2UU9O

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uu9O00
4DR6O 4DV3O 2Z0AA 2F4VO 1AB3A 4OPAA 1N33O 3O65A 1R6TA 4JV5O 2JRIA 4B3SO 3J80N 5IWAO 2AGAA 2HHHO 1N32O 4YHHO 1HNXO 1HNWO 1G1XB 4LF9O 1XMOO 3JAMN 2LW7A 4JYAO 4B3TO 4DR1O 4X62O 2ZM6O 2UUAO 4JI6O 5H5NA 4K0KO 4NXMO 1XEQA 2ZKOA 2DOSA 4DV4O 4LF7O 1A32A 1AILA 4DUZO 4NXNO 5BR8O 4JI0O 4DR7O 4LF8O 1XNQO 4LF5O 4JI3O 5IT9N 3F5TA 4AQYO 4JI5O 4X65O 1R1BA 4GKKO 4DV7O 1N34O 4DR4O 3R66A 4OPHA 1FKAO 4LF6O 4LFBO 4JI2O 4B3MO 1NS1A 3M8AA 1F7YA 4LFCO 1N36O 3J81N 4GKJO 4JI8O 1X59A 2N74A 2UXBO 1IBLO 4JI4O 5LMUO 4DV1O 2VQFO 4JI1O 3T1HO 4OX9O 2UU9O 4DV2O 1IBMO 4LFAO 3T1YO 1YZBA 2DJVA 1FYJA 5LMNO 1J5EO 1I94O 5LL6Y 4DUYO 2UXCO 4DR5O 3RT3C 5FLXN 1HR0O 4DV6O 4DV0O 2UUCO 1KUQA 2VQEO 4X66O 5BXZA 1XNRO 2UXDO 4DR2O 5BY1A 4JI7O 5A2QN 4B3RO 4LF4O 4X64O 1HNZO 1D2DA 2FKXA 4DR3O 3J7AU 3SDLA 2UUBO 4DV5O 3OTOO 4KHPO 2E5LO 4YY3O 1XMQO 1FJGO 1IBKO 1DK1A 4A5UB
chains in the Genus database with same CATH superfamily
4DV1B 2CTWA 1P49A 5IJ9B 2OCHA 3O65A 4RQFA 1I5XA 5LYJA 3N2GA 4GCZA 5B1AB 1MOFA 2JEUA 1RM1B 4QE7A 1HNWO 3ZJZA 4OGQB 3CCSV 2ZXWC 1MZFA 4FFKA 1RSOB 1M90W 2QSAA 4XDJA 2B5UA 4Q6GA 4L87A 3WFVA 1EN5A 4RUFA 2ZR2A 4PDVA 2UUAO 5H5NA 3FKSG 3CMEV 1QBZA 3JCZA 2XT9A 3BHPA 2ZKOA 1XUQA 4NVPA 1N33B 2YXYA 3ABKC 5BR8O 4KL1A 4B3SB 4FVMA 3M99B 5JJNB 2OTLV 2XHBA 5BMVB 2PI5A 1GMGA 1I08A 1SERA 5IT9N 3UCSC 1WPBA 2DYRC 4GKKO 3RVYA 3ZMVA 2GSMB 3SJQC 1K7DA 3OR6C 4FK5C 3VBBA 3T1HO 1F23A 2A7WA 3CRAA 4O4LA 3ABMC 3DTUB 2DN9A 4I9QA 1XNQB 1Q6UA 4MVUA 1YTFB 5CBHA 4P2ZA 5L3BA 3ASOC 4WFHA 3HKEA 4NTYA 3ETGA 5EZYA 4CH5A 4DV0B 4B3RO 3JATB 5GONB 2N04A 2WLLB 1SA0A 3F5WC 4Z2WA 1D2DA 1M56B 1SZXA 3ZN1A 2CTQA 2OCCB 3J7AU 3OR7C 3ZHRA 4H44B 3H9VA 3UT5B 2Y0PA 2YI8A 3L9DA 3JD2A 4TV9B 1TVKA 4BIZA 4JV5O 4KP4A 4DR5B 1FPOA 3QO5A 2OYQA 4F6RB 2W0FC 3K5MA 3H1IH 5B1BC 1GN2A 5L3DA 3TGUH 1V54B 5E79Z 2HHHB 4PD4F 3A0HZ 3ABUA 5FPRA 1YCIA 1S72V 2QKCA 2ZM6O 4G2KA 2QM7A 2IU0A 4DW1A 3RWRD 4O2BB 1VF6A 5DEDA 1DF5A 1Y74A 3JAWB 3E2EA 1XOUA 4LF8O 1H2NA 4NXMB 3AG3C 3E89A 3SPHA 2ETNA 1JMKC 3D3IA 3G71V 4DYLA 5CB4A 2B1GA 1VQPV 2GV9A 1QNMA 1KB9F 3E8FA 4P9OA 3KG2A 4FLTA 5K1XA 2ZCEA 4W4KA 4GKJO 4J42A 2CTPA 3IAYA 1XBLA 2AHYA 2GDSA 3L70H 1KC8W 2AHZA 4JAVA 1GRJA 4CS2A 1AR4A 2Q68A 1IBMO 4JF3A 5LYJB 4EFEA 3N2GB 5GTHZ 4GX1A 1Q82W 5B1NA 3IC9A 2RMKB 2KG7B 2B9ZA 3K5OA 4GZRB 1L1FA 3FYEB 4HNAA 4GT1A 4QPJA 1MSWD 1ZUQA 2R70A 4FFBA 3CWBH 3C3SA 2EX3A 4O4JB 1AJPA 1OCOB 4KXRA 3RYCA 5D5QA 1DK1A 4J11A 4BW9A 2GUZA 3IJ4A 1OCZB 4F4LA 2F4VO 2UU9B 2NN4A 2M6YA 3K3WA 1EBOA 2RDCA 5L3FA 2RN9A 2EIKC 2ZE8A 1NR1A 4DV6B 2HJDA 3AK1A 3ZRSA 2CK3G 2R9RB 2Q4PA 3WG7C 4X89A 3CCQV 1XMOO 4GUNA 1R3LC 3ZMUA 5LXTA 3K58A 4J7KA 3CRMA 2BOBC 3CCJV 3ZEDA 2BTOA 4JTAB 4O4LB 2G38A 3HKCA 1K4DC 2JDIG 3G80A 4FIPC 1QR9A 2W6IG 2YIBD 3HKEB 2YXHA 5KHHA 3DXRA 5EZYB 4UVCA 1YI2V 1SRYA 3TXQA 2ZE7A 1SA0B 4BW5A 2ZDIA 1JA8A 1NS1A 4WCEV 2HR3A 3J81N 2IJKA 1KYOF 4JI8O 4DK0A 3X2QB 3OTFA 2EULA 2YI9A 4X62B 1NTZH 1QHTA 1SC5B 3OMAB 2D2CB 3W7TA 1TVKB 3D36A 2VWJA 1YF2A 2LFSA 4LFAO 3FB7C 1FYJA 2QWNB 3B2EE 5LL6Y 4DUYO 1GM9A 4DUZB 3CRCA 2IJHA 3ZMZA 5BZBA 2EBOA 4IGGA 4JAAA 2ZIMA 2P22C 3THOA 3CPWU 2DYSC 3WB2A 1G8MA 3SJAC 2WLJA 2CAZC 3K0GA 4WBNA 1ZLZA 2E5LO 2HG5C 5CA3A 5LP6C 4A5UB 5LMUB 1Y74B 1KP3A 1R6NA 3L75H 2LJ2A 4WFGA 3SYAA 4PJ0Z 3HKDA 4J41A 3MD0A 5B5EZ 4CH6A 2ITCC 4I55A 2DWEC 5CB4B 4O4IA 5IYDO 1QQCA 1XQ8A 5D5PA 4G27B 3AG1C 4R6ZA 1IBKB 4MTFA 2FB5A 4K0KO 1XEQA 2DOSA 4FPPA 4DV4O 4Z1MG 1VF7A 1F51A 4HNAB 4F6EA 4JI5O 1RFYA 2RJZA 5CBGA 4MVMA 1OCRC 1S5LZ 4DR4O 4FFBB 4B3MO 1K8AW 1PNKA 3ZS8C 3P32A 3RYCB 4R7CA 4JYAB 2ATKC 3JD4A 2YC0A 1D5NA 2GUZB 4U7NA 3SJBC 4YJ3A 3LSSA 2ZNJA 3RBZA 1XHXA 3CP1A 1YZBA 1TUBA 3K06A 4LR3A 2V1DA 3D8CA 1ZX3A 3VQYA 2PGGA 4QPKA 3SPGA 5KAFZ 1H2KA 1QU7A 3OGIB 1OCCB 4MVOA 1BQZA 4YXWG 4DW0A 1L8DA 5LXTB 4LF6B 3AG2B 3SPIA 5K1PA 1IVSA 4I9WA 4PA4A 2Q73A 1H8EG 1B6QA 2F95B 1AR5A 1VQ5V 2ODMA 5J2TA 3FX7A 1M5IA 1VEWA 4DR3B 3ZRWA 1H38A 2Z0AA 4X1IA 5H6QA 2LW1A 1SQPH 2HJFC 1THZA 3K59A 4JYYA 4BIUA 2UXCB 2KB1A 5B1AC 4JZGA 3UKMA 1N32O 3CCVV 1XNRB 3N2KA 4DR2B 1RM1C 1FXVA 4I4TA 4UFZA 3JAMN 1HNXB 1H8HG 2A0LA 3GVMA 1CXZB 5IJ0A 4N23A 2GTAA 5KUMA 4DR6B 2F93B 1KD1W 4UV9A 4JGSA 4P9PA 4X20A 4XBFA 3ICXA 2XASA 3K79A 3OUSA 1B3QA 1AI4A 1EN4A 2JJ2G 4LF5O 1IX9A 4AQYO 2XAHA 1YDXA 3CRRA 2LO1A 4I7ZB 3ZMSA 4LC1A 4OPHA 4GX2A 4WBNB 1NH2B 1F4NA 4CS3A 1QCEA 5FL7G 5HFMA 1G6UA 2KQXA 1SF9A 2Q6AA 4DV1O 3HKDB 1WN7A 1FXKA 1EZVH 3JSLA 4I55B 5KHKA 3K5NA 4O4IB 2E74B 1T5EA 1YITV 1VQ6V 3UQ8A 2ZR3A 4OX9B 4I5SA 3CE2A 2Y69B 3ZCCA 2XAJA 4UUJC 5L3GA 3K5LA 3OE7G 4CZZA 4UVBA 3P3NA 4DV7B 1US6A 3STLC 2D3OW 4XDLA 2X6AA 2KSDA 3M7MX 4LFCB 2JK5C 2UXNA 3FYIB 1GK9A 1M56C 3ETEA 4J80A 2OCCC 3OTOO 2QM4A 3ZHTA 4GX0A 3SPCA 4I0XA 5CA1A 1N33O 3OM3B 1NVPD 3JD1A 1R6TA 4HYOA 4B3SO 3TJTA 1K9MW 1ZAUA 1SESA 3SYOA 1DF4A 2L35A 3RYFA 1MZEA 3CCMV 3C3TA 4DRXA 4NKGB 2Y0IA 2AXTZ 4TV8A 4YJ3B 4B7KA 1HDJA 2Q67A 1TUBB 1NTKH 2ZINA 5HFLA 4BIOA 1FFXA 4JAUA 1KP2A 1XNQO 5EIBC 3HB3B 3BPZA 1JOYA 3I5DA 2IU3A 3VQXA 2EIJC 3ZRVA 2ILMA 3JAKB 5F2VO 2KKWA 1NJIW 2LGQA 1S0VA 3E83A 2F66C 4FM2A 1VP7A 1K5SA 2H8PC 1PV0A 1TGOA 3ZRWB 1VQ9V 4X1IB 4EKWA 2EINB 1MA1A 2PZSA 2C2AA 1YJNV 4AILC 1YTFD 3LNMB 5IYCO 4DR5O 3RFRA 5FLXN 2QKAA 2Y48A 3N2KB 2PTMA 1VQNV 4W4LA 1PL0A 3BA9A 3JYCA 4I4TB 4JI7O 2UUCB 4UB8Z 4LFBB 3JALA 3EVKA 2ARHA 1K34A 5IJ0B 1OCOC 4YY3O 4YIOA 5LOVB 1ZSPA 2YEVA 1OCZC 3K0DA 4X20B 4IT5A 2EILB 1AB3A 4DK1A 4DV2B 4PDRA 3SGIA 1R3IC 1Q86W 1N0NA 3B4SA 4QGPA 4O4HB 5LMNB 3PN1A 3CS5A 4NYKA 5EBWC 3ZBHA 2BE3A 4WFBV 2IJIA 2Q8VA 3U10A 5LGTA 2M7WA 4X66B 4CBCA 3OEHG 4YHHO 1SQBH 4X8AA 4NR1A 1FAFA 4LF9O 3LSQA 2EZPA 4LF4B 1JPXA 1TAEA 5JQGA 4ZOLB 3H1KH 4CS4A 2LW7A 1HNWB 3QVNA 1NU1H 4DV5B 1UJWB 1JR9A 5KLVH 4DR1O 1KECA 5JWPA 1J95A 2GHYA 5ITZA 3N27A 2HVKC 2CDYA 4JASA 1Q5OA 3JARB 3EXAA 5EIBD 2DWDC 1H2GA 3A2FA 1QLEB 1SKVA 5CBFA 1CPYA 2PI4A 1N34O 3OGCC 3T2MA 4K35A 1Y4MA 1F7YA 3FD9A 3LDEA 4C7UA 4GKKB 2YIBA 4FLUA 1ZL8A 4FM0A 3X2QC 4I0XB 2YXLA 5CA1B 1H2SB 3AK3A 2UU9O 4MW3A 4RO2A 5KAIZ 3AG4B 3K9AA 1AP5A 4PV1B 1WB7A 4NXNB 1U97A 4DV6O 3RYFB 2W0XA 1E1QG 3OW2U 1Q90D 5KMGA 4DRXB 1TA8A 1KKCA 3FB5C 4TV8B 1N36B 5EK0A 3ML0A 4YJ2A 5H6RA 4B3RB 4PI0A 3FB6C 1SZTA 1VF6C 2QWRB 1FFXB 2HVJC 2F1MA 2Q5ZA 3BA8A 4FLYA 2XAFA 3ZHSA 5L3CA 2IJJA 3AEIA 4FLWA 1DGSA 2ZNIA 5B3SC 2P7TC 3W7XA 1N4CA 2BOCC 2NLJC 3KKYA 2DYRB 4QJFB 1XILA 2W6JG 1LUVA 2EJ7A 4X62O 2QA4V 4I50A 2OTJV 4UB6Z 3ZX6A 4DV3B 2Q7EA 2ZM6B 3B40A 4DUZO 3ABMB 2K1EA 1BHBA 4EB6A 4PHZA 1XREA 3HR0A 1OHHG 2B1IA 2ZT9B 1Y66A 3CXHF 1X59A 2GBOA 1YVWA 1BHAA 4PA9A 1GM8A 5E1AC 2YEVB 5LMUO 4GKJB 4MVZA 2IH1C 4E4EA 3ABLB 1S5JA 2EIMB 4JI0B 3CC7V 2PYJA 2VQEO 3GWKC 4K3AA 1P84F 4B7EA 1AJQA 2OT5A 1YJWV 2QM8A 3AG2C 3H1HH 5ITZB 1L0LH 1B04A 2UXBB 1LUWA 1IBKO 1Y76A 3RGBA 3E8BA 4JI1B 5GW7A 3T4ZA 2LP7A 2L6LA 3CHXA 1JFFA 5KUKA 2QWPB 1M57B 2CTRA 1I94B 4IYIA 1R73A 2AGAA 4FZ0A 1DTOA 4ZBMA 3ZHVA 2F43G 1K3EA 2ZDIC 3KCXA 4D7SA 3ASNB 5KA6A 1N0JA 4BAYA 2E75B 1D5AA 1Z2GA 4X64B 1HNZB 4D7TA 1PM9A 4JYAO 2A06H 1FJGB 1XMQB 2N05A 3WU2Z 1RP3B 1MG1A 1WPXA 1Y67A 1BSMA 4O2AA 1VQMV 1W0JG 3UO2A 1TUEB 3FAVA 5IWAB 5KMGB 5IYZA 2X6BA 4ZKIA 1JVMA 4MT8A 4AI8A 5JCOA 4LF6O 1S76D 1XL6A 1YHQV 3ABTA 4YJ2B 3M8AA 3CXCU 2VWKA 2WLMA 1IXMA 3K9SA 4B08A 4KFMA 1W2BU 3LDCA 4J10A 4B3TB 3O9OA 1K4CC 4JI4O 1Q43A 3Q4HA 1GKFA 4LP8A 1VQOV 1BZKA 2YIAA 4XDKA 3OMNB 3BAAA 4K8ZA 1J5EO 2UXCO 2P06A 3TCUA 5JJEB 4J9ZB 2Y69C 4DO2A 2UXDO 1XNRO 4DR2O 3LUTB 3CJHA 1S3JA 1QVFU 1VQ4V 3G6BA 3UO3A 2F23A 1R3KC 4PA3A 2PUSA 2FKXA 1VIBA 2WWWA 4I50B 3B77A 1Q6HA 4MVSA 2IM9A 3S3WA 4RUEA 2RQ6A 3K04A 4UCVA 2HP8A 2BSKA 2MW2B 4PDMA 1I7FA 3DSQA 4DR6O 2PYLA 1K73W 2XUMA 3TK1A 4EB6B 2XAGA 4X88A 3W7WA 1IXBA 3BCCH 3U11A 3DC5A 3DC6A 5LGNA 3DGEA 3HKCB 1ROPA 4IIJA 2JS5A 1M4UA 1JQ0A 2PF4E 4KHPB 5DM6V 3G6EV 3DXRB 4JTDB 5KX5A 4L8JA 2H3OA 1YXBA 2DQ3A 1A32A 3LDDA 5KHGA 2OIGA 2ZE6A 5LHGA 3E22A 3RW0A 3JSNA 4TSFG 4DV4B 1NH2D 4DV7O 3R66A 4X9QA 2JS3A 4LFCO 2GTSA 4JTCB 2IBZH 2MK3A 1Y76B 3BABA 3ETDA 1EN6A 3JCUZ 1QR8A 4N21A 4JI6B 4ZHQA 2LFRA 1JFFB 2Z3YA 3ZRXA 5EBLC 3RYIA 1Z5VA 1BS3A 3OAAG 2FMLA 4LF7B 5A9GA 2P5OA 1GM7A 4E2LA 4DR7B 3T1CA 3ETQA 2CH7A 3B8MA 2WPDG 4X65B 5A2QN 5FPOA 4H0LB 4JI2B 4UVAA 3CB2A 3I55V 2QDOA 2WAMA 1V55B 1VARA 2P6JA 4O2AB 3TETA 2EILC 3FAVB 4Q20A 3T1YB 3RN4A 1YIJV 1Y6XA 5IYZB 1IZ3A 1KBHA 1HR0B 2E76B 1S77D 2CGOA 3CCRV 1G1XB 1CP9A 4CC5A 3OT7A 5B66Z 4GX5A 1YEWA 1N32B 1Q7YW 2XTAA 1P7BA 3LSUA 3QTCA 3Q4HB 4F6RA 1VQKV 4U3FH 4PELA 4NB5A 4HZ3A 3OUFA 2BCCH 1IURA 1HW7A 1AILA 1K92A 2Q9LA 3CJHB 2YIDA 1QLEC 2DE0X 5KA5A 1V54C 1R1BA 1HWYA 3F7VC 1GO3F 3AK2A 4LFBO 1FKAO 4JYCA 4NTWA 2P90A 2BSKB 4UCSA 1BT8A 1NQTA 4QE9A 4TQDA 2IW5A 4KUMA 1YJ9V 1L0NH 3IC7A 4DV2O 4MTXA 1SQVH 1XDCA 3AG4C 5LMNO 3TXSA 2P67A 4PA6A 1W59A 4DV0O 3NXSA 5IY5B 4LH7A 4X66O 4UXNA 4JI3B 3QG5A 1WP7A 1GTOA 2QR4A 4X1KA 3ZMTA 1NVPB 4BR6A 3WB1A 4GYCB 4IIJB 3CRQA 5J2TB 4LF4O 3CYOA 2JVDA 1F4MA 2KG7A 1Q8IA 3SDLA 4DV5O 2Q7GA 2JGDA 1IBLB 5KX5B 2OWOA 2WLIA 2VQFB 2R72A 3OTOB 2JEXA 1WB8A 4LNUA 3E35A 2XNDG 4O4JA 3E22B 3LNNA 2R9AA 1KU9A 2P4KA 4MVQA 4TT3G 1PP9H 3I56V 2HHHO 1VMGA 1QLNA 4ZIBA 1E79G 4CH4A 4RWUA 3ZHUA 1ENVA 2UUBB 1B06A 3A8TA 4ZHQB 1NT2B 4FMTA 1P7GA 1K97A 1G4YB 1PPJH 4NXMO 3RYIB 1BQ0A 3T4DA 2WLKA 4NXNO 3L72H 2ZE5A 2CH7B 5AG2A 1H2MA 1GH6A 3L71H 3W7SA 3W7UA 1FS0G 2V7QG 5TISZ 2WA4A 1FXKB 3E8GA 1N36O 4UCUA 3FFQA 4WF9V 1I5YA 4H33A 3IFXA 2UUAB 4TUYA 2HKOA 2YUAA 1XHZA 2X6CA 4UCOA 1RPOA 3CX5F 3S3XA 3CMAV 3K08A 4TWKA 2FL4A 3ABLC 1HP8A 1OZ0A 3RVZA 5LGUA 5BR8B 2EIMC 2HEPA 3OFNG 4IHJA 1GN6A 1DLBA 5BY1A 2QWQB 1VF5B 5IYBO 1PD3A 4CC6A 1SQQH 2NR5A 1MABG 1MNGA 4JI7B 5FNVA 3EHBB 1M9NA 3QO8A 2O57A 1NI8A 2CE4A 1EZJA 4DV3O 3T1HB 4OPAA 5C8YA 2A3QA 4YY3B 4HAMA 3H1LH 3MHSC 4ZI7A 3CD6V 1Q3EA 1M57C 1W0KG 2XOKG 2XAQA 2YSUB 4TOIA 2ZXWB 1OJHA 2QE7G 1NR7A 3ASNC 5LHIA 5JVDA 3CCUV 2EIJB 2YDEA 3R65A 4YHHB 4RQEA 1AI7A 1SQGA 4LF9B 3BEHA 5DECA 2QWOB 4HBNA 3IGAC 3SR2C 1N8RW 4R50A 2ZQMA 4DR1B 1GN4A 2LGWA 2NNUA 3CSXA 3ABKB 1YSCA 1WAZA 4JI0O 4JV5B 4X1KB 3F5TA 1H2LA 2R9IA 3CCEV 2LQTA 4J7JA 2UXXA 4G28B 3UM7A 1M93A 1ORQC 3QF7A 5H9CA 2JGDB 3ZN0A 1PNLA 1UFIA 1XI1A 4ASUG 1OV9A 1N34B 2UXBO 2WLIB 1R3JC 4WFEA 4LH6A 4LNUB 4JI1O 5KHIA 3STZC 1FFTB 2ADPA 3P30A 4WFFA 1AI6A 4ICGA 5B1OA 2VRZA 3HPLC 3G4SV 1I94O 2WSSG 5JH7A 2Y4UA 2BTQA 4UCRA 4LF8B 3JALB 2Q0OC 5IDJA 1KUQA 2RCVA 3ASOB 1Q81W 1AJNA 1M1KW 2A79B 1Z5WA 3RYHA 1RPRA 4X64O 1HNZO 5LBQA 5LHHA 4U3JA 3BFRA 4Z1VA 1LR1A 1NBMG 1K33A 1FJGO 1XMQO 3L74H 1SS3A 2JGUA 4LWSA 1S5HC 5C93A 2QJ1A 5J2UA 1IBMB 1PL4A 3HKBA 2JRIA 1OCCC 1MSDA 1NKDA 3J80N 5IWAO 5JQGB 1WP8A 1JJOA 2VS0A 1LNQA 5CA0A 5CN0A 5B1BB 3SJCC 3APQA 1P4RA 1MMMA 5LA6A 4B3TO 4TUYB 2JIZG 1SQXH 2HLDG 3SYCA 4U7OA 2ZIOA 5LP6A 1PKXA 2F4VB 2X0LA 1IDSA 4ABMA 2ITDC 3VQVA 2EZOA 4IHJB 3AG3B 4FLXA 1ZL8B 2A9HA 3FB8C 1FXHA 1URFA 4J9YB 2YICA 4TQFA 3D36C 1XMOB 5FNVB 1WLEA 2CGNA 1U96A 3C90A 3VOUA 4MS2A 2QTOA 1BGYH 3APOA 3BVOA 4X1YA 5C8YB 1KMIZ 5KHJA 5EYPA 4ZI7B 4UCTA 2V4DA 1EFRG 3WB0A 1JJ2U 1WNSA 3K03A 3EFFK 5BXZA 3JASA 1SQFA 1BMFG 4LBEC 5JVDB 1KKDA 5IE9A 4H37A 5B3SB 1JX9A 2VQEB 1WA8A 1V9PA 1Q6IA 2RNBA 4DR3O 1X4TA 4BWAA 4EEQA 4JI8B 1GN3A 3G67A 3QNEA 3P3PA 3K57A 3CC4V 4KHPO 1BE3H 1V55C 5EC1C 2IH3C 3GB7C 3AG7A 1PNMA 4AHCA 4MTOA 4QNHB 4LFAB 2JJ1G 2QKSA 2EIKB 4FJCC 5DN6G 4NTXA 4DUYB 2OIEA 1ZWIC 3JD3A 5JCOC 1GAXA 3OMIB 2AZ0A 1HNXO 3WG7B 3A0BZ 1BCCH 5GTIZ 2Q69A 2H94A 4MVRA 1COWG 4FLZA 1AP6A 2E5LB 3H1JH 2PY5A 4JI6O 3BRCA 3A0RA 5EBMC 2DMXA 2WA3A 5JH7B 2BTQB 4QIWF 4LF7O 4H13B 5IJ9A 4DR7O 1E1RG 3JD0A 3F7YC 2DQ0A 4IL6Z 5CMUA 4X65O 4GLXA 3RYHB 4JI2O 1EM1A 4U3JB 2P4VA 4EFBA 5H2FZ 1RSOA 4WFAV 2QGNA 1AR1B 4FM1A 3JAKA 4LWSB 4OXSA 1XL4A 5J2UB 2K9PA 4LCUC 4OX9O 4K0KB 4JYBA 1WJZA 3HKBB 3NR7A 3CCLV 3T1YO 5JJJB 4JI4B 2QEXV 3E8HA 3CC2V 2AW9A 3RT3C 1HR0O 1NTMH 5L3EA 5CA0B 5IY5C 1ZTEA 4JI5B 1J5EB 5BMVA 2DYSB 1NZ6A 4DR4B 4B3MB 1QVGU 2UXDB 5LA6B 4P30A 3SYPA 2Q7HA 4PA7A 3GWOA 2EINC 1JCHA 5LP6B 4UV8A 5J9PC 1I0HA 4JPRA 4J7ZA 2HFEC 1O9GA 1FD9A 2Y4TA 3PJSK 4YIPA 2DW4A 5LOVA 3ZIAG 1O9HA 5EC2C 4CH3A 2WLNA 2E3CA 3B8NA 2Q0AA 4D6TH 2AZ2A 2ZD9A 3SYQA 4O4HA 2FTKA 3VQWA 4FZ1A 4PI2A 1K5QA 3JATA 3KZIZ 3AG1B 2WLHA 5GONA 4MSWC 2WLLA 2YS8A 4X1YB 1VQ8V 4PDLA 2FYUH 1BL8A 5EYPB 4MTGA 1VQLV 4ZOLA 4IYHA 3UT5A 2QTSA 3CEIA 4TV9A 3JASB 4FLVA 1KQSU 4JI3O 3E86A 3JARA 2Z5UA 1OCRB 1WA8B 2ADQB 1AVMA 3SPJA 1CEZA 1FXKC 4MW8A 2N74A 1SETA 3U0ZA 1IBLO 2VQFO 4R8CA 3MAQA 2DJVA 3MHHC 3D3QA 4O2BA 3B09A 1UPGA 4RAIA 2EJRA 4DXWA 3MDSA 3JAWA 2UUCO 4LF5B 4K8XA 3L73H 4AQYB 3H01A 3BY6A 3OEEG 3OD4A 2CUGA 3ZHQA 1R6KA 2X7RB 1AI5A 2UUBO 3KCYA 1AROP 1VQ7V 4JZ2A 3QO7A
chains in the Genus database with same CATH topology
4DR6O 4DV3O 2Z0AA 2F4VO 1AB3A 4OPAA 1N33O 3O65A 1R6TA 4JV5O 2JRIA 4B3SO 3J80N 5IWAO 2AGAA 2HHHO 1N32O 4YHHO 1HNXO 1HNWO 1G1XB 4LF9O 1XMOO 3JAMN 2LW7A 4JYAO 4B3TO 4DR1O 4X62O 2ZM6O 2UUAO 4JI6O 5H5NA 4K0KO 4NXMO 1XEQA 2ZKOA 2DOSA 4DV4O 4LF7O 1A32A 1AILA 4DUZO 4NXNO 5BR8O 4JI0O 4DR7O 4LF8O 1XNQO 4LF5O 4JI3O 5IT9N 3F5TA 4AQYO 4JI5O 4X65O 1R1BA 4GKKO 4DV7O 1N34O 4DR4O 3R66A 4OPHA 1FKAO 4LF6O 4LFBO 4JI2O 4B3MO 1NS1A 3M8AA 1F7YA 4LFCO 1N36O 3J81N 4GKJO 4JI8O 1X59A 2N74A 2UXBO 1IBLO 4JI4O 5LMUO 4DV1O 2VQFO 4JI1O 3T1HO 4OX9O 2UU9O 4DV2O 1IBMO 4LFAO 3T1YO 1YZBA 2DJVA 1FYJA 5LMNO 1J5EO 1I94O 5LL6Y 4DUYO 2UXCO 4DR5O 3RT3C 5FLXN 1HR0O 4DV6O 4DV0O 2UUCO 1KUQA 2VQEO 4X66O 5BXZA 1XNRO 2UXDO 4DR2O 5BY1A 4JI7O 5A2QN 4B3RO 4LF4O 4X64O 1HNZO 1D2DA 2FKXA 4DR3O 3J7AU 3SDLA 2UUBO 4DV5O 3OTOO 4KHPO 2E5LO 4YY3O 1XMQO 1FJGO 1IBKO 1DK1A 4A5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 O;  4DV3 O;  2Z0A A;  2F4V O;  1AB3 A;  4OPA A;  1N33 O;  3O65 A;  1R6T A;  4JV5 O;  2JRI A;  4B3S O;  3J80 N;  5IWA O;  2AGA A;  2HHH O;  1N32 O;  4YHH O;  1HNX O;  1HNW O;  1G1X B;  4LF9 O;  1XMO O;  3JAM N;  2LW7 A;  4JYA O;  4B3T O;  4DR1 O;  4X62 O;  2ZM6 O;  2UUA O;  4JI6 O;  5H5N A;  4K0K O;  4NXM O;  1XEQ A;  2ZKO A;  2DOS A;  4DV4 O;  4LF7 O;  1A32 A;  1AIL A;  4DUZ O;  4NXN O;  5BR8 O;  4JI0 O;  4DR7 O;  4LF8 O;  1XNQ O;  4LF5 O;  4JI3 O;  5IT9 N;  3F5T A;  4AQY O;  4JI5 O;  4X65 O;  1R1B A;  4GKK O;  4DV7 O;  1N34 O;  4DR4 O;  3R66 A;  4OPH A;  1FKA O;  4LF6 O;  4LFB O;  4JI2 O;  4B3M O;  1NS1 A;  3M8A A;  1F7Y A;  4LFC O;  1N36 O;  3J81 N;  4GKJ O;  4JI8 O;  1X59 A;  2N74 A;  2UXB O;  1IBL O;  4JI4 O;  5LMU O;  4DV1 O;  2VQF O;  4JI1 O;  3T1H O;  4OX9 O;  2UU9 O;  4DV2 O;  1IBM O;  4LFA O;  3T1Y O;  1YZB A;  2DJV A;  1FYJ A;  5LMN O;  1J5E O;  1I94 O;  5LL6 Y;  4DUY O;  2UXC O;  4DR5 O;  3RT3 C;  5FLX N;  1HR0 O;  4DV6 O;  4DV0 O;  2UUC O;  1KUQ A;  2VQE O;  4X66 O;  5BXZ A;  1XNR O;  2UXD O;  4DR2 O;  5BY1 A;  4JI7 O;  5A2Q N;  4B3R O;  4LF4 O;  4X64 O;  1HNZ O;  1D2D A;  2FKX A;  4DR3 O;  3J7A U;  3SDL A;  2UUB O;  4DV5 O;  3OTO O;  4KHP O;  2E5L O;  4YY3 O;  1XMQ O;  1FJG O;  1IBK O;  1DK1 A;  4A5U B; 
#chains in the Genus database with same CATH topology
 4DV1 B;  2CTW A;  1P49 A;  5IJ9 B;  2OCH A;  3O65 A;  4RQF A;  1I5X A;  5LYJ A;  3N2G A;  4GCZ A;  5B1A B;  1MOF A;  2JEU A;  1RM1 B;  4QE7 A;  1HNW O;  3ZJZ A;  4OGQ B;  3CCS V;  2ZXW C;  1MZF A;  4FFK A;  1RSO B;  1M90 W;  2QSA A;  4XDJ A;  2B5U A;  4Q6G A;  4L87 A;  3WFV A;  1EN5 A;  4RUF A;  2ZR2 A;  4PDV A;  2UUA O;  5H5N A;  3FKS G;  3CME V;  1QBZ A;  3JCZ A;  2XT9 A;  3BHP A;  2ZKO A;  1XUQ A;  4NVP A;  1N33 B;  2YXY A;  3ABK C;  5BR8 O;  4KL1 A;  4B3S B;  4FVM A;  3M99 B;  5JJN B;  2OTL V;  2XHB A;  5BMV B;  2PI5 A;  1GMG A;  1I08 A;  1SER A;  5IT9 N;  3UCS C;  1WPB A;  2DYR C;  4GKK O;  3RVY A;  3ZMV A;  2GSM B;  3SJQ C;  1K7D A;  3OR6 C;  4FK5 C;  3VBB A;  3T1H O;  1F23 A;  2A7W A;  3CRA A;  4O4L A;  3ABM C;  3DTU B;  2DN9 A;  4I9Q A;  1XNQ B;  1Q6U A;  4MVU A;  1YTF B;  5CBH A;  4P2Z A;  5L3B A;  3ASO C;  4WFH A;  3HKE A;  4NTY A;  3ETG A;  5EZY A;  4CH5 A;  4DV0 B;  4B3R O;  3JAT B;  5GON B;  2N04 A;  2WLL B;  1SA0 A;  3F5W C;  4Z2W A;  1D2D A;  1M56 B;  1SZX A;  3ZN1 A;  2CTQ A;  2OCC B;  3J7A U;  3OR7 C;  3ZHR A;  4H44 B;  3H9V A;  3UT5 B;  2Y0P A;  2YI8 A;  3L9D A;  3JD2 A;  4TV9 B;  1TVK A;  4BIZ A;  4JV5 O;  4KP4 A;  4DR5 B;  1FPO A;  3QO5 A;  2OYQ A;  4F6R B;  2W0F C;  3K5M A;  3H1I H;  5B1B C;  1GN2 A;  5L3D A;  3TGU H;  1V54 B;  5E79 Z;  2HHH B;  4PD4 F;  3A0H Z;  3ABU A;  5FPR A;  1YCI A;  1S72 V;  2QKC A;  2ZM6 O;  4G2K A;  2QM7 A;  2IU0 A;  4DW1 A;  3RWR D;  4O2B B;  1VF6 A;  5DED A;  1DF5 A;  1Y74 A;  3JAW B;  3E2E A;  1XOU A;  4LF8 O;  1H2N A;  4NXM B;  3AG3 C;  3E89 A;  3SPH A;  2ETN A;  1JMK C;  3D3I A;  3G71 V;  4DYL A;  5CB4 A;  2B1G A;  1VQP V;  2GV9 A;  1QNM A;  1KB9 F;  3E8F A;  4P9O A;  3KG2 A;  4FLT A;  5K1X A;  2ZCE A;  4W4K A;  4GKJ O;  4J42 A;  2CTP A;  3IAY A;  1XBL A;  2AHY A;  2GDS A;  3L70 H;  1KC8 W;  2AHZ A;  4JAV A;  1GRJ A;  4CS2 A;  1AR4 A;  2Q68 A;  1IBM O;  4JF3 A;  5LYJ B;  4EFE A;  3N2G B;  5GTH Z;  4GX1 A;  1Q82 W;  5B1N A;  3IC9 A;  2RMK B;  2KG7 B;  2B9Z A;  3K5O A;  4GZR B;  1L1F A;  3FYE B;  4HNA A;  4GT1 A;  4QPJ A;  1MSW D;  1ZUQ A;  2R70 A;  4FFB A;  3CWB H;  3C3S A;  2EX3 A;  4O4J B;  1AJP A;  1OCO B;  4KXR A;  3RYC A;  5D5Q A;  1DK1 A;  4J11 A;  4BW9 A;  2GUZ A;  3IJ4 A;  1OCZ B;  4F4L A;  2F4V O;  2UU9 B;  2NN4 A;  2M6Y A;  3K3W A;  1EBO A;  2RDC A;  5L3F A;  2RN9 A;  2EIK C;  2ZE8 A;  1NR1 A;  4DV6 B;  2HJD A;  3AK1 A;  3ZRS A;  2CK3 G;  2R9R B;  2Q4P A;  3WG7 C;  4X89 A;  3CCQ V;  1XMO O;  4GUN A;  1R3L C;  3ZMU A;  5LXT A;  3K58 A;  4J7K A;  3CRM A;  2BOB C;  3CCJ V;  3ZED A;  2BTO A;  4JTA B;  4O4L B;  2G38 A;  3HKC A;  1K4D C;  2JDI G;  3G80 A;  4FIP C;  1QR9 A;  2W6I G;  2YIB D;  3HKE B;  2YXH A;  5KHH A;  3DXR A;  5EZY B;  4UVC A;  1YI2 V;  1SRY A;  3TXQ A;  2ZE7 A;  1SA0 B;  4BW5 A;  2ZDI A;  1JA8 A;  1NS1 A;  4WCE V;  2HR3 A;  3J81 N;  2IJK A;  1KYO F;  4JI8 O;  4DK0 A;  3X2Q B;  3OTF A;  2EUL A;  2YI9 A;  4X62 B;  1NTZ H;  1QHT A;  1SC5 B;  3OMA B;  2D2C B;  3W7T A;  1TVK B;  3D36 A;  2VWJ A;  1YF2 A;  2LFS A;  4LFA O;  3FB7 C;  1FYJ A;  2QWN B;  3B2E E;  5LL6 Y;  4DUY O;  1GM9 A;  4DUZ B;  3CRC A;  2IJH A;  3ZMZ A;  5BZB A;  2EBO A;  4IGG A;  4JAA A;  2ZIM A;  2P22 C;  3THO A;  3CPW U;  2DYS C;  3WB2 A;  1G8M A;  3SJA C;  2WLJ A;  2CAZ C;  3K0G A;  4WBN A;  1ZLZ A;  2E5L O;  2HG5 C;  5CA3 A;  5LP6 C;  4A5U B;  5LMU B;  1Y74 B;  1KP3 A;  1R6N A;  3L75 H;  2LJ2 A;  4WFG A;  3SYA A;  4PJ0 Z;  3HKD A;  4J41 A;  3MD0 A;  5B5E Z;  4CH6 A;  2ITC C;  4I55 A;  2DWE C;  5CB4 B;  4O4I A;  5IYD O;  1QQC A;  1XQ8 A;  5D5P A;  4G27 B;  3AG1 C;  4R6Z A;  1IBK B;  4MTF A;  2FB5 A;  4K0K O;  1XEQ A;  2DOS A;  4FPP A;  4DV4 O;  4Z1M G;  1VF7 A;  1F51 A;  4HNA B;  4F6E A;  4JI5 O;  1RFY A;  2RJZ A;  5CBG A;  4MVM A;  1OCR C;  1S5L Z;  4DR4 O;  4FFB B;  4B3M O;  1K8A W;  1PNK A;  3ZS8 C;  3P32 A;  3RYC B;  4R7C A;  4JYA B;  2ATK C;  3JD4 A;  2YC0 A;  1D5N A;  2GUZ B;  4U7N A;  3SJB C;  4YJ3 A;  3LSS A;  2ZNJ A;  3RBZ A;  1XHX A;  3CP1 A;  1YZB A;  1TUB A;  3K06 A;  4LR3 A;  2V1D A;  3D8C A;  1ZX3 A;  3VQY A;  2PGG A;  4QPK A;  3SPG A;  5KAF Z;  1H2K A;  1QU7 A;  3OGI B;  1OCC B;  4MVO A;  1BQZ A;  4YXW G;  4DW0 A;  1L8D A;  5LXT B;  4LF6 B;  3AG2 B;  3SPI A;  5K1P A;  1IVS A;  4I9W A;  4PA4 A;  2Q73 A;  1H8E G;  1B6Q A;  2F95 B;  1AR5 A;  1VQ5 V;  2ODM A;  5J2T A;  3FX7 A;  1M5I A;  1VEW A;  4DR3 B;  3ZRW A;  1H38 A;  2Z0A A;  4X1I A;  5H6Q A;  2LW1 A;  1SQP H;  2HJF C;  1THZ A;  3K59 A;  4JYY A;  4BIU A;  2UXC B;  2KB1 A;  5B1A C;  4JZG A;  3UKM A;  1N32 O;  3CCV V;  1XNR B;  3N2K A;  4DR2 B;  1RM1 C;  1FXV A;  4I4T A;  4UFZ A;  3JAM N;  1HNX B;  1H8H G;  2A0L A;  3GVM A;  1CXZ B;  5IJ0 A;  4N23 A;  2GTA A;  5KUM A;  4DR6 B;  2F93 B;  1KD1 W;  4UV9 A;  4JGS A;  4P9P A;  4X20 A;  4XBF A;  3ICX A;  2XAS A;  3K79 A;  3OUS A;  1B3Q A;  1AI4 A;  1EN4 A;  2JJ2 G;  4LF5 O;  1IX9 A;  4AQY O;  2XAH A;  1YDX A;  3CRR A;  2LO1 A;  4I7Z B;  3ZMS A;  4LC1 A;  4OPH A;  4GX2 A;  4WBN B;  1NH2 B;  1F4N A;  4CS3 A;  1QCE A;  5FL7 G;  5HFM A;  1G6U A;  2KQX A;  1SF9 A;  2Q6A A;  4DV1 O;  3HKD B;  1WN7 A;  1FXK A;  1EZV H;  3JSL A;  4I55 B;  5KHK A;  3K5N A;  4O4I B;  2E74 B;  1T5E A;  1YIT V;  1VQ6 V;  3UQ8 A;  2ZR3 A;  4OX9 B;  4I5S A;  3CE2 A;  2Y69 B;  3ZCC A;  2XAJ A;  4UUJ C;  5L3G A;  3K5L A;  3OE7 G;  4CZZ A;  4UVB A;  3P3N A;  4DV7 B;  1US6 A;  3STL C;  2D3O W;  4XDL A;  2X6A A;  2KSD A;  3M7M X;  4LFC B;  2JK5 C;  2UXN A;  3FYI B;  1GK9 A;  1M56 C;  3ETE A;  4J80 A;  2OCC C;  3OTO O;  2QM4 A;  3ZHT A;  4GX0 A;  3SPC A;  4I0X A;  5CA1 A;  1N33 O;  3OM3 B;  1NVP D;  3JD1 A;  1R6T A;  4HYO A;  4B3S O;  3TJT A;  1K9M W;  1ZAU A;  1SES A;  3SYO A;  1DF4 A;  2L35 A;  3RYF A;  1MZE A;  3CCM V;  3C3T A;  4DRX A;  4NKG B;  2Y0I A;  2AXT Z;  4TV8 A;  4YJ3 B;  4B7K A;  1HDJ A;  2Q67 A;  1TUB B;  1NTK H;  2ZIN A;  5HFL A;  4BIO A;  1FFX A;  4JAU A;  1KP2 A;  1XNQ O;  5EIB C;  3HB3 B;  3BPZ A;  1JOY A;  3I5D A;  2IU3 A;  3VQX A;  2EIJ C;  3ZRV A;  2ILM A;  3JAK B;  5F2V O;  2KKW A;  1NJI W;  2LGQ A;  1S0V A;  3E83 A;  2F66 C;  4FM2 A;  1VP7 A;  1K5S A;  2H8P C;  1PV0 A;  1TGO A;  3ZRW B;  1VQ9 V;  4X1I B;  4EKW A;  2EIN B;  1MA1 A;  2PZS A;  2C2A A;  1YJN V;  4AIL C;  1YTF D;  3LNM B;  5IYC O;  4DR5 O;  3RFR A;  5FLX N;  2QKA A;  2Y48 A;  3N2K B;  2PTM A;  1VQN V;  4W4L A;  1PL0 A;  3BA9 A;  3JYC A;  4I4T B;  4JI7 O;  2UUC B;  4UB8 Z;  4LFB B;  3JAL A;  3EVK A;  2ARH A;  1K34 A;  5IJ0 B;  1OCO C;  4YY3 O;  4YIO A;  5LOV B;  1ZSP A;  2YEV A;  1OCZ C;  3K0D A;  4X20 B;  4IT5 A;  2EIL B;  1AB3 A;  4DK1 A;  4DV2 B;  4PDR A;  3SGI A;  1R3I C;  1Q86 W;  1N0N A;  3B4S A;  4QGP A;  4O4H B;  5LMN B;  3PN1 A;  3CS5 A;  4NYK A;  5EBW C;  3ZBH A;  2BE3 A;  4WFB V;  2IJI A;  2Q8V A;  3U10 A;  5LGT A;  2M7W A;  4X66 B;  4CBC A;  3OEH G;  4YHH O;  1SQB H;  4X8A A;  4NR1 A;  1FAF A;  4LF9 O;  3LSQ A;  2EZP A;  4LF4 B;  1JPX A;  1TAE A;  5JQG A;  4ZOL B;  3H1K H;  4CS4 A;  2LW7 A;  1HNW B;  3QVN A;  1NU1 H;  4DV5 B;  1UJW B;  1JR9 A;  5KLV H;  4DR1 O;  1KEC A;  5JWP A;  1J95 A;  2GHY A;  5ITZ A;  3N27 A;  2HVK C;  2CDY A;  4JAS A;  1Q5O A;  3JAR B;  3EXA A;  5EIB D;  2DWD C;  1H2G A;  3A2F A;  1QLE B;  1SKV A;  5CBF A;  1CPY A;  2PI4 A;  1N34 O;  3OGC C;  3T2M A;  4K35 A;  1Y4M A;  1F7Y A;  3FD9 A;  3LDE A;  4C7U A;  4GKK B;  2YIB A;  4FLU A;  1ZL8 A;  4FM0 A;  3X2Q C;  4I0X B;  2YXL A;  5CA1 B;  1H2S B;  3AK3 A;  2UU9 O;  4MW3 A;  4RO2 A;  5KAI Z;  3AG4 B;  3K9A A;  1AP5 A;  4PV1 B;  1WB7 A;  4NXN B;  1U97 A;  4DV6 O;  3RYF B;  2W0X A;  1E1Q G;  3OW2 U;  1Q90 D;  5KMG A;  4DRX B;  1TA8 A;  1KKC A;  3FB5 C;  4TV8 B;  1N36 B;  5EK0 A;  3ML0 A;  4YJ2 A;  5H6R A;  4B3R B;  4PI0 A;  3FB6 C;  1SZT A;  1VF6 C;  2QWR B;  1FFX B;  2HVJ C;  2F1M A;  2Q5Z A;  3BA8 A;  4FLY A;  2XAF A;  3ZHS A;  5L3C A;  2IJJ A;  3AEI A;  4FLW A;  1DGS A;  2ZNI A;  5B3S C;  2P7T C;  3W7X A;  1N4C A;  2BOC C;  2NLJ C;  3KKY A;  2DYR B;  4QJF B;  1XIL A;  2W6J G;  1LUV A;  2EJ7 A;  4X62 O;  2QA4 V;  4I50 A;  2OTJ V;  4UB6 Z;  3ZX6 A;  4DV3 B;  2Q7E A;  2ZM6 B;  3B40 A;  4DUZ O;  3ABM B;  2K1E A;  1BHB A;  4EB6 A;  4PHZ A;  1XRE A;  3HR0 A;  1OHH G;  2B1I A;  2ZT9 B;  1Y66 A;  3CXH F;  1X59 A;  2GBO A;  1YVW A;  1BHA A;  4PA9 A;  1GM8 A;  5E1A C;  2YEV B;  5LMU O;  4GKJ B;  4MVZ A;  2IH1 C;  4E4E A;  3ABL B;  1S5J A;  2EIM B;  4JI0 B;  3CC7 V;  2PYJ A;  2VQE O;  3GWK C;  4K3A A;  1P84 F;  4B7E A;  1AJQ A;  2OT5 A;  1YJW V;  2QM8 A;  3AG2 C;  3H1H H;  5ITZ B;  1L0L H;  1B04 A;  2UXB B;  1LUW A;  1IBK O;  1Y76 A;  3RGB A;  3E8B A;  4JI1 B;  5GW7 A;  3T4Z A;  2LP7 A;  2L6L A;  3CHX A;  1JFF A;  5KUK A;  2QWP B;  1M57 B;  2CTR A;  1I94 B;  4IYI A;  1R73 A;  2AGA A;  4FZ0 A;  1DTO A;  4ZBM A;  3ZHV A;  2F43 G;  1K3E A;  2ZDI C;  3KCX A;  4D7S A;  3ASN B;  5KA6 A;  1N0J A;  4BAY A;  2E75 B;  1D5A A;  1Z2G A;  4X64 B;  1HNZ B;  4D7T A;  1PM9 A;  4JYA O;  2A06 H;  1FJG B;  1XMQ B;  2N05 A;  3WU2 Z;  1RP3 B;  1MG1 A;  1WPX A;  1Y67 A;  1BSM A;  4O2A A;  1VQM V;  1W0J G;  3UO2 A;  1TUE B;  3FAV A;  5IWA B;  5KMG B;  5IYZ A;  2X6B A;  4ZKI A;  1JVM A;  4MT8 A;  4AI8 A;  5JCO A;  4LF6 O;  1S76 D;  1XL6 A;  1YHQ V;  3ABT A;  4YJ2 B;  3M8A A;  3CXC U;  2VWK A;  2WLM A;  1IXM A;  3K9S A;  4B08 A;  4KFM A;  1W2B U;  3LDC A;  4J10 A;  4B3T B;  3O9O A;  1K4C C;  4JI4 O;  1Q43 A;  3Q4H A;  1GKF A;  4LP8 A;  1VQO V;  1BZK A;  2YIA A;  4XDK A;  3OMN B;  3BAA A;  4K8Z A;  1J5E O;  2UXC O;  2P06 A;  3TCU A;  5JJE B;  4J9Z B;  2Y69 C;  4DO2 A;  2UXD O;  1XNR O;  4DR2 O;  3LUT B;  3CJH A;  1S3J A;  1QVF U;  1VQ4 V;  3G6B A;  3UO3 A;  2F23 A;  1R3K C;  4PA3 A;  2PUS A;  2FKX A;  1VIB A;  2WWW A;  4I50 B;  3B77 A;  1Q6H A;  4MVS A;  2IM9 A;  3S3W A;  4RUE A;  2RQ6 A;  3K04 A;  4UCV A;  2HP8 A;  2BSK A;  2MW2 B;  4PDM A;  1I7F A;  3DSQ A;  4DR6 O;  2PYL A;  1K73 W;  2XUM A;  3TK1 A;  4EB6 B;  2XAG A;  4X88 A;  3W7W A;  1IXB A;  3BCC H;  3U11 A;  3DC5 A;  3DC6 A;  5LGN A;  3DGE A;  3HKC B;  1ROP A;  4IIJ A;  2JS5 A;  1M4U A;  1JQ0 A;  2PF4 E;  4KHP B;  5DM6 V;  3G6E V;  3DXR B;  4JTD B;  5KX5 A;  4L8J A;  2H3O A;  1YXB A;  2DQ3 A;  1A32 A;  3LDD A;  5KHG A;  2OIG A;  2ZE6 A;  5LHG A;  3E22 A;  3RW0 A;  3JSN A;  4TSF G;  4DV4 B;  1NH2 D;  4DV7 O;  3R66 A;  4X9Q A;  2JS3 A;  4LFC O;  2GTS A;  4JTC B;  2IBZ H;  2MK3 A;  1Y76 B;  3BAB A;  3ETD A;  1EN6 A;  3JCU Z;  1QR8 A;  4N21 A;  4JI6 B;  4ZHQ A;  2LFR A;  1JFF B;  2Z3Y A;  3ZRX A;  5EBL C;  3RYI A;  1Z5V A;  1BS3 A;  3OAA G;  2FML A;  4LF7 B;  5A9G A;  2P5O A;  1GM7 A;  4E2L A;  4DR7 B;  3T1C A;  3ETQ A;  2CH7 A;  3B8M A;  2WPD G;  4X65 B;  5A2Q N;  5FPO A;  4H0L B;  4JI2 B;  4UVA A;  3CB2 A;  3I55 V;  2QDO A;  2WAM A;  1V55 B;  1VAR A;  2P6J A;  4O2A B;  3TET A;  2EIL C;  3FAV B;  4Q20 A;  3T1Y B;  3RN4 A;  1YIJ V;  1Y6X A;  5IYZ B;  1IZ3 A;  1KBH A;  1HR0 B;  2E76 B;  1S77 D;  2CGO A;  3CCR V;  1G1X B;  1CP9 A;  4CC5 A;  3OT7 A;  5B66 Z;  4GX5 A;  1YEW A;  1N32 B;  1Q7Y W;  2XTA A;  1P7B A;  3LSU A;  3QTC A;  3Q4H B;  4F6R A;  1VQK V;  4U3F H;  4PEL A;  4NB5 A;  4HZ3 A;  3OUF A;  2BCC H;  1IUR A;  1HW7 A;  1AIL A;  1K92 A;  2Q9L A;  3CJH B;  2YID A;  1QLE C;  2DE0 X;  5KA5 A;  1V54 C;  1R1B A;  1HWY A;  3F7V C;  1GO3 F;  3AK2 A;  4LFB O;  1FKA O;  4JYC A;  4NTW A;  2P90 A;  2BSK B;  4UCS A;  1BT8 A;  1NQT A;  4QE9 A;  4TQD A;  2IW5 A;  4KUM A;  1YJ9 V;  1L0N H;  3IC7 A;  4DV2 O;  4MTX A;  1SQV H;  1XDC A;  3AG4 C;  5LMN O;  3TXS A;  2P67 A;  4PA6 A;  1W59 A;  4DV0 O;  3NXS A;  5IY5 B;  4LH7 A;  4X66 O;  4UXN A;  4JI3 B;  3QG5 A;  1WP7 A;  1GTO A;  2QR4 A;  4X1K A;  3ZMT A;  1NVP B;  4BR6 A;  3WB1 A;  4GYC B;  4IIJ B;  3CRQ A;  5J2T B;  4LF4 O;  3CYO A;  2JVD A;  1F4M A;  2KG7 A;  1Q8I A;  3SDL A;  4DV5 O;  2Q7G A;  2JGD A;  1IBL B;  5KX5 B;  2OWO A;  2WLI A;  2VQF B;  2R72 A;  3OTO B;  2JEX A;  1WB8 A;  4LNU A;  3E35 A;  2XND G;  4O4J A;  3E22 B;  3LNN A;  2R9A A;  1KU9 A;  2P4K A;  4MVQ A;  4TT3 G;  1PP9 H;  3I56 V;  2HHH O;  1VMG A;  1QLN A;  4ZIB A;  1E79 G;  4CH4 A;  4RWU A;  3ZHU A;  1ENV A;  2UUB B;  1B06 A;  3A8T A;  4ZHQ B;  1NT2 B;  4FMT A;  1P7G A;  1K97 A;  1G4Y B;  1PPJ H;  4NXM O;  3RYI B;  1BQ0 A;  3T4D A;  2WLK A;  4NXN O;  3L72 H;  2ZE5 A;  2CH7 B;  5AG2 A;  1H2M A;  1GH6 A;  3L71 H;  3W7S A;  3W7U A;  1FS0 G;  2V7Q G;  5TIS Z;  2WA4 A;  1FXK B;  3E8G A;  1N36 O;  4UCU A;  3FFQ A;  4WF9 V;  1I5Y A;  4H33 A;  3IFX A;  2UUA B;  4TUY A;  2HKO A;  2YUA A;  1XHZ A;  2X6C A;  4UCO A;  1RPO A;  3CX5 F;  3S3X A;  3CMA V;  3K08 A;  4TWK A;  2FL4 A;  3ABL C;  1HP8 A;  1OZ0 A;  3RVZ A;  5LGU A;  5BR8 B;  2EIM C;  2HEP A;  3OFN G;  4IHJ A;  1GN6 A;  1DLB A;  5BY1 A;  2QWQ B;  1VF5 B;  5IYB O;  1PD3 A;  4CC6 A;  1SQQ H;  2NR5 A;  1MAB G;  1MNG A;  4JI7 B;  5FNV A;  3EHB B;  1M9N A;  3QO8 A;  2O57 A;  1NI8 A;  2CE4 A;  1EZJ A;  4DV3 O;  3T1H B;  4OPA A;  5C8Y A;  2A3Q A;  4YY3 B;  4HAM A;  3H1L H;  3MHS C;  4ZI7 A;  3CD6 V;  1Q3E A;  1M57 C;  1W0K G;  2XOK G;  2XAQ A;  2YSU B;  4TOI A;  2ZXW B;  1OJH A;  2QE7 G;  1NR7 A;  3ASN C;  5LHI A;  5JVD A;  3CCU V;  2EIJ B;  2YDE A;  3R65 A;  4YHH B;  4RQE A;  1AI7 A;  1SQG A;  4LF9 B;  3BEH A;  5DEC A;  2QWO B;  4HBN A;  3IGA C;  3SR2 C;  1N8R W;  4R50 A;  2ZQM A;  4DR1 B;  1GN4 A;  2LGW A;  2NNU A;  3CSX A;  3ABK B;  1YSC A;  1WAZ A;  4JI0 O;  4JV5 B;  4X1K B;  3F5T A;  1H2L A;  2R9I A;  3CCE V;  2LQT A;  4J7J A;  2UXX A;  4G28 B;  3UM7 A;  1M93 A;  1ORQ C;  3QF7 A;  5H9C A;  2JGD B;  3ZN0 A;  1PNL A;  1UFI A;  1XI1 A;  4ASU G;  1OV9 A;  1N34 B;  2UXB O;  2WLI B;  1R3J C;  4WFE A;  4LH6 A;  4LNU B;  4JI1 O;  5KHI A;  3STZ C;  1FFT B;  2ADP A;  3P30 A;  4WFF A;  1AI6 A;  4ICG A;  5B1O A;  2VRZ A;  3HPL C;  3G4S V;  1I94 O;  2WSS G;  5JH7 A;  2Y4U A;  2BTQ A;  4UCR A;  4LF8 B;  3JAL B;  2Q0O C;  5IDJ A;  1KUQ A;  2RCV A;  3ASO B;  1Q81 W;  1AJN A;  1M1K W;  2A79 B;  1Z5W A;  3RYH A;  1RPR A;  4X64 O;  1HNZ O;  5LBQ A;  5LHH A;  4U3J A;  3BFR A;  4Z1V A;  1LR1 A;  1NBM G;  1K33 A;  1FJG O;  1XMQ O;  3L74 H;  1SS3 A;  2JGU A;  4LWS A;  1S5H C;  5C93 A;  2QJ1 A;  5J2U A;  1IBM B;  1PL4 A;  3HKB A;  2JRI A;  1OCC C;  1MSD A;  1NKD A;  3J80 N;  5IWA O;  5JQG B;  1WP8 A;  1JJO A;  2VS0 A;  1LNQ A;  5CA0 A;  5CN0 A;  5B1B B;  3SJC C;  3APQ A;  1P4R A;  1MMM A;  5LA6 A;  4B3T O;  4TUY B;  2JIZ G;  1SQX H;  2HLD G;  3SYC A;  4U7O A;  2ZIO A;  5LP6 A;  1PKX A;  2F4V B;  2X0L A;  1IDS A;  4ABM A;  2ITD C;  3VQV A;  2EZO A;  4IHJ B;  3AG3 B;  4FLX A;  1ZL8 B;  2A9H A;  3FB8 C;  1FXH A;  1URF A;  4J9Y B;  2YIC A;  4TQF A;  3D36 C;  1XMO B;  5FNV B;  1WLE A;  2CGN A;  1U96 A;  3C90 A;  3VOU A;  4MS2 A;  2QTO A;  1BGY H;  3APO A;  3BVO A;  4X1Y A;  5C8Y B;  1KMI Z;  5KHJ A;  5EYP A;  4ZI7 B;  4UCT A;  2V4D A;  1EFR G;  3WB0 A;  1JJ2 U;  1WNS A;  3K03 A;  3EFF K;  5BXZ A;  3JAS A;  1SQF A;  1BMF G;  4LBE C;  5JVD B;  1KKD A;  5IE9 A;  4H37 A;  5B3S B;  1JX9 A;  2VQE B;  1WA8 A;  1V9P A;  1Q6I A;  2RNB A;  4DR3 O;  1X4T A;  4BWA A;  4EEQ A;  4JI8 B;  1GN3 A;  3G67 A;  3QNE A;  3P3P A;  3K57 A;  3CC4 V;  4KHP O;  1BE3 H;  1V55 C;  5EC1 C;  2IH3 C;  3GB7 C;  3AG7 A;  1PNM A;  4AHC A;  4MTO A;  4QNH B;  4LFA B;  2JJ1 G;  2QKS A;  2EIK B;  4FJC C;  5DN6 G;  4NTX A;  4DUY B;  2OIE A;  1ZWI C;  3JD3 A;  5JCO C;  1GAX A;  3OMI B;  2AZ0 A;  1HNX O;  3WG7 B;  3A0B Z;  1BCC H;  5GTI Z;  2Q69 A;  2H94 A;  4MVR A;  1COW G;  4FLZ A;  1AP6 A;  2E5L B;  3H1J H;  2PY5 A;  4JI6 O;  3BRC A;  3A0R A;  5EBM C;  2DMX A;  2WA3 A;  5JH7 B;  2BTQ B;  4QIW F;  4LF7 O;  4H13 B;  5IJ9 A;  4DR7 O;  1E1R G;  3JD0 A;  3F7Y C;  2DQ0 A;  4IL6 Z;  5CMU A;  4X65 O;  4GLX A;  3RYH B;  4JI2 O;  1EM1 A;  4U3J B;  2P4V A;  4EFB A;  5H2F Z;  1RSO A;  4WFA V;  2QGN A;  1AR1 B;  4FM1 A;  3JAK A;  4LWS B;  4OXS A;  1XL4 A;  5J2U B;  2K9P A;  4LCU C;  4OX9 O;  4K0K B;  4JYB A;  1WJZ A;  3HKB B;  3NR7 A;  3CCL V;  3T1Y O;  5JJJ B;  4JI4 B;  2QEX V;  3E8H A;  3CC2 V;  2AW9 A;  3RT3 C;  1HR0 O;  1NTM H;  5L3E A;  5CA0 B;  5IY5 C;  1ZTE A;  4JI5 B;  1J5E B;  5BMV A;  2DYS B;  1NZ6 A;  4DR4 B;  4B3M B;  1QVG U;  2UXD B;  5LA6 B;  4P30 A;  3SYP A;  2Q7H A;  4PA7 A;  3GWO A;  2EIN C;  1JCH A;  5LP6 B;  4UV8 A;  5J9P C;  1I0H A;  4JPR A;  4J7Z A;  2HFE C;  1O9G A;  1FD9 A;  2Y4T A;  3PJS K;  4YIP A;  2DW4 A;  5LOV A;  3ZIA G;  1O9H A;  5EC2 C;  4CH3 A;  2WLN A;  2E3C A;  3B8N A;  2Q0A A;  4D6T H;  2AZ2 A;  2ZD9 A;  3SYQ A;  4O4H A;  2FTK A;  3VQW A;  4FZ1 A;  4PI2 A;  1K5Q A;  3JAT A;  3KZI Z;  3AG1 B;  2WLH A;  5GON A;  4MSW C;  2WLL A;  2YS8 A;  4X1Y B;  1VQ8 V;  4PDL A;  2FYU H;  1BL8 A;  5EYP B;  4MTG A;  1VQL V;  4ZOL A;  4IYH A;  3UT5 A;  2QTS A;  3CEI A;  4TV9 A;  3JAS B;  4FLV A;  1KQS U;  4JI3 O;  3E86 A;  3JAR A;  2Z5U A;  1OCR B;  1WA8 B;  2ADQ B;  1AVM A;  3SPJ A;  1CEZ A;  1FXK C;  4MW8 A;  2N74 A;  1SET A;  3U0Z A;  1IBL O;  2VQF O;  4R8C A;  3MAQ A;  2DJV A;  3MHH C;  3D3Q A;  4O2B A;  3B09 A;  1UPG A;  4RAI A;  2EJR A;  4DXW A;  3MDS A;  3JAW A;  2UUC O;  4LF5 B;  4K8X A;  3L73 H;  4AQY B;  3H01 A;  3BY6 A;  3OEE G;  3OD4 A;  2CUG A;  3ZHQ A;  1R6K A;  2X7R B;  1AI5 A;  2UUB O;  3KCY A;  1ARO P;  1VQ7 V;  4JZ2 A;  3QO7 A; 
#chains in the Genus database with same CATH homology
 4DR6 O;  4DV3 O;  2Z0A A;  2F4V O;  1AB3 A;  4OPA A;  1N33 O;  3O65 A;  1R6T A;  4JV5 O;  2JRI A;  4B3S O;  3J80 N;  5IWA O;  2AGA A;  2HHH O;  1N32 O;  4YHH O;  1HNX O;  1HNW O;  1G1X B;  4LF9 O;  1XMO O;  3JAM N;  2LW7 A;  4JYA O;  4B3T O;  4DR1 O;  4X62 O;  2ZM6 O;  2UUA O;  4JI6 O;  5H5N A;  4K0K O;  4NXM O;  1XEQ A;  2ZKO A;  2DOS A;  4DV4 O;  4LF7 O;  1A32 A;  1AIL A;  4DUZ O;  4NXN O;  5BR8 O;  4JI0 O;  4DR7 O;  4LF8 O;  1XNQ O;  4LF5 O;  4JI3 O;  5IT9 N;  3F5T A;  4AQY O;  4JI5 O;  4X65 O;  1R1B A;  4GKK O;  4DV7 O;  1N34 O;  4DR4 O;  3R66 A;  4OPH A;  1FKA O;  4LF6 O;  4LFB O;  4JI2 O;  4B3M O;  1NS1 A;  3M8A A;  1F7Y A;  4LFC O;  1N36 O;  3J81 N;  4GKJ O;  4JI8 O;  1X59 A;  2N74 A;  2UXB O;  1IBL O;  4JI4 O;  5LMU O;  4DV1 O;  2VQF O;  4JI1 O;  3T1H O;  4OX9 O;  2UU9 O;  4DV2 O;  1IBM O;  4LFA O;  3T1Y O;  1YZB A;  2DJV A;  1FYJ A;  5LMN O;  1J5E O;  1I94 O;  5LL6 Y;  4DUY O;  2UXC O;  4DR5 O;  3RT3 C;  5FLX N;  1HR0 O;  4DV6 O;  4DV0 O;  2UUC O;  1KUQ A;  2VQE O;  4X66 O;  5BXZ A;  1XNR O;  2UXD O;  4DR2 O;  5BY1 A;  4JI7 O;  5A2Q N;  4B3R O;  4LF4 O;  4X64 O;  1HNZ O;  1D2D A;  2FKX A;  4DR3 O;  3J7A U;  3SDL A;  2UUB O;  4DV5 O;  3OTO O;  4KHP O;  2E5L O;  4YY3 O;  1XMQ O;  1FJG O;  1IBK O;  1DK1 A;  4A5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...