQF A;  3T1C A;  5B1A C;  4PDM A;  4X20 B;  2L35 A;  1VQL V;  1YCI A;  1MG1 A;  4GX2 A;  5J2U A;  2XAS A;  3HKB A;  5BY1 A;  4JAV A;  4ZFF C;  3SPI A;  2OCC C;  4KFM A;  3HB3 B;  1IVS A;  3X2Q B;  3M8A A;  1TVK B;  1VMG A;  2P4K A;  2A3Q A;  3LSU A;  1PNM A;  1W59 A;  1EN4 A;  3DTU B;  5LGU A;  3RVZ A;  1R73 A;  5H2F Z;  4AQY O;  4D7S A;  3BRC A;  2OWO A;  1AI7 A;  3J81 N;  4JYA O;  4OGQ B;  3VOU A;  1P7G A;  3OGC C;  2YIB A;  1JMK C;  4K0K B;  2OTJ V;  3I56 V;  3CS5 A;  3K5M A;  1GM7 A;  5CA0 A;  2YI9 A;  4DYL A;  1FS0 G;  3D3Q A;  2VQE B;  1ZAU A;  1NVP D;  2QTS A;  2Y69 B;  2UXB O;  2JDI G;  3L75 H;  4J80 A;  4UFZ A;  5GON A;  2C7W A;  4IIJ B;  2HVJ C;  1KYO F;  2ARH A;  3H1H H;  4HBN A;  1Y4M A;  3ZHU A;  2UXD O;  2DYR B;  5HHD A;  4FFB A;  1JA8 A;  4DR3 B;  1KLA A;  2VQE O;  2E5L O;  1PL0 A;  4TUY B;  2LO1 A;  3B4S A;  1A32 A;  3OD4 A;  1BSM A;  1VQK V;  3OUF A;  5EIB D;  2F4V O;  1N34 B;  3LDD A;  5HK5 A;  3U11 A;  4O4L A;  1AGQ A;  3G6B A;  4I4T A;  2AGA A;  3NXS A;  3GWK C;  1IDS A;  3BAB A;  3CC2 V;  5F3H I;  1S76 D;  3LNN A;  1TAE A;  1SG1 A;  5CA1 B;  1QFW B;  1AP5 A;  1IBL B;  2WLH A;  1BMP A;  4UCO A;  1G1X B;  1NTK H;  5EZY B;  5JH7 B;  3VBB A;  3A8T A;  1NQT A;  5EC1 C;  5B3S B;  5KHK A;  2GTS A;  2QWR B;  1GH6 A;  4JAA A;  3MDS A;  1YJW V;  3ZN1 A;  1ZSP A;  3K79 A;  1OCR C;  4IL6 Z;  2M6Y A;  4FMT A;  4GLX A;  3L71 H;  4WBN A;  3C3S A;  4O4I B;  3C3T A;  4JZG A;  1IBM B;  3PJS K;  4GX1 A;  4DR1 B;  2YXY A;  3BHP A;  2BTQ A;  2IU0 A;  1GK9 A;  2P06 A;  1PL4 A;  4DUY O;  2DWE C;  2ZR2 A;  3ETQ A;  1AR5 A;  4IYH A;  2WSS G;  4NKG B;  2QJB A;  1I5Y A;  3E83 A;  2RQ6 A;  2WLL A;  4I9W A;  4MW8 A;  2H94 A;  1P4R A;  3IC9 A;  2F93 B;  3RWR D;  3FB5 C;  3ZMU A;  1UPG A;  1G6U A;  1US6 A;  3RYH A;  3SPH A;  4YJ3 A;  2EIL C;  5FV2 V;  3APQ A;  4FIP C;  1J95 A;  4TQD A;  5B1A B;  4DXW A;  1XNR B;  1Q43 A;  2EIN B;  4FLV A;  1AI5 A;  1RM1 C;  5LYJ B;  4PA7 A;  1XWD A;  4I50 B;  1XBL A;  3AG4 C;  4DR5 O;  2OCC B;  3VQV A;  4DR7 B;  4XPJ A;  4OX9 B;  1REW A;  4O2A B;  5K1P A;  4LF4 B;  3R65 A;  3T4Z A;  2DN9 A;  3IFX A;  4DRX A;  2F43 G;  3OR7 C;  2KG7 B;  2D3O W;  5F3B C;  1Y74 B;  3J80 N;  4PV1 B;  1VAR A;  1MZE A;  3T1H B;  4LF8 O;  2DWD C;  5IWA B;  3H01 A;  3JVF A;  1F51 A;  1QLN A;  4DV4 O;  3V2A A;  1DF5 A;  3OFN G;  4AIL C;  1SQQ H;  4P9O A;  1B8M A;  4OPA A;  3AG1 C;  1V55 C;  3ZMS A;  1S3J A;  1GN6 A;  3SJQ C;  1BGY H;  4DV3 B;  5LXT B;  3B8M A;  3EFF K;  3BK3 A;  2BCC H;  1FAF A;  1S5H C;  4NXN O;  1BQ0 A;  3W7S A;  4LF7 B;  4PI2 A;  1FJG B;  2EIK C;  4PEL A;  4DO2 A;  2BOC C;  1IBK O;  3E8B A;  2XAQ A;  3DSQ A;  2ZKO A;  4LFB B;  4IT5 A;  4I0X A;  2CGN A;  3E86 A;  3RYC B;  1XI1 A;  3NR7 A;  4HZ3 A;  1VF6 A;  3OW2 U;  1Y67 A;  1HCN B;  5H9C A;  1HR0 B;  4FLT A;  1LXI A;  1TZI V;  5GTI Z;  3ZS8 C;  4X62 B;  5C8Y B;  4JI2 B;  2XAC A;  2MK3 A;  4FFK A;  3TCU A;  3A0B Z;  4DUZ O;  2XTA A;  3K03 A;  1VP7 A;  1SA0 B;  2EBO A;  1QCE A;  1XHX A;  2QWN B;  4UCU A;  1KKC A;  1WAQ A;  1OCR B;  5KAI Z;  1MSD A;  1F4N A;  4DV6 B;  2X1X E;  3E07 A;  2BHK A;  3APO A;  3SYP A;  4YJ2 B;  1J5E O;  1Y76 A;  2TGI A;  1PKX A;  4NXM O;  3OE7 G;  2JEX A;  3JAK B;  3LUT B;  4H44 B;  2Q69 A;  2ZDI C;  4DW1 A;  1AJN A;  3P32 A;  2YEV A;  4U7O A;  2JEU A;  2Y4U A;  4GKK O;  1BND B;  1AB3 A;  4FK5 C;  1HNX O;  3JCU Z;  3FAV A;  1MKG A;  1GO3 F;  3HKE B;  1JJO A;  2FYU H;  2Y4T A;  2B1G A;  4UVC A;  1F7Y A;  4AI8 A;  1YDX A;  2JGD A;  2UUC B;  2Q7H A;  1TUE B;  4LNU A;  2EIL B;  5L3D A;  2UU9 B;  3ZHT A;  1BE3 H;  3N2G B;  1N4C A;  4CZZ A;  2V7Q G;  4DV1 O;  5KX5 A;  3B77 A;  4TV8 A;  1JPY A;  1NT3 A;  1RM1 B;  2FKX A;  4CH6 A;  3AG4 B;  1P49 A;  3WB2 A;  5L3E A;  3PN1 A;  3H1L H;  2BOB C;  4MVR A;  3K5L A;  2GV9 A;  5DM6 V;  1HNW O;  3RYI A;  2R9R B;  1FXK A;  5FLX N;  3ABU A;  1QHT A;  2PTM A;  1H2S B;  2QTO A;  2LW7 A;  2ILM A;  3OMN B;  1NH2 B;  4CH4 A;  4IHJ A;  3JSL A;  4R7C A;  2W6I G;  3OGI B;  5D5Q A;  4EFV A;  5IYZ A;  5LL6 Y;  1TGJ A;  3RVY A;  2X6B A;  2QM8 A;  2HP8 A;  3IJ2 A;  3ZRW A;  2H64 A;  4A5U B;  1BQZ A;  4JI7 B;  1XRE A;  2HFE C;  4K3A A;  3BCC H;  2PYJ A;  3AG1 B;  1V55 B;  3P9W A;  5HI5 A;  4X1I B;  4JI3 B;  2QCW A;  3JAS B;  3AEI A;  4HYO A;  5EYP B;  2CTW A;  2CK3 G;  5TIS Z;  4LF6 O;  1YIJ V;  2GUZ A;  2AW9 A;  4QE7 A;  5LHG A;  4ZHQ B;  1QBZ A;  4CS3 A;  2EIK B;  5FNV A;  1URF A;  2QSA A;  2XND G;  4FZ1 A;  5HFM A;  2PGG A;  4XDJ A;  5LBQ A;  1KTZ A;  5BQ8 B;  3DXR B;  5FV1 V;  2QJ9 A;  5DEC A;  1TFG A;  1CEZ A;  2V5E B;  1QR9 A;  1DLB A;  2QEX V;  3W7X A;  1VQ4 V;  2X6C A;  5CBG A;  3K59 A;  1NI8 A;  4TV9 A;  1N36 B;  4MPL A;  3OT7 A;  3DC5 A;  3KCY A;  1GRJ A;  5B1B C;  2IU3 A;  4ZIB A;  1FFT B;  1H2L A;  3K5N A;  2PF4 E;  3CPW U;  1YTF D;  5LP6 C;  2YXH A;  5CA3 A;  5E1A C;  5EC2 C;  4ASU G;  1W0K G;  4EKW A;  2YIA A;  3U0Z A;  3ZMV A;  5E79 Z;  1XNQ O;  4I55 A;  4MT8 A;  3BFR A;  3RBZ A;  4DV2 B;  1ZTE A;  1FL7 B;  4AY9 A;  3AK1 A;  4DV0 B;  4EEQ A;  5BMV B;  1S77 D;  4DV7 B;  2DQ3 A;  3GWO A;  1KUQ A;  5F2V O;  4JI6 O;  1WLE A;  4LC1 A;  2GOO A;  1NS1 A;  2XAG A;  3GVM A;  1HNZ B;  4QCI C;  2Q7G A;  3FB7 C;  1Q6H A;  3HKC B;  3CCM V;  2UUA B;  3LNM B;  3OMA B;  4LH7 A;  5KA5 A;  4JV5 O;  1XHZ A;  1TVK A;  2QE7 G;  3R66 A;  4X66 B;  3SJA C;  5JQG A;  1AVM A;  1FLT V;  4U7N A;  2Q5Z A;  2WLI A;  4J42 A;  1SF9 A;  4B3M B;  3B09 A;  4G2K A;  1WQ9 A;  1N33 B;  4JI0 O;  2LP7 A;  1SQP H;  3SPC A;  2P4V A;  1B3Q A;  2R72 A;  2P67 A;  2UXN A;  1TGO A;  3AG3 C;  4O4J B;  2Q73 A;  2VQF B;  1Q6U A;  5BR8 O;  2ARV A;  2IW5 A;  1IUR A;  4UV8 A;  4PJ0 Z;  2QM7 A;  1H2N A;  1AOC A;  2WAM A;  2JS3 A;  4RO2 A;  4BW9 A;  1SQX H;  2OIG A;  2ZT9 B;  2X0L A;  2QM4 A;  3CCE V;  1H2K A;  2IJJ A;  3UT5 B;  4GLS E;  4QHU C;  3CRA A;  3HKD A;  2B1I A;  2ZM6 O;  2DE0 X;  3SYQ A;  2ARP A;  4CH5 A;  4WFH A;  3E22 A;  5LA6 B;  1HRP B;  1SQV H;  1ZUQ A;  3CME V;  4EAX A;  1KP2 A;  1Z2G A;  5IY5 C;  3RFR A;  4YIP A;  1M4U A;  2ATK C;  2A7W A;  2EZP A;  1MZF A;  1KB9 F;  1QFW A;  4MTF A;  1JJ2 U;  3QO8 A;  4LFA O;  4AQY B;  3ZN0 A;  4QJF B;  4JYA B;  1UJW B;  5CB4 B;  4E2L A;  3M99 B;  3LDE A;  1OCC C;  2YXL A;  1K4D C;  1D5N A;  3N2K A;  3KCX A;  4LXS J;  4EB6 A;  4MQW B;  4P9P A;  4QE9 A;  2UXB B;  2ZIM A;  3UO3 A;  3ASN C;  3ZHS A;  2AZ2 A;  3GB7 C;  1YZB A;  3K08 A;  4O4I A;  3W7U A;  5IJ0 B;  2ZNI A;  3B40 A;  4DR6 O;  2UXD B;  4RUE A;  1I5X A;  3CHX A;  4WFB V;  2E5L B;  3ZRX A;  5ITZ A;  1H2M A;  1WB8 A;  1KP3 A;  1UFI A;  2R52 A;  2F4V B;  3QO5 A;  1VQ5 V;  4TOI A;  3MAQ A;  3SEK B;  5LP6 B;  4DR4 O;  4H37 A;  4JAU A;  1M5I A;  5LMN O;  1AJP A;  3K58 A;  4UCT A;  3TET A;  2CAZ C;  1GN3 A;  1VQN V;  3LSQ A;  2UXC O;  1XIL A;  1YJ9 V;  3HR0 A;  4PD4 F;  4BV4 L;  2Q9L A;  2HKO A;  2JGU A;  2B0U A;  1CZ8 V;  5J9P C;  1Q6I A;  1VEW A;  5EIB C;  2YS8 A;  3WG7 C;  2ZXW B;  4JAS A;  2CH7 B;  1RSO B;  2RMK B;  5LYJ A;  1IZ3 A;  1YF2 A;  4UI0 A;  4I9Q A;  4O2A A;  5KUK A;  4X65 O;  1NTM H;  1XL4 A;  3H1I H;  3T1Y O;  2BSK B;  3ZBH A;  2E74 B;  4BAY A;  1WA8 B;  3AK3 A;  2RN9 A;  2YIC A;  4HQX A;  4DUY B;  5LOV A;  4RQF A;  4QPK A;  2DMX A;  5EBL C;  1K8A W;  4BIZ A;  1M93 A;  1SC5 B;  4F6R B;  2C2A A;  2QWP B;  4O2B A;  1JR9 A;  2KB1 A;  2PI4 A;  3ZX6 A;  3H1K H;  4W4K A;  2JK5 C;  4MID A;  1Q8I A;  3IGA C;  4B7E A;  4CC6 A;  3ZED A;  2LFS A;  3HPL C;  3ETD A;  2QJA A;  3T2M A;  5LXT A;  1JQ0 A;  2F95 B;  1O9G A;  3HH2 A;  4XBF A;  3FYE B;  2UUB O;  3BDY V;  5CA0 B;  1MNG A;  1I94 O;  4YCI C;  4J7K A; 
#chains in the Genus database with same CATH homology
 2TGI A;  4TV8 B;  3UT5 A;  4GLN E;  5HHV A;  3RYC A;  4AHC A;  5JJJ B;  3JAK B;  3VQY A;  4ZI7 B;  1HCN A;  4F6R A;  1FFX B;  4PHZ A;  4DR4 B;  1BND B;  3QTC A;  4X1K A;  5C8Y A;  5JQG B;  4NVP A;  5LMN B;  5IJ9 B;  2P6A A;  1T5E A;  1MKG A;  2UXC B;  3M7M X;  3BUK A;  3HKE B;  1JJO A;  3BMP A;  3MJG A;  4PI0 A;  3MJK A;  1WQ9 B;  3JAR B;  4LF8 B;  1WNS A;  1VPF A;  4I4T B;  4UI2 B;  4IHJ B;  4DV4 B;  4QAF C;  5CB4 A;  2UUC B;  2Q7H A;  4LNU A;  5IYZ B;  2UU9 B;  2F66 C;  1XMQ B;  2P5O A;  3SR2 C;  5D5P A;  2VXS A;  3EVS B;  3N2G B;  4DR2 B;  3THO A;  1SQG A;  1DGS A;  4B3S B;  4DK1 A;  3RJR A;  5KX5 A;  1I7F A;  4MQW A;  4TV8 A;  1JPY A;  4NXN B;  2RJZ A;  4FLX A;  1NT3 A;  4X65 B;  2E3C A;  3JAK A;  1VPP V;  5KMG B;  4CH6 A;  1NYU B;  1JFF B;  2IFG E;  1P49 A;  5HHX A;  3WB2 A;  1FFX A;  3T1Y B;  1PDG A;  3RYF B;  3PN1 A;  4X1J A;  4HSA A;  2V4D A;  4FLU A;  4X1Y B;  4CS2 A;  1IBK B;  2R53 A;  3K5L A;  5IJ9 A;  2GV9 A;  4ZOL A;  1YEW A;  2H62 A;  3RYI A;  4I50 A;  2HHH B;  4EFE A;  4LXR J;  3U10 A;  2PUS A;  4WBN B;  3HKD B;  4JI4 B;  3HKE A;  1BTG A;  4WPB A;  1QHT A;  2XV7 A;  2PTM A;  1H2S B;  1WPB A;  3ICX A;  3JAR A;  3E22 B;  2FJH V;  4CH4 A;  2KKW A;  4IHJ A;  3JSL A;  5JJN B;  5LP6 A;  5D5Q A;  4EFV A;  5BPU A;  1TUB A;  2VWK A;  5IYZ A;  2QJ1 A;  1TGJ A;  4DUZ B;  4FM1 A;  2VWE A;  3IJ2 A;  3JAW B;  2H64 A;  2KD3 A;  2GYZ A;  4YY3 B;  4JI7 B;  5J2U B;  3HKB B;  4KHP B;  2PYJ A;  2PY5 A;  2ZNJ A;  3P9W A;  2YIB D;  4X1I B;  4JI3 B;  2QCW A;  5HI5 A;  5JJE B;  3JAS B;  2OYQ A;  2BTO A;  3QF7 A;  2ZIO A;  2UUB B;  5EYP B;  5FPR A;  4UCR A;  3N2K B;  5HI4 A;  4FAO A;  1ES7 A;  4HNA A;  4EB6 B;  4YJ3 B;  5BQB A;  1RSO A;  1J5E B;  1I94 B;  1MJV A;  2X1W A;  4FVM A;  4ZHQ B;  1NT2 B;  4CS3 A;  1FZV A;  2FJG V;  5FNV A;  3BAA A;  3JAL A;  4NXM B;  2QR0 C;  2PGG A;  4Q6G A;  3SJB C;  1KTZ A;  5KHI A;  5BQ8 B;  5J2T B;  2YI8 A;  3UQ8 A;  2QJ9 A;  5FV1 V;  1Q3E A;  4GKK B;  1TFG A;  1E9J A;  3K57 A;  5BQE A;  4EC7 A;  1XWD B;  2ASK A;  3B4V A;  5KHH A;  4LF9 B;  1NYS B;  1B98 A;  2V5E B;  2PYL A;  1HNX B;  4TQF A;  3FFQ A;  4X64 B;  1REU A;  4X20 B;  5ITZ B;  4L8J A;  3JAT B;  5GON B;  3K59 A;  5J2U A;  3HKB A;  4ZFF C;  4TV9 A;  1N36 B;  4MPL A;  3RGB A;  4EDW V;  1TVK B;  5JZ7 A;  4ZIB A;  1VF7 A;  1Z5W A;  5LMU B;  4FFB B;  3K5N A;  3WB1 A;  5K1X A;  4UCS A;  5LP6 C;  4JI5 B;  2Q7E A;  4DV5 B;  4FLW A;  4LH6 A;  4DV1 B;  1SGF B;  5JCO C;  1SA0 A;  4D7S A;  3BRC A;  2OWO A;  4FM0 A;  3EO1 C;  4CC5 A;  4O4L B;  2YIA A;  2YIB A;  1JMK C;  4KL1 A;  3U0Z A;  4K0K B;  2GYR A;  4U3J A;  1B8M B;  4I55 A;  3BA8 A;  5J2T A;  3K5M A;  5HI3 A;  4DV2 B;  1FL7 B;  4AY9 A;  5CA0 A;  2YI9 A;  4DV0 B;  2PZS A;  4EEQ A;  1B8K A;  5BMV B;  4DV7 B;  1HNW B;  2VQE B;  1ZAU A;  4YJ2 A;  2P22 C;  2HEP A;  2GOO A;  4UFZ A;  3JAT A;  1HNZ B;  5GON A;  4QCI C;  2Q7G A;  2C7W A;  3HKC B;  4IIJ B;  2UUA B;  4LH7 A;  4ZI7 A;  1XHZ A;  4JI8 B;  3S1K V;  5BQC A;  1TVK A;  4KV5 A;  4HBN A;  4X66 B;  1BND A;  3SJA C;  2GH0 C;  5HHD A;  4FFB A;  5JQG A;  4DR3 B;  5LOV B;  1FLT V;  1KLA A;  4TUY B;  3S1B V;  4O2B B;  3B2E E;  5EIB D;  1TZH V;  4HQU A;  1N34 B;  4B3M B;  1WQ9 A;  5HK5 A;  3U11 A;  4O4L A;  2GNN A;  1N33 B;  1AGQ A;  4I4T A;  3SGI A;  3BPZ A;  1ZKZ A;  1WWW V;  2BTQ B;  2R72 A;  3BAB A;  1DZ7 A;  5F3H I;  4LF6 B;  3BA9 A;  3LNN A;  1SKV A;  1TAE A;  5KHJ A;  1SG1 A;  1TGO A;  5CA1 B;  5HHC A;  2EX3 A;  4O4J B;  3N2G A;  5FPO A;  1QFW B;  1IBL B;  1BMP A;  4HR9 A;  4KXZ A;  4UCO A;  2R9A A;  2VQF B;  5EZY B;  1BJ1 V;  4B08 A;  5JH7 B;  4YHH B;  4LF5 B;  2ARV A;  4ZBN A;  5KHK A;  1KLC A;  2JVD A;  5KMG A;  4FLY A;  1HCF A;  3V6B A;  5BQ8 D;  1JFF A;  5HK5 E;  1HD4 A;  1AOC A;  4BW9 A;  3RYF A;  3RYH B;  2QM4 A;  4X1Y A;  1XQ8 A;  1MKK A;  3VQX A;  3UT5 B;  4GLS E;  4UHY A;  4UHZ A;  2ZIN A;  3CSX A;  3SJC C;  4QHU C;  4GLX A;  4GYC B;  3HKD A;  4WBN A;  1SQF A;  2ARP A;  1M4U L;  4O4I B;  1X4T A;  4CH5 A;  3E22 A;  5LA6 B;  1HRP B;  4UI1 A;  1D5A A;  1IBM B;  4EAX A;  4EFB A;  4DR1 B;  3BHP A;  3RFR A;  2BTQ A;  1M4U A;  3JSN A;  3JAW A;  3ETQ A;  1QFW A;  4AQY B;  4JYA B;  2QJB A;  1KU9 A;  2RQ6 A;  5CB4 B;  4DRX B;  1WN7 A;  1TA8 A;  1B04 A;  2F93 B;  5JVD B;  3RWR D;  1N32 B;  4X1I A;  1XNQ B;  3JAS A;  4D7T A;  2YXL A;  2JS5 A;  1G6U A;  3QG5 A;  5EYP A;  3WB0 A;  3N2K A;  3RYH A;  4LXS J;  2ZCE A;  4JI6 B;  4EB6 A;  5KX5 B;  4YJ3 A;  4MQW B;  3A2F A;  5FV2 V;  2Q0A A;  4ZHQ A;  2UXB B;  1KMI Z;  2ZIM A;  2IM9 A;  3IAY A;  2PJY A;  4TQD A;  1BET A;  1XNR B;  4O4I A;  1Q43 A;  4JV5 B;  5BQ8 A;  5LA6 A;  1HRP A;  5IJ0 B;  2ZNI A;  1V9P A;  4FLV A;  4ZOL B;  5LYJ B;  5KHG A;  2UXD B;  1XWD A;  3RYI B;  4I50 B;  3CHX A;  3OTO B;  2E5L B;  3VQV A;  4DR7 B;  4XPJ A;  4OX9 B;  1REW A;  4O2A B;  4X20 A;  5K1P A;  5ITZ A;  2F1M A;  4LF4 B;  2VWJ A;  4N1D A;  4CS4 A;  2R52 A;  5E4G A;  2F4V B;  4B3R B;  4TOI A;  3MAQ A;  3SEK B;  5LP6 B;  4DRX A;  4JI0 B;  5JVD A;  1M5I A;  1TUB B;  3K58 A;  4UCT A;  2CAZ C;  5F3B C;  1HW7 A;  3OTF A;  2R70 A;  4CH3 A;  1TGK A;  4BV4 L;  4EDX V;  2JGU A;  4O4H B;  3T1H B;  1XMO B;  2B0U A;  5IWA B;  5BR8 B;  3JVF A;  1RV6 V;  1QQC A;  1CZ8 V;  3V2A A;  4AIL C;  4UCV A;  3CB2 A;  1Q5O A;  1Z5V A;  5EIB C;  1B8M A;  4HNA B;  5IJ0 A;  1FL7 A;  4BWA A;  5LYJ A;  4LR3 A;  5BMV A;  4KZN A;  4UI0 A;  4DV3 B;  5FNV B;  3JAL B;  5LXT B;  4I9Q A;  3BK3 A;  3K5O A;  3VQW A;  4O2A A;  4JI1 B;  4LF7 B;  2ZM6 B;  4PI2 A;  3FUB B;  1FJG B;  3HKC A;  4IIJ A;  5BQE B;  1WQ8 A;  4K8Z A;  3DSQ A;  4LFB B;  5JCO A;  1KAT W;  4HQX A;  4DUY B;  5LOV A;  2XHB A;  3RYC B;  1QTY R;  1XI1 A;  4TUY A;  4TV9 B;  4LFC B;  4LFA B;  1M93 A;  1HCN B;  4F6R B;  1HR0 B;  4FLT A;  4O2B A;  1LXI A;  4O4H A;  1TZI V;  3QTK A;  1LX5 A;  4FLZ A;  3ZS8 C;  4X62 B;  4X1K B;  4DK0 A;  5C8Y B;  4K8X A;  4JI2 B;  1L8D A;  2XAC A;  4MID A;  1Q8I A;  4CC6 A;  3ZED A;  2QJA A;  5CA1 A;  1SA0 B;  4O4J A;  5AEJ A;  1XHX A;  5LXT A;  1O9H A;  3QB4 A;  1S5J A;  5EZY A;  4GKJ B;  1S4Y B;  5JH7 A;  2QCQ A;  2VPF A;  4YCG C;  4U3J B;  4UCU A;  2F95 B;  1O9G A;  4I55 B;  3HH2 A;  4B3T B;  4LNU B;  1WAQ A;  3KFD A;  4AY9 B;  3BDY V;  5CA0 B;  4FM2 A;  4DR6 B;  4DV6 B;  2X1X E;  3E07 A;  2BHK A;  4YCI C;  4YJ2 B;  4DR5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...