2UU9O

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uu9O00
1XNRO 5H5NA 4LFCO 2N74A 4DV4O 4DR4O 1XEQA 3R66A 4DV5O 1X59A 4JI5O 3SDLA 3J81N 4JI7O 4DV2O 1FKAO 3RT3C 5BXZA 1IBLO 4DR7O 4JI3O 4B3RO 2VQEO 5IWAO 1R6TA 4LF9O 1HNZO 3M8AA 4K0KO 2F4VO 4LF4O 1IBKO 5LMNO 4B3MO 2AGAA 4JV5O 3F5TA 4DR1O 1D2DA 4LF5O 4LF8O 1XNQO 5LL6Y 4DUZO 4JI8O 1R1BA 4NXMO 2UXCO 5LMUO 2VQFO 4DV1O 4DV6O 2ZKOA 1AILA 4DV7O 2LW7A 4A5UB 1F7YA 5FLXN 3T1YO 3J7AU 4DR3O 4LFBO 1FJGO 2UXDO 1DK1A 4X64O 4GKJO 2ZM6O 1IBMO 4OX9O 1N33O 2UUBO 4GKKO 4KHPO 4JI0O 3OTOO 1HR0O 4NXNO 1FYJA 1I94O 5IT9N 4DV3O 4DV0O 4DR5O 1XMOO 1NS1A 1HNWO 4LF7O 5A2QN 4B3TO 4JYAO 4JI4O 1AB3A 4B3SO 1KUQA 4YHHO 2Z0AA 1HNXO 4OPHA 2UXBO 1J5EO 4YY3O 2HHHO 3O65A 1G1XB 2JRIA 4JI6O 4OPAA 4X65O 5BR8O 1N32O 4LFAO 5BY1A 4DR6O 3JAMN 4X66O 2UUAO 4JI1O 4X62O 3T1HO 4LF6O 1N34O 1N36O 2FKXA 2E5LO 4DUYO 2DJVA 4DR2O 2UUCO 2DOSA 4AQYO 1XMQO 3J80N 1A32A 2UU9O 4JI2O 1YZBA
chains in the Genus database with same CATH superfamily
1XBLA 2JGDA 2ZIMA 2ZE7A 3CCSV 3FAVB 5EK0A 1JOYA 1RPRA 4DR5B 2B1IA 1BHBA 2LGQA 3CRMA 5D5QA 1P7GA 4ICGA 2KKWA 1OCRC 4EFBA 4K35A 1SQPH 3ABLC 3ZMUA 3E8FA 4FFBB 4IYHA 1IBKO 2UXDB 4NKGB 4WFFA 5CB4A 2LQTA 4JV5O 2YIBD 2JK5C 4HNAA 5BMVA 4J10A 4FM1A 4FM2A 1XI1A 5KLVH 1UJWB 5IY5C 2DYRC 2RQ6A 3HKBA 4H0LB 1XMOB 2ZKOA 4GLXA 1VQ9V 2Q0OC 2ZXWB 4LF6B 4BIOA 1P84F 3E35A 1F4NA 3CC7V 3WG7B 4ZBMA 4IL6Z 5ITZA 3UQ8A 3RVZA 1HNXB 3NR7A 3W7UA 4DRXA 2HHHB 2XAFA 3FYEB 4FLWA 2AHYA 3L74H 1R3IC 2IBZH 1GTOA 3ZN0A 4GT1A 4BIUA 1NH2D 2H94A 2Z0AA 1IX9A 1AR5A 1OJHA 2Q6AA 4AQYB 3RYFA 1K97A 1YJNV 1N32O 4NVPA 2UU9B 4LFAO 4JI2B 2AXTZ 1GO3F 1JMKC 5L3GA 1R3KC 4LF5B 1P49A 4F6EA 2HR3A 1S5HC 4JGSA 4PJ0Z 4J9YB 3K57A 5EZYB 2QKCA 1I7FA 1QQCA 2YICA 1N8RW 2P67A 1YZBA 1JR9A 3W7WA 1HDJA 3STLC 4WFEA 1XL6A 3AG4B 2DWEC 1TVKB 4FK5C 5B1OA 1Z2GA 4B3MB 5H6RA 3TXQA 4O4IA 3SDLA 4YJ3A 2D3OW 4RUEA 2QWPB 4FZ0A 5IY5B 2OIGA 2DYRB 1K8AW 4U7NA 4JI3O 4FLYA 4DV7B 2X7RB 2WLMA 5IJ9B 4WBNB 4O2BB 1AVMA 2R72A 4LF4O 1FJGB 4J7KA 1B04A 3ABUA 3KG2A 2AGAA 3OTFA 3P30A 3WFVA 3B8MA 3C3SA 4UCSA 3AG1B 2EZOA 1N0NA 1TA8A 5EBMC 5LMUO 3UO2A 1M56C 2DWDC 1LUVA 2WLIB 4BWAA 5EC1C 2EZPA 2Q67A 4H44B 3CCQV 2A7WA 2XOKG 1MOFA 1WNSA 5H6QA 2UUBO 5KHGA 4UV8A 3RFRA 1XUQA 2LFRA 3ZHQA 2GTSA 2YEVB 4PA4A 1NZ6A 3K04A 3K0GA 5EC2C 4F6RA 5BZBA 2E74B 5KUMA 3SYPA 2YI8A 1SZTA 1GM7A 2Z5UA 2OCHA 1K7DA 1J95A 1XMQB 4UB8Z 2X6CA 1KBHA 4KP4A 1CPYA 3SYAA 5BY1A 2P5OA 2L6LA 5LGUA 1H38A 3FAVA 4DR4B 4MVRA 5LGTA 1ZX3A 3DC5A 4BAYA 2X6AA 4OXSA 1XHXA 3P3PA 1V55B 3LSSA 1FFTB 4FFBA 4J11A 4LBEC 1YTFD 5FPOA 1SQVH 5AG2A 2N74A 4I4TB 1XDCA 3VQWA 2ZDIA 2OCCB 2XASA 2Q7HA 2QDOA 4JYCA 5H2FZ 5TISZ 3SPJA 3ZHUA 2QM7A 3CWBH 3ZEDA 1QU7A 1BSMA 5B3SB 5JJJB 3ABKC 3ETGA 2GBOA 2Y4UA 2ILMA 4DR3B 3CCVV 5LMNO 1FXKC 1PNLA 1QLEC 2YUAA 4C7UA 1COWG 4JI6B 1YCIA 4IIJB 1I94B 1ZLZA 5EBWC 1I5XA 2RDCA 1Y76B 3OMIB 1HNWB 4E4EA 4EB6B 1GM9A 3K58A 4X20B 1IBMO 2YDEA 1K9MW 5A9GA 5E79Z 3OMNB 3AK2A 4JI0O 3OTOO 4J42A 1TGOA 2PGGA 1S3JA 2HVJC 1GRJA 1QVFU 2DMXA 5FNVB 3AG2C 4X65B 5EIBD 2QE7G 5BR8B 1SQXH 2ZQMA 1VF6C 5B1AC 1S0VA 3ZIAG 5KHHA 1K4CC 2YC0A 1KUQA 1OCZB 1N36B 2Z3YA 2EIMB 5EZYA 3GB7C 3D3IA 1AP5A 5LXTB 2JRIA 5LBQA 4U7OA 1IBKB 2F43G 3JCZA 3ZRVA 1JFFB 1ROPA 4O4HB 1TVKA 4CC6A 5LOVB 2HKOA 1RSOB 3ZX6A 2IU3A 2D2CB 2WLKA 4DV5B 2CE4A 3UO3A 4DK0A 3RGBA 1VQ6V 1KYOF 5IJ9A 1YHQV 4WBNA 4O2BA 1ZL8B 2XAGA 1WP7A 1Y6XA 4HZ3A 4PHZA 1BT8A 3ZMSA 4JI5O 4PD4F 1RFYA 4DR1B 1SF9A 5IJ0B 3EVKA 1HWYA 4FJCC 2WLIA 3ZN1A 2VQFB 2YS8A 1K33A 1VQ7V 4K0KO 1K5SA 1DF4A 1LUWA 4RQEA 5JJEB 2LGWA 1YIJV 4ZOLB 2YEVA 4KHPB 4DUZO 4I7ZB 1V54C 2QSAA 3K9SA 1M1KW 3TJTA 3JD3A 4I5SA 1MZEA 2F1MA 4JASA 2CTRA 3BEHA 4J9ZB 3OMAB 2AW9A 4B7KA 1Y4MA 3ZMTA 1URFA 3EHBB 1HW7A 3W7TA 3ZHVA 1NI8A 4MS2A 4DV0O 1XILA 4P9OA 3A8TA 1W0KG 2Y69B 5GONB 2YXYA 3B40A 3H1HH 5B66Z 5HFMA 3OM3B 4YHHO 1Q8IA 1W2BU 2KSDA 2XT9A 1OCCC 2EIKB 4XDKA 1GN6A 2BCCH 2IJJA 1VP7A 2CDYA 4X66O 3HB3B 4I4TA 4ZHQB 1T5EA 1JX9A 3M7MX 1JQ0A 3EXAA 3VBBA 4GZRB 1VF7A 1VQ5V 3G4SV 1OHHG 3BAAA 3CE2A 2DYSB 1IBLB 4QPJA 3CMEV 3B09A 4O2AB 1MMMA 4LF9B 3E22B 2F4VB 2CK3G 5KAFZ 4TWKA 3STZC 4Q6GA 4IIJA 2Q69A 3L9DA 3CCRV 3J81N 5KHKA 4LF8B 1Y76A 1JA8A 4EB6A 5IYDO 1VQMV 4X20A 3VOUA 1HNZO 1G6UA 1RM1B 3VQXA 1PL4A 4ABMA 3JALB 2ZM6B 4MSWC 1WB7A 3ETQA 3JD1A 3FB8C 1XL4A 3VQVA 1HR0B 4LH6A 3T2MA 4FLUA 5FNVA 4QIWF 2A9HA 4LF7B 4LFBO 3K59A 4X64O 4GKJO 2CH7B 4OX9O 2B5UA 1SRYA 2ARHA 5LXTA 1B6QA 1PKXA 1BE3H 1ORQC 2DQ3A 4HBNA 1JFFA 2IH1C 4O4HA 4BIZA 1WLEA 5LOVA 1WJZA 1RSOA 2GSMB 1BL8A 1S77D 3FB7C 2EJRA 1JCHA 1Y66A 2PZSA 4B3SO 2E5LB 4OPHA 2UXBO 4YIOA 4TQDA 1N0JA 3IJ4A 1ZL8A 1NT2B 2ZDIC 4CBCA 2FYUH 3BABA 2HJFC 1VEWA 4L87A 3I5DA 4ZIBA 4DR6O 5GW7A 4LFCB 4JAUA 2ZXWC 3P32A 2CGNA 5IJ0A 5CBGA 2CAZC 3WG7C 2OTJV 1WPBA 5H9CA 2NNUA 2AZ2A 1EM1A 4DR7B 1CXZB 1MG1A 5FPRA 4JTDB 2RNBA 5JJNB 3L71H 1FAFA 1B3QA 4ZOLA 4NYKA 1NVPB 3G80A 4UCUA 4JI7O 4K8XA 1FKAO 3LDEA 3RT3C 3K06A 4PA6A 5BXZA 3ZCCA 1QR9A 1H2NA 4WCEV 4X88A 4YXWG 2EULA 4MVZA 1R6NA 1E1RG 2Q0AA 3FD9A 1SETA 1L8DA 2JS3A 2A3QA 5IYBO 1NTMH 3K79A 1KU9A 4KXRA 2WLJA 5KA5A 3L72H 4DV6O 1AROP 2ETNA 4HYOA 5GONA 2LW1A 5HFLA 4FLZA 1JJOA 2E3CA 4B08A 3ASOB 4JI4B 1IXBA 1O9GA 1N33O 2K9PA 2QWOB 3AG4C 3ASNB 2P4KA 2Q7GA 1PP9H 4R7CA 4FZ1A 4UVBA 4QGPA 3CRCA 1IDSA 3N2GB 2QJ1A 4ZHQA 4JYAO 4UVAA 4CC5A 2XAJA 1LR1A 4CZZA 1ZAUA 3THOA 4X62B 4L8JA 2F95B 4DUYB 2ZR2A 4YY3O 2IM9A 3CJHB 4WFHA 4D7TA 1SQBH 4O2AA 1SS3A 3E22A 5L3DA 3AG1C 2R9AA 3ABTA 3B77A 1RPOA 3ZJZA 3T1HO 3NXSA 1N34O 2CTPA 2FKXA 3AK1A 3RYIB 1K92A 3E86A 1D5NA 4YJ2B 3J80N 2YIAA 1Z5VA 3H1IH 3QNEA 1GN3A 5KA6A 5IWAB 3JALA 4B7EA 1YXBA 1YF2A 4DV4O 1XEQA 2RJZA 1S76D 3CRAA 3JAKB 4X1IB 5DECA 1KKDA 1Q3EA 5GTHZ 5DM6V 4JI8B 4NXMB 4N23A 1R3JC 3PJSK 2CH7A 3WB2A 1MSDA 4YHHB 3QO8A 5JVDB 3UCSC 2HLDG 1QCEA 2BSKB 1KP2A 3F5TA 1BGYH 4GKKB 1R1BA 3BFRA 4LR3A 1TUBB 4FMTA 4IGGA 3CC2V 3CHXA 1V55C 4UCTA 2M6YA 2QM4A 1M93A 3B2EE 1L1FA 4QJFB 1PV0A 4LP8A 4NTXA 1FYJA 5KHIA 5IT9N 1J5EB 2HJDA 2OCCC 1EFRG 4DV3O 1Q5OA 3ETEA 4TV8B 4GCZA 5B3SC 3CRRA 1GMGA 4BR6A 2R9IA 1OV9A 4JI1B 3SJBC 1E1QG 2ZR3A 1M90W 2R70A 1EZVH 5CBHA 1QNMA 2Q73A 3ZMZA 3JAMN 3DXRB 1AI5A 4H37A 4ZKIA 1Q43A 2QR4A 2XUMA 3H9VA 4DR2O 2DOSA 4N21A 2HFEC 3Q4HB 2EIJB 1XNRO 3FB5C 3FB6C 2YXHA 1S5JA 1F4MA 1GH6A 2IW5A 5IYCO 4DV2O 1VQ4V 4O4LB 1XNQB 1OCZC 2UXCB 2EIMC 3APOA 2ZE6A 3SJAC 4DV1B 2VQEO 3OGCC 3BPZA 3T1YB 3ZHRA 1FS0G 2N04A 4RO2A 1IURA 2W0XA 1AJNA 2FMLA 4UV9A 1ZUQA 2ZIOA 5LL6Y 1V9PA 1AI6A 2PUSA 3N2GA 3AEIA 3UM7A 1Q82W 4JZ2A 3CYOA 2LW7A 4MTOA 1SA0B 3C90A 1VQPV 2YXLA 1G8MA 3PN1A 1Q81W 3CJHA 4NXNO 3N2KA 1K34A 4Q20A 3BA8A 4JPRA 2EINB 4P9PA 5K1XA 3MAQA 4B3TO 4R50A 2UUAB 4FFKA 3RYIA 3B4SA 4YJ2A 1KKCA 1XQ8A 1X4TA 1IXMA 2P06A 1PPJH 2Y0IA 3AG3B 5IDJA 3F7VC 3CCMV 3D36A 2F23A 2ZCEA 3ICXA 1NR7A 4I55B 3JAKA 1FXHA 4X1IA 1EN5A 2QKSA 3S3XA 3HKDB 3FFQA 3LSQA 2BTOA 2VS0A 2DJVA 3ZMVA 2V1DA 2ZNIA 2UUCO 1SQQH 3QF7A 3HR0A 5KHJA 2EBOA 2QKAA 3N27A 5JVDA 3TK1A 4NTYA 4LNUB 2R9RB 2BSKA 2X0LA 1H2LA 5LHHA 2Y69C 4JV5B 1NBMG 1ENVA 2IJIA 3ZRWB 1TUBA 4WFGA 3A0BZ 2ADQB 2EIKC 1WA8B 4B3RO 1ZTEA 1R6TA 3E8GA 3WU2Z 2XTAA 3M8AA 4QE9A 1HP8A 2IJHA 2QTOA 2Y4TA 1H8HG 1UFIA 4CH6A 1OZ0A 5F2VO 3GVMA 3SGIA 4TV8A 1KMIZ 2L35A 1PD3A 4G2KA 3FKSG 2P4VA 2DYSC 1PM9A 1NVPD 2UXDO 2P22C 4PDVA 5JWPA 3K08A 3ZRSA 3OEHG 1XMOO 5CN0A 1ZWIC 1N32B 3DXRA 1U96A 4LFAB 2XHBA 2NLJC 3SYCA 4I9QA 1RM1C 4MVMA 2QTSA 2JJ1G 1HNXO 2HEPA 3BVOA 4TSFG 3SJCC 2HHHO 4XDLA 3Q4HA 2A06H 1QVGU 3CX5F 3ZS8C 1S5LZ 2XAQA 1PNKA 1EZJA 4EFEA 4O4LA 1THZA 4KL1A 2V4DA 1BHAA 4AQYO 4G27B 5EIBC 3AK3A 4JI3B 2UU9O 4JI2O 3ZHSA 5CA3A 4LF4B 3UKMA 3VQYA 3JYCA 4FM0A 3E89A 3K9AA 5J2UB 1I0HA 3I55V 3IGAC 4EKWA 4KFMA 5LMUB 1Q6HA 1SA0A 3O9OA 5J2TB 5CA1B 3MD0A 4JTAB 4FLXA 4B3MO 3SPGA 2UUBB 3OD4A 3BHPA 2ZNJA 4MVQA 1GN2A 1GAXA 4I50B 4DV7O 5D5PA 2UXXA 4X9QA 5FLXN 3KKYA 1YVWA 1FJGO 1OCOB 2JVDA 4Z1MG 4DR2B 3X2QB 5CA0B 2N05A 4I55A 2W6IG 4YIPA 1GM8A 1AB3A 3WB0A 3HKDA 1Q7YW 3RYHB 3UT5B 1G1XB 3ZRXA 2C2AA 4LNUA 2DQ0A 4CS3A 2WPDG 2QEXV 1YJ9V 1R3LC 1VIBA 3DTUB 2VWKA 3ZRWA 3ASOC 4Z2WA 4XDJA 3E8BA 4RQFA 3K5NA 4KUMA 2JIZG 4U3FH 1WA8A 3ASNC 1VARA 1XMQO 3SPCA 1NTKH 3JARB 1Y74B 4PI0A 4TV9B 2KB1A 5LP6B 3W7XA 4WF9V 4CH3A 1M57B 4W4KA 4DR4O 1KB9F 3BRCA 3JCUZ 5LMNB 5B1BB 1QBZA 4ASUG 1BQZA 1DTOA 2AHZA 2LFSA 1F23A 4FPPA 4X89A 3BY6A 1BZKA 3CXHF 1VMGA 1IBMB 5LA6B 2IH3C 3OTOB 4JI0B 4LWSB 1AR1B 1RP3B 2O57A 2EJ7A 4I0XB 3OR7C 2OIEA 4DR3O 1ZSPA 4J7JA 3D36C 2F66C 4GX5A 3CB2A 2UUCB 1I94O 3ZHTA 4P30A 3FX7A 2KQXA 4CS4A 2OT5A 4NTWA 1NS1A 3HKCB 5E1AC 1HNWO 4JAVA 4DK1A 2LO1A 3BCCH 4DW0A 4Z1VA 3D8CA 5K1PA 1N4CA 1W0JG 4FVMA 2G38A 3H01A 1VQNV 1DLBA 2ZE8A 3IC9A 4TUYB 4MW8A 4X65O 5BR8O 3CCEV 3A2FA 1H2GA 2DE0X 5J2UA 2MW2B 1TAEA 3LDCA 3I56V 3OUFA 1N36O 2NN4A 4JI5B 2FTKA 1SERA 1KC8W 1LNQA 1EBOA 2ZD9A 3TCUA 2Q4PA 4D6TH 5J2TA 3A0HZ 4QNHB 5CA1A 3LDDA 4K0KB 3N2KB 1Q86W 1E79G 2MK3A 4H33A 3R66A 4K3AA 3DGEA 4DV5O 2X6BA 2GUZB 3K3WA 2QWQB 4DUZB 4I50A 5LHIA 2PYJA 2E75B 5B1NA 2A0LA 4GX0A 3RYCB 1YEWA 2P7TC 4FIPC 1IVSA 4D7SA 4LCUC 4UCRA 2YI9A 4X1KB 4O4JB 2ITCC 5CA0A 4DR1O 1Q6UA 1D5AA 2RCVA 2OWOA 1FFXB 3A0RA 4IHJB 4DV0B 3MHSC 3ETDA 2VQFO 2XNDG 2EX3A 1AILA 1SC5B 3OR6C 2IJKA 3LUTB 3MHHC 4A5UB 2KG7B 3GWOA 2GHYA 4BW5A 2EIJC 4R8CA 2EILB 1Q6IA 3RYHA 1YI2V 4KHPO 3UT5A 3DC6A 1NTZH 4P2ZA 2GV9A 3KCXA 3CMAV 4TQFA 3ABMB 4CH4A 1DGSA 5JQGB 1Y67A 4X66B 4J80A 2PTMA 5KUKA 2B9ZA 1AI7A 5JH7B 3B8NA 1CEZA 1OCRB 3JARA 1Y74A 3ABLB 4TV9A 2Y48A 3H1JH 1KD1W 5LP6A 3T4DA 1SQGA 5LYJB 3OT7A 3FYIB 2JS5A 5KAIZ 1BCCH 3JASB 1WP8A 2WLLB 1K3EA 2Q68A 1GK9A 3LNNA 4UVCA 1K5QA 5LHGA 1NJIW 2EINC 1WB8A 3TXSA 1HNZB 3SPIA 2V7QG 2WSSG 4PELA 5LA6A 4LWSA 4WFAV 1AR4A 2ATKC 3K5LA 4UB6Z 5L3CA 4I0XA 3LNMB 1XHZA 2DW4A 3TGUH 1IBLO 3JD2A 1XREA 3JAWA 4LF9O 3K5MA 3AG3C 3ZBHA 2E76B 1R73A 2F4VO 4LFBB 4TOIA 1WAZA 4X64B 4GKJB 1JVMA 3CCJV 1P4RA 2BTQB 4OX9B 4LF8O 4TT3G 3HKCA 5DEDA 2YSUB 3D3QA 4DO2A 1YJWV 4I9WA 3OEEG 3OAAG 4NB5A 4RUFA 3J7AU 1PL0A 2ZM6O 4QE7A 2ITDC 4B3SB 2JEUA 1HR0O 2QWNB 4TUYA 2UXBB 1K4DC 4FLTA 3DSQA 4LF7O 5IE9A 2Q8VA 4DR6B 4PA3A 4GX2A 3SYQA 1NKDA 3KCYA 5CBFA 1YDXA 2QM8A 1W59A 5B5EZ 5EYPB 2VWJA 4MTXA 4CS2A 5J9PC 1DF5A 4MVSA 2Q5ZA 2WWWA 4G28B 4PV1B 1FD9A 2A79B 4CH5A 2H8PC 4J41A 5FL7G 5KMGB 2GUZA 3APQA 3E83A 3SPHA 4E2LA 2E5LO 4W4LA 1PNMA 1M56B 3L70H 4JI7B 1R6KA 1US6A 1MABG 1AJPA 1O9HA 1BS3A 3RYCA 1IZ3A 5JCOA 1H2KA 1VQOV 2Q7EA 4X1KA 1S72V 4O4JA 4LFCO 1XOUA 3CCUV 3G71V 2ADPA 3U11A 3BA9A 4GUNA 4X1YB 1FFXA 4PDLA 4IHJA 5DN6G 1Z5WA 4DV6B 4U3JB 4DR7O 1QHTA 2KG7A 2XAHA 4PDMA 3AG7A 1MZFA 3P3NA 2W6JG 3JATB 1N33B 1D2DA 3OW2U 1P7BA 3F7YC 4AI8A 3CS5A 3LSUA 1JPXA 1NH2B 5JQGA 4PA9A 3CEIA 2BOBC 2DN9A 4DXWA 4JYAB 5IYZB 5JH7A 2Y0PA 3JSLA 1GKFA 4MW3A 3OUSA 3QO7A 3HKEB 4MTFA 3RWRD 4YY3B 3T4ZA 2CTWA 4DR5O 4JAAA 5LYJA 4LH7A 1EN4A 5LGNA 1QLNA 2OTLV 4PA7A 3S3WA 4JI4O 1Q90D 3JASA 4WFBV 3T1HB 1N34B 2WLLA 2LJ2A 4JYBA 3ABKB 4JF3A 3SYOA 4NR1A 2YIDA 4OPAA 2PI5A 1FXKB 2NR5A 3H1LH 1QLEB 2QGNA 4RAIA 3H1KH 4DV4B 4X62O 4LF6O 1OCOC 4ZI7B 4R6ZA 3K03A 3R65A 3OE7G 4DUYO 1MA1A 3IC7A 3E2EA 2BE3A 1H2MA 3X2QC 2Q9LA 2OYQA 2P6JA 3GWKC 5KX5B 1A32A 1MSWD 4JZGA 1G4YB 4PDRA 3MDSA 2M7WA 2BTQA 3CP1A 3JD0A 4UXNA 4HAMA 1X59A 4XBFA 3AG2B 1VQ8V 3CC4V 2IU0A 2PY5A 3CD6V 5B1AB 5IWAO 5C8YB 3QG5A 4H13B 2W0FC 3SJQC 2UXNA 3CCLV 2PF4E 2HP8A 2JGDB 3ML0A 4LF5O 4JI8O 2CUGA 4X8AA 2RMKB 4NXMO 2ZT9B 4DV3B 3JSNA 1VQKV 1F7YA 2H3OA 3IAYA 1DK1A 4DW1A 1QR8A 5LP6C 1M57C 5EYPA 1VQLV 3CPWU 4GKKO 5CB4B 2JJ2G 5B1BC 4HNAB 5BMVB 3U10A 2ZE5A 2JEXA 1WN7A 3W7SA 5L3BA 3HKBB 4MT8A 2FB5A 5KMGA 1JJ2U 3WB1A 3T1CA 3IFXA 1YTFB 3EFFK 4UUJC 5ITZB 1TUEB 2B1GA 2YIBA 4LC1A 2F93B 2CGOA 4AILC 1J5EO 2PI4A 1FXVA 3K5OA 4BW9A 4DRXB 1AJQA 3QO5A 2RN9A 1XNRB 1YSCA 4X1YA 4JI1O 2K1EA 1NU1H 4DYLA 1KECA 2QWRB 1V54B 2JGUA 3OGIB 4K8ZA 4JYYA 4DV2B 4RWUA 4U3JA 1SKVA 2ODMA 3TETA 2LP7A 3RYFB 2VQEB 2GTAA 2HG5C 1SESA 3JATA 2BOCC 5H5NA 4QPKA 1YITV 1SQFA 3L73H 1U97A 3KZIZ 4UCOA 3SR2C 2WA4A 3U0ZA 4GYCB 1M5IA 5L3FA 2WLHA 1L0LH 2P90A 5IYZA 3CRQA 4F4LA 3HPLC 3RW0A 3F5WC 1I08A 2FL4A 2WA3A 1OCCB 1KP3A 3JD4A 3HKEA 4MVOA 3E8HA 4NXNB 1XNQO 4O4IB 4GX1A 2UXCO 4YJ3B 4DV1O 2ZINA 1AP6A 3CXCU 4UFZA 3T1YO 3QTCA 4PI2A 4B3TB 1I5YA 3K0DA 3QVNA 1B06A 2JDIG 2CTQA 4EEQA 5C93A 1VF5B 3RN4A 4OGQB 4J7ZA 2PYLA 1NR1A 2AZ0A 1FXKA 1F51A 1WPXA 1H2SB 3G6EV 5CMUA 1H8EG 1L0NH 5GTIZ 5A2QN 3G6BA 5EBLC 1CP9A 4ZI7A 4JTCB 5JCOC 2GDSA 1K73W 1BQ0A 3OFNG 3JAWB 1KQSU 1M9NA 5KX5A 3O65A 2VRZA 4FLVA 1FPOA 4JI6O 1M4UA 2QA4V 1AI4A 3RVYA 3G67A 1BMFG 1EN6A 2UUAO 4F6RB 3L75H 4MTGA 1MNGA 3CSXA 3RBZA 4IT5A 2WLNA 4MVUA 3C3TA 1NQTA 2WAMA 5L3EA 2EILC 1VF6A 1GN4A 3M99B 5C8YA 4IYIA 4AHCA 2HVKC 1UPGA 4B3RB 1SZXA 4UCVA 3ABMC
chains in the Genus database with same CATH topology
1XNRO 5H5NA 4LFCO 2N74A 4DV4O 4DR4O 1XEQA 3R66A 4DV5O 1X59A 4JI5O 3SDLA 3J81N 4JI7O 4DV2O 1FKAO 3RT3C 5BXZA 1IBLO 4DR7O 4JI3O 4B3RO 2VQEO 5IWAO 1R6TA 4LF9O 1HNZO 3M8AA 4K0KO 2F4VO 4LF4O 1IBKO 5LMNO 4B3MO 2AGAA 4JV5O 3F5TA 4DR1O 1D2DA 4LF5O 4LF8O 1XNQO 5LL6Y 4DUZO 4JI8O 1R1BA 4NXMO 2UXCO 5LMUO 2VQFO 4DV1O 4DV6O 2ZKOA 1AILA 4DV7O 2LW7A 4A5UB 1F7YA 5FLXN 3T1YO 3J7AU 4DR3O 4LFBO 1FJGO 2UXDO 1DK1A 4X64O 4GKJO 2ZM6O 1IBMO 4OX9O 1N33O 2UUBO 4GKKO 4KHPO 4JI0O 3OTOO 1HR0O 4NXNO 1FYJA 1I94O 5IT9N 4DV3O 4DV0O 4DR5O 1XMOO 1NS1A 1HNWO 4LF7O 5A2QN 4B3TO 4JYAO 4JI4O 1AB3A 4B3SO 1KUQA 4YHHO 2Z0AA 1HNXO 4OPHA 2UXBO 1J5EO 4YY3O 2HHHO 3O65A 1G1XB 2JRIA 4JI6O 4OPAA 4X65O 5BR8O 1N32O 4LFAO 5BY1A 4DR6O 3JAMN 4X66O 2UUAO 4JI1O 4X62O 3T1HO 4LF6O 1N34O 1N36O 2FKXA 2E5LO 4DUYO 2DJVA 4DR2O 2UUCO 2DOSA 4AQYO 1XMQO 3J80N 1A32A 2UU9O 4JI2O 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  5H5N A;  4LFC O;  2N74 A;  4DV4 O;  4DR4 O;  1XEQ A;  3R66 A;  4DV5 O;  1X59 A;  4JI5 O;  3SDL A;  3J81 N;  4JI7 O;  4DV2 O;  1FKA O;  3RT3 C;  5BXZ A;  1IBL O;  4DR7 O;  4JI3 O;  4B3R O;  2VQE O;  5IWA O;  1R6T A;  4LF9 O;  1HNZ O;  3M8A A;  4K0K O;  2F4V O;  4LF4 O;  1IBK O;  5LMN O;  4B3M O;  2AGA A;  4JV5 O;  3F5T A;  4DR1 O;  1D2D A;  4LF5 O;  4LF8 O;  1XNQ O;  5LL6 Y;  4DUZ O;  4JI8 O;  1R1B A;  4NXM O;  2UXC O;  5LMU O;  2VQF O;  4DV1 O;  4DV6 O;  2ZKO A;  1AIL A;  4DV7 O;  2LW7 A;  4A5U B;  1F7Y A;  5FLX N;  3T1Y O;  3J7A U;  4DR3 O;  4LFB O;  1FJG O;  2UXD O;  1DK1 A;  4X64 O;  4GKJ O;  2ZM6 O;  1IBM O;  4OX9 O;  1N33 O;  2UUB O;  4GKK O;  4KHP O;  4JI0 O;  3OTO O;  1HR0 O;  4NXN O;  1FYJ A;  1I94 O;  5IT9 N;  4DV3 O;  4DV0 O;  4DR5 O;  1XMO O;  1NS1 A;  1HNW O;  4LF7 O;  5A2Q N;  4B3T O;  4JYA O;  4JI4 O;  1AB3 A;  4B3S O;  1KUQ A;  4YHH O;  2Z0A A;  1HNX O;  4OPH A;  2UXB O;  1J5E O;  4YY3 O;  2HHH O;  3O65 A;  1G1X B;  2JRI A;  4JI6 O;  4OPA A;  4X65 O;  5BR8 O;  1N32 O;  4LFA O;  5BY1 A;  4DR6 O;  3JAM N;  4X66 O;  2UUA O;  4JI1 O;  4X62 O;  3T1H O;  4LF6 O;  1N34 O;  1N36 O;  2FKX A;  2E5L O;  4DUY O;  2DJV A;  4DR2 O;  2UUC O;  2DOS A;  4AQY O;  1XMQ O;  3J80 N;  1A32 A;  2UU9 O;  4JI2 O;  1YZB A; 
#chains in the Genus database with same CATH topology
 1XBL A;  2JGD A;  2ZIM A;  2ZE7 A;  3CCS V;  3FAV B;  5EK0 A;  1JOY A;  1RPR A;  4DR5 B;  2B1I A;  1BHB A;  2LGQ A;  3CRM A;  5D5Q A;  1P7G A;  4ICG A;  2KKW A;  1OCR C;  4EFB A;  4K35 A;  1SQP H;  3ABL C;  3ZMU A;  3E8F A;  4FFB B;  4IYH A;  1IBK O;  2UXD B;  4NKG B;  4WFF A;  5CB4 A;  2LQT A;  4JV5 O;  2YIB D;  2JK5 C;  4HNA A;  5BMV A;  4J10 A;  4FM1 A;  4FM2 A;  1XI1 A;  5KLV H;  1UJW B;  5IY5 C;  2DYR C;  2RQ6 A;  3HKB A;  4H0L B;  1XMO B;  2ZKO A;  4GLX A;  1VQ9 V;  2Q0O C;  2ZXW B;  4LF6 B;  4BIO A;  1P84 F;  3E35 A;  1F4N A;  3CC7 V;  3WG7 B;  4ZBM A;  4IL6 Z;  5ITZ A;  3UQ8 A;  3RVZ A;  1HNX B;  3NR7 A;  3W7U A;  4DRX A;  2HHH B;  2XAF A;  3FYE B;  4FLW A;  2AHY A;  3L74 H;  1R3I C;  2IBZ H;  1GTO A;  3ZN0 A;  4GT1 A;  4BIU A;  1NH2 D;  2H94 A;  2Z0A A;  1IX9 A;  1AR5 A;  1OJH A;  2Q6A A;  4AQY B;  3RYF A;  1K97 A;  1YJN V;  1N32 O;  4NVP A;  2UU9 B;  4LFA O;  4JI2 B;  2AXT Z;  1GO3 F;  1JMK C;  5L3G A;  1R3K C;  4LF5 B;  1P49 A;  4F6E A;  2HR3 A;  1S5H C;  4JGS A;  4PJ0 Z;  4J9Y B;  3K57 A;  5EZY B;  2QKC A;  1I7F A;  1QQC A;  2YIC A;  1N8R W;  2P67 A;  1YZB A;  1JR9 A;  3W7W A;  1HDJ A;  3STL C;  4WFE A;  1XL6 A;  3AG4 B;  2DWE C;  1TVK B;  4FK5 C;  5B1O A;  1Z2G A;  4B3M B;  5H6R A;  3TXQ A;  4O4I A;  3SDL A;  4YJ3 A;  2D3O W;  4RUE A;  2QWP B;  4FZ0 A;  5IY5 B;  2OIG A;  2DYR B;  1K8A W;  4U7N A;  4JI3 O;  4FLY A;  4DV7 B;  2X7R B;  2WLM A;  5IJ9 B;  4WBN B;  4O2B B;  1AVM A;  2R72 A;  4LF4 O;  1FJG B;  4J7K A;  1B04 A;  3ABU A;  3KG2 A;  2AGA A;  3OTF A;  3P30 A;  3WFV A;  3B8M A;  3C3S A;  4UCS A;  3AG1 B;  2EZO A;  1N0N A;  1TA8 A;  5EBM C;  5LMU O;  3UO2 A;  1M56 C;  2DWD C;  1LUV A;  2WLI B;  4BWA A;  5EC1 C;  2EZP A;  2Q67 A;  4H44 B;  3CCQ V;  2A7W A;  2XOK G;  1MOF A;  1WNS A;  5H6Q A;  2UUB O;  5KHG A;  4UV8 A;  3RFR A;  1XUQ A;  2LFR A;  3ZHQ A;  2GTS A;  2YEV B;  4PA4 A;  1NZ6 A;  3K04 A;  3K0G A;  5EC2 C;  4F6R A;  5BZB A;  2E74 B;  5KUM A;  3SYP A;  2YI8 A;  1SZT A;  1GM7 A;  2Z5U A;  2OCH A;  1K7D A;  1J95 A;  1XMQ B;  4UB8 Z;  2X6C A;  1KBH A;  4KP4 A;  1CPY A;  3SYA A;  5BY1 A;  2P5O A;  2L6L A;  5LGU A;  1H38 A;  3FAV A;  4DR4 B;  4MVR A;  5LGT A;  1ZX3 A;  3DC5 A;  4BAY A;  2X6A A;  4OXS A;  1XHX A;  3P3P A;  1V55 B;  3LSS A;  1FFT B;  4FFB A;  4J11 A;  4LBE C;  1YTF D;  5FPO A;  1SQV H;  5AG2 A;  2N74 A;  4I4T B;  1XDC A;  3VQW A;  2ZDI A;  2OCC B;  2XAS A;  2Q7H A;  2QDO A;  4JYC A;  5H2F Z;  5TIS Z;  3SPJ A;  3ZHU A;  2QM7 A;  3CWB H;  3ZED A;  1QU7 A;  1BSM A;  5B3S B;  5JJJ B;  3ABK C;  3ETG A;  2GBO A;  2Y4U A;  2ILM A;  4DR3 B;  3CCV V;  5LMN O;  1FXK C;  1PNL A;  1QLE C;  2YUA A;  4C7U A;  1COW G;  4JI6 B;  1YCI A;  4IIJ B;  1I94 B;  1ZLZ A;  5EBW C;  1I5X A;  2RDC A;  1Y76 B;  3OMI B;  1HNW B;  4E4E A;  4EB6 B;  1GM9 A;  3K58 A;  4X20 B;  1IBM O;  2YDE A;  1K9M W;  5A9G A;  5E79 Z;  3OMN B;  3AK2 A;  4JI0 O;  3OTO O;  4J42 A;  1TGO A;  2PGG A;  1S3J A;  2HVJ C;  1GRJ A;  1QVF U;  2DMX A;  5FNV B;  3AG2 C;  4X65 B;  5EIB D;  2QE7 G;  5BR8 B;  1SQX H;  2ZQM A;  1VF6 C;  5B1A C;  1S0V A;  3ZIA G;  5KHH A;  1K4C C;  2YC0 A;  1KUQ A;  1OCZ B;  1N36 B;  2Z3Y A;  2EIM B;  5EZY A;  3GB7 C;  3D3I A;  1AP5 A;  5LXT B;  2JRI A;  5LBQ A;  4U7O A;  1IBK B;  2F43 G;  3JCZ A;  3ZRV A;  1JFF B;  1ROP A;  4O4H B;  1TVK A;  4CC6 A;  5LOV B;  2HKO A;  1RSO B;  3ZX6 A;  2IU3 A;  2D2C B;  2WLK A;  4DV5 B;  2CE4 A;  3UO3 A;  4DK0 A;  3RGB A;  1VQ6 V;  1KYO F;  5IJ9 A;  1YHQ V;  4WBN A;  4O2B A;  1ZL8 B;  2XAG A;  1WP7 A;  1Y6X A;  4HZ3 A;  4PHZ A;  1BT8 A;  3ZMS A;  4JI5 O;  4PD4 F;  1RFY A;  4DR1 B;  1SF9 A;  5IJ0 B;  3EVK A;  1HWY A;  4FJC C;  2WLI A;  3ZN1 A;  2VQF B;  2YS8 A;  1K33 A;  1VQ7 V;  4K0K O;  1K5S A;  1DF4 A;  1LUW A;  4RQE A;  5JJE B;  2LGW A;  1YIJ V;  4ZOL B;  2YEV A;  4KHP B;  4DUZ O;  4I7Z B;  1V54 C;  2QSA A;  3K9S A;  1M1K W;  3TJT A;  3JD3 A;  4I5S A;  1MZE A;  2F1M A;  4JAS A;  2CTR A;  3BEH A;  4J9Z B;  3OMA B;  2AW9 A;  4B7K A;  1Y4M A;  3ZMT A;  1URF A;  3EHB B;  1HW7 A;  3W7T A;  3ZHV A;  1NI8 A;  4MS2 A;  4DV0 O;  1XIL A;  4P9O A;  3A8T A;  1W0K G;  2Y69 B;  5GON B;  2YXY A;  3B40 A;  3H1H H;  5B66 Z;  5HFM A;  3OM3 B;  4YHH O;  1Q8I A;  1W2B U;  2KSD A;  2XT9 A;  1OCC C;  2EIK B;  4XDK A;  1GN6 A;  2BCC H;  2IJJ A;  1VP7 A;  2CDY A;  4X66 O;  3HB3 B;  4I4T A;  4ZHQ B;  1T5E A;  1JX9 A;  3M7M X;  1JQ0 A;  3EXA A;  3VBB A;  4GZR B;  1VF7 A;  1VQ5 V;  3G4S V;  1OHH G;  3BAA A;  3CE2 A;  2DYS B;  1IBL B;  4QPJ A;  3CME V;  3B09 A;  4O2A B;  1MMM A;  4LF9 B;  3E22 B;  2F4V B;  2CK3 G;  5KAF Z;  4TWK A;  3STZ C;  4Q6G A;  4IIJ A;  2Q69 A;  3L9D A;  3CCR V;  3J81 N;  5KHK A;  4LF8 B;  1Y76 A;  1JA8 A;  4EB6 A;  5IYD O;  1VQM V;  4X20 A;  3VOU A;  1HNZ O;  1G6U A;  1RM1 B;  3VQX A;  1PL4 A;  4ABM A;  3JAL B;  2ZM6 B;  4MSW C;  1WB7 A;  3ETQ A;  3JD1 A;  3FB8 C;  1XL4 A;  3VQV A;  1HR0 B;  4LH6 A;  3T2M A;  4FLU A;  5FNV A;  4QIW F;  2A9H A;  4LF7 B;  4LFB O;  3K59 A;  4X64 O;  4GKJ O;  2CH7 B;  4OX9 O;  2B5U A;  1SRY A;  2ARH A;  5LXT A;  1B6Q A;  1PKX A;  1BE3 H;  1ORQ C;  2DQ3 A;  4HBN A;  1JFF A;  2IH1 C;  4O4H A;  4BIZ A;  1WLE A;  5LOV A;  1WJZ A;  1RSO A;  2GSM B;  1BL8 A;  1S77 D;  3FB7 C;  2EJR A;  1JCH A;  1Y66 A;  2PZS A;  4B3S O;  2E5L B;  4OPH A;  2UXB O;  4YIO A;  4TQD A;  1N0J A;  3IJ4 A;  1ZL8 A;  1NT2 B;  2ZDI C;  4CBC A;  2FYU H;  3BAB A;  2HJF C;  1VEW A;  4L87 A;  3I5D A;  4ZIB A;  4DR6 O;  5GW7 A;  4LFC B;  4JAU A;  2ZXW C;  3P32 A;  2CGN A;  5IJ0 A;  5CBG A;  2CAZ C;  3WG7 C;  2OTJ V;  1WPB A;  5H9C A;  2NNU A;  2AZ2 A;  1EM1 A;  4DR7 B;  1CXZ B;  1MG1 A;  5FPR A;  4JTD B;  2RNB A;  5JJN B;  3L71 H;  1FAF A;  1B3Q A;  4ZOL A;  4NYK A;  1NVP B;  3G80 A;  4UCU A;  4JI7 O;  4K8X A;  1FKA O;  3LDE A;  3RT3 C;  3K06 A;  4PA6 A;  5BXZ A;  3ZCC A;  1QR9 A;  1H2N A;  4WCE V;  4X88 A;  4YXW G;  2EUL A;  4MVZ A;  1R6N A;  1E1R G;  2Q0A A;  3FD9 A;  1SET A;  1L8D A;  2JS3 A;  2A3Q A;  5IYB O;  1NTM H;  3K79 A;  1KU9 A;  4KXR A;  2WLJ A;  5KA5 A;  3L72 H;  4DV6 O;  1ARO P;  2ETN A;  4HYO A;  5GON A;  2LW1 A;  5HFL A;  4FLZ A;  1JJO A;  2E3C A;  4B08 A;  3ASO B;  4JI4 B;  1IXB A;  1O9G A;  1N33 O;  2K9P A;  2QWO B;  3AG4 C;  3ASN B;  2P4K A;  2Q7G A;  1PP9 H;  4R7C A;  4FZ1 A;  4UVB A;  4QGP A;  3CRC A;  1IDS A;  3N2G B;  2QJ1 A;  4ZHQ A;  4JYA O;  4UVA A;  4CC5 A;  2XAJ A;  1LR1 A;  4CZZ A;  1ZAU A;  3THO A;  4X62 B;  4L8J A;  2F95 B;  4DUY B;  2ZR2 A;  4YY3 O;  2IM9 A;  3CJH B;  4WFH A;  4D7T A;  1SQB H;  4O2A A;  1SS3 A;  3E22 A;  5L3D A;  3AG1 C;  2R9A A;  3ABT A;  3B77 A;  1RPO A;  3ZJZ A;  3T1H O;  3NXS A;  1N34 O;  2CTP A;  2FKX A;  3AK1 A;  3RYI B;  1K92 A;  3E86 A;  1D5N A;  4YJ2 B;  3J80 N;  2YIA A;  1Z5V A;  3H1I H;  3QNE A;  1GN3 A;  5KA6 A;  5IWA B;  3JAL A;  4B7E A;  1YXB A;  1YF2 A;  4DV4 O;  1XEQ A;  2RJZ A;  1S76 D;  3CRA A;  3JAK B;  4X1I B;  5DEC A;  1KKD A;  1Q3E A;  5GTH Z;  5DM6 V;  4JI8 B;  4NXM B;  4N23 A;  1R3J C;  3PJS K;  2CH7 A;  3WB2 A;  1MSD A;  4YHH B;  3QO8 A;  5JVD B;  3UCS C;  2HLD G;  1QCE A;  2BSK B;  1KP2 A;  3F5T A;  1BGY H;  4GKK B;  1R1B A;  3BFR A;  4LR3 A;  1TUB B;  4FMT A;  4IGG A;  3CC2 V;  3CHX A;  1V55 C;  4UCT A;  2M6Y A;  2QM4 A;  1M93 A;  3B2E E;  1L1F A;  4QJF B;  1PV0 A;  4LP8 A;  4NTX A;  1FYJ A;  5KHI A;  5IT9 N;  1J5E B;  2HJD A;  2OCC C;  1EFR G;  4DV3 O;  1Q5O A;  3ETE A;  4TV8 B;  4GCZ A;  5B3S C;  3CRR A;  1GMG A;  4BR6 A;  2R9I A;  1OV9 A;  4JI1 B;  3SJB C;  1E1Q G;  2ZR3 A;  1M90 W;  2R70 A;  1EZV H;  5CBH A;  1QNM A;  2Q73 A;  3ZMZ A;  3JAM N;  3DXR B;  1AI5 A;  4H37 A;  4ZKI A;  1Q43 A;  2QR4 A;  2XUM A;  3H9V A;  4DR2 O;  2DOS A;  4N21 A;  2HFE C;  3Q4H B;  2EIJ B;  1XNR O;  3FB5 C;  3FB6 C;  2YXH A;  1S5J A;  1F4M A;  1GH6 A;  2IW5 A;  5IYC O;  4DV2 O;  1VQ4 V;  4O4L B;  1XNQ B;  1OCZ C;  2UXC B;  2EIM C;  3APO A;  2ZE6 A;  3SJA C;  4DV1 B;  2VQE O;  3OGC C;  3BPZ A;  3T1Y B;  3ZHR A;  1FS0 G;  2N04 A;  4RO2 A;  1IUR A;  2W0X A;  1AJN A;  2FML A;  4UV9 A;  1ZUQ A;  2ZIO A;  5LL6 Y;  1V9P A;  1AI6 A;  2PUS A;  3N2G A;  3AEI A;  3UM7 A;  1Q82 W;  4JZ2 A;  3CYO A;  2LW7 A;  4MTO A;  1SA0 B;  3C90 A;  1VQP V;  2YXL A;  1G8M A;  3PN1 A;  1Q81 W;  3CJH A;  4NXN O;  3N2K A;  1K34 A;  4Q20 A;  3BA8 A;  4JPR A;  2EIN B;  4P9P A;  5K1X A;  3MAQ A;  4B3T O;  4R50 A;  2UUA B;  4FFK A;  3RYI A;  3B4S A;  4YJ2 A;  1KKC A;  1XQ8 A;  1X4T A;  1IXM A;  2P06 A;  1PPJ H;  2Y0I A;  3AG3 B;  5IDJ A;  3F7V C;  3CCM V;  3D36 A;  2F23 A;  2ZCE A;  3ICX A;  1NR7 A;  4I55 B;  3JAK A;  1FXH A;  4X1I A;  1EN5 A;  2QKS A;  3S3X A;  3HKD B;  3FFQ A;  3LSQ A;  2BTO A;  2VS0 A;  2DJV A;  3ZMV A;  2V1D A;  2ZNI A;  2UUC O;  1SQQ H;  3QF7 A;  3HR0 A;  5KHJ A;  2EBO A;  2QKA A;  3N27 A;  5JVD A;  3TK1 A;  4NTY A;  4LNU B;  2R9R B;  2BSK A;  2X0L A;  1H2L A;  5LHH A;  2Y69 C;  4JV5 B;  1NBM G;  1ENV A;  2IJI A;  3ZRW B;  1TUB A;  4WFG A;  3A0B Z;  2ADQ B;  2EIK C;  1WA8 B;  4B3R O;  1ZTE A;  1R6T A;  3E8G A;  3WU2 Z;  2XTA A;  3M8A A;  4QE9 A;  1HP8 A;  2IJH A;  2QTO A;  2Y4T A;  1H8H G;  1UFI A;  4CH6 A;  1OZ0 A;  5F2V O;  3GVM A;  3SGI A;  4TV8 A;  1KMI Z;  2L35 A;  1PD3 A;  4G2K A;  3FKS G;  2P4V A;  2DYS C;  1PM9 A;  1NVP D;  2UXD O;  2P22 C;  4PDV A;  5JWP A;  3K08 A;  3ZRS A;  3OEH G;  1XMO O;  5CN0 A;  1ZWI C;  1N32 B;  3DXR A;  1U96 A;  4LFA B;  2XHB A;  2NLJ C;  3SYC A;  4I9Q A;  1RM1 C;  4MVM A;  2QTS A;  2JJ1 G;  1HNX O;  2HEP A;  3BVO A;  4TSF G;  3SJC C;  2HHH O;  4XDL A;  3Q4H A;  2A06 H;  1QVG U;  3CX5 F;  3ZS8 C;  1S5L Z;  2XAQ A;  1PNK A;  1EZJ A;  4EFE A;  4O4L A;  1THZ A;  4KL1 A;  2V4D A;  1BHA A;  4AQY O;  4G27 B;  5EIB C;  3AK3 A;  4JI3 B;  2UU9 O;  4JI2 O;  3ZHS A;  5CA3 A;  4LF4 B;  3UKM A;  3VQY A;  3JYC A;  4FM0 A;  3E89 A;  3K9A A;  5J2U B;  1I0H A;  3I55 V;  3IGA C;  4EKW A;  4KFM A;  5LMU B;  1Q6H A;  1SA0 A;  3O9O A;  5J2T B;  5CA1 B;  3MD0 A;  4JTA B;  4FLX A;  4B3M O;  3SPG A;  2UUB B;  3OD4 A;  3BHP A;  2ZNJ A;  4MVQ A;  1GN2 A;  1GAX A;  4I50 B;  4DV7 O;  5D5P A;  2UXX A;  4X9Q A;  5FLX N;  3KKY A;  1YVW A;  1FJG O;  1OCO B;  2JVD A;  4Z1M G;  4DR2 B;  3X2Q B;  5CA0 B;  2N05 A;  4I55 A;  2W6I G;  4YIP A;  1GM8 A;  1AB3 A;  3WB0 A;  3HKD A;  1Q7Y W;  3RYH B;  3UT5 B;  1G1X B;  3ZRX A;  2C2A A;  4LNU A;  2DQ0 A;  4CS3 A;  2WPD G;  2QEX V;  1YJ9 V;  1R3L C;  1VIB A;  3DTU B;  2VWK A;  3ZRW A;  3ASO C;  4Z2W A;  4XDJ A;  3E8B A;  4RQF A;  3K5N A;  4KUM A;  2JIZ G;  4U3F H;  1WA8 A;  3ASN C;  1VAR A;  1XMQ O;  3SPC A;  1NTK H;  3JAR B;  1Y74 B;  4PI0 A;  4TV9 B;  2KB1 A;  5LP6 B;  3W7X A;  4WF9 V;  4CH3 A;  1M57 B;  4W4K A;  4DR4 O;  1KB9 F;  3BRC A;  3JCU Z;  5LMN B;  5B1B B;  1QBZ A;  4ASU G;  1BQZ A;  1DTO A;  2AHZ A;  2LFS A;  1F23 A;  4FPP A;  4X89 A;  3BY6 A;  1BZK A;  3CXH F;  1VMG A;  1IBM B;  5LA6 B;  2IH3 C;  3OTO B;  4JI0 B;  4LWS B;  1AR1 B;  1RP3 B;  2O57 A;  2EJ7 A;  4I0X B;  3OR7 C;  2OIE A;  4DR3 O;  1ZSP A;  4J7J A;  3D36 C;  2F66 C;  4GX5 A;  3CB2 A;  2UUC B;  1I94 O;  3ZHT A;  4P30 A;  3FX7 A;  2KQX A;  4CS4 A;  2OT5 A;  4NTW A;  1NS1 A;  3HKC B;  5E1A C;  1HNW O;  4JAV A;  4DK1 A;  2LO1 A;  3BCC H;  4DW0 A;  4Z1V A;  3D8C A;  5K1P A;  1N4C A;  1W0J G;  4FVM A;  2G38 A;  3H01 A;  1VQN V;  1DLB A;  2ZE8 A;  3IC9 A;  4TUY B;  4MW8 A;  4X65 O;  5BR8 O;  3CCE V;  3A2F A;  1H2G A;  2DE0 X;  5J2U A;  2MW2 B;  1TAE A;  3LDC A;  3I56 V;  3OUF A;  1N36 O;  2NN4 A;  4JI5 B;  2FTK A;  1SER A;  1KC8 W;  1LNQ A;  1EBO A;  2ZD9 A;  3TCU A;  2Q4P A;  4D6T H;  5J2T A;  3A0H Z;  4QNH B;  5CA1 A;  3LDD A;  4K0K B;  3N2K B;  1Q86 W;  1E79 G;  2MK3 A;  4H33 A;  3R66 A;  4K3A A;  3DGE A;  4DV5 O;  2X6B A;  2GUZ B;  3K3W A;  2QWQ B;  4DUZ B;  4I50 A;  5LHI A;  2PYJ A;  2E75 B;  5B1N A;  2A0L A;  4GX0 A;  3RYC B;  1YEW A;  2P7T C;  4FIP C;  1IVS A;  4D7S A;  4LCU C;  4UCR A;  2YI9 A;  4X1K B;  4O4J B;  2ITC C;  5CA0 A;  4DR1 O;  1Q6U A;  1D5A A;  2RCV A;  2OWO A;  1FFX B;  3A0R A;  4IHJ B;  4DV0 B;  3MHS C;  3ETD A;  2VQF O;  2XND G;  2EX3 A;  1AIL A;  1SC5 B;  3OR6 C;  2IJK A;  3LUT B;  3MHH C;  4A5U B;  2KG7 B;  3GWO A;  2GHY A;  4BW5 A;  2EIJ C;  4R8C A;  2EIL B;  1Q6I A;  3RYH A;  1YI2 V;  4KHP O;  3UT5 A;  3DC6 A;  1NTZ H;  4P2Z A;  2GV9 A;  3KCX A;  3CMA V;  4TQF A;  3ABM B;  4CH4 A;  1DGS A;  5JQG B;  1Y67 A;  4X66 B;  4J80 A;  2PTM A;  5KUK A;  2B9Z A;  1AI7 A;  5JH7 B;  3B8N A;  1CEZ A;  1OCR B;  3JAR A;  1Y74 A;  3ABL B;  4TV9 A;  2Y48 A;  3H1J H;  1KD1 W;  5LP6 A;  3T4D A;  1SQG A;  5LYJ B;  3OT7 A;  3FYI B;  2JS5 A;  5KAI Z;  1BCC H;  3JAS B;  1WP8 A;  2WLL B;  1K3E A;  2Q68 A;  1GK9 A;  3LNN A;  4UVC A;  1K5Q A;  5LHG A;  1NJI W;  2EIN C;  1WB8 A;  3TXS A;  1HNZ B;  3SPI A;  2V7Q G;  2WSS G;  4PEL A;  5LA6 A;  4LWS A;  4WFA V;  1AR4 A;  2ATK C;  3K5L A;  4UB6 Z;  5L3C A;  4I0X A;  3LNM B;  1XHZ A;  2DW4 A;  3TGU H;  1IBL O;  3JD2 A;  1XRE A;  3JAW A;  4LF9 O;  3K5M A;  3AG3 C;  3ZBH A;  2E76 B;  1R73 A;  2F4V O;  4LFB B;  4TOI A;  1WAZ A;  4X64 B;  4GKJ B;  1JVM A;  3CCJ V;  1P4R A;  2BTQ B;  4OX9 B;  4LF8 O;  4TT3 G;  3HKC A;  5DED A;  2YSU B;  3D3Q A;  4DO2 A;  1YJW V;  4I9W A;  3OEE G;  3OAA G;  4NB5 A;  4RUF A;  3J7A U;  1PL0 A;  2ZM6 O;  4QE7 A;  2ITD C;  4B3S B;  2JEU A;  1HR0 O;  2QWN B;  4TUY A;  2UXB B;  1K4D C;  4FLT A;  3DSQ A;  4LF7 O;  5IE9 A;  2Q8V A;  4DR6 B;  4PA3 A;  4GX2 A;  3SYQ A;  1NKD A;  3KCY A;  5CBF A;  1YDX A;  2QM8 A;  1W59 A;  5B5E Z;  5EYP B;  2VWJ A;  4MTX A;  4CS2 A;  5J9P C;  1DF5 A;  4MVS A;  2Q5Z A;  2WWW A;  4G28 B;  4PV1 B;  1FD9 A;  2A79 B;  4CH5 A;  2H8P C;  4J41 A;  5FL7 G;  5KMG B;  2GUZ A;  3APQ A;  3E83 A;  3SPH A;  4E2L A;  2E5L O;  4W4L A;  1PNM A;  1M56 B;  3L70 H;  4JI7 B;  1R6K A;  1US6 A;  1MAB G;  1AJP A;  1O9H A;  1BS3 A;  3RYC A;  1IZ3 A;  5JCO A;  1H2K A;  1VQO V;  2Q7E A;  4X1K A;  1S72 V;  4O4J A;  4LFC O;  1XOU A;  3CCU V;  3G71 V;  2ADP A;  3U11 A;  3BA9 A;  4GUN A;  4X1Y B;  1FFX A;  4PDL A;  4IHJ A;  5DN6 G;  1Z5W A;  4DV6 B;  4U3J B;  4DR7 O;  1QHT A;  2KG7 A;  2XAH A;  4PDM A;  3AG7 A;  1MZF A;  3P3N A;  2W6J G;  3JAT B;  1N33 B;  1D2D A;  3OW2 U;  1P7B A;  3F7Y C;  4AI8 A;  3CS5 A;  3LSU A;  1JPX A;  1NH2 B;  5JQG A;  4PA9 A;  3CEI A;  2BOB C;  2DN9 A;  4DXW A;  4JYA B;  5IYZ B;  5JH7 A;  2Y0P A;  3JSL A;  1GKF A;  4MW3 A;  3OUS A;  3QO7 A;  3HKE B;  4MTF A;  3RWR D;  4YY3 B;  3T4Z A;  2CTW A;  4DR5 O;  4JAA A;  5LYJ A;  4LH7 A;  1EN4 A;  5LGN A;  1QLN A;  2OTL V;  4PA7 A;  3S3W A;  4JI4 O;  1Q90 D;  3JAS A;  4WFB V;  3T1H B;  1N34 B;  2WLL A;  2LJ2 A;  4JYB A;  3ABK B;  4JF3 A;  3SYO A;  4NR1 A;  2YID A;  4OPA A;  2PI5 A;  1FXK B;  2NR5 A;  3H1L H;  1QLE B;  2QGN A;  4RAI A;  3H1K H;  4DV4 B;  4X62 O;  4LF6 O;  1OCO C;  4ZI7 B;  4R6Z A;  3K03 A;  3R65 A;  3OE7 G;  4DUY O;  1MA1 A;  3IC7 A;  3E2E A;  2BE3 A;  1H2M A;  3X2Q C;  2Q9L A;  2OYQ A;  2P6J A;  3GWK C;  5KX5 B;  1A32 A;  1MSW D;  4JZG A;  1G4Y B;  4PDR A;  3MDS A;  2M7W A;  2BTQ A;  3CP1 A;  3JD0 A;  4UXN A;  4HAM A;  1X59 A;  4XBF A;  3AG2 B;  1VQ8 V;  3CC4 V;  2IU0 A;  2PY5 A;  3CD6 V;  5B1A B;  5IWA O;  5C8Y B;  3QG5 A;  4H13 B;  2W0F C;  3SJQ C;  2UXN A;  3CCL V;  2PF4 E;  2HP8 A;  2JGD B;  3ML0 A;  4LF5 O;  4JI8 O;  2CUG A;  4X8A A;  2RMK B;  4NXM O;  2ZT9 B;  4DV3 B;  3JSN A;  1VQK V;  1F7Y A;  2H3O A;  3IAY A;  1DK1 A;  4DW1 A;  1QR8 A;  5LP6 C;  1M57 C;  5EYP A;  1VQL V;  3CPW U;  4GKK O;  5CB4 B;  2JJ2 G;  5B1B C;  4HNA B;  5BMV B;  3U10 A;  2ZE5 A;  2JEX A;  1WN7 A;  3W7S A;  5L3B A;  3HKB B;  4MT8 A;  2FB5 A;  5KMG A;  1JJ2 U;  3WB1 A;  3T1C A;  3IFX A;  1YTF B;  3EFF K;  4UUJ C;  5ITZ B;  1TUE B;  2B1G A;  2YIB A;  4LC1 A;  2F93 B;  2CGO A;  4AIL C;  1J5E O;  2PI4 A;  1FXV A;  3K5O A;  4BW9 A;  4DRX B;  1AJQ A;  3QO5 A;  2RN9 A;  1XNR B;  1YSC A;  4X1Y A;  4JI1 O;  2K1E A;  1NU1 H;  4DYL A;  1KEC A;  2QWR B;  1V54 B;  2JGU A;  3OGI B;  4K8Z A;  4JYY A;  4DV2 B;  4RWU A;  4U3J A;  1SKV A;  2ODM A;  3TET A;  2LP7 A;  3RYF B;  2VQE B;  2GTA A;  2HG5 C;  1SES A;  3JAT A;  2BOC C;  5H5N A;  4QPK A;  1YIT V;  1SQF A;  3L73 H;  1U97 A;  3KZI Z;  4UCO A;  3SR2 C;  2WA4 A;  3U0Z A;  4GYC B;  1M5I A;  5L3F A;  2WLH A;  1L0L H;  2P90 A;  5IYZ A;  3CRQ A;  4F4L A;  3HPL C;  3RW0 A;  3F5W C;  1I08 A;  2FL4 A;  2WA3 A;  1OCC B;  1KP3 A;  3JD4 A;  3HKE A;  4MVO A;  3E8H A;  4NXN B;  1XNQ O;  4O4I B;  4GX1 A;  2UXC O;  4YJ3 B;  4DV1 O;  2ZIN A;  1AP6 A;  3CXC U;  4UFZ A;  3T1Y O;  3QTC A;  4PI2 A;  4B3T B;  1I5Y A;  3K0D A;  3QVN A;  1B06 A;  2JDI G;  2CTQ A;  4EEQ A;  5C93 A;  1VF5 B;  3RN4 A;  4OGQ B;  4J7Z A;  2PYL A;  1NR1 A;  2AZ0 A;  1FXK A;  1F51 A;  1WPX A;  1H2S B;  3G6E V;  5CMU A;  1H8E G;  1L0N H;  5GTI Z;  5A2Q N;  3G6B A;  5EBL C;  1CP9 A;  4ZI7 A;  4JTC B;  5JCO C;  2GDS A;  1K73 W;  1BQ0 A;  3OFN G;  3JAW B;  1KQS U;  1M9N A;  5KX5 A;  3O65 A;  2VRZ A;  4FLV A;  1FPO A;  4JI6 O;  1M4U A;  2QA4 V;  1AI4 A;  3RVY A;  3G67 A;  1BMF G;  1EN6 A;  2UUA O;  4F6R B;  3L75 H;  4MTG A;  1MNG A;  3CSX A;  3RBZ A;  4IT5 A;  2WLN A;  4MVU A;  3C3T A;  1NQT A;  2WAM A;  5L3E A;  2EIL C;  1VF6 A;  1GN4 A;  3M99 B;  5C8Y A;  4IYI A;  4AHC A;  2HVK C;  1UPG A;  4B3R B;  1SZX A;  4UCV A;  3ABM C; 
#chains in the Genus database with same CATH homology
 1XNR O;  5H5N A;  4LFC O;  2N74 A;  4DV4 O;  4DR4 O;  1XEQ A;  3R66 A;  4DV5 O;  1X59 A;  4JI5 O;  3SDL A;  3J81 N;  4JI7 O;  4DV2 O;  1FKA O;  3RT3 C;  5BXZ A;  1IBL O;  4DR7 O;  4JI3 O;  4B3R O;  2VQE O;  5IWA O;  1R6T A;  4LF9 O;  1HNZ O;  3M8A A;  4K0K O;  2F4V O;  4LF4 O;  1IBK O;  5LMN O;  4B3M O;  2AGA A;  4JV5 O;  3F5T A;  4DR1 O;  1D2D A;  4LF5 O;  4LF8 O;  1XNQ O;  5LL6 Y;  4DUZ O;  4JI8 O;  1R1B A;  4NXM O;  2UXC O;  5LMU O;  2VQF O;  4DV1 O;  4DV6 O;  2ZKO A;  1AIL A;  4DV7 O;  2LW7 A;  4A5U B;  1F7Y A;  5FLX N;  3T1Y O;  3J7A U;  4DR3 O;  4LFB O;  1FJG O;  2UXD O;  1DK1 A;  4X64 O;  4GKJ O;  2ZM6 O;  1IBM O;  4OX9 O;  1N33 O;  2UUB O;  4GKK O;  4KHP O;  4JI0 O;  3OTO O;  1HR0 O;  4NXN O;  1FYJ A;  1I94 O;  5IT9 N;  4DV3 O;  4DV0 O;  4DR5 O;  1XMO O;  1NS1 A;  1HNW O;  4LF7 O;  5A2Q N;  4B3T O;  4JYA O;  4JI4 O;  1AB3 A;  4B3S O;  1KUQ A;  4YHH O;  2Z0A A;  1HNX O;  4OPH A;  2UXB O;  1J5E O;  4YY3 O;  2HHH O;  3O65 A;  1G1X B;  2JRI A;  4JI6 O;  4OPA A;  4X65 O;  5BR8 O;  1N32 O;  4LFA O;  5BY1 A;  4DR6 O;  3JAM N;  4X66 O;  2UUA O;  4JI1 O;  4X62 O;  3T1H O;  4LF6 O;  1N34 O;  1N36 O;  2FKX A;  2E5L O;  4DUY O;  2DJV A;  4DR2 O;  2UUC O;  2DOS A;  4AQY O;  1XMQ O;  3J80 N;  1A32 A;  2UU9 O;  4JI2 O;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...