2YDEA

Factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 107
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ydeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ydeA01
4Z2WA 2ILMA 2CGNA 1H2LA 3KCXA 4B7EA 4AI8A 1YCIA 4JAAA 2WA3A 2YC0A 3KCYA 4Z1VA 1H2KA 4BIOA 5JWPA 3D8CA 1MZEA 2W0XA 3OD4A 1IZ3A 2YDEA 1H2MA 1H2NA 3P3PA 4QU2A 4B7KA 4NR1A 2CGOA 3P3NA 1MZFA 2XUMA 2Y0IA 2WA4A
chains in the Genus database with same CATH superfamily
4RHV1 1F2NA 5BNQA 3W7TA 1R73A 4JAAA 1VB2A 4E9KA 2ZAAA 2IXJA 1I5XA 2Q73A 2WZPP 1JYWA 2ZR2A 4MGQA 2WLKA 1UW8A 5EK0A 2XOKG 5DN2A 2KD7A 1UQXA 1MVEA 4YWAA 4JI7O 4DV6O 4HKWA 1TA8A 4AK3A 2DWEC 4X6QB 4CYDA 1OV9A 4J42A 2VG9A 1DBNA 1A32A 2P6HA 5FBJA 4UCUA 1EPZA 5FOJB 1VRH2 1YQ5A 2IZWA 1QY4A 3MUZ1 2IFRA 1VALA 3CBNA 5FY4A 4NIDA 3D4KA 5LCWL 3GZEA 1X8EA 3BB6A 3AB0A 5EJ1B 1PK6A 1QJEA 4XPVA 5L3GA 4QX0A 3KHCA 1YYNA 4C91A 3KMHA 4B08A 3A0NA 1H2SB 3VHRA 3ZMVA 2HWC1 1W9WA 4JCKA 2RDQA 2FZ2A 2Z42A 4NR1A 2EIDA 4KMQA 4XMIA 2DCZA 3HKCA 1OOPA 4EROA 1KU9A 2JDMA 3LA2A 4K8ZA 2YIDA 1MS3A 1S3JA 3BA9A 1W8FA 1IDSA 1AHSA 1HN0A 3FHIB 2XBO2 2RDSA 4I0WB 4ZHNA 2QQLA 1YQCA 4PIYA 5A7SA 3NMBA 4AVCA 2A79B 2XQRA 4NRQA 4YVWC 1FOD3 4A7KA 2WN2A 1R3JC 4QPWA 2NMOA 2WQZC 1I7FA 4A5UB 2PHXA 4A45A 2HJFC 1GQHA 1LJ7A 2AGSA 1DDLA 4MXWB 1XNQO 3H8OA 5EXOA 4WFEA 3FAVB 3URFA 2ZXQA 5K1PA 4X64O 1AYN2 2PHDA 1RUJ3 3QD6A 5LBQA 3CJIA 2LM3A 3S5QA 4G28B 4X20A 4YVSC 2XAJA 2UUCB 4PI0A 3E8GA 4DRRA 4I7ZB 1BQPA 2A6WA 5FXZA 3NWKA 2YXSA 1SBDA 5HCFA 1QMJA 3PVEA 1W05A 4QPGB 2Y64A 2VTFA 5IVJA 4AWDA 5LHHA 4ISRA 1PO22 4DV3O 4MX3A 4Y4YA 3GBFA 2AHZA 2KR2A 2XJSA 1GP6A 1K5SA 3WOGA 4HSLA 5LOVA 2PYJA 3CXHF 2OCCB 2YI8A 4P02B 4QGLA 4J6GA 3K51A 5J9PC 3ZR6A 2W1SA 4GMP3 3NRUA 1NTKH 4HBNA 4UFHA 1D4M1 4CEWC 1NQTA 5DPNA 4UB6Z 2F4VB 2B39A 4YGCA 4D6SA 2E53A 3THOA 3SHRA 4CEYC 2JJ2G 1OH4A 3D3IA 1W8TA 1XNRO 1GZCA 1QU0A 1W2UA 2D3PA 2Y4UA 2YIBA 3U1XA 1PX3A 5I93A 3WG1A 3JASA 4KXRA 1H6XA 1RMU2 3A7QA 3RI8A 4GKYA 5CVRA 5J2UB 4WBBA 5FZMA 5FLIA 3S5AA 4H2AA 1AL22 1V9PA 4CDQB 3FN9A 1DGSA 1AL21 5CA6A 2J1EA 1GH6A 3S0MA 1UD1A 3GCWA 2VH9A 4J9ZB 2OIGA 2QM8A 4PLOA 1UU4A 4G2KA 1NCQA 1XBFA 1GTOA 1J1LA 1JI6A 2W91A 1OJHA 3E83A 2WWSA 3B4SA 1QEXA 1VBE1 2BEOA 3WDWA 4TTGA 2W39A 2J1SA 1OBNA 4FOVA 1XXNA 4QPYA 1FNZA 1CZSA 3ZIXA 4JV4A 2CTQA 4YG6A 3ZXJA 1RUOA 4LF6O 4ATEA 2NYYA 2MPFA 4XF4A 2HWD2 1W90A 2GSYA 4JI3O 1RUC1 2Y0OA 1Q6IA 5IK5A 2RR12 3D8CA 5IUQA 5DAQA 4YW4A 2I45A 1EPWA 1HWYA 4IW3A 4XCBA 3RWKX 4ATFA 2LP7A 1GN6A 1EM1A 4GB33 4DV0B 3VZMA 1A78A 1SMVA 5LMUB 4GKKO 1CD3G 2Q1MA 1BQ0A 1LKNA 3JBG3 4M3CA 3CRRA 1LOCA 1R1ZA 4B3MB 4LO6B 4GH4C 1F51A 2B8MA 1JFFB 4BQ2A 3W59A 3WW2A 5JVDA 3AZWA 1NCRC 4QX3A 4I02A 4CC5A 1DGRN 3WG2A 1VQOV 1NH2D 4FFHA 1JCHA 2RQ6A 1VQ8V 2ZHNA 4IEPA 4QIWF 3ZFGA 1E1QG 4FFBA 3U4SA 4I5SA 2W92A 2OT7A 5EHDA 4KGGA 5F2SA 2WL1A 3RI9A 1SS3A 1XOUA 2EIJC 5DEDA 3HMYA 2A75A 2DBNA 3USUB 5C8YA 2VNGA 1W6QB 5FLHA 4DUYO 1LUWA 2HEWF 2FDKA 4TN7A 5EFUA 1P7GA 4FAGA 4XAAA 1PL0A 4D0QA 3JD4A 2ARXA 2QTOA 2P37A 1DGWA 1AXZA 2I2SA 2QQIA 1YZBA 2VVFA 3E5QA 5DG1A 4CH4A 3PJYA 1HB3A 2QFEA 3P3NA 4TQDA 1J5EB 1OLMA 2WFF2 1FYUA 2RN9A 2ET7A 1W2NA 3QH7A 2VZOA 1W6NA 4FTBA 1ENSA 3I2HA 3PTRB 2VC9A 1IZ3A 1CXZB 1W6NB 4PCRA 1ZRIA 5CISA 2J42A 5FP8A 5I0UA 4PDLA 1W6MA 4NXNO 2B9UA 1U5ZA 4J41A 1QH7A 1H8TC 1HP8A 2F66C 4LMFA 1GLHA 1SFNA 1KQRA 1NA1A 4COYA 2ZIMA 5AVAA 1N1YA 5IFTA 4FCAA 2Q7GA 1VQPV 1AYM2 5FY1A 2QZ2A 2W47A 2WNVB 1IG0A 3ZYFA 5A6XA 3SPGA 1N3QA 3JCUZ 2VBBA 4KBZA 1D0HA 3V65A 1US6A 4FZ0A 1C3HA 4CH5A 4MOAA 1BCXA 4IETA 4OULA 3W9AA 4CDUB 2LTNA 4FPKA 4FM1A 3BUCA 4GAZA 3ASIA 3VKOA 1ND3A 2ZGLA 3I2DA 3HWJA 4CS2A 3AYAA 2DWRA 4LBQA 5FK8A 4YGDA 1IBLO 2EIKB 2VQFB 3O1OA 1O5UA 3CDZB 5DDJ2 1FV3A 3ZFGB 1JMKC 2DYCA 5C70A 2GUZA 3JAMN 3U37A 5H9CA 2LQTA 5JMOA 4A2UA 5IJ0A 1LGCA 1URFA 4TUYB 4DV4O 2EXKA 1S0DA 5HV0A 3F5TA 1HV0A 2TNFA 2MHFA 3N7KA 3D6EA 2RS12 1GMMA 2ZEXA 5SV5A 2RDRA 5C5UA 2YC2A 4OHWA 1WW5A 2UWBA 2P5OA 2XOMA 3ETGA 2YY1A 3RYCB 5LHGA 5J3UA 1KJLA 3VN4A 4GH4A 3B94A 4ZIBA 3N7MA 1XHXA 3ZFFA 1CX1A 3TGUH 2D40A 1OZ0A 4PLNA 4L11A 3AP6A 3CL1A 2Y48A 4YY3B 2P34A 1UU6A 5JSRA 1RUD3 4NXMO 1YNAA 1NH2B 4JAVA 1W6OA 4NB5A 4DIQA 3P5BA 3BHPA 4NROA 2BNNA 5JVVA 4D8MA 2GN3A 1SEFA 5GKAC 3OUSA 3RWRD 1K73W 2ZT9B 4Q4X1 2XJPA 1RUE3 2KM2A 2EA7A 4JI0B 4MTFA 1BEV2 3H01A 4YJ2B 1XNTA 3UNPA 1UYXA 3U11A 1VBA2 4Y20B 4XUNA 3ZKUA 1Y74A 1YCIA 1V6KA 1GZWA 1WJZA 4GQ7A 4CH6A 4B4QA 2VO5A 1VMHA 4E2SA 3CNAA 5FO9B 3ZKYA 4TV9B 3J80N 4A6SA 3LDBA 4FPGA 1OCOC 3IMMA 5KC6A 4LF7O 4FPJA 4YG3A 1GP4A 1WAZA 4OUSA 5A80A 1W9TA 4CDUC 4YZ1A 2BFUS 3NXSA 4AOCA 2K1EA 2NLRA 1UY2A 3WG7B 4NHYA 3HT1A 2BSKA 1DLLA 2Y60A 1CESA 1PHMA 4YIPA 3H50A 1FV2A 4CU9A 5JAXA 3CLPA 2VVEA 4Q4W2 5C3OA 2VULA 2GU9A 4XUPA 2JG9A 1V9U1 2YIBD 4H37A 3SKVA 4JZ2A 2RJZA 2GH8A 3CCSV 4AFAA 4Z1MG 2P4EA 2QTWB 3NSTA 1AXYA 1L0LH 4Q8KA 1JOBA 4CEWA 1F9KA 1EV12 1UOJA 4JI6B 2R49A 3AL6A 2HEPA 3ZYPA 3W58A 2B1GA 1T6GC 2E7AA 1NY71 4MVUA 2AH2A 3MPBA 4ZKIA 1EUUA 3WQ7A 5IYYA 2Q67A 1GSLA 2XTAA 5IAVA 3LIHA 2PHUA 2FDIA 2XASA 2JG8B 1CWPA 4UVBA 5FPBA 5A7QA 2W68A 4B4PA 1IQDC 3B7MA 3WP6A 5LBEA 5CA1A 3O1RA 2DQ3A 5EYPB 4TZDA 3ZSEA 2HP8A 1VE0A 3EFFK 1XSQA 1TGOA 3BGAA 1RUF3 5EPAA 1UZVA 3OE7G 3KKYA 2D6NA 4YW5A 4YVSA 1S5LZ 3N2KB 4DV2B 3X2QC 2WZR1 3TEYA 1MNGA 2HKXA 5ACA2 3HKDA 4AI3A 4DUZB 1F15A 3OTOO 2XJUA 4AI1A 3I55V 5LP6A 1L0NH 2XAHA 2I07B 3FLPA 5LA6A 1QJU1 3F2ZA 3ES4A 3SXWA 4CP1A 3JD3A 3I8TA 3V0AA 3BOPA 4LF4O 1X33A 3EXUA 2P06A 5GALA 4V2WA 4LT5A 2YSUB 3V0BB 4AILC 3E6BA 5IT6A 4M0NA 1FPN2 1LR1A 5B1BB 1S55A 2ZM6O 2VNOA 1J84A 1I6XA 1SLTA 2XL7A 1AR82 3E6CC 3K4AA 3INAA 2QGNA 1QJX3 1SBFA 5A2QN 3N9NA 1CEZA 3W7WA 1H1AA 2ZE7A 3OB8A 4Q4V1 3CCLV 4MTXA 2F4LA 2JK5C 3NAPB 1NZIA 5JXHA 2E63A 3AMHA 3AK1A 1AR5A 2OA2A 3NAPA 1BVP1 5FMCA 4LO4B 4MXWA 4IEVA 3RZJA 1PIV3 2RMU3 4GKJB 1ENQA 4PV1B 2F4PA 2A71A 3MW2A 4IE7A 2RS31 3O1PA 2EAAA 2WQ4A 4Q4W1 1AR92 3PTYA 2BWAA 3H8XA 2RS13 3W7UA 1V9U2 1AR91 1SQBH 4AQYB 4MGSA 1HB2A 2WAAA 2LGWA 2W94A 1KD1W 1S0GA 2W9XA 4I0XA 1ASJ1 1DG6A 2GTAA 1W6PB 4P9JA 1AR72 3ETPA 1VBC1 5DDJ3 5KXBA 3J81N 4GT1A 4UCOA 3H42B 1M1KW 1K5MC 4OPAA 1O3SA 2J7MA 3GALA 2D3RA 4CZZA 2FB5A 2HWB3 1PL4A 4CCLA 2B46X 1O3RA 1CVNA 1E5SA 5K0UA 3SC7X 1FFXA 1TUBB 2RCVA 2ZOEB 2VOWA 2XONA 5B66Z 1T6BX 4LH6A 4FQZA 2DUOA 1WD3A 1M57B 4DXTA 1EAH3 4W6XA 3T4HB 5FZKA 3S3XA 1W39A 4E8CA 1K5QA 4I4TA 1B04A 4WV8A 4WVMB 1E1RG 3UV9A 1QR8A 3GHNA 3T4VA 3P6BA 1BJQA 1VMGA 4O2BA 4MS2A 3TB0A 2YBPA 2O1QA 5KAIZ 2IUWA 2KQXA 2O8OA 2AHYA 3RYFB 3CMAV 1C8M1 1NI8A 4XJWA 3R05A 2WAOA 2OPWA 2GN7A 5J2TA 5FLJA 1R3LC 5AFBA 1XNDA 5A7OA 3I2IA 1OPMA 5L7OA 3SITA 2J1TA 3O12A 4LFBB 3ACIA 2GNBA 3FB8C 1JOJA 2QTSA 3P3PA 4QE7A 1YIJV 2VOXA 3H8UA 4IYHA 4GD4A 3THCA 4JGYA 3UGFA 3CZJA 1NE6A 4HZ3A 1X82A 3K0GA 3B77A 1VB4A 1ZX5A 2G4IA 2BBAA 4F8AA 1VR3A 4JHTA 2O0OA 3M3CA 2UXDB 4AFBA 2VRZA 2MW2B 2HHHO 3SJAC 3ETDA 1QDOA 2HYKA 5C9AC 1O4ZA 1AR4A 3N35A 4CP0A 5A1LA 4TYSA 1ENXA 1CIWA 2V4DA 2HWE1 5ISLA 3LDEA 2AXTZ 3CCUV 4H13B 1ZA7A 2H8PC 5A3NA 4HMZA 5BNOA 3BVOA 5JR7B 1KEXA 2VZRA 1MQTC 1AJPA 4OHYA 3K79A 1JH5A 1SFYA 3HB3B 1KS4A 1ZZBA 3VBOA 4HXCA 2XAQA 3IDCB 1QGLA 3OUHA 2JIZG 1YFYA 2GDSA 2ZHKA 3H1HH 4DR2B 1H9PA 3OJBA 2IVJA 4L2NA 1RGSA 3CJIB 2G9ZA 5DUUA 4WBNA 1N1VA 5FZ9A 4QQ2A 5K4LA 3WINE 2W2IA 4WM7B 5C8CB 2SLIA 1D4M2 2R072 2ZGPA 5DUXA 2AYHA 3LSUA 3VBHC 5A1FA 5I0TA 5A33A 3VGIA 1Q8SA 5HFLA 4W4ZA 3HQXA 2VCCA 2NN8A 4O4LA 2YBSA 2UXXA 3ZYBA 3N7JA 1ULPA 4AHCA 1QHDA 3HOBA 1RUH3 1W3XA 3MLLA 4K20A 4TUYA 4A3ZA 4NIAA 1G6NA 1JR9A 4EZ4A 4N21A 1US2A 1V9U3 1TMF3 1B06A 1QJFA 4KG0A 2WT2A 3AJZA 5BR8O 4YZ5A 4BYYA 5FY5A 1WA6X 2DTWA 1UFIA 3BU7A 3T4ZA 4RQPC 4K0KO 5IDJA 4AQSA 2L9LA 1PVC1 1CX4A 5KAFZ 2IFWA 2AZ0A 2VMFA 4AI2A 3WW3A 4N43B 3DN7A 3K08A 1FXKC 1AUYA 1K3EA 4DR4B 2JDNA 2K0GA 4QXHA 3NKTA 5GM0A 2DN9A 3BIWE 4R7CA 4PF5A 3FL7A 4B3SO 5JZGC 1SG3A 1XDCA 4MXVA 2X10A 3MIDA 4B3RB 3OOXA 4I01A 4YZ4A 2DWDC 5BNNA 1NVPB 4JYAO 1VAVA 2VE1A 5EYPA 5J09A 4MVZA 4RGKA 2V5DA 3IZOA 3PUSA 2UURA 5JJNB 4BXSV 2Y34A 4PD4F 3WNOA 1PZ9A 4O4IB 5L3EA 1Q86W 1REEA 1UY3A 1L7LA 5ITZA 2HWE2 3ZHUA 3WVJA 4JI5O 3HVDA 1W8UA 5JOYA 2P2KA 3U75A 3A0HZ 4G9SB 3NNGA 2W3JA 5IJ9B 4UFIA 2BFUL 1RUD1 4UV8A 4Y22A 4EWEA 2WO3A 1SA0A 1YXBA 3OTFA 2ZMNA 5FBZA 4WM7C 1Q8QA 4H44B 2WFF3 3ZPOA 4MUVA 1AR93 2FDGA 4XJUA 3AKSA 1H2GA 1G9FA 2ZBJA 3VBUA 2R6QA 3T1HB 4YIOA 5SV8A 3VBUB 5FAXA 1VQLV 2XQXA 3KT7A 4XFHA 5A3LA 2Y69B 1GQGA 1A6CA 2W46A 3WF3A 4F7ZA 5EQUA 4CPBD 4F3JA 3FMGA 5F5CA 4BHPA 5EV7A 3WP3A 5CFDB 1Z2GA 1T5EA 4YW7A 1W0KG 4CP2A 1AX2A 5CMUA 5FXXA 4X66O 3AG2B 3IAPA 2UUBB 3HKCB 5DECA 4NXNB 2GBOA 5KWRA 1QJY2 4JTNA 4NPRA 5A7WB 5EC1C 1CAUB 3UO2A 4ZS2A 2OZ6A 4PELA 5EP9A 3WCRA 5KUMA 4Q4Y1 2I74A 3QTCA 1N32O 2P3KA 1K33A 4MVRA 4MV2A 1XMQO 3KT4A 3CB2A 4GWMA 3ZRVA 5C4WA 1UPIA 2VUCA 2PQQA 3RPQA 5JR2A 4LBNA 1O9HA 5H2FZ 3M3OA 3CEIA 3DPRB 2NQYA 1G8MA 2V4VA 4AQTA 1R1A3 2BOCC 2HLDG 1VQ4V 1GV9A 2WRAA 4FPLA 3HR9A 2MNGA 5B1NA 1CJDA 3JAKA 3JALA 4LF5O 3RYPA 3JATB 4JTAB 4CXXA 5JSOA 4YW6A 4LORA 1JYCA 2X6CA 2AREA 5I91A 2WFF1 3KGZA 3ZYRA 1S0BA 5FUPA 4O9EA 5IVVA 4P08A 3ES1A 3NNMA 1QLEC 1Z0HA 1HRI2 4F6EA 4O4JA 1CP9A 3RYKA 5EZYB 4RQFA 3AYCA 1AF9A 2A6VA 4XZPA 1D5AA 1LULA 1NOVA 3J8F3 3K3NA 2D6OX 1O4YA 4BAYA 1NZ6A 2HWF1 1QH6A 4JKMA 4KWKA 3ZS8C 3N36A 2EAKA 4Q0UA 1EFRG 4QNHB 3MICA 5DDJ1 1HXS2 4DW1A 3F5WC 5L3CA 5F5AA 3SYOA 2EZPA 3BCCH 2HH9A 5JJEB 2XVLA 1WLTA 3ZIAG 2VOTA 1MOFA 3OR7C 1RUD2 4N53B 2JWPA 4IV3C 3E8FA 3OW2U 3CCJV 2ZDIC 4FXGB 4DR1B 3SJQC 4EKWA 4TV9A 2IXIA 1JUHA 5L73A 3ZN0A 1RJ8A 4LFCB 2VJXA 2QM4A 1BSMA 4GWIA 3VD9A 4PLMA 2RS33 3N9QA 3OYWA 4UFKA 3G80A 5IHRA 2ZE8A 4ZZ8A 4IHJA 1VF7A 5KA5A 4HN0A 4AHWA 4UBHA 3RW0A 1R6NA 4RS5A 5LHIA 4I3PA 1YI9A 2X09A 4M00A 2QEXV 1KS5A 3C7GA 4X1IB 1P7BA 2BOIA 4BZ4A 4PDWA 1RUH1 1H8TB 4UVAA 2VQTA 3EMRA 1XQ8A 1GKBA 1SRYA 4DO0A 3M7MX 4PBOA 5CG8A 2X7RB 1PZ7A 4BE3A 4CU8A 3NR7A 3W7SA 4DK1A 1LU1A 3A0KA 4LFAB 1UZ0A 1UPGA 4FM2A 5T5LA 3HKDB 5FJHA 3KCYA 1AYN3 2R042 2CSGA 5K0UB 5A6QA 2FKXA 4IQPA 2Q4PA 1DGRA 3OGVA 4LJHA 1C8M2 4AVBA 3T0AA 1GWKA 4N9IA 1SQVH 5DZEA 2BOJA 5FFOC 5GLVA 5K7PA 4NTWA 1H0BA 1FKAO 3SH3A 1AL0G 3O1TA 2Q0AA 1QF3A 5EYXA 4NWVA 4XFFA 5FTTC 5KXEA 1LHNA 1BHBA 1WA4A 4K8FA 1JW6A 2PTMA 4LBLA 3POFA 3VBRC 3OG2A 4Y5SA 1HRI1 1GO3F 4CCKA 2VCMA 2XLFA 4XUTA 1Q56A 2ZE5A 4AEJA 1FNYA 2VTXJ 4YW1A 4FLXA 2WT1A 5C71A 4WFFA 4NHLA 3CRCA 2F17A 4J7JA 5FUIA 5HXMA 2R062 3LEMA 4NAOA 4FPEA 4MGKE 3VBHB 4URAA 2DU1A 1IKPA 1I5PA 1JZ4A 3Q4HB 4JTDB 1UOBA 3CO2A 1EZJA 3NJZA 1NJIW 3V0BA 4IGGA 5HCHA 1XRUA 5D8AA 1WBFA 2PY5A 3O0WA 1RSOB 2DF7A 1RVF2 1Y9GA 3WB2A 2A6XA 2VNRA 5GLUA 4UFZA 2WS91 4MVTA 2ZD9A 5C3QA 5HCAA 1HXS1 1FX5A 2DQ0A 3WUCA 4JQTA 2HWD1 4CCCA 1GICA 4JI1B 2BTVC 2RR11 3ABMB 3IAYA 2AW9A 4EYUA 1ND2C 3AL5A 2VWKA 4JV5O 3CJHA 1NG0A 4B1LA 1HNWB 2ZX4A 1WLWA 4E4HA 3ETQA 3RS6A 4LC1A 3TNPB 3GVMA 2X05A 2DURA 3ZYJB 1RPRA 3FAVA 1UO9A 4HOOA 5E1AC 3ZN6B 3A0RA 2ITCC 2ZXWB 4HVQA 3WQBA 1UOFA 2AGAA 5IJRA 3L70H 1S2KA 4AHYA 1L7QA 1VJ2A 1JYTA 1AJNA 3AXDA 1XJAA 3ABUA 1Y76B 5I8YA 1S0IA 3VBRB 2XUMA 2JG8C 4LWSA 1NLQA 1OC1A 5FYBA 1HJFA 3VD3A 3BABA 1PVC2 5LGTA 1SLLA 5CA0A 2VW1A 3AP4A 3M70A 5CFCB 2AENA 1Y74B 2BNMA 5C33A 1SCRA 1HRV3 2CTWA 2A6YA 4UW3A 3AKQA 4QXBA 3ZXAC 1OMIA 1K4DC 3S7EA 1OCCC 1WPXA 4P14A 3KWVA 4W50A 5CU1A 2GNDA 3DYMA 4IGQA 4OMDA 1JMUB 4WBNB 4PHZA 3DL3A 4X8NA 3R65A 2UU8A 4LKEA 4JYBA 4YW3A 5IT9N 3P30A 1PIV1 1AZDA 3EB7A 3LQCA 2WN3A 2DYRC 4RSUA 1XMOO 3VL9A 4JI2O 3RZGA 4AFCA 5JDBA 3E22A 2DVBA 4H55A 2CYFA 2BSKB 1VF5B 5A7PA 2E74B 1ZBA3 3AMQA 4E4DX 3ABLC 1NBMG 3KT1A 5BNNB 3CS5A 5A3WA 1TZOA 2AC1A 1Y67A 4N23A 3AFGA 3NJXA 1AR71 1WMDA 3IWZA 2FMYA 3K48A 1BZKA 1CPMA 4DV7B 1NAEA 2QBXA 3I2FA 4XAEA 3O1MA 3VKFC 5GLTA 2OIIA 3PIGA 5BNPB 2YPJA 4AEDC 1HQWA 1UX7A 4FT8A 2VXJA 3I59B 4L8QA 3POWA 2DJVA 2Y6GA 2C9KA 2ZXWC 5CKNA 4JTCB 2PYLA 5A32B 1VEWA 2Y6LA 4F83A 1W9SA 4EN0A 1H1MA 2MEV1 5T3NA 4MHRA 4XF9A 1IS3A 4GMP0 2YBKA 4X62O 4QPIC 3UYJA 1OF4A 1ZWIC 2G1MA 3ZX7A 5F39A 4IE6A 4JTOA 3GXUA 2XDVA 4Y5TA 3POEA 2PHTA 2PHRA 4O2BB 1RL3A 5B1OA 4CUCA 3R4UA 5H9RA 1R3IC 4TLFA 1X59A 2Q8VA 3OT7A 1AXKA 2JECA 3LDKA 2EJ7A 1B3QA 3R4DB 2HWB1 2J1RA 1V6LA 5HCBA 1QJY1 2VQEB 5J2TB 2QDNA 1HNXB 2BNOA 2D5FA 1LTEA 2ZMLA 4FMTA 3ACLA 3UT0A 5L7OB 2R043 5C3RA 5LBBA 2FL4A 4Q8LA 5F2VO 1MEC1 1SQQH 1QXPA 4LITA 4CBCA 1I0HA 3S57A 1BMV2 4DUVA 4QM9A 2W95A 3VDDA 2FZ1A 3ASOB 3J8F2 1JYIA 1UZYA 4CSWA 2QNKA 4AE2A 1MS5A 4RYDA 4I55B 4CDXB 3OPWA 2PAMA 1U5IA 2RS51 1GN3A 4GWNA 4FPOB 4O2AB 2YZ4A 4FOYA 3OD4A 3T4DA 2VMEA 5CEHA 4CDWB 3QG5A 4Y3OA 2PLV2 1NLRA 5FZ3A 3OFNG 3NJVA 4I0BA 1MR5A 4CCOA 1M56B 3IAQA 5FZIA 2QQOA 3WHTA 1GN2A 3SMHA 2Y26A 2RMU1 5B3SB 4JI4O 1IBLB 3UGHA 3O5SA 1SZTA 3LGRA 5HV4A 2N05A 1OQEA 4MG2A 4EFBA 3SPHA 4KH9A 2VZUA 1V55C 2JDKA 3CQOA 1UU5A 1WW4A 2XPJA 3TCUA 1O5LA 3IBMA 3KCXA 4P30A 2A6ZA 3ABKB 5IJ9A 3JBG2 1IBKO 4CCJA 1YFWA 4LHLA 4DV3B 1KQSU 1KC8W 4D6QA 4LP8A 1OUSA 1FOD1 4NHMA 1WLEA 1APNA 2ZMKA 1YTFB 3IPVA 1VBB2 2DYSC 4PA4A 4Q4V2 2A9HA 4J1XA 1AILA 1M4WA 5LRSA 4INDA 4ZOLB 4DV5B 3MLJA 2YICA 3HNBM 3ZRWB 1Q8IA 2JD4A 5LOVB 2WC2A 1MA1A 1H2LA 5LMNO 5FIXA 4CH3A 4R9AA 1MG1A 3CU7A 3OPTA 4S2FA 1EUTA 1IS6A 3PUHA 2EINB 3SPJA 3FHAA 4MH0E 3T0BA 3AG2C 3VBFA 4R4ZA 4X65B 3EHKA 1D7PM 4ISQA 1W3VA 4PDMA 5CKMA 1X7NA 1CAUA 1GOFA 2QQJA 4IEYA 3WX5A 2YC4A 1TVKB 1YF2A 3CZUA 5DXDA 1S0VA 3POYA 1WWYA 5LYJB 3V56A 3Q8AA 4C1WA 1KBHA 2Y8KA 4I3GA 1C1FA 1Z7S3 2P3IA 1CQ9A 5HBAA 5FJKA 1RITA 2WA3A 3JCIA 3UL2A 2QSAA 4LF7B 4FVVA 3C7EA 4I2OA 2UWCA 1KKDA 4LHSA 3ABTA 4BA6A 4DB5A 1UN1A 2JRIA 3T2OA 1K4CC 2XVKA 5KUKA 4MVSA 4QPGC 5KXDA 3VDBA 2FYUH 4YLZA 4K6BA 3C90A 2JDUA 3WZ1A 4XDPA 1FPOA 2X53S 5DM6V 3O1UA 2QDRA 3R0RA 4LO5B 4YG0A 2WFPA 2RM23 3M99B 2DOSA 4IXLA 4CC6A 2ARAA 2VW2A 1QOTA 2PGGA 4IGPA 4ZZ5A 2VZTA 1GOHA 4JYYA 1W8NA 3VB9A 2W0FC 1VBA3 1YVWA 2XKOA 4I0AA 4OYUA 5IYDO 1U5YA 1BGYH 2UUAB 2P7TC 2L6LA 1FD9A 4LHNA 3F95A 1N34B 2VQAA 4P9PA 2CAVA 1H2KA 2UUCO 4R52A 5HPOA 4LOSA 5EC2C 1Z5VA 4CA9A 4LNVA 2BPA2 4MHUA 1RM1C 5IE9A 5C6CA 1SHWB 3H7JA 1BEV3 3CF6E 5ABJB 1N3PA 2CDPA 4DEQA 2W0XA 1AR61 4YFWA 4YZ3A 2PF4E 4SLIA 2YIAA 4IEXA 2GNMA 1Z7S1 1KXGA 1WD4A 4PA9A 1NTMH 3LDRA 4GULA 4N43C 1VQNV 3I2OA 1NUKA 4OGQB 1HNZO 2E5LB 1MZ5A 4AFMA 1P8JA 4QDSA 2JEXA 3DXRA 3LB9A 4ASLA 1QQP1 1FOD2 2E31A 3F7VC 2WLLA 1XC6A 3FYEB 4BK5A 2AR6A 4BU2A 2D6MA 4GA9A 1YTFD 4G27B 5BXZA 2A7WA 3JD73 4Z07A 1BYHA 1ZBA1 3RFRA 1DQ0A 3UKTA 3CWBH 4IEZA 2EVXA 3AG4C 1F5JA 3ZXGA 3SGIA 4PA3A 4GALA 5EBWC 1AJOA 4NWWA 4XMAA 3SYCA 2C26A 4E2QA 4ZU5A 1C1LA 4L9BA 3N9LA 4HT1T 3M3EA 2OT5A 2VU9A 4IHJB 4YXWG 3MEPA 1M9NA 1Y3TA 1O4TA 3B9IA 4YPJA 4X20B 3BAAA 5JIAA 3E8HA 2X5IA 1FAFA 2RNBA 4LQRA 4HPKB 2ZR3A 1W6MB 4FP2A 1ZLZA 4P5YA 5DAXA 4P9LA 4GLXA 4A4AA 4DFSA 3PDQA 4JF3A 1RXFA 1LAJA 2RR13 5DZGA 2WWJA 4CCMA 4K3AA 4EFEA 2CGPA 4MVQA 2Y69C 4CS4A 4CDWC 1ROPA 4M3CB 2ERFA 1REFA 2E3CA 1RUF2 3R66A 4FBFA 3J7LA 5CIRA 5FZGA 3CCQV 4A44A 2WZR3 2EX3A 4B29A 4YYOA 3KV9A 3OGIB 4X9QA 1PX4A 4CP9B 4ES9A 3POGA 2EXIA 3CSXA 1VQ9V 3F7YC 1AR1B 2RS53 4Z2WA 4OZOA 1AP6A 4CDXA 4CCEA 4META 1QLNA 3BRCA 2N04A 3LSQA 1IG3A 1MS4A 1PNLA 2JEUA 2CK3G 2LFSA 3A22A 2Y33A 3M2MA 4B3NA 2WSSG 1GBGA 5BR8B 3RMXA 4YHHO 3K46A 2PHWA 3HQRA 4WM8C 1ULGA 3KVBA 2UXCB 1AJKA 1FPN3 3N7LA 1ND2A 1IS5A 3MIEA 2O57A 3JQXA 3PUIA 3KCCA 4QKDA 5F9TA 4WCEV 3SJCC 3BEHA 5E88A 4DXRA 1SF9A 1GNYA 5B2GB 3PUQA 4YJ3A 3AP5A 3B8NA 3T09A 3H8RA 4YJ3B 3I49A 1V6MA 1FJGO 4D7TA 4XHXA 4K9SA 2FCTA 2ZCEA 3UETA 2GZWA 4QAWA 2QJVA 4KHPB 2X0LA 4LBQD 5FZDA 4D6TH 3K5OA 3POSA 4CU7A 2WNVC 2A7AA 4W65A 1RUJ1 1VQ5V 4OX9O 5FYCA 4RQPB 1DGLA 3WY6A 4XE9A 4UFJA 1RIRA 2EJRA 2ORZA 1VQMV 2WA4A 1VMJA 3WF4A 2W08A 1ZZ7A 4COWA 1ZZ9A 2HVKC 2ZE6A 4KQ7A 1Y76A 4J11A 4AXOA 1WB8A 5FYVA 2WDBA 2BQPA 1BCCH 4O7XA 1AVBA 1CGPA 1XHZA 2HHHB 1FXVA 4JPRA 4MTOA 3VBOB 4XFCA 3SYQA 4IUGA 2ZS6B 1K45A 4JQRA 1JUIA 3E97A 2P3JA 1QBZA 1HNZB 1FMD1 3ZFEC 2R16A 2PFWA 2J1VA 4UF0A 1OFSA 2JD9A 1JA8A 3DKQA 1DGWX 2D6KA 3T30A 4W4LA 3T3YA 2W1UA 2D3SA 5K1XA 5LA0A 2ZKLA 3FBYA 3R4SA 4XIOA 3DYPA 3WW1A 2A73B 1STMA 4H7LA 1O8PA 2OPKA 4IV1B 4X64B 5DUVA 1RUC2 2WR9A 3ITQA 3WUDA 5IWAO 5CFCA 4HNAA 1AI6A 4AGVA 2XNDG 2PAKA 5A6YA 3OBTA 3GBGA 2CE4A 1OKQA 2VQFO 4LKDA 1R091 4JI8O 1LOFA 1WMEA 2JEMA 5A3PA 1XNCA 3K4DA 1RUF1 1G7YA 4PDWC 1HB4A 3HEIA 5FQ0A 1JHJA 5B4NA 3SEPA 5IYZB 3OYWB 5FQ0B 3STLC 3LPGA 2QQKA 1RVF3 5EBMC 1XSRA 1KECA 4DUWA 2R30A 3RWNA 3HKEB 4QKFA 4Y33A 3KG2A 4XZUG 3JD2A 2F23A 2Z2SB 3CRQA 1X8MA 4GKKB 5LW9A 1TME2 1UL9A 2RS52 5FPAA 2BVBA 4E27A 2D7FA 3PU3A 4O4HA 1PO11 2B7YA 2D93A 3LNMB 4UXNA 2RS11 1JN2P 4K8RB 4IV3A 5B4XA 1XILA 3ML0A 3K04A 2Q8CA 1PO21 2LO1A 1EAH1 1TEIA 4LBMA 1D4M3 4IE5A 5DUWA 1ZBE3 4AR2A 5LL6Y 1ZRFA 1YSCA 4X1YB 1PVC3 2DMXA 5ABJC 3ZXFA 2HJDA 1KMIZ 5FYZA 3L9JT 1PZ8A 4RAIA 5J98B 2RE9A 3MHSC 2D5HA 5BMVA 3TEWA 5KHHA 3ZMNA 1W2OA 1V55B 1WCQA 5FREA 2ENRA 2WIIB 3RZZA 4X1KA 1N3OA 1R6TA 2WS93 3ZFEB 4QXCA 5FZ7A 5IATA 1N33O 1PPJH 3RYRA 1SQXH 5FWJA 1PK6B 4RFT0 2IVIB 4DO2A 5C8WA 3QO7A 1LOFC 3RVHA 3IDAA 1M90W 2AACA 4QWNA 4LBKA 2WNUC 2WNEA 4LH7A 4HLTA 5FOBB 4AEMA 4DXWA 3ABMC 5B3SC 1EP0A 1FXHA 3RJRA 3K57A 2E75B 5FMOL 3P32A 1LRHA 3AG1B 2R70A 4JGSA 1NE4A 4MVOA 2V73A 3WXPA 1OOPB 4LR4A 5A7WA 4Z8BA 4UT5A 4ZI7A 3SEEA 1WLCA 4FPFA 2WLPA 4LUMA 1QNYA 1VBD1 2W5FA 3K77A 4LPLA 1LHVA 4SBVA 3TEZA 3AKPA 2DYRB 1QJX2 3PU8A 4UXAA 1RHI2 1LR5A 1Q90D 2ATFA 4DR5B 2YGMA 3SQOA 2FDHA 1RUC3 4RWUA 1H4GA 4X1IA 1HW5A 4O4HB 1COV3 2VQUA 4XDLA 4QX8A 3AK0A 3WNKA 4H14A 2UU9O 2LROA 2Q8OA 2CL2A 5FMBA 4EZHA 2VS0A 5GLZA 4QKNA 4XETA 1A3KA 4HVRA 4BPZA 3ZYIB 2QUOA 5I0SA 3CJHB 1ZRCA 5ITZB 2CUGA 1ULEA 2QR4A 1FATA 1FFXB 3MIFA 1JVMA 4TWTA 1QQP2 2NMNA 4UF0B 5AC93 2IW5A 3BY6A 3I3BA 4WM7A 2KB1A 1NT0A 2YB7A 5GZCA 1SKVA 3UJOA 5BXXA 4QKBA 2DCTA 3CE2A 4TOIA 2HYXA 2JX9A 4BM8A 3OEBA 3T1LA 3AZYA 4Q27A 2OQ7A 2QZ3A 3L2HA 4DV6B 1GMGA 2WLLB 1NA1B 4BIFA 2R071 3KSCA 1ZAUA 3AC0A 4FXKB 4BQYA 3ZDVA 4DV1O 4BQXA 4Q4X2 5CADA 3QLQA 2ZIOA 4QQOA 1BEV1 1XNRB 3OBZA 3HN3A 3M4FA 2GTSA 3BA8A 4LA2A 2TBVA 2EIJB 1IPSA 4NO4A 3VBSB 1R082 1R083 4XBFA 2ZX0A 1YQ8A 2XB6C 2NZ9A 4FLUA 4RUEA 1K5JA 4FQ4A 1QXRA 2JIGA 2PLV3 1RMU1 4WFBV 4TQFA 1UJWB 1QNMA 4NUBA 2WNOA 2PLV1 1VIWB 4D7YA 1G1XB 3RZMA 1BBT2 5JSPA 2UYBA 1FI2A 2R1DA 2GUZB 4FVMA 2WSVA 1CAWB 1I3HA 3J8F1 1NCRB 3ZDSA 1VQKV 4R8CA 1QDCA 4KU7A 1HNWO 3IJ4A 1WCSA 4JDNA 1NQDA 3J7AU 1TAEA 4DR7B 5FUNA 4XBLA 2VVDA 3WG7C 1E79G 4COVA 3AP9A 4BR6A 4NOTA 3TBDA 1Q43A 5G04L 1M56C 1H30A 3CXCU 1R093 4TLGA 2QQUA 4L97A 3JATA 3VLBB 1URXA 2CV6A 2R063 3APQA 2Q5ZA 2GH2A 3QO5A 2D2CB 1LOGA 2WLQA 4O61A 3KF3A 1FT9A 1H4HA 4LE4A 1RUG3 2VM9A 3CKHA 2ZCWA 4GMP1 5A3MA 5IK8A 4H0LB 3THTA 2QWNB 5JI7A 5LXTB 4MYEA 2XWBB 1N0JA 2X5IB 4QX5A 3T1HO 3AZZA 1UMIA 4DNYA 3PVOA 4RR3B 1MEC2 2YG0A 1NX9A 5B1AC 4LK6A 4I50A 3RYHB 3CCRV 4EB6A 2P67A 4C8DA 4HNAB 4J10A 5LBCA 3AM2A 5FZ8A 3VBOC 4IIJB 4U3JB 3ZHQA 4FOWA 2VD7A 1MQTA 5GZEA 2XHNA 2RJ2A 1W0NA 4Q0SA 4YY3O 4GWJA 1XE0A 5CFDA 1COV2 4M3CE 4A7ZA 5GZGA 3NNFA 2EXJA 1ZTEA 1RUJ2 4XEZA 5D5PA 3MDPA 1SQ4A 1ULCA 4MZUA 5CG9A 1WN7A 4N43A 5FXVA 3Q4HA 4TV8A 2P6JA 5D21A 1LEDA 1QOOA 3OGCC 1LOBA 1KYOF 1S2EA 1UMHA 1AI5A 4F4LA 1ZRDA 1DF4A 2WQ8A 3IB3A 4Q0VA 2ZGMA 4FFBB 3B8MA 4J25A 5IJ0B 4WFGA 4CUBA 2V5YA 4XF1A 4JGYC 1JJOA 1Y43B 1UPSA 3SH4A 1UY1A 3G6JB 4XC9A 1HB1A 2BGOA 2O8QA 3ZSKA 1BBT1 2DYSB 1D2SA 4PDWB 3DF0A 1X4TA 3KHBA 4OXSA 4PT6A 3RDIA 2KXLA 1J5EO 3OAAG 4O4IA 1ZZ8A 3B9CA 4OHXA 1HRV1 4JI3B 1GU3A 3JSLA 4FM0A 4H33A 5LZ6A 3U10A 4QU1A 5JCOC 1PGL2 4GUNA 3JARB 2W87A 5F8PA 3VHOA 1CZVA 3MI8A 1PGW2 3E6DA 4GB32 4AVAA 1PGW1 2VBDA 3ZN4A 4QPGA 4I0XB 4DY3A 1UOGA 4MTGA 1GYKA 2QQPA 3WNXA 4XQWA 4AGGA 1HN1A 4BLIA 1H8EG 4JI6O 1TMF1 2JDPA 1GAXA 1ZX3A 4X66B 1OHHG 4E2LA 2QKCA 1JZ5A 3ZRWA 5BYNA 3PVNA 4R9CA 3MBWA 1S0FA 3HBZA 2DVAA 3C3TA 3CHXA 2Y38A 2IH3C 2UXBO 4HONA 3H1KH 3SR2C 4JDOA 4LO7A 4V2VA 3ZOIA 4MW3A 2OYZA 3T2TA 3VBFB 3PIJA 3V0AB 1MZEA 3WU2Z 1N1SA 2ZAHA 2KA3A 4Y1VA 3POIA 2C1FA 2E7TA 3KD4A 3NVCA 2B9ZA 1H38A 1H8VA 4CUGA 4DR6B 4AGRA 4QM8A 2GV9A 3GGLA 1JTZX 5FZLA 4QT6A 1OCZB 4ZS3A 1AX1A 4ZBMA 4RS5B 5APAA 1OCRC 1ZBA2 1Z5WA 3KV4A 4GX1A 1S5JA 5EBLC 5FLXN 2VXRA 2DVGA 1ULDA 2N7GA 1PVXA 5FDBA 3RVZA 4B3SB 2GC0A 2DUQA 4PA7A 3FB7C 3WP4A 4UW5A 5FYTA 4JAUA 5EYYA 5FYMA 1K34A 3BYWA 4MO3M 5GZDA 1VP6A 5IYCO 3MF6A 3OMNB 1COV1 1OSGA 3VD7A 3NL1A 1VARA 3WFVA 1QIQA 3ETEA 2VZPA 3N9MA 3MV11 4IEQA 5T52A 4Q4Y3 1P49A 1GM7A 1W0PA 3RG0A 1C5HA 2VOKA 4UI9L 4IEUA 5KR7A 4ET7A 1TNFA 4LBEC 1CAVB 3X2QB 3QOPA 5KLVH 2UXCO 1LU2A 4IE0A 4DUYB 1IQAA 1FS0G 2ZGOA 1RPOA 2DTYA 3ZXEA 2XLGA 4FLZA 4NAMA 3EQEA 4DR1O 4CCDA 3I2JA 2AUYA 1UZWA 3WDTA 1RUG2 4X8PA 3THDA 2Q1FA 1UXXX 2K9ZA 2B42B 3ILRA 1NR1A 3IC7A 3H3LA 1P4RA 3EYPA 2ZX2A 1QXJA 3D36C 1WA8A 4PBPA 4EJRA 3IT8A 4M4RA 2K2SA 1ZL8A 3VD5A 1J3PA 5AC92 3VHPA 3BCWA 3ZXKA 2GP5A 4TWKA 3DC5A 2YGLA 1WP8A 1GZWB 4YW2A 3SNMA 1JBCA 3W5NA 2LALA 3D0SA 4UBGA 4X89A 2BJSA 4I4TB 2O14A 4Q0QA 3CCVV 4DV4B 4JGZB 5KX5A 3OPZA 5IFPA 3MLKA 4ZKTB 5FNVA 2ZTNA 2LRPA 1D4VB 3ZJZA 1L8DA 2JB8A 2RVAA 4CDQC 3E1F1 2E26A 1RUI1 3JASB 3T1MA 1SESA 1W28A 3UO3A 1Y66A 5FZHA 4UYBA 1UYPA 4ABMA 2UUBO 1Y7BA 4HAMA 1POV1 1AB3A 4B3MO 3B2EE 4RD7A 2QWOB 3ST7A 5IWFA 3N2GB 4LIUA 3O1VA 4UCSA 4P9XA 5BZBA 2R9RB 2ZZJA 5KXCA 2FMLA 4FPYA 1JZ3A 2DW4A 1KUQA 3NNLA 3LE0A 4XURA 2OS2A 3RJ2X 3AYEA 3L73H 2E76B 4ES8A 1DU3D 3CYOA 1RYYA 4ZHQB 2CWMA 1YHFA 5A32A 1ONAA 4JDMA 1HV1A 3BODA 3WCSA 2GC2A 3MW3A 3OEAA 1S76D 3ZM8A 3B00A 2UY8A 1K8AW 2JICA 4FFGA 4YRDA 3J7HA 3IIAA 3OEEG 2ZINA 1YLLA 4OI4A 4JHZA 4PJYA 1JOYA 3VDAA 1US3A 4XHBA 3CMGA 3K5MA 4P9OA 1ALYA 4IL7A 1R1A2 3X29B 4UVCA 1NKDA 3VKLA 2YPDA 3UJQA 3OM3B 4UB8Z 3MIHA 3VZLA 4GX0A 5LA9A 5CFCC 1EN5A 2IJJA 1BXHA 2E33A 2OZJA 1F7YA 3SISA 3K75B 1BHGA 2R061 2XT9A 1O9GA 4MLOA 5FL7G 4YFZA 3NNJA 4DR6O 4AVTA 4Q1RA 2VQ0A 1GR3A 1ND3B 3DXUA 1U0AA 1VAMA 2JDYA 3ZFEA 4AHZA 2ILMA 3LZZA 4FIPC 5CB4B 4FO9A 1HDJA 3LEGA 3JCZA 4JI1O 1FAYA 4JRLA 1GM9A 2IJHA 5FZ4A 3Q8EA 4NTXA 4FLVA 1W8ZA 1XI1A 2NM1A 2YEVB 1PIV2 4DR2O 1I94O 2R7EB 2QE7G 4IV1C 3RT3C 3USUA 2FTKA 4AG4A 3ELNA 2YEVA 1QJZA 5CNAA 1W04A 3QVNA 1JU4A 3O14A 3ZN5A 4KWLA 3N9PA 5LEJA 2DVDA 1XE8A 5KHKA 2VW0A 2YROA 2GMMA 2DFCA 2V72A 3VBSA 5HFMA 2ATKC 1N47A 5L9BA 1DYOA 4IT5A 1UKRA 5A3UA 2BGCA 4R4XA 2BDRA 2XLAA 3TNQA 2QE3A 3FJSA 3FYIB 3AG7A 4P9GA 3WQ1A 2X6AA 5C8CA 4QX2A 4NHKA 3C7FA 2GHYA 2XL9A 4ITCA 4K1YA 5FY9A 4K0KB 1ND3C 2V1DA 4A3XA 1HXS3 1UY4A 4JASA 5CYYA 3E89A 2DDUA 1OCOB 2Q6AA 4OHVA 3WEZA 4LTAA 2Y4TA 2VQEO 3QH6A 3C3SA 2BE3A 1CONA 5H9QA 1L3JA 4RHV2 4DRXB 1NLSA 3C3VA 4XABA 1JPXA 3SPIA 3DKWA 4IEWA 4WM8A 2TUNA 2ZNJA 1C8NA 4AQ2A 1SQFA 1HR0O 4XW3A 1GOGA 1WZXA 1POV0 2PQSA 2CAZC 4YVSB 3CD6V 5FXWA 3OBRA 4Z82A 5C8CC 1N36B 1R1A1 1KP2A 1YJ9V 4Q1PA 3N27A 2RM22 1M06G 1PO12 2CH7A 3H1YA 3TN91 3VDCA 2CH7B 3QCWA 5JUVA 1I9RA 4LBOA 1XNKA 5LGNA 3K4ZA 3VBSC 5GONB 4DR5O 1LB2A 3A2FA 2DFBA 1DLCA 4CDXC 2BBVA 4QE9A 3GBWA 2EZOA 2JB4A 4TV8B 4BJ0A 4DV7O 4MGYE 4LF8O 1R6KA 1KJRA 1K7DA 1LCLA 3ACFA 2GP3A 2VZSA 4FP3A 3EJKA 4W6YA 3LFMA 1PGSA 5D5QA 4IV1A 3VKNA 4RN5A 2P17A 4DUZO 1CIYA 3RYFA 4CDWA 2JGDB 1XU2A 3E86A 1OCRB 5J2UA 3FE5A 4D6RA 5LY2A 1QJX1 1R64A 4UV9A 1GP5A 3GZTB 4FZ1A 4ASUG 1F31A 1MPXA 4IIJA 4U3JA 3FLTA 2NN4A 1H6YA 4YNIA 4XTMA 4BQWA 3K5NA 1MS8A 3CX5F 2CGOA 4AW7A 1SPPB 4BB3A 4FFKA 3IN9A 3A8TA 4PQQA 2RV9A 3C7HA 1AI4A 5DZFA 3BTXA 5LK7B 5LK5A 4CUAA 1DTOA 4OI2A 2Q1ZB 3HKBB 3LSEA 3D82A 3MUY1 2QM7A 3B3QE 4QGMA 2ZEZA 1KDKA 3ZFFB 4GJYA 4U2AA 3MAQA 1LOAA 1VPHA 2OQ6A 4Z2AA 4J7KA 5KMGA 3VOUA 1NCRA 4I9QA 1EAH2 1XQNA 1T2XA 3LOIA 3MFAA 3GZUC 5C93A 2VR4A 5B1AB 2H0BA 2JVDA 3FWEA 4DRXA 3T1CA 1EYBA 1N1TA 3JALB 3JAKB 4WM8B 5FPRA 1TG7A 5B1BC 1OT5A 4OHZA 3NJYA 1GWLA 1NQJA 3ALQA 1SLCA 2CAUA 4YM2A 3ZX6A 2Z5UA 4LHKA 5FKBA 5T5OA 1ODMA 3ZEDA 4QMAA 4RGGA 3TJTA 2ET1A 3RSJA 4IE4A 4DV0O 2QQVA 5HI0A 4QQLA 3RQ0A 5LMUO 4NKGB 1XEQA 1S4CA 4Y5Z0 3RMYA 5JH7A 5I0RA 4XF3A 4W6WA 4JI4B 3IIIA 5F6LB 2DV9A 1DZQA 4OQ8A 5CB4A 4XBNA 2ZDIA 5L3BA 1LEMA 3I97A 4KU8A 4WVWA 4L87A 2P4VA 1YRZA 4R9BA 3DXRB 2B9VA 3H1IH 2Q9LA 3OD0A 4XQ4A 3WNNA 3JD1A 1DQ1A 1ZZ6A 1NXD1 2P3YA 2Q7HA 4ONUA 2HWF3 1NCQC 1OXCA 4JI2B 3OUJA 3PHMA 4CDQA 4XBQA 3K59A 2JDZA 1GQPA 4S2HA 2H6BA 3LSDA 1RMU3 3IDEA 4G4FA 3H1WA 4U7OA 2Y6HA 5BV6A 4YHHB 1LECA 1SQPH 4E4SA 5JMCA 4ZI7B 4HN1A 2GAUA 4JX0A 1LOEA 5IVBA 2E32A 5DAPA 3KLSA 4XXPA 5C4WB 2YFUA 4CVUA 2R073 2BWCA 2F6BA 1RFYA 4UW4A 3D36A 1S0CA 3AMPA 4RFRB 1UMZA 2QWQB 4L8JA 5CZKA 3ASNC 5LASA 3CCMV 3O9OA 3JD0A 5FZFA 2EIEA 3DGTA 1QNWA 3WG3A 1G9DA 4JRAA 3IDBB 1ST8A 5AFEA 1AYN1 1OLRA 1PV0A 4ORFA 4LE3A 5GW7A 1JYXA 2HVJC 4IL6Z 2IH1C 2UXNA 2BU9A 1N33B 1S2BA 2LJ2A 3CRAA 4UW6A 2EIKC 1SZBA 3KM5A 4LXLA 4PDVA 3ZYGA 3KGLA 1D2QA 3NV1A 4DY5A 3OBAA 4BMEA 1IX9A 1U97A 3VBFC 1KB9F 3TWIA 3OGGA 4OVEA 5FZAA 4I55A 1VMFA 5E89A 1QOSA 3CJIC 3RN4A 5IVYA 5IW0A 3VZOA 2ZGQA 2WJSA 2B1IA 2LS6A 3I2KA 1WA8B 5CA0B 3LA3A 4JKLA 4QGPA 2QA4V 4WVVA 4QB2A 3B40A 4E8DA 3ASNB 1Q5OA 2HEVF 4Q0PA 3E35A 1YJKA 2XUEA 1G9CA 5G05L 5FYSA 1V6NA 5AVPA 5CN0A 3LA7A 4H3WA 1BLZA 1N8RW 1GKFA 2VMHA 3AVSA 1GK9A 2P90A 4NIGA 4JYAB 4XVHA 1R3KC 1VRH1 4CXYA 4DRVA 1DK1A 1W8WA 1Y4MA 4PJ0Z 4X88A 3ZVXA 3AYDA 1YFUA 1MZ6A 4N9HA 1KITA 2XWJB 4LFBO 4LNUA 1UAIA 1HLCA 1W06A 2IXKA 1DLBA 4LLOA 1CAWA 1OOPC 4V1PA 5FV3A 2EILC 2Q69A 1KD7A 3OTOB 2E9QA 2Q7EA 2WABA 1W2BU 1EN4A 2R9IA 5A6ZA 2YUEA 3I4IA 4DV2O 2EF6A 2VTXA 1DQ6A 1Q6UA 4M01A 1UF2C 1ZVFA 2PI5A 3CJXA 3KB5A 3VL8A 4FLWA 3ILFA 4P5HA 1RINA 5BNNC 5KC5A 2XJQA 2Q4SA 2FD8A 2SBAA 2BP6A 5JCOA 4TSVA 5F37A 2FCUA 5JZGA 3W21A 2H0VA 5FPLA 2YI9A 1ZM1A 2ZM6B 2VPVA 2AZ2A 4JI0O 1TUBA 2E51A 3S30A 1CAXB 2WINB 3L9DA 4YZ2A 2C4XA 3L72H 3G6EV 5JXIA 5GTHZ 3N3HA 3SCGA 3FUOA 1XNAA 4L0PA 1MZFA 2RJKA 4LKFA 2IJIA 3H0OA 4AL9A 3GF6A 1YI2V 3ECQA 5FZEA 1GZ9A 1LENA 5LYJA 3ROUA 4JV5B 2XHKA 1AVMA 1Q6HA 1RJ7A 1D5NA 4RA0A 2MEV2 3EBRA 4EN6B 2WO2A 4XTPA 3SKJE 3AG3C 3W7XA 1NTZH 3IM0A 5GJ6A 3LAGA 4G3YC 5FYHA 2BTOA 1BS3A 1N32B 3HPLC 3FD9A 1COWG 2WYFA 2ODMA 1GM8A 3DPRC 4K3UA 1D2DA 5IYZA 3VBHA 3U0ZA 1YIPA 4QPIA 3UQ8A 4JGZA 5JVDB 5K8SA 2ES3A 3JZVA 4BW9A 1TUEB 2XJVA 3PN1A 4A42A 5CFDC 1RVF1 3HR0A 3POBA 5KHJA 4BK4A 4KL1A 4DR7O 4BDVB 2HWF2 4ZXEA 4OLLA 3DYOA 3R6SA 4AEDA 5LGUA 4J1WA 4BCUA 2ZKOA 5KMGB 5FK7A 3B01A 1W99A 1HRI3 3VQVA 2B5HA 1ULOA 2YXHA 4QX7A 1F4MA 1E5RA 2WLHA 5BNOC 3PNAA 5FWEA 2Q0OC 2XAFA 4QD2A 3KQRA 4CPBA 1DP0A 3GJAA 1PP9H 5JJJB 3G4SV 1HJGA 4DYLA 1IBMO 2Y6FA 1Y9MA 1X36A 1QQCA 2BRTA 5C9AA 1QJU2 1QJU3 4W4KA 5F5IA 3BKZA 2YXLA 3VQWA 4XJ8A 2Q5TA 3ZRXA 1JFFA 1Y6XA 3WSOA 5FP9A 3LF7A 3EVKA 4JI5B 2QVSB 4Y22B 5IVCA 2DBIA 3J26N 1Q8PA 1VQ6V 1OCCB 1UXZA 1DHKB 2V4AA 1ZREA 2OUJA 1FFTB 4LBQB 1W9YA 1FMD2 1QQP3 2BOBC 1F5FA 3IPVB 3O7OA 2VAUA 3K0DA 2ZZQA 4AZZA 3WNLA 4UFLA 3EHBB 2ZGUA 4L99A 1L7RA 4AEKA 3K06A 2QJ1A 4Q6GA 2C2AA 3L75H 3SDLA 1PMHX 3DGEA 3STZC 4EE2A 4HK9A 3WG4A 2FQPA 1F35A 2WLNA 1V54C 1XL6A 3QACA 1G9AA 2UXDO 2XMLA 1JX9A 2VCAA 3JYCA 5FNVB 1YHQV 4M0HA 3AK3A 3UGGA 1JZ7A 2PI4A 1HKDA 5F3EA 4QHBA 3TRSB 2WO7A 4MSVA 2LW1A 5AC91 3RVYA 4DUXA 1O59A 1NR7A 2EIMB 1UCXA 1V0AA 1SFPA 1KRIA 1OD5A 1K5MA 2JS3A 3DUIA 3M8AA 1K5MB 3DEMA 5E8AA 4RHV3 1XNQB 2J1UA 1JS9A 3AKRA 1RP3B 4HYOA 2D43A 1W6QA 2W1WA 3OF1A 2G9GA 1M5IA 4K35A 3SYAA 3I59A 1RC6A 3PLQA 4GIQA 1OA4A 5FMOS 3K3OA 3T2QA 2ZQMA 5D8AC 3NO8A 2A5ZA 2WWUA 3NW4A 3NQHA 4YARA 4FLTA 3GB7C 2LGQA 2VY0A 1YQ6A 3L74H 1MVQA 4C0HA 2JE7A 5BMVB 2EXHA 4XQDA 3G67A 3OCPA 2CDYA 3TEXA 2JGUA 4FPCA 1V54B 3HPNA 5EZYA 1C28A 4XYXA 4LF5B 3GDBA 3K9SA 1MACA 1PM4A 1OURA 4DXSA 5DAWA 2NLJC 2EICA 3ASOC 2NPIA 4C90A 3ZRSA 1RTVA 5IVFA 4TSFG 4QGNA 2JDIG 1H8HG 3VBRA 1DQ4A 1B35C 1UIKA 4DPNA 1O3TA 1ZSPA 3WD5A 5FZBA 3LD8A 5FO8B 2Z69A 4NPMA 3RNSA 4KG8A 3MHHC 3JD72 3UCSC 5EJ3A 1AR81 1SERA 3AG1C 1Z78A 3AZVA 3VKMA 4OPHA 4EWDA 1N0NA 2M6YA 1Q81W 1ORQC 5L3FA 1DYKA 5JPNB 4BWAA 3V64A 5M0TA 5C7GA 2E7QA 2ZGRA 5TSWA 1E5HA 1YIFA 2WNUA 4DV5O 1WMXA 3BN6A 1QVFU 3KZ4C 3BOWA 3WNMA 1W6PA 2Y0PA 3HBKA 2OVUA 1UZZA 1PGL1 3HNMA 2VUDA 3ZMZA 3I2GA 2WLJA 3TYJA 3VZNA 3UKMA 4W8JA 2DU0A 5I8SA 4KP4A 4EQVA 3NKGA 1EZVH 3MZHA 3T1YO 2ZNIA 4RS5C 3WQ0A 3ZBHA 3N2KA 3KVAA 4EV0A 4CEWB 2B5UA 5BPXA 4QB6A 1VBC2 5ABJA 2WYSA 2VWJA 2OW4A 2XR4A 4GXLA 2F43G 1F8VA 1O7FA 3D3AA 2OUHA 5F7UA 3I56V 2HWB2 1POQA 3ZMOA 1O91A 3G71V 2WLIA 2WZ8A 1MS0A 3QO8A 4MADA 1H9WA 4E2GA 4NVPA 1K3IA 4PI2A 3JB8A 5ANNA 2MK3A 5E79Z 4BW5A 4IESA 5B5EZ 2JG9C 1J59A 4CRQA 3LIGA 2A3QA 3M8LA 1WUVA 1OA3A 4O65A 3M3IA 3B5LB 5BNPC 4HL0A 2ZABA 1ASJ3 5F3CA 4WFAV 5FCCA 4N53A 2GNTA 1BBT3 2OWOA 5FPOA 2ZPXA 3VV1A 3Q9OA 1JZ2A 3DXTA 1OLQA 2D98A 1C57A 4J80A 2PXJA 2JKXA 4CDUA 3BVCA 2X29A 3T08A 4BWOA 1B09A 4QPIB 4IEOA 5LA6B 3KV6A 4Q20A 1SBEA 5LY1A 4Z1VA 1NXMA 5C3PA 5H5NA 1GFF2 2WKKA 2XJTA 3VD4A 3CC4V 3O0XA 5T5JA 3FFZA 4XFBA 1X50A 4Q4X3 4LF9O 5ACA1 3FX3A 1F4AA 2E6VA 1SCSA 1WMFA 4NPLA 1ZNPA 1XYPA 2ETEA 2ADDA 5DG2A 4MGZE 1DCSA 4HKLA 2BCCH 4ASKA 4LF4B 3WB1A 3ZHSA 2IXHA 1IPJA 1OA2A 2D6LX 2XBO3 3MPPG 3VZJA 4BIUA 1RXGA 4XJAA 5HXVA 4BIOA 4KUMA 5FY8A 4ZPIA 3D0JA 2ARCA 3SPCA 1W0OA 4GH4B 3DTUB 1W2AX 4UCRA 1O6UA 2ETNA 3ZMUA 2DCJA 3TOJA 1X9TA 5IK7A 3SCHA 3MYXA 2ZX1A 4P9WA 2JE8A 3OMAB 3DC6A 5L9RA 1ASJ2 4XDJA 1C4RA 3FKSG 4O4JB 3GWOA 1VBD3 4FFFA 2C24A 1B6QA 4WVMA 4BQ3A 3UESA 1C5IA 3RYIB 5KBFA 2JS5A 1RB8G 4XUQA 1P84F 2BZDA 2QCSB 4TT3G 1XNBA 1AJQA 1WCUA 1RM1B 3K9AA 4EN7B 3QNEA 4B7KA 1EN6A 1ENVA 1EY2A 2UWAA 4YVWB 1PNMA 3BIEA 4XDQA 1D0GA 4GKJO 2JDAA 2WNVA 4AQYO 4X62B 4Q4V3 4RL7A 4LF6B 3LDCA 2D97A 3VBUC 3LNNA 1QWRA 5JPMB 4COZA 4JZRA 1PKXA 3RZLA 3OY8B 4N90A 2ZACA 2IM9A 4RQEA 3USSA 4DEVA 1LODA 3Q8BA 4A41A 4Q5OA 2G9FA 4PQ9A 4CP9A 2W6IG 3HJRA 1AP5A 1JU3A 3ABKC 2D6PA 3VUOA 4CEYB 4NTYA 5CBGA 3B69A 1BMV1 3KS7A 4LEJA 1TE1B 5D8AB 4HG6B 3BTYA 3HKEA 1W0JG 4R50A 1HNXO 4GZ9A 4OZXA 4MGIE 4YM1A 1VBB1 5FR3A 3BPSA 4E4EA 3LWCA 1KP3A 3AFKA 1OVSA 1IXMA 2Z4FA 5CBFA 5CA3A 4B7EA 1NA1C 1SZXA 3TXQA 2VECA 1Q82W 1VBE3 4URTA 2KSDA 5FY7A 1XYOA 5JWPA 4NIIA 4CCNA 1ENRA 3AXEA 4QB1A 2QQNA 2EIBA 1DF0A 3AG3B 3UT5A 2PAEA 5J36A 5K9YA 1HW7A 1KGYA 5F2WA 4OQ9A 1YO8A 2ZHLA 4WZFA 2ORXA 5C9AB 3E8BA 1JYVA 2DVFA 2N74A 1MMMA 3QF7A 4OUEA 4NJ4A 1FXKA 2R72A 4AFDA 1IURA 5D2AA 1ZBE2 4RQPA 4AI8A 4X1KB 1DQ2A 3ON7A 3TK1A 1W6OB 2G19A 4OCTA 3QBQA 2OXBA 2P1BA 3MD0A 2PN5A 3JAWA 2Z79A 4O4LB 5BUVA 1K9MW 1BK0A 1QKQA 4QHOA 2AEZA 2PELA 4NIHA 2JENA 2HJIA 3RGBA 3WV6A 2VCBA 2X5IC 1YQ2A 1YITV 3JSNA 1IBKB 1IPKA 4BIZA 3O0VA 1AI7A 1YJLA 1DZRA 3M7AA 3ZFGC 5F1RA 5H9PA 1UY0A 3MDSA 3HN1A 4Q4W3 3ZYHA 1JYNA 5LA1A 2IXLA 2GSMB 1XL4A 1V6IA 1EV13 5CB7A 2G38A 1U96A 3EO6A 2RDCA 1I1EA 3MFCA 1PD3A 3O65A 4AI9A 5EZWA 1G6UA 2XXZA 1QLEB 5H6QA 5JOZA 1XU1A 4Q29A 1XREA 1IVSA 4XFGA 1JOPA 4Y1XA 3WP5A 1ZUQA 3ZMSA 1OHFA 2IC1A 2VNVA 1V70A 3ZXLA 1ZYBA 3PURA 4HANA 1YDXA 1RUNA 5FPUA 4HKOA 4H7MA 1Y9QA 4DMIA 1NCQB 2J1AA 5LEKA 2AZ5A 3IKWA 5KHIA 2OYQA 3WDXA 1NZCA 4LLFA 1UX6A 2W6JG 3C8XA 2HG5C 3NV2A 4QX1A 1J95A 4LUKA 2VMIA 4KFMA 1BE3H 3KQ4B 1JODA 4QXKA 3HQUA 1O3QA 3GYDA 2FCVA 1SQGA 1NS1A 2WS92 1OPOA 2WLIB 2RM21 1VLNA 3PJQA 4HPKA 2W52A 3BU0A 4PIZA 4UFMA 1OLME 4LFAO 2A3XA 3H1JH 3ACHA 2OCHA 3T2MA 5CA1B 3ZHVA 1N4CA 1WB7A 4NMIA 3LUTB 5L7OC 3AZXA 2D44A 1VBB3 1PO23 1FPN1 1RHI1 1WPBA 1GRJA 3CCEV 3RZHA 1ZBE1 5CBLA 2ID4A 1VBD2 4NXMB 2VOVA 3FUQA 1R1BA 3WDVA 4GCZA 5T55A 3PMSA 2QDOA 4ICGA 3OGSA 2JJ1G 4ZXKA 5DMYA 2XH6A 5IK4A 5LP6B 5GONA 3WDUA 1SLIA 4U7NA 4YGEA 4B3TB 3K58A 4CEYA 4S2GA 5EWSA 5A33B 4QDQA 3AMNA 3AKTA 2D3OW 2LW8A 2R041 3AP7A 5K0UC 1K42A 1BT8A 4NHXA 1UWWA 2ADPA 3VZKA 3BALA 2GDFA 3H9VA 5ANQA 1ND2B 2W1QA 1YFXA 3Q8CA 4C1XA 2NP0A 4BQ1A 4QPJA 3TN92 1K92A 4MSWC 1SLAA 4FLYA 1PO13 2ARBA 3BPZA 1POV3 5C5TA 3K3WA 4LF8B 3GJBA 1IKQA 1Y4WA 3C7OA 1OVPA 1LGNA 3ZXDA 3ORJA 4Z92B 1RUH2 3W20A 1KDMA 1UYYA 1S0EA 5T50A 1IOAA 4NN0A 3U07A 4FOQA 1LNQA 4XDOA 1XYNA 3ZHRA 5FPVA 3WHUA 3O1SA 4U36A 1GN4A 4IDZA 1QHTA 2CTPA 3VQXA 4X8AA 5IAXA 3TETA 1U12A 3WDYA 2QQWA 3FC0A 3NAPC 3I3DA 3U4XA 2PMWB 1S0JA 2B45X 3JAWB 2F1MA 4IV3B 3SJBC 2JE9A 1F23A 1WBLA 3ZCCA 5LRRA 5JXJA 5T54A 4J9YB 2PZSA 1AYM3 4EB6B 3H1MA 4YVWA 4XACA 3CRMA 4WFHA 2FBEA 2ZKNA 1LHOA 3P1IA 3ATGA 3J7NA 3FB6C 3SCFA 2BTQB 2UUAO 1XMQB 3Q8FA 2F93B 1XB9A 3OY8A 4IERA 5ERLA 3CIHA 5TISZ 4LR3A 3ZSMA 2WSUA 1S5HC 5JH7B 4DZGA 2XGXA 1MS9A 1R092 2V7QG 4LIVA 4LOTA 3IMNA 1SA0B 1BK1A 2XVGA 5IWAB 4ZU4A 2NNUA 5F3GA 5LP6C 1UYZA 4MVMA 3AJYA 2V09A 5A3TA 4XXAA 2WNUB 4HVOA 2HLEA 4D3WA 5FZ1A 3PVBB 4B1MA 4UUJC 2P22C 4F6RA 5IY5C 5T5PA 3UKVA 2HWE3 4AF9A 3ZPYA 2IBZH 4FPPA 2YS8A 4QJFB 4BOWA 3G6BA 3JUUA 4HETA 2JG9B 4K8XA 2B4KA 1PK6C 2TEPA 3PUAA 3OGRA 2IJKA 4BH9A 1IS4A 4D7SA 4N7IA 1WLDA 1JHNA 2BUKA 5E6HA 3U78A 3K5LA 1UNBA 3I54A 4K21A 4JC1A 2CTVA 4JGYB 3CP1A 3VDDC 4D69A 1BL8A 1V6JA 2AEYA 3ZR5A 5FO7B 4XOGA 4ZONA 4UOJA 2JKBA 1ZZCA 3J7MA 4K7JA 2JXAA 2ZGTA 4P9IA 4BISA 1CJPA 4DV1B 1OD3A 1XPWA 1H1IA 5JQGB 3AVRA 4LKSA 1PMIA 4D94A 5F3IA 4HSJA 2P4KA 5I8TA 3RYIA 2XAGA 1CZTA 4ZU7A 1QVGU 2M7WA 2VUJA 2RHPA 4JZGA 4QDRA 4XF0A 1OQ1A 5LMNB 4YJ2A 1OI6A 4S2DA 3WF2A 4GYCB 5BNOB 4AI0A 5F5QA 1PM9A 1WCDJ 4PF1A 2C0ZA 1PNGA 3N9OA 1XUQA 4NRPA 3J9SA 1QU7A 1U5XA 1K12A 5GLWA 4KNCA 4UAPA 3ACGA 2Q68A 1IGOA 4HK8A 4QQPA 4A6OA 3BI3A 3GNEA 1BZWA 3DSQA 3ZSLA 1FYJA 4XJ9A 3BFRA 3MW4A 2HR3A 4Y1UA 1PMJX 2X6BA 2WT0A 4XJZA 4KWUA 1Q3EA 4Y1ZA 2XKPA 3SLIA 1VBC3 5A3OA 4QU2A 3OUIA 1JQ0A 3ZLIA 2C9AA 2BVVA 2WPDG 5J1XA 2PHFA 1MABG 5I0DA 1FXZA 1TQ5A 1OQDA 1GZTA 1YI7A 4AVVA 1VRBA 4PIXA 5IY5B 5EIBD 5FYIA 3KZIZ 4GB31 1AYM1 5LBFA 4P9YA 2R0FA 3WF1A 2Q8DA 3JQWA 2Q30A 5CAZA 1NT2B 4XFIA 1AR83 4M3CF 1VQ7V 2WUHA 4PA6A 4PDRA 2EALA 5LB6A 1TME3 2ZX3A 4EN8B 3WB0A 2EIMC 2Y6KA 1NVPD 1VAKA 3B93A 3ZFFC 4JKKA 1HR0B 5LXTA 4R8HA 3UK9A 4FTEA 1RSOA 4DS0A 4WZCA 5JQGA 2Y0IA 1HQLA 2JG8A 2ZGSA 3NV4A 4I50B 5IVEA 1Q8VA 5J48A 1JZ8A 1BVVA 5ACA3 2JDHA 2VZVA 1XBLA 5FZ6A 2YYOA 1KFUL 2QKDA 2CTRA 3FFQA 1XE7A 2HWD3 1OCZC 4WVZA 4K40A 3ZMTA 1PNFA 4UWDA 1CPYA 2FDJA 1F4NA 2WBKA 1TVGA 2R32A 3GM8A 2DCKA 1S77D 3UKNA 5LWBA 4COUA 1DF5A 2IU3A 4LF9B 3WR0A 2YHJA 2VZ3A 2VBPA 3CMEV 3S6PA 3T0DA 4N7UA 2E5LO 1MSWD 4IYIA 3OR6C 1K97A 2A1XA 1I5YA 3TAYA 2EINC 3M3QA 2WZEA 4EWAA 3LCPA 1C8M3 2P5BA 2CY6A 2A3YA 2VGDA 3WNPA 1SDWA 5FPZA 1J1TA 1W2TA 3U14A 2UY9A 4AAXA 4EN9B 2YU2A 4X65O 4UCTA 3PL0A 4MW8A 3B09A 1G4YB 3GZAA 2Q8EA 3OSDA 1JJ2U 1H8TA 4GJZA 1W03A 3A4UA 2IWGB 3IGAC 1QJY3 4P2ZA 3T2PA 4RGAA 1OH3A 2OTLV 1AL23 1J58A 1YJNV 1HX6A 3L71H 1I94B 4LA3A 1LHWA 2ZGKA 2XHBA 2ZEWA 4M4PA 1MSDA 2OX0A 4FTSA 1WNSA 2R9AA 4DR3O 5AG2A 4Y4RA 4CE8A 1W8HA 1M57C 2X8KA 4GX5A 3ZN6A 5A9GA 2GC3A 3MIBA 3ICXA 3JARA 4OFGA 4ARXA 2UYAA 1H2MA 2RDNA 3WT3A 1NU1H 2WWWA 4KI5M 2MEV3 1OFNA 3MGUA 5H6RA 2IU0A 4KWJA 1XMOB 1HRV2 4QHZA 5DAVA 2HKOA 2BW8A 1S72V 1A8DA 4N8MA 5DQ0A 3JBG1 5E1RA 3CEWA 1CN1A 4CU6A 5A70A 1V00A 2XG3A 4OI1A 4NRMA 4ZHQA 3I3MA 2QKSA 5F6KA 2GMPA 5F32A 4J7ZA 5FP4A 2NR5A 4CTEA 5FZ0A 5FP3A 1O8SA 3LEKA 1BKZA 3BTZA 5KX5B 1CAXA 1E5IA 3FX7A 3JB4C 1Q8OA 3SH5A 2QWPB 3LEIA 4XILA 1DFQA 2EBOA 2A3WA 4ARYA 1WKYA 4RUFA 3RYHA 1G8WA 2EILB 3I7DA 5A1AA 3G7DA 3HD8B 1VF6A 2C6SA 3ZN1A 3VQYA 1BMFG 2WAMA 3PJSK 3RRDA 3AEIA 1WGPA 3I3EA 2CHHA 1GWMA 1UIJA 2P6CA 2HWC3 3J4UH 4KHPO 4GZRB 2VZQA 3E2EA 1G86A 3OEHG 4TXWA 1MQTB 1NYWA 5C8YB 4AHXA 2FHRA 1AR63 2GC1A 1GNZA 3K03A 1VP7A 5JIUA 3GWKC 4OX9B 2A0LA 3PMEA 3H7YA 3IFXA 3DCQA 4BXFA 3HAGA 3IC9A 4DXZA 1ZRRA 1PM7A 2RMU2 1NKGA 3VDDB 2VMDA 1THZA 4XFAA 1RUG1 3HT2A 4FFIA 3E5UA 5FKCA 4XUOA 3CC2V 1R081 5JLVA 3RZKA 1FXKB 2CWSA 2RJLA 4I09A 5DN6G 2K9PA 4CXWA 2KG7B 3H3UA 3ZSJA 1RUI3 1SLBA 3LPFA 2KG7A 3E22B 3ABZA 3FLRA 3D3QA 3FB5C 2EIGA 4Y26A 1OUXA 3T1YB 4U3FH 2XJRA 5D1IA 4HFSA 1LNSA 4FJCC 1UKGA 3A0BZ 1G9BA 3D5OA 4B3RO 2Z3YA 2DE0X 1TMF2 2OCCC 1MEC3 1DYPA 4N53C 2Z0AA 3DECA 2ZHMA 5BNPA 5L36A 4ZOLA 2YFZA 4LULA 4OUMA 2VUAA 2BGPA 2HEYF 2KKWA 2BTQA 5C3SA 5EIYB 3WLUA 2RG4A 2RMKB 5BY5A 2VZ1A 2Z5WA 2HBUA 3K2OA 2UU9B 5JXGA 2C5DA 4FK5C 3OMIB 4JI8B 1V6OA 3MIGA 4FSJA 2LUWA 5BY1A 4C7UA 4A7YA 4I9WA 3AK2A 2QKAA 2VL4A 4P00B 1VIBA 1JXNA 3KF5A 2FMDA 4IGOA 1WW6A 1AX0A 5GTIZ 2OIEA 1AROP 1SACA 1S1AA 1FJGB 4HZFA 1AR73 3BTAA 3S3WA 2CU5A 5C4WC 5EIBC 4Y24A 3I5DA 1I5ZA 1IHMA 4NYKA 5EJZB 1L1FA 2BYVE 2LW7A 1VF6C 1YEWA 4X6RB 4DR3B 1GNHA 4WF9V 1W9FA 1ODNA 1VBE2 1BQZA 4LBJA 1PNKA 3S7IA 5L3DA 4XIKA 2YMZA 2J22A 5FPXA 1J83A 4R9DA 3HKBA 4QPKA 3ME2A 3ILNA 1A8MA 1ZA4A 3H1LH 4YM3A 4AAPA 4NE9A 4O2AA 1YUDA 3APBA 1M93A 1EV11 3LOBA 3MO4A 2ITDC 4AEDB 4RO2A 4FPHA 1NY72 3KV5A 2YV8A 2LFRA 5H9SA 5J7MA 4F6RB 3LKJA 5FY0A 5KHGA 4XCAA 1N36O 1OF3A 1OKOA 2JIJA 2ZEYA 1SC5B 1EBOA 4K1ZA 4LFCO 2CNAA 2EULA 4CS3A 4DW0A 3A23A 1DQ5A 2DCYA 4B3TO 3CPWU 1Q7YW 1ACCA 2HFEC 1DZTA 4Y20A 1B35A 1W8OA 2YUAA 3MHZA 5JI9A 4MT8A 2VMCA 4ASMB 4L92A 2A06H 1TME1 5FMDA 4FI9A 1FMD3 3ZHTA 1WW7A 3N4MA 4AYUA 3FZ3A 2DUPA 3VHNA 3RBZA 1CAVA 3TXSA 2PA7A 4JI7B 1YWKA 3SYPA 3THPA 4B4RA 2BV4A 1RUE2 1TVKA 4GX2A 4AQ6A 3MF9A 2WZR2 2OTJV 2PYTA 1A34A 4ZY9A 5E16A 1LESA 4OMCA 5FYYA 4E4ZA 1VBA1 5FP7A 4FAHA 4MGTA 1ZL8B 3A21A 4I30A 5J96B 1YC61 3C2UA 3DV8A 3EXAA 1RUI2 1BHAA 5FYUA 4BLJA 1REDA 3CC7V 4KBBA 4DK0A 3JU9A 4DQAA 2F95B 4Q2FA 3TN93 5A7NA 1QR9A 2QWRB 3I3QA 3AX4A 2ARHA 5J37A 1QCEA 3ZO0B 1HDKA 2L35A 2ZA9A 3POJA 1IBMB 3WW4A 5JCTA 4LNUB 1XOYA 2IXCA 3N2GA 1SETA 1HQNA 2JGDA 3APOA 4CZSA 1RHI3 4JYCA 2R1BA 5FZOB 2HBTA 3AG4B 2R0HA 2OKXA 4DOUA 2UXBB 3AMMA 1F4HA 1Z7S2 4YSFA 4JVAA 4XDKA 1MS1A 3UM7A 5FZOA 5L19A 1J3QA 2ADEA 1I08A 1RUE1 3HIFA 1CPNA 4C0BA 2RS32 5FZCA 1W59A 2WO1A 1SPPA 5GZFA 3JXSA 1LGBA 2JJ6A 2Y6JA 1KKCA 3UT5B 3ENRA 2YDEA 1KFXL 2H94A 1LHUA 4X1YA 5FRAA 4YGBA 1B35B 5DABA 1HIXA 2YU1A 4BQ5A 4O9GA 3L2YA 5JZGB 3VBBA 1GUIA 4AVSA 4Y1YA 3LFIA 1VRH3 3E5XA 4Q26A 2PHLA 3W5MA 3MV01 2K46A 2QQMA 5KA6A 2CDOA 4EEQA 3WF0A 3HNYM 1LUVA 2YXYA 4RR3A 4Q4Y2 1WP7A 3FHQA 4OI0A 3B02A 1IXBA 4LWSB 5CKQA 1YXWA 3ZIWA 3FBMA 1GANA 4YM0A 2CGNA 5IYBO 3M1HA 5LA2A 4LO8A 1J3RA 2WLMA 4KGQA 2XBO1 3OGJA 4RR3C 1WCKA 3LSSA 1ULFA 1YJWV 1N34O 3LDDA 4DINB 4LCUC 3H3ZA 5LATA 1TNRA 3NV3A 3RYCA 2H6CA 2ADQB 4LK7A 3ABLB 1SDDB 3GHMA 4QQHA 5CBHA 4UCVA 2BERA 2GMEA 1X9PA 4GKXA 2ZJCA 1JZ6A 4R6ZA 4BMBA 4BQ4A 2F4VO 4B8EA 2FDFA 5JOXA 3GCXA 1DIWA 2PUSA 2A70A 1E57A 2GALA 2YC0A 2VMGA 5L9VA 3OUFA 3H9AA 2HWC2 2H3OA 4JGZC 3JD71 1H2NA 2ZGNA 1M4UA 1CR7A 4DR4O 1AR62 5JOWA 3DPRA
chains in the Genus database with same CATH topology
4RHV1 2IXHA 4PDWA 1IPJA 1F2NA 1OA2A 2D6LX 1RUH1 1BBT1 2XBO3 5BNQA 1H8TB 3MPPG 1D2SA 1VB2A 4JAAA 3VZJA 4PDWB 3DF0A 4XJAA 5HXVA 1GKBA 4E9KA 2ZAAA 2IXJA 4BIOA 4PBOA 5CG8A 3RDIA 1PZ7A 2KXLA 4BE3A 3D0JA 2WZPP 1ZZ8A 3B9CA 4Y0EA 1UW8A 4OHXA 1W0OA 1LU1A 3A0KA 1HRV1 4GH4B 1MVEA 5T5LA 2DCJA 3TOJA 4HKWA 3KCYA 1AYN3 2R042 5K0UB 3U10A 5IK7A 4AK3A 3SCHA 3MYXA 4X6QB 2ZX1A 4P9WA 1PGL2 4BHFA 4CYDA 2VG9A 4IQPA 1DBNA 1DGRA 1C8M2 1ASJ2 1C4RA 4AVBA 1EPZA 3VHOA 5FOJB 3MI8A 4N9IA 1PGW2 1VRH2 1VBD3 3E6DA 5DZEA 2IZWA 5FFOC 4GB32 1QY4A 4WVMA 5GLVA 5K7PA 1C5IA 4AVAA 1PGW1 5KBFA 2IFRA 1H0BA 3ZN4A 4QPGA 3SH3A 1RB8G 4DY3A 1VALA 1AL0G 1GYKA 3D4KA 2QCSB 1XNBA 1X8EA 2Q0AA 3BB6A 3AB0A 1QF3A 5EYXA 2QQPA 4NWVA 4XFFA 4EN7B 5FTTC 4B7KA 1PK6A 5KXEA 1EY2A 4XPVA 1LHNA 1WA4A 2UWAA 3WNXA 4YVWB 4XQWA 4AGGA 1YYNA 4K8FA 4C91A 4BLIA 1TMF1 3KMHA 4XDQA 1D0GA 1JW6A 3A0NA 2PTMA 3VHRA 4LBLA 2HWC1 3VBRC 2WNVA 4Q4V3 1HRI1 4RL7A 2D97A 3VBUC 2XLFA 1QWRA 5JPMB 4COZA 4JCKA 1Q56A 5BYNA 4AEJA 2FZ2A 1FNYA 3PVNA 3OY8B 4R9CA 4N90A 2ZACA 2Z42A 4YW1A 1S0FA 3USSA 2WT1A 1LODA 4NR1A 3HBZA 2DVAA 4NHLA 2G9FA 4PQ9A 2Y38A 4XMIA 4JDOA 2DCZA 4LO7A 2R062 1OOPA 4EROA 2OYZA 3T2TA 4FPEA 4MGKE 3VBFB 2D6PA 3VBHB 3V0AB 3LA2A 1MZEA 2DU1A 1N1SA 3VUOA 4CEYB 1IKPA 2ZAHA 2KA3A 4Y1VA 3B69A 1BMV1 2C1FA 2E7TA 3CO2A 3KD4A 3NJZA 3NVCA 1MS3A 3V0BA 3N6WA 3KS7A 4LEJA 1TE1B 5D8AB 1H8VA 1AHSA 2OG7A 1XRUA 4AGRA 5D8AA 4QM8A 4OZXA 3FHIB 4MGIE 2XBO2 4YM1A 4I0WB 1VBB1 1WBFA 3O0WA 2DF7A 1RVF2 1JTZX 4QT6A 2A6XA 1AX1A 4RS5B 4PIYA 1ZBA2 4AVCA 3LWCA 2VNRA 5GLUA 3AFKA 2WS91 4MVTA 4YVWC 5HCAA 1HXS1 2VXRA 2DVGA 1ULDA 2N7GA 1FX5A 1PVXA 5FDBA 1FOD3 4B7EA 1NA1C 3WUCA 4CVYA 4A7KA 2HWD1 2GC0A 2DUQA 1GICA 2VECA 1VBE3 3WP4A 2BTVC 2RR11 4URTA 4UW5A 2NMOA 1XYOA 5JWPA 2WQZC 5EYYA 1ENRA 3AXEA 2PHXA 1DF0A 1GQHA 5GZDA 1VP6A 1LJ7A 1ND2C 1COV1 1OSGA 2AGSA 2PAEA 3MF6A 5J36A 3NL1A 5K9YA 1NG0A 1DDLA 4MXWB 2ZX4A 1YO8A 1WLWA 5EXOA 3ETQA 2ZHLA 3RS6A 4WZFA 3TNPB 4IEQA 2DURA 3URFA 3ZYJB 5C9AB 2DVFA 5T52A 4Q4Y3 1AYN2 2PHDA 1W0PA 3RG0A 1C5HA 1RUJ3 3QD6A 3ZN6B 2VOKA 4IEUA 3CJIA 4AFDA 2LM3A 1TNFA 1CAVB 4YVSC 3QOPA 1LU2A 4C5WA 4HVQA 1ZBE2 4DRRA 4RQPA 2ZGOA 1IQAA 4AI8A 1BQPA 2A6WA 3NWKA 1DQ2A 2YXSA 1SBDA 5HCFA 1QMJA 2DTYA 1W6OB 3ZXEA 2XLGA 1S2KA 3PVEA 3QBQA 3EQEA 4AHYA 4QPGB 2AUYA 1VJ2A 2PN5A 4AWDA 3WDTA 1RUG2 4X8PA 3AXDA 4ISRA 2Z79A 5BUVA 2K9ZA