2UU9O

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uu9O00
4DV5O 2UXDO 4DV7O 1DK1A 3SDLA 3O65A 4X64O 5LL6Y 4X66O 1F7YA 4DV4O 1N34O 2UUAO 3T1YO 4JI1O 4JI8O 1YZBA 4DV2O 4B3MO 1AILA 5IWAO 4JI6O 3OTOO 2ZKOA 4OPHA 1I94O 1N33O 1J5EO 4KHPO 4LFAO 1FJGO 2UXBO 1N36O 5A2QN 1IBMO 3J80N 4OPAA 1HNWO 1IBLO 2F4VO 5BXZA 1KUQA 4LF7O 1R6TA 4B3TO 3R66A 4YY3O 4DUYO 4DV0O 4X65O 3T1HO 4NXMO 4DV1O 4JI5O 1AB3A 1NS1A 3JAMN 3F5TA 4DUZO 4LFCO 4JI2O 4JI7O 1HNXO 2Z0AA 5LMNO 4DR7O 1A32A 4DR5O 4A5UB 4DR6O 4LF9O 2ZM6O 3J7AU 1XNRO 2AGAA 2UUBO 4DR2O 2VQFO 5H5NA 4AQYO 2UXCO 4GKJO 4NXNO 1D2DA 5FLXN 4LF5O 1FYJA 5BR8O 4DV6O 1HNZO 4DR1O 4DV3O 1XEQA 4JI3O 4X62O 5LMUO 4LF4O 2VQEO 2JRIA 2DOSA 4GKKO 4B3SO 5BY1A 1X59A 4JI0O 4LFBO 4K0KO 4JYAO 5IT9N 4LF6O 4YHHO 4JI4O 1R1BA 1IBKO 3J81N 2FKXA 4DR3O 2HHHO 4DR4O 4LF8O 4B3RO 1N32O 2N74A 2LW7A 2UU9O 2UUCO 1XMQO 4OX9O 1XMOO 2E5LO 1HR0O 1XNQO 2DJVA 3RT3C 3M8AA 1FKAO 1G1XB 4JV5O
chains in the Genus database with same CATH superfamily
1VF7A 2WLNA 3CJHB 2YSUB 4P30A 4K8ZA 3BA9A 2HKOA 4YJ3B 1N34O 1SKVA 4PI0A 3ABKB 3HB3B 5K1XA 4PI2A 1Q6UA 1Q3EA 5JQGA 2ARHA 2ZE5A 1EN6A 3RFRA 1FJGO 2OT5A 1Y6XA 1ZLZA 3IFXA 4QIWF 1EZVH 1YHQV 2UUBB 4TV8A 2Y0IA 1R6TA 4K8XA 4OXSA 3EFFK 4ZI7B 5IE9A 2Q0AA 5FL7G 2EIMC 2YIDA 4JI5O 2EJ7A 5J2TA 5IYCO 4WBNA 2X6CA 5LMNO 5LP6A 3ZN1A 2OYQA 1QQCA 2CGOA 4BIZA 1DLBA 4KUMA 2Y0PA 4DR3B 4R6ZA 2EZOA 5CBHA 4IHJA 4TV8B 1XEQA 2M7WA 5B66Z 3N2GB 4KHPB 4GZRB 2CAZC 3OMIB 5J2TB 5JVDA 2ZNJA 1XI1A 1U97A 3B77A 1BZKA 3HKBA 3IC9A 1K73W 1TGOA 1R1BA 4DR4O 4PA6A 1YVWA 3P3PA 1KECA 4IHJB 4AILC 1YITV 1JFFB 3I5DA 1JX9A 1IBMB 5JCOC 5JVDB 1EZJA 2YS8A 5CN0A 3MHHC 3JCZA 5L3BA 5KAIZ 1YTFD 3ZRXA 3ZIAG 2VQEB 3ASNB 3CCSV 2DYSC 2ZCEA 1OHHG 2W0FC 3RWRD 2QTOA 3K9AA 5KA5A 2E74B 3BCCH 5IYZB 5KHKA 4B7EA 5J9PC 1AI6A 3KKYA 3VQXA 2AZ0A 2VWJA 1S5HC 1OCRC 1ZX3A 1BQZA 4FMTA 3AG2B 4Z2WA 2LGQA 3R66A 4DUYO 4X65O 5KHJA 4DV3B 1O9HA 4FM1A 1S3JA 4RWUA 2QM7A 2OCHA 2PI5A 1MABG 2PUSA 1N4CA 4PA4A 1YF2A 5LXTB 4F4LA 3K5NA 1NR7A 3GWKC 1I0HA 1RSOB 3L73H 1Q90D 4I55A 4HBNA 4LF5O 1LUWA 5H6RA 4DR1O 5IJ0B 5KX5B 1UJWB 2B1IA 4U3FH 1R3IC 4CC6A 5KAFZ 1X59A 4O4LA 4MVMA 2X0LA 1SQXH 3K0DA 3S3XA 1M56C 2ZDIA 1Q82W 2JJ2G 1YCIA 2B5UA 1JJ2U 4J10A 4E2LA 1QBZA 4LF8O 1N8RW 2PGGA 3K5OA 3S3WA 4FLWA 4LH7A 1L1FA 1RP3B 5KA6A 1N33B 4OX9O 2K9PA 2ADPA 1NTMH 3CSXA 2NN4A 3K04A 2H3OA 2DYRC 4HNAB 4DV7O 3CRAA 3B40A 4FK5C 3SDLA 1MMMA 5CB4A 1HDJA 2E76B 1JA8A 5CBGA 5LGTA 4DV4O 1IZ3A 1GO3F 5EC1C 2GBOA 1WNSA 3CD6V 1YJNV 1UPGA 1U96A 2RN9A 2W6IG 2JEUA 1SQPH 3JD2A 1IBKB 5JJJB 1KUQA 3QTCA 2QM8A 3ZRSA 2GHYA 1ORQC 1HNZB 1JPXA 3F5TA 1Y67A 3AG4B 5GTIZ 1PNMA 2XAQA 2P5OA 4JI7O 2EIJB 1VP7A 3CMAV 2HVJC 2IJJA 3D36C 4H37A 4YHHB 4FLUA 3UO2A 1XHXA 3PN1A 2XHBA 4AQYO 2F95B 5GTHZ 2XASA 1IXBA 1KQSU 1BHAA 4DYLA 4FVMA 3U0ZA 5LMUO 3TXSA 2N05A 2Z5UA 2R9RB 4FFKA 1KD1W 3OMAB 2O57A 5EZYA 3ICXA 4PD4F 3G67A 4DK1A 3ABMB 5DN6G 1M4UA 1M57C 2A0LA 2R9IA 1ENVA 1XBLA 1L0LH 4YY3B 3B09A 2RCVA 2Z3YA 2AHZA 5IDJA 1WJZA 1URFA 3W7UA 1KU9A 1XOUA 1DGSA 1GRJA 1SC5B 3M8AA 2Y69C 4PDLA 4D7SA 4JV5O 2DN9A 3FKSG 5EZYB 1Y74A 2JDIG 4X66O 4ZIBA 4PA9A 1F7YA 2JIZG 2JS3A 4FJCC 4YIPA 1SQVH 1NR1A 1THZA 4G27B 3TXQA 2ZKOA 3K08A 3LUTB 2AW9A 4PDVA 5H2FZ 4LF6B 2VWKA 2AHYA 4X1KA 2CH7A 1US6A 3A0RA 2ATKC 3K79A 1AJPA 3UO3A 3T1CA 1L8DA 4DV0O 4NXMO 2E3CA 4DV1O 1NS1A 1Y74B 4JPRA 2WPDG 2CTQA 2E5LB 2OCCC 1R6NA 3L71H 4B3SB 2GV9A 4ZOLA 1M5IA 3SJCC 4WF9V 2DQ3A 3OEEG 4DR5O 3OR7C 3RVZA 4WFAV 5KUKA 1WPBA 3HR0A 5IYDO 3H1HH 4EB6A 2AGAA 1KKCA 3D8CA 4YIOA 1GH6A 1D5NA 1IX9A 4H0LB 5FLXN 4JYCA 5L3FA 3SYAA 4I9QA 2ITDC 2OIGA 1I94B 3LSQA 2A06H 4UV9A 1EN5A 3CRMA 1XL4A 1K5SA 3H1LH 3WB0A 4JYAO 1SZTA 1S5JA 1YJ9V 2HP8A 5IT9N 2EBOA 1V54B 1K34A 3AK2A 3E8BA 4CS4A 4JTCB 2Q9LA 1YIJV 3FB8C 3TCUA 1YTFB 2WLJA 2ZINA 4EB6B 5B1BB 2YI9A 2Q7HA 4BIUA 2UU9O 3JAWA 5H9CA 3E8FA 1XNQO 3QO8A 4P9PA 2F4VB 1FKAO 5BZBA 1BSMA 3G71V 3QO5A 1Y76B 4QE9A 5FPRA 4TT3G 2KSDA 4I7ZB 5IWAO 4NYKA 3H9VA 1TUEB 1B04A 3JAWB 1XNRB 1IBLO 3QG5A 3EVKA 5IY5C 3ETDA 3DXRA 3SJQC 1MZEA 2CGNA 3W7XA 4GKJB 1B06A 5BMVA 2EIKB 1RM1C 2WLLB 1FXKA 3VQWA 5LBQA 4W4KA 4OGQB 5B1NA 4GKKB 4JI0B 2F43G 4I4TA 4PELA 3K59A 1QR8A 3AG1B 5LHGA 2GTSA 2ADQB 2OWOA 3CRCA 5DEDA 1N34B 3DXRB 3ZCCA 4J7JA 2ZD9A 4UCTA 3ZRWA 2YUAA 3RVYA 3DGEA 1FJGB 2LGWA 5B1AB 2LJ2A 4X8AA 3E35A 3IJ4A 3KCXA 2EJRA 2ZE8A 2EILB 1H2LA 2A7WA 3BFRA 3Q4HB 3A2FA 3CRQA 4I4TB 3QO7A 4JI5B 4X89A 4O4HA 1JVMA 1WB8A 4O4JA 5LMNB 1J5EB 3SPGA 3P3NA 3ABKC 2DJVA 1V55B 1WN7A 3P30A 1OCCB 3WU2Z 3VOUA 2EINC 4DV5O 2UXDO 4YJ3A 3CCVV 1IDSA 3E89A 4RQFA 3QNEA 4FLZA 2RMKB 4RQEA 2OIEA 1AR1B 1VQ8V 1YDXA 4G2KA 4UVAA 4B7KA 4DXWA 4O4JB 4LF9B 2UXBO 4L87A 2R9AA 4ZI7A 2Q7GA 1I5YA 5LGNA 3APOA 1GM9A 1F4MA 3ABLC 1Z5WA 4JI3B 1PL4A 3OTFA 1QCEA 4JAVA 3MAQA 4J9YB 5L3EA 1KMIZ 2UXNA 2DQ0A 2Y48A 4UVCA 2FTKA 4F6RA 3HKDB 1WA8B 3K57A 4DR6O 1OZ0A 4J9ZB 3B8MA 5LGUA 1S76D 1ZL8A 2XAGA 1T5EA 3OGIB 3KZIZ 4PA7A 3X2QC 5LP6C 3KCYA 5KHIA 4K3AA 1VQ4V 3OEHG 1FYJA 3N2GA 3CHXA 4RUFA 4X62O 1B6QA 3H1IH 3JATA 1N0JA 4LF4O 1VQ5V 1CPYA 1XREA 2WLIB 3RGBA 3DC6A 4F6RB 3ZMTA 1OCZB 2H8PC 1KBHA 2FKXA 4DUYB 3CRRA 1NH2D 1ZL8B 1Q6IA 5EC2C 2YI8A 1CP9A 2JVDA 4TQDA 1JFFA 4EFBA 1M93A 2XAHA 1W0JG 1NT2B 1WB7A 1XMOO 4ICGA 3OMNB 2JS5A 3JATB 3ASNC 3LDDA 1DF5A 4CS3A 3HKCA 2QGNA 1Z2GA 2Q7EA 4WFHA 5L3DA 5LYJB 1DK1A 4DW0A 3JD4A 2KG7A 2GUZB 4X64O 4DR1B 3RYFA 3IC7A 5FNVA 1SA0B 3G80A 5IYZA 2YEVA 4UCUA 2DWDC 1LR1A 2P67A 3CCJV 2QWNB 4X1YB 3HKCB 1R73A 2EIMB 4TSFG 4UCOA 2C2AA 1KC8W 1BHBA 1DTOA 2CUGA 2WSSG 1AB3A 1XQ8A 2KG7B 4Q20A 1EN4A 1MSDA 4JASA 3RYFB 1QNMA 2HVKC 3APQA 1KYOF 5FNVB 3B2EE 2PYLA 2RNBA 3RN4A 2YEVB 5LXTA 4U7OA 2P4KA 4DV7B 3CCRV 2VRZA 1RSOA 3UM7A 3THOA 2P4VA 3TETA 4KL1A 2MK3A 2UUBO 4DR2O 1R6KA 1Q7YW 4U3JA 4X88A 5JCOA 1Y66A 4FIPC 5IJ0A 4PV1B 5KX5A 3CS5A 3BAAA 1OCOC 4UCRA 1I7FA 2PY5A 4K0KO 2N04A 5F2VO 5KHHA 4GT1A 2WA3A 1SQBH 1XDCA 3FYIB 4CH4A 3CCEV 4DR3O 1JR9A 3ML0A 2EX3A 2LO1A 4K35A 3CPWU 2HHHO 2B1GA 3TK1A 4JI8B 4ZBMA 4U3JB 3ASOC 5HFMA 1YSCA 3H01A 4LFAB 1N36B 1ZUQA 3LSUA 2LFRA 4HNAA 3T4DA 2YDEA 1ZWIC 5CBFA 4AQYB 3FFQA 2LQTA 5LMUB 4TQFA 2QR4A 3N2KB 4DO2A 4DUZB 3OUFA 3AG3C 2QKAA 1G8MA 1M1KW 4DV2O 2FYUH 1YEWA 3M99B 2EZPA 1OCRB 2HR3A 1UFIA 3AG4C 2ZM6B 1IBMO 2GDSA 4OPAA 1PL0A 2EIJC 4ABMA 5DECA 2RDCA 3OUSA 1ZSPA 3M7MX 2AZ2A 1AVMA 2YIBD 2Q67A 4QJFB 1K5QA 3T1HO 3K06A 4UB8Z 3VBBA 3JYCA 2XOKG 2XUMA 4B08A 4JAAA 3CCUV 4DR7O 1P7GA 2A3QA 1WP8A 2YIAA 1MSWD 4CC5A 1S72V 1FXVA 2Q5ZA 2PTMA 2QWPB 2LFSA 3ABUA 1EM1A 4DV3O 1K33A 3RBZA 1VARA 1XMQB 2BSKA 1MA1A 2QM4A 4FLVA 1M56B 3DSQA 3CXHF 1XUQA 2ZXWC 1WLEA 2W0XA 1FPOA 3A0HZ 1J95A 1MZFA 4XDJA 2CTWA 1K3EA 3JARA 4DV1B 3ZEDA 2UUAB 3T1YB 4JI1B 4B3MB 4Z1VA 1K4CC 4JI6B 4YJ2A 3UQ8A 4DR5B 5KHGA 4J41A 2DYRB 2BSKB 5EBMC 1VQLV 3FX7A 4IIJB 1BQ0A 4D6TH 5E1AC 3FB7C 4I50B 5JWPA 3K58A 1GN6A 3JCUZ 4LFCB 3JARB 1GK9A 4H13B 4W4LA 1H8EG 4WCEV 3L74H 1PNKA 3FB5C 4EKWA 1N33O 1M9NA 4YJ2B 5C93A 1H2KA 5A2QN 4LWSB 3J80N 1HNWO 4J7KA 3C90A 3K5LA 4HAMA 2VQFB 4LF7O 1PD3A 3FB6C 4J11A 4NB5A 4DV6B 3WB1A 2JGDB 1XNQB 2QWOB 1HNXO 2Q4PA 1QLNA 3FYEB 4UXNA 5EYPA 2YC0A 3L75H 1HWYA 5JJEB 3J7AU 4JI4B 4IYIA 1NH2B 2IM9A 1VIBA 1BGYH 1NBMG 1HNZO 1O9GA 1SESA 2UUCB 3E86A 5EK0A 4NTXA 5K1PA 1TA8A 4FZ1A 4RAIA 2ETNA 3E83A 1SQFA 2CDYA 4ZHQA 3F5WC 5EYPB 4YHHO 2L35A 3QVNA 1P4RA 3J81N 2BE3A 3ZX6A 1VF5B 4DRXA 2IJKA 1JQ0A 1VQKV 2Y69B 3OTOB 4NVPA 4DW1A 1NTZH 1FFTB 4UCSA 3CCQV 1VF6A 3ZHRA 4KXRA 1NVPD 4ZHQB 4FFBA 1AR5A 1NU1H 1Y76A 2XNDG 4KP4A 1R3KC 1D5AA 4IGGA 2NR5A 4JI2B 1E79G 1Y4MA 4DRXB 2F1MA 2EIKC 1SETA 5B3SC 3CYOA 4Q6GA 5BXZA 1VQ9V 4JAUA 2RJZA 5LOVB 2DMXA 1SQGA 2UXCB 2OCCB 2WLLA 4ZKIA 4FFBB 3H1JH 2FB5A 1I5XA 1ZTEA 3JAMN 2ZT9B 4TV9B 2Q69A 4FLTA 2PI4A 3IAYA 3N27A 4DV5B 1FXKC 4IL6Z 3UT5B 3ZBHA 4UVBA 3AK3A 4RUEA 4NXNO 2EILC 1COWG 5EIBC 4B3RB 4R50A 5CA3A 5BR8O 3MHSC 1HR0B 3E8GA 1K97A 2DOSA 4B3SO 3FAVB 3AG7A 4LFBO 1VEWA 3Q4HA 3WG7B 1XHZA 5KLVH 1OCCC 3ZMVA 3RYHA 2ITCC 1N32O 3T2MA 1H8HG 3JASA 3BHPA 1BMFG 4YXWG 5CA0A 1IVSA 4JTAB 4J7ZA 3RT3C 1XILA 4O4IA 4FM2A 2RQ6A 2A79B 4F6EA 1NI8A 4MS2A 4CH5A 1XL6A 3ZN0A 5LL6Y 1JOYA 3CC7V 1TVKA 4QE7A 4X62B 4JZGA 4LF4B 1YZBA 1YXBA 3RYHB 1AILA 1Q5OA 1RPRA 1QHTA 4MT8A 3JASB 4IYHA 3STLC 5CA0B 1KP3A 4CZZA 3ZMUA 2F4VO 3K0GA 2E75B 2PYJA 4MTFA 1RM1B 4O4IB 2Y4TA 2K1EA 1X4TA 3JD0A 3ZHQA 4B3TO 3I56V 2WLHA 3SYCA 4WFBV 4I0XA 4GLXA 5CMUA 1VQPV 3OAAG 4TOIA 1HP8A 1TVKB 3HKDA 3SPCA 1WA8A 1EBOA 5B1OA 3E8HA 2Q8VA 1LUVA 5D5PA 1H2NA 1XNRO 3HKEA 1BCCH 5JJNB 3WB2A 1QU7A 4DR4B 2HLDG 2XTAA 4WFFA 1OCZC 2EULA 4GKJO 5ITZA 5HFLA 4P9OA 5CA1A 5L3GA 3R65A 4TWKA 3SPJA 3JD1A 4I0XB 4GX5A 2WLIA 4J42A 4GKKO 1GN2A 2HJDA 5BY1A 4QNHB 1R3LC 4JI0O 2IH3C 3U11A 1FFXB 2QSAA 1R3JC 4GCZA 3K3WA 3OM3B 4UFZA 1IXMA 3EXAA 4NTWA 2HG5C 3HKEB 2W6JG 2AXTZ 2Y4UA 4HYOA 5KUMA 3LDEA 2OTLV 1WP7A 4MSWC 1QVGU 5ITZB 1SQQH 5CA1B 2EINB 1QLEB 3U10A 4X1IB 2D2CB 1PP9H 4MVOA 1LNQA 5LYJA 2DWEC 4DR2B 2GUZA 2F23A 2BTQA 2P06A 2QA4V 5LHHA 1SA0A 2V4DA 2QWRB 4U7NA 4X65B 2YXHA 3NR7A 2KKWA 4K0KB 1J5EO 3ETEA 3UKMA 1ROPA 5JQGB 4X1YA 3ABLB 1FS0G 1SZXA 2HHHB 2IBZH 4NR1A 1NQTA 4AI8A 2BTQB 4LF5B 2CTPA 2WAMA 4C7UA 3BA8A 3K9SA 3CXCU 2CTRA 3AG2C 5GONA 2ODMA 2DE0X 4IT5A 4I9WA 4JF3A 4WFEA 3SYOA 1A32A 4WBNB 4FZ0A 4A5UB 4LF9O 3X2QB 5LP6B 3A8TA 5EBLC 1N0NA 1AI4A 4GUNA 4LF8B 1AI5A 2VS0A 1KP2A 4MW8A 3ZHSA 4DV2B 3CB2A 1P84F 4JI3O 5TISZ 4UB6Z 4OX9B 3SPHA 1I08A 5LA6A 1W0KG 5GONB 4O2AA 2X6AA 2QTSA 3MDSA 4LNUA 4LH6A 1NVPB 3CC4V 3JAKA 4FPPA 4XDLA 2LW1A 3BPZA 4P2ZA 3HKBB 3T1HB 2X7RB 4D7TA 3KG2A 4DV4B 4FLYA 3BVOA 4QPKA 4H33A 3OD4A 5J2UA 4Z1MG 4DR7B 4JYYA 2XT9A 3BEHA 1H38A 3W7WA 2F93B 3OR6C 3SJBC 5LA6B 3GVMA 4MVZA 1BS3A 4O2AB 3CEIA 1MNGA 4LNUB 4N23A 2KQXA 3AK1A 3O65A 3SJAC 2H94A 3JAKB 3N2KA 4MVQA 1IURA 1FXHA 1EFRG 1K8AW 1SF9A 1YJWV 3W7SA 4JI7B 2ZDIC 4GX1A 4OPHA 2GTAA 5J2UB 2IJIA 4MTOA 1H2MA 3H1KH 4KHPO 3JALA 4LCUC 2IU3A 3ABTA 1SS3A 2DYSB 1GM8A 2PF4E 1GKFA 4PDRA 2NLJC 1WAZA 3ZHTA 1JMKC 3D3IA 1ZAUA 2YICA 2WLKA 5EBWC 4UV8A 3K03A 1G4YB 5IYBO 2XAJA 5LHIA 3E2EA 1OJHA 2QEXV 4XDKA 3JALB 1QVFU 3VQVA 3F7YC 4N21A 4GX0A 1OCOB 2FMLA 1D2DA 2YXLA 2HFEC 4I55B 2VQEO 2ZE7A 3BRCA 4NTYA 4RO2A 2OTJV 3C3SA 3ZS8C 1HNWB 3CWBH 3TJTA 2BCCH 3ZMZA 2P7TC 2R70A 1AP5A 4MVRA 3G6EV 4JV5B 2ILMA 4O4LB 2BOCC 4LF7B 4DK0A 5EIBD 2L6LA 3JD3A 3ASOB 2UXXA 4X66B 3OFNG 2IW5A 1VQMV 3ABMC 4LP8A 1HNXB 1CEZA 1VMGA 1P49A 2V7QG 1GN4A 1K92A 4IIJA 3RYIA 3CMEV 4I50A 3B4SA 3AG3B 3LNNA 4UUJC 5E79Z 3RYCA 4DV0B 5AG2A 4KFMA 5C8YA 4NXMB 5CB4B 1CXZB 4CS2A 4LR3A 4JI8O 1P7BA 3FD9A 1JCHA 3T4ZA 3SR2C 2IH1C 4LWSA 2HEPA 1S77D 4LFAO 4BWAA 1N36O 4GX2A 1Z5VA 2IJHA 1B3QA 3RYIB 1AI7A 1GTOA 4NKGB 4R7CA 4MTXA 1H2SB 1NKDA 2JGDA 3D36A 4CH3A 2A9HA 4BR6A 3RYCB 1H2GA 4JZ2A 5C8YB 4DUZO 2ZQMA 2B9ZA 2Z0AA 3I55V 3OT7A 4JYAB 3W7TA 3OW2U 1GMGA 2M6YA 4FLXA 1TAEA 2ZM6O 5H6QA 1FAFA 1VQOV 1KKDA 1L0NH 4BAYA 3DC5A 2HJFC 3QF7A 1BL8A 5H5NA 3UCSC 4BW5A 1MOFA 1VQ6V 4R8CA 4PHZA 2WA4A 2UU9B 4MVSA 2ZXWB 4AHCA 2JRIA 3DTUB 3STZC 2JJ1G 5IJ9A 1VQNV 1W59A 3CP1A 1BE3H 1IBKO 4G28B 4QGPA 1PNLA 1Q43A 1G6UA 2Q68A 3LSSA 3WFVA 1V54C 2CE4A 3ZHVA 4BIOA 5JH7A 5IWAB 4PDMA 3OE7G 1XMQO 5B1BC 3IGAC 1M57B 1IBLB 3ETQA 5IJ9B 2QWQB 3L9DA 1S0VA 3K5MA 2GSMB 3SPIA 5DM6V 4NXNB 4MTGA 3PJSK 5BR8B 1K7DA 1GN3A 2JGUA 2UUAO 1VF6C 2F66C 3T1YO 4JI1O 3O9OA 3TGUH 3HPLC 4B3MO 4PA3A 4JI6O 2JK5C 4LFBB 5JH7B 3A0BZ 3L72H 1VQ7V 1GAXA 4TUYA 1PKXA 5LOVA 2YXYA 2Q73A 5A9GA 2KB1A 3LNMB 2QE7G 4X1KB 3SYQA 2CH7B 1N32B 4O2BA 4YY3O 4CH6A 5B5EZ 4TV9A 4LFCO 2V1DA 1V9PA 2PZSA 1Q8IA 1E1QG 1TUBA 1AJNA 1W2BU 1SERA 3UT5A 4QPJA 4XBFA 2WLMA 4ZOLB 1NTKH 2ZIOA 4MVUA 2QDOA 4JTDB 3ZHUA 4TUYB 2CK3G 2VQFO 2D3OW 3WG7C 3AG1C 4JYBA 2BTOA 3F7VC 4JGSA 1K4DC 4DV6O 1NJIW 5D5QA 4O2BB 5GW7A 3CC2V 3FAVA 2X6BA 2P22C 3CE2A 3JSLA 5KMGA 1OV9A 2MW2B 1TUBB 2ZIMA 4LF6O 2UXDB 2FL4A 3G6BA 4JI4O 4B3TB 5B1AC 3EHBB 2BOBC 1MG1A 2QJ1A 3MD0A 4HZ3A 3G4SV 4UCVA 2XAFA 4LBEC 4EEQA 2LP7A 2NNUA 3B8NA 1NZ6A 2N74A 2IU0A 4GYCB 2UUCO 1F23A 2E5LO 4X9QA 3ZJZA 1M90W 1BT8A 2UXBB 1AJQA 2R72A 4EFEA 2YIBA 1G1XB 4BW9A 5KMGB 1F51A 1KB9F 3AEIA 3GB7C 3L70H 4LC1A 3C3TA 1V55C 1GM7A 1E1RG 1HW7A 2QKSA 4ASUG 5B3SB 3ZRVA 1WPXA 4WFGA 3OTOO 3P32A 1I94O 2JEXA 2P6JA 4DR6B 4X20A 1RPOA 1QR9A 4I5SA 1FD9A 1AP6A 3LDCA 3D3QA 1F4NA 3SGIA 2G38A 1YI2V 3ETGA 5FPOA 4L8JA 2ZE6A 2DW4A 3GWOA 5BMVB 4JI2O 1FXKB 5IY5B 3JSNA 1K9MW 1Q86W 1AROP 3BABA 1Q6HA 4X20B 2Q6AA 3BY6A 2QKCA 4J80A 2UXCO 1RFYA 2Q0OC 2ZNIA 4PJ0Z 1XMOB 1DF4A 4MW3A 4CBCA 1FFXA 3ZRWB 3VQYA 1S5LZ 2ZR3A 3E22A 4H44B 3SYPA 3CJHA 3CCLV 1PM9A 1JJOA 2WWWA 1PPJH 1QLEC 1Q81W 2ZR2A 3OGCC 4E4EA 4X64B 3ZMSA 4FM0A 5L3CA 1AR4A 3CCMV 3NXSA 4B3RO 2LW7A 4O4HB 4X1IA 1HR0O 1SRYA 1PV0A 2P90A 3RW0A 3E22B 3CX5F
chains in the Genus database with same CATH topology
4DV5O 2UXDO 4DV7O 1DK1A 3SDLA 3O65A 4X64O 5LL6Y 4X66O 1F7YA 4DV4O 1N34O 2UUAO 3T1YO 4JI1O 4JI8O 1YZBA 4DV2O 4B3MO 1AILA 5IWAO 4JI6O 3OTOO 2ZKOA 4OPHA 1I94O 1N33O 1J5EO 4KHPO 4LFAO 1FJGO 2UXBO 1N36O 5A2QN 1IBMO 3J80N 4OPAA 1HNWO 1IBLO 2F4VO 5BXZA 1KUQA 4LF7O 1R6TA 4B3TO 3R66A 4YY3O 4DUYO 4DV0O 4X65O 3T1HO 4NXMO 4DV1O 4JI5O 1AB3A 1NS1A 3JAMN 3F5TA 4DUZO 4LFCO 4JI2O 4JI7O 1HNXO 2Z0AA 5LMNO 4DR7O 1A32A 4DR5O 4A5UB 4DR6O 4LF9O 2ZM6O 3J7AU 1XNRO 2AGAA 2UUBO 4DR2O 2VQFO 5H5NA 4AQYO 2UXCO 4GKJO 4NXNO 1D2DA 5FLXN 4LF5O 1FYJA 5BR8O 4DV6O 1HNZO 4DR1O 4DV3O 1XEQA 4JI3O 4X62O 5LMUO 4LF4O 2VQEO 2JRIA 2DOSA 4GKKO 4B3SO 5BY1A 1X59A 4JI0O 4LFBO 4K0KO 4JYAO 5IT9N 4LF6O 4YHHO 4JI4O 1R1BA 1IBKO 3J81N 2FKXA 4DR3O 2HHHO 4DR4O 4LF8O 4B3RO 1N32O 2N74A 2LW7A 2UU9O 2UUCO 1XMQO 4OX9O 1XMOO 2E5LO 1HR0O 1XNQO 2DJVA 3RT3C 3M8AA 1FKAO 1G1XB 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  2UXD O;  4DV7 O;  1DK1 A;  3SDL A;  3O65 A;  4X64 O;  5LL6 Y;  4X66 O;  1F7Y A;  4DV4 O;  1N34 O;  2UUA O;  3T1Y O;  4JI1 O;  4JI8 O;  1YZB A;  4DV2 O;  4B3M O;  1AIL A;  5IWA O;  4JI6 O;  3OTO O;  2ZKO A;  4OPH A;  1I94 O;  1N33 O;  1J5E O;  4KHP O;  4LFA O;  1FJG O;  2UXB O;  1N36 O;  5A2Q N;  1IBM O;  3J80 N;  4OPA A;  1HNW O;  1IBL O;  2F4V O;  5BXZ A;  1KUQ A;  4LF7 O;  1R6T A;  4B3T O;  3R66 A;  4YY3 O;  4DUY O;  4DV0 O;  4X65 O;  3T1H O;  4NXM O;  4DV1 O;  4JI5 O;  1AB3 A;  1NS1 A;  3JAM N;  3F5T A;  4DUZ O;  4LFC O;  4JI2 O;  4JI7 O;  1HNX O;  2Z0A A;  5LMN O;  4DR7 O;  1A32 A;  4DR5 O;  4A5U B;  4DR6 O;  4LF9 O;  2ZM6 O;  3J7A U;  1XNR O;  2AGA A;  2UUB O;  4DR2 O;  2VQF O;  5H5N A;  4AQY O;  2UXC O;  4GKJ O;  4NXN O;  1D2D A;  5FLX N;  4LF5 O;  1FYJ A;  5BR8 O;  4DV6 O;  1HNZ O;  4DR1 O;  4DV3 O;  1XEQ A;  4JI3 O;  4X62 O;  5LMU O;  4LF4 O;  2VQE O;  2JRI A;  2DOS A;  4GKK O;  4B3S O;  5BY1 A;  1X59 A;  4JI0 O;  4LFB O;  4K0K O;  4JYA O;  5IT9 N;  4LF6 O;  4YHH O;  4JI4 O;  1R1B A;  1IBK O;  3J81 N;  2FKX A;  4DR3 O;  2HHH O;  4DR4 O;  4LF8 O;  4B3R O;  1N32 O;  2N74 A;  2LW7 A;  2UU9 O;  2UUC O;  1XMQ O;  4OX9 O;  1XMO O;  2E5L O;  1HR0 O;  1XNQ O;  2DJV A;  3RT3 C;  3M8A A;  1FKA O;  1G1X B;  4JV5 O; 
#chains in the Genus database with same CATH topology
 1VF7 A;  2WLN A;  3CJH B;  2YSU B;  4P30 A;  4K8Z A;  3BA9 A;  2HKO A;  4YJ3 B;  1N34 O;  1SKV A;  4PI0 A;  3ABK B;  3HB3 B;  5K1X A;  4PI2 A;  1Q6U A;  1Q3E A;  5JQG A;  2ARH A;  2ZE5 A;  1EN6 A;  3RFR A;  1FJG O;  2OT5 A;  1Y6X A;  1ZLZ A;  3IFX A;  4QIW F;  1EZV H;  1YHQ V;  2UUB B;  4TV8 A;  2Y0I A;  1R6T A;  4K8X A;  4OXS A;  3EFF K;  4ZI7 B;  5IE9 A;  2Q0A A;  5FL7 G;  2EIM C;  2YID A;  4JI5 O;  2EJ7 A;  5J2T A;  5IYC O;  4WBN A;  2X6C A;  5LMN O;  5LP6 A;  3ZN1 A;  2OYQ A;  1QQC A;  2CGO A;  4BIZ A;  1DLB A;  4KUM A;  2Y0P A;  4DR3 B;  4R6Z A;  2EZO A;  5CBH A;  4IHJ A;  4TV8 B;  1XEQ A;  2M7W A;  5B66 Z;  3N2G B;  4KHP B;  4GZR B;  2CAZ C;  3OMI B;  5J2T B;  5JVD A;  2ZNJ A;  1XI1 A;  1U97 A;  3B77 A;  1BZK A;  3HKB A;  3IC9 A;  1K73 W;  1TGO A;  1R1B A;  4DR4 O;  4PA6 A;  1YVW A;  3P3P A;  1KEC A;  4IHJ B;  4AIL C;  1YIT V;  1JFF B;  3I5D A;  1JX9 A;  1IBM B;  5JCO C;  5JVD B;  1EZJ A;  2YS8 A;  5CN0 A;  3MHH C;  3JCZ A;  5L3B A;  5KAI Z;  1YTF D;  3ZRX A;  3ZIA G;  2VQE B;  3ASN B;  3CCS V;  2DYS C;  2ZCE A;  1OHH G;  2W0F C;  3RWR D;  2QTO A;  3K9A A;  5KA5 A;  2E74 B;  3BCC H;  5IYZ B;  5KHK A;  4B7E A;  5J9P C;  1AI6 A;  3KKY A;  3VQX A;  2AZ0 A;  2VWJ A;  1S5H C;  1OCR C;  1ZX3 A;  1BQZ A;  4FMT A;  3AG2 B;  4Z2W A;  2LGQ A;  3R66 A;  4DUY O;  4X65 O;  5KHJ A;  4DV3 B;  1O9H A;  4FM1 A;  1S3J A;  4RWU A;  2QM7 A;  2OCH A;  2PI5 A;  1MAB G;  2PUS A;  1N4C A;  4PA4 A;  1YF2 A;  5LXT B;  4F4L A;  3K5N A;  1NR7 A;  3GWK C;  1I0H A;  1RSO B;  3L73 H;  1Q90 D;  4I55 A;  4HBN A;  4LF5 O;  1LUW A;  5H6R A;  4DR1 O;  5IJ0 B;  5KX5 B;  1UJW B;  2B1I A;  4U3F H;  1R3I C;  4CC6 A;  5KAF Z;  1X59 A;  4O4L A;  4MVM A;  2X0L A;  1SQX H;  3K0D A;  3S3X A;  1M56 C;  2ZDI A;  1Q82 W;  2JJ2 G;  1YCI A;  2B5U A;  1JJ2 U;  4J10 A;  4E2L A;  1QBZ A;  4LF8 O;  1N8R W;  2PGG A;  3K5O A;  3S3W A;  4FLW A;  4LH7 A;  1L1F A;  1RP3 B;  5KA6 A;  1N33 B;  4OX9 O;  2K9P A;  2ADP A;  1NTM H;  3CSX A;  2NN4 A;  3K04 A;  2H3O A;  2DYR C;  4HNA B;  4DV7 O;  3CRA A;  3B40 A;  4FK5 C;  3SDL A;  1MMM A;  5CB4 A;  1HDJ A;  2E76 B;  1JA8 A;  5CBG A;  5LGT A;  4DV4 O;  1IZ3 A;  1GO3 F;  5EC1 C;  2GBO A;  1WNS A;  3CD6 V;  1YJN V;  1UPG A;  1U96 A;  2RN9 A;  2W6I G;  2JEU A;  1SQP H;  3JD2 A;  1IBK B;  5JJJ B;  1KUQ A;  3QTC A;  2QM8 A;  3ZRS A;  2GHY A;  1ORQ C;  1HNZ B;  1JPX A;  3F5T A;  1Y67 A;  3AG4 B;  5GTI Z;  1PNM A;  2XAQ A;  2P5O A;  4JI7 O;  2EIJ B;  1VP7 A;  3CMA V;  2HVJ C;  2IJJ A;  3D36 C;  4H37 A;  4YHH B;  4FLU A;  3UO2 A;  1XHX A;  3PN1 A;  2XHB A;  4AQY O;  2F95 B;  5GTH Z;  2XAS A;  1IXB A;  1KQS U;  1BHA A;  4DYL A;  4FVM A;  3U0Z A;  5LMU O;  3TXS A;  2N05 A;  2Z5U A;  2R9R B;  4FFK A;  1KD1 W;  3OMA B;  2O57 A;  5EZY A;  3ICX A;  4PD4 F;  3G67 A;  4DK1 A;  3ABM B;  5DN6 G;  1M4U A;  1M57 C;  2A0L A;  2R9I A;  1ENV A;  1XBL A;  1L0L H;  4YY3 B;  3B09 A;  2RCV A;  2Z3Y A;  2AHZ A;  5IDJ A;  1WJZ A;  1URF A;  3W7U A;  1KU9 A;  1XOU A;  1DGS A;  1GRJ A;  1SC5 B;  3M8A A;  2Y69 C;  4PDL A;  4D7S A;  4JV5 O;  2DN9 A;  3FKS G;  5EZY B;  1Y74 A;  2JDI G;  4X66 O;  4ZIB A;  4PA9 A;  1F7Y A;  2JIZ G;  2JS3 A;  4FJC C;  4YIP A;  1SQV H;  1NR1 A;  1THZ A;  4G27 B;  3TXQ A;  2ZKO A;  3K08 A;  3LUT B;  2AW9 A;  4PDV A;  5H2F Z;  4LF6 B;  2VWK A;  2AHY A;  4X1K A;  2CH7 A;  1US6 A;  3A0R A;  2ATK C;  3K79 A;  1AJP A;  3UO3 A;  3T1C A;  1L8D A;  4DV0 O;  4NXM O;  2E3C A;  4DV1 O;  1NS1 A;  1Y74 B;  4JPR A;  2WPD G;  2CTQ A;  2E5L B;  2OCC C;  1R6N A;  3L71 H;  4B3S B;  2GV9 A;  4ZOL A;  1M5I A;  3SJC C;  4WF9 V;  2DQ3 A;  3OEE G;  4DR5 O;  3OR7 C;  3RVZ A;  4WFA V;  5KUK A;  1WPB A;  3HR0 A;  5IYD O;  3H1H H;  4EB6 A;  2AGA A;  1KKC A;  3D8C A;  4YIO A;  1GH6 A;  1D5N A;  1IX9 A;  4H0L B;  5FLX N;  4JYC A;  5L3F A;  3SYA A;  4I9Q A;  2ITD C;  2OIG A;  1I94 B;  3LSQ A;  2A06 H;  4UV9 A;  1EN5 A;  3CRM A;  1XL4 A;  1K5S A;  3H1L H;  3WB0 A;  4JYA O;  1SZT A;  1S5J A;  1YJ9 V;  2HP8 A;  5IT9 N;  2EBO A;  1V54 B;  1K34 A;  3AK2 A;  3E8B A;  4CS4 A;  4JTC B;  2Q9L A;  1YIJ V;  3FB8 C;  3TCU A;  1YTF B;  2WLJ A;  2ZIN A;  4EB6 B;  5B1B B;  2YI9 A;  2Q7H A;  4BIU A;  2UU9 O;  3JAW A;  5H9C A;  3E8F A;  1XNQ O;  3QO8 A;  4P9P A;  2F4V B;  1FKA O;  5BZB A;  1BSM A;  3G71 V;  3QO5 A;  1Y76 B;  4QE9 A;  5FPR A;  4TT3 G;  2KSD A;  4I7Z B;  5IWA O;  4NYK A;  3H9V A;  1TUE B;  1B04 A;  3JAW B;  1XNR B;  1IBL O;  3QG5 A;  3EVK A;  5IY5 C;  3ETD A;  3DXR A;  3SJQ C;  1MZE A;  2CGN A;  3W7X A;  4GKJ B;  1B06 A;  5BMV A;  2EIK B;  1RM1 C;  2WLL B;  1FXK A;  3VQW A;  5LBQ A;  4W4K A;  4OGQ B;  5B1N A;  4GKK B;  4JI0 B;  2F43 G;  4I4T A;  4PEL A;  3K59 A;  1QR8 A;  3AG1 B;  5LHG A;  2GTS A;  2ADQ B;  2OWO A;  3CRC A;  5DED A;  1N34 B;  3DXR B;  3ZCC A;  4J7J A;  2ZD9 A;  4UCT A;  3ZRW A;  2YUA A;  3RVY A;  3DGE A;  1FJG B;  2LGW A;  5B1A B;  2LJ2 A;  4X8A A;  3E35 A;  3IJ4 A;  3KCX A;  2EJR A;  2ZE8 A;  2EIL B;  1H2L A;  2A7W A;  3BFR A;  3Q4H B;  3A2F A;  3CRQ A;  4I4T B;  3QO7 A;  4JI5 B;  4X89 A;  4O4H A;  1JVM A;  1WB8 A;  4O4J A;  5LMN B;  1J5E B;  3SPG A;  3P3N A;  3ABK C;  2DJV A;  1V55 B;  1WN7 A;  3P30 A;  1OCC B;  3WU2 Z;  3VOU A;  2EIN C;  4DV5 O;  2UXD O;  4YJ3 A;  3CCV V;  1IDS A;  3E89 A;  4RQF A;  3QNE A;  4FLZ A;  2RMK B;  4RQE A;  2OIE A;  1AR1 B;  1VQ8 V;  1YDX A;  4G2K A;  4UVA A;  4B7K A;  4DXW A;  4O4J B;  4LF9 B;  2UXB O;  4L87 A;  2R9A A;  4ZI7 A;  2Q7G A;  1I5Y A;  5LGN A;  3APO A;  1GM9 A;  1F4M A;  3ABL C;  1Z5W A;  4JI3 B;  1PL4 A;  3OTF A;  1QCE A;  4JAV A;  3MAQ A;  4J9Y B;  5L3E A;  1KMI Z;  2UXN A;  2DQ0 A;  2Y48 A;  4UVC A;  2FTK A;  4F6R A;  3HKD B;  1WA8 B;  3K57 A;  4DR6 O;  1OZ0 A;  4J9Z B;  3B8M A;  5LGU A;  1S76 D;  1ZL8 A;  2XAG A;  1T5E A;  3OGI B;  3KZI Z;  4PA7 A;  3X2Q C;  5LP6 C;  3KCY A;  5KHI A;  4K3A A;  1VQ4 V;  3OEH G;  1FYJ A;  3N2G A;  3CHX A;  4RUF A;  4X62 O;  1B6Q A;  3H1I H;  3JAT A;  1N0J A;  4LF4 O;  1VQ5 V;  1CPY A;  1XRE A;  2WLI B;  3RGB A;  3DC6 A;  4F6R B;  3ZMT A;  1OCZ B;  2H8P C;  1KBH A;  2FKX A;  4DUY B;  3CRR A;  1NH2 D;  1ZL8 B;  1Q6I A;  5EC2 C;  2YI8 A;  1CP9 A;  2JVD A;  4TQD A;  1JFF A;  4EFB A;  1M93 A;  2XAH A;  1W0J G;  1NT2 B;  1WB7 A;  1XMO O;  4ICG A;  3OMN B;  2JS5 A;  3JAT B;  3ASN C;  3LDD A;  1DF5 A;  4CS3 A;  3HKC A;  2QGN A;  1Z2G A;  2Q7E A;  4WFH A;  5L3D A;  5LYJ B;  1DK1 A;  4DW0 A;  3JD4 A;  2KG7 A;  2GUZ B;  4X64 O;  4DR1 B;  3RYF A;  3IC7 A;  5FNV A;  1SA0 B;  3G80 A;  5IYZ A;  2YEV A;  4UCU A;  2DWD C;  1LR1 A;  2P67 A;  3CCJ V;  2QWN B;  4X1Y B;  3HKC B;  1R73 A;  2EIM B;  4TSF G;  4UCO A;  2C2A A;  1KC8 W;  1BHB A;  1DTO A;  2CUG A;  2WSS G;  1AB3 A;  1XQ8 A;  2KG7 B;  4Q20 A;  1EN4 A;  1MSD A;  4JAS A;  3RYF B;  1QNM A;  2HVK C;  3APQ A;  1KYO F;  5FNV B;  3B2E E;  2PYL A;  2RNB A;  3RN4 A;  2YEV B;  5LXT A;  4U7O A;  2P4K A;  4DV7 B;  3CCR V;  2VRZ A;  1RSO A;  3UM7 A;  3THO A;  2P4V A;  3TET A;  4KL1 A;  2MK3 A;  2UUB O;  4DR2 O;  1R6K A;  1Q7Y W;  4U3J A;  4X88 A;  5JCO A;  1Y66 A;  4FIP C;  5IJ0 A;  4PV1 B;  5KX5 A;  3CS5 A;  3BAA A;  1OCO C;  4UCR A;  1I7F A;  2PY5 A;  4K0K O;  2N04 A;  5F2V O;  5KHH A;  4GT1 A;  2WA3 A;  1SQB H;  1XDC A;  3FYI B;  4CH4 A;  3CCE V;  4DR3 O;  1JR9 A;  3ML0 A;  2EX3 A;  2LO1 A;  4K35 A;  3CPW U;  2HHH O;  2B1G A;  3TK1 A;  4JI8 B;  4ZBM A;  4U3J B;  3ASO C;  5HFM A;  1YSC A;  3H01 A;  4LFA B;  1N36 B;  1ZUQ A;  3LSU A;  2LFR A;  4HNA A;  3T4D A;  2YDE A;  1ZWI C;  5CBF A;  4AQY B;  3FFQ A;  2LQT A;  5LMU B;  4TQF A;  2QR4 A;  3N2K B;  4DO2 A;  4DUZ B;  3OUF A;  3AG3 C;  2QKA A;  1G8M A;  1M1K W;  4DV2 O;  2FYU H;  1YEW A;  3M99 B;  2EZP A;  1OCR B;  2HR3 A;  1UFI A;  3AG4 C;  2ZM6 B;  1IBM O;  2GDS A;  4OPA A;  1PL0 A;  2EIJ C;  4ABM A;  5DEC A;  2RDC A;  3OUS A;  1ZSP A;  3M7M X;  2AZ2 A;  1AVM A;  2YIB D;  2Q67 A;  4QJF B;  1K5Q A;  3T1H O;  3K06 A;  4UB8 Z;  3VBB A;  3JYC A;  2XOK G;  2XUM A;  4B08 A;  4JAA A;  3CCU V;  4DR7 O;  1P7G A;  2A3Q A;  1WP8 A;  2YIA A;  1MSW D;  4CC5 A;  1S72 V;  1FXV A;  2Q5Z A;  2PTM A;  2QWP B;  2LFS A;  3ABU A;  1EM1 A;  4DV3 O;  1K33 A;  3RBZ A;  1VAR A;  1XMQ B;  2BSK A;  1MA1 A;  2QM4 A;  4FLV A;  1M56 B;  3DSQ A;  3CXH F;  1XUQ A;  2ZXW C;  1WLE A;  2W0X A;  1FPO A;  3A0H Z;  1J95 A;  1MZF A;  4XDJ A;  2CTW A;  1K3E A;  3JAR A;  4DV1 B;  3ZED A;  2UUA B;  3T1Y B;  4JI1 B;  4B3M B;  4Z1V A;  1K4C C;  4JI6 B;  4YJ2 A;  3UQ8 A;  4DR5 B;  5KHG A;  4J41 A;  2DYR B;  2BSK B;  5EBM C;  1VQL V;  3FX7 A;  4IIJ B;  1BQ0 A;  4D6T H;  5E1A C;  3FB7 C;  4I50 B;  5JWP A;  3K58 A;  1GN6 A;  3JCU Z;  4LFC B;  3JAR B;  1GK9 A;  4H13 B;  4W4L A;  1H8E G;  4WCE V;  3L74 H;  1PNK A;  3FB5 C;  4EKW A;  1N33 O;  1M9N A;  4YJ2 B;  5C93 A;  1H2K A;  5A2Q N;  4LWS B;  3J80 N;  1HNW O;  4J7K A;  3C90 A;  3K5L A;  4HAM A;  2VQF B;  4LF7 O;  1PD3 A;  3FB6 C;  4J11 A;  4NB5 A;  4DV6 B;  3WB1 A;  2JGD B;  1XNQ B;  2QWO B;  1HNX O;  2Q4P A;  1QLN A;  3FYE B;  4UXN A;  5EYP A;  2YC0 A;  3L75 H;  1HWY A;  5JJE B;  3J7A U;  4JI4 B;  4IYI A;  1NH2 B;  2IM9 A;  1VIB A;  1BGY H;  1NBM G;  1HNZ O;  1O9G A;  1SES A;  2UUC B;  3E86 A;  5EK0 A;  4NTX A;  5K1P A;  1TA8 A;  4FZ1 A;  4RAI A;  2ETN A;  3E83 A;  1SQF A;  2CDY A;  4ZHQ A;  3F5W C;  5EYP B;  4YHH O;  2L35 A;  3QVN A;  1P4R A;  3J81 N;  2BE3 A;  3ZX6 A;  1VF5 B;  4DRX A;  2IJK A;  1JQ0 A;  1VQK V;  2Y69 B;  3OTO B;  4NVP A;  4DW1 A;  1NTZ H;  1FFT B;  4UCS A;  3CCQ V;  1VF6 A;  3ZHR A;  4KXR A;  1NVP D;  4ZHQ B;  4FFB A;  1AR5 A;  1NU1 H;  1Y76 A;  2XND G;  4KP4 A;  1R3K C;  1D5A A;  4IGG A;  2NR5 A;  4JI2 B;  1E79 G;  1Y4M A;  4DRX B;  2F1M A;  2EIK C;  1SET A;  5B3S C;  3CYO A;  4Q6G A;  5BXZ A;  1VQ9 V;  4JAU A;  2RJZ A;  5LOV B;  2DMX A;  1SQG A;  2UXC B;  2OCC B;  2WLL A;  4ZKI A;  4FFB B;  3H1J H;  2FB5 A;  1I5X A;  1ZTE A;  3JAM N;  2ZT9 B;  4TV9 B;  2Q69 A;  4FLT A;  2PI4 A;  3IAY A;  3N27 A;  4DV5 B;  1FXK C;  4IL6 Z;  3UT5 B;  3ZBH A;  4UVB A;  3AK3 A;  4RUE A;  4NXN O;  2EIL C;  1COW G;  5EIB C;  4B3R B;  4R50 A;  5CA3 A;  5BR8 O;  3MHS C;  1HR0 B;  3E8G A;  1K97 A;  2DOS A;  4B3S O;  3FAV B;  3AG7 A;  4LFB O;  1VEW A;  3Q4H A;  3WG7 B;  1XHZ A;  5KLV H;  1OCC C;  3ZMV A;  3RYH A;  2ITC C;  1N32 O;  3T2M A;  1H8H G;  3JAS A;  3BHP A;  1BMF G;  4YXW G;  5CA0 A;  1IVS A;  4JTA B;  4J7Z A;  3RT3 C;  1XIL A;  4O4I A;  4FM2 A;  2RQ6 A;  2A79 B;  4F6E A;  1NI8 A;  4MS2 A;  4CH5 A;  1XL6 A;  3ZN0 A;  5LL6 Y;  1JOY A;  3CC7 V;  1TVK A;  4QE7 A;  4X62 B;  4JZG A;  4LF4 B;  1YZB A;  1YXB A;  3RYH B;  1AIL A;  1Q5O A;  1RPR A;  1QHT A;  4MT8 A;  3JAS B;  4IYH A;  3STL C;  5CA0 B;  1KP3 A;  4CZZ A;  3ZMU A;  2F4V O;  3K0G A;  2E75 B;  2PYJ A;  4MTF A;  1RM1 B;  4O4I B;  2Y4T A;  2K1E A;  1X4T A;  3JD0 A;  3ZHQ A;  4B3T O;  3I56 V;  2WLH A;  3SYC A;  4WFB V;  4I0X A;  4GLX A;  5CMU A;  1VQP V;  3OAA G;  4TOI A;  1HP8 A;  1TVK B;  3HKD A;  3SPC A;  1WA8 A;  1EBO A;  5B1O A;  3E8H A;  2Q8V A;  1LUV A;  5D5P A;  1H2N A;  1XNR O;  3HKE A;  1BCC H;  5JJN B;  3WB2 A;  1QU7 A;  4DR4 B;  2HLD G;  2XTA A;  4WFF A;  1OCZ C;  2EUL A;  4GKJ O;  5ITZ A;  5HFL A;  4P9O A;  5CA1 A;  5L3G A;  3R65 A;  4TWK A;  3SPJ A;  3JD1 A;  4I0X B;  4GX5 A;  2WLI A;  4J42 A;  4GKK O;  1GN2 A;  2HJD A;  5BY1 A;  4QNH B;  1R3L C;  4JI0 O;  2IH3 C;  3U11 A;  1FFX B;  2QSA A;  1R3J C;  4GCZ A;  3K3W A;  3OM3 B;  4UFZ A;  1IXM A;  3EXA A;  4NTW A;  2HG5 C;  3HKE B;  2W6J G;  2AXT Z;  2Y4U A;  4HYO A;  5KUM A;  3LDE A;  2OTL V;  1WP7 A;  4MSW C;  1QVG U;  5ITZ B;  1SQQ H;  5CA1 B;  2EIN B;  1QLE B;  3U10 A;  4X1I B;  2D2C B;  1PP9 H;  4MVO A;  1LNQ A;  5LYJ A;  2DWE C;  4DR2 B;  2GUZ A;  2F23 A;  2BTQ A;  2P06 A;  2QA4 V;  5LHH A;  1SA0 A;  2V4D A;  2QWR B;  4U7N A;  4X65 B;  2YXH A;  3NR7 A;  2KKW A;  4K0K B;  1J5E O;  3ETE A;  3UKM A;  1ROP A;  5JQG B;  4X1Y A;  3ABL B;  1FS0 G;  1SZX A;  2HHH B;  2IBZ H;  4NR1 A;  1NQT A;  4AI8 A;  2BTQ B;  4LF5 B;  2CTP A;  2WAM A;  4C7U A;  3BA8 A;  3K9S A;  3CXC U;  2CTR A;  3AG2 C;  5GON A;  2ODM A;  2DE0 X;  4IT5 A;  4I9W A;  4JF3 A;  4WFE A;  3SYO A;  1A32 A;  4WBN B;  4FZ0 A;  4A5U B;  4LF9 O;  3X2Q B;  5LP6 B;  3A8T A;  5EBL C;  1N0N A;  1AI4 A;  4GUN A;  4LF8 B;  1AI5 A;  2VS0 A;  1KP2 A;  4MW8 A;  3ZHS A;  4DV2 B;  3CB2 A;  1P84 F;  4JI3 O;  5TIS Z;  4UB6 Z;  4OX9 B;  3SPH A;  1I08 A;  5LA6 A;  1W0K G;  5GON B;  4O2A A;  2X6A A;  2QTS A;  3MDS A;  4LNU A;  4LH6 A;  1NVP B;  3CC4 V;  3JAK A;  4FPP A;  4XDL A;  2LW1 A;  3BPZ A;  4P2Z A;  3HKB B;  3T1H B;  2X7R B;  4D7T A;  3KG2 A;  4DV4 B;  4FLY A;  3BVO A;  4QPK A;  4H33 A;  3OD4 A;  5J2U A;  4Z1M G;  4DR7 B;  4JYY A;  2XT9 A;  3BEH A;  1H38 A;  3W7W A;  2F93 B;  3OR6 C;  3SJB C;  5LA6 B;  3GVM A;  4MVZ A;  1BS3 A;  4O2A B;  3CEI A;  1MNG A;  4LNU B;  4N23 A;  2KQX A;  3AK1 A;  3O65 A;  3SJA C;  2H94 A;  3JAK B;  3N2K A;  4MVQ A;  1IUR A;  1FXH A;  1EFR G;  1K8A W;  1SF9 A;  1YJW V;  3W7S A;  4JI7 B;  2ZDI C;  4GX1 A;  4OPH A;  2GTA A;  5J2U B;  2IJI A;  4MTO A;  1H2M A;  3H1K H;  4KHP O;  3JAL A;  4LCU C;  2IU3 A;  3ABT A;  1SS3 A;  2DYS B;  1GM8 A;  2PF4 E;  1GKF A;  4PDR A;  2NLJ C;  1WAZ A;  3ZHT A;  1JMK C;  3D3I A;  1ZAU A;  2YIC A;  2WLK A;  5EBW C;  4UV8 A;  3K03 A;  1G4Y B;  5IYB O;  2XAJ A;  5LHI A;  3E2E A;  1OJH A;  2QEX V;  4XDK A;  3JAL B;  1QVF U;  3VQV A;  3F7Y C;  4N21 A;  4GX0 A;  1OCO B;  2FML A;  1D2D A;  2YXL A;  2HFE C;  4I55 B;  2VQE O;  2ZE7 A;  3BRC A;  4NTY A;  4RO2 A;  2OTJ V;  3C3S A;  3ZS8 C;  1HNW B;  3CWB H;  3TJT A;  2BCC H;  3ZMZ A;  2P7T C;  2R70 A;  1AP5 A;  4MVR A;  3G6E V;  4JV5 B;  2ILM A;  4O4L B;  2BOC C;  4LF7 B;  4DK0 A;  5EIB D;  2L6L A;  3JD3 A;  3ASO B;  2UXX A;  4X66 B;  3OFN G;  2IW5 A;  1VQM V;  3ABM C;  4LP8 A;  1HNX B;  1CEZ A;  1VMG A;  1P49 A;  2V7Q G;  1GN4 A;  1K92 A;  4IIJ A;  3RYI A;  3CME V;  4I50 A;  3B4S A;  3AG3 B;  3LNN A;  4UUJ C;  5E79 Z;  3RYC A;  4DV0 B;  5AG2 A;  4KFM A;  5C8Y A;  4NXM B;  5CB4 B;  1CXZ B;  4CS2 A;  4LR3 A;  4JI8 O;  1P7B A;  3FD9 A;  1JCH A;  3T4Z A;  3SR2 C;  2IH1 C;  4LWS A;  2HEP A;  1S77 D;  4LFA O;  4BWA A;  1N36 O;  4GX2 A;  1Z5V A;  2IJH A;  1B3Q A;  3RYI B;  1AI7 A;  1GTO A;  4NKG B;  4R7C A;  4MTX A;  1H2S B;  1NKD A;  2JGD A;  3D36 A;  4CH3 A;  2A9H A;  4BR6 A;  3RYC B;  1H2G A;  4JZ2 A;  5C8Y B;  4DUZ O;  2ZQM A;  2B9Z A;  2Z0A A;  3I55 V;  3OT7 A;  4JYA B;  3W7T A;  3OW2 U;  1GMG A;  2M6Y A;  4FLX A;  1TAE A;  2ZM6 O;  5H6Q A;  1FAF A;  1VQO V;  1KKD A;  1L0N H;  4BAY A;  3DC5 A;  2HJF C;  3QF7 A;  1BL8 A;  5H5N A;  3UCS C;  4BW5 A;  1MOF A;  1VQ6 V;  4R8C A;  4PHZ A;  2WA4 A;  2UU9 B;  4MVS A;  2ZXW B;  4AHC A;  2JRI A;  3DTU B;  3STZ C;  2JJ1 G;  5IJ9 A;  1VQN V;  1W59 A;  3CP1 A;  1BE3 H;  1IBK O;  4G28 B;  4QGP A;  1PNL A;  1Q43 A;  1G6U A;  2Q68 A;  3LSS A;  3WFV A;  1V54 C;  2CE4 A;  3ZHV A;  4BIO A;  5JH7 A;  5IWA B;  4PDM A;  3OE7 G;  1XMQ O;  5B1B C;  3IGA C;  1M57 B;  1IBL B;  3ETQ A;  5IJ9 B;  2QWQ B;  3L9D A;  1S0V A;  3K5M A;  2GSM B;  3SPI A;  5DM6 V;  4NXN B;  4MTG A;  3PJS K;  5BR8 B;  1K7D A;  1GN3 A;  2JGU A;  2UUA O;  1VF6 C;  2F66 C;  3T1Y O;  4JI1 O;  3O9O A;  3TGU H;  3HPL C;  4B3M O;  4PA3 A;  4JI6 O;  2JK5 C;  4LFB B;  5JH7 B;  3A0B Z;  3L72 H;  1VQ7 V;  1GAX A;  4TUY A;  1PKX A;  5LOV A;  2YXY A;  2Q73 A;  5A9G A;  2KB1 A;  3LNM B;  2QE7 G;  4X1K B;  3SYQ A;  2CH7 B;  1N32 B;  4O2B A;  4YY3 O;  4CH6 A;  5B5E Z;  4TV9 A;  4LFC O;  2V1D A;  1V9P A;  2PZS A;  1Q8I A;  1E1Q G;  1TUB A;  1AJN A;  1W2B U;  1SER A;  3UT5 A;  4QPJ A;  4XBF A;  2WLM A;  4ZOL B;  1NTK H;  2ZIO A;  4MVU A;  2QDO A;  4JTD B;  3ZHU A;  4TUY B;  2CK3 G;  2VQF O;  2D3O W;  3WG7 C;  3AG1 C;  4JYB A;  2BTO A;  3F7V C;  4JGS A;  1K4D C;  4DV6 O;  1NJI W;  5D5Q A;  4O2B B;  5GW7 A;  3CC2 V;  3FAV A;  2X6B A;  2P22 C;  3CE2 A;  3JSL A;  5KMG A;  1OV9 A;  2MW2 B;  1TUB B;  2ZIM A;  4LF6 O;  2UXD B;  2FL4 A;  3G6B A;  4JI4 O;  4B3T B;  5B1A C;  3EHB B;  2BOB C;  1MG1 A;  2QJ1 A;  3MD0 A;  4HZ3 A;  3G4S V;  4UCV A;  2XAF A;  4LBE C;  4EEQ A;  2LP7 A;  2NNU A;  3B8N A;  1NZ6 A;  2N74 A;  2IU0 A;  4GYC B;  2UUC O;  1F23 A;  2E5L O;  4X9Q A;  3ZJZ A;  1M90 W;  1BT8 A;  2UXB B;  1AJQ A;  2R72 A;  4EFE A;  2YIB A;  1G1X B;  4BW9 A;  5KMG B;  1F51 A;  1KB9 F;  3AEI A;  3GB7 C;  3L70 H;  4LC1 A;  3C3T A;  1V55 C;  1GM7 A;  1E1R G;  1HW7 A;  2QKS A;  4ASU G;  5B3S B;  3ZRV A;  1WPX A;  4WFG A;  3OTO O;  3P32 A;  1I94 O;  2JEX A;  2P6J A;  4DR6 B;  4X20 A;  1RPO A;  1QR9 A;  4I5S A;  1FD9 A;  1AP6 A;  3LDC A;  3D3Q A;  1F4N A;  3SGI A;  2G38 A;  1YI2 V;  3ETG A;  5FPO A;  4L8J A;  2ZE6 A;  2DW4 A;  3GWO A;  5BMV B;  4JI2 O;  1FXK B;  5IY5 B;  3JSN A;  1K9M W;  1Q86 W;  1ARO P;  3BAB A;  1Q6H A;  4X20 B;  2Q6A A;  3BY6 A;  2QKC A;  4J80 A;  2UXC O;  1RFY A;  2Q0O C;  2ZNI A;  4PJ0 Z;  1XMO B;  1DF4 A;  4MW3 A;  4CBC A;  1FFX A;  3ZRW B;  3VQY A;  1S5L Z;  2ZR3 A;  3E22 A;  4H44 B;  3SYP A;  3CJH A;  3CCL V;  1PM9 A;  1JJO A;  2WWW A;  1PPJ H;  1QLE C;  1Q81 W;  2ZR2 A;  3OGC C;  4E4E A;  4X64 B;  3ZMS A;  4FM0 A;  5L3C A;  1AR4 A;  3CCM V;  3NXS A;  4B3R O;  2LW7 A;  4O4H B;  4X1I A;  1HR0 O;  1SRY A;  1PV0 A;  2P90 A;  3RW0 A;  3E22 B;  3CX5 F; 
#chains in the Genus database with same CATH homology
 4DV5 O;  2UXD O;  4DV7 O;  1DK1 A;  3SDL A;  3O65 A;  4X64 O;  5LL6 Y;  4X66 O;  1F7Y A;  4DV4 O;  1N34 O;  2UUA O;  3T1Y O;  4JI1 O;  4JI8 O;  1YZB A;  4DV2 O;  4B3M O;  1AIL A;  5IWA O;  4JI6 O;  3OTO O;  2ZKO A;  4OPH A;  1I94 O;  1N33 O;  1J5E O;  4KHP O;  4LFA O;  1FJG O;  2UXB O;  1N36 O;  5A2Q N;  1IBM O;  3J80 N;  4OPA A;  1HNW O;  1IBL O;  2F4V O;  5BXZ A;  1KUQ A;  4LF7 O;  1R6T A;  4B3T O;  3R66 A;  4YY3 O;  4DUY O;  4DV0 O;  4X65 O;  3T1H O;  4NXM O;  4DV1 O;  4JI5 O;  1AB3 A;  1NS1 A;  3JAM N;  3F5T A;  4DUZ O;  4LFC O;  4JI2 O;  4JI7 O;  1HNX O;  2Z0A A;  5LMN O;  4DR7 O;  1A32 A;  4DR5 O;  4A5U B;  4DR6 O;  4LF9 O;  2ZM6 O;  3J7A U;  1XNR O;  2AGA A;  2UUB O;  4DR2 O;  2VQF O;  5H5N A;  4AQY O;  2UXC O;  4GKJ O;  4NXN O;  1D2D A;  5FLX N;  4LF5 O;  1FYJ A;  5BR8 O;  4DV6 O;  1HNZ O;  4DR1 O;  4DV3 O;  1XEQ A;  4JI3 O;  4X62 O;  5LMU O;  4LF4 O;  2VQE O;  2JRI A;  2DOS A;  4GKK O;  4B3S O;  5BY1 A;  1X59 A;  4JI0 O;  4LFB O;  4K0K O;  4JYA O;  5IT9 N;  4LF6 O;  4YHH O;  4JI4 O;  1R1B A;  1IBK O;  3J81 N;  2FKX A;  4DR3 O;  2HHH O;  4DR4 O;  4LF8 O;  4B3R O;  1N32 O;  2N74 A;  2LW7 A;  2UU9 O;  2UUC O;  1XMQ O;  4OX9 O;  1XMO O;  2E5L O;  1HR0 O;  1XNQ O;  2DJV A;  3RT3 C;  3M8A A;  1FKA O;  1G1X B;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...