2UU9O

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uu9O00
4X64O 4LF8O 1FJGO 4JI3O 4LF9O 2UUAO 1FKAO 4LFBO 4DV5O 3O65A 5IWAO 1YZBA 1XMOO 4AQYO 4LF6O 4GKJO 2F4VO 1FYJA 2UUBO 2UXBO 2E5LO 4DV4O 4NXMO 4OPAA 4JI4O 4JI8O 4DV1O 4OX9O 2ZKOA 4X65O 1R6TA 1G1XB 5LL6Y 1HNWO 5BY1A 5IT9N 5FLXN 2DJVA 1I94O 3T1HO 4JI5O 1N36O 1N34O 2UUCO 5LMUO 2JRIA 4JYAO 2UU9O 1N32O 2ZM6O 1XNRO 4LFAO 2UXCO 4B3MO 4DR4O 4DR1O 5H5NA 4YY3O 3T1YO 4X62O 1AB3A 4DV3O 4JV5O 4DR2O 4K0KO 4DV6O 1AILA 3F5TA 1A32A 4A5UB 4DR3O 1HNZO 3OTOO 3J7AU 1R1BA 4JI0O 2HHHO 2N74A 4YHHO 1XMQO 4LFCO 4NXNO 3SDLA 1DK1A 1IBLO 2LW7A 2VQEO 3M8AA 4DR7O 3R66A 4DV7O 1N33O 2Z0AA 4OPHA 1IBKO 4B3TO 5BR8O 4JI7O 5LMNO 2AGAA 4DR5O 4LF7O 4LF4O 4DUZO 4JI2O 4B3SO 1XNQO 2UXDO 3JAMN 4DV2O 1D2DA 1KUQA 4DV0O 4JI6O 4B3RO 5BXZA 5A2QN 4KHPO 4DUYO 2VQFO 3J80N 4GKKO 4X66O 1HNXO 4DR6O 2DOSA 1X59A 3RT3C 4LF5O 1F7YA 2FKXA 1HR0O 3J81N 1XEQA 1IBMO 4JI1O 1NS1A 1J5EO
chains in the Genus database with same CATH superfamily
2YUAA 5J9PC 1YSCA 3CP1A 2YC0A 1FFTB 3SYOA 5IWAB 3JSNA 4FM0A 2EX3A 1M4UA 1E1QG 1V54C 4GT1A 1J5EB 3K04A 3CRRA 2CE4A 2DQ3A 3L74H 4L87A 4WFGA 5J2UB 5ITZA 1AP6A 2QWQB 1VQ4V 5LXTA 1M9NA 4O2BA 4O4LB 2RDCA 3BHPA 1BS3A 1U97A 5HFMA 4FLYA 4B3MO 3ZHVA 4GYCB 2QEXV 4LF9B 1AB3A 4ZHQA 3JD0A 2HVJC 3OUFA 4C7UA 4B3RB 5KA6A 3K5LA 4TWKA 4LWSB 5CB4B 1K7DA 2PF4E 3RYFB 4R7CA 4UB6Z 2ZE8A 1NTMH 2P4KA 4D7TA 3FYEB 2HJFC 2OTLV 3MDSA 4PI0A 2AGAA 3CX5F 1EBOA 4ZOLB 3UT5B 2RMKB 4PDMA 1Y66A 5EC1C 1N4CA 3P3NA 1DGSA 2IJHA 4NKGB 2ZXWB 1SF9A 4JYBA 1P7BA 4CS2A 3K0GA 3G6BA 2DQ0A 1K5QA 4WFAV 4JZ2A 4OGQB 1VQKV 1K97A 1SKVA 3Q4HA 4MTOA 3MD0A 3W7TA 2V7QG 4P30A 3CHXA 3X2QB 2H3OA 2NLJC 3SPJA 4TV9A 3LSQA 3E22A 4X1KB 2HHHB 3ZEDA 1Y74B 1D5AA 5EYPB 5CA1B 3JCUZ 1AI6A 2UXBO 1KP2A 4NXMO 4O4HB 5JQGB 1XNQB 4PA7A 1H2SB 3ZX6A 2IH1C 2JS3A 3P3PA 1YCIA 1N36O 1W0KG 1N32B 1IXMA 1FFXA 2YXLA 5KHGA 2QTSA 2UU9O 1VMGA 4FLUA 3T1YO 2NNUA 2PY5A 1NZ6A 5GW7A 3EXAA 1RFYA 2KG7A 4DV6B 3OEEG 2PI4A 5KA5A 1BHBA 1VF6C 2WLHA 2P5OA 3JATA 4J7ZA 2VQEB 3ZHSA 5LYJA 4FLVA 4OX9B 5LA6B 1VF6A 2YXHA 3K03A 3RN4A 3D36A 3HKEA 2RCVA 1VIBA 1YF2A 1AR4A 4TQDA 3CEIA 3K08A 4B3TO 1EFRG 1GN6A 2E76B 1M5IA 3ETGA 4YJ2B 5KX5B 5KAFZ 3SJQC 3OE7G 2Q9LA 4TUYA 4IIJA 3H1KH 1ZTEA 4K3AA 2ZE5A 1IBMB 3JAKA 1SETA 1Q6IA 4LC1A 5A2QN 2RQ6A 2V4DA 3QO7A 3N2KA 3A2FA 1RSOA 2UUCB 5KUKA 3JD3A 2CH7B 4B7KA 2AHYA 2IBZH 1AR5A 1PD3A 4BWAA 3VQVA 3K57A 1VQOV 3CMAV 3BY6A 4LF6B 2M6YA 3HR0A 3ZRVA 4DW0A 1SESA 2IU0A 3E86A 3S3XA 3RYIA 4DV2B 5B3SC 1GMGA 3JAKB 2VQFB 4MVMA 2ZNIA 1FS0G 4J10A 3ABLC 3SYPA 1M56B 4CS3A 1XHZA 4H44B 3RYFA 2BOCC 1AJQA 1OCZB 4LF5B 3ABUA 4QE7A 5H6QA 5FNVA 2D2CB 5B1BC 1AROP 4DV3O 3D3IA 4DR2O 3ZN0A 4K35A 5H9CA 2EJ7A 2LFSA 1A32A 1ZL8B 1HNZO 1NR1A 4QGPA 3G4SV 5EBLC 1W2BU 3OTOB 2DYRB 1VF5B 4JI1B 3SDLA 1OCRB 3RW0A 3T1HB 2AZ2A 2H8PC 1P7GA 2VWKA 1O9HA 2KB1A 2JJ1G 4UVCA 3JAMN 1JVMA 2P22C 1JFFA 4YY3B 4B3RO 1S5JA 4UCRA 3UKMA 4F6EA 2LQTA 3E22B 5B1AC 2R9RB 3LNMB 2FKXA 5L3CA 1ZWIC 5JCOC 3ETDA 3JASA 2YDEA 1K92A 1OCOB 4X64B 2CTPA 1JJOA 2LO1A 3RYCB 3WG7B 2CH7A 2DWEC 1R3KC 3RBZA 5FNVB 2ZD9A 4G27B 1FYJA 4B3SB 5LP6A 4F4LA 3MHHC 3E8GA 4DR4B 3B4SA 4IIJB 1HNXB 1TVKB 4LCUC 2R72A 3DGEA 2XAJA 5B1OA 1B6QA 1TA8A 1VP7A 4LFCB 1MZFA 4BIZA 4FJCC 1VEWA 1WPXA 3RYCA 5DM6V 2ZQMA 1IVSA 1YITV 2BE3A 3RFRA 5KHHA 1F51A 3ASOC 1ZLZA 4UXNA 3HB3B 1AP5A 3UO3A 3PJSK 5JWPA 1VQ8V 1DK1A 3CCQV 3OR6C 4DR7O 1QNMA 2GUZA 3OMNB 1KP3A 1JJ2U 4UVAA 5BR8O 1N34B 1M93A 1SQVH 4TUYB 1ENVA 4PA6A 1FD9A 1Y6XA 4JI2O 4IL6Z 4GKJB 1OCCB 1K33A 3ZIAG 3AG2C 5EBWC 3OT7A 1FXVA 2Y69C 5FL7G 3APQA 4DV0O 4K0KB 5EZYB 4DR6B 4GKKO 1KD1W 3ASNB 3L73H 4DK0A 1X59A 2D3OW 5CN0A 5EC2C 2JGDA 2UXDB 1V9PA 2DYSB 1S5HC 4TSFG 1K73W 3CJHB 3U0ZA 3FAVB 4CBCA 1EZJA 1BT8A 3L70H 1G8MA 5D5PA 2PI5A 2ZE6A 3C90A 3ZHUA 3AK1A 1RP3B 4WCEV 4KFMA 3O65A 3K5NA 1CP9A 1AVMA 3OD4A 3SPHA 1KBHA 2HEPA 2X7RB 5LHHA 3U10A 3B8NA 1HP8A 2PZSA 4J11A 1VQNV 3B77A 3STLC 1QQCA 1I94O 1H2LA 2P7TC 3T4DA 4H0LB 3VQXA 1R6KA 3K5MA 2JJ2G 2UU9B 5F2VO 4TOIA 4W4KA 1MA1A 3CXCU 1GTOA 5KX5A 1U96A 5IDJA 2MK3A 3CPWU 2EBOA 2CTRA 4U3JB 5H2FZ 1R3LC 4DUYB 4PHZA 3TJTA 5CBHA 3ZRSA 4X66B 3RWRD 2EULA 5KMGA 4H13B 1UPGA 3FFQA 1Q86W 2EIMB 3ZJZA 1WNSA 2Z0AA 2ZCEA 2UXXA 2QJ1A 3ZHTA 4CS4A 4LH6A 1NH2D 1AJNA 2E74B 2DYSC 4RWUA 2XUMA 5JJEB 4LF4O 4TV8B 3WFVA 2ATKC 5L3BA 3FKSG 2ZM6B 4UB8Z 3AK2A 3P30A 3MHSC 4MVZA 1Z5VA 4N23A 2ZR2A 4MW3A 2F23A 3FB8C 1P49A 3CMEV 5KLVH 2GDSA 3CCRV 5LMUB 3LUTB 1K5SA 5LA6A 5LGTA 1Q7YW 1YTFB 2YI9A 4DK1A 1JQ0A 2WLKA 3A0RA 4WFHA 3JALA 4Q6GA 1FXKA 2QWNB 2A7WA 5JJJB 4B3TB 1FXKC 3IAYA 4GUNA 5LP6B 3CXHF 4LF6O 2QKCA 1O9GA 1FXHA 1GM7A 1YEWA 3JARB 1V54B 3W7WA 3X2QC 4B08A 5K1PA 4J42A 4Z1VA 2QM4A 2RNBA 5BY1A 1NT2B 3UCSC 4EKWA 2DJVA 4DYLA 2BTQB 1WB7A 1XL6A 5LOVA 3ZRWA 4I4TA 2UUCO 4X20A 1NU1H 3QVNA 3WB2A 4WFEA 1XBLA 4ZKIA 2Q7GA 4YY3O 2Q4PA 3CE2A 1NI8A 4GX1A 4K0KO 4Z2WA 2ADPA 1ZUQA 2JGUA 4A5UB 4DR3O 1ZL8A 4IT5A 1OHHG 4JI4B 4JI2B 1HNWB 5IY5C 2OYQA 1ZSPA 2VQEO 1NR7A 1MZEA 4FLXA 4J41A 1BMFG 4YJ3A 2QTOA 4DV7O 4I50A 2PGGA 3C3SA 3OW2U 4ZHQB 1Z2GA 3LSSA 1M1KW 1AI7A 1Q43A 2CDYA 5DN6G 4CC5A 4KL1A 1XNQO 3OTFA 1RM1B 4BR6A 2OTJV 1GAXA 1CXZB 1XDCA 4JI6B 1D2DA 4RQFA 2CGNA 4JYCA 2GUZB 1NTZH 4MS2A 2NN4A 1H8HG 4LF7B 3B09A 1XILA 3ZRWB 2A79B 3UQ8A 1QU7A 1F23A 4PA3A 2LP7A 3HKEB 2Q5ZA 4DR2B 4K8ZA 1SQQH 4DV5B 2QWPB 1Q6HA 3JCZA 1W59A 3PN1A 1BL8A 3RGBA 1UJWB 4XDKA 2BSKA 2KG7B 2E5LO 1R3JC 2ZKOA 4IYHA 4PDVA 1Q5OA 3GWOA 4DV1O 2CGOA 3A8TA 2XTAA 3QG5A 4I50B 5EK0A 1SS3A 5KAIZ 4F6RA 1QR9A 1QBZA 3OUSA 5K1XA 3DC5A 3ABMB 2XAGA 2XAHA 4LFAO 4JI8B 3G80A 2UXCO 5IYCO 3ABMC 2KKWA 3K3WA 3T1CA 1I5YA 4XDLA 3SYAA 3HKDA 1MABG 2L35A 3D3QA 5IJ9B 1GH6A 1BGYH 4HYOA 4ZIBA 2B1IA 3CCSV 2EILB 1H8EG 1SRYA 4QIWF 4LFAB 2FB5A 3TGUH 2IU3A 3JD4A 1Z5WA 5B1NA 4DR1B 2A9HA 3T1YB 2B1GA 1VQ9V 4FVMA 2EIMC 3ASOB 3HKBB 3DSQA 1BSMA 1WLEA 4JI7O 1WAZA 2HP8A 4P2ZA 5GONB 2F95B 2F93B 2LGWA 3AG3B 3L71H 3KG2A 1IX9A 4J9YB 2FYUH 3LDDA 3FB6C 4B3MB 1PNMA 2OCCC 2YSUB 2QSAA 1N33B 5H6RA 2Q73A 3OMAB 5BR8B 3O9OA 2DOSA 4NXNB 1F7YA 3HKDB 5LGNA 3J81N 1IBLB 1NKDA 2Y69B 3SPCA 2WLIA 2ZINA 3FYIB 1KYOF 3DXRB 3HKCA 4JZGA 1FJGO 2UXNA 3EFFK 3STZC 5KMGB 2A06H 4DV5O 2ITDC 3W7UA 5IWAO 3W7XA 2EINC 1BHAA 4U3FH 1R6NA 1NJIW 1HDJA 2E5LB 4LNUA 5IT9N 4NB5A 4LR3A 2IJKA 1YTFD 1H2NA 4RO2A 2QM8A 4FM1A 3CCJV 1VQPV 4KP4A 4MVQA 3RYIB 1GN3A 3ZRXA 5L3DA 2W6JG 4DR4O 2Q6AA 2X6AA 4WFFA 2AHZA 4JV5O 3N2GA 3QO8A 2YICA 1YVWA 3F5TA 4QJFB 3E8BA 3J7AU 3GVMA 3IC7A 4EEQA 3THOA 1ORQC 1T5EA 4L8JA 2LJ2A 1GO3F 2LW7A 1FJGB 3TK1A 1Q6UA 1EM1A 2C2AA 2KSDA 2P06A 3BA9A 1HW7A 4PA9A 3OGIB 3BPZA 3CCVV 2PTMA 2XASA 3A0BZ 3D8CA 4JI7B 1M90W 1WJZA 1K9MW 4U3JA 1WA8A 2CTQA 2YIBD 3FX7A 4DV4B 1PNLA 3SR2C 4I4TB 1I94B 1S72V 5BXZA 3SPIA 2ADQB 3J80N 5B1AB 1F4NA 4YIPA 4HAMA 1IZ3A 2AZ0A 3ABLB 3W7SA 3VBBA 2VRZA 3ZS8C 2P4VA 2Y0PA 2AXTZ 3E8HA 4JI1O 4FFBB 4JAAA 2G38A 3CC7V 5KHIA 4P9OA 3BA8A 1MMMA 1S5LZ 4PD4F 1FKAO 1COWG 2BTQA 4GKJO 3G67A 2WLJA 1XOUA 4XBFA 1IURA 4PDLA 1M57C 3CB2A 2Q67A 3HKBA 5FLXN 2LGQA 4FZ0A 3JAWB 4DR7B 3N2KB 2ILMA 5FPRA 1TUEB 4X88A 2F66C 1H38A 4DUZB 4JYAO 2EILC 4O4HA 2UXBB 5LBQA 4N21A 4PJ0Z 4FFBA 4X1KA 1B04A 4IHJA 5IJ9A 2QA4V 2O57A 1OCZC 3N2GB 1BQZA 4J80A 1H2MA 5CA3A 3JD2A 2R9AA 2EIKC 4J7KA 3MAQA 1XI1A 2B9ZA 2QWOB 3F7YC 4AHCA 5CA0A 4GX2A 4UCSA 4NXNO 4DO2A 1EZVH 2ZDIA 4IYIA 3M8AA 2DYRC 2V1DA 3JASB 3A0HZ 1N33O 2DN9A 4LNUB 1SC5B 4OPHA 1V55B 5LMNO 4LF7O 4QNHB 2WPDG 3OMIB 4JGSA 4J9ZB 4HZ3A 3WU2Z 2DW4A 4JI6O 4KHPO 2GBOA 4DUYO 1LNQA 4QPJA 3B40A 5J2UA 3IFXA 2ITCC 3M99B 1S76D 4Q20A 3E89A 5KHJA 1IBMO 1NQTA 3CRCA 2Q68A 4JI3O 4MTXA 5EBMC 4FPPA 1I7FA 2K1EA 1SERA 1JMKC 2UUAB 3T2MA 1Y76B 4Z1MG 3DC6A 1I0HA 4KXRA 3ZMZA 2YS8A 3KKYA 2JGDB 2Q7EA 4DV4O 1AR1B 2EINB 2JVDA 1BCCH 1XMQB 2XT9A 3UO2A 2OWOA 4YJ3B 2YIAA 3T1HO 4JI5O 5C93A 3SPGA 3K58A 5LMUO 3FD9A 1JX9A 5LMNB 3I56V 1WN7A 3DXRA 3HKCB 5KHKA 3AEIA 2EJRA 5EIBD 5JVDB 1VQ7V 2ZE7A 3K9SA 4JYYA 4MVSA 1ZAUA 4FLZA 3APOA 2ZIOA 2YEVA 3QF7A 2Q0OC 4YHHO 2L6LA 4LFCO 5DEDA 3QNEA 4YHHB 2FL4A 4PA4A 1BQ0A 2XAQA 2Z5UA 3CD6V 1K4DC 1QR8A 1S0VA 4TQFA 4DXWA 2HFEC 4DUZO 4JYAB 4B3SO 1PL4A 2WLIB 4O4LA 3CRAA 4EB6A 2X0LA 4DV7B 1QVFU 3ABKC 2VQFO 2OCCB 3H1JH 1OCCC 3NXSA 4GZRB 1SQBH 2GSMB 2QGNA 2OIGA 3C3TA 4BW9A 4I55B 2Q0AA 3SGIA 4AI8A 2OIEA 4R8CA 1I5XA 2LFRA 1ZX3A 3G6EV 5IYZB 1AI5A 1KKDA 5GONA 5BMVB 4E2LA 1QCEA 3ICXA 4MVRA 4JI5B 5KUMA 1BE3H 2R9IA 3FB5C 1P4RA 1AJPA 4H33A 3BVOA 5IE9A 4JI4O 1B06A 1SZXA 2Q8VA 3B8MA 4UCOA 1SQFA 3JALB 4YIOA 3BEHA 1MOFA 5LYJB 4JASA 1QLEC 5CA0B 3K9AA 4I0XA 2QWRB 1YHQV 1PL0A 3CCUV 1RSOB 1QLEB 1E79G 4DR1O 2WLLA 2Q7HA 2ZIMA 1D5NA 3RYHA 2EZOA 3ZHQA 2Y4UA 3VQYA 2QR4A 4WBNA 3E8FA 1KECA 4IHJB 4KHPB 1V55C 2WA3A 2Y0IA 4RQEA 1JA8A 1SQXH 2HR3A 1XHXA 3E83A 1K34A 3LNNA 2IJIA 2OCHA 3EHBB 4RAIA 1H2GA 3JAWA 2HLDG 3ZMTA 2A3QA 1WP7A 4NVPA 4I55A 2GTSA 4HNAB 4JTCB 4U7OA 1URFA 3IGAC 4LWSA 1NTKH 4MVUA 1YJ9V 4X65B 1OZ0A 4I5SA 4MSWC 2W0FC 1KKCA 2E75B 4JV5B 2BSKB 1QLNA 1HNZB 3CJHA 4UV9A 4X1YA 1W0JG 2P6JA 4D6TH 4I9WA 2BCCH 5L3GA 5LXTB 5J2TB 4UCVA 4PDRA 3RVYA 3VQWA 4O4IA 4FM2A 5EZYA 2GTAA 1PKXA 3K5OA 2JS5A 3ML0A 3WG7C 4JAUA 1US6A 3ETQA 4TV8A 1TAEA 2N04A 2UUBO 1XNRB 3FB7C 1G1XB 3ABTA 2WA4A 5JVDA 1HNWO 3OR7C 4LF8B 2PYLA 1N0NA 3F7VC 2FTKA 3SYQA 4NTXA 4J7JA 3OAAG 3GWKC 1OJHA 3S3WA 4FFKA 1MG1A 4O2BB 5IYDO 4BIOA 3SJCC 3N27A 3LDCA 3ZMSA 2CTWA 1QVGU 1VARA 4DV6O 4CH3A 1KC8W 2YEVB 4ABMA 2YIBA 1FAFA 1Y4MA 1R73A 5J2TA 1Q82W 1DF5A 2UUBB 2LW1A 2CUGA 4X1IB 3OFNG 3R66A 2EIKB 5LHGA 1I08A 5DECA 3AG1C 4JTAB 4WF9V 1IBKO 4JF3A 4X20B 2JDIG 5IY5B 4BW5A 4CH5A 3AG4C 1KMIZ 5BZBA 5JCOA 1XQ8A 5IJ0B 2M7WA 4GCZA 1DF4A 2R70A 3JATB 3CRQA 4E4EA 2YI8A 3JD1A 4GKKB 4UCUA 5IJ0A 2YIDA 4QPKA 4DV0B 2A0LA 3OGCC 1GN4A 3SJBC 1SQPH 3SYCA 3WB1A 4X8AA 1HR0O 3VOUA 1EN4A 3OEHG 4PI2A 5LP6C 5EYPA 2BOBC 1PNKA 1FXKB 4DV3B 1GRJA 1G6UA 4LFBO 3CWBH 4LP8A 1M57B 4FIPC 1EN6A 4CZZA 4GLXA 1JR9A 4X65O 5JQGA 1XREA 2AW9A 3GB7C 4O4JA 1M56C 3KZIZ 2RN9A 1J95A 2IJJA 5LGUA 2ZR3A 1MSWD 3EVKA 3K06A 2QKAA 1E1RG 4LH7A 4ZI7A 3CCLV 3LSUA 4FLWA 1VQLV 1JFFB 5GTIZ 3WB0A 4TT3G 2K9PA 1Q90D 3H1HH 1R1BA 3I55V 3ZMUA 2DE0X 1YDXA 4NYKA 2WLNA 1VQ6V 2GHYA 3K79A 1IBLO 3P32A 2EIJB 5CB4A 3CCEV 1TGOA 4I9QA 4ZOLA 3UT5A 4F6RB 3H1IH 3AK3A 2HJDA 1LUVA 4MT8A 2QM7A 1SA0B 3CC2V 2B5UA 4DR5O 1YIJV 4YXWG 1N8RW 3R65A 1NVPD 2DWDC 3TETA 3BCCH 1GKFA 3K59A 2UXDO 4CC6A 2JK5C 1Q8IA 2KQXA 2P67A 1GK9A 2X6BA 3H9VA 2IH3C 5HFLA 3AG2B 2WSSG 2F1MA 2Y4TA 4DR6O 1IDSA 4UV8A 1RPRA 3ABKB 4HBNA 4H37A 2UXCB 1EN5A 3BABA 1NVPB 2W6IG 2Y48A 1Y76A 4LF8O 3L9DA 1WP8A 3KCXA 2DMXA 1VQ5V 3ZBHA 1CEZA 1XMOO 4AQYO 4X1YB 4FK5C 2F4VO 3SJAC 3E35A 4DV1B 4OPAA 4JI8O 3E2EA 5LOVB 2VS0A 5D5QA 4O4IB 1KQSU 4DW1A 2W0XA 2EZPA 1N34O 5L3EA 4GX5A 4IGGA 5JJNB 1N32O 1PP9H 2JEXA 1YXBA 4X62B 1WPBA 1RPOA 1SZTA 5H5NA 2HKOA 4X62O 2IW5A 5C8YB 5CBGA 4LFBB 2ETNA 1LR1A 3KCYA 1ROPA 3CRMA 1S3JA 1L1FA 2IM9A 2NR5A 3F5WC 2PUSA 2HHHO 4X1IA 4HNAA 4W4LA 1XMQO 3AG4B 1DLBA 1GM9A 4MVOA 4O2AB 1PV0A 1HR0B 3G71V 1MSDA 3TXSA 4RUFA 1Y67A 1YI2V 2ZDIC 3AG7A 2CK3G 4I0XB 4PV1B 1NBMG 4MW8A 1YJWV 4AQYB 4JI3B 2YXYA 2HVKC 1XL4A 1WA8B 4R50A 3JARA 3BFRA 3OM3B 1F4MA 4WBNB 3ASNC 1Q81W 3BAAA 1KUQA 1TUBA 2ZT9B 4JPRA 1JOYA 3RVZA 4KUMA 4JTDB 1X4TA 2WWWA 3CCMV 4EFBA 4P9PA 1PPJH 3RT3C 1UFIA 4CH4A 4CH6A 3Q4HB 4EFEA 4UVBA 2ZXWC 4QE9A 3TXQA 1K4CC 1XUQA 1JPXA 1J5EO 2WAMA 3TCUA 1JCHA 2QKSA 1TUBB 2UUAO 4DR5B 2H94A 1YZBA 4I7ZB 1Y74A 4MTFA 4DRXA 2BTOA 3HPLC 4D7SA 1R6TA 5CMUA 5LL6Y 4NTWA 5B1BB 4X89A 4PELA 3D36C 1YJNV 2QDOA 5GTHZ 2OT5A 2ZM6O 1XNRO 3CSXA 4WFBV 4LF4B 1THZA 4BIUA 2HG5C 1KU9A 4OXSA 1KB9F 5C8YA 1OCRC 3L72H 3M7MX 1BZKA 1L8DA 2QE7G 5L3FA 3ZN1A 3T4ZA 1B3QA 1MNGA 5EIBC 1DTOA 1VF7A 3QO5A 2N74A 1G4YB 3CS5A 3IJ4A 5BMVA 2XOKG 1FPOA 2FMLA 5E79Z 4B7EA 5ITZB 3NR7A 3RYHB 5LHIA 5FPOA 4FMTA 4MTGA 1XMOB 4BAYA 2P90A 1VQMV 2F43G 4EB6B 4DV2O 2JIZG 2PYJA 1L0NH 4ASUG 1RM1C 1S77D 4ZI7B 2Q69A 1SA0A 3L75H 3QTCA 2F4VB 2JEUA 4K8XA 2MW2B 5IYBO 3K0DA 1GM8A 4X64O 5AG2A 4JAVA 3CYOA 3ZMVA 1CPYA 4LF9O 1FFXB 1P84F 3IC9A 4X9QA 2WLLB 3ZHRA 1H2KA 1IBKB 5B3SB 3H01A 4ZBMA 3ETEA 4DR3B 1OCOC 4FLTA 4U7NA 1QHTA 4OX9O 2XAFA 2XHBA 2E3CA 3LDEA 4G28B 1L0LH 4R6ZA 4GX0A 4UUJC 1PM9A 2ARHA 3H1LH 3B2EE 4UFZA 2WLMA 5JH7B 3DTUB 2JRIA 2XNDG 2CAZC 4UCTA 4O4JB 1K3EA 4RUEA 5A9GA 3JYCA 3ZCCA 1Q3EA 1AILA 2GV9A 2RJZA 2EIJC 5IYZA 1NH2B 1IXBA 3OTOO 3U11A 5B5EZ 5CBFA 4LBEC 3AG1B 4JI0O 2ZNJA 4NTYA 2X6CA 4NXMB 4DRXB 3UM7A 2N05A 4ICGA 1TVKA 5E1AC 4YJ2A 1WB8A 4FZ1A 1SQGA 4XDJA 1N36B 1OV9A 3I5DA 2VWJA 3JSLA 1HWYA 1GN2A 4AILC 2Z3YA 4O2AA 5B66Z 3AG3C 5CA1A 1R3IC 1K8AW 4X66O 4G2KA 1HNXO 1AI4A 2ODMA 3CC4V 4LF5O 4TV9B 5TISZ 3BRCA 4JI0B 4NR1A 3FAVA 1N0JA 1LUWA 1XEQA 5JH7A 1NS1A
chains in the Genus database with same CATH topology
4X64O 4LF8O 1FJGO 4JI3O 4LF9O 2UUAO 1FKAO 4LFBO 4DV5O 3O65A 5IWAO 1YZBA 1XMOO 4AQYO 4LF6O 4GKJO 2F4VO 1FYJA 2UUBO 2UXBO 2E5LO 4DV4O 4NXMO 4OPAA 4JI4O 4JI8O 4DV1O 4OX9O 2ZKOA 4X65O 1R6TA 1G1XB 5LL6Y 1HNWO 5BY1A 5IT9N 5FLXN 2DJVA 1I94O 3T1HO 4JI5O 1N36O 1N34O 2UUCO 5LMUO 2JRIA 4JYAO 2UU9O 1N32O 2ZM6O 1XNRO 4LFAO 2UXCO 4B3MO 4DR4O 4DR1O 5H5NA 4YY3O 3T1YO 4X62O 1AB3A 4DV3O 4JV5O 4DR2O 4K0KO 4DV6O 1AILA 3F5TA 1A32A 4A5UB 4DR3O 1HNZO 3OTOO 3J7AU 1R1BA 4JI0O 2HHHO 2N74A 4YHHO 1XMQO 4LFCO 4NXNO 3SDLA 1DK1A 1IBLO 2LW7A 2VQEO 3M8AA 4DR7O 3R66A 4DV7O 1N33O 2Z0AA 4OPHA 1IBKO 4B3TO 5BR8O 4JI7O 5LMNO 2AGAA 4DR5O 4LF7O 4LF4O 4DUZO 4JI2O 4B3SO 1XNQO 2UXDO 3JAMN 4DV2O 1D2DA 1KUQA 4DV0O 4JI6O 4B3RO 5BXZA 5A2QN 4KHPO 4DUYO 2VQFO 3J80N 4GKKO 4X66O 1HNXO 4DR6O 2DOSA 1X59A 3RT3C 4LF5O 1F7YA 2FKXA 1HR0O 3J81N 1XEQA 1IBMO 4JI1O 1NS1A 1J5EO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 O;  4LF8 O;  1FJG O;  4JI3 O;  4LF9 O;  2UUA O;  1FKA O;  4LFB O;  4DV5 O;  3O65 A;  5IWA O;  1YZB A;  1XMO O;  4AQY O;  4LF6 O;  4GKJ O;  2F4V O;  1FYJ A;  2UUB O;  2UXB O;  2E5L O;  4DV4 O;  4NXM O;  4OPA A;  4JI4 O;  4JI8 O;  4DV1 O;  4OX9 O;  2ZKO A;  4X65 O;  1R6T A;  1G1X B;  5LL6 Y;  1HNW O;  5BY1 A;  5IT9 N;  5FLX N;  2DJV A;  1I94 O;  3T1H O;  4JI5 O;  1N36 O;  1N34 O;  2UUC O;  5LMU O;  2JRI A;  4JYA O;  2UU9 O;  1N32 O;  2ZM6 O;  1XNR O;  4LFA O;  2UXC O;  4B3M O;  4DR4 O;  4DR1 O;  5H5N A;  4YY3 O;  3T1Y O;  4X62 O;  1AB3 A;  4DV3 O;  4JV5 O;  4DR2 O;  4K0K O;  4DV6 O;  1AIL A;  3F5T A;  1A32 A;  4A5U B;  4DR3 O;  1HNZ O;  3OTO O;  3J7A U;  1R1B A;  4JI0 O;  2HHH O;  2N74 A;  4YHH O;  1XMQ O;  4LFC O;  4NXN O;  3SDL A;  1DK1 A;  1IBL O;  2LW7 A;  2VQE O;  3M8A A;  4DR7 O;  3R66 A;  4DV7 O;  1N33 O;  2Z0A A;  4OPH A;  1IBK O;  4B3T O;  5BR8 O;  4JI7 O;  5LMN O;  2AGA A;  4DR5 O;  4LF7 O;  4LF4 O;  4DUZ O;  4JI2 O;  4B3S O;  1XNQ O;  2UXD O;  3JAM N;  4DV2 O;  1D2D A;  1KUQ A;  4DV0 O;  4JI6 O;  4B3R O;  5BXZ A;  5A2Q N;  4KHP O;  4DUY O;  2VQF O;  3J80 N;  4GKK O;  4X66 O;  1HNX O;  4DR6 O;  2DOS A;  1X59 A;  3RT3 C;  4LF5 O;  1F7Y A;  2FKX A;  1HR0 O;  3J81 N;  1XEQ A;  1IBM O;  4JI1 O;  1NS1 A;  1J5E O; 
#chains in the Genus database with same CATH topology
 2YUA A;  5J9P C;  1YSC A;  3CP1 A;  2YC0 A;  1FFT B;  3SYO A;  5IWA B;  3JSN A;  4FM0 A;  2EX3 A;  1M4U A;  1E1Q G;  1V54 C;  4GT1 A;  1J5E B;  3K04 A;  3CRR A;  2CE4 A;  2DQ3 A;  3L74 H;  4L87 A;  4WFG A;  5J2U B;  5ITZ A;  1AP6 A;  2QWQ B;  1VQ4 V;  5LXT A;  1M9N A;  4O2B A;  4O4L B;  2RDC A;  3BHP A;  1BS3 A;  1U97 A;  5HFM A;  4FLY A;  4B3M O;  3ZHV A;  4GYC B;  2QEX V;  4LF9 B;  1AB3 A;  4ZHQ A;  3JD0 A;  2HVJ C;  3OUF A;  4C7U A;  4B3R B;  5KA6 A;  3K5L A;  4TWK A;  4LWS B;  5CB4 B;  1K7D A;  2PF4 E;  3RYF B;  4R7C A;  4UB6 Z;  2ZE8 A;  1NTM H;  2P4K A;  4D7T A;  3FYE B;  2HJF C;  2OTL V;  3MDS A;  4PI0 A;  2AGA A;  3CX5 F;  1EBO A;  4ZOL B;  3UT5 B;  2RMK B;  4PDM A;  1Y66 A;  5EC1 C;  1N4C A;  3P3N A;  1DGS A;  2IJH A;  4NKG B;  2ZXW B;  1SF9 A;  4JYB A;  1P7B A;  4CS2 A;  3K0G A;  3G6B A;  2DQ0 A;  1K5Q A;  4WFA V;  4JZ2 A;  4OGQ B;  1VQK V;  1K97 A;  1SKV A;  3Q4H A;  4MTO A;  3MD0 A;  3W7T A;  2V7Q G;  4P30 A;  3CHX A;  3X2Q B;  2H3O A;  2NLJ C;  3SPJ A;  4TV9 A;  3LSQ A;  3E22 A;  4X1K B;  2HHH B;  3ZED A;  1Y74 B;  1D5A A;  5EYP B;  5CA1 B;  3JCU Z;  1AI6 A;  2UXB O;  1KP2 A;  4NXM O;  4O4H B;  5JQG B;  1XNQ B;  4PA7 A;  1H2S B;  3ZX6 A;  2IH1 C;  2JS3 A;  3P3P A;  1YCI A;  1N36 O;  1W0K G;  1N32 B;  1IXM A;  1FFX A;  2YXL A;  5KHG A;  2QTS A;  2UU9 O;  1VMG A;  4FLU A;  3T1Y O;  2NNU A;  2PY5 A;  1NZ6 A;  5GW7 A;  3EXA A;  1RFY A;  2KG7 A;  4DV6 B;  3OEE G;  2PI4 A;  5KA5 A;  1BHB A;  1VF6 C;  2WLH A;  2P5O A;  3JAT A;  4J7Z A;  2VQE B;  3ZHS A;  5LYJ A;  4FLV A;  4OX9 B;  5LA6 B;  1VF6 A;  2YXH A;  3K03 A;  3RN4 A;  3D36 A;  3HKE A;  2RCV A;  1VIB A;  1YF2 A;  1AR4 A;  4TQD A;  3CEI A;  3K08 A;  4B3T O;  1EFR G;  1GN6 A;  2E76 B;  1M5I A;  3ETG A;  4YJ2 B;  5KX5 B;  5KAF Z;  3SJQ C;  3OE7 G;  2Q9L A;  4TUY A;  4IIJ A;  3H1K H;  1ZTE A;  4K3A A;  2ZE5 A;  1IBM B;  3JAK A;  1SET A;  1Q6I A;  4LC1 A;  5A2Q N;  2RQ6 A;  2V4D A;  3QO7 A;  3N2K A;  3A2F A;  1RSO A;  2UUC B;  5KUK A;  3JD3 A;  2CH7 B;  4B7K A;  2AHY A;  2IBZ H;  1AR5 A;  1PD3 A;  4BWA A;  3VQV A;  3K57 A;  1VQO V;  3CMA V;  3BY6 A;  4LF6 B;  2M6Y A;  3HR0 A;  3ZRV A;  4DW0 A;  1SES A;  2IU0 A;  3E86 A;  3S3X A;  3RYI A;  4DV2 B;  5B3S C;  1GMG A;  3JAK B;  2VQF B;  4MVM A;  2ZNI A;  1FS0 G;  4J10 A;  3ABL C;  3SYP A;  1M56 B;  4CS3 A;  1XHZ A;  4H44 B;  3RYF A;  2BOC C;  1AJQ A;  1OCZ B;  4LF5 B;  3ABU A;  4QE7 A;  5H6Q A;  5FNV A;  2D2C B;  5B1B C;  1ARO P;  4DV3 O;  3D3I A;  4DR2 O;  3ZN0 A;  4K35 A;  5H9C A;  2EJ7 A;  2LFS A;  1A32 A;  1ZL8 B;  1HNZ O;  1NR1 A;  4QGP A;  3G4S V;  5EBL C;  1W2B U;  3OTO B;  2DYR B;  1VF5 B;  4JI1 B;  3SDL A;  1OCR B;  3RW0 A;  3T1H B;  2AZ2 A;  2H8P C;  1P7G A;  2VWK A;  1O9H A;  2KB1 A;  2JJ1 G;  4UVC A;  3JAM N;  1JVM A;  2P22 C;  1JFF A;  4YY3 B;  4B3R O;  1S5J A;  4UCR A;  3UKM A;  4F6E A;  2LQT A;  3E22 B;  5B1A C;  2R9R B;  3LNM B;  2FKX A;  5L3C A;  1ZWI C;  5JCO C;  3ETD A;  3JAS A;  2YDE A;  1K92 A;  1OCO B;  4X64 B;  2CTP A;  1JJO A;  2LO1 A;  3RYC B;  3WG7 B;  2CH7 A;  2DWE C;  1R3K C;  3RBZ A;  5FNV B;  2ZD9 A;  4G27 B;  1FYJ A;  4B3S B;  5LP6 A;  4F4L A;  3MHH C;  3E8G A;  4DR4 B;  3B4S A;  4IIJ B;  1HNX B;  1TVK B;  4LCU C;  2R72 A;  3DGE A;  2XAJ A;  5B1O A;  1B6Q A;  1TA8 A;  1VP7 A;  4LFC B;  1MZF A;  4BIZ A;  4FJC C;  1VEW A;  1WPX A;  3RYC A;  5DM6 V;  2ZQM A;  1IVS A;  1YIT V;  2BE3 A;  3RFR A;  5KHH A;  1F51 A;  3ASO C;  1ZLZ A;  4UXN A;  3HB3 B;  1AP5 A;  3UO3 A;  3PJS K;  5JWP A;  1VQ8 V;  1DK1 A;  3CCQ V;  3OR6 C;  4DR7 O;  1QNM A;  2GUZ A;  3OMN B;  1KP3 A;  1JJ2 U;  4UVA A;  5BR8 O;  1N34 B;  1M93 A;  1SQV H;  4TUY B;  1ENV A;  4PA6 A;  1FD9 A;  1Y6X A;  4JI2 O;  4IL6 Z;  4GKJ B;  1OCC B;  1K33 A;  3ZIA G;  3AG2 C;  5EBW C;  3OT7 A;  1FXV A;  2Y69 C;  5FL7 G;  3APQ A;  4DV0 O;  4K0K B;  5EZY B;  4DR6 B;  4GKK O;  1KD1 W;  3ASN B;  3L73 H;  4DK0 A;  1X59 A;  2D3O W;  5CN0 A;  5EC2 C;  2JGD A;  2UXD B;  1V9P A;  2DYS B;  1S5H C;  4TSF G;  1K73 W;  3CJH B;  3U0Z A;  3FAV B;  4CBC A;  1EZJ A;  1BT8 A;  3L70 H;  1G8M A;  5D5P A;  2PI5 A;  2ZE6 A;  3C90 A;  3ZHU A;  3AK1 A;  1RP3 B;  4WCE V;  4KFM A;  3O65 A;  3K5N A;  1CP9 A;  1AVM A;  3OD4 A;  3SPH A;  1KBH A;  2HEP A;  2X7R B;  5LHH A;  3U10 A;  3B8N A;  1HP8 A;  2PZS A;  4J11 A;  1VQN V;  3B77 A;  3STL C;  1QQC A;  1I94 O;  1H2L A;  2P7T C;  3T4D A;  4H0L B;  3VQX A;  1R6K A;  3K5M A;  2JJ2 G;  2UU9 B;  5F2V O;  4TOI A;  4W4K A;  1MA1 A;  3CXC U;  1GTO A;  5KX5 A;  1U96 A;  5IDJ A;  2MK3 A;  3CPW U;  2EBO A;  2CTR A;  4U3J B;  5H2F Z;  1R3L C;  4DUY B;  4PHZ A;  3TJT A;  5CBH A;  3ZRS A;  4X66 B;  3RWR D;  2EUL A;  5KMG A;  4H13 B;  1UPG A;  3FFQ A;  1Q86 W;  2EIM B;  3ZJZ A;  1WNS A;  2Z0A A;  2ZCE A;  2UXX A;  2QJ1 A;  3ZHT A;  4CS4 A;  4LH6 A;  1NH2 D;  1AJN A;  2E74 B;  2DYS C;  4RWU A;  2XUM A;  5JJE B;  4LF4 O;  4TV8 B;  3WFV A;  2ATK C;  5L3B A;  3FKS G;  2ZM6 B;  4UB8 Z;  3AK2 A;  3P30 A;  3MHS C;  4MVZ A;  1Z5V A;  4N23 A;  2ZR2 A;  4MW3 A;  2F23 A;  3FB8 C;  1P49 A;  3CME V;  5KLV H;  2GDS A;  3CCR V;  5LMU B;  3LUT B;  1K5S A;  5LA6 A;  5LGT A;  1Q7Y W;  1YTF B;  2YI9 A;  4DK1 A;  1JQ0 A;  2WLK A;  3A0R A;  4WFH A;  3JAL A;  4Q6G A;  1FXK A;  2QWN B;  2A7W A;  5JJJ B;  4B3T B;  1FXK C;  3IAY A;  4GUN A;  5LP6 B;  3CXH F;  4LF6 O;  2QKC A;  1O9G A;  1FXH A;  1GM7 A;  1YEW A;  3JAR B;  1V54 B;  3W7W A;  3X2Q C;  4B08 A;  5K1P A;  4J42 A;  4Z1V A;  2QM4 A;  2RNB A;  5BY1 A;  1NT2 B;  3UCS C;  4EKW A;  2DJV A;  4DYL A;  2BTQ B;  1WB7 A;  1XL6 A;  5LOV A;  3ZRW A;  4I4T A;  2UUC O;  4X20 A;  1NU1 H;  3QVN A;  3WB2 A;  4WFE A;  1XBL A;  4ZKI A;  2Q7G A;  4YY3 O;  2Q4P A;  3CE2 A;  1NI8 A;  4GX1 A;  4K0K O;  4Z2W A;  2ADP A;  1ZUQ A;  2JGU A;  4A5U B;  4DR3 O;  1ZL8 A;  4IT5 A;  1OHH G;  4JI4 B;  4JI2 B;  1HNW B;  5IY5 C;  2OYQ A;  1ZSP A;  2VQE O;  1NR7 A;  1MZE A;  4FLX A;  4J41 A;  1BMF G;  4YJ3 A;  2QTO A;  4DV7 O;  4I50 A;  2PGG A;  3C3S A;  3OW2 U;  4ZHQ B;  1Z2G A;  3LSS A;  1M1K W;  1AI7 A;  1Q43 A;  2CDY A;  5DN6 G;  4CC5 A;  4KL1 A;  1XNQ O;  3OTF A;  1RM1 B;  4BR6 A;  2OTJ V;  1GAX A;  1CXZ B;  1XDC A;  4JI6 B;  1D2D A;  4RQF A;  2CGN A;  4JYC A;  2GUZ B;  1NTZ H;  4MS2 A;  2NN4 A;  1H8H G;  4LF7 B;  3B09 A;  1XIL A;  3ZRW B;  2A79 B;  3UQ8 A;  1QU7 A;  1F23 A;  4PA3 A;  2LP7 A;  3HKE B;  2Q5Z A;  4DR2 B;  4K8Z A;  1SQQ H;  4DV5 B;  2QWP B;  1Q6H A;  3JCZ A;  1W59 A;  3PN1 A;  1BL8 A;  3RGB A;  1UJW B;  4XDK A;  2BSK A;  2KG7 B;  2E5L O;  1R3J C;  2ZKO A;  4IYH A;  4PDV A;  1Q5O A;  3GWO A;  4DV1 O;  2CGO A;  3A8T A;  2XTA A;  3QG5 A;  4I50 B;  5EK0 A;  1SS3 A;  5KAI Z;  4F6R A;  1QR9 A;  1QBZ A;  3OUS A;  5K1X A;  3DC5 A;  3ABM B;  2XAG A;  2XAH A;  4LFA O;  4JI8 B;  3G80 A;  2UXC O;  5IYC O;  3ABM C;  2KKW A;  3K3W A;  3T1C A;  1I5Y A;  4XDL A;  3SYA A;  3HKD A;  1MAB G;  2L35 A;  3D3Q A;  5IJ9 B;  1GH6 A;  1BGY H;  4HYO A;  4ZIB A;  2B1I A;  3CCS V;  2EIL B;  1H8E G;  1SRY A;  4QIW F;  4LFA B;  2FB5 A;  3TGU H;  2IU3 A;  3JD4 A;  1Z5W A;  5B1N A;  4DR1 B;  2A9H A;  3T1Y B;  2B1G A;  1VQ9 V;  4FVM A;  2EIM C;  3ASO B;  3HKB B;  3DSQ A;  1BSM A;  1WLE A;  4JI7 O;  1WAZ A;  2HP8 A;  4P2Z A;  5GON B;  2F95 B;  2F93 B;  2LGW A;  3AG3 B;  3L71 H;  3KG2 A;  1IX9 A;  4J9Y B;  2FYU H;  3LDD A;  3FB6 C;  4B3M B;  1PNM A;  2OCC C;  2YSU B;  2QSA A;  1N33 B;  5H6R A;  2Q73 A;  3OMA B;  5BR8 B;  3O9O A;  2DOS A;  4NXN B;  1F7Y A;  3HKD B;  5LGN A;  3J81 N;  1IBL B;  1NKD A;  2Y69 B;  3SPC A;  2WLI A;  2ZIN A;  3FYI B;  1KYO F;  3DXR B;  3HKC A;  4JZG A;  1FJG O;  2UXN A;  3EFF K;  3STZ C;  5KMG B;  2A06 H;  4DV5 O;  2ITD C;  3W7U A;  5IWA O;  3W7X A;  2EIN C;  1BHA A;  4U3F H;  1R6N A;  1NJI W;  1HDJ A;  2E5L B;  4LNU A;  5IT9 N;  4NB5 A;  4LR3 A;  2IJK A;  1YTF D;  1H2N A;  4RO2 A;  2QM8 A;  4FM1 A;  3CCJ V;  1VQP V;  4KP4 A;  4MVQ A;  3RYI B;  1GN3 A;  3ZRX A;  5L3D A;  2W6J G;  4DR4 O;  2Q6A A;  2X6A A;  4WFF A;  2AHZ A;  4JV5 O;  3N2G A;  3QO8 A;  2YIC A;  1YVW A;  3F5T A;  4QJF B;  3E8B A;  3J7A U;  3GVM A;  3IC7 A;  4EEQ A;  3THO A;  1ORQ C;  1T5E A;  4L8J A;  2LJ2 A;  1GO3 F;  2LW7 A;  1FJG B;  3TK1 A;  1Q6U A;  1EM1 A;  2C2A A;  2KSD A;  2P06 A;  3BA9 A;  1HW7 A;  4PA9 A;  3OGI B;  3BPZ A;  3CCV V;  2PTM A;  2XAS A;  3A0B Z;  3D8C A;  4JI7 B;  1M90 W;  1WJZ A;  1K9M W;  4U3J A;  1WA8 A;  2CTQ A;  2YIB D;  3FX7 A;  4DV4 B;  1PNL A;  3SR2 C;  4I4T B;  1I94 B;  1S72 V;  5BXZ A;  3SPI A;  2ADQ B;  3J80 N;  5B1A B;  1F4N A;  4YIP A;  4HAM A;  1IZ3 A;  2AZ0 A;  3ABL B;  3W7S A;  3VBB A;  2VRZ A;  3ZS8 C;  2P4V A;  2Y0P A;  2AXT Z;  3E8H A;  4JI1 O;  4FFB B;  4JAA A;  2G38 A;  3CC7 V;  5KHI A;  4P9O A;  3BA8 A;  1MMM A;  1S5L Z;  4PD4 F;  1FKA O;  1COW G;  2BTQ A;  4GKJ O;  3G67 A;  2WLJ A;  1XOU A;  4XBF A;  1IUR A;  4PDL A;  1M57 C;  3CB2 A;  2Q67 A;  3HKB A;  5FLX N;  2LGQ A;  4FZ0 A;  3JAW B;  4DR7 B;  3N2K B;  2ILM A;  5FPR A;  1TUE B;  4X88 A;  2F66 C;  1H38 A;  4DUZ B;  4JYA O;  2EIL C;  4O4H A;  2UXB B;  5LBQ A;  4N21 A;  4PJ0 Z;  4FFB A;  4X1K A;  1B04 A;  4IHJ A;  5IJ9 A;  2QA4 V;  2O57 A;  1OCZ C;  3N2G B;  1BQZ A;  4J80 A;  1H2M A;  5CA3 A;  3JD2 A;  2R9A A;  2EIK C;  4J7K A;  3MAQ A;  1XI1 A;  2B9Z A;  2QWO B;  3F7Y C;  4AHC A;  5CA0 A;  4GX2 A;  4UCS A;  4NXN O;  4DO2 A;  1EZV H;  2ZDI A;  4IYI A;  3M8A A;  2DYR C;  2V1D A;  3JAS B;  3A0H Z;  1N33 O;  2DN9 A;  4LNU B;  1SC5 B;  4OPH A;  1V55 B;  5LMN O;  4LF7 O;  4QNH B;  2WPD G;  3OMI B;  4JGS A;  4J9Z B;  4HZ3 A;  3WU2 Z;  2DW4 A;  4JI6 O;  4KHP O;  2GBO A;  4DUY O;  1LNQ A;  4QPJ A;  3B40 A;  5J2U A;  3IFX A;  2ITC C;  3M99 B;  1S76 D;  4Q20 A;  3E89 A;  5KHJ A;  1IBM O;  1NQT A;  3CRC A;  2Q68 A;  4JI3 O;  4MTX A;  5EBM C;  4FPP A;  1I7F A;  2K1E A;  1SER A;  1JMK C;  2UUA B;  3T2M A;  1Y76 B;  4Z1M G;  3DC6 A;  1I0H A;  4KXR A;  3ZMZ A;  2YS8 A;  3KKY A;  2JGD B;  2Q7E A;  4DV4 O;  1AR1 B;  2EIN B;  2JVD A;  1BCC H;  1XMQ B;  2XT9 A;  3UO2 A;  2OWO A;  4YJ3 B;  2YIA A;  3T1H O;  4JI5 O;  5C93 A;  3SPG A;  3K58 A;  5LMU O;  3FD9 A;  1JX9 A;  5LMN B;  3I56 V;  1WN7 A;  3DXR A;  3HKC B;  5KHK A;  3AEI A;  2EJR A;  5EIB D;  5JVD B;  1VQ7 V;  2ZE7 A;  3K9S A;  4JYY A;  4MVS A;  1ZAU A;  4FLZ A;  3APO A;  2ZIO A;  2YEV A;  3QF7 A;  2Q0O C;  4YHH O;  2L6L A;  4LFC O;  5DED A;  3QNE A;  4YHH B;  2FL4 A;  4PA4 A;  1BQ0 A;  2XAQ A;  2Z5U A;  3CD6 V;  1K4D C;  1QR8 A;  1S0V A;  4TQF A;  4DXW A;  2HFE C;  4DUZ O;  4JYA B;  4B3S O;  1PL4 A;  2WLI B;  4O4L A;  3CRA A;  4EB6 A;  2X0L A;  4DV7 B;  1QVF U;  3ABK C;  2VQF O;  2OCC B;  3H1J H;  1OCC C;  3NXS A;  4GZR B;  1SQB H;  2GSM B;  2QGN A;  2OIG A;  3C3T A;  4BW9 A;  4I55 B;  2Q0A A;  3SGI A;  4AI8 A;  2OIE A;  4R8C A;  1I5X A;  2LFR A;  1ZX3 A;  3G6E V;  5IYZ B;  1AI5 A;  1KKD A;  5GON A;  5BMV B;  4E2L A;  1QCE A;  3ICX A;  4MVR A;  4JI5 B;  5KUM A;  1BE3 H;  2R9I A;  3FB5 C;  1P4R A;  1AJP A;  4H33 A;  3BVO A;  5IE9 A;  4JI4 O;  1B06 A;  1SZX A;  2Q8V A;  3B8M A;  4UCO A;  1SQF A;  3JAL B;  4YIO A;  3BEH A;  1MOF A;  5LYJ B;  4JAS A;  1QLE C;  5CA0 B;  3K9A A;  4I0X A;  2QWR B;  1YHQ V;  1PL0 A;  3CCU V;  1RSO B;  1QLE B;  1E79 G;  4DR1 O;  2WLL A;  2Q7H A;  2ZIM A;  1D5N A;  3RYH A;  2EZO A;  3ZHQ A;  2Y4U A;  3VQY A;  2QR4 A;  4WBN A;  3E8F A;  1KEC A;  4IHJ B;  4KHP B;  1V55 C;  2WA3 A;  2Y0I A;  4RQE A;  1JA8 A;  1SQX H;  2HR3 A;  1XHX A;  3E83 A;  1K34 A;  3LNN A;  2IJI A;  2OCH A;  3EHB B;  4RAI A;  1H2G A;  3JAW A;  2HLD G;  3ZMT A;  2A3Q A;  1WP7 A;  4NVP A;  4I55 A;  2GTS A;  4HNA B;  4JTC B;  4U7O A;  1URF A;  3IGA C;  4LWS A;  1NTK H;  4MVU A;  1YJ9 V;  4X65 B;  1OZ0 A;  4I5S A;  4MSW C;  2W0F C;  1KKC A;  2E75 B;  4JV5 B;  2BSK B;  1QLN A;  1HNZ B;  3CJH A;  4UV9 A;  4X1Y A;  1W0J G;  2P6J A;  4D6T H;  4I9W A;  2BCC H;  5L3G A;  5LXT B;  5J2T B;  4UCV A;  4PDR A;  3RVY A;  3VQW A;  4O4I A;  4FM2 A;  5EZY A;  2GTA A;  1PKX A;  3K5O A;  2JS5 A;  3ML0 A;  3WG7 C;  4JAU A;  1US6 A;  3ETQ A;  4TV8 A;  1TAE A;  2N04 A;  2UUB O;  1XNR B;  3FB7 C;  1G1X B;  3ABT A;  2WA4 A;  5JVD A;  1HNW O;  3OR7 C;  4LF8 B;  2PYL A;  1N0N A;  3F7V C;  2FTK A;  3SYQ A;  4NTX A;  4J7J A;  3OAA G;  3GWK C;  1OJH A;  3S3W A;  4FFK A;  1MG1 A;  4O2B B;  5IYD O;  4BIO A;  3SJC C;  3N27 A;  3LDC A;  3ZMS A;  2CTW A;  1QVG U;  1VAR A;  4DV6 O;  4CH3 A;  1KC8 W;  2YEV B;  4ABM A;  2YIB A;  1FAF A;  1Y4M A;  1R73 A;  5J2T A;  1Q82 W;  1DF5 A;  2UUB B;  2LW1 A;  2CUG A;  4X1I B;  3OFN G;  3R66 A;  2EIK B;  5LHG A;  1I08 A;  5DEC A;  3AG1 C;  4JTA B;  4WF9 V;  1IBK O;  4JF3 A;  4X20 B;  2JDI G;  5IY5 B;  4BW5 A;  4CH5 A;  3AG4 C;  1KMI Z;  5BZB A;  5JCO A;  1XQ8 A;  5IJ0 B;  2M7W A;  4GCZ A;  1DF4 A;  2R70 A;  3JAT B;  3CRQ A;  4E4E A;  2YI8 A;  3JD1 A;  4GKK B;  4UCU A;  5IJ0 A;  2YID A;  4QPK A;  4DV0 B;  2A0L A;  3OGC C;  1GN4 A;  3SJB C;  1SQP H;  3SYC A;  3WB1 A;  4X8A A;  1HR0 O;  3VOU A;  1EN4 A;  3OEH G;  4PI2 A;  5LP6 C;  5EYP A;  2BOB C;  1PNK A;  1FXK B;  4DV3 B;  1GRJ A;  1G6U A;  4LFB O;  3CWB H;  4LP8 A;  1M57 B;  4FIP C;  1EN6 A;  4CZZ A;  4GLX A;  1JR9 A;  4X65 O;  5JQG A;  1XRE A;  2AW9 A;  3GB7 C;  4O4J A;  1M56 C;  3KZI Z;  2RN9 A;  1J95 A;  2IJJ A;  5LGU A;  2ZR3 A;  1MSW D;  3EVK A;  3K06 A;  2QKA A;  1E1R G;  4LH7 A;  4ZI7 A;  3CCL V;  3LSU A;  4FLW A;  1VQL V;  1JFF B;  5GTI Z;  3WB0 A;  4TT3 G;  2K9P A;  1Q90 D;  3H1H H;  1R1B A;  3I55 V;  3ZMU A;  2DE0 X;  1YDX A;  4NYK A;  2WLN A;  1VQ6 V;  2GHY A;  3K79 A;  1IBL O;  3P32 A;  2EIJ B;  5CB4 A;  3CCE V;  1TGO A;  4I9Q A;  4ZOL A;  3UT5 A;  4F6R B;  3H1I H;  3AK3 A;  2HJD A;  1LUV A;  4MT8 A;  2QM7 A;  1SA0 B;  3CC2 V;  2B5U A;  4DR5 O;  1YIJ V;  4YXW G;  1N8R W;  3R65 A;  1NVP D;  2DWD C;  3TET A;  3BCC H;  1GKF A;  3K59 A;  2UXD O;  4CC6 A;  2JK5 C;  1Q8I A;  2KQX A;  2P67 A;  1GK9 A;  2X6B A;  3H9V A;  2IH3 C;  5HFL A;  3AG2 B;  2WSS G;  2F1M A;  2Y4T A;  4DR6 O;  1IDS A;  4UV8 A;  1RPR A;  3ABK B;  4HBN A;  4H37 A;  2UXC B;  1EN5 A;  3BAB A;  1NVP B;  2W6I G;  2Y48 A;  1Y76 A;  4LF8 O;  3L9D A;  1WP8 A;  3KCX A;  2DMX A;  1VQ5 V;  3ZBH A;  1CEZ A;  1XMO O;  4AQY O;  4X1Y B;  4FK5 C;  2F4V O;  3SJA C;  3E35 A;  4DV1 B;  4OPA A;  4JI8 O;  3E2E A;  5LOV B;  2VS0 A;  5D5Q A;  4O4I B;  1KQS U;  4DW1 A;  2W0X A;  2EZP A;  1N34 O;  5L3E A;  4GX5 A;  4IGG A;  5JJN B;  1N32 O;  1PP9 H;  2JEX A;  1YXB A;  4X62 B;  1WPB A;  1RPO A;  1SZT A;  5H5N A;  2HKO A;  4X62 O;  2IW5 A;  5C8Y B;  5CBG A;  4LFB B;  2ETN A;  1LR1 A;  3KCY A;  1ROP A;  3CRM A;  1S3J A;  1L1F A;  2IM9 A;  2NR5 A;  3F5W C;  2PUS A;  2HHH O;  4X1I A;  4HNA A;  4W4L A;  1XMQ O;  3AG4 B;  1DLB A;  1GM9 A;  4MVO A;  4O2A B;  1PV0 A;  1HR0 B;  3G71 V;  1MSD A;  3TXS A;  4RUF A;  1Y67 A;  1YI2 V;  2ZDI C;  3AG7 A;  2CK3 G;  4I0X B;  4PV1 B;  1NBM G;  4MW8 A;  1YJW V;  4AQY B;  4JI3 B;  2YXY A;  2HVK C;  1XL4 A;  1WA8 B;  4R50 A;  3JAR A;  3BFR A;  3OM3 B;  1F4M A;  4WBN B;  3ASN C;  1Q81 W;  3BAA A;  1KUQ A;  1TUB A;  2ZT9 B;  4JPR A;  1JOY A;  3RVZ A;  4KUM A;  4JTD B;  1X4T A;  2WWW A;  3CCM V;  4EFB A;  4P9P A;  1PPJ H;  3RT3 C;  1UFI A;  4CH4 A;  4CH6 A;  3Q4H B;  4EFE A;  4UVB A;  2ZXW C;  4QE9 A;  3TXQ A;  1K4C C;  1XUQ A;  1JPX A;  1J5E O;  2WAM A;  3TCU A;  1JCH A;  2QKS A;  1TUB B;  2UUA O;  4DR5 B;  2H94 A;  1YZB A;  4I7Z B;  1Y74 A;  4MTF A;  4DRX A;  2BTO A;  3HPL C;  4D7S A;  1R6T A;  5CMU A;  5LL6 Y;  4NTW A;  5B1B B;  4X89 A;  4PEL A;  3D36 C;  1YJN V;  2QDO A;  5GTH Z;  2OT5 A;  2ZM6 O;  1XNR O;  3CSX A;  4WFB V;  4LF4 B;  1THZ A;  4BIU A;  2HG5 C;  1KU9 A;  4OXS A;  1KB9 F;  5C8Y A;  1OCR C;  3L72 H;  3M7M X;  1BZK A;  1L8D A;  2QE7 G;  5L3F A;  3ZN1 A;  3T4Z A;  1B3Q A;  1MNG A;  5EIB C;  1DTO A;  1VF7 A;  3QO5 A;  2N74 A;  1G4Y B;  3CS5 A;  3IJ4 A;  5BMV A;  2XOK G;  1FPO A;  2FML A;  5E79 Z;  4B7E A;  5ITZ B;  3NR7 A;  3RYH B;  5LHI A;  5FPO A;  4FMT A;  4MTG A;  1XMO B;  4BAY A;  2P90 A;  1VQM V;  2F43 G;  4EB6 B;  4DV2 O;  2JIZ G;  2PYJ A;  1L0N H;  4ASU G;  1RM1 C;  1S77 D;  4ZI7 B;  2Q69 A;  1SA0 A;  3L75 H;  3QTC A;  2F4V B;  2JEU A;  4K8X A;  2MW2 B;  5IYB O;  3K0D A;  1GM8 A;  4X64 O;  5AG2 A;  4JAV A;  3CYO A;  3ZMV A;  1CPY A;  4LF9 O;  1FFX B;  1P84 F;  3IC9 A;  4X9Q A;  2WLL B;  3ZHR A;  1H2K A;  1IBK B;  5B3S B;  3H01 A;  4ZBM A;  3ETE A;  4DR3 B;  1OCO C;  4FLT A;  4U7N A;  1QHT A;  4OX9 O;  2XAF A;  2XHB A;  2E3C A;  3LDE A;  4G28 B;  1L0L H;  4R6Z A;  4GX0 A;  4UUJ C;  1PM9 A;  2ARH A;  3H1L H;  3B2E E;  4UFZ A;  2WLM A;  5JH7 B;  3DTU B;  2JRI A;  2XND G;  2CAZ C;  4UCT A;  4O4J B;  1K3E A;  4RUE A;  5A9G A;  3JYC A;  3ZCC A;  1Q3E A;  1AIL A;  2GV9 A;  2RJZ A;  2EIJ C;  5IYZ A;  1NH2 B;  1IXB A;  3OTO O;  3U11 A;  5B5E Z;  5CBF A;  4LBE C;  3AG1 B;  4JI0 O;  2ZNJ A;  4NTY A;  2X6C A;  4NXM B;  4DRX B;  3UM7 A;  2N05 A;  4ICG A;  1TVK A;  5E1A C;  4YJ2 A;  1WB8 A;  4FZ1 A;  1SQG A;  4XDJ A;  1N36 B;  1OV9 A;  3I5D A;  2VWJ A;  3JSL A;  1HWY A;  1GN2 A;  4AIL C;  2Z3Y A;  4O2A A;  5B66 Z;  3AG3 C;  5CA1 A;  1R3I C;  1K8A W;  4X66 O;  4G2K A;  1HNX O;  1AI4 A;  2ODM A;  3CC4 V;  4LF5 O;  4TV9 B;  5TIS Z;  3BRC A;  4JI0 B;  4NR1 A;  3FAV A;  1N0J A;  1LUW A;  1XEQ A;  5JH7 A;  1NS1 A; 
#chains in the Genus database with same CATH homology
 4X64 O;  4LF8 O;  1FJG O;  4JI3 O;  4LF9 O;  2UUA O;  1FKA O;  4LFB O;  4DV5 O;  3O65 A;  5IWA O;  1YZB A;  1XMO O;  4AQY O;  4LF6 O;  4GKJ O;  2F4V O;  1FYJ A;  2UUB O;  2UXB O;  2E5L O;  4DV4 O;  4NXM O;  4OPA A;  4JI4 O;  4JI8 O;  4DV1 O;  4OX9 O;  2ZKO A;  4X65 O;  1R6T A;  1G1X B;  5LL6 Y;  1HNW O;  5BY1 A;  5IT9 N;  5FLX N;  2DJV A;  1I94 O;  3T1H O;  4JI5 O;  1N36 O;  1N34 O;  2UUC O;  5LMU O;  2JRI A;  4JYA O;  2UU9 O;  1N32 O;  2ZM6 O;  1XNR O;  4LFA O;  2UXC O;  4B3M O;  4DR4 O;  4DR1 O;  5H5N A;  4YY3 O;  3T1Y O;  4X62 O;  1AB3 A;  4DV3 O;  4JV5 O;  4DR2 O;  4K0K O;  4DV6 O;  1AIL A;  3F5T A;  1A32 A;  4A5U B;  4DR3 O;  1HNZ O;  3OTO O;  3J7A U;  1R1B A;  4JI0 O;  2HHH O;  2N74 A;  4YHH O;  1XMQ O;  4LFC O;  4NXN O;  3SDL A;  1DK1 A;  1IBL O;  2LW7 A;  2VQE O;  3M8A A;  4DR7 O;  3R66 A;  4DV7 O;  1N33 O;  2Z0A A;  4OPH A;  1IBK O;  4B3T O;  5BR8 O;  4JI7 O;  5LMN O;  2AGA A;  4DR5 O;  4LF7 O;  4LF4 O;  4DUZ O;  4JI2 O;  4B3S O;  1XNQ O;  2UXD O;  3JAM N;  4DV2 O;  1D2D A;  1KUQ A;  4DV0 O;  4JI6 O;  4B3R O;  5BXZ A;  5A2Q N;  4KHP O;  4DUY O;  2VQF O;  3J80 N;  4GKK O;  4X66 O;  1HNX O;  4DR6 O;  2DOS A;  1X59 A;  3RT3 C;  4LF5 O;  1F7Y A;  2FKX A;  1HR0 O;  3J81 N;  1XEQ A;  1IBM O;  4JI1 O;  1NS1 A;  1J5E O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...