2YDEA

Factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ydeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ydeA01
4JAAA 4AI8A 4BIOA 4Z2WA 3KCYA 3P3NA 2YC0A 1IZ3A 3P3PA 2ILMA 2WA4A 4QU2A 1YCIA 2W0XA 2YDEA 1H2NA 3KCXA 5JWPA 3OD4A 2Y0IA 1H2KA 2CGNA 1H2MA 1MZEA 2CGOA 4B7KA 1H2LA 2XUMA 4Z1VA 1MZFA 2WA3A 4B7EA 4NR1A 3D8CA
chains in the Genus database with same CATH superfamily
2XOMA 1FNYA 1QNWA 2VZOA 3EB7A 4UF0B 5IY5C 3RRDA 3K5OA 5BNPA 1AR92 5JJNB 4XBQA 4AG4A 1IBLB 1XDCA 2AYHA 3OF1A 2ZHLA 4PDVA 5FYCA 3ZX7A 2C9AA 2WRAA 3LOBA 4YZ5A 4NTWA 3L9JT 2IH3C 1CONA 1R6KA 2P34A 5LMUO 4J6GA 4BOWA 3P3NA 1L0LH 1B35B 2JDNA 1WMXA 1LEMA 4Y1VA 3QO7A 2B9UA 4DXZA 3KSCA 1YQ5A 3LNMB 1WZXA 4WBBA 3SH4A 4BMEA 2B46X 2E75B 4LE3A 3LQCA 3IM0A 2W46A 1OCRC 2AZ2A 5L3EA 5F5QA 2JDKA 5JCTA 5KHIA 3I4IA 4GWMA 2JGDA 2PUSA 4KBZA 4CXWA 1CAVA 1LAJA 4L8QA 4BK5A 5CA1B 1OMIA 3RJ2X 5KC5A 1J83A 4JDOA 4BIZA 2HEYF 2XH6A 1XQ8A 4YNIA 1GP4A 2BWAA 1S1AA 3WF4A 1UMIA 3B8NA 4J7JA 4Q4Y1 4B3MB 1GWKA 2GDSA 5BV6A 1X59A 4K40A 4L97A 2DV9A 5KX5B 1OLMA 3O1RA 1MEC2 3DPRC 2ZGTA 2FDIA 5GZFA 4JI6B 3CDZB 3FX3A 5C3QA 2W08A 3IKWA 3JD4A 3DC6A 4GWNA 3MIHA 3DTUB 2JJ2G 4IEOA 1S0GA 1AB3A 3ZXDA 3RYPA 1VMJA 4XJAA 4BB3A 3UQ8A 2QQPA 4JQRA 1OKOA 3UL2A 1ASJ3 4EROA 1ORQC 4JTAB 4NOTA 3AEIA 4X1IB 4Y22A 5B4NA 2WKKA 4UCRA 3G4SV 4XJZA 4FIPC 4CDWC 1F23A 4WZFA 2WA3A 3JQXA 1OFSA 1TQ5A 3KT7A 2G38A 4PI0A 3NW4A 5IYDO 1ZA7A 4TUYA 1RUJ3 1KBHA 2X53S 3ZN6B 3CMEV 1YC61 2AACA 1W0PA 1RMU2 1FD9A 3F2ZA 3WG7B 4XFAA 3ZJZA 2ZHNA 4XAEA 4DUYO 3CXHF 4YM3A 5L3DA 1G8MA 1ZVFA 5B66Z 1WPXA 3T1YO 1K5JA 3AL6A 1NLQA 5DUVA 4BQXA 3P1IA 5FZAA 3H1IH 5K0UC 4IIJB 2HVJC 4HVQA 1UWWA 3SYPA 3DYOA 5IK5A 3E35A 4UXAA 1UOBA 3LAGA 1C8M3 4TQDA 5FZ4A 2YGMA 1U5YA 4LF7B 3VBUB 3UKVA 1KDMA 3NV2A 5E8AA 4WVMB 1I08A 3E1F1 1Y67A 4LBOA 1UPIA 2FHRA 3ELNA 2XHNA 3TBDA 2OQ6A 3I59A 5L3FA 4FOYA 4DV7B 2GMMA 3LB9A 5LEJA 5AVPA 4RGGA 3AKRA 1N8RW 5FMBA 4NIAA 4TLFA 4HKWA 2JJ1G 1SS3A 2B1IA 1S5LZ 2PI5A 2VMHA 4J9ZB 2ARXA 4FPGA 4BJ0A 4JKLA 3O1VA 1RUD3 4BQYA 3PUHA 4B1MA 5C8WA 5L7OC 1WLWA 1IPKA 1HN0A 3IDEA 2J42A 5K7PA 4FFHA 1AVBA 3E6CC 3C90A 4X62B 4JV4A 1LNSA 4B4PA 1RTVA 3J9SA 2RM22 2TBVA 2P3IA 3K9SA 4HPKB 1K4CC 4KNCA 4AGVA 1HN1A 3DPRA 2KKWA 3TXQA 2A9HA 2A6ZA 3DXRB 3SPIA 1KS4A 4YW5A 2WA4A 2FCTA 2XJVA 3WHUA 3RZHA 4GALA 3JALB 3C3SA 2VWJA 2YI9A 1QR8A 2PTMA 1W03A 1SBFA 2QTOA 1RP3B 3NL1A 5CKMA 1DQ1A 4NWWA 4X6QB 2W92A 2FL4A 1L8DA 3SJQC 1F4MA 2UUAB 4OZXA 1CIYA 2FKXA 2N74A 1X9TA 1Z7S2 2WWUA 1VAVA 4QKFA 4Z82A 3CCUV 2QQKA 2XBO3 4CDWA 1SQPH 1R6TA 4IE4A 3ZYIB 5FO7B 3J8F3 4CZSA 4DV2B 5GTHZ 1J1LA 1PNFA 2K9ZA 1P4RA 2HJFC 4ZS2A 4WF9V 2F1MA 1AR82 2JWPA 2AENA 1LOGA 4XXAA 1O5UA 4RR3B 1WA6X 2YDEA 1N1VA 3A8TA 1GP6A 4COVA 4UCUA 5FZLA 3H3LA 3LCPA 2ZMKA 5GLTA 2UU9B 2OCHA 2PYJA 4MVSA 3H3UA 5K9YA 3BU0A 4UFJA 1GUIA 1LRHA 5K0UA 3PUIA 4YY3O 1RUOA 2LGWA 5B1AB 2PHXA 1IBMO 3SEEA 1VQKV 1CAUB 4BWOA 3RZJA 1CWPA 4FCAA 4QPIB 1X50A 1NQJA 3X2QB 1BSMA 5JR2A 1BT8A 5EV7A 5JLVA 2RJKA 1IG3A 3IZOA 3J4UH 3PUAA 2Q1ZB 1WLTA 5FIXA 5A33B 3EBRA 1EN4A 1QMJA 4PQ9A 1GK9A 5LA0A 4A6OA 1WCSA 4YGCA 5HV4A 5L7OA 5A1FA 1JYVA 2CAUA 3ZR6A 5FZ1A 4Q0VA 4WBNA 1QDOA 1BHAA 4Y3OA 3VBRB 4COUA 3FWEA 1RUF1 4ZKTB 2EX3A 3CCRV 3MIDA 1ZZ9A 1K92A 1LJ7A 2XAQA 5E1AC 3W21A 2Y8KA 5FQ0A 4R8HA 4UB6Z 2FDJA 2VOXA 5DM6V 2NPIA 4IE7A 4YW6A 1PK6B 4HBNA 2ET7A 1DDLA 3OM3B 3T30A 3HKEA 3LFMA 1QDCA 5CVRA 3FHAA 2BOJA 2BFUL 4H44B 3NV1A 1Y74A 5DZEA 3AK0A 2WPDG 1HXS2 3OSDA 5FXVA 2BDRA 2FCUA 4TV8B 2WAMA 5FZOB 4UW3A 2WSSG 1OJHA 2B9VA 1O3RA 4BIUA 1DZTA 2AEYA 3UV9A 1RUH1 2HFEC 5D8AB 1WJZA 4RO2A 4FTBA 3IB3A 2UXBO 4XJUA 1LESA 1N1TA 4MGKE 2YS8A 5HPOA 2Z4FA 4D6QA 4DRVA 2ZR3A 2XJUA 5CG9A 4CE8A 1FYUA 1T6GC 1CD3G 2R30A 4BHPA 1FATA 2D43A 4FQ4A 2XXZA 1RL3A 2R043 5B4XA 2HWE2 1XNTA 1B06A 5FNVA 1RC6A 1QY4A 2QTWB 5J48A 4I4TB 4AEDC 4GB33 4I0AA 4AFDA 2ZCWA 3I7DA 5FYBA 1UY0A 4AQ6A 3I54A 3K75B 2IXIA 3SYQA 1KD1W 2WWJA 5ABJB 3CKHA 4JX0A 5JVDA 1XNRB 1OHFA 2HYXA 3ABMC 2R70A 1OSGA 4JI8O 3ABTA 1XNCA 3VBHB 2WLLB 1FV3A 4ARXA 5I8SA 4AEJA 4KG0A 2IJJA 3RZLA 3VBOC 2DE0X 3HQXA 3PTYA 1QVGU 4YVSB 1URXA 1V6NA 5HCFA 3SH3A 1EPZA 5IYZB 3PNAA 2XLGA 1OF4A 1PMJX 1KDKA 3G6JB 5JSRA 5CA0B 3S7IA 5C6CA 4QQOA 4URTA 3N2GA 1MVQA 3HOBA 1YHFA 2WLIB 4OULA 1SHWB 4JZGA 4LF9O 4AE2A 1YEWA 3JSLA 3U78A 1O8PA 3DC5A 4I0XA 4Q4Y2 5C5UA 4NHLA 2CNAA 2GC0A 1XMOO 3CMAV 5A6QA 3ON7A 4PQQA 5GZDA 4MSVA 1I5YA 1GQGA 2R9AA 3PN1A 2GN7A 3CJXA 5HXMA 5FYIA 1F15A 3UCSC 1ZRDA 4E8CA 1AI6A 4H0LB 3R6SA 4QB1A 2Q8EA 4YM1A 3VDDC 1UYYA 1N4CA 2PAKA 1SQFA 2W6JG 4OCTA 3LSEA 3UK9A 2YXSA 4AF9A 1C5IA 2VZPA 4NVPA 1VQNV 1XNQO 3ZX6A 5CFCB 4I2OA 1RUC3 4BCUA 1I3HA 3VZMA 1HNXO 2H0BA 3KZIZ 4O9GA 4EYUA 4DR1O 2YPDA 3ENRA 3GJAA 4CDUC 1SESA 2KB1A 4BA6A 4LFBB 5LYJB 5EZWA 5A6YA 1PZ7A 1Y76B 4RUFA 4I02A 4LF8B 4L99A 4EB6A 1V6JA 2E32A 1SQBH 2RMU3 5FZIA 4JTCB 3ZRWA 1BQ0A 4AFCA 4WFHA 4F4LA 2OCCB 2EILB 2DU1A 2GH8A 1F4NA 1IBKO 1XUQA 1VBB1 4QDRA 1XSQA 4GWJA 2ZMNA 2AGSA 2Y48A 4O4LB 1SLAA 1OUSA 3AZXA 2ZGLA 4DV1B 2XPJA 4ORFA 1W9SA 3PJQA 2RDRA 4DV5O 1LEDA 2P6JA 4AEDA 1YFXA 3AMMA 2UUCB 3GBWA 1CAWA 2NN4A 3CJHA 1S4CA 2A06H 5FTTC 3DXTA 1VBD1 4O2BA 3S57A 1QEXA 4EWAA 4OVEA 2E53A 4ZXEA 1ZZBA 2K9PA 3H7JA 3ZXLA 2E3CA 3VBOA 3IAYA 2W1SA 4FLXA 5FUPA 4F83A 1XXNA 3WP5A 2PFWA 1ZREA 4YW2A 2ZPXA 3ETGA 3TYJA 4ZHNA 3MHHC 2UXCO 2GNBA 1H6XA 5FKCA 3H3ZA 2EIEA 3KQRA 4Z2AA 1GWMA 4INDA 3N4MA 1QJFA 4NROA 5FZMA 4QPYA 1H38A 3H1LH 5ITZB 4DR7B 4UFKA 5T50A 3HB3B 3B09A 5F6LB 1I7FA 1FS0G 4JTNA 2OVUA 2B9ZA 1UY1A 2WR9A 3UGHA 4LKFA 3O12A 4PDWC 3POBA 2YBKA 3ZXEA 3H8UA 2VQFO 4N7UA 4DR3O 5I0RA 1JS9A 3USSA 4GT1A 3T2OA 1BBT3 2Q4SA 1YJLA 2CWMA 4LWSA 1WCUA 3VDDA 4CEYB 3FKSG 5F2SA 3WNPA 1QXPA 5C33A 1QXJA 4GWIA 2VM9A 1UFIA 4XQWA 1JYTA 3ETQA 3IPVA 3X29B 3WLUA 4CDUA 5A7PA 5FZ0A 2GTAA 1UKRA 2W47A 2N7GA 2WLKA 4FPKA 3VBSB 1SCRA 2FDGA 4JGYB 2D3SA 3UO3A 2Z5UA 4LA2A 1EBOA 1PIV3 4DS0A 4JAVA 1O5LA 3JATB 2MHFA 1BQZA 4IGQA 5CBFA 2WNVB 4ZU4A 3JXSA 4GXLA 1L7QA 5CB7A 4AVBA 5DN6G 1W3XA 5EK0A 1UAIA 4YZ3A 1RUJ1 4ATEA 3WDVA 3KWVA 4FM0A 5BYNA 4B4RA 1SZBA 1D0GA 1VAMA 2JD9A 1URFA 3AMHA 2C26A 5GJ6A 5T5LA 4YVWC 3EMRA 1XHXA 4ONUA 2WN2A 2CAZC 2Y6JA 5F8PA 4PA6A 5KX5A 5F39A 5JDBA 2PELA 1NTZH 2WSVA 1VARA 3APQA 4B7KA 5FZFA 3FLPA 1ND3B 1WBLA 4GX1A 2GNTA 3BALA 3UT0A 3O1UA 4X9QA 4LMFA 5IK7A 4FFFA 5K4LA 4AEKA 4PI2A 1D7PM 3WDTA 3TNPB 3GZAA 1FYJA 3FC0A 5JOYA 3SJAC 3JSNA 1ST8A 2K46A 3WSOA 2JKXA 1YFYA 1SDWA 2JDAA 4LIUA 3POFA 3ALQA 2QVSB 3NNFA 2EJRA 1GQPA 1W8TA 3MV01 1KS5A 1FNZA 1PNMA 1UPGA 2AH2A 5IAVA 3TEWA 3HT1A 2RDNA 2WS91 1FOD2 1D5NA 5GALA 4I9QA 1QVFU 4LFCO 1POQA 2CTPA 1A8DA 2OZJA 4BLIA 2D3PA 4ARYA 3E5UA 1GKBA 2XNDG 4X6RB 2Y33A 1FFXB 3R65A 3LSSA 1DGRN 2B42B 5GZGA 2CDOA 4RN5A 1N36O 2ZNJA 3LGRA 4DK1A 3AZYA 1UKGA 2A1XA 3J81N 4BR6A 4O61A 3KV9A 4PDWA 1OH4A 4BW9A 2E26A 4B3TO 3VZJA 5JPMB 1R3IC 2G9FA 4Z8BA 5DG1A 2YY1A 4FP2A 2OYQA 3KLSA 4H33A 1G86A 2JIZG 3LSQA 5I0DA 3POWA 4IIJA 4UVCA 1XPWA 4L8JA 1TGOA 4G28B 1RUH2 3Q8FA 5LA9A 3QO8A 3CE2A 2QDRA 1XL4A 2P67A 3M1HA 4QPIC 5L3BA 3PJSK 4C0HA 1YIFA 3RYFB 2CAVA 4I55B 1AYN3 1R093 1H8TC 3I97A 4D8MA 1RITA 3K04A 5FPVA 3IN9A 3H1MA 1KFUL 1VLNA 4R9BA 1RVF3 3OY8B 3VDCA 2R72A 5DZGA 3OYWA 5AFEA 1K3EA 3MW4A 1ND2B 3OBZA 1HNWB 5FPXA 3BU7A 1KUQA 1W28A 4YVWA 1LGBA 2B39A 1PMHX 1BVVA 5LK5A 1BYHA 4NN0A 4XF0A 3F7VC 5HXVA 1C28A 2ARBA 4X8NA 5FXXA 1K5QA 3JALA 3OGGA 2J1RA 1PK6C 1M9NA 3T2TA 1DP0A 4QXBA 1OOPB 5LMNB 3VD9A 1I9RA 4YLZA 2LQTA 2VPVA 3ZRXA 2X6BA 4FI9A 5F3EA 3U4SA 1TME3 1HRV3 4MOAA 2A75A 4Y1ZA 3ECQA 3AKQA 1GWLA 1H2KA 1H0BA 5D8AC 5DAVA 1ALYA 5H5NA 5IYCO 3JCUZ 2WZR1 2Z42A 3PTRB 3GBFA 4GH4C 4LH7A 4UT5A 4K35A 3CX5F 5FY9A 3PUQA 1NR1A 3HKBB 2CY6A 1HB4A 2JIGA 4MGZE 2YC4A 4Q0SA 2R32A 1H8EG 1YQCA 5T52A 4QB6A 2H8PC 4L87A 4BYYA 2EAAA 2YU1A 3VDAA 4QGPA 2BTQB 1DHKB 4AGRA 1QJU1 5GTIZ 4AI9A 4QB2A 4HNAB 1QOSA 3LSDA 2Q68A 1F51A 5BXXA 3DL3A 3ACFA 3WDXA 4UYBA 4PCRA 2C0ZA 1Z2GA 1JMUB 3JARB 4Y5Z0 1AR71 3MLKA 1VRH3 4HMZA 2A7AA 3H0OA 4IV1C 1JODA 3KZ4C 3FZ3A 3FFQA 1CAUA 5KR7A 3GWOA 3LDRA 1DZQA 1OCZC 2YROA 5LXTA 4QPIA 1I1EA 1VF7A 3USUB 4P9YA 1P7GA 1YXWA 1M56B 1VBB2 2VCCA 1W04A 1WD3A 1PO23 1PL4A 3IIAA 5C3SA 4J1WA 4FPFA 5A33A 3FUQA 1H8TA 5FLXN 1WA8B 4PV1B 1AL23 4P5HA 3Q4HB 5FY4A 2QFEA 4OXSA 2F4VO 2X6AA 2HBTA 2R041 4R6ZA 3BIEA 3L71H 1IS5A 3GZUC 4GB31 1QJX3 4GJYA 1SEFA 3K4DA 3STZC 4AFMA 1VBD2 1FJGO 3NO8A 1N33O 3HVDA 2VNOA 1OXCA 1FFTB 3HKCB 4WFAV 1TEIA 4UVBA 1V6KA 2C24A 4LBEC 1PK6A 1UJWB 1XQNA 5JQGA 1XB9A 3ZIAG 5CFCC 1L0NH 1LTEA 2UWBA 5FPLA 4JHZA 1IS6A 2WO2A 1AR61 3JD1A 3T2PA 3RI8A 4NE9A 5C70A 4DRXB 3AK2A 5LGNA 4J9YB 5A2QN 2QBXA 3OPTA 3AYDA 5D8AA 5EXOA 3ZXFA 3ETPA 4TN7A 3W7TA 1G9FA 4GH4A 2W9XA 1XRUA 3RMYA 2VQEO 2OCCC 2JDUA 1E5HA 3W58A 1J5EB 4JI1O 3BCCH 2BOIA 3ZN1A 1H1IA 1PNLA 2E63A 4LPLA 3O0VA 3FMGA 5CZKA 3WW1A 2A3WA 5AC93 2Y26A 1SA0A 2E7AA 2RNBA 3K79A 1NYWA 5JJEB 4I4TA 3DF0A 2UY8A 1O9HA 1I94O 2D7FA 1VQ8V 2F4LA 4XFFA 1JHNA 4X64O 4JV5O 1OA3A 2BJSA 4JI5B 4L9BA 4GZRB 4NHMA 1HRI3 4W4KA 4RGKA 4XW3A 1RUC1 4XF1A 2BNNA 2WLLA 1VP7A 1GN2A 4CP2A 2QWOB 1ASJ2 4IV1A 2L9LA 4EZHA 5DXDA 2X8KA 1CPNA 4UAPA 4WM8B 1WA4A 3BUCA 5T55A 4LUKA 1OVPA 3A21A 5IYZA 5A7QA 2CSGA 3PLQA 2BV4A 1H2SB 1YJKA 5CA0A 3E8HA 4YWAA 3ROUA 4UV9A 3I5DA 1O6UA 1RUJ2 5F3IA 2VS0A 2WLIA 1AJNA 2ZIMA 1YJWV 5L9VA 3E2EA 2EALA 2K0GA 4NMIA 2W95A 3CU7A 4DQAA 4G2KA 4LNVA 4DUWA 4GMP3 1UXZA 2IXLA 4PDLA 1JI6A 4UFZA 5C9AB 3D3IA 4NTXA 3VL9A 2ITDC 1BHBA 4YGEA 3IIIA 5KHGA 2J1TA 2WWWA 2DCYA 3LDCA 5FPBA 1MSDA 4CXXA 3ML0A 5F5IA 3M3CA 2CL2A 4JYAB 3BVOA 3Q8CA 4B3SO 5FPOA 4K21A 1OBNA 4CEYC 1UN1A 2CTWA 2DCJA 3C2UA 2VE1A 3ZXJA 2NR5A 5CFCA 4LA3A 2VL4A 4IE5A 1AVMA 2DBIA 2IU0A 1PZ9A 5FBJA 5LYJA 1Y76A 2FDKA 4Q4V3 3VBSC 3T1HO 1RUD2 4Y5TA 4HYOA 4F8AA 4QX7A 3OMAB 5DPNA 2DWDC 4O2AB 5LB6A 1O7FA 4MTOA 1GMGA 3FN9A 2WNVC 3KV6A 2G19A 3AX4A 4KI5M 3ORJA 3NV4A 3K4AA 3WV6A 2X29A 4JI3B 2CYFA 4LJHA 3VDBA 1C4RA 3RT3C 5TSWA 1BBT1 1UF2C 3ZSEA 2P3YA 4LCUC 4QU2A 3L74H 1ENQA 1ND3C 4HETA 2LFSA 2E7QA 1SDDB 4EZ4A 5JMOA 4DXRA 1K45A 4UW5A 4IL7A 4Q4X3 5FY5A 1L7LA 2KA3A 2JG8C 4AVTA 3IGAC 1YDXA 1RXGA 5FJKA 4GMP0 2XBO2 3HNYM 4B29A 1U5IA 5IVYA 2F4PA 2HWC3 2CGNA 2AZ5A 5H9CA 4E2SA 4GLXA 2WABA 3OEEG 1NH2D 1ZX3A 1PIV1 2C2AA 2Y69B 2D5HA 2OIEA 2BYVE 3B77A 3AYEA 5FOJB 4GKYA 2VG9A 4GKJO 1KYOF 5ITZA 3OBRA 2D6MA 1O3SA 2ZQMA 2HWD3 1XYNA 3GBGA 2RN9A 1VQLV 4FTEA 2VRZA 2WN3A 4WVVA 2B1GA 1E5IA 2WNUB 5D5PA 4Y1UA 1PM9A 4G27B 2ZHMA 2Q0AA 4UWDA 3GHNA 2YG0A 2BP6A 1RUI3 3JCIA 4LF5O 4RA0A 1C3HA 2NYYA 1NR7A 1HQNA 2EINB 3T1CA 4CEYA 2WC2A 3TCUA 1FMD3 4CS3A 2EIDA 2CTVA 3HR9A 3ES4A 3AZZA 2CUGA 2RQ6A 1NCQB 3OE7G 1PHMA 1LENA 2VVEA 3ZIWA 4NXNB 2RJLA 4E9KA 2PXJA 3W9AA 4H55A 4XIKA 3FAVA 4WVWA 4Q0UA 3HNBM 2WFPA 5FBZA 5FCCA 3WUDA 3NVCA 5C8CB 3VBSA 3KCXA 3PMEA 1XNBA 4WFBV 1DU3D 3E89A 2XG3A 1S2KA 2HWB1 4ZOLB 3FHQA 3RW0A 3PMSA 2WNVA 3RZMA 5EZYB 1MOFA 4YPJA 4J42A 4CP1A 2DMXA 1SLLA 1RUE1 1X7NA 5E6HA 1ND2C 1QU0A 4IQPA 2LFRA 2XWBB 2BEOA 2ENRA 4ZPIA 1COWG 2YICA 4YJ2B 1SBDA 4NTYA 2XQRA 1Q6IA 1THZA 1AR72 4CH4A 4JGZB 1ND3A 1PO13 3OMNB 3NKGA 2G4IA 2VBPA 1VBE1 1OOPC 2X7RB 4P9LA 1JQ0A 3OUJA 2VNRA 5GLWA 5T3NA 1AZDA 2V4DA 2JG8A 5JPNB 5KUMA 4B3MO 2W91A 2WUHA 1AX0A 3ZN5A 4OMDA 5LP6B 3N9QA 2Y64A 4FM1A 4JI6O 5IVEA 2YB7A 2UU8A 3V0AA 4OUEA 5DZFA 1R091 2R042 2VCMA 3RDIA 4KHPO 5LA6A 1RVF1 1KJLA 4GB32 5E79Z 1VQ7V 4I9WA 3TEXA 5CIRA 3KV5A 3WF3A 1ZL8B 1ZNPA 4TWKA 2D6NA 2YEVB 2ZACA 3JAWB 1F4AA 3LDKA 4DR2O 1UCXA 1JCHA 3BTAA 4DUXA 4OPHA 5A3NA 2Y6GA 2RG4A 3NNGA 3O1TA 3BB6A 2R49A 4Q1RA 4LF4B 4MVMA 2RVAA 1FV2A 3ACIA 4R8CA 3R4SA 1PM4A 4H7LA 1W2NA 2DFCA 5I0TA 2PLV3 4R9CA 4DZGA 2RS13 2Q67A 3TK1A 4JI0B 3N36A 1HB3A 2ZKNA 1MNGA 4KFMA 1TME1 4XDOA 2ZCEA 1HRV1 1MS0A 2ZEZA 3INAA 3ZEDA 4JAAA 3FB5C 3FX7A 4I3PA 1JTZX 2IWGB 4TTGA 1M56C 5FP8A 5F3GA 4BXSV 1SETA 4OI0A 3KB5A 3RYFA 1DQ6A 4K8RB 4YFZA 1POV3 3K03A 4D6RA 4LR3A 5L9BA 1ZRFA 3EXUA 1OQEA 2ARAA 4PF5A 4XUOA 4ATFA 2VO5A 4CUGA 4LF7O 4QDQA 5IW0A 5LK7B 3OY8A 1S0EA 1YHQV 5BNQA 1ND2A 2VOWA 3OOXA 2QWNB 4QPKA 5EYPB 1D2DA 3EVKA 3M3IA 3PJYA 1F35A 5FP4A 2ZZJA 2YSUB 2EIJB 2VZQA 3SHRA 4DUZO 3ZHRA 5LMUB 2Q30A 4FZ0A 3EHKA 1RUC2 4UI9L 4R9DA 2WAOA 3UNPA 3QBQA 4XF4A 4DXWA 5EJ3A 4UFMA 4HVRA 2E76B 5IJ9B 2H6CA 3K0DA 5EBLC 4P9IA 1VRH1 1YI2V 5B1BB 2VTFA 2IXKA 5CKNA 1NQDA 3D4KA 1OOPA 1US3A 2Q7EA 4X62O 1XNAA 1DGWX 4MW3A 3JB4C 4D7SA 2UUBB 3WD5A 2WLPA 1AXYA 3WW3A 4EQVA 4Y4RA 4FFKA 5IHRA 2ZXQA 2MEV3 4RQEA 1UY3A 4QXHA 1I5XA 3LFIA 2IH1C 1AL21 2AC1A 3AP6A 2UYAA 4IV3B 4CU8A 4XHXA 5LCWL 3KCCA 1XYOA 3J7AU 5CBLA 1QJX1 1TVKB 3VQYA 2UY9A 5LOVB 4YG6A 3CCLV 2Y6LA 4LBJA 4UW4A 4ASMB 4HNAA 5FP7A 4ISRA 3AVSA 3JBG3 1ZBE3 5LGTA 3I2OA 1IURA 2KQXA 2LP7A 1UY4A 1V55B 1G9DA 1POV0 4QX5A 4K0KB 3AZWA 2V73A 1OF3A 5J2UA 1COV3 2ZGPA 2R073 1LOEA 3RYCB 2A5ZA 4WM8C 2AUYA 1JZ7A 1XE7A 3AG3B 1WCKA 5IK4A 1CXZB 3USUA 1MSWD 3BCWA 1G9AA 3RN4A 2UU9O 3BVCA 5FY1A 2QKCA 1SCSA 3T08A 4KH9A 1SQVH 4LC1A 2GH2A 3BEHA 4MVUA 1QHTA 4LEJA 5JOWA 1WA8A 2XL7A 3CRQA 4E2GA 3WP3A 2JDMA 3ILFA 2QZ3A 3WHTA 5KA5A 4KWJA 4LFAB 2XJRA 5GLZA 3M8AA 4CEWB 2DDUA 3I56V 5GM0A 1GZCA 4NR1A 4DUYB 3MYXA 1PGL1 1BBT2 5C9AC 3VOUA 1ZM1A 4OQ9A 3SMHA 1DYOA 2OS2A 5DUUA 1DYKA 4QQHA 1H4HA 2ZM6O 2OT7A 4HVOA 5A7NA 1ULOA 1D2SA 4V2VA 3HKCA 4DYLA 5FZ8A 3C3VA 4M3CA 4QGNA 5J37A 1HRI1 4JGSA 4CCKA 1DTOA 1N3OA 2XONA 5J2TB 2E31A 3WNKA 2XLAA 3QTCA 2A79B 3GYDA 3N9LA 2QWQB 3VKMA 3MAQA 3JUUA 2PHFA 3U0ZA 2UWAA 4ZZ5A 4QU1A 4DW0A 4DK0A 2WDBA 2DVDA 3C7EA 3ZSLA 1SLIA 1GM7A 1PIV2 4DRXA 3NAPC 4A44A 1S77D 3TAYA 4D7TA 3H8XA 5FZ9A 1XMQB 1E79G 2YFUA 5KA6A 1AL0G 3CLPA 5FZCA 4AOCA 4XQ4A 3SPCA 2NMNA 3UGGA 3LA2A 5FYMA 1LULA 2NNUA 5IJ0B 4LLFA 1GM8A 3CP1A 4D3WA 3B69A 1R3JC 3LA7A 2ZGSA 4KWLA 3ZBHA 4I50B 2D2CB 2LW7A 1QIQA 2VGDA 1WMFA 2F66C 3ABUA 4IHJB 3U4XA 4XBFA 3FUOA 4GUNA 3T4VA 3HPNA 2RS53 5J9PC 4JAUA 4DR4B 1I0HA 3ZXGA 1S5JA 3RVZA 4DO0A 2LW8A 2VMEA 2WIIB 1MVEA 4FOWA 4JC1A 5FLIA 2A6VA 4FLZA 4H14A 3L2YA 5FZ3A 1PD3A 3W7SA 1N3QA 2SBAA 4WM8A 1LUVA 1FXZA 4CS2A 4OUMA 4Q4V1 4L2NA 2R7EB 3AKSA 3TWIA 3NV3A 1N34O 3CL1A 3WW2A 5FR3A 1IX9A 3WU2Z 4EN6B 5I8TA 4S2HA 4B08A 1K97A 1JFFB 3I2JA 3PVEA 1JOYA 4FP3A 1ZUQA 3NXSA 2RE9A 1LODA 4LOSA 3MBWA 4BU2A 1EP0A 5JOXA 3J7HA 4MYEA 4DV4O 2XHKA 1AYM1 2F93B 1NU1H 5CADA 5C9AA 1RXFA 4BIFA 2KM2A 5C4WC 3O9OA 3K57A 4BQ1A 1IKPA 2TUNA 4MW8A 5DEDA 3WNOA 4FVVA 5C7GA 4YZ1A 4YY3B 1NE4A 3LIGA 2ZOEB 2AW9A 1IBMB 2EINC 1PNGA 5DMYA 4QXCA 1KQSU 3HQRA 5A3PA 3HD8B 2D6PA 2R6QA 2A6YA 3ZMOA 1NCQC 1OCCB 2P4KA 3PHMA 5K1XA 3ACLA 3V65A 4BQ2A 3FB8C 4Q4X1 4G9SB 3OJBA 4CBCA 3ZDSA 3IFXA 1VBA3 1HX6A 1AYN2 1GNHA 4TT3G 1W8NA 1SPPA 1R092 2HWC1 3NAPA 1I5ZA 3LDEA 2ETEA 2GUZA 3FYIB 1RVF2 5GW7A 4U2AA 2PQQA 1UZVA 1GSLA 2ZAAA 2F23A 3WG4A 4PBPA 4K3AA 4O2AA 1LOBA 2YIDA 4QE9A 4QGLA 4DW1A 1IGOA 3ZN0A 2HWD1 2WO7A 1RUG1 1KKDA 5IVBA 3T1MA 2WAAA 2VU9A 4C90A 1TUBA 1S2EA 1JXNA 4FXGB 4AI2A 1FXKB 1KJRA 5JXHA 4CXYA 2YUEA 1RUI1 2WFF3 3O5SA 3WZ1A 5FMDA 1YF2A 3DUIA 4H37A 1FMD1 3RBZA 1J3PA 4MXWB 1ENSA 5LBCA 4QIWF 2JKBA 3SKJE 4E2LA 4IEQA 5L3CA 4AHZA 1TME2 1AR81 5T5JA 1HRV2 2J1SA 4N53B 3SYOA 5FK8A 4X1KB 3K2OA 4J7KA 5KC6A 4UW6A 4DV1O 4OI1A 4KUMA 2EIKC 2QM4A 4DV0O 1CAXB 2P1BA 2UXBB 4JZRA 4LBQD 3V0BB 2KG7B 2HEWF 2W3JA 3ZSJA 2DW4A 3L70H 2UUCO 3TB0A 5IAXA 2I45A 5FREA 3VUOA 2OUHA 1Q5OA 3E5QA 2QKDA 4NAOA 2WLQA 4PDRA 4DNYA 2DVGA 3AG4B 3H7YA 1O3QA 4GX5A 4ZS3A 2VNVA 2Y0OA 3L75H 1XE8A 4JHTA 4LNUB 3OAAG 1EZVH 3E8BA 1G6UA 3OCPA 4W6WA 3U1XA 1R1A3 5J7MA 3WFVA 1GOHA 3MIBA 4COWA 4COZA 3MW3A 4Y20B 1WLEA 1KP3A 5C4WA 4ET7A 2ERFA 2XUEA 4LKDA 1HP8A 1H2LA 5BNOB 1OV9A 1YNAA 3HN3A 5FWJA 1VRH2 4M01A 4JI8B 1PO11 4UXNA 4A7ZA 3I3QA 1VQ4V 1NCQA 1RUNA 2ZA9A 2W6IG 2GP5A 5D21A 4RHV3 2PHDA 1S0FA 3KCYA 1PVC3 1PO22 2JDHA 1RMU3 4DR5O 4XFCA 2PY5A 3WG2A 4FLUA 5B3SB 1AL22 4LF9B 3BIWE 4P02B 2NLRA 3A0RA 3MIFA 3BKZA 4FT8A 4HONA 4CU6A 4KBBA 5FYYA 5EP9A 4Q27A 1QJX2 1QH6A 4N90A 3AP5A 4D6TH 2PHWA 5FMCA 2YPJA 4YW4A 4H2AA 1EAH3 3JB8A 1W6NA 3FB6C 3LKJA 1QGLA 3OFNG 4YJ2A 3ABLB 3OEBA 1E1QG 5B1OA 3Q8EA 4YM2A 2EIJC 5FPZA 3ZFFB 1HIXA 2JECA 1XNQB 1YYNA 4LE4A 1YJ9V 3LPGA 1HNXB 4HT1T 1W0JG 1SFYA 2PLV1 5E16A 1K5MC 4DR1B 4XE9A 1Y3TA 2HWE1 3CO2A 2RS11 3RG0A 4WFGA 3N27A 1S3JA 3KM5A 2QKSA 4FMTA 1Y6XA 2RDCA 3LEKA 4W4LA 4U7OA 4RQFA 2GSYA 1NH2B 1VEWA 3GNEA 2RS33 3KF5A 1XU1A 2FMYA 2WL1A 1M4WA 3MEPA 4FPOB 4NAMA 1VQMV 4CCEA 2VUDA 4XDPA 4DR6B 3HWJA 1WP8A 2DURA 1NA1B 5A6ZA 1PGL2 5KHJA 4O4IB 2CGPA 3AP4A 1FXHA 4DV5B 4JI7O 4ZONA 3M70A 4ICGA 2HEVF 2QUOA 5CG8A 2XASA 1ZL8A 3G6EV 2MK3A 4GA9A 4F3JA 1Q3EA 2JIJA 2JG9C 1F4HA 4X65O 1Z7S3 3LEIA 2JE9A 3B40A 3GB7C 1K9MW 1HRI2 1KP2A 3EYPA 3ASOB 1W9YA 4TWTA 2P3JA 3WCRA 1MQTB 2Y34A 5GKAC 4IXLA 1W2AX 1W6MA 4MGIE 1V55C 3E8GA 3FFZA 1VIWB 2Z69A 2OA2A 4N43C 1YQ8A 4FPCA 1XILA 1H8VA 1C8NA 1O4YA 3H1KH 1NKDA 1SACA 3K0GA 4QT6A 5JIAA 3AFGA 3AG3C 2UXCB 4D6SA 1JZ6A 2CH7B 3GWKC 1OQ1A 5FUIA 3CCMV 4YYOA 4N9IA 4CCOA 5I93A 4OX9O 2JENA 4MUVA 3K5LA 2X10A 2QR4A 3V64A 1YTFD 5F9TA 2V4AA 1O59A 3S3WA 3P3PA 1QKQA 5CBGA 1KXGA 4CEWC 2ZIOA 3JQWA 2BFUS 3MFAA 2LUWA 1CX4A 4XF3A 4DR3B 4JI2O 2B4KA 3DECA 2WO3A 4E4EA 2BW8A 1JN2P 1Z0HA 3R0RA 3WXPA 1V9U3 2W1UA 4YHHB 4MGQA 5LBFA 3ZIXA 3ZLIA 1UIJA 3M4FA 3JBG1 1R083 4GKXA 5ACA3 2BQPA 3I2KA 3PU3A 4AR2A 2XJSA 1K5MA 5IJ9A 3OGVA 3H01A 5J36A 1LB2A 1SBEA 3SPJA 1VQPV 3JASA 4Q4V2 2VZUA 1BE3H 1K4DC 3NNMA 1US6A 1O3TA 2ZEYA 2R071 2WNEA 3OPWA 1HNWO 4R4ZA 5DDJ3 5BMVA 1JVMA 4NPRA 1V0AA 4ISQA 5I0UA 2JEXA 4CC6A 2GC2A 4LLOA 3N9PA 4IW3A 3QD6A 2XTAA 3HBKA 1JX9A 4HK8A 4J10A 4UBHA 3LUTB 3FD9A 2RCVA 3Q9OA 2Y0PA 1SG3A 3CEIA 2WZ8A 2Q7GA 1IOAA 1AYM2 2RJZA 4CCLA 3RI9A 4BIOA 4W50A 2J22A 3HN1A 2JXAA 4S2DA 4LF6O 4LBKA 3CS5A 2UXNA 2ZD9A 4XBLA 4NIIA 2JG9A 1ZRRA 2WYSA 1TNFA 3LIHA 4PA9A 2ZEXA 3TOJA 5FZDA 4YRDA 3P32A 1FPN3 2ZE5A 3U75A 3RS6A 4NIHA 1WLDA 1REEA 1EZJA 4Q4X2 4RS5B 1RGSA 5EYXA 2ARHA 2ZAHA 4UCTA 4N43A 1RYYA 2EXIA 5DQ0A 2HWC2 2BPA2 3VN4A 2YHJA 1DQ4A 3RYCA 2IFRA 3PDQA 3MIGA 5LASA 4NRMA 3OTOB 3AVRA 4LO8A 4P9OA 4A42A 1JUHA 1CPMA 1K34A 3OEAA 5IVFA 3GCXA 1W0KG 4EJRA 5FRAA 2HWD2 1DF5A 5KAIZ 1N36B 1DLBA 1RUG2 4NKGB 1IG0A 1PMIA 4YJ3B 1Y9QA 3H1WA 3ASNB 2HWF3 4JVAA 4ZY9A 1EYBA 2Q4PA 4B1LA 4CEWA 2EIMB 3F5TA 3LPFA 1SKVA 1RJ7A 2X5IC 1YUDA 3N2KA 1RUI2 4G4FA 3OUHA 1FMD2 4RSUA 2FMDA 2UYBA 2RS51 3EQEA 1G9BA 1WN7A 3MICA 5F5AA 5J1XA 3OUIA 4CC5A 2BOCC 1AF9A 2B8MA 2HHHO 3MLLA 3KGLA 1H2MA 1OCCC 1OPMA 4QPJA 4QDSA 5EIBD 1RSOB 3QCWA 3A0HZ 3OT7A 1SFPA 4KWKA 4IYIA 3S6PA 4P30A 2QQWA 4XOGA 2KD7A 4A6SA 1V54C 3ZMZA 3IMMA 1D4VB 1FAYA 4PHZA 1T5EA 1KD7A 2XR4A 4EN7B 1W8OA 1LHOA 4PJYA 3VV1A 1VE0A 1H1AA 2W39A 5A32B 4YARA 1ULGA 4AYUA 1YITV 1H6YA 4FFBA 3NNLA 1OCRB 1RHI3 4JKKA 3MDPA 3HQUA 4ASKA 4D7YA 2VMDA 4YW3A 2V4VA 2QM7A 4RUEA 4AQYO 1FXKC 1I6XA 1PO12 1FOD1 1S72V 3ZFEB 1LNQA 1SZXA 4IHJA 1SQXH 4XUQA 1F2NA 3SCGA 4ZU5A 2HKXA 1W6OB 1W0NA 1OVSA 1J5EO 1QLNA 3AC0A 3K9AA 5J3UA 2IW5A 4XFHA 1YFUA 5BR8B 1DGSA 1VF6C 1W9WA 1PX4A 4N7IA 1NLRA 4W6XA 4BISA 1CQ9A 3J7NA 3MUY1 1HV0A 1EV13 1JYXA 4AQTA 1H4GA 1O4TA 1ZYBA 4JI5O 3ABKC 4FAHA 4BQWA 1VIBA 4EN9B 4HSLA 4E4DX 3AYCA 1B6QA 5FLHA 2VNGA 1BL8A 1JFFA 3JCZA 4AK3A 4AQSA 5FYUA 1Y7BA 2F17A 2Y0IA 3L2HA 2X5IA 4NXMO 3MI8A 1JYNA 3ZRVA 1VQOV 4C1WA 3OGRA 3RPQA 3BTYA 4Y5SA 2PLV2 1W99A 3I2FA 2HR3A 3RJRA 2RS12 2ZGMA 1CIWA 3VZOA 2QJVA 1IQAA 4DPNA 5KXDA 2QQVA 3TGUH 3VD4A 5DUXA 4ZI7B 4KU8A 5FLJA 2OUJA 4IGGA 2PHLA 2K1EA 1ENXA 4X20A 5CA3A 2VQTA 2VMCA 4Q1PA 4IEUA 3WEZA 3IC7A 4QGMA 1BZKA 1GZWA 2VOVA 4FVMA 5DABA 3AL5A 1NCRB 4DFSA 1S0JA 4JYAO 2GHYA 4XZUG 3NRUA 1DZRA 2SLIA 3CCEV 1CJPA 2ID4A 4B3RO 3BI3A 5JI7A 4UUJC 3R4DB 2WT2A 2UXDB 4UCVA 4A4AA 1QLEC 4HKOA 2BRTA 2XB6C 3UM7A 1R1A1 2JEMA 4CUBA 2QNKA 4XCBA 1OKQA 4QXKA 1GN3A 1FJGB 1JMKC 4FFIA 1JOBA 3CBNA 1FXKA 2VUCA 4CU7A 3AM2A 3I3MA 5CNAA 3ABLC 5D2AA 5ERLA 1AJKA 2V72A 3SNMA 3ZFFC 4C91A 3FYEB 5D5QA 1DQ2A 4UOJA 4YGDA 5C8YA 4WBNB 1Q82W 1VPHA 5FYZA 4MXWA 2P6HA 4RQPB 2LW1A 2GAUA 3CSXA 2Y60A 4S2GA 2UXXA 1C1LA 5LRSA 1VQ5V 1LHUA 5C3PA 2R1DA 4HL0A 1VF6A 3VD7A 1A6CA 1H9WA 3FHIB 4X1KA 5FY0A 1OLRA 2HP8A 3VZLA 1PVC1 2HJIA 2A0LA 4JI3O 4B3NA 3HIFA 3MPBA 1M57B 1B35C 2KG7A 2W5FA 3U10A 2VQEB 3CNAA 3K06A 4CP9A 4JI1B 4HKLA 1MS4A 2JB4A 1Y74B 4P9JA 4ZKIA 5HI0A 4YZ2A 4LP8A 3E6DA 2ETNA 1QCEA 4FQZA 5IFTA 1ULCA 3POGA 2LTNA 4DXSA 4IETA 3H42B 3KVAA 3GZEA 1I94B 2IM9A 4A7YA 2DYCA 3JBG2 4JV5B 4J41A 4JDNA 4QHBA 4IEVA 4K8FA 4LUMA 3ASOC 2XKPA 2VCAA 2C6SA 3RYRA 3OR6C 2HVKC 3BTZA 3WOGA 4J25A 2VC9A 2ITCC 1COV2 4OHWA 5B1NA 5FNVB 2R072 4QQ2A 4PA7A 1RUF3 3ME2A 4PBOA 4XCAA 3B00A 4WFFA 2RV9A 3D6EA 3WT3A 1KU9A 4JI4O 5C71A 1JYCA 1QOTA 2RS31 4TOIA 2XVKA 3NWKA 3NKTA 5LATA 4RFRB 4TSFG 4YSFA 3K77A 1L3JA 4BXFA 4Z92B 2XQXA 3WNLA 4CVUA 4D94A 2TNFA 4XMIA 3KG2A 2XAFA 1XHZA 1D5AA 3WB2A 2D40A 3AG7A 4EKWA 1H1MA 2ZNIA 1PM7A 1M1KW 3FB7C 5FO9B 3OEHG 3S7EA 2O57A 1VQ6V 4MTXA 1LGNA 1AXKA 1ZZ7A 3B9CA 4CSWA 3RZGA 3MHSC 2F6BA 3M7AA 1HWYA 1OHHG 3N2GB 4UF0A 4K8ZA 2WT0A 3IDBB 4B3SB 1QJY3 3K08A 3FLTA 3B9IA 2QQMA 3S5QA 4DV3B 1OZ0A 3ZFFA 4I0XB 3WVJA 4XQDA 5GLUA 4MGSA 3WG7C 1LHWA 1NY71 4LXLA 2AR6A 2WZEA 3PVNA 4LBQB 2Y4TA 2MPFA 3N9OA 4QWNA 3K5NA 2W1QA 1PV0A 5F7UA 3VBBA 3QOPA 3D5OA 4PJ0Z 1ENRA 2CK3G 4OHVA 4MX3A 1YFWA 2FD8A 1NBMG 4CPBD 1JOPA 1B35A 4YG3A 1BGYH 4BLJA 4R52A 2VQUA 2VCBA 2R0FA 3VBUC 3ZCCA 4PLNA 1UOGA 2YYOA 1Q43A 2D5FA 3I2HA 1ASJ1 3ZS8C 3CC2V 3SDLA 1NX9A 3UESA 1GO3F 4O4IA 2AHZA 5LGUA 5F37A 3I3EA 4LBMA 3MZHA 4XBNA 5FMOL 2RS52 3GDBA 5CA1A 3K4ZA 2D97A 2ET1A 1D2QA 2VOKA 4BAYA 4CTEA 5ACA1 3WF0A 5KWRA 3PIJA 5K8SA 2XAJA 3WF2A 3MV11 3KQ4B 5CA6A 2ZX3A 3LE0A 2P4EA 3NMBA 4RS5C 4DV6B 1NTKH 2V5YA 4AEDB 3OBTA 4L92A 1XU2A 1V6LA 4HN1A 4X89A 4K1YA 4NHYA 2R9RB 1ZZCA 3MPPG 3SCHA 5DDJ1 2C9KA 2HG5C 1C8M1 3CJIB 4O2BB 1OCOB 2IFWA 4L11A 2CH7A 3ETDA 2PI4A 4QJFB 3OPZA 4LF4O 1R1BA 4FBFA 4MVZA 2F95B 4GKKO 4GKJB 4AW7A 2R063 5LY2A 1GV9A 2QQLA 2P5BA 3VBOB 1EFRG 4JYCA 2D93A 3LA3A 4GD4A 1FPOA 1W2OA 4X1IA 4DEQA 2EIMC 3B93A 4Z07A 1V6IA 3CHXA 4FLTA 2BBVA 1UYPA 1RUD1 4X66B 1HR0B 4LF5B 3UGFA 1CP9A 2A71A 1QQP3 1CGPA 3C7GA 1IVSA 1FPN1 2D44A 3ZPOA 2FZ2A 3U07A 1VBB3 1LCLA 2RR13 4M00A 4XAAA 4NWVA 3ZN6A 1V70A 4RR3C 1LKNA 2GV9A 4HK9A 3CWBH 5H6RA 1A8MA 2W0FC 4KG8A 5KXBA 1VBA2 4C1XA 3ZKUA 4UFLA 5CFDB 2ZABA 2Y38A 3DEMA 5DG2A 2D3RA 1X4TA 4R50A 1Q8OA 4QAWA 4LWSB 2VW2A 1SQ4A 3VDDB 3A7QA 5B1AC 3VGIA 2NZ9A 1NI8A 2NQYA 3WINE 1NT2B 3AMQA 1VBD3 4FFGA 5EBMC 2JGUA 2CV6A 4IEZA 3VBUA 2IJKA 1BHGA 1K5SA 3SCFA 3SQOA 4PA3A 4WVMA 3IPVB 2VZSA 1GN6A 3B5LB 4META 1HJGA 4QX0A 3X2QC 1G1XB 2NMOA 4CDUB 2Y6HA 3HT2A 5L9RA 1X36A 1NG0A 4E2QA 2HWF1 1BK0A 3H8OA 3I3BA 4N9HA 2ILMA 1N47A 2XBO1 4EN0A 4OGQB 2UUBO 3PU8A 4FXKB 2WFF2 3WQ1A 2OWOA 3KF3A 3VD5A 3J8F1 4AVCA 4KMQA 2QWPB 1NZIA 3VZKA 4IEPA 2GTSA 3GZTB 3ZFEC 4JPRA 4QX3A 1B04A 4U36A 3I8TA 3UYJA 2DTYA 4Q6GA 3VBRC 4OMCA 3RYIB 3R66A 2QKAA 1Y9MA 4H7MA 2Q8OA 1RJ8A 2Y4UA 5HCBA 1N32B 1K7DA 4RS5A 4HPKA 2ZKLA 3RYKA 2A3QA 2L6LA 3TJTA 5B5EZ 4FPLA 3DXRA 1BK1A 3H1YA 5FK7A 3EXAA 1XEQA 2P17A 5F3CA 3AJYA 3G80A 4PLMA 3KVBA 5FYSA 2E6VA 2E5LO 1UD1A 4LOTA 4BQ4A 3L73H 1YTFB 3KKYA 4YIPA 4MTFA 4KHPB 1UX6A 1WW4A 3A0KA 2HLEA 5FZHA 4UVAA 5BNNB 1OUXA 4XFIA 1R1A2 3FL7A 3POEA 5BY1A 4K0KO 1F5FA 4K20A 3M2MA 5LY1A 4Z1VA 4YJ3A 1RHI1 1KEXA 4MVRA 2O8OA 2DYSB 2P4VA 4NUBA 3G7DA 4DR2B 5CBHA 5JH7B 3LNNA 5IWAB 4M3CF 3HR0A 1UYXA 1JZ8A 1UQXA 3CXCU 1ODMA 1XOYA 3O0WA 2DU0A 1WUVA 4LORA 4Z2WA 1W2BU 3GHMA 4PD4F 1CX1A 1E57A 2ZGKA 2GSMB 4G3YC 4XJ8A 4RHV2 1WW6A 1VF5B 4RR3A 2X0LA 1PVC2 4EEQA 3ZHUA 5CISA 4LFAO 3IWZA 4PDWB 3EFFK 1P84F 4BQ3A 1BMFG 2Q0OC 5CKQA 2VVFA 3ZN4A 3B3QE 5ABJC 1RSOA 1JZ3A 2BUKA 3LWCA 5IUQA 1EV11 4MTGA 1MR5A 1TUEB 3VBHC 3QF7A 3RMXA 2NN8A 5ANNA 1NCRC 4Q4W3 2QE7G 2JICA 3WQ0A 3GVMA 4QMAA 5FZGA 1YCIA 4EFEA 1XNDA 3N9NA 4GZ9A 1T6BX 4YVSC 2FBEA 1EAH2 1D0HA 5A32A 3ETEA 2HH9A 3WW4A 5JXGA 3P5BA 5EPAA 2DWEC 2A3XA 5A7WB 1VMGA 1DYPA 4JYBA 1STMA 1DIWA 2I2SA 1BEV3 4DUZB 2FB5A 2JE8A 2WS93 1REDA 3RWNA 3ZFEA 2VMIA 4Y26A 1LHNA 4TQFA 5I0SA 1XMQO 1IPSA 2A7WA 4ASLA 3RWRD 3VQXA 3ZRSA 3VBRA 4A3ZA 2JDZA 1W6OA 5IYYA 1X8EA 3JAMN 3OYWB 5FAXA 4RQPC 3DCQA 2QCSB 5J96B 2GNDA 2B45X 2RS32 2Q69A 3HJRA 4YVWB 2CGOA 3APOA 2GBOA 4M0NA 5APAA 4XJWA 1W59A 3TXSA 1YJNV 4NHKA 1M57C 4JDMA 4QX1A 3AG1B 4A3XA 4R9AA 1SF9A 1P8JA 3J80N 4CH5A 2YIBD 1W0OA 1O8SA 4YM0A 1XSRA 5M0TA 2XJQA 3JYCA 4TV8A 3AG2B 4DR4O 5FZOA 5HCAA 2YUAA 3QO5A 2OPWA 1DLLA 2W2IA 4K1ZA 4AHYA 3H1HH 2WQ4A 4TV9B 5FYVA 4AFAA 1M5IA 1MG1A 4SLIA 1LOFC 4J7ZA 3W7UA 3C3TA 4MH0E 2EILC 1LHVA 3THPA 2VR4A 5SV8A 2VUJA 3SLIA 5LHGA 5FPRA 2AREA 2VWKA 5JXJA 1NY72 1JU4A 3CRMA 2WYFA 1HJFA 1BJQA 4XUNA 4I01A 2HJDA 1XNKA 2PZSA 3WB0A 1I5PA 4JTDB 1J95A 2BNOA 4ZI7A 3LOIA 4XDKA 3O1OA 2V1DA 1D4M3 2BTVC 1GKFA 5FWEA 3MLJA 1PPJH 5ABJA 2H6BA 4CU9A 2PHRA 1R73A 3E22B 4LBLA 4EE2A 3SYCA 5H2FZ 3VBHA 1NCRA 5A3WA 3LEMA 2PAEA 2DN9A 4XIOA 3GXUA 5IT9N 4QX8A 4BZ4A 3THDA 5LL6Y 2VECA 1OLME 2OKXA 3DSQA 2VH9A 3O7OA 4YGBA 4YVSA 2DQ0A 1WWYA 5LXTB 3C8XA 3ZMSA 1V9U2 2RMU1 3ZDVA 3IDAA 3E97A 1TE1B 2BNMA 4D0QA 2ZM6B 4MHRA 4LHSA 1OH3A 4DY5A 1WPBA 4JASA 2WZR3 1AP6A 1R082 5GONB 5ACA2 2PYTA 1R6NA 1H8TB 3OBAA 3RZKA 5E89A 3ZHVA 4LKSA 1JPXA 3AFKA 5D1IA 2ARCA 1NKGA 2HEPA 1MZEA 3IJ4A 1U12A 4RQPA 1K42A 2C4XA 5DDJ2 3H9AA 5IK8A 3MD0A 5A6XA 4Y1XA 4O4JB 1C8M2 3H9VA 3UKTA 1WAZA 5KLVH 1QJU3 1HDKA 2RMKB 1Q8SA 1AR1B 5EJ1B 4NB5A 3T0BA 2ZJCA 2XAHA 4AI0A 2LO1A 5JIUA 1QNYA 5JMCA 1AX1A 1J59A 2BERA 5EYYA 5JQGB 1S0VA 2P06A 1AR73 3GJBA 4BQ5A 1NVPD 4HN0A 3QH6A 4OYUA 2JEUA 1ZA4A 1Q6HA 4JGYC 4DIQA 1UU4A 1JHJA 3ZR5A 4BWAA 4QHOA 2VULA 4Q0QA 4CCJA 4CCDA 1WLCA 1LOFA 5HFMA 2P3KA 1Q7YW 4AI3A 3F95A 4XXPA 4UFHA 2P22C 1FPN2 1IHMA 1OD5A 1ZRIA 1R64A 5FKBA 1XREA 1J58A 4GH4B 3ST7A 4ES9A 5FDBA 1QJY1 4M0HA 4WVZA 2EICA 1OC1A 3WP4A 1DGWA 3CRCA 2YI8A 4O4LA 2DVBA 2Q73A 3E5XA 2VZ3A 4BE3A 3BPZA 1MA1A 4FM2A 3ZMNA 3POYA 1SA0B 2XJTA 3EO6A 1OFNA 1AR5A 1JU3A 1NJIW 3S5AA 1PGW1 2ZZQA 1Q8VA 4URAA 1RIRA 1S0BA 2VOTA 2ZE7A 5LA2A 2LROA 1N34B 4XMAA 5FJHA 4IEWA 1JZ4A 4P08A 4NO4A 3CJIC 1JZ2A 1YWKA 1OCOC 2Z0AA 1JW6A 5A3UA 3BA8A 3PIGA 4UCSA 2HWF2 4FPYA 2ADDA 4IV1B 4FLVA 2QJ1A 4JKMA 4XDLA 1MACA 4DV4B 1OCZB 3OD0A 5G05L 1AR63 1KKCA 1UX7A 3J8F2 1AJOA 3ZYHA 3JAKB 1UL9A 5FYHA 4U3FH 4LHKA 3PL0A 3WDUA 3WX5A 1US2A 1TA8A 4QM9A 2ATKC 1J84A 2DTWA 3RSJA 4V1PA 1GR3A 2ZX0A 1NOVA 3UKMA 4XZPA 1N0JA 3E83A 2ZEWA 3QH7A 1ONAA 3TRSB 3IT8A 1REFA 2WNOA 3J7MA 2R0HA 1NQTA 2BGPA 1HNZO 4FLWA 3NQHA 2ZT9B 1K73W 2VJXA 3AB0A 4CUAA 2BTOA 4LBQA 4X88A 3O65A 2CDPA 2QE3A 4XACA 5CFDC 4DB5A 5DUWA 3AK3A 3AKTA 2ORXA 4A5UB 3CCQV 1F31A 3MF9A 3O1MA 5FXWA 1PZ8A 2VD7A 4XF9A 1F8VA 1MMMA 3ABZA 3A23A 4ITCA 4KGGA 2XKOA 3VZNA 1IBLO 3TNQA 1WMEA 1GRJA 5F5CA 3CZJA 1MZFA 1RHI2 2R061 2Q6AA 2I07B 2PMWB 1U0AA 2M6YA 4A41A 2PHTA 2WINB 1AP5A 4JGYA 1DQ5A 3POIA 2RDQA 4FPJA 5CEHA 5ANQA 3ZVXA 2FTKA 3OR7C 2DFBA 2RJ2A 2WQZC 3CQOA 2V09A 1LOAA 3JATA 1UPSA 3MUZ1 3UT5B 1YRZA 4Q5OA 1Q6UA 1XJAA 1EN5A 1QQP1 4Z1MG 4LO6B 2IVIB 3I3DA 4PIYA 2W1WA 4C0BA 2C5DA 2VBBA 3I2IA 2RR11 3G67A 4LBNA 2EJ7A 3MFCA 4DR6O 4I7ZB 1W6QB 1NS1A 4QNHB 4NPMA 3CB2A 2GMEA 3BGAA 2KXLA 4DV0B 3AZVA 1EV12 1M06G 3CC7V 2OTJV 1JR9A 4AGGA 5I8YA 3DGTA 2Q5ZA 3B2EE 3BODA 1VAKA 3UJOA 1DK1A 2IJIA 3CJIA 4IEYA 5T54A 5I91A 5FPUA 1VALA 1JJ2U 3BOPA 1WP7A 2D6OX 3K46A 2BU9A 3D0SA 4X1YB 5KBFA 1N3PA 4XUPA 1NTMH 3DV8A 3FBYA 3NR7A 5BNNC 4KGQA 2H94A 3SYAA 5FZKA 1Z78A 3BFRA 2DVAA 2YBSA 4MXVA 2JVDA 5JVVA 3HBZA 2DYSC 4B8EA 1AYN1 3MGUA 2HKOA 4XETA 1G7YA 4Q29A 1K8AW 3ASIA 2YU2A 5A1LA 4N21A 1FFXA 3NJVA 4E4SA 5J98B 2VUAA 2Z79A 1W90A 2WLHA 2VTXJ 3SISA 2DVFA 3OGCC 3U37A 3WUCA 3VHOA 3ZM8A 5DAXA 2DBNA 5A3MA 4AI8A 2EZPA 3M8LA 3HMYA 4AAPA 4F7ZA 4XJ9A 4QKBA 2VW0A 1YVWA 2GU9A 5CFDA 3W59A 4DR5B 1QH7A 1NXD1 3AXDA 2NP0A 1SRYA 5FV3A 4YHHO 4IDZA 2JE7A 4W8JA 1ULEA 4OI2A 4W4ZA 3UETA 5LHHA 3IDCB 1PX3A 5KHKA 5TISZ 5IFPA 4LO4B 3FAVB 3QACA 4Q0PA 2LS6A 2O0OA 1KFXL 1Q81W 2CWSA 1LU2A 3ZYJB 4I55A 2DUPA 1QNMA 4CH3A 1X82A 3AYAA 3BA9A 1E5RA 2B7YA 2ZXWB 5JCOC 1U96A 2Q5TA 4IE0A 2AEZA 3VKNA 4HFSA 3O1SA 1PKXA 5JZGB 2W0XA 3Q8AA 1GP5A 2D6KA 5JOZA 3JD73 2MNGA 3VB9A 3CZUA 2BWCA 3RYIA 4DUVA 5L3GA 4DV7O 4ZIBA 5E88A 1B3QA 1G4YB 4N23A 4OUSA 3VLBB 4EWEA 4H13B 1R1ZA 1JH5A 2YBPA 4C7UA 3TN93 1YLLA 1CPYA 1Y4MA 3TETA 4R7CA 3AXEA 4E4HA 4A45A 1NZ6A 1PVXA 3E6BA 4MSWC 1OQDA 3G71V 4LO5B 4XILA 1ACCA 1SZTA 3AG1C 1DF4A 4LHNA 4Q4W1 4IERA 4LQRA 2IVJA 4ZBMA 2GP3A 1N1YA 3AG2C 2PQSA 3VHNA 4K3UA 5A7SA 5BNNA 2RMU2 3WQBA 3P6BA 4JI7B 5LWBA 3VKLA 2JG8B 1RINA 1GANA 3D0JA 5CB4B 1Q90D 1PO21 3SC7X 1A3KA 3NJXA 4LK6A 2VZTA 2R1BA 3MHZA 4X65B 5LBEA 4AI1A 2JDIG 2Q8VA 1BEV1 5JH7A 3V0AB 3BRCA 5JAXA 5JWPA 3CPWU 3OTOO 4KP4A 1SC5B 3DKQA 3HKBA 1O91A 3SR2C 1WD4A 3L9DA 4O4HB 1Y9GA 1VQ9V 2HWB3 2JK5C 2IXJA 3ES1A 5LA6B 1UMHA 2UUAO 1QJZA 1RUF2 4FO9A 5JJJB 4BMBA 3ILNA 2VY0A 2VZ1A 3DGEA 1HB2A 2KSDA 5C3RA 3WP6A 1ZBA3 1A78A 3ATGA 5EIBC 2BTQA 1RUE3 4CCCA 3H1JH 1MS8A 1NXMA 4LULA 4O7XA 2EULA 1SQQH 3QLQA 3T4DA 5LRRA 2DF7A 4I30A 3L72H 5FZ6A 3U14A 4Q20A 3OGJA 5KXEA 2Z5WA 2TEPA 4HLTA 4DV2O 3NJYA 3S3XA 2EA7A 1YIPA 4LIVA 2NLJC 1O4ZA 4QQLA 3JARA 5L19A 1C1FA 4OX9B 3SJBC 1BKZA 1VBE3 2WLMA 2W68A 3W7XA 1QWRA 4MO3M 3VHPA 1ZSPA 2ZX1A 1OPOA 3BN6A 4AILC 4JI2B 2IUWA 4XYXA 4RYDA 4O9EA 1QJY2 5A7WA 1PNKA 1BVP1 3GCWA 1G9CA 3VQVA 4XHBA 3VBFB 3ZYGA 4X8AA 3ZMUA 4KU7A 5FUNA 3DKWA 3H50A 3Q4HA 5JCOA 1VB2A 3OUFA 4KXRA 4FPPA 5AC91 2J1UA 1QXRA 3LZZA 3EJKA 4Y1YA 1GNZA 4EV0A 5C93A 1PGW2 3T1YB 1WBFA 2QDNA 1IKQA 3F5WC 1ULFA 2YC2A 5ISLA 3ZOIA 4FPEA 3KGZA 1D4M1 2PN5A 2OX0A 1AUYA 3BPSA 3J26N 1X8MA 4P2ZA 5IT6A 1VP6A 5C3OA 1VBC3 1UNBA 3K5MA 2QM8A 4NIGA 2FCVA 4NJ4A 4FTSA 3D3AA 5HFLA 3THOA 1LR5A 5FZBA 1XBLA 1OI6A 4MHUA 4LF6B 4J80A 3CRRA 5BR8O 3D82A 2XVLA 1AI7A 4TV9A 3O14A 5BZBA 4RD7A 1O9GA 1LGCA 2J1EA 4FK5C 1WCDJ 2DYRB 3VHRA 1UYZA 1J1TA 4RWUA 1UZ0A 3ZHTA 4XFBA 2WLNA 4LKEA 4GMP1 4OI4A 5CYYA 4Y4YA 2BVVA 3KV4A 5CAZA 3WNMA 1WCQA 2I74A 2IZWA 4P9XA 2QGNA 2IU3A 4XDQA 4RL7A 4RAIA 2WT1A 1UZZA 4GX0A 4XUTA 2P90A 1TG7A 3O0XA 3ZXAC 2LJ2A 3K58A 1Z5WA 4ABMA 1MS1A 2DUQA 1BLZA 3E22A 3UJQA 2ADEA 1TMF3 2R062 3JD0A 3WB1A 2NM1A 3T3YA 4NYKA 3RQ0A 4MS2A 2W94A 3V56A 2QDOA 1UY2A 3HKDB 5J2UB 2VTXA 1S0DA 4GULA 1TZOA 2XAGA 1P49A 3BHPA 4DOUA 1U97A 5FZEA 2YIAA 4LO7A 2BGOA 4BDVB 5EC2C 1UW8A 1CESA 1QQP2 4ZHQB 5JSPA 2IJHA 4A7KA 2Y69C 2AZ0A 3W5MA 1GLHA 4DINB 1XNRO 1W06A 2RR12 4GX2A 2YXLA 1YZBA 4QPGB 3K51A 5GONA 3R4UA 4HSJA 4PLOA 2UURA 2XVGA 4WM7B 3WF1A 4UB8Z 4I09A 3T1LA 2GNMA 1PP9H 5DAPA 2LALA 2HHHB 4FJCC 3B4SA 1OA2A 3VQWA 4P5YA 5LEKA 2WNUC 2J7MA 2UXDO 4NRPA 3N3HA 3VKOA 3WQ7A 3M3EA 3MW2A 1JA8A 4DRRA 4YZ4A 5HBAA 4O4JA 1W6PB 4GAZA 3APBA 2VAUA 2CDYA 2QTSA 3PVBB 3OGSA 4LK7A 1RPOA 4MLOA 2WJSA 3RVYA 1KC8W 4XEZA 1E5SA 1BMV1 2E9QA 2YGLA 4K7JA 4M3CB 1NT0A 1AR93 5GZEA 3ACHA 4AVAA 2EXHA 2D3OW 1HB1A 4PIZA 5C8CC 2D98A 1Z5VA 2L35A 1BXHA 5EJZB 4AQYB 2AHYA 5FL7G 3ZHSA 1OD3A 2W87A 2Q1MA 1BCXA 1KRIA 4P14A 4OFGA 3A22A 4XDJA 3ACGA 2V5DA 5B2GB 4LFBO 4IGPA 2ZR2A 2OPKA 2DCKA 4NRQA 1VMFA 4TYSA 2FZ1A 3H8RA 4LF8O 3RYHB 2BVBA 3W20A 5SV5A 3POJA 1LU1A 3HPLC 3C7HA 1R3LC 4XTPA 2WZPP 3W5NA 2BBAA 2WSUA 2YXHA 2OIIA 1K3IA 4I5SA 5AG2A 1TNRA 2OW4A 4JZ2A 1UXXX 3AP7A 4JGZC 2QQIA 3BTXA 5AVAA 4CZZA 3URFA 3LDDA 3AK1A 4CUCA 2ADPA 1HW7A 1VMHA 1A32A 2VXJA 2ES3A 3SGIA 1VB4A 2CTQA 1W9FA 4F6RB 3FJSA 2ADQB 3D36C 5LP6C 3QG5A 3LDBA 2OYZA 3JD2A 4NXMB 1MEC3 2YZ4A 2OQ7A 4I0WB 1OA4A 4E27A 2G1MA 2QEXV 1GMMA 3JAKA 4Q26A 3T09A 1RM1B 1EPWA 1IXMA 1IDSA 5BXZA 3T4HB 4JF3A 4JQTA 5F2VO 1XC6A 3A2FA 2XOKG 2KR2A 4WV8A 4FZ1A 4FAGA 3VKFC 5CU1A 2WQ8A 4BH9A 1JYIA 2WNUA 2W52A 4QKNA 4YXWG 3R05A 2OTLV 4QHZA 2DCZA 2FDFA 5FXZA 1QHDA 4Q4W2 3RNSA 1RPRA 2P2KA 4DR7O 1ZWIC 1JYWA 4XTMA 2HBUA 1NVPB 4JTOA 1WW5A 3OD4A 1YI9A 3ZXKA 1FXVA 3KS7A 4DV3O 3DXUA 4JRAA 3T2MA 4YIOA 4B3RB 4U3JB 2PGGA 2EIGA 4XPVA 4CDQB 2ZDIC 3K3NA 3JZVA 3LEGA 3SEPA 1BEV2 5C8CA 2G9ZA 2ZBJA 4XC9A 4BW5A 5FZ7A 1SPPB 3NAPB 2WS92 4B7EA 3LSUA 4EFBA 5KXCA 1KQRA 2DJVA 2GUZB 3IAPA 1XMOB 4ZOLA 3UT5A 1M93A 2CE4A 2ZMLA 3IAQA 5EZYA 2ZXWC 5LW9A 1AILA 4FPHA 4HANA 4MGYE 1GTOA 1W8HA 1WW7A 5JZGC 1NUKA 2Y6KA 4EN8B 1MPXA 1OURA 3CC4V 3CEWA 3WCSA 1W6QA 5F2WA 2JJ6A 1AYM3 1TUBB 1XBFA 4CDXB 3VD3A 2XMLA 1DGLA 5A70A 1XOUA 4JGZA 2MW2B 3GM8A 2BSKB 4ZZ8A 3VL8A 1GBGA 2OT5A 5B1BC 3AKPA 3KD4A 1QR9A 2Q9LA 1QU7A 4KL1A 4MVOA 4X1YA 1SMVA 1DCSA 2RM23 3OW2U 4AQ2A 2CTRA 4DV6O 3D36A 3SKVA 3GF6A 1L1FA 1TVGA 4AHCA 1KMIZ 2X05A 1H2NA 5LP6A 1IBKB 5A9GA 4D69A 1POV1 4Q8LA 3MIEA 2A70A 1ZAUA 4JCKA 2WWSA 4CP0A 5AC92 2A6WA 5L73A 1S0CA 4GQ7A 1W39A 1MZ6A 1KB9F 4QE7A 2JX9A 1YXBA 4MV2A 3OG2A 4CCNA 1GQHA 5J09A 5EFUA 3A4UA 3N7JA 4IV3C 1CN1A 3JD71 1ZX5A 3U11A 4AHXA 1D4M2 2CU5A 2YEVA 3JAWA 4DXTA 2OIGA 2Q8CA 5FY8A 4IGOA 4JI4B 1RUG3 3ZFGB 2IXHA 5C4WB 1EN6A 1QJEA 4CPBA 3TN91 1KITA 3FBMA 1QOOA 4X66O 1HR0O 1K33A 1JBCA 1SERA 2JDYA 4AXOA 1HW5A 2X6CA 2ZX2A 4W65A 2D6LX 3B8MA 1HDJA 5T5PA 3G6BA 1RB8G 5A3TA 1EUUA 1AR83 4AWDA 1F5JA 1W8UA 4GYCB 5KMGB 1H2GA 4IYHA 3FLRA 2ZDIA 3OMIB 2QQUA 5BY5A 3N7MA 2WZR2 4OHXA 3TEZA 1BZWA 1W3VA 4FOQA 3RFRA 2MEV1 4A2UA 4TLGA 3BAAA 5FOBB 4OPAA 2ZTNA 1Y66A 3M7MX 3CCSV 4RGAA 3VBFC 4K6BA 2PA7A 2J1VA 5DN2A 2RHPA 5JZGA 2VQFB 5JR7B 3EHBB 5FP3A 1IXBA 2WLJA 1GM9A 2JS5A 5F32A 2ZX4A 1ZBA1 1CZVA 1C5HA 4QX2A 4UBGA 1LOCA 1ODNA 1QJU2 1UZWA 4K8XA 5EYPA 4S2FA 3ILRA 1W6NB 2EVXA 2ZGNA 4QM8A 2AXTZ 2JS3A 5BNPB 1ZBE1 3C7FA 1AJQA 3UO2A 3GGLA 3K3OA 2CHHA 2EXKA 4KQ7A 2O14A 1DF0A 1HQLA 5EWSA 5F6KA 5EQUA 1N0NA 1COV1 2H3OA 2QSAA 2ORZA 3CYOA 3PVOA 4MADA 4QD2A 3WG3A 1CJDA 1LECA 4SBVA 2LRPA 1N32O 5FYTA 2EIKB 5T5OA 4P9GA 1ULDA 5CB4A 4Q8KA 3LD8A 3M99B 3AJZA 4PIXA 1WKYA 3M3QA 4PDMA 2J1AA 4AEMA 2DYRC 1AHSA 1DBNA 5LBQA 4P9PA 2XL9A 5LMNO 4QKDA 2XHBA 4O4HA 4IV3A 5EHDA 1HXS3 2PAMA 5H6QA 1GOGA 2AGAA 5BPXA 2JGDB 1YO8A 4LR4A 2BCCH 3SXWA 1TVKA 3ZSMA 5IVCA 1BQPA 2ZGOA 1CAVB 4HZFA 5LBBA 4UV8A 5LOVA 1YQ6A 5JUVA 3T2QA 5CN0A 2YC0A 2EAKA 1BMV2 2M7WA 3CRAA 2QZ2A 5H9PA 5IWAO 4OQ8A 2JDPA 1Y43B 1VBC1 4MT8A 2N04A 1UOJA 4GKKB 2PF4E 2LGQA 1CZTA 1W6MB 4IE6A 5F1RA 4I3GA 1Q86W 4AVVA 3QNEA 1YIJV 1IS4A 1AR62 5KAFZ 2HWE3 4XURA 5FFOC 1AI4A 4HAMA 2GC3A 2BE3A 1S55A 3ZMVA 4Y33A 5IVJA 1K12A 3B7MA 4YW7A 4LFCB 4CRQA 2EZOA 1OT5A 2GC1A 2R16A 1C57A 3PURA 1PL0A 3VBFA 4QPGC 3ZYRA 2ODMA 2DQ3A 5H9RA 3SH5A 4WM7C 3N9MA 4E8DA 1VJ2A 4DMIA 4PA4A 3A0NA 3UKNA 5FO8B 3WY6A 4B3TB 1U5ZA 3B02A 2BZDA 1H8HG 4Y22B 2O1QA 4NIDA 5A1AA 3MDSA 3BOWA 3RZZA 2Z3YA 1Q8PA 5HCHA 3J7LA 4HZ3A 4KWUA 5IY5B 2YFZA 3WR0A 4TUYB 1UZYA 4AZZA 4V2WA 1H9PA 2FQPA 3IMNA 4X8PA 2FDHA 1TMF1 1JOJA 4IESA 3E86A 5J2TA 2GZWA 1GAXA 1CZSA 4CA9A 2VZVA 3HAGA 1K5MB 4Q4Y3 3IC9A 3QVNA 1UO9A 1KGYA 1E1RG 1AJPA 3JASB 2Q1FA 2P37A 3RWKX 5IJRA 1JUIA 5BMVB 4PF1A 1DQ0A 3D8CA 3AMPA 1Y4WA 2Q8DA 1GH6A 3B94A 2EXJA 1ZZ8A 5IATA 3IBMA 3I59B 3ZPYA 4BK4A 5IJ0A 2ZGUA 1DG6A 4FOVA 2ZHKA 2B5HA 4RFT0 2WO1A 1MABG 4I50A 2E7TA 3CCJV 4OZOA 3AMNA 5HV0A 4LH6A 1QF3A 1W8ZA 5FPAA 3A0BZ 2VZRA 2JG9B 3O1PA 1HLCA 1UIKA 4K9SA 2HLDG 3ZO0B 2XUMA 2P5OA 1QQCA 2E5LB 1VR3A 4PT6A 4QPWA 4XVHA 5DAQA 1N1SA 3I2DA 2JB8A 4TZDA 2VVDA 1AR91 4N53C 1S76D 1GU3A 2B5UA 3ZMTA 1U5XA 4LTAA 2XGXA 2E74B 3OGIB 2WBKA 2VXRA 2XWJB 4N43B 2XJPA 3JD3A 2LM3A 1VBA1 1GN4A 3DPRB 1V9PA 1WGPA 2IBZH 3LF7A 2G9GA 3HKDA 3SPHA 2VMGA 5A3OA 4CYDA 1MS9A 4TXWA 1YQ2A 2DCTA 3MF6A 2EF6A 2BGCA 5A7OA 4MG2A 5FP9A 4ZHQA 3AG4C 4AAXA 1GZ9A 3T4ZA 2ZGQA 1RM1C 2DWRA 4PELA 5BUVA 1R3KC 3N7LA 2A6XA 3HEIA 3NJZA 4QPGA 5EIYB 5IYBO 1CR7A 4N8MA 2R9IA 1GZTA 4IUGA 4WM7A 1ZRCA 2K2SA 5E1RA 1F7YA 2Q7HA 4YG0A 2OXBA 4BPZA 3AP9A 3D3QA 1WB8A 1ZLZA 4CDWB 4O65A 4ASUG 2PHUA 1RFYA 3N2KB 4F6EA 3ITQA 1HQWA 4H3WA 2WFF1 1L7RA 5BNOC 3F7YC 5G04L 1W6PA 5A3LA 1MS3A 1WMDA 2YIBA 4E4ZA 1UU6A 1KECA 4MVTA 1M4UA 1YSCA 2FYUH 1HV1A 5FMOS 4MZUA 2GALA 3OUSA 3C7OA 3CCVV 4CH6A 1GOFA 2A3YA 1W2TA 2VQAA 2UWCA 4CDQC 3ZHQA 3ZYBA 5K0UB 4WFEA 5B3SC 1MEC1 3E8FA 3KT1A 4YFWA 2O8QA 1J3QA 3N7KA 1CEZA 2H0VA 2JD4A 4EWDA 4GIQA 2Y6FA 5LA1A 1BS3A 1P7BA 3ZKYA 2F4VB 3JD72 1QBZA 2DUOA 1AR4A 1AROP 4LITA 1A34A 2YXYA 4FFBB 1MS5A 4DY3A 1N33B 4UFIA 3ICXA 3TN92 1W8FA 1JZ5A 5H9SA 4ZXKA 3KHCA 2QA4V 3RYHA 2P7TC 3JU9A 5L7OB 1J3RA 4CDXC 5DAWA 3NNJA 1UMZA 2FMLA 1APNA 2XDVA 1XI1A 4IEXA 1NZCA 1SQGA 3NSTA 1AX2A 3CD6V 2GDFA 2N05A 1Q8IA 4FLYA 4N53A 5GZCA 1B09A 4RHV1 4LHLA 1WNSA 4MVQA 2OZ6A 3STLC 4WZCA 5A80A 5FQ0B 4QQPA 1W2UA 1RMU1 2MEV2 1CAXA 2ZINA 4F6RA 3MO4A 4M4RA 1NLSA 3I2GA 3V0BA 2ZE8A 3DYPA 5JI9A 3HKEB 5KHHA 1GFF2 3N35A 4AHWA 1IPJA 3ZYPA 1UU5A 2HWB2 3DN7A 1LR1A 3W7WA 3SJCC 1MZ5A 3K3WA 2ZKOA 2IXCA 2VW1A 2JRIA 5K1PA 1DLCA 1NA1C 1BCCH 3M3OA 2VQ0A 1ZBA2 4LNUA 5CMUA 4P9WA 1W8WA 4HG6B 1RUE2 4J1XA 4IT5A 3K48A 1G8WA 1NE6A 1EAH1 1SLCA 5EBWC 4DEVA 3KMHA 4Y20A 4X64B 3DYMA 1ZBE2 2X5IB 4AFBA 4WCEV 3I55V 5IDJA 1FX5A 3BYWA 3ZFGC 2X09A 5BNOA 4OHYA 3OTFA 2C1FA 1G6NA 3CMGA 1MQTC 1FI2A 3T0DA 1HKDA 3THTA 1FOD3 5EC1C 1IS3A 4JRLA 2PYLA 1VBE2 2HYKA 5DECA 4AL9A 1X33A 3S0MA 4MGTA 1PGSA 1AXZA 2GMPA 2BOBC 4U3JA 5L36A 4CCMA 4DO2A 2RM21 4CDQA 5GLVA 2DOSA 5JSOA 4GCZA 3GALA 4X20B 2EIBA 5JVDB 3WNNA 4OLLA 1Q56A 1F9KA 1GZWB 1FT9A 1V54B 1V6MA 5FY7A 4ES8A 1EUTA 2YV8A 2ZS6B 5IVVA 4ZU7A 1NAEA 3KT4A 2A73B 4NXNO 1RUH3 2ZE6A 2QQJA 5IE9A 4TSVA 3WNXA 2VBDA 2Z2SB 3Q8BA 4C8DA 5AFBA 1Z7S1 4FSJA 1SLBA 4B4QA 1W9TA 4IL6Z 1VBC2 1CVNA 4CDXA 5KUKA 1SFNA 1ROPA 5BNPC 1W05A 2ATFA 5C5TA 3ZSKA 1V6OA 3POSA 3HNMA 1DGRA 2E51A 4XABA 5C8YB 2BSKA 1UOFA 1V00A 2P6CA 5JXIA 2F43G 4BM8A 3WDYA 1ULPA 3BY6A 3WG1A 1DFQA 1S0IA 3FE5A 4AVSA 3T1HB 3KHBA 3SITA 1ENVA 1EY2A 3S30A 2IC1A 1T2XA 3CIHA 2E33A 4HOOA 2QQOA 4NHXA 4M3CE 3B01A 3RVHA 1TAEA 2GN3A 1YI7A 3BABA 2YMZA 4CP9B 4JYYA 3ZYFA 3ABKB 1XE0A 3T0AA 1EM1A 1NA1A 4HXCA 5LHIA 3I49A 1JJOA 1Q8QA 2XLFA 2RDSA 3P30A 4EB6B 4CS4A 4J11A 1V9U1 1X9PA 3ZRWB 4COYA 1LUWA 4XFGA 1WB7A 1SLTA 4W6YA 3ZFGA 3SPGA 3CF6E 2VMFA 4OHZA 1TMF2 1XL6A 1R081 1M90W 1MQTA 3THCA 2V7QG 4L0PA 5LZ6A 1IZ3A 1XYPA 4NPLA 2EBOA 1AI5A 1H30A 3K59A 1CAWB 1GYKA 3CJHB 1ZZ6A 4R4XA 5KMGA 1OLQA 3WDWA 1S5HC 4M4PA 4U7NA 3OB8A 4P00B 1FKAO 4UCOA 3TEYA 2QWRB 2ZGRA 3ABMB 1FAFA 5IWFA 3RGBA 1GNYA 4Q2FA 4I0BA 4YW1A 1VRBA 3PUSA 1GICA 2XT9A 5H9QA 4JI0O 2QQNA 3ASNC 1HXS1 4GJZA 1ZTEA 4LT5A 1HNZB 1S2BA 1QLEB 1IQDC 4Y24A
chains in the Genus database with same CATH topology
1RUD2 5LRRA 2DF7A 4F8AA 4C5WA 1FNYA 1QNWA 4I30A 1EV13 3OGJA 4AQTA 5KXEA 2Z5WA 2TEPA 4HLTA 1H4GA 1O4TA 3RRDA 1ZYBA 2EA7A 5BNPA 1AR92 1YIPA 1O7FA 4FAHA 4XBQA 4AG4A 1O4ZA 4QQLA 4EN9B 2WNVC 5L19A 2AYHA 4HSLA 4E4DX 1C1FA 3OF1A 3AYCA 2ZHLA 3AX4A 1BKZA 5FLHA 2VNGA 3ZX7A 3NV4A 1VBE3 4AQSA 4AK3A 2C9AA 3LOBA 2W68A 4YZ5A 1Y7BA 1QWRA 3WV6A 3VHPA 2ZX1A 2X29A 3L9JT 2CYFA 1OPOA 2Y0IA 3L2HA 2X5IA 1CONA 4XYXA 1C4RA 3MI8A 4O9EA 1QJY2 5TSWA 2P34A 1BBT1 1UF2C 4J6GA 3ZSEA 4C1WA 3RPQA 4BOWA 3P3NA 1BVP1 1G9CA 1B35B 4QU2A 4XHBA 3VBFB 3ZYGA 1LEMA 1ENQA 1ND3C 2PLV2 4HETA 4Y1VA 4KU7A 2B9UA 2E7QA 4DXZA 3KSCA 3DKWA 3H50A 3RJRA 2RS12 1VB2A 4WBBA 3SH4A 2ZGMA 4BMEA 5AC91 1OS7A 2B46X 1QXRA 1CIWA 3EJKA 3LZZA 4Y1YA 4LE3A 1GNZA 4EV0A 3VZOA 3IM0A 2QJVA 1IQAA 4UW5A 4DPNA 1PGW2 5KXDA 4IL7A 1WBFA 2QDNA 4Q4X3 5DUXA 5F5QA 4KU8A 5FLJA 1IKQA 2KA3A 1ULFA 2OUJA 2JG8C 4AVTA 3EATX 2PHLA 5JCTA 5KHIA 3I4IA 4GMP0 4GWMA 2XBO2 1ENXA 4B29A 1U5IA 4FPEA 3KGZA 2F4PA 2HWC3 2CGNA 1D4M1 2PN5A 2AZ5A 1AUYA 4E2SA 4Q1PA 4IEUA 1CAVA 4QGMA 3J26N 1X8MA 1PIV1 1GZWA 2VOVA 4L8QA 5IT6A 1VP6A 1NCRB 2D5HA 1VBC3 4DFSA 1OMIA 2BYVE 1S0JA 3RJ2X 5KC5A 3AYEA 4JDOA 5FOJB 4GKYA 2VG9A 2HEYF 1DZRA 2SLIA 2XH6A 4YNIA 1CJPA 4FTSA 3OBRA 2BWAA 1S1AA 1LR5A 2D6MA 5JI7A 1O3SA 2HWD3 3R4DB 1XYNA 2WT2A 4Q4Y1 3GBGA 4HKOA 4FTEA 5BV6A 1OI6A 2XB6C 1R1A1 2JEMA 4K40A 2DV9A 2QNKA 4L97A 4WVVA 1MEC2 1OKQA 3D82A 4QXKA 2WNUB 4Y1UA 2XVLA 3DPRC 2ZGTA 5GZFA 3FX3A 3O14A 2W08A 4RD7A 2ZHMA 2Q0AA 3GHNA 1LGCA 3IKWA 1RUI3 3JCIA 4RA0A 1C3HA 1WCDJ 2NYYA 4GWNA 3AM2A 3MIHA 5CNAA 1HQNA 3VHRA 4CEYA 2WC2A 1J1TA 1AJKA 4IEOA 1FMD3 1S0GA 3ZXDA 3SNMA 3ZFFC 4C91A 2CTVA 3HR9A 3ES4A 4XFBA 3RYPA 3AZZA 1DQ2A 4XJAA 4YGDA 4GMP1 4OI4A 1NCQB 1PHMA 1LENA 4Y4YA 2VVEA 4MXWA 3ZIWA 4RQPB 2BVVA 2QQPA 2RJLA 4JQRA 2GAUA 5CAZA 4E9KA 3W9AA 4H55A 4S2GA 4XIKA 1C1LA 2I74A 2IZWA 5LRSA 3UL2A 4P9XA 1LHUA 2R1DA 1ASJ3 4HL0A 4WVWA 4EROA 1A6CA 1H9WA 3FHIB 4Q0UA 4NOTA 1OLRA 4XDQA 4RL7A 2WFPA 3VZLA 1PVC1 4BGKA 5FBZA 5FCCA 3WUDA 2WT1A 2HJIA 3NVCA 5C8CB 4Y22A 2WKKA 3VBSA 4B3NA 1UZZA 3KCXA 3HIFA 3MPBA 4XJZA 4CDWC 3PMEA 1XNBA 1B35C 1DU3D 4WZFA 2WA3A 2XG3A 3JQXA 3U10A 3CNAA 1OFSA 1TQ5A 3O0XA 4M2GA 3ZXAC 3KT7A 1MS1A 1S2KA 2DUQA 2HWB1 3NW4A 3UJQA 1TMF3 4M2CA 2R062 4HKLA 1MS4A 1DRYA 1RUJ3 3PMSA 4P9JA 2WNVA 2NM1A 2X53S 5HI0A 4YZ2A 3RQ0A 3ZN6B 3E6DA 1W0PA 1RMU2 4CP1A