1M4UA

Crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
199
Chain Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Bone Morphogenetic Protein-7
publication title Structural Basis of BMP Signalling Inhibition by the Cystine Knot Protein Noggin
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 199
sequence length 206
ec nomenclature
pdb deposition date 2002-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.520 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m4uA02
2.10.90.10 Mainly Beta Ribbon Cystine Knot Cytokines, subunit B Cystine-knot cytokines 1m4uA01
1TZIV 1ES7A 1LX5A 4MQWB 5BQ8A 1TGJA 3S1KV 4ZBNA 4LXSJ 1BNDB 5HHXA 5HI3A 1M4UA 2KD3A 3E07A 4EDXV 2QJ9A 2QCQA 1S4YB 2IM9A 1XWDB 1MKGA 2FJHV 5BQCA 1QFWA 1B8MA 1WQ8A 2IFGE 5FV2V 1REUA 3V2AA 5AEJA 4AY9B 4ZFFC 1KTZA 2ASKA 2QCWA 2XACA 1BTGA 1TGKA 1ZKZA 3QTKA 1LXIA 2GYZA 4FAOA 4XPJA 1FZVA 5F3HI 4GLNE 4EAXA 1REWA 4GLSE 4LXRJ 5HI5A 5HI4A 2V5EB 1SG1A 3EO1C 4UHYA 5F3BC 2GH0C 1MKKA 2QJAA 3HH2A 4EDWV 5BQEA 4UI1A 4HQUA 4MQWA 4HSAA 1NYUB 2P6AA 4HR9A 5BQ8D 1BNDA 1FL7A 1HCNA 3B4VA 1E9JA 4MPLA 4QCIC 1HRPB 4QAFC 5HK5E 4EFVA 1BMPA 3IJ2A 3RJRA 1FLTV 3SEKB 4YCIC 3EVSB 4WPBA 1NT3A 1PDGA 1KLAA 1VPFA 2GYRA 1NYSB 1WQ9A 4UI0A 5JZ7A 2XV7A 2GNNA 1AGQA 5BQ8B 3KFDA 1SGFB 3QB4A 2VXSA 3JVFA 3V6BA 1BETA 1B98A 1MJVA 1B8KA 4KXZA 4X1JA 1HCFA 2R52A 2VPFA 5HK5A 2PJYA 5HHVA 2B0UA 3BK3A 4N1DA 1RV6V 1WAQA 1M4UL 4UHZA 3BMPA 5BQEB 2VWEA 1QFWB 1VPPV 3FUBB 2ARVA 4EC7A 1B8MB 5HHCA 1HD4A 1CZ8V 2H62A 2R53A 1JPYA 1FL7B 1HCNB 1XWDA 4YCGC 1TZHV 4MIDA 5E4GA 4BV4L 2QJBA 3BDYV 2ARPA 3MJGA 4KZNA 4KV5A 1KATW 4AY9A 1DZ7A 2TGIA 1BJ1V 4QHUC 2C7WA 3MJKA 2X1WA 2FJGV 2BHKA 5BPUA 1HRPA 3S1BV 1QTYR 1WWWV 1WQ9B 2H64A 4HQXA 4UI2B 2X1XE 1AOCA 1KLCA 5BQBA 3BUKA 5FV1V 5HHDA 2QR0C 3P9WA 2GOOA 1TFGA
chains in the Genus database with same CATH superfamily
3F7VC 4TQFA 4X88A 1FAFA 1O9GA 3N27A 1PPJH 1DGSA 5HHXA 2PF4E 1JQ0A 2GTSA 2ZE8A 4MW3A 3FB7C 1S72V 1YIJV 1REUA 2ADQB 3DTUB 3U0ZA 3APOA 2RCVA 1DLBA 1FFTB 3MAQA 2YIBD 2Q8VA 1NU1H 4GLSE 1I94O 4R50A 4RQFA 4D6TH 4W4LA 3RW0A 3HKCA 4DR3O 2P06A 3HPLC 3K9AA 3IJ4A 3B4VA 1ZLZA 3JARA 1BMPA 3BA9A 3FAVA 3TK1A 4J41A 5FL7G 3IC9A 4LWSA 4JTCB 4LCUC 3K5NA 2GYRA 1WA8A 4MTFA 2QR4A 4TOIA 1NYSB 3LDCA 1GM8A 2VS0A 2GNNA 3RBZA 2PI4A 1T5EA 4NTXA 3JCUZ 5LP6B 3SYQA 4FLWA 1Y76A 4MVOA 2E5LB 5ITZA 1M4UL 2NR5A 3BEHA 4MTXA 5LOVB 3CC4V 5IT9N 3OGCC 4DR2B 1THZA 4O4HA 1NT2B 3QO5A 1ZTEA 4MIDA 3K08A 2ZDIC 1H2GA 3W7SA 1D5AA 2YIBA 1RSOA 2X1WA 2FJGV 1SA0A 1A32A 2HVJC 1HRPA 1M93A 2ATKC 1JPXA 2CAZC 3ZN1A 1DTOA 4J10A 4QAFC 3P30A 3ZMZA 1XL6A 4P9PA 3THOA 4JI8B 3S1KV 1WB8A 5EIBD 1COWG 2KD3A 4GCZA 1TVKA 2LFSA 3LDEA 4JZ2A 2ZR3A 2OTJV 1K5QA 1UPGA 3H1IH 5CA1A 2FYUH 2RNBA 3LSQA 3ZEDA 5B5EZ 5EYPA 1YI2V 5H9CA 4WF9V 3V2AA 2E5LO 4TV9A 4DV2B 1KTZA 1TGKA 2RMKB 2YI9A 2GSMB 4DR2O 4KXRA 1L0LH 4LF9B 4WBNB 4RWUA 3SGIA 1JCHA 1VARA 1OZ0A 4HYOA 4J9ZB 4P30A 3UO3A 1IBLB 2EZPA 1NVPB 1OCOB 2YSUB 4YJ2A 1BGYH 1S0VA 3CX5F 3VOUA 4U3FH 3ASOB 1EBOA 2L35A 3R66A 4Q6GA 1IXMA 3CYOA 1X59A 1OCOC 3ZMTA 3HH2A 3K59A 1VQ9V 3ASOC 4NXNB 3FYIB 5H6RA 1F4MA 1QU7A 4ZIBA 4JI8O 1ENVA 2FKXA 2IW5A 4PI2A 4TUYA 3FX7A 2V7QG 1I08A 3SPGA 4R7CA 5B1NA 1PNMA 2ILMA 3GB7C 4DV2O 2Q0AA 4I0XA 2OTLV 2LGQA 2ZKOA 2WPDG 2N05A 3HKDB 1HCFA 1IXBA 4JAAA 5JJJB 2PTMA 2JS3A 3E83A 3L74H 1YDXA 4HZ3A 4F6EA 4LF9O 1VEWA 3W7TA 3NR7A 4X1YA 2DJVA 1N4CA 2EIMB 2VRZA 1IBLO 1XWDA 2DYSB 1Y6XA 3X2QC 4X20B 3JYCA 5DECA 4P2ZA 1H2LA 1KU9A 2QE7G 2GUZB 4CZZA 2DYSC 3H9VA 2HR3A 4YIPA 4QGPA 4NXNO 1XL4A 5TISZ 1K92A 2E74B 4UI2B 2Q73A 4BR6A 1Q8IA 4PV1B 2ZIOA 4UCUA 3CRMA 2OCCB 1PDGA 5HFMA 4FM0A 3JAKB 1V54B 1Y67A 3ZHVA 1FD9A 1M4UA 2OCCC 5IYZB 3AG1B 4MVQA 1BSMA 3D36C 2JJ1G 4YJ3B 1V54C 5IE9A 3IGAC 4JGSA 2FJHV 4DR4B 4DW0A 1SQFA 3AG1C 5EZYA 3AK1A 1DF4A 1G6UA 1FFXB 1XREA 3ZHQA 4X1IB 4C7UA 1BTGA 3QTKA 4GX0A 3ZIAG 4LH7A 3K03A 1EM1A 2GYZA 1LUWA 3CCJV 3FB5C 1SQVH 4A5UB 1S3JA 3GWOA 2ZCEA 4AQYB 5HFLA 1RP3B 3F7YC 1N8RW 3JATA 2AHYA 4GZRB 1Y74B 4JI2O 1US6A 3QVNA 3ZHRA 2OWOA 1QQCA 2AXTZ 2EIJB 1B06A 2EIJC 4JAVA 3BABA 1WPBA 3ZRWB 1MSWD 3JD3A 4X9QA 2D2CB 3A0HZ 3CCRV 4UHZA 3BMPA 3A0RA 3PN1A 1H8EG 2JJ2G 3Q4HA 3AG7A 4AQYO 4JYAB 4YCGC 4CS2A 4O2AA 5CA0B 4XDLA 2TGIA 5BR8B 1ZL8B 3BA8A 1P4RA 1WPXA 4DV7B 2XASA 2Z0AA 2Q69A 1RPRA 4K8XA 1P7GA 2PYLA 1NZ6A 4I4TB 2HG5C 1FPOA 3ZHTA 2KG7A 3K9SA 5LBQA 1ES7A 2JGDB 3C3SA 3UT5A 3T4DA 1BNDB 4O4LA 5LXTB 2HKOA 1R6NA 5AG2A 5JQGA 2LQTA 4PHZA 4TT3G 1GRJA 3H01A 4GT1A 1MKGA 1D5NA 3B8MA 1XDCA 4FMTA 5FPOA 3UO2A 4JF3A 2QWRB 2HP8A 1NKDA 4LF4B 1L1FA 4K3AA 4JYAO 4WFBV 2XHBA 5BR8O 4LXRJ 3FKSG 4DV7O 3TXSA 2BCCH 5DN6G 3E22B 4HQUA 2YEVB 2WLHA 2Q67A 3CCEV 1AILA 2X6BA 4U3JA 4DK0A 3DXRA 4UB6Z 1JX9A 2P7TC 1SQGA 4ZBMA 4LP8A 1XQ8A 1NH2D 2Q7GA 3KFDA 3N2KA 4GYCB 3QB4A 2X7RB 1S5LZ 5EC1C 2FMLA 2F23A 4JI6B 4LF4O 5CB4B 1MA1A 4FFBB 2B0UA 5BQEB 4ABMA 1J95A 4DV0B 1JA8A 3QTCA 3ASNB 3OR6C 4NXMB 2XNDG 1TZHV 3W7UA 4IHJB 4BV4L 2B5UA 2OCHA 4FLYA 5BMVA 2Z3YA 1Q6IA 1V9PA 1YHQV 1O9HA 3UKMA 4MS2A 1WWWV 4ZOLB 4OX9B 4RUFA 1SESA 1GN2A 4X66B 4O4IB 1NI8A 4G2KA 5LYJA 1NTZH 2DW4A 4IIJA 4DR1B 4YHHB 1SS3A 1VQKV 1VQOV 1R3JC 1K34A 2DYRB 3LDDA 3RVYA 2YIAA 1AR5A 4TWKA 3TCUA 1EN5A 3ZMVA 5KMGA 1OCCC 3HKBA 4JI6O 1FS0G 4CS3A 3WB1A 2DYRC 5FV2V 2MW2B 1HP8A 4DV0O 1VQPV 1SQPH 1F4NA 2XAJA 4UV9A 4CH4A 3ABUA 5K1XA 4NXMO 1N32B 4HNAA 3KKYA 1TUBA 4XPJA 4TV8B 2A3QA 5C8YA 3G80A 5HI4A 3IAYA 3ETGA 3K04A 4UB8Z 3JASA 2EJ7A 4GX5A 3VQYA 4OX9O 4FFKA 1YITV 1FL7A 1PD3A 2C2AA 1RFYA 4IL6Z 4X66O 1W0KG 3ICXA 2UXDB 4QCIC 5KLVH 1N0NA 4LNUB 4ASUG 3G67A 4YHHO 5H5NA 1ZX3A 1Q3EA 4DR1O 1BL8A 4LF5B 4FLUA 2Q9LA 3ABTA 5JCOC 1FXKA 1FXVA 3GVMA 5GTIZ 3M99B 5CMUA 3BFRA 3CE2A 4PDVA 2WLIB 3JD0A 5DM6V 4UFZA 1N32O 4BIOA 1VQ7V 1RV6V 5HHCA 1ZWIC 4UCRA 2BSKB 2Q7HA 4DW1A 1LNQA 5E4GA 2GDSA 3MJGA 5A2QN 4RO2A 2P4KA 1JFFB 4NR1A 3BHPA 1QLEB 3CSXA 4IYHA 4NTYA 3MDSA 2ODMA 3CP1A 4WFGA 2QKSA 2UXDO 1WQ9B 4BIUA 2CGOA 3JAWA 4OGQB 4ZI7B 3R65A 1KC8W 4LF5O 4L87A 3P9WA 4YY3O 1JVMA 2QEXV 3F5WC 4MW8A 1M1KW 1TGJA 4DR7B 5LA6B 1AJNA 4RQEA 4EKWA 4BW5A 5BQCA 5LOVA 1FJGB 4X1KB 5L3GA 2ZDIA 4G27B 2QCWA 1YCIA 3OMAB 4UCSA 3K58A 2QSAA 1IBKB 4HAMA 2HVKC 1FZVA 1VQ4V 1J5EB 2V5EB 1SG1A 3T1YB 1NTMH 3HKEB 3ZRVA 5IJ0A 1HCNA 2XT9A 1YVWA 1Z5WA 4DR7O 5HK5E 1XOUA 4WPBA 1XUQA 4JI0B 3I5DA 3WG7B 4DO2A 2K1EA 5GTHZ 1FJGO 1P49A 1M5IA 1SZTA 2Q4PA 4D7TA 1M9NA 5J2UB 3CD6V 1SGFB 2RN9A 2YUAA 5E79Z 4WBNA 5BZBA 3CCQV 1IBKO 2WLLA 1G1XB 1URFA 1R3IC 5LGUA 3CHXA 4EC7A 2V4DA 1VPPV 3T4ZA 1J5EO 2LJ2A 1AP5A 2A9HA 3L71H 1VQNV 3PJSK 2VQEO 4EFEA 2QJBA 2HHHB 2CTPA 4DRXB 5L3CA 3T1YO 1K73W 3TJTA 2EZOA 4Q20A 3SYPA 5D5PA 4FM1A 1BQ0A 2QKCA 3AG2B 3OM3B 4K0KB 1QTYR 2PI5A 1OCRB 2QGNA 5F2VO 3OMNB 2X1XE 5J2TB 4ZHQB 4RAIA 2QA4V 2JIZG 3GWKC 1OCRC 4JI0O 2R70A 3ZHUA 5LP6C 3SJAC 5IWAB 3HKDA 1K33A 1WB7A 2A06H 1Z2GA 3AG4B 3RT3C 2IFGE 3E86A 2PY5A 3VQVA 3FB6C 2CTRA 1SQXH 5J9PC 3AG4C 2W6IG 5FPRA 3SJCC 4PI0A 1GM9A 3JD4A 3CJHB 5IYDO 2HHHO 5F3HI 3HR0A 1JJ2U 3SYOA 2JRIA 5KHIA 1I7FA 3K3WA 4FK5C 1EZJA 4K0KO 4JZGA 3STZC 1KQSU 3CPWU 3H1KH 4EDWV 2AZ0A 1IBMB 4UI1A 2YS8A 3WB0A 2R72A 5IYZA 1IVSA 3ML0A 1S76D 5IWAO 1Q81W 4JTAB 3AEIA 1KLAA 3MHSC 4UI0A 1QBZA 2KQXA 4PD4F 3TETA 2D3OW 2Q68A 1B98A 1MSDA 4NKGB 1OV9A 2Y4UA 1Q5OA 2QTSA 3HKCB 4LBEC 1PNKA 1OHHG 3BCCH 1B8MB 1KKDA 3JALA 4QJFB 4DUYB 1CPYA 4XBFA 1N0JA 1ZAUA 2UUBB 1RPOA 2CH7B 1Y74A 4KV5A 2OIEA 3FAVB 2B1GA 2ZNJA 1IBMO 4LWSB 2UUAB 3CCUV 1BQZA 3RWRD 3WB2A 4PDRA 1JR9A 1WA8B 4RUEA 1BE3H 2DQ3A 2L6LA 3RGBA 3BVOA 3LSSA 1AJQA 1SQQH 1Y76B 4LF7B 5ITZB 4PDLA 3L70H 4PA6A 4DV3B 3LNMB 2CDYA 1MABG 1XMOB 2EIMC 1K9MW 3OE7G 1N34B 2V1DA 3HB3B 3P3PA 1SERA 1RSOB 1H2MA 1SA0B 4DUYO 1LXIA 5FLXN 4JI2B 2IJJA 2Q5ZA 3SR2C 2UUBO 4FAOA 1WP7A 4FZ1A 1NTKH 2FTKA 4UCTA 4AILC 1VQLV 3JD2A 2UUAO 4UHYA 4JI7B 3JSLA 5IYCO 2QJ1A 1B04A 1TVKB 5CBGA 1QR8A 1I0HA 2CTQA 2W0FC 1BNDA 3E8FA 5CA1B 1NR7A 4G28B 5JJNB 4I7ZB 3LNNA 5EYPB 4JI1B 4EFVA 4LF7O 3EXAA 5FNVA 2NLJC 3CEIA 4DV3O 1MG1A 2ZINA 2ZIMA 5JVDA 1VQ6V 1XMOO 1VPFA 1HWYA 4FZ0A 5H6QA 1N34O 1K4DC 1AGQA 4LR3A 3O9OA 4X1JA 4YJ2B 3QF7A 4MTOA 1SKVA 2MK3A 3G71V 2ARVA 3ZMUA 5H2FZ 3P3NA 3FYEB 4JI7O 3DC6A 2ADPA 1AI7A 2ZE7A 1F51A 1DZ7A 3I56V 4LH6A 5E1AC 1E1RG 1NS1A 3MJKA 3K0GA 1PNLA 1R6TA 4QE7A 2H64A 4DK1A 1GM7A 1AOCA 4JI1O 5FV1V 4I55B 3UM7A 2WA4A 4X64B 4MQWB 4QPKA 2XOKG 1PL0A 3E07A 4X1YB 5KX5A 3RYFB 2H94A 4H44B 4UV8A 4FFBA 2JGUA 4O2BB 1IX9A 1XWDB 2Q6AA 4LF6B 3QO7A 3J7AU 1B6QA 4EB6A 2BTQB 1I5XA 3FFQA 3ZCCA 2YICA 1GH6A 4WFFA 2XAHA 2E3CA 1AP6A 3SYAA 4EAXA 5C93A 2QWQB 1H8HG 5LMUB 4J42A 1K5SA 1AROP 3ZS8C 4JI5B 3SJBC 5KHKA 4DV6B 3AK2A 3ABLB 2QWNB 5JH7A 4X64O 4MPLA 5EZYB 2GTAA 1GO3F 4F6RA 2EINB 3ABLC 2R9IA 1E79G 5LGTA 2F95B 4XDJA 4LF6O 3CRRA 2EINC 5B1BB 1D2DA 4HBNA 1R3KC 3V6BA 1BETA 5B1BC 4TV8A 1XBLA 1FXHA 3JATB 2DE0X 4FM2A 1QFWB 4DUZB 4FPPA 1IURA 1QHTA 5LMUO 4O4JB 4JYCA 4AY9A 4H33A 4JI5O 1AR4A 2JVDA 4LNUA 3RYCB 4DV6O 5JJEB 4H37A 2HJFC 1SRYA 3SJQC 3N2GA 3VQXA 2EILB 3K0DA 2QR0C 1H2NA 3A0BZ 3IFXA 4JYYA 4UUJC 2K9PA 4MVMA 5KAFZ 5DEDA 4WFHA 4LXSJ 4ZBNA 4I9QA 4CBCA 3ASNC 3Q4HB 1M57B 2YXLA 1CXZB 3IC7A 4O2AB 3OD4A 1YJWV 1PM9A 2BSKA 5D5QA 1M57C 4E2LA 2Y69B 3A2FA 3CWBH 1ZKZA 5EBMC 1WNSA 4DUZO 1KB9F 2Y69C 4NYKA 2YI8A 2JDIG 4Z2WA 2Y0IA 1REWA 1Q90D 4PA3A 2KG7B 1Q6HA 2LO1A 4I50B 5L3FA 3OEHG 1NQTA 1MKKA 3CC7V 3CXCU 5GW7A 4HSAA 1AJPA 2P4VA 3ETEA 2Q7EA 3ABKB 4H13B 3H1HH 5EC2C 2KB1A 2F4VB 2WWWA 3ABKC 2YXYA 1Q82W 1ZUQA 3CS5A 4L8JA 4DYLA 3RYIB 2EX3A 3ZHSA 4B3RB 4UVCA 4ICGA 5IJ9A 3C90A 3KCYA 4J7JA 3QNEA 4XDKA 1B8KA 5LGNA 4NTWA 1LUVA 2AHZA 4JI4B 4N1DA 3BRCA 2F93B 2BE3A 4JASA 3W7XA 1QR9A 2BOBC 1HNZB 2QM7A 4B08A 3E35A 1K97A 1NBMG 4YY3B 3B09A 2KSDA 1HR0B 3HKEA 3K79A 4MSWC 2DMXA 3DXRB 3ZMSA 4X65B 1JOYA 1XNRO 1YTFB 2DOSA 2W6JG 2LW1A 4R8CA 4HQXA 4DV5B 2F4VO 5BQBA 1TUEB 1DK1A 1Q6UA 1QCEA 3N2KB 2P90A 4JI3B 4OXSA 4DR6B 2E76B 4K8ZA 1TZIV 4FJCC 1S5HC 1N33B 3OT7A 1BT8A 4DXWA 4B3RO 4KUMA 4E4EA 4FLTA 4U7NA 4WFEA 5KHHA 3AG3B 4WCEV 1VMGA 3RVZA 2A79B 4JI4O 1YXBA 1AI6A 5BMVB 3OUSA 1QLEC 1KUQA 2AGAA 3AG3C 5IDJA 1HNZO 2IH3C 5B1AB 1HR0O 1VP7A 1PKXA 3AK3A 4GLNE 5B1AC 4X65O 1HW7A 2EBOA 5LP6A 2H3OA 5LYJB 2GH0C 3B4SA 4NB5A 3TXQA 2QJAA 4DV5O 4MT8A 1NVPD 1VF6C 4JI3O 5KA5A 3S3XA 4DR6O 1IZ3A 4EEQA 3G4SV 2CGNA 3HKBB 1YSCA 1N33O 2XAGA 1JMKC 2ZR2A 1FLTV 1EFRG 3RYHB 3SEKB 2DWDC 5L3BA 2GBOA 1KP3A 1PL4A 3J80N 1EZVH 3OMIB 1TUBB 2JEXA 2VQEB 5BQ8B 5C8YB 2G38A 1BHBA 3JVFA 3OAAG 2R52A 3JASB 4MVUA 2Y4TA 1LR1A 3LSUA 3G6EV 2PJYA 3T1HB 4JTDB 2UU9B 3BK3A 3SYCA 1WAQA 1H2KA 4IT5A 2VWEA 2H62A 3OGIB 1Q7YW 1FL7B 1KP2A 1HNXB 2ARHA 3P32A 1W59A 1BCCH 1BJ1V 2PGGA 1KBHA 1X4TA 3JCZA 4H0LB 1R3LC 2QWPB 1HDJA 4GX1A 4QE9A 4YIOA 5BPUA 2HLDG 4I9WA 5LMNB 2DWEC 3WG7C 4J9YB 4X89A 1FXKB 3WFVA 2Q0OC 1KMIZ 2VWJA 1UJWB 2GOOA 1TFGA 4U7OA 1FXKC 2X6CA 4LFCB 4UXNA 4WFAV 1Q86W 3CRQA 2GV9A 2YXHA 2R9RB 2IM9A 4OPAA 2P5OA 2OT5A 4J11A 3E2EA 1B8MA 2WLKA 1WQ8A 3T1HO 2QTOA 4KP4A 2UU9O 4ZFFC 2A0LA 2XACA 3L73H 2CH7A 2UXXA 3AG2C 2WLJA 1HNXO 3JAWB 4PJ0Z 2UXCB 5B1OA 5LHGA 3M7MX 4BW9A 5GONB 5LMNO 2IU0A 3UQ8A 1XMQB 1F7YA 3E8GA 3A8TA 3B8NA 1G8MA 2LFRA 2P6AA 5EBLC 1G4YB 1P84F 2KKWA 4LFCO 4X20A 4B7KA 1CEZA 1YF2A 2WLMA 3IJ2A 2M6YA 2PUSA 3CXHF 3K5MA 2GUZA 3EFFK 4PA7A 2PZSA 1GAXA 2IJKA 2ZD9A 2IJIA 1TA8A 3E8HA 2VXSA 2JS5A 4LC1A 1MJVA 3G6BA 1XI1A 2Z5UA 3D36A 3JAKA 3H1JH 3B77A 1RM1B 4EFBA 3BPZA 5L3DA 3FUBB 2LP7A 4YJ3A 3CCVV 2UXCO 2IJHA 1L8DA 2RQ6A 3ETQA 5IJ0B 1HCNB 2ZXWB 4MVRA 1GN3A 1RM1C 1ROPA 4DR5B 4N23A 3BDYV 2ARPA 1XMQO 1AI4A 1FFXA 4J7ZA 3M8AA 2ZXWC 4X1IA 2P6JA 3ZBHA 1FKAO 3CB2A 3CCMV 3DSQA 2RDCA 3U11A 1K8AW 2A7WA 1BZKA 2WLLB 4BWAA 1GTOA 3JARB 5B66Z 1AVMA 2UUCB 1S4YB 4GX2A 1AI5A 5K1PA 2YC0A 1QNMA 4KHPB 3K06A 2P67A 4FIPC 4JPRA 1GN4A 2N04A 3CRCA 4UCOA 4DR5O 3ZN0A 4P9OA 2CK3G 5HI5A 5B3SB 1VF5B 3ZRWA 1AR1B 5L3EA 4KFMA 2DN9A 4O4HB 4I55A 1AB3A 5B3SC 4B3SB 2HEPA 4MQWA 1MOFA 3D3IA 3K5OA 4FVMA 5KUKA 2WA3A 3X2QB 5CA0A 1HRPB 3RYFA 3S3WA 4X8AA 1ZL8A 1S5JA 4O2BA 4PDMA 1ORQC 3D8CA 1E1QG 3EVSB 2VWKA 3DC5A 5KHGA 2QKAA 3JD1A 1W0JG 2BTOA 2UUCO 2WLNA 2BTQA 4CC6A 1BS3A 2EJRA 2N74A 4FLZA 4I4TA 3I55V 3C3TA 4KHPO 4KXZA 3CMAV 2JGDA 1OCZB 1EN4A 5LXTA 2IBZH 2FL4A 1OCZC 5LL6Y 1JPYA 4BIZA 4TV9B 4CS4A 4NVPA 3JAMN 1QVGU 1KATW 1CP9A 3B2EE 3EHBB 4QHUC 3T2MA 4B3SO 2BHKA 3OTOB 2XTAA 2DQ0A 5JWPA 2H8PC 1Z5VA 1XHZA 3ETDA 3ZX6A 2YDEA 4KL1A 3BUKA 5HHDA 1XILA 3LUTB 1XHXA 3MD0A 3D3QA 1SETA 1WAZA 2B9ZA 3UCSC 1BMFG 2OIGA 2QDOA 3L9DA 2F66C 1F23A 4AHCA 2HFEC 3E22A 2YIDA 2YEVA 3B40A 3VBBA 2QCQA 3JALB 4TUYB 1EN6A 1QFWA 1OJHA 2ITDC 4PA9A 3JSNA 5LHHA 1QVFU 2F1MA 2ASKA 4O4JA 2HJDA 3CC2V 4I0XB 2FB5A 2CUGA 2ZT9B 4MVZA 4JV5B 5EIBC 4QIWF 3RYCA 1Q43A 3RN4A 4DR4O 3F5TA 2B1IA 3OTOO 3EO1C 1SZXA 5CB4A 4PELA 3H1LH 3O65A 4I5SA 5BQEA 1FYJA 2R9AA 1W2BU 4HR9A 4UVAA 4LFAB 2ZE5A 4IHJA 3OTFA 3FD9A 4GKKB 5A9GA 4TQDA 1NT3A 1WLEA 2XUMA 2Y0PA 1DF5A 5CBFA 4DV4B 1MNGA 5JZ7A 2JK5C 2E75B 4ZOLA 1B3QA 1VF7A 1SF9A 3E8BA 2IU3A 1P7BA 4D7SA 1UFIA 4O4IA 1HNWB 4MVSA 2F43G 2GHYA 1YTFD 2VPFA 1V55B 3QO8A 1SC5B 4JV5O 4I50A 3RFRA 2ETNA 2RJZA 1V55C 4AI8A 3BY6A 3SPHA 2ZM6B 1IDSA 5FNVB 3MHHC 1H38A 2JEUA 5CA3A 5JVDB 4LFAO 3KZIZ 5BXZA 4IGGA 3FB8C 1S77D 3WU2Z 4GKKO 1PP9H 1KLCA 3RYIA 1XEQA 1TGOA 3NXSA 4B3TB 3ZJZA 4B3MB 2M7WA 4DV1B 4DV4O 5HI3A 2X6AA 4EDXV 4PA4A 1MZFA 4ZKIA 2PYJA 1KD1W 3U10A 1VQ8V 1HNWO 2BOCC 3STLC 3W7WA 5AEJA 5JCOA 4CC5A 2X0LA 1WP8A 4CH3A 2EILC 1K3EA 2ZM6O 5KAIZ 1I5YA 4J80A 2WLIA 3OR7C 5EBWC 4J7KA 4MTGA 3QG5A 3OW2U 5KX5B 5BQ8D 2EIKB 4JYBA 4B3TO 4B3MO 4TSFG 2VQFB 1E9JA 2XAFA 4Z1MG 2CE4A 4DV1O 1YJNV 1JFFA 4EB6B 2EIKC 3RJRA 3OEEG 4GUNA 4FLXA 2QM4A 3ABMB 4LFBB 3EVKA 4YXWG 1WQ9A 3OUFA 2NNUA 4ZI7A 3ABMC 3UT5B 1Y66A 5KUMA 1QLNA 1Y4MA 4N21A 4O4LB 3CCLV 1R1BA 1H2SB 5JQGB 1SQBH 1XNRB 5CBHA 5LA6A 4UCVA 5IY5B 1VQMV 1U97A 1VF6A 1HD4A 2IH1C 5BY1A 1CZ8V 3VQWA 2UXBB 3K5LA 5IY5C 1XNQB 1OCCB 1KECA 4X1KA 5JH7B 5LHIA 2CTWA 2QWOB 2ZQMA 3SDLA 3SPCA 4KZNA 1WN7A 2C7WA 5EK0A 1KYOF 4F6RB 1U96A 2W0XA 2ZNIA 1R6KA 2O57A 3J81N 1TAEA 4GKJB 1GMGA 3RYHA 2VQFO 1YZBA 2EULA 4W4KA 2P22C 5KHJA 1LX5A 1M90W 5BQ8A 2NN4A 4X62B 4LFBO 1GN6A 1YJ9V 3CRAA 2QJ9A 4BAYA 2OYQA 4U3JB 1NJIW 1ZSPA 3KG2A 4QPJA 1N36B 2AZ2A 1VQ5V 4AY9B 4R6ZA 2WSSG 2UXBO 4K35A 3E89A 1XNQO 1K4CC 1R73A 5IYBO 3N2GB 4LF8B 1JJOA 5J2UA 4B7EA 2Y48A 2QM8A 5F3BC 4GKJO 3T1CA 1GKFA 1L0NH 1NYUB 1PV0A 3OFNG 2WAMA 1BHAA 3SPJA 3CMEV 2ZE6A 2LGWA 4DRXA 4X62O 1GK9A 1MZEA 2XAQA 4JAUA 2UXNA 4YCIC 3ZRXA 4CH6A 4Z1VA 2ITCC 4IYIA 1N36O 4OPHA 4UVBA 2XV7A 5J2TA 5CN0A 4ZHQA 3DGEA 1NR1A 3CCSV 4IIJB 3BAAA 4F4LA 3TGUH 1M56B 4CH5A 1WJZA 5HK5A 5HHVA 5KMGB 2AW9A 3K57A 5GONA 1M56C 1YEWA 4FLVA 4LF8O 2R53A 3L75H 4QNHB 1NH2B 3ZRSA 1MMMA 1K7DA 4HNAB 1I94B 3S1BV 5KA6A 3SPIA 3APQA 1KKCA 3L72H 3KCXA 2LW7A 1VIBA 4DR3B 3CJHA 5IJ9B 4GLXA
chains in the Genus database with same CATH topology
4O4IB 4X64B 4MQWB 4TQFA 5LYJA 1O9GA 4IIJA 4BWAA 1DGSA 4DR1B 4YHHB 5HHXA 3E07A 3JARB 4X1YB 5KX5A 3RYFB 2YIAA 4FFBA 2JGUA 4O2BB 1S4YB 2UUCB 1XWDB 5KMGA 4LF6B 3HKBA 4CS3A 3WB1A 5FV2V 1REUA 5K1PA 4EB6A 2BTQB 4KHPB 3FFQA 3U0ZA 4CH4A 4UCOA 5K1XA 3MAQA 1N32B 4HNAA 1TUBA 4XPJA 2YIBD 2E3CA 4TV8B 4EAXA 5C8YA 4GLSE 5HI5A 5HI4A 3IAYA 5LMUB 3JASA 3ZS8C 4O4HB 4I55A 3HKCA 4JI5B 3VQYA 3SJBC 4B3SB 2HEPA 4MQWA 5KHKA 1FL7A 4DV6B 3K5OA 4FVMA 3ICXA 2UXDB 3B4VA 5JH7A 4MPLA 3JARA 5CA0A 4QCIC 1HRPB 5EZYB 3RYFA 4LNUB 1BMPA 3BA9A 4O2BA 1S5JA 1Q3EA 4F6RA 4LF5B 3EVSB 2VWKA 5KHGA 3K5NA 2BTOA 4FLUA 2GYRA 2F95B 4TOIA 2BTQA 4CC6A 1NYSB 5JCOC 4FLZA 2GNNA 4I4TA 4HBNA 3V6BA 1BETA 1T5EA 4KXZA 4TV8A 5LP6B 3JATB 4FLWA 4UFZA 2E5LB 5ITZA 1RV6V 4FM2A 1M4UL 5LXTA 5LOVB 1QFWB 5HHCA 4DUZB 4UCRA 2Q7HA 4O4HA 4DR2B 1JPYA 1NT2B 4TV9B 4CS4A 1QHTA 4NVPA 4MIDA 4O4JB 5E4GA 3MJGA 1KATW 4AY9A 1D5AA 1JFFB 3B2EE 4QHUC 2YIBA 1RSOA 3BHPA 2X1WA 3CSXA 2FJGV 1SA0A 2BHKA 3OTOB 1HRPA 2JVDA 1M93A 4LNUA 3RYCB 5JJEB 1Z5VA 1XHZA 1WQ9B 2CAZC 3JAWA 3VQXA 3N2GA 4KL1A 4ZI7B 3BUKA 5HHDA 2QR0C 3P9WA 4QAFC 1XHXA 1TGJA 3THOA 4DR7B 4JI8B 5EIBD 4LXSJ 3S1KV 5LA6B 4ZBNA 2KD3A 1TVKA 2F66C 4AHCA 4I9QA 3E22A 2QCQA 3JALB 4TUYB 5BQCA 5CA1A 5LOVA 1FJGB 4X1KB 2YXLA 1QFWA 4O2AB 3ZEDA 5EYPA 3JSNA 3V2AA 5D5QA 4TV9A 3A2FA 2F1MA 4DV2B 1KTZA 2ASKA 2QCWA 1TGKA 4O4JA 1ZKZA 2YI9A 1WNSA 4UCSA 3K58A 1IBKB 4LF9B 4WBNB 1FZVA 3SGIA 2YI8A 4JV5B 5EIBC 3RYCA 1REWA 1Q43A 1J5EB 1IBLB 2V5EB 4YJ2A 1SG1A 3EO1C 4I50B 5CB4A 3T1YB 1MKKA 4Q6GA 3HH2A 5BQEA 2R9AA 4HSAA 3HKEB 3K59A 5IJ0A 4HR9A 4NXNB 1HCNA 2Q7EA 4LFAB 4ZIBA 4IHJA 3OTFA 1Z5WA 4GKKB 5HK5E 2F4VB 4TQDA 4PI2A 4TUYA 4WPBA 1NT3A 4JI0B 4L8JA 3RYIB 2EX3A 4DV4B 1P49A 1M5IA 4B3RB 5JZ7A 4ZOLA 4D7TA 5IJ9A 1VF7A 5J2UB 1SGFB 2Q0AA 4WBNA 4D7SA 1B8KA 4O4IA 3HKDB 1HCFA 5JJJB 1HNWB 2PTMA 4JI4B 2VPFA 4N1DA 3BRCA 3CHXA 2F93B 4EC7A 2V4DA 1VPPV 4X1YA 4I50A 3RFRA 1HNZB 4B08A 2RJZA 1XWDA 4YY3B 4EFEA 4X20B 1HR0B 2QJBA 2HHHB 3HKEA 4DRXB 2ZM6B 5FNVB 1KU9A 5D5PA 4FM1A 4X65B 5JVDB 4K0KB 1QTYR 4HQXA 4DV5B 4UI2B 2X1XE 5J2TB 4ZHQB 1KLCA 5BQBA 1Q8IA 3N2KB 2ZIOA 4JI3B 4UCUA 3RYIA 4DR6B 1TGOA 4B3TB 1PDGA 4K8ZA 4B3MB 1TZIV 2R70A 4FM0A 3JAKB 5LP6C 3SJAC 1N33B 4DV1B 5IWAB 5HI3A 1M4UA 4EDXV 5IYZB 3HKDA 4YJ3B 2PYJA 4FLTA 2FJHV 5KHHA 4DR4B 1SQFA 3U10A 5EZYA 2IFGE 2PY5A 5AEJA 1G6UA 5BMVB 3VQVA 1FFXB 5JCOA 4X1IB 1BTGA 4CC5A 3QTKA 5FPRA 3SJCC 4LH7A 2GYZA 4PI0A 4CH3A 5F3HI 4GLNE 2ZCEA 5KHIA 4AQYB 1I7FA 1HW7A 5LP6A 3JATA 5LYJB 2GH0C 3QG5A 2QJAA 4EDWV 1IBMB 4UI1A 5KX5B 5BQ8D 3WB0A 2R72A 4EEQA 5IYZA 3HKBB 2VQFB 1E9JA 2OWOA 1JFFA 4EB6B 3RJRA 1JMKC 1FLTV 3SEKB 3RYHB 1QQCA 4FLXA 2QM4A 1KLAA 4LFBB 1WQ9A 1TUBB 4UI0A 2VQEB 5BQ8B 4ZI7A 3UT5B 5C8YB 3BABA 3JVFA 1B98A 4O4LB 1WPBA 2R52A 1H2SB 3JASB 5JQGB 1XNRB 5LA6A 2PJYA 1Q5OA 3T1HB 4UCVA 2UU9B 3HKCB 3BK3A 1WAQA 4UHZA 3BMPA 2VWEA 1HD4A 1B8MB 1CZ8V 3JALA 3PN1A 3VQWA 4DUYB 2H62A 2UXBB 3K5LA 1FL7B 1ZAUA 4JYAB 1XNQB 4YCGC 4CS2A 2UUBB 4X1KA 5JH7B 1HNXB 4O2AA 5CA0B 4KZNA 4KV5A 2TGIA 1BJ1V 5BR8B 3BA8A 1WN7A 2PGGA 2C7WA 1X4TA 2ZNJA 4F6RB 4DV7B 2UUAB 5BPUA 3RWRD 3WB2A 2ZNIA 5LMNB 1TAEA 4GKJB 3RYHA 4K8XA 2PYLA 4I4TB 3RGBA 2P22C 5KHJA 1KMIZ 2VWJA 2GOOA 1TFGA 1ES7A 1LX5A 4LFCB 5BQ8A 3UT5A 4X62B 1BNDB 4LF7B 5ITZB 4O4LA 5LXTB 2QJ9A 4DV3B 5JQGA 4PHZA 1XMOB 2GV9A 2OYQA 4U3JB 2IM9A 1MKGA 2P5OA 1N36B 1N34B 1B8MA 1WQ8A 4AY9B 4ZFFC 5FPOA 2XACA 1SA0B 4LF4B 1LXIA 4JI2B 3SR2C 4FAOA 4UCTA 3JAWB 3N2GB 2XHBA 2UXCB 4AILC 1JJOA 5J2UA 4LF8B 4LXRJ 3M7MX 4BW9A 4JI7B 4UHYA 5GONB 5F3BC 3JSLA 3UQ8A 1XMQB 2QJ1A 1B04A 1TVKB 3E22B 4HQUA 1NYUB 2P6AA 1BNDA 5CA1B 2KKWA 4X20A 5JJNB 4DRXA 3LNNA 5EYPB 4JI1B 4EFVA 3IJ2A 4U3JA 5FNVA 4DK0A 2PUSA 3K5MA 4YCIC 2ZINA 4CH6A 2ZIMA 5JVDA 1SQGA 1VPFA 2PZSA 1XQ8A 2XV7A 5J2TA 1AGQA 4ZHQA 2Q7GA 3KFDA 3N2KA 4GYCB 4LR3A 3QB4A 1TA8A 4IIJB 2VXSA 2JS5A 1MJVA 3BAAA 4X1JA 4JI6B 4YJ2B 3QF7A 1XI1A 3JAKA 4CH5A 5CB4B 1SKVA 5HK5A 4FFBB 5HHVA 2B0UA 5KMGB 4EFBA 5BQEB 3BPZA 4DV0B 2ARVA 3K57A 3FUBB 5GONA 4YJ3A 1YEWA 3QTCA 4FLVA 1L8DA 2RQ6A 3ETQA 5IJ0B 4NXMB 2R53A 1HCNB 1TZHV 4IHJB 4DR5B 4BV4L 3BDYV 2ARPA 4FLYA 1DZ7A 4LH6A 5BMVA 1FFXA 3MJKA 4HNAB 1I94B 4X1IA 3S1BV 1V9PA 1O9HA 1WWWV 2H64A 4DK1A 3CB2A 4DR3B 4ZOLB 1AOCA 4OX9B 5IJ9B 3DSQA 5FV1V 4I55B 4GLXA 3U11A 4X66B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZI V;  1ES7 A;  1LX5 A;  4MQW B;  5BQ8 A;  1TGJ A;  3S1K V;  4ZBN A;  4LXS J;  1BND B;  5HHX A;  5HI3 A;  1M4U A;  2KD3 A;  3E07 A;  4EDX V;  2QJ9 A;  2QCQ A;  1S4Y B;  2IM9 A;  1XWD B;  1MKG A;  2FJH V;  5BQC A;  1QFW A;  1B8M A;  1WQ8 A;  2IFG E;  5FV2 V;  1REU A;  3V2A A;  5AEJ A;  4AY9 B;  4ZFF C;  1KTZ A;  2ASK A;  2QCW A;  2XAC A;  1BTG A;  1TGK A;  1ZKZ A;  3QTK A;  1LXI A;  2GYZ A;  4FAO A;  4XPJ A;  1FZV A;  5F3H I;  4GLN E;  4EAX A;  1REW A;  4GLS E;  4LXR J;  5HI5 A;  5HI4 A;  2V5E B;  1SG1 A;  3EO1 C;  4UHY A;  5F3B C;  2GH0 C;  1MKK A;  2QJA A;  3HH2 A;  4EDW V;  5BQE A;  4UI1 A;  4HQU A;  4MQW A;  4HSA A;  1NYU B;  2P6A A;  4HR9 A;  5BQ8 D;  1BND A;  1FL7 A;  1HCN A;  3B4V A;  1E9J A;  4MPL A;  4QCI C;  1HRP B;  4QAF C;  5HK5 E;  4EFV A;  1BMP A;  3IJ2 A;  3RJR A;  1FLT V;  3SEK B;  4YCI C;  3EVS B;  4WPB A;  1NT3 A;  1PDG A;  1KLA A;  1VPF A;  2GYR A;  1NYS B;  1WQ9 A;  4UI0 A;  5JZ7 A;  2XV7 A;  2GNN A;  1AGQ A;  5BQ8 B;  3KFD A;  1SGF B;  3QB4 A;  2VXS A;  3JVF A;  3V6B A;  1BET A;  1B98 A;  1MJV A;  1B8K A;  4KXZ A;  4X1J A;  1HCF A;  2R52 A;  2VPF A;  5HK5 A;  2PJY A;  5HHV A;  2B0U A;  3BK3 A;  4N1D A;  1RV6 V;  1WAQ A;  1M4U L;  4UHZ A;  3BMP A;  5BQE B;  2VWE A;  1QFW B;  1VPP V;  3FUB B;  2ARV A;  4EC7 A;  1B8M B;  5HHC A;  1HD4 A;  1CZ8 V;  2H62 A;  2R53 A;  1JPY A;  1FL7 B;  1HCN B;  1XWD A;  4YCG C;  1TZH V;  4MID A;  5E4G A;  4BV4 L;  2QJB A;  3BDY V;  2ARP A;  3MJG A;  4KZN A;  4KV5 A;  1KAT W;  4AY9 A;  1DZ7 A;  2TGI A;  1BJ1 V;  4QHU C;  2C7W A;  3MJK A;  2X1W A;  2FJG V;  2BHK A;  5BPU A;  1HRP A;  3S1B V;  1QTY R;  1WWW V;  1WQ9 B;  2H64 A;  4HQX A;  4UI2 B;  2X1X E;  1AOC A;  1KLC A;  5BQB A;  3BUK A;  5FV1 V;  5HHD A;  2QR0 C;  3P9W A;  2GOO A;  1TFG A; 
#chains in the Genus database with same CATH topology
 3F7V C;  4TQF A;  4X88 A;  1FAF A;  1O9G A;  3N27 A;  1PPJ H;  1DGS A;  5HHX A;  2PF4 E;  1JQ0 A;  2GTS A;  2ZE8 A;  4MW3 A;  3FB7 C;  1S72 V;  1YIJ V;  1REU A;  2ADQ B;  3DTU B;  3U0Z A;  3APO A;  2RCV A;  1DLB A;  1FFT B;  3MAQ A;  2YIB D;  2Q8V A;  1NU1 H;  4GLS E;  1I94 O;  4R50 A;  4RQF A;  4D6T H;  4W4L A;  3RW0 A;  3HKC A;  4DR3 O;  2P06 A;  3HPL C;  3K9A A;  3IJ4 A;  3B4V A;  1ZLZ A;  3JAR A;  1BMP A;  3BA9 A;  3FAV A;  3TK1 A;  4J41 A;  5FL7 G;  3IC9 A;  4LWS A;  4JTC B;  4LCU C;  3K5N A;  2GYR A;  1WA8 A;  4MTF A;  2QR4 A;  4TOI A;  1NYS B;  3LDC A;  1GM8 A;  2VS0 A;  2GNN A;  3RBZ A;  2PI4 A;  1T5E A;  4NTX A;  3JCU Z;  5LP6 B;  3SYQ A;  4FLW A;  1Y76 A;  4MVO A;  2E5L B;  5ITZ A;  1M4U L;  2NR5 A;  3BEH A;  4MTX A;  5LOV B;  3CC4 V;  5IT9 N;  3OGC C;  4DR2 B;  1THZ A;  4O4H A;  1NT2 B;  3QO5 A;  1ZTE A;  4MID A;  3K08 A;  2ZDI C;  1H2G A;  3W7S A;  1D5A A;  2YIB A;  1RSO A;  2X1W A;  2FJG V;  1SA0 A;  1A32 A;  2HVJ C;  1HRP A;  1M93 A;  2ATK C;  1JPX A;  2CAZ C;  3ZN1 A;  1DTO A;  4J10 A;  4QAF C;  3P30 A;  3ZMZ A;  1XL6 A;  4P9P A;  3THO A;  4JI8 B;  3S1K V;  1WB8 A;  5EIB D;  1COW G;  2KD3 A;  4GCZ A;  1TVK A;  2LFS A;  3LDE A;  4JZ2 A;  2ZR3 A;  2OTJ V;  1K5Q A;  1UPG A;  3H1I H;  5CA1 A;  2FYU H;  2RNB A;  3LSQ A;  3ZED A;  5B5E Z;  5EYP A;  1YI2 V;  5H9C A;  4WF9 V;  3V2A A;  2E5L O;  4TV9 A;  4DV2 B;  1KTZ A;  1TGK A;  2RMK B;  2YI9 A;  2GSM B;  4DR2 O;  4KXR A;  1L0L H;  4LF9 B;  4WBN B;  4RWU A;  3SGI A;  1JCH A;  1VAR A;  1OZ0 A;  4HYO A;  4J9Z B;  4P30 A;  3UO3 A;  1IBL B;  2EZP A;  1NVP B;  1OCO B;  2YSU B;  4YJ2 A;  1BGY H;  1S0V A;  3CX5 F;  3VOU A;  4U3F H;  3ASO B;  1EBO A;  2L35 A;  3R66 A;  4Q6G A;  1IXM A;  3CYO A;  1X59 A;  1OCO C;  3ZMT A;  3HH2 A;  3K59 A;  1VQ9 V;  3ASO C;  4NXN B;  3FYI B;  5H6R A;  1F4M A;  1QU7 A;  4ZIB A;  4JI8 O;  1ENV A;  2FKX A;  2IW5 A;  4PI2 A;  4TUY A;  3FX7 A;  2V7Q G;  1I08 A;  3SPG A;  4R7C A;  5B1N A;  1PNM A;  2ILM A;  3GB7 C;  4DV2 O;  2Q0A A;  4I0X A;  2OTL V;  2LGQ A;  2ZKO A;  2WPD G;  2N05 A;  3HKD B;  1HCF A;  1IXB A;  4JAA A;  5JJJ B;  2PTM A;  2JS3 A;  3E83 A;  3L74 H;  1YDX A;  4HZ3 A;  4F6E A;  4LF9 O;  1VEW A;  3W7T A;  3NR7 A;  4X1Y A;  2DJV A;  1N4C A;  2EIM B;  2VRZ A;  1IBL O;  1XWD A;  2DYS B;  1Y6X A;  3X2Q C;  4X20 B;  3JYC A;  5DEC A;  4P2Z A;  1H2L A;  1KU9 A;  2QE7 G;  2GUZ B;  4CZZ A;  2DYS C;  3H9V A;  2HR3 A;  4YIP A;  4QGP A;  4NXN O;  1XL4 A;  5TIS Z;  1K92 A;  2E74 B;  4UI2 B;  2Q73 A;  4BR6 A;  1Q8I A;  4PV1 B;  2ZIO A;  4UCU A;  3CRM A;  2OCC B;  1PDG A;  5HFM A;  4FM0 A;  3JAK B;  1V54 B;  1Y67 A;  3ZHV A;  1FD9 A;  1M4U A;  2OCC C;  5IYZ B;  3AG1 B;  4MVQ A;  1BSM A;  3D36 C;  2JJ1 G;  4YJ3 B;  1V54 C;  5IE9 A;  3IGA C;  4JGS A;  2FJH V;  4DR4 B;  4DW0 A;  1SQF A;  3AG1 C;  5EZY A;  3AK1 A;  1DF4 A;  1G6U A;  1FFX B;  1XRE A;  3ZHQ A;  4X1I B;  4C7U A;  1BTG A;  3QTK A;  4GX0 A;  3ZIA G;  4LH7 A;  3K03 A;  1EM1 A;  2GYZ A;  1LUW A;  3CCJ V;  3FB5 C;  1SQV H;  4A5U B;  1S3J A;  3GWO A;  2ZCE A;  4AQY B;  5HFL A;  1RP3 B;  3F7Y C;  1N8R W;  3JAT A;  2AHY A;  4GZR B;  1Y74 B;  4JI2 O;  1US6 A;  3QVN A;  3ZHR A;  2OWO A;  1QQC A;  2AXT Z;  2EIJ B;  1B06 A;  2EIJ C;  4JAV A;  3BAB A;  1WPB A;  3ZRW B;  1MSW D;  3JD3 A;  4X9Q A;  2D2C B;  3A0H Z;  3CCR V;  4UHZ A;  3BMP A;  3A0R A;  3PN1 A;  1H8E G;  2JJ2 G;  3Q4H A;  3AG7 A;  4AQY O;  4JYA B;  4YCG C;  4CS2 A;  4O2A A;  5CA0 B;  4XDL A;  2TGI A;  5BR8 B;  1ZL8 B;  3BA8 A;  1P4R A;  1WPX A;  4DV7 B;  2XAS A;  2Z0A A;  2Q69 A;  1RPR A;  4K8X A;  1P7G A;  2PYL A;  1NZ6 A;  4I4T B;  2HG5 C;  1FPO A;  3ZHT A;  2KG7 A;  3K9S A;  5LBQ A;  1ES7 A;  2JGD B;  3C3S A;  3UT5 A;  3T4D A;  1BND B;  4O4L A;  5LXT B;  2HKO A;  1R6N A;  5AG2 A;  5JQG A;  2LQT A;  4PHZ A;  4TT3 G;  1GRJ A;  3H01 A;  4GT1 A;  1MKG A;  1D5N A;  3B8M A;  1XDC A;  4FMT A;  5FPO A;  3UO2 A;  4JF3 A;  2QWR B;  2HP8 A;  1NKD A;  4LF4 B;  1L1F A;  4K3A A;  4JYA O;  4WFB V;  2XHB A;  5BR8 O;  4LXR J;  3FKS G;  4DV7 O;  3TXS A;  2BCC H;  5DN6 G;  3E22 B;  4HQU A;  2YEV B;  2WLH A;  2Q67 A;  3CCE V;  1AIL A;  2X6B A;  4U3J A;  4DK0 A;  3DXR A;  4UB6 Z;  1JX9 A;  2P7T C;  1SQG A;  4ZBM A;  4LP8 A;  1XQ8 A;  1NH2 D;  2Q7G A;  3KFD A;  3N2K A;  4GYC B;  3QB4 A;  2X7R B;  1S5L Z;  5EC1 C;  2FML A;  2F23 A;  4JI6 B;  4LF4 O;  5CB4 B;  1MA1 A;  4FFB B;  2B0U A;  5BQE B;  4ABM A;  1J95 A;  4DV0 B;  1JA8 A;  3QTC A;  3ASN B;  3OR6 C;  4NXM B;  2XND G;  1TZH V;  3W7U A;  4IHJ B;  4BV4 L;  2B5U A;  2OCH A;  4FLY A;  5BMV A;  2Z3Y A;  1Q6I A;  1V9P A;  1YHQ V;  1O9H A;  3UKM A;  4MS2 A;  1WWW V;  4ZOL B;  4OX9 B;  4RUF A;  1SES A;  1GN2 A;  4X66 B;  4O4I B;  1NI8 A;  4G2K A;  5LYJ A;  1NTZ H;  2DW4 A;  4IIJ A;  4DR1 B;  4YHH B;  1SS3 A;  1VQK V;  1VQO V;  1R3J C;  1K34 A;  2DYR B;  3LDD A;  3RVY A;  2YIA A;  1AR5 A;  4TWK A;  3TCU A;  1EN5 A;  3ZMV A;  5KMG A;  1OCC C;  3HKB A;  4JI6 O;  1FS0 G;  4CS3 A;  3WB1 A;  2DYR C;  5FV2 V;  2MW2 B;  1HP8 A;  4DV0 O;  1VQP V;  1SQP H;  1F4N A;  2XAJ A;  4UV9 A;  4CH4 A;  3ABU A;  5K1X A;  4NXM O;  1N32 B;  4HNA A;  3KKY A;  1TUB A;  4XPJ A;  4TV8 B;  2A3Q A;  5C8Y A;  3G80 A;  5HI4 A;  3IAY A;  3ETG A;  3K04 A;  4UB8 Z;  3JAS A;  2EJ7 A;  4GX5 A;  3VQY A;  4OX9 O;  4FFK A;  1YIT V;  1FL7 A;  1PD3 A;  2C2A A;  1RFY A;  4IL6 Z;  4X66 O;  1W0K G;  3ICX A;  2UXD B;  4QCI C;  5KLV H;  1N0N A;  4LNU B;  4ASU G;  3G67 A;  4YHH O;  5H5N A;  1ZX3 A;  1Q3E A;  4DR1 O;  1BL8 A;  4LF5 B;  4FLU A;  2Q9L A;  3ABT A;  5JCO C;  1FXK A;  1FXV A;  3GVM A;  5GTI Z;  3M99 B;  5CMU A;  3BFR A;  3CE2 A;  4PDV A;  2WLI B;  3JD0 A;  5DM6 V;  4UFZ A;  1N32 O;  4BIO A;  1VQ7 V;  1RV6 V;  5HHC A;  1ZWI C;  4UCR A;  2BSK B;  2Q7H A;  4DW1 A;  1LNQ A;  5E4G A;  2GDS A;  3MJG A;  5A2Q N;  4RO2 A;  2P4K A;  1JFF B;  4NR1 A;  3BHP A;  1QLE B;  3CSX A;  4IYH A;  4NTY A;  3MDS A;  2ODM A;  3CP1 A;  4WFG A;  2QKS A;  2UXD O;  1WQ9 B;  4BIU A;  2CGO A;  3JAW A;  4OGQ B;  4ZI7 B;  3R65 A;  1KC8 W;  4LF5 O;  4L87 A;  3P9W A;  4YY3 O;  1JVM A;  2QEX V;  3F5W C;  4MW8 A;  1M1K W;  1TGJ A;  4DR7 B;  5LA6 B;  1AJN A;  4RQE A;  4EKW A;  4BW5 A;  5BQC A;  5LOV A;  1FJG B;  4X1K B;  5L3G A;  2ZDI A;  4G27 B;  2QCW A;  1YCI A;  3OMA B;  4UCS A;  3K58 A;  2QSA A;  1IBK B;  4HAM A;  2HVK C;  1FZV A;  1VQ4 V;  1J5E B;  2V5E B;  1SG1 A;  3T1Y B;  1NTM H;  3HKE B;  3ZRV A;  5IJ0 A;  1HCN A;  2XT9 A;  1YVW A;  1Z5W A;  4DR7 O;  5HK5 E;  1XOU A;  4WPB A;  1XUQ A;  4JI0 B;  3I5D A;  3WG7 B;  4DO2 A;  2K1E A;  5GTH Z;  1FJG O;  1P49 A;  1M5I A;  1SZT A;  2Q4P A;  4D7T A;  1M9N A;  5J2U B;  3CD6 V;  1SGF B;  2RN9 A;  2YUA A;  5E79 Z;  4WBN A;  5BZB A;  3CCQ V;  1IBK O;  2WLL A;  1G1X B;  1URF A;  1R3I C;  5LGU A;  3CHX A;  4EC7 A;  2V4D A;  1VPP V;  3T4Z A;  1J5E O;  2LJ2 A;  1AP5 A;  2A9H A;  3L71 H;  1VQN V;  3PJS K;  2VQE O;  4EFE A;  2QJB A;  2HHH B;  2CTP A;  4DRX B;  5L3C A;  3T1Y O;  1K73 W;  3TJT A;  2EZO A;  4Q20 A;  3SYP A;  5D5P A;  4FM1 A;  1BQ0 A;  2QKC A;  3AG2 B;  3OM3 B;  4K0K B;  1QTY R;  2PI5 A;  1OCR B;  2QGN A;  5F2V O;  3OMN B;  2X1X E;  5J2T B;  4ZHQ B;  4RAI A;  2QA4 V;  2JIZ G;  3GWK C;  1OCR C;  4JI0 O;  2R70 A;  3ZHU A;  5LP6 C;  3SJA C;  5IWA B;  3HKD A;  1K33 A;  1WB7 A;  2A06 H;  1Z2G A;  3AG4 B;  3RT3 C;  2IFG E;  3E86 A;  2PY5 A;  3VQV A;  3FB6 C;  2CTR A;  1SQX H;  5J9P C;  3AG4 C;  2W6I G;  5FPR A;  3SJC C;  4PI0 A;  1GM9 A;  3JD4 A;  3CJH B;  5IYD O;  2HHH O;  5F3H I;  3HR0 A;  1JJ2 U;  3SYO A;  2JRI A;  5KHI A;  1I7F A;  3K3W A;  4FK5 C;  1EZJ A;  4K0K O;  4JZG A;  3STZ C;  1KQS U;  3CPW U;  3H1K H;  4EDW V;  2AZ0 A;  1IBM B;  4UI1 A;  2YS8 A;  3WB0 A;  2R72 A;  5IYZ A;  1IVS A;  3ML0 A;  1S76 D;  5IWA O;  1Q81 W;  4JTA B;  3AEI A;  1KLA A;  3MHS C;  4UI0 A;  1QBZ A;  2KQX A;  4PD4 F;  3TET A;  2D3O W;  2Q68 A;  1B98 A;  1MSD A;  4NKG B;  1OV9 A;  2Y4U A;  1Q5O A;  2QTS A;  3HKC B;  4LBE C;  1PNK A;  1OHH G;  3BCC H;  1B8M B;  1KKD A;  3JAL A;  4QJF B;  4DUY B;  1CPY A;  4XBF A;  1N0J A;  1ZAU A;  2UUB B;  1RPO A;  2CH7 B;  1Y74 A;  4KV5 A;  2OIE A;  3FAV B;  2B1G A;  2ZNJ A;  1IBM O;  4LWS B;  2UUA B;  3CCU V;  1BQZ A;  3RWR D;  3WB2 A;  4PDR A;  1JR9 A;  1WA8 B;  4RUE A;  1BE3 H;  2DQ3 A;  2L6L A;  3RGB A;  3BVO A;  3LSS A;  1AJQ A;  1SQQ H;  1Y76 B;  4LF7 B;  5ITZ B;  4PDL A;  3L70 H;  4PA6 A;  4DV3 B;  3LNM B;  2CDY A;  1MAB G;  1XMO B;  2EIM C;  1K9M W;  3OE7 G;  1N34 B;  2V1D A;  3HB3 B;  3P3P A;  1SER A;  1RSO B;  1H2M A;  1SA0 B;  4DUY O;  1LXI A;  5FLX N;  4JI2 B;  2IJJ A;  2Q5Z A;  3SR2 C;  2UUB O;  4FAO A;  1WP7 A;  4FZ1 A;  1NTK H;  2FTK A;  4UCT A;  4AIL C;  1VQL V;  3JD2 A;  2UUA O;  4UHY A;  4JI7 B;  3JSL A;  5IYC O;  2QJ1 A;  1B04 A;  1TVK B;  5CBG A;  1QR8 A;  1I0H A;  2CTQ A;  2W0F C;  1BND A;  3E8F A;  5CA1 B;  1NR7 A;  4G28 B;  5JJN B;  4I7Z B;  3LNN A;  5EYP B;  4JI1 B;  4EFV A;  4LF7 O;  3EXA A;  5FNV A;  2NLJ C;  3CEI A;  4DV3 O;  1MG1 A;  2ZIN A;  2ZIM A;  5JVD A;  1VQ6 V;  1XMO O;  1VPF A;  1HWY A;  4FZ0 A;  5H6Q A;  1N34 O;  1K4D C;  1AGQ A;  4LR3 A;  3O9O A;  4X1J A;  4YJ2 B;  3QF7 A;  4MTO A;  1SKV A;  2MK3 A;  3G71 V;  2ARV A;  3ZMU A;  5H2F Z;  3P3N A;  3FYE B;  4JI7 O;  3DC6 A;  2ADP A;  1AI7 A;  2ZE7 A;  1F51 A;  1DZ7 A;  3I56 V;  4LH6 A;  5E1A C;  1E1R G;  1NS1 A;  3MJK A;  3K0G A;  1PNL A;  1R6T A;  4QE7 A;  2H64 A;  4DK1 A;  1GM7 A;  1AOC A;  4JI1 O;  5FV1 V;  4I55 B;  3UM7 A;  2WA4 A;  4X64 B;  4MQW B;  4QPK A;  2XOK G;  1PL0 A;  3E07 A;  4X1Y B;  5KX5 A;  3RYF B;  2H94 A;  4H44 B;  4UV8 A;  4FFB A;  2JGU A;  4O2B B;  1IX9 A;  1XWD B;  2Q6A A;  4LF6 B;  3QO7 A;  3J7A U;  1B6Q A;  4EB6 A;  2BTQ B;  1I5X A;  3FFQ A;  3ZCC A;  2YIC A;  1GH6 A;  4WFF A;  2XAH A;  2E3C A;  1AP6 A;  3SYA A;  4EAX A;  5C93 A;  2QWQ B;  1H8H G;  5LMU B;  4J42 A;  1K5S A;  1ARO P;  3ZS8 C;  4JI5 B;  3SJB C;  5KHK A;  4DV6 B;  3AK2 A;  3ABL B;  2QWN B;  5JH7 A;  4X64 O;  4MPL A;  5EZY B;  2GTA A;  1GO3 F;  4F6R A;  2EIN B;  3ABL C;  2R9I A;  1E79 G;  5LGT A;  2F95 B;  4XDJ A;  4LF6 O;  3CRR A;  2EIN C;  5B1B B;  1D2D A;  4HBN A;  1R3K C;  3V6B A;  1BET A;  5B1B C;  4TV8 A;  1XBL A;  1FXH A;  3JAT B;  2DE0 X;  4FM2 A;  1QFW B;  4DUZ B;  4FPP A;  1IUR A;  1QHT A;  5LMU O;  4O4J B;  4JYC A;  4AY9 A;  4H33 A;  4JI5 O;  1AR4 A;  2JVD A;  4LNU A;  3RYC B;  4DV6 O;  5JJE B;  4H37 A;  2HJF C;  1SRY A;  3SJQ C;  3N2G A;  3VQX A;  2EIL B;  3K0D A;  2QR0 C;  1H2N A;  3A0B Z;  3IFX A;  4JYY A;  4UUJ C;  2K9P A;  4MVM A;  5KAF Z;  5DED A;  4WFH A;  4LXS J;  4ZBN A;  4I9Q A;  4CBC A;  3ASN C;  3Q4H B;  1M57 B;  2YXL A;  1CXZ B;  3IC7 A;  4O2A B;  3OD4 A;  1YJW V;  1PM9 A;  2BSK A;  5D5Q A;  1M57 C;  4E2L A;  2Y69 B;  3A2F A;  3CWB H;  1ZKZ A;  5EBM C;  1WNS A;  4DUZ O;  1KB9 F;  2Y69 C;  4NYK A;  2YI8 A;  2JDI G;  4Z2W A;  2Y0I A;  1REW A;  1Q90 D;  4PA3 A;  2KG7 B;  1Q6H A;  2LO1 A;  4I50 B;  5L3F A;  3OEH G;  1NQT A;  1MKK A;  3CC7 V;  3CXC U;  5GW7 A;  4HSA A;  1AJP A;  2P4V A;  3ETE A;  2Q7E A;  3ABK B;  4H13 B;  3H1H H;  5EC2 C;  2KB1 A;  2F4V B;  2WWW A;  3ABK C;  2YXY A;  1Q82 W;  1ZUQ A;  3CS5 A;  4L8J A;  4DYL A;  3RYI B;  2EX3 A;  3ZHS A;  4B3R B;  4UVC A;  4ICG A;  5IJ9 A;  3C90 A;  3KCY A;  4J7J A;  3QNE A;  4XDK A;  1B8K A;  5LGN A;  4NTW A;  1LUV A;  2AHZ A;  4JI4 B;  4N1D A;  3BRC A;  2F93 B;  2BE3 A;  4JAS A;  3W7X A;  1QR9 A;  2BOB C;  1HNZ B;  2QM7 A;  4B08 A;  3E35 A;  1K97 A;  1NBM G;  4YY3 B;  3B09 A;  2KSD A;  1HR0 B;  3HKE A;  3K79 A;  4MSW C;  2DMX A;  3DXR B;  3ZMS A;  4X65 B;  1JOY A;  1XNR O;  1YTF B;  2DOS A;  2W6J G;  2LW1 A;  4R8C A;  4HQX A;  4DV5 B;  2F4V O;  5BQB A;  1TUE B;  1DK1 A;  1Q6U A;  1QCE A;  3N2K B;  2P90 A;  4JI3 B;  4OXS A;  4DR6 B;  2E76 B;  4K8Z A;  1TZI V;  4FJC C;  1S5H C;  1N33 B;  3OT7 A;  1BT8 A;  4DXW A;  4B3R O;  4KUM A;  4E4E A;  4FLT A;  4U7N A;  4WFE A;  5KHH A;  3AG3 B;  4WCE V;  1VMG A;  3RVZ A;  2A79 B;  4JI4 O;  1YXB A;  1AI6 A;  5BMV B;  3OUS A;  1QLE C;  1KUQ A;  2AGA A;  3AG3 C;  5IDJ A;  1HNZ O;  2IH3 C;  5B1A B;  1HR0 O;  1VP7 A;  1PKX A;  3AK3 A;  4GLN E;  5B1A C;  4X65 O;  1HW7 A;  2EBO A;  5LP6 A;  2H3O A;  5LYJ B;  2GH0 C;  3B4S A;  4NB5 A;  3TXQ A;  2QJA A;  4DV5 O;  4MT8 A;  1NVP D;  1VF6 C;  4JI3 O;  5KA5 A;  3S3X A;  4DR6 O;  1IZ3 A;  4EEQ A;  3G4S V;  2CGN A;  3HKB B;  1YSC A;  1N33 O;  2XAG A;  1JMK C;  2ZR2 A;  1FLT V;  1EFR G;  3RYH B;  3SEK B;  2DWD C;  5L3B A;  2GBO A;  1KP3 A;  1PL4 A;  3J80 N;  1EZV H;  3OMI B;  1TUB B;  2JEX A;  2VQE B;  5BQ8 B;  5C8Y B;  2G38 A;  1BHB A;  3JVF A;  3OAA G;  2R52 A;  3JAS B;  4MVU A;  2Y4T A;  1LR1 A;  3LSU A;  3G6E V;  2PJY A;  3T1H B;  4JTD B;  2UU9 B;  3BK3 A;  3SYC A;  1WAQ A;  1H2K A;  4IT5 A;  2VWE A;  2H62 A;  3OGI B;  1Q7Y W;  1FL7 B;  1KP2 A;  1HNX B;  2ARH A;  3P32 A;  1W59 A;  1BCC H;  1BJ1 V;  2PGG A;  1KBH A;  1X4T A;  3JCZ A;  4H0L B;  1R3L C;  2QWP B;  1HDJ A;  4GX1 A;  4QE9 A;  4YIO A;  5BPU A;  2HLD G;  4I9W A;  5LMN B;  2DWE C;  3WG7 C;  4J9Y B;  4X89 A;  1FXK B;  3WFV A;  2Q0O C;  1KMI Z;  2VWJ A;  1UJW B;  2GOO A;  1TFG A;  4U7O A;  1FXK C;  2X6C A;  4LFC B;  4UXN A;  4WFA V;  1Q86 W;  3CRQ A;  2GV9 A;  2YXH A;  2R9R B;  2IM9 A;  4OPA A;  2P5O A;  2OT5 A;  4J11 A;  3E2E A;  1B8M A;  2WLK A;  1WQ8 A;  3T1H O;  2QTO A;  4KP4 A;  2UU9 O;  4ZFF C;  2A0L A;  2XAC A;  3L73 H;  2CH7 A;  2UXX A;  3AG2 C;  2WLJ A;  1HNX O;  3JAW B;  4PJ0 Z;  2UXC B;  5B1O A;  5LHG A;  3M7M X;  4BW9 A;  5GON B;  5LMN O;  2IU0 A;  3UQ8 A;  1XMQ B;  1F7Y A;  3E8G A;  3A8T A;  3B8N A;  1G8M A;  2LFR A;  2P6A A;  5EBL C;  1G4Y B;  1P84 F;  2KKW A;  4LFC O;  4X20 A;  4B7K A;  1CEZ A;  1YF2 A;  2WLM A;  3IJ2 A;  2M6Y A;  2PUS A;  3CXH F;  3K5M A;  2GUZ A;  3EFF K;  4PA7 A;  2PZS A;  1GAX A;  2IJK A;  2ZD9 A;  2IJI A;  1TA8 A;  3E8H A;  2VXS A;  2JS5 A;  4LC1 A;  1MJV A;  3G6B A;  1XI1 A;  2Z5U A;  3D36 A;  3JAK A;  3H1J H;  3B77 A;  1RM1 B;  4EFB A;  3BPZ A;  5L3D A;  3FUB B;  2LP7 A;  4YJ3 A;  3CCV V;  2UXC O;  2IJH A;  1L8D A;  2RQ6 A;  3ETQ A;  5IJ0 B;  1HCN B;  2ZXW B;  4MVR A;  1GN3 A;  1RM1 C;  1ROP A;  4DR5 B;  4N23 A;  3BDY V;  2ARP A;  1XMQ O;  1AI4 A;  1FFX A;  4J7Z A;  3M8A A;  2ZXW C;  4X1I A;  2P6J A;  3ZBH A;  1FKA O;  3CB2 A;  3CCM V;  3DSQ A;  2RDC A;  3U11 A;  1K8A W;  2A7W A;  1BZK A;  2WLL B;  4BWA A;  1GTO A;  3JAR B;  5B66 Z;  1AVM A;  2UUC B;  1S4Y B;  4GX2 A;  1AI5 A;  5K1P A;  2YC0 A;  1QNM A;  4KHP B;  3K06 A;  2P67 A;  4FIP C;  4JPR A;  1GN4 A;  2N04 A;  3CRC A;  4UCO A;  4DR5 O;  3ZN0 A;  4P9O A;  2CK3 G;  5HI5 A;  5B3S B;  1VF5 B;  3ZRW A;  1AR1 B;  5L3E A;  4KFM A;  2DN9 A;  4O4H B;  4I55 A;  1AB3 A;  5B3S C;  4B3S B;  2HEP A;  4MQW A;  1MOF A;  3D3I A;  3K5O A;  4FVM A;  5KUK A;  2WA3 A;  3X2Q B;  5CA0 A;  1HRP B;  3RYF A;  3S3W A;  4X8A A;  1ZL8 A;  1S5J A;  4O2B A;  4PDM A;  1ORQ C;  3D8C A;  1E1Q G;  3EVS B;  2VWK A;  3DC5 A;  5KHG A;  2QKA A;  3JD1 A;  1W0J G;  2BTO A;  2UUC O;  2WLN A;  2BTQ A;  4CC6 A;  1BS3 A;  2EJR A;  2N74 A;  4FLZ A;  4I4T A;  3I55 V;  3C3T A;  4KHP O;  4KXZ A;  3CMA V;  2JGD A;  1OCZ B;  1EN4 A;  5LXT A;  2IBZ H;  2FL4 A;  1OCZ C;  5LL6 Y;  1JPY A;  4BIZ A;  4TV9 B;  4CS4 A;  4NVP A;  3JAM N;  1QVG U;  1KAT W;  1CP9 A;  3B2E E;  3EHB B;  4QHU C;  3T2M A;  4B3S O;  2BHK A;  3OTO B;  2XTA A;  2DQ0 A;  5JWP A;  2H8P C;  1Z5V A;  1XHZ A;  3ETD A;  3ZX6 A;  2YDE A;  4KL1 A;  3BUK A;  5HHD A;  1XIL A;  3LUT B;  1XHX A;  3MD0 A;  3D3Q A;  1SET A;  1WAZ A;  2B9Z A;  3UCS C;  1BMF G;  2OIG A;  2QDO A;  3L9D A;  2F66 C;  1F23 A;  4AHC A;  2HFE C;  3E22 A;  2YID A;  2YEV A;  3B40 A;  3VBB A;  2QCQ A;  3JAL B;  4TUY B;  1EN6 A;  1QFW A;  1OJH A;  2ITD C;  4PA9 A;  3JSN A;  5LHH A;  1QVF U;  2F1M A;  2ASK A;  4O4J A;  2HJD A;  3CC2 V;  4I0X B;  2FB5 A;  2CUG A;  2ZT9 B;  4MVZ A;  4JV5 B;  5EIB C;  4QIW F;  3RYC A;  1Q43 A;  3RN4 A;  4DR4 O;  3F5T A;  2B1I A;  3OTO O;  3EO1 C;  1SZX A;  5CB4 A;  4PEL A;  3H1L H;  3O65 A;  4I5S A;  5BQE A;  1FYJ A;  2R9A A;  1W2B U;  4HR9 A;  4UVA A;  4LFA B;  2ZE5 A;  4IHJ A;  3OTF A;  3FD9 A;  4GKK B;  5A9G A;  4TQD A;  1NT3 A;  1WLE A;  2XUM A;  2Y0P A;  1DF5 A;  5CBF A;  4DV4 B;  1MNG A;  5JZ7 A;  2JK5 C;  2E75 B;  4ZOL A;  1B3Q A;  1VF7 A;  1SF9 A;  3E8B A;  2IU3 A;  1P7B A;  4D7S A;  1UFI A;  4O4I A;  1HNW B;  4MVS A;  2F43 G;  2GHY A;  1YTF D;  2VPF A;  1V55 B;  3QO8 A;  1SC5 B;  4JV5 O;  4I50 A;  3RFR A;  2ETN A;  2RJZ A;  1V55 C;  4AI8 A;  3BY6 A;  3SPH A;  2ZM6 B;  1IDS A;  5FNV B;  3MHH C;  1H38 A;  2JEU A;  5CA3 A;  5JVD B;  4LFA O;  3KZI Z;  5BXZ A;  4IGG A;  3FB8 C;  1S77 D;  3WU2 Z;  4GKK O;  1PP9 H;  1KLC A;  3RYI A;  1XEQ A;  1TGO A;  3NXS A;  4B3T B;  3ZJZ A;  4B3M B;  2M7W A;  4DV1 B;  4DV4 O;  5HI3 A;  2X6A A;  4EDX V;  4PA4 A;  1MZF A;  4ZKI A;  2PYJ A;  1KD1 W;  3U10 A;  1VQ8 V;  1HNW O;  2BOC C;  3STL C;  3W7W A;  5AEJ A;  5JCO A;  4CC5 A;  2X0L A;  1WP8 A;  4CH3 A;  2EIL C;  1K3E A;  2ZM6 O;  5KAI Z;  1I5Y A;  4J80 A;  2WLI A;  3OR7 C;  5EBW C;  4J7K A;  4MTG A;  3QG5 A;  3OW2 U;  5KX5 B;  5BQ8 D;  2EIK B;  4JYB A;  4B3T O;  4B3M O;  4TSF G;  2VQF B;  1E9J A;  2XAF A;  4Z1M G;  2CE4 A;  4DV1 O;  1YJN V;  1JFF A;  4EB6 B;  2EIK C;  3RJR A;  3OEE G;  4GUN A;  4FLX A;  2QM4 A;  3ABM B;  4LFB B;  3EVK A;  4YXW G;  1WQ9 A;  3OUF A;  2NNU A;  4ZI7 A;  3ABM C;  3UT5 B;  1Y66 A;  5KUM A;  1QLN A;  1Y4M A;  4N21 A;  4O4L B;  3CCL V;  1R1B A;  1H2S B;  5JQG B;  1SQB H;  1XNR B;  5CBH A;  5LA6 A;  4UCV A;  5IY5 B;  1VQM V;  1U97 A;  1VF6 A;  1HD4 A;  2IH1 C;  5BY1 A;  1CZ8 V;  3VQW A;  2UXB B;  3K5L A;  5IY5 C;  1XNQ B;  1OCC B;  1KEC A;  4X1K A;  5JH7 B;  5LHI A;  2CTW A;  2QWO B;  2ZQM A;  3SDL A;  3SPC A;  4KZN A;  1WN7 A;  2C7W A;  5EK0 A;  1KYO F;  4F6R B;  1U96 A;  2W0X A;  2ZNI A;  1R6K A;  2O57 A;  3J81 N;  1TAE A;  4GKJ B;  1GMG A;  3RYH A;  2VQF O;  1YZB A;  2EUL A;  4W4K A;  2P22 C;  5KHJ A;  1LX5 A;  1M90 W;  5BQ8 A;  2NN4 A;  4X62 B;  4LFB O;  1GN6 A;  1YJ9 V;  3CRA A;  2QJ9 A;  4BAY A;  2OYQ A;  4U3J B;  1NJI W;  1ZSP A;  3KG2 A;  4QPJ A;  1N36 B;  2AZ2 A;  1VQ5 V;  4AY9 B;  4R6Z A;  2WSS G;  2UXB O;  4K35 A;  3E89 A;  1XNQ O;  1K4C C;  1R73 A;  5IYB O;  3N2G B;  4LF8 B;  1JJO A;  5J2U A;  4B7E A;  2Y48 A;  2QM8 A;  5F3B C;  4GKJ O;  3T1C A;  1GKF A;  1L0N H;  1NYU B;  1PV0 A;  3OFN G;  2WAM A;  1BHA A;  3SPJ A;  3CME V;  2ZE6 A;  2LGW A;  4DRX A;  4X62 O;  1GK9 A;  1MZE A;  2XAQ A;  4JAU A;  2UXN A;  4YCI C;  3ZRX A;  4CH6 A;  4Z1V A;  2ITC C;  4IYI A;  1N36 O;  4OPH A;  4UVB A;  2XV7 A;  5J2T A;  5CN0 A;  4ZHQ A;  3DGE A;  1NR1 A;  3CCS V;  4IIJ B;  3BAA A;  4F4L A;  3TGU H;  1M56 B;  4CH5 A;  1WJZ A;  5HK5 A;  5HHV A;  5KMG B;  2AW9 A;  3K57 A;  5GON A;  1M56 C;  1YEW A;  4FLV A;  4LF8 O;  2R53 A;  3L75 H;  4QNH B;  1NH2 B;  3ZRS A;  1MMM A;  1K7D A;  4HNA B;  1I94 B;  3S1B V;  5KA6 A;  3SPI A;  3APQ A;  1KKC A;  3L72 H;  3KCX A;  2LW7 A;  1VIB A;  4DR3 B;  3CJH A;  5IJ9 B;  4GLX A; 
#chains in the Genus database with same CATH homology
 4O4I B;  4X64 B;  4MQW B;  4TQF A;  5LYJ A;  1O9G A;  4IIJ A;  4BWA A;  1DGS A;  4DR1 B;  4YHH B;  5HHX A;  3E07 A;  3JAR B;  4X1Y B;  5KX5 A;  3RYF B;  2YIA A;  4FFB A;  2JGU A;  4O2B B;  1S4Y B;  2UUC B;  1XWD B;  5KMG A;  4LF6 B;  3HKB A;  4CS3 A;  3WB1 A;  5FV2 V;  1REU A;  5K1P A;  4EB6 A;  2BTQ B;  4KHP B;  3FFQ A;  3U0Z A;  4CH4 A;  4UCO A;  5K1X A;  3MAQ A;  1N32 B;  4HNA A;  1TUB A;  4XPJ A;  2YIB D;  2E3C A;  4TV8 B;  4EAX A;  5C8Y A;  4GLS E;  5HI5 A;  5HI4 A;  3IAY A;  5LMU B;  3JAS A;  3ZS8 C;  4O4H B;  4I55 A;  3HKC A;  4JI5 B;  3VQY A;  3SJB C;  4B3S B;  2HEP A;  4MQW A;  5KHK A;  1FL7 A;  4DV6 B;  3K5O A;  4FVM A;  3ICX A;  2UXD B;  3B4V A;  5JH7 A;  4MPL A;  3JAR A;  5CA0 A;  4QCI C;  1HRP B;  5EZY B;  3RYF A;  4LNU B;  1BMP A;  3BA9 A;  4O2B A;  1S5J A;  1Q3E A;  4F6R A;  4LF5 B;  3EVS B;  2VWK A;  5KHG A;  3K5N A;  2BTO A;  4FLU A;  2GYR A;  2F95 B;  4TOI A;  2BTQ A;  4CC6 A;  1NYS B;  5JCO C;  4FLZ A;  2GNN A;  4I4T A;  4HBN A;  3V6B A;  1BET A;  1T5E A;  4KXZ A;  4TV8 A;  5LP6 B;  3JAT B;  4FLW A;  4UFZ A;  2E5L B;  5ITZ A;  1RV6 V;  4FM2 A;  1M4U L;  5LXT A;  5LOV B;  1QFW B;  5HHC A;  4DUZ B;  4UCR A;  2Q7H A;  4O4H A;  4DR2 B;  1JPY A;  1NT2 B;  4TV9 B;  4CS4 A;  1QHT A;  4NVP A;  4MID A;  4O4J B;  5E4G A;  3MJG A;  1KAT W;  4AY9 A;  1D5A A;  1JFF B;  3B2E E;  4QHU C;  2YIB A;  1RSO A;  3BHP A;  2X1W A;  3CSX A;  2FJG V;  1SA0 A;  2BHK A;  3OTO B;  1HRP A;  2JVD A;  1M93 A;  4LNU A;  3RYC B;  5JJE B;  1Z5V A;  1XHZ A;  1WQ9 B;  2CAZ C;  3JAW A;  3VQX A;  3N2G A;  4KL1 A;  4ZI7 B;  3BUK A;  5HHD A;  2QR0 C;  3P9W A;  4QAF C;  1XHX A;  1TGJ A;  3THO A;  4DR7 B;  4JI8 B;  5EIB D;  4LXS J;  3S1K V;  5LA6 B;  4ZBN A;  2KD3 A;  1TVK A;  2F66 C;  4AHC A;  4I9Q A;  3E22 A;  2QCQ A;  3JAL B;  4TUY B;  5BQC A;  5CA1 A;  5LOV A;  1FJG B;  4X1K B;  2YXL A;  1QFW A;  4O2A B;  3ZED A;  5EYP A;  3JSN A;  3V2A A;  5D5Q A;  4TV9 A;  3A2F A;  2F1M A;  4DV2 B;  1KTZ A;  2ASK A;  2QCW A;  1TGK A;  4O4J A;  1ZKZ A;  2YI9 A;  1WNS A;  4UCS A;  3K58 A;  1IBK B;  4LF9 B;  4WBN B;  1FZV A;  3SGI A;  2YI8 A;  4JV5 B;  5EIB C;  3RYC A;  1REW A;  1Q43 A;  1J5E B;  1IBL B;  2V5E B;  4YJ2 A;  1SG1 A;  3EO1 C;  4I50 B;  5CB4 A;  3T1Y B;  1MKK A;  4Q6G A;  3HH2 A;  5BQE A;  2R9A A;  4HSA A;  3HKE B;  3K59 A;  5IJ0 A;  4HR9 A;  4NXN B;  1HCN A;  2Q7E A;  4LFA B;  4ZIB A;  4IHJ A;  3OTF A;  1Z5W A;  4GKK B;  5HK5 E;  2F4V B;  4TQD A;  4PI2 A;  4TUY A;  4WPB A;  1NT3 A;  4JI0 B;  4L8J A;  3RYI B;  2EX3 A;  4DV4 B;  1P49 A;  1M5I A;  4B3R B;  5JZ7 A;  4ZOL A;  4D7T A;  5IJ9 A;  1VF7 A;  5J2U B;  1SGF B;  2Q0A A;  4WBN A;  4D7S A;  1B8K A;  4O4I A;  3HKD B;  1HCF A;  5JJJ B;  1HNW B;  2PTM A;  4JI4 B;  2VPF A;  4N1D A;  3BRC A;  3CHX A;  2F93 B;  4EC7 A;  2V4D A;  1VPP V;  4X1Y A;  4I50 A;  3RFR A;  1HNZ B;  4B08 A;  2RJZ A;  1XWD A;  4YY3 B;  4EFE A;  4X20 B;  1HR0 B;  2QJB A;  2HHH B;  3HKE A;  4DRX B;  2ZM6 B;  5FNV B;  1KU9 A;  5D5P A;  4FM1 A;  4X65 B;  5JVD B;  4K0K B;  1QTY R;  4HQX A;  4DV5 B;  4UI2 B;  2X1X E;  5J2T B;  4ZHQ B;  1KLC A;  5BQB A;  1Q8I A;  3N2K B;  2ZIO A;  4JI3 B;  4UCU A;  3RYI A;  4DR6 B;  1TGO A;  4B3T B;  1PDG A;  4K8Z A;  4B3M B;  1TZI V;  2R70 A;  4FM0 A;  3JAK B;  5LP6 C;  3SJA C;  1N33 B;  4DV1 B;  5IWA B;  5HI3 A;  1M4U A;  4EDX V;  5IYZ B;  3HKD A;  4YJ3 B;  2PYJ A;  4FLT A;  2FJH V;  5KHH A;  4DR4 B;  1SQF A;  3U10 A;  5EZY A;  2IFG E;  2PY5 A;  5AEJ A;  1G6U A;  5BMV B;  3VQV A;  1FFX B;  5JCO A;  4X1I B;  1BTG A;  4CC5 A;  3QTK A;  5FPR A;  3SJC C;  4LH7 A;  2GYZ A;  4PI0 A;  4CH3 A;  5F3H I;  4GLN E;  2ZCE A;  5KHI A;  4AQY B;  1I7F A;  1HW7 A;  5LP6 A;  3JAT A;  5LYJ B;  2GH0 C;  3QG5 A;  2QJA A;  4EDW V;  1IBM B;  4UI1 A;  5KX5 B;  5BQ8 D;  3WB0 A;  2R72 A;  4EEQ A;  5IYZ A;  3HKB B;  2VQF B;  1E9J A;  2OWO A;  1JFF A;  4EB6 B;  3RJR A;  1JMK C;  1FLT V;  3SEK B;  3RYH B;  1QQC A;  4FLX A;  2QM4 A;  1KLA A;  4LFB B;  1WQ9 A;  1TUB B;  4UI0 A;  2VQE B;  5BQ8 B;  4ZI7 A;  3UT5 B;  5C8Y B;  3BAB A;  3JVF A;  1B98 A;  4O4L B;  1WPB A;  2R52 A;  1H2S B;  3JAS B;  5JQG B;  1XNR B;  5LA6 A;  2PJY A;  1Q5O A;  3T1H B;  4UCV A;  2UU9 B;  3HKC B;  3BK3 A;  1WAQ A;  4UHZ A;  3BMP A;  2VWE A;  1HD4 A;  1B8M B;  1CZ8 V;  3JAL A;  3PN1 A;  3VQW A;  4DUY B;  2H62 A;  2UXB B;  3K5L A;  1FL7 B;  1ZAU A;  4JYA B;  1XNQ B;  4YCG C;  4CS2 A;  2UUB B;  4X1K A;  5JH7 B;  1HNX B;  4O2A A;  5CA0 B;  4KZN A;  4KV5 A;  2TGI A;  1BJ1 V;  5BR8 B;  3BA8 A;  1WN7 A;  2PGG A;  2C7W A;  1X4T A;  2ZNJ A;  4F6R B;  4DV7 B;  2UUA B;  5BPU A;  3RWR D;  3WB2 A;  2ZNI A;  5LMN B;  1TAE A;  4GKJ B;  3RYH A;  4K8X A;  2PYL A;  4I4T B;  3RGB A;  2P22 C;  5KHJ A;  1KMI Z;  2VWJ A;  2GOO A;  1TFG A;  1ES7 A;  1LX5 A;  4LFC B;  5BQ8 A;  3UT5 A;  4X62 B;  1BND B;  4LF7 B;  5ITZ B;  4O4L A;  5LXT B;  2QJ9 A;  4DV3 B;  5JQG A;  4PHZ A;  1XMO B;  2GV9 A;  2OYQ A;  4U3J B;  2IM9 A;  1MKG A;  2P5O A;  1N36 B;  1N34 B;  1B8M A;  1WQ8 A;  4AY9 B;  4ZFF C;  5FPO A;  2XAC A;  1SA0 B;  4LF4 B;  1LXI A;  4JI2 B;  3SR2 C;  4FAO A;  4UCT A;  3JAW B;  3N2G B;  2XHB A;  2UXC B;  4AIL C;  1JJO A;  5J2U A;  4LF8 B;  4LXR J;  3M7M X;  4BW9 A;  4JI7 B;  4UHY A;  5GON B;  5F3B C;  3JSL A;  3UQ8 A;  1XMQ B;  2QJ1 A;  1B04 A;  1TVK B;  3E22 B;  4HQU A;  1NYU B;  2P6A A;  1BND A;  5CA1 B;  2KKW A;  4X20 A;  5JJN B;  4DRX A;  3LNN A;  5EYP B;  4JI1 B;  4EFV A;  3IJ2 A;  4U3J A;  5FNV A;  4DK0 A;  2PUS A;  3K5M A;  4YCI C;  2ZIN A;  4CH6 A;  2ZIM A;  5JVD A;  1SQG A;  1VPF A;  2PZS A;  1XQ8 A;  2XV7 A;  5J2T A;  1AGQ A;  4ZHQ A;  2Q7G A;  3KFD A;  3N2K A;  4GYC B;  4LR3 A;  3QB4 A;  1TA8 A;  4IIJ B;  2VXS A;  2JS5 A;  1MJV A;  3BAA A;  4X1J A;  4JI6 B;  4YJ2 B;  3QF7 A;  1XI1 A;  3JAK A;  4CH5 A;  5CB4 B;  1SKV A;  5HK5 A;  4FFB B;  5HHV A;  2B0U A;  5KMG B;  4EFB A;  5BQE B;  3BPZ A;  4DV0 B;  2ARV A;  3K57 A;  3FUB B;  5GON A;  4YJ3 A;  1YEW A;  3QTC A;  4FLV A;  1L8D A;  2RQ6 A;  3ETQ A;  5IJ0 B;  4NXM B;  2R53 A;  1HCN B;  1TZH V;  4IHJ B;  4DR5 B;  4BV4 L;  3BDY V;  2ARP A;  4FLY A;  1DZ7 A;  4LH6 A;  5BMV A;  1FFX A;  3MJK A;  4HNA B;  1I94 B;  4X1I A;  3S1B V;  1V9P A;  1O9H A;  1WWW V;  2H64 A;  4DK1 A;  3CB2 A;  4DR3 B;  4ZOL B;  1AOC A;  4OX9 B;  5IJ9 B;  3DSQ A;  5FV1 V;  4I55 B;  4GLX A;  3U11 A;  4X66 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...