2YDEA

Factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ydeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ydeA01
4B7EA 2WA4A 1YCIA 1H2NA 4NR1A 3P3NA 4AI8A 3P3PA 4Z2WA 2ILMA 2CGOA 2XUMA 4JAAA 1IZ3A 3KCXA 4BIOA 5JWPA 1H2MA 1H2KA 1MZEA 3KCYA 2YC0A 2W0XA 4B7KA 4QU2A 2WA3A 2Y0IA 4Z1VA 3OD4A 1H2LA 2CGNA 3D8CA 2YDEA 1MZFA
chains in the Genus database with same CATH superfamily
5KHKA 5LZ6A 3ZMOA 3N2GA 2HEVF 4AHWA 5T54A 2VNGA 3E8HA 2AHYA 1J5EO 3F2ZA 1CPNA 5GLZA 1NYWA 1XU1A 4LFCO 3POYA 5FDBA 3FC0A 3JZVA 4QQLA 4KHPB 3RZGA 2PMWB 2FB5A 4FPEA 3DGEA 5FK8A 4Y1YA 1HR0B 4DEQA 1X59A 2UU9B 3CO2A 3GHNA 4DUYO 2R043 3UO3A 2Q8EA 4UW5A 2YPJA 1AYN3 3R6SA 1S0IA 1F23A 1WA4A 4NIHA 3RWKX 4E2LA 2IH1C 4K8XA 1LHOA 1H30A 1R091 3K4DA 3RVYA 4P9YA 1AR91 1N36O 3A8TA 2P6HA 3SH4A 1PV0A 5E1RA 1Y9MA 3B5LB 2ITDC 1YQCA 4F6RA 2XHBA 4LFBO 1NR1A 1F8VA 1S2KA 5FZLA 3IGAC 1HQNA 5DAQA 3AYAA 3MICA 5K4LA 2ZX0A 3VBBA 3WW2A 4XTPA 2OT7A 1LECA 2VD7A 1UPSA 3LSEA 4P9WA 2QVSB 1UU4A 3ZFEC 1O91A 1G9DA 4MOAA 2EXKA 2A6VA 2G38A 2VQTA 1FFXB 5JXHA 3E5QA 4FCAA 3VHNA 1XNQB 4YVWC 1LTEA 1PNLA 5BMVB 1OUSA 1CAVA 1KDKA 5CFDC 3T0DA 1ENSA 5F39A 1QY4A 1SBEA 2CWMA 2X53S 3WUCA 2C0ZA 3NJVA 3MO4A 4XUTA 4YZ5A 1DYPA 2Z2SB 1GWLA 3J81N 4TSVA 5D5PA 3BCCH 3Q4HA 3H7YA 4QIWF 1Q8QA 4OI4A 3VBRB 2YI9A 5FMOL 3AXEA 3CQOA 2CTVA 4LBQD 4JI7B 2DCYA 2B7YA 3UKMA 4YVSC 1EM1A 3TEXA 3T2QA 4B3RB 1G9BA 3IMNA 1NCRA 2D5HA 2D2CB 3PVNA 2AZ0A 2N04A 1QR9A 5C8CC 3K3OA 4YZ1A 2E7TA 3VHPA 4PQ9A 1L0LH 4FPJA 2VR4A 2EZPA 3PUQA 4LKSA 3KF3A 2VW1A 3GBFA 1QJU2 4CDQC 4JKLA 4GH4A 3ZFGC 2Y6JA 4YHHO 3HNMA 1UD1A 3LZZA 4DNYA 4GZRB 4XC9A 1WGPA 1FPOA 1APNA 2NP0A 3RYIA 4FBFA 2DUPA 3URFA 2VCAA 2LO1A 1YJLA 3OMIB 4O2AB 2R041 2C1FA 1N0JA 3ACIA 3J7LA 3BTAA 3WV6A 1G9AA 3BALA 3PU3A 2CE4A 4CDUB 5FOJB 1W0OA 4HETA 1NBMG 2FMDA 3HB3B 2RM21 5BR8B 1X7NA 4PA4A 1HLCA 3ZSEA 1HB3A 5JSPA 1SLBA 2W0FC 4PA7A 5DN6G 2Y8KA 4R4XA 2A6WA 3EQEA 4L99A 2ENRA 2LGQA 3Q9OA 3WP3A 2WA4A 3O5SA 1VQOV 4IE0A 2TNFA 2Y69B 2HR3A 3GZUC 2BWCA 1T6GC 3UK9A 5CN0A 4AEDC 4CE8A 4I0XB 2PHXA 2CTWA 4DUWA 2WLKA 2J1VA 4P9XA 4DXRA 4EFBA 5JI7A 1COWG 1AF9A 4NJ4A 2CL2A 3B02A 3CC4V 1Y74B 1XEQA 3HVDA 1ULGA 4PDRA 2ZR3A 4I4TB 4AAPA 4JAAA 1V6MA 2BJSA 2UUBB 4MO3M 3UKTA 5DZGA 2XAGA 3LA2A 4AZZA 1HJGA 1NY71 5F2VO 4PDWC 2YGMA 2ET7A 3SJAC 2P37A 2MPFA 5FCCA 3AK1A 1XXNA 1SFNA 3J4UH 3C3VA 1VBD3 2YS8A 5F32A 5FZBA 2MEV3 2EIJB 3CJIB 4FLXA 2CGPA 3QH7A 3WDWA 1KUQA 4YW5A 1WBLA 3LB9A 2A70A 3ZXGA 2OTLV 4UFLA 3RYCB 2YU2A 4PLOA 3TBDA 5IE9A 4XDKA 2FHRA 4MADA 4GMP0 4X9QA 4ONUA 3RZLA 2W91A 3ZVXA 2D5FA 4BCUA 1SRYA 5SV5A 3LD8A 2XWBB 2QM7A 3JAKA 1N1SA 1SPPA 4O61A 3FUQA 3OR7C 3J26N 3NJYA 3BABA 3MIFA 4OUSA 4K9SA 1IBKO 2CAUA 4ORFA 4LXLA 4D7SA 5FIXA 1H8EG 2GUZA 3Q8AA 5FJHA 3FN9A 4YZ4A 1WD4A 3RN4A 1SDDB 5KLVH 3MLJA 1AZDA 1EFRG 1KC8W 5JVDB 3U14A 4FAGA 4E2QA 1LU1A 5L3EA 1ZRRA 1PVC1 2VNVA 5H2FZ 3V65A 4CXYA 4FQZA 1BKZA 4XQ4A 4JGZB 3OEHG 4B4QA 1JJ2U 5FKCA 3BOWA 1V6LA 2A75A 5T5PA 3BFRA 2DFCA 1UKRA 3KS7A 4LF8O 4IEQA 5FBJA 1UZ0A 5DUWA 3M70A 1DYOA 3TEWA 4W65A 5KAFZ 1K4DC 2JEXA 3MD0A 1VBE3 2KM2A 1YRZA 1DP0A 5IVFA 1GM8A 1GYKA 4FAHA 2XKPA 5F5IA 4O65A 3KHCA 1FKAO 1W6MB 4OHWA 3ZDSA 1R3LC 5ABJA 4X89A 2X29A 3DEMA 3IB3A 3WINE 4QPIC 4HKWA 1DZRA 1Z7S3 2E75B 3MIDA 2PHWA 4RHV1 3ORJA 4JI4O 3DV8A 3AX4A 2H8PC 1RJ7A 3WHTA 1F15A 3AK2A 1F4HA 2VULA 3MW2A 3OUSA 1VB4A 5FREA 3Q8CA 2HVJC 1SQVH 2JDKA 4IUGA 1TUBA 2A6XA 2PLV2 2HJIA 1JMKC 1SQXH 1RUC2 4AEKA 5I93A 4MXWB 1H2LA 2EILB 4WFEA 1QJU3 3AYCA 1UFIA 2WABA 4MVQA 1XC6A 3BI3A 4DK0A 2AHZA 3UO2A 4OHXA 4OZOA 5FQ0A 3ZFFB 2QQPA 2MEV1 4YM0A 3TGUH 4I9WA 1XYNA 1N34B 1R1A2 1U5IA 5IHRA 1CJDA 3K5NA 4P00B 1PK6B 3IAPA 4Y26A 2R6QA 1YXWA 4D6RA 3ABMB 1GR3A 2XWJB 1I5PA 3VD7A 4FP3A 5CADA 1J3QA 1R3KC 4JAUA 1VF5B 1R6KA 2WZEA 4OPHA 2Y6KA 1R1ZA 2Q1FA 4C7UA 3W5MA 3TB0A 1CEZA 1RUF2 3RDIA 5KC6A 2RR11 3KLSA 3UNPA 4A41A 2EZOA 1GNHA 3HQRA 4DYLA 2LW7A 3AXDA 5FY8A 3IKWA 2DE0X 2AGAA 3WNPA 5KHJA 3ZYBA 2HBUA 1S0FA 4H55A 3MGUA 5LBFA 2ORZA 1P84F 4DR7O 3IC9A 2LTNA 1NXD1 4XAEA 4DV0B 1IGOA 5FZAA 2GC3A 3BA9A 3AL6A 1AL21 1BQZA 1NLRA 1MS4A 5BY5A 1TA8A 4O4HB 4AI8A 4H7LA 3H8OA 1PO11 4AL9A 2D3SA 3GALA 4X1YB 2PYJA 1C5HA 4BZ4A 5CA3A 4W4ZA 1Z78A 1H2SB 3DKWA 4J6GA 1HNZB 3JD4A 1R3IC 4MH0E 1FOD1 1NVPB 3JARB 3LDRA 4IEYA 2BTQB 5G04L 2P17A 1UY0A 2ZGPA 1YNAA 3I2FA 5A1AA 3JAWB 1HRI3 1NCRC 5KUMA 2C9AA 4UV8A 2Y33A 4RYDA 1W6PB 2XOKG 2JDMA 1BVP1 1MZFA 1SESA 1RUE3 2DYRB 3E8BA 3W5NA 1QH7A 1FXKB 2JEUA 4HLTA 4ASMB 4MG2A 2OCCC 1MEC1 2V1DA 3PMSA 3P1IA 1GQGA 1DDLA 3ZMSA 1VMJA 1RHI1 2WFF3 1EPZA 4GH4C 4XF0A 2BGCA 4B1LA 2ZEYA 1LHVA 2V09A 1POQA 4J1XA 2VCBA 1EY2A 1XYPA 1VRH2 2I74A 3I49A 5LBEA 3K57A 3AKPA 3HKCB 3IBMA 1H1MA 1V70A 3ACGA 1TVKB 1W0KG 3VBFB 1VQ4V 3RI8A 3TRSB 5K1XA 4X1IA 4JYBA 2ZGUA 2VOWA 1W9TA 3E97A 4D6QA 1V9U2 2PI4A 4U7NA 2ZEZA 3E5UA 5IJ0A 2NLJC 3TXSA 2ZE5A 4ZI7B 2EX3A 2Q67A 3SQOA 1BL8A 3PUSA 3AG1C 2QTWB 4L0PA 4LO7A 2OTJV 2ZNJA 4KGGA 1MZEA 4FT8A 3OBAA 2J22A 3UGFA 4BK5A 1OPOA 5A3UA 4DXZA 3RYHB 2EAAA 3QNEA 5A3WA 3IC7A 4YW7A 1POV3 1QIQA 4PF1A 4I55B 1MPXA 2CUGA 3INAA 3S5QA 1GH6A 4AEMA 5HFLA 3ZYIB 3H1JH 2ZGTA 2MW2B 1ENXA 1SC5B 2WLQA 3C2UA 2ZMKA 3K51A 1YIFA 5F3IA 4NE9A 4JTOA 1KQSU 4L8QA 5EC1C 5JUVA 1E79G 4WBNA 3BU0A 2VL4A 1QBZA 2JRIA 4N21A 4NYKA 4L87A 2CV6A 1PGW2 4LNVA 4X66O 4YW6A 1LB2A 5A33A 4IETA 2VBPA 3T2PA 5C3SA 2BFUS 1X50A 3RYKA 1QGLA 2OPWA 3GWKC 2XBO3 1TME2 3UL2A 2VVEA 1FMD2 3I4IA 2O1QA 2KG7A 1V54C 3UT5A 2DFBA 1P7BA 5J48A 3N7KA 4RS5B 4UFIA 4OI1A 4TN7A 4JDOA 2KR2A 4LITA 4OGQB 1DGWA 1HRI1 1XSQA 5L73A 1D7PM 3POIA 3CXHF 2B5HA 3BYWA 5IK7A 1NUKA 2VOKA 5BNOA 3TAYA 4JGSA 2IC1A 3O65A 1MVQA 2JJ6A 3VBOB 3P30A 4EEQA 4LF6B 4JI8O 4Q4X3 4DR5O 5FZ6A 5E16A 4H37A 2LFRA 1PIV2 5LY2A 2DURA 1RUOA 4PHZA 1BT8A 1J95A 4FPFA 1BGYH 4CS4A 3JALA 1GN4A 1TMF1 4JZRA 5CG9A 1LRHA 3M3QA 1IHMA 2QTSA 4G4FA 1W9FA 3FAVB 3RVHA 5JOXA 2J1RA 2C5DA 2QGNA 3FB8C 1Q6IA 4ZS2A 1ZM1A 1VBB3 3T3YA 3WB0A 5GTIZ 4U36A 4MTOA 4QX7A 1G8WA 1JJOA 4ASUG 2PYTA 1OA4A 2RJKA 4TV8A 4UCUA 3WNMA 1WCQA 3D3AA 4IEXA 1XQNA 5KXBA 1W03A 3O12A 4BWAA 5K7PA 1LESA 4AHZA 2GN7A 3EBRA 1TEIA 3POSA 1MS5A 1QJY3 1S0JA 1XMOO 4XABA 2CK3G 4QKNA 2X7RB 4EN9B 3EJKA 4LBMA 3VLBB 3I56V 3KZ4C 3PLQA 3KVAA 4YLZA 1K33A 4KBBA 4WM7A 1BJQA 4YIOA 3J80N 1VAKA 2O57A 5ABJC 2ATKC 2ZGSA 2FL4A 3BA8A 1Q8PA 1I7FA 1OA2A 2EJRA 4LHKA 1WAZA 2WWSA 2F95B 1QDCA 2UWAA 4JI3B 1VBA3 4NHYA 1OFNA 1CPYA 3T2TA 2A9HA 4B7EA 3ZN6B 1ZNPA 1UMHA 1XYOA 3NV4A 2V5DA 4QU1A 2HYXA 1YLLA 3KCXA 1J84A 4AGRA 2R16A 5C5TA 3K77A 1BEV3 3APOA 5H9QA 1RITA 3MLKA 3JQXA 4NUBA 3JD71 3TEYA 4GWMA 3AK3A 5FNVA 1DQ4A 3ZN5A 5JPMB 5L3GA 4GKKB 3D3QA 1WZXA 2W39A 1A78A 3OGRA 4S2GA 2OYQA 3EO6A 4D3WA 1AYM3 2UUCO 1RUD2 4DFSA 3ML0A 1ODNA 4IE4A 2G19A 2IFRA 3ZN4A 1AR71 3DC6A 1QMJA 5KXCA 3K58A 1DLBA 1U0AA 1GN6A 2D3OW 3HPNA 3IIIA 5FZ7A 3MYXA 2R072 5L3DA 3VD3A 1S2EA 4XJUA 4CVUA 1JQ0A 1XHXA 4UCOA 4RWUA 1W04A 1H8HG 2IXJA 4R8CA 5LGUA 4DY3A 2B5UA 2RS53 1M56B 1K5MB 4LFCB 1WMEA 4N9IA 2RE9A 2FTKA 1VBB1 4XHBA 4H7MA 4OXSA 5CA0B 1ZRIA 5LBQA 3RBZA 2AEZA 4LBOA 4UOJA 1MOFA 1VAMA 1RUH1 1HNWO 4A6OA 1JUIA 1ND2B 4YJ3B 4CS2A 4EJRA 2ZBJA 4ZONA 2XAQA 3S5AA 1YTFB 2ETEA 3CCVV 5K9YA 2CDOA 2ZMNA 3S30A 3ZPYA 1SCRA 5D8AB 2F93B 1ZBA2 3DGTA 1GZWB 1NQTA 5B1AB 1UZZA 4PLNA 4DV1O 1XL4A 3FZ3A 2A3XA 3ABUA 2YXHA 1QLEB 3AFKA 1PX4A 3R0RA 4HN0A 3RPQA 2W47A 3AG2C 2VMFA 4JTDB 1GP6A 4U3JB 3T1YO 1C3HA 2P3YA 2XQRA 3X2QB 5L7OA 3NNFA 4KL1A 1UL9A 1QQP1 1K9MW 4Q0SA 2ZNIA 4P5HA 2OYZA 1C5IA 3M8AA 5F5QA 2QQLA 2Y0OA 1FNZA 2HWD3 3LUTB 4WFBV 1NH2D 3VBUA 1T2XA 3ZR6A 3FYIB 3C3TA 1BCXA 3VL8A 3FBYA 3B40A 1REEA 1O59A 3B00A 1SS3A 2JD9A 3GF6A 5ANQA 1YFYA 2R0HA 3G80A 3W7SA 2B9UA 5FPUA 1UPGA 1BEV1 4A3ZA 1X9PA 4DRXA 2V5YA 4QPGB 1KD1W 2UXDO 3ZHTA 4JASA 5FLHA 2HKXA 4X6QB 1EUUA 1TAEA 1W3VA 2WLNA 4Q4V3 2Q4PA 5I0SA 2WWJA 5IJ9B 3VDDA 1AYM1 1PNKA 3RVZA 3DXTA 3K4AA 4DY5A 2XQXA 3T1MA 1UZVA 4KI5M 2O0OA 3BTXA 2Y6FA 3MPPG 1SQQH 5FPAA 3E89A 2WNUA 5LL6Y 4YZ2A 2RJZA 5CBLA 3AMNA 2F23A 3UV9A 2FQPA 5AG2A 3D5OA 5A3MA 4XPVA 4DV4O 2DVGA 1NKDA 4RR3B 1JHNA 3AG4C 4NXNO 2D3RA 5KX5A 3VN4A 2IU0A 2I07B 4RQPA 4TTGA 3VZOA 5E89A 3EVKA 1QCEA 2YY1A 4X1KB 5H5NA 2NYYA 3B2EE 1EV11 2DCKA 4MW8A 1VQMV 1HKDA 1RJ8A 3I2OA 1IQDC 1UMZA 2VMDA 5EHDA 5FP3A 4MGZE 3ENRA 1PO22 3O1UA 1JZ6A 3E1F1 2EIBA 2F4PA 3UGHA 4AGVA 2FDHA 1OF4A 4FTSA 2YSUB 3D82A 2YGLA 2YEVA 1TG7A 1ST8A 5IK4A 4B4PA 3EXAA 5FYIA 4Q4Y2 2EINC 2WJSA 2UWBA 3S3WA 3GJAA 3PURA 3SMHA 5IUQA 3EFFK 2IJHA 1XE7A 1W2UA 1W8TA 3O1OA 1QNWA 4FFFA 2LM3A 1W39A 2L6LA 5IFTA 3HT2A 4QQ2A 1EAH2 1CXZB 4JI1B 3VHRA 5BNOC 1OT5A 2VO5A 5DDJ2 4CCOA 4R4ZA 4ET7A 2ZIOA 3J7AU 1ULCA 1LOBA 4XFCA 5LHHA 3AMQA 2QA4V 2PQQA 1E57A 2XPJA 4RAIA 5C71A 1QOTA 3LAGA 2A5ZA 4X64O 3ABTA 4DUZO 1VF7A 4D94A 1JYTA 2CGNA 1RUI2 1HX6A 2AACA 1LUVA 3KGLA 4EWDA 1K8AW 4QT6A 4PBOA 4MVUA 4Z2AA 1CX1A 3CPWU 3VDAA 5J2UA 1ENQA 2ZINA 1ZBE2 1Q3EA 5A7OA 4WBBA 3OD4A 3K0GA 2IU3A 2JG8B 2EAKA 4Q0VA 3CSXA 1XL6A 4JI6O 2DOSA 1W05A 3WG7C 1VF6A 1LHUA 1DLCA 2ZCWA 2ZKLA 1OC1A 4PIZA 3V0BA 4A7KA 2QUOA 2VQFO 2OIIA 1GN3A 5DXDA 1ZBA3 1HB4A 1L7QA 2JG9B 1RSOB 5B4NA 4DV5O 2DYSC 4P9GA 3BTZA 1FPN1 3WU2Z 1AR81 1QOSA 3I2GA 1OCOB 3CWBH 4JI2O 1ASJ3 5LW9A 2C9KA 5BMVA 3CRQA 3C7HA 5DG2A 1F2NA 2RDQA 4WM7C 1NZIA 4W4KA 1Y43B 2WWWA 2GNTA 4JI5O 2NM1A 3FLTA 2QJVA 2ZE7A 2HKOA 4QM9A 1H8TA 2ZEXA 1COV2 1XJAA 1PZ7A 1OJHA 2OUHA 2G9FA 4XFIA 4QB6A 1ZWIC 2E53A 4D6SA 4YGCA 4LF8B 1I94O 1HQWA 3U4SA 2AR6A 2A73B 4P30A 4TWKA 1WJZA 4BW9A 2WNVA 1I9RA 1CZVA 1CN1A 4FM0A 4K8ZA 2HWE2 3RZHA 1RUJ3 5ACA2 4UF0B 2YFZA 5B1OA 2AH2A 4FFGA 1KRIA 1JOJA 4D8MA 5LHIA 4LBQB 1QJX2 5LGNA 2XVLA 1W0JG 2Q6AA 2WSUA 4AFAA 3B4SA 2EIKC 4JI4B 1XB9A 4CU9A 4AR2A 3RZMA 4IEZA 2HWC1 4S2HA 3HOBA 1K4CC 2BOBC 2JDYA 4CP2A 3QD6A 1T5EA 3PDQA 2KQXA 1VPHA 1YJNV 1LJ7A 3H01A 4DO2A 3ES4A 1RXGA 1OQ1A 1XBLA 2HFEC 2UXBO 1VE0A 2ADPA 4IGOA 3LDEA 4WM8B 2ZACA 1MS1A 3CCJV 3N7MA 3PJSK 1CR7A 3K3WA 5DQ0A 2XVKA 5L9RA 5LBBA 2WS92 2ZXQA 5JOWA 5K0UB 3M2MA 5HV4A 4AFCA 2WLIB 4J9YB 1NLSA 3MIGA 4JKMA 3WXPA 4LR4A 1KP3A 2J1EA 1WP8A 4UFHA 4UFZA 1SCSA 3LA7A 1K12A 1WLEA 4FPGA 4ZXKA 1H1IA 3SHRA 1OHFA 1RMU1 4YPJA 3KV6A 1DQ1A 2WNEA 4NPMA 5KMGB 4KFMA 3ZXDA 2RMU2 5IYDO 1IPJA 1AJOA 3QG5A 4UCRA 2PAEA 3T30A 2A7AA 5K8SA 4I0XA 4FPHA 4ZU4A 3CXCU 2JEMA 4D69A 3BVCA 5A32A 3USSA 2H0VA 4Q4W3 1GK9A 5L7OC 3I3MA 1IKPA 4L8JA 4Q5OA 3APQA 1HIXA 4I4TA 3ZMVA 1Y9QA 3H1WA 4K21A 1TVGA 1AILA 4DR2O 1XQ8A 2AZ2A 2Y34A 5KXEA 1W8NA 3NJZA 4P08A 4BPZA 4DEVA 3R4UA 3APBA 4HVRA 3VBUC 2W46A 3PVEA 4ZBMA 1HW5A 4P9OA 1GN2A 4KP4A 3WD5A 2ZTNA 4EN8B 3G4SV 1IS6A 2YIAA 4XURA 4GKYA 3LEIA 2WR9A 1UYPA 4KMQA 4H44B 1VR3A 5CA1A 3SYQA 3M1HA 3LPFA 1JYVA 4PDLA 4XCAA 3D0SA 4P02B 2BNMA 5FPLA 3JATB 1O7FA 2EIMB 1AJQA 3V64A 3V0AA 3SJBC 3AEIA 1GWMA 2GP3A 2D6OX 4HVQA 2FCVA 4J7JA 1R1BA 1C8NA 2HWF2 3VDDC 2EA7A 2XH6A 1OLRA 2QKDA 1R3JC 2JENA 1DQ5A 1HXS2 2Q30A 1PL0A 4XBLA 1L7LA 1LULA 3OPWA 4UFKA 4AI2A 2WNUC 1O5LA 1V6JA 1JU4A 5B66Z 4V2WA 2CNAA 3A0KA 1ZRFA 1RVF2 3T4VA 4XFHA 1NQJA 3LQCA 3WG3A 3M7MX 3PJYA 1HB2A 3GGLA 3Q8EA 3U4XA 4FPCA 2RS32 2P2KA 4JGZA 3NNMA 4EB6B 4QD2A 5IY5C 3WF1A 5HCHA 4XDQA 3DYMA 2GMPA 2Q68A 4NN0A 4P9IA 5FYYA 4BHPA 4LFAO 4XW3A 1KJRA 5GZDA 5B4XA 5LBCA 2W87A 5F5AA 1B3QA 2CWSA 1KJLA 1JFFA 1Q81W 3AKTA 2VXJA 2O14A 1W6MA 4J1WA 3R4DB 2R0FA 1F35A 1KQRA 1BVVA 3HJRA 4NRPA 3VUOA 5LXTB 3GM8A 1FJGO 2A06H 3VBHB 1V6NA 1NCQA 3QH6A 4I9QA 3ECQA 3OOXA 3ZSMA 3ZSJA 2QFEA 4NTWA 3ABLB 2PAMA 1LOGA 4F3JA 1Q8VA 3SR2C 3RGBA 2WO3A 1C8M3 2Z42A 4CDXA 4R50A 4X66B 1XRUA 3KCCA 4DIQA 3WDXA 4CTEA 1MG1A 2C4XA 1OD3A 3K2OA 1QJEA 5F9TA 1YJKA 1H2KA 3W7XA 2YXSA 3FJSA 1X82A 4S2DA 5FXVA 2YG0A 3J8F2 4QKFA 5EYXA 3ME2A 3J9SA 2JS3A 3TNQA 1N0NA 4FLUA 2BYVE 1VBC2 2UXXA 2PAKA 1ZL8B 3H0OA 4FXGB 1ACCA 4LTAA 3BB6A 2BOCC 2JDPA 4E4HA 1B06A 4NMIA 4JI8B 4DR5B 4BOWA 1VIBA 3HNYM 1U12A 3H3UA 2RDNA 3FB7C 2Y4UA 2DU1A 2QWOB 4OYUA 4Q27A 4X62O 2VNRA 1E5SA 4XJZA 1VF6C 1JOPA 3OMAB 3USUB 1S0GA 2JS5A 2WQ4A 4PA6A 5DM6V 4CA9A 5JXJA 3JD3A 2SBAA 5EZYB 2DV9A 4WZCA 5JXGA 3FB5C 2X6AA 2GSYA 4LNUB 3ZYGA 4GX5A 2QQMA 2ZX3A 4LHSA 1IPKA 2R1DA 2B1GA 5B3SC 4IDZA 5T5JA 1KECA 4R8HA 1US6A 3AB0A 2ZE6A 2DVAA 5CB7A 5LMUO 1H8TC 5M0TA 2F6BA 2XLAA 4BIZA 2WDBA 4YZ3A 4O4LB 3VBRC 3JARA 5FYTA 1IXMA 4Y1UA 4ASKA 2ZS6B 5FY5A 2BTQA 4GXLA 2PHTA 1XMOB 4ZZ8A 3WNXA 3EMRA 1NA1B 4EQVA 2DTWA 1OV9A 3JAWA 5IT6A 3UQ8A 4C0BA 1OCZB 3MF6A 3H50A 1CAWA 4L2NA 2WZR2 2VUAA 4YWAA 2WNVC 1GP5A 1NTZH 4CP0A 2JWPA 1OKQA 3U11A 1YIPA 2DU0A 4YVSB 5FMCA 1GZCA 4U7OA 2QM4A 4CCKA 5LB6A 2W0XA 4QU2A 4NHLA 1EN6A 1CP9A 1N33O 3THCA 4E9KA 1W59A 3CX5F 1RUG3 5DN2A 1YC61 5A1LA 4F83A 4AI9A 1GUIA 3BGAA 1F31A 4EZHA 2BDRA 5FY0A 3I3EA 4Q1RA 1OMIA 3N7LA 4DO0A 1ORQC 1A8DA 3CCLV 3HKCA 3I59B 3PJQA 5BNQA 4FM1A 3K46A 2HEPA 5EWSA 3VBFA 5L9BA 3ZYRA 3N9MA 3VZMA 5B2GB 4IGPA 3D0JA 5HXMA 2JJ1G 3GWOA 4XUPA 1TNFA 3NVCA 2PLV1 4R9AA 4CDUC 1RIRA 1I5ZA 5KHIA 1RUC1 2PN5A 1GSLA 2VZPA 1WA8B 3JD1A 4Y4YA 1WWYA 4M00A 4BLJA 5HCFA 2OKXA 3ZMTA 3IJ4A 2UUCB 4UB6Z 4XF9A 4URTA 5JMOA 1W0PA 5GTHZ 1Q8SA 1R1A1 2EALA 5FZ9A 2E7QA 4KG0A 2Y64A 3RYPA 3H1LH 1KS5A 3RYHA 4IGQA 3PVOA 1JVMA 1DBNA 2BGPA 1LKNA 1BBT2 4QQOA 3OGCC 1AP6A 2ZGMA 2W94A 3RNSA 4GZ9A 3RRDA 3CMAV 5FY9A 5A7WB 4I55A 4XQDA 4QNHB 3B09A 2Y69C 2ZCEA 5FZMA 4Y1XA 1S5JA 3EB7A 2E7AA 1BXHA 4AQYO 1W6OA 3RYFA 1N32O 4M3CB 4DV3O 2YDEA 1KXGA 1RUF1 5LA6A 4XZPA 4UW3A 2FDJA 4DR1O 1NZCA 2YC4A 4FPOB 3GJBA 3QO7A 5AC92 5C3PA 4AEDB 1LAJA 5E6HA 4MTXA 3U0ZA 3BPSA 1HNWB 3WEZA 4HFSA 1XBFA 5LK7B 2JKBA 4OZXA 4XUNA 2ARCA 3UESA 5LYJA 1MSDA 2VM9A 3CCRV 2RDCA 4LHLA 3RS6A 2M7WA 1SHWB 4I02A 4XJAA 4Q8KA 1F9KA 4HKOA 4DV1B 3CJXA 4RS5A 1FS0G 3DL3A 4DXSA 4IIJB 1SDWA 3MDPA 3S7IA 2EIJC 3W7UA 2H6BA 1ALYA 1B04A 5A3PA 1P8JA 1F4MA 3H8RA 4CBCA 3SITA 5FPVA 3ZRWA 3STLC 2PHFA 3OGIB 2WL1A 1R092 1AR92 1OHHG 5J2TB 2DBIA 2A1XA 1JZ5A 4P9PA 4WCEV 4J80A 4GKJO 4HSJA 4A5UB 3ASNC 2EJ7A 1RL3A 2ZXWB 5JIAA 4IT5A 2XJSA 5CKNA 3PHMA 4PV1B 3VDBA 3FAVA 1D4M3 4TUYB 5T52A 4LBJA 5EFUA 5FL7G 4K6BA 4I50B 4JTAB 5F8PA 2RJ2A 3JSLA 3BN6A 1E5IA 4G9SB 4CH4A 2UXDB 5ERLA 1JU3A 4IYIA 2QQUA 4GWIA 5FWEA 4I30A 3N9PA 4AE2A 2GZWA 1XNKA 4EE2A 4I7ZB 5C9AA 2P6JA 1DF0A 1VRH1 3FX7A 2CHHA 4JGZC 1TGOA 1OQEA 2H3OA 3THPA 1W2NA 2DCJA 2CTPA 1PM9A 1ND3A 1MS9A 1CVNA 1OUXA 1GKBA 2WUHA 3NV2A 3QTCA 1V9U1 3HKBA 2E76B 3L2HA 4FO9A 5JWPA 5G05L 4GMP3 1SQBH 3LF7A 4P14A 3ZCCA 3DTUB 1IQAA 4FFIA 3SPJA 2WC2A 1QLNA 1LEDA 4AQ2A 4CU6A 3FD9A 4DV4B 3RSJA 2W1SA 3N2KA 2EXJA 2K9PA 4N53A 1VAVA 5JZGB 3U37A 4NXNB 4LBEC 2R062 3TOJA 2VGDA 5FYBA 4QB2A 4QXCA 2I45A 4DMIA 1VMHA 3FYEB 2ARAA 5J1XA 2FBEA 1W06A 2JK5C 2RCVA 3CMEV 1UXZA 3SDLA 1NCQC 4QPIB 1HW7A 2J1AA 1XILA 2ADQB 3J7HA 4QPKA 4A45A 3AC0A 2LFSA 4UVCA 3FLRA 4RGAA 4RA0A 1SBDA 2VXRA 5A3LA 3K5OA 4CDXC 1NZ6A 2ZHLA 4LUKA 4OX9O 1AUYA 1PGW1 2L9LA 2EILC 1CGPA 1IS3A 2XHNA 3N2GB 1CPMA 2QE3A 2R042 2XB6C 5CNAA 2JXAA 4K0KO 2P90A 1AYN2 4QGLA 2WAOA 1QWRA 5IVEA 5BNNB 5IAXA 1F4NA 1UY1A 1UN1A 3POGA 1GP4A 1OOPB 3DF0A 4JTNA 5GALA 2VOTA 1CZTA 1TME1 3OE7G 3WNLA 5BV6A 1YITV 4OLLA 1FMD1 3QLQA 2Q8DA 3VKLA 4GB33 3ABMC 4U3FH 1YFUA 1FT9A 2ET1A 1XUQA 4XXPA 2VZOA 2VJXA 4I01A 4X6RB 1HRV3 1Q43A 1AI6A 1WBFA 1HWYA 1OVPA 4ZS3A 1VQ5V 1THZA 1YHFA 1CAXA 2E51A 1XNRO 4YGDA 1K45A 5C4WA 1PMJX 2VTXJ 4W8JA 5FZOA 1JYWA 1JXNA 5DABA 1SQPH 2OIEA 4FLYA 4O4IA 3JBG3 4P5YA 1DGRN 2P3IA 1ND2A 2ATFA 1UNBA 4X64B 3UM7A 3JUUA 4F6RB 4DUZB 5BZBA 3GZEA 1UO9A 4ZPIA 4YJ2A 1FV2A 4YW4A 4XUOA 3H9AA 4XYXA 1XE8A 4XFBA 3ROUA 1H9PA 4FTEA 5K1PA 2HWB3 4GAZA 1GZWA 5CB4A 4IV1A 1GLHA 3CCQV 4FPKA 5FY4A 3LNMB 2YIDA 2VPVA 1P7GA 2KA3A 3AZXA 2ZHMA 1NY72 3ABZA 3CBNA 3EHKA 3WOGA 3M4FA 4ZZ5A 3B01A 1VQ8V 3T1CA 4GX1A 1WCDJ 4QHOA 2UXNA 2B4KA 1GTOA 1SFYA 4AHYA 4KWUA 3GBWA 1CAVB 3DXRB 3NWKA 1L1FA 4ES9A 2PYLA 4W6YA 3RWRD 5GLWA 5CFCA 4D6TH 5SV8A 2VRZA 3VD9A 2CSGA 5LA9A 5CISA 3E6BA 1O5UA 2DCTA 4XFFA 1WPBA 4FP2A 1JZ8A 3IPVA 2DYRC 4JI2B 4JX0A 4P9JA 1PM4A 3E8FA 4Q20A 4LLOA 3DXUA 3H1MA 1CD3G 4H14A 4FIPC 3O1SA 3W59A 3WDTA 4JI5B 2X0LA 4AI1A 1R093 1MS0A 1AR93 4QPGA 3OMNB 1LOAA 5BXZA 4GH4B 1NH2B 3JD0A 3VKNA 1PGL2 5AFEA 4MSVA 3VBFC 1PVC2 1K5QA 2IVJA 4DOUA 3I54A 3P6BA 1I94B 4Y33A 5L3FA 4I09A 1L8DA 2YBKA 3WNNA 1AR4A 3RYIB 4YFWA 2ORXA 5GONA 1UYZA 3QVNA 1DQ0A 3R4SA 4CCNA 3AP6A 1BS3A 5T3NA 1MQTB 1HRV1 1C57A 3VD5A 3ZXKA 1RUD1 2WIIB 5H9RA 3CE2A 4XFAA 2OA2A 4RR3A 3U1XA 3VZJA 3AYDA 2ZMLA 4ISRA 2IW5A 4BLIA 3JXSA 3BODA 5IYZA 3SCGA 3WG2A 4CCEA 4LPLA 5FJKA 5FYSA 4QGPA 1YCIA 4A3XA 2R071 4QKBA 2PQSA 4N23A 1M4UA 3AG1B 4YM2A 5AVAA 2OXBA 4XHXA 1MA1A 4JV5O 4X1KA 3DC5A 2GNDA 2ZQMA 1QQCA 4LBKA 2D98A 4JQRA 3AP7A 4BIUA 2BSKB 2WN3A 1ENRA 2VMHA 2ETNA 5FRAA 2D6PA 3OEEG 2ARXA 3SXWA 3UYJA 3W21A 1QH6A 4E8CA 5A6XA 1O4YA 1ZZ6A 5J7MA 3LSSA 4PELA 1JHJA 5FR3A 3MV01 4LF7O 4JYCA 5EJ1B 3ZSKA 4XIOA 3HBKA 3LDCA 1M4WA 1VBD2 5FPBA 1GO3F 3B8NA 3LIHA 1X9TA 5JAXA 4XDLA 2RDRA 2MEV2 4DUXA 5CMUA 4D7TA 2XKOA 3S0MA 1ONAA 1N3PA 4RS5C 4C90A 2YFUA 3CHXA 1HR0O 4L92A 1N47A 4COWA 4PI0A 1V54B 3O9OA 3NV3A 2VBDA 1JZ2A 3OPTA 3UKNA 1OI6A 1KKDA 4DW0A 1YFWA 3B94A 3P32A 2V7QG 4YIPA 1S5LZ 2HVKC 3O0VA 2Y4TA 3H1IH 3ASOB 4QAWA 5IVYA 3OTOO 2RM23 3EYPA 5IWAO 1RTVA 5A2QN 1P49A 1DF5A 3WP6A 5IVBA 3ILRA 1LNSA 1PNFA 3SCHA 4QX3A 4E2SA 3O0XA 1G1XB 4X20B 4CZZA 3ES1A 1SPPB 4MGKE 3WLUA 5JMCA 3B9IA 3E5XA 2LW8A 3JSNA 5LP6A 3I5DA 3RFRA 1QKQA 2VQUA 4MTFA 1GV9A 2DDUA 4R9BA 3ETGA 5A9GA 5FPXA 1B35A 2CAZC 5IWFA 3E8GA 4NAOA 1WKYA 5C9AC 1VMGA 4UW4A 1FXVA 2F43G 1XNQO 4CZSA 1PZ8A 3GNEA 3SEPA 3JCZA 3PTYA 4FVVA 5GZEA 3BEHA 4B08A 4MGYE 1ND3C 1UOJA 1HP8A 2C2AA 2BERA 1VBE2 3ITQA 2XHKA 1KP2A 1Q7YW 4MLOA 5LOVA 5JCTA 2QE7G 4J42A 1JOYA 2QQWA 2Q8VA 2WLLB 4JI7O 1YI7A 5JJJB 3ALQA 1UIKA 1J1LA 1B6QA 2RV9A 2WAAA 5EJ3A 1Z7S2 4N53C 2JDIG 4OVEA 4XQWA 3W7WA 1K34A 1W6NB 3SKJE 2Y6HA 1NT0A 3K4ZA 3NNLA 2RHPA 1F51A 3K5MA 1RHI2 1GKFA 3F7VC 3QO5A 4L11A 4Z92B 4DR3O 4ZY9A 4PT6A 2BWAA 4NIGA 1SLCA 2RMKB 3IMMA 2E9QA 4LFAB 5LGTA 4YG6A 2E3CA 1AR1B 4F8AA 2Q9LA 2BP6A 2E26A 2ZDIA 4CCDA 4AI3A 3BPZA 1E1QG 1TUBB 1AX0A 3R65A 2BRTA 4Q4Y1 1H0BA 2Q5ZA 3C7GA 4HK9A 1ZA7A 4EN7B 3AG3C 3IN9A 4AFBA 1PVC3 2YIBA 1DQ6A 1ZRCA 5FMOS 4LKDA 4FVMA 3DUIA 3O0WA 4FSJA 1EAH1 2FDFA 4W4LA 4QX1A 2F17A 2YUEA 4KWJA 4IL6Z 3WNOA 3K06A 5DDJ1 1M56C 2K2SA 3NRUA 1PMHX 2TEPA 4WM8A 1VARA 1XNCA 1M06G 5C4WC 2ARHA 2QEXV 3OUHA 5LEKA 1PZ9A 4CC5A 1T6BX 1ND2C 2XLGA 4ZOLB 4NRMA 2BQPA 3T0AA 4ASLA 1JOBA 1YQ6A 1NE6A 2IXIA 4NXMO 2GHYA 3MFCA 2V72A 4GA9A 2R7EB 3RG0A 2DTYA 1RUI1 3B8MA 2GV9A 2W68A 4IV1C 5KMGA 3SGIA 5B1AC 3DPRB 3VKOA 3ABKB 1XREA 2GNMA 3OT7A 4RHV3 1PGSA 4TWTA 2MNGA 1QLEC 1FX5A 4DS0A 3IFXA 4B3SO 2JGUA 1D0GA 1GNZA 1IG3A 3HAGA 1K42A 1A6CA 2PELA 3GYDA 4ABMA 3JYCA 3X2QC 3DYOA 1S0BA 4X62B 4OQ8A 1HRI2 1SZBA 4I3PA 5FP4A 2P3KA 3AG2B 2VUCA 3X29B 1BHBA 5CFCC 3TJTA 5J98B 2LRPA 1S72V 1W8ZA 1RUE2 1AXKA 3MIBA 1ZRDA 4CUGA 4Z1VA 2CH7A 4AHXA 1K3EA 1WD3A 4FLVA 3B9CA 2WFF2 4NVPA 4LO8A 4NIIA 5BNPA 3VKFC 4AWDA 1W3XA 4YRDA 3WDVA 4K35A 3POBA 5A7NA 1AJKA 4AVBA 5I8TA 3FHIB 4GQ7A 5LMUB 4QPGC 4Y22B 3NJXA 1BK0A 5AFBA 3WDUA 1SMVA 2VW2A 2BTOA 4KNCA 5TISZ 4HG6B 4TYSA 3CL1A 3KKYA 5DUUA 3ST7A 2RR13 3S6PA 1VALA 4XEZA 1H6YA 1EN5A 5DECA 5JR2A 3ZXFA 2P06A 3I97A 3V56A 3L9DA 1AR63 4OI2A 5AVPA 4Z8BA 3T2OA 3JU9A 5IVJA 1I08A 2HWE1 5DUXA 5ACA1 4DV2O 2TBVA 1N33B 3OYWA 3NAPB 3AK0A 3QBQA 1H6XA 1AL23 5FZIA 3HQUA 4RR3C 4QHBA 2NZ9A 1QJX1 4X65B 1PO13 2LP7A 1UWWA 3FX3A 3WCRA 5JSRA 3VB9A 5EXOA 4PIYA 1NI8A 1XNDA 1Z5VA 2QCSB 2ZT9B 4LF5O 3L71H 3AG4B 1FOD3 1LEMA 1KB9F 2KB1A 2A3QA 2WZPP 2JDHA 2HG5C 1UOBA 4LMFA 3ACHA 2AZ5A 5JQGB 4W6XA 5CBFA 1EBOA 3M3CA 4Y5Z0 4ICGA 2HLEA 2DWRA 1VLNA 4EV0A 2CTQA 4DR6O 2WS91 4FI9A 5H6QA 1BQPA 3MV11 3CU7A 2B8MA 3BOPA 2XBO2 4LH6A 2IBZH 1GANA 2X10A 2OVUA 1MEC3 4WBNB 4QPYA 2A0LA 2DWDC 1TNRA 3KG2A 2DJVA 2ZHKA 4AQ6A 1O9HA 4PI2A 4IESA 1RHI3 2RDSA 5FLIA 1JS9A 1QHDA 4BB3A 2XAHA 5A33B 3NKGA 4FJCC 1I5YA 1I0HA 2XJTA 3U10A 2EINB 3K0DA 3K3NA 2RMU1 4XF4A 2X5IB 4ATEA 2NQYA 1FYUA 1P4RA 1N32B 2G1MA 4B3TO 4Q4X2 5A3TA 4AGGA 4DV3B 1WUVA 3UT5B 4J7KA 2BW8A 4WFFA 1O8SA 3W20A 4DR1B 3IWZA 2B46X 2HBTA 3OW2U 4IHJB 3WQ1A 4M3CE 4LC1A 1PMIA 1UXXX 3HKEA 1X36A 4XOGA 4EYUA 3UETA 1NE4A 3O1PA 4I3GA 3NMBA 1D2QA 1VBB2 1Z0HA 2ZX2A 4JC1A 1CX4A 3I3DA 4YNIA 4MZUA 1SLLA 3JALB 3RMYA 2WFPA 2XJPA 3VV1A 4ARXA 4O4JB 1XU2A 2R70A 4ZHQB 1L3JA 1Y76A 5LP6C 1D5NA 1YF2A 3BRCA 1S0EA 3P5BA 1B35C 1AR61 5I0RA 5FMBA 3QF7A 1J59A 1QJY2 2BBVA 4RN5A 4AXOA 4XETA 4JHZA 3UT0A 4M4RA 4TV8B 4GKJB 4J10A 2HWF1 4LWSA 4AI0A 4JPRA 4B3NA 2VZ3A 4CDWA 1HXS1 1GFF2 1BHGA 1ZVFA 3QOPA 3ZO0B 5C70A 4J7ZA 1W6QA 5EBMC 3ZRVA 2AREA 5I8YA 4E2GA 1NTMH 2QDNA 3WG7B 3HT1A 3VGIA 3A0BZ 3HR0A 1JBCA 4FPYA 4HSLA 2JIZG 3THDA 1RVF1 4RUEA 2WINB 4F4LA 3PMEA 4K1YA 2DYSB 3MBWA 2P7TC 3WSOA 5KHHA 1QJZA 1VBA2 2NMOA 1BMV2 5DAWA 5FP7A 5F6LB 4R9DA 3TEZA 5JH7A 1IBLB 2RS31 4NROA 2CDYA 2OQ6A 1G9CA 1QXPA 1FXHA 4XDJA 4EZ4A 1F4AA 1BEV2 4HVOA 2K0GA 1QEXA 2V4VA 1GMMA 2EIDA 3WUDA 1NA1A 2EBOA 1UU6A 2V4AA 3UGGA 1KS4A 1WB7A 3OEAA 5L19A 1TMF3 1XNBA 4CH6A 2PZSA 3PUHA 5LATA 4CEYB 1M57B 1LOEA 3ZXAC 4AG4A 1AYM2 3BAAA 1C28A 2ZDIC 2WPDG 1G8MA 1SG3A 2Q69A 4OMCA 3JAMN 2E32A 1X8MA 1QVGU 2XT9A 4EWAA 3CNAA 2XL7A 3CC2V 2XXZA 4BXSV 3LFIA 3TCUA 3KF5A 4NTYA 2KXLA 4O2BB 4N43B 1RXFA 3CS5A 1JYIA 2SLIA 3I59A 5J36A 1M9NA 2RS52 1DLLA 2ITCC 4NKGB 5JVVA 1O4TA 1AX1A 1N1VA 4XAAA 3CCUV 1FYJA 3VBSA 2PHLA 1SLIA 4OX9B 4WM8C 1OURA 4DV7O 3SCFA 2LROA 4K0KB 2RJLA 3ZMZA 1IKQA 3WNKA 1WMFA 2FMLA 3WZ1A 3SISA 4BQXA 1R081 4E4SA 4CU8A 2CYFA 4TOIA 4WVMA 2GTAA 4HMZA 3J7MA 2KSDA 3J8F1 5DUVA 4YGBA 1IDSA 4ZHNA 1TZOA 4N9HA 4WZFA 3JASA 1R6TA 4LH7A 1PHMA 2DQ3A 4LKFA 3A7QA 1VBC1 4RFRB 2WO1A 3POJA 2LALA 4JZGA 3N9QA 3HMYA 4PJ0Z 2WYFA 5FOBB 2CY6A 1GMGA 4M3CA 4IV3A 4A42A 3KV9A 4YG3A 1PP9H 4DR4O 1LU2A 2W6JG 2BVBA 2HWD2 2PFWA 3JD73 1D2SA 4HN1A 3KD4A 1DHKB 2KD7A 4UXAA 5ITZA 4CH5A 1KFXL 4Q6GA 3HBZA 1VEWA 3VD4A 3IAQA 1Q8OA 2QSAA 2PGGA 1AR73 1W8HA 3IDEA 1AL0G 4CUAA 1CONA 3HN1A 1NXMA 3ZLIA 4IIJA 3C7EA 5BNPC 1KEXA 1REFA 4CYDA 3VBUB 3SPHA 4Q4V2 3NQHA 5DEDA 2NLRA 4BAYA 3GDBA 2HJDA 3G71V 2EIMC 2ZGLA 1RM1C 5L36A 1CAUA 3DECA 4UB8Z 4J41A 5J2TA 1S3JA 4DRXB 4HNAA 1XSRA 3L9JT 1WA6X 4DB5A 1RUH3 1UPIA 3POFA 2WZR1 2PI5A 1JYCA 4MTGA 4TXWA 4TUYA 3MIHA 3TNPB 2E5LO 4HZFA 3VDDB 5FTTC 5B1BC 3WDYA 3W58A 5FYZA 3K79A 4M3CF 4LOSA 2BVVA 1JX9A 3SYAA 1LGNA 2XJRA 2HJFC 1F7YA 2JB4A 3RI9A 3ZDVA 1GOHA 4HT1T 2DYCA 3H3LA 2VZVA 4GX0A 5D1IA 2DQ0A 3O7OA 4META 1QQP3 4N7UA 5KX5B 2QTOA 1DG6A 1DGLA 4NR1A 4HONA 4RQPB 3NO8A 3TN91 4QE7A 4XE9A 1V55C 4JI3O 1UX7A 1ZX3A 5IY5B 3MHZA 1U5ZA 2QM8A 1RYYA 1VQLV 3O1VA 2YZ4A 2EXHA 3CB2A 5DPNA 3PL0A 1CIYA 4QKDA 2Q7EA 3WB1A 5A1FA 3FFQA 5KBFA 2FZ1A 2HHHO 5C5UA 1WNSA 3GHMA 5A6QA 5JZGA 1YWKA 3ZX7A 2P4KA 2DCZA 5D5QA 5CEHA 1OCRC 1NT2B 2VMCA 1BBT1 5LASA 5FZEA 3PIJA 2YEVB 4Z2WA 4UVBA 4JV5B 4LO4B 1BCCH 2LJ2A 1S76D 1EZVH 5C8YB 2ZZJA 3CEIA 1PNMA 2WLPA 3PNAA 4G27B 1YSCA 3MI8A 5CU1A 5EYPA 5AC91 2E31A 5A6ZA 4IEPA 2OIGA 2Q7HA 2P34A 3DYPA 3H1HH 4LF7B 5BNNA 1QNMA 4PBPA 1A3KA 3KSCA 1OOPA 2ZGRA 1J5EB 1MS3A 1G7YA 3KVBA 5HBAA 2VWJA 1PD3A 1VQ7V 3P3PA 4DRRA 4AYUA 1NS1A 2GNBA 2QWPB 3E22A 1LGBA 4OHVA 3RZZA 4LUMA 4DUYB 4UAPA 2WZ8A 3NR7A 1EV13 1RMU2 5F7UA 2JKXA 3Q8FA 2GSMB 2W2IA 5J2UB 1W2BU 3A22A 4A7ZA 4KGQA 3OTOB 4TLFA 3RYRA 5IWAB 5FUNA 2GU9A 4CP9B 1N36B 4CDWC 4LOTA 3OF1A 3FHAA 1ASJ2 5T5LA 3AG7A 3MHSC 4HOOA 4AFMA 2IXKA 3FUOA 4LFBB 3V0BB 2XJQA 5HI0A 4JAVA 4FFBB 4QQHA 5C3RA 2WAMA 1SZTA 4Y5SA 1MABG 4HAMA 5EC2C 4I0AA 4M0HA 4WFHA 3D3IA 5EV7A 2AENA 2C26A 3VDCA 2EVXA 5B3SB 3DXRA 1YHQV 1YIJV 2E63A 4GX2A 4MSWC 2EULA 5BUVA 1NA1C 1HNXO 1H8TB 2RS13 2WT2A 2QZ3A 1U5XA 1OCZC 1DTOA 5L3BA 4X88A 1HB1A 1RUJ2 2VAUA 3F5WC 1S0CA 2O8QA 1VJ2A 2QKAA 1DGRA 5J37A 1O3SA 5FZ8A 1ULPA 1KU9A 2X8KA 2O8OA 1SA0A 5KUKA 2OW4A 5F5CA 4NHXA 3CRAA 2YIBD 2EF6A 2JDAA 2WNVB 4LO6B 3VHOA 2ZGOA 5JJEB 3NNGA 4OUEA 5EPAA 2R061 5C7GA 4FLWA 4IQPA 1V00A 2A7WA 1OQDA 2CGOA 2N05A 1IZ3A 1H2MA 1CWPA 5D2AA 4I0BA 5EBLC 4XUQA 4WFGA 4HK8A 2R32A 5IATA 1M90W 4LEJA 2QR4A 1ZZCA 4DR3B 1OCCB 4LR3A 4YW1A 1BK1A 1BHAA 4YHHB 2PF4E 3VBSC 1ZSPA 5KHGA 4DV6O 4WV8A 4XACA 2BV4A 1AI7A 4AQTA 3H8UA 1RB8G 1SF9A 3CMGA 4Q2FA 4BIFA 1W28A 3LDKA 1FPN3 1MQTA 1AR83 1AYN1 2JGDA 5KWRA 2OZ6A 1MZ6A 5CA6A 1Z2GA 4Y20A 3WB2A 4K1ZA 2DF7A 5CBHA 4CH3A 3ZRSA 1Q6UA 1FAFA 3ZBHA 5FZ1A 2B42B 4GJYA 4TV9A 1NG0A 4V1PA 1NQDA 2JB8A 4NRQA 4Q4W2 2ZGKA 1LHNA 2D6MA 3LEKA 4XBFA 1ZAUA 1H9WA 4IV3C 2Z4FA 4Q1PA 2BSKA 2VCCA 3CJHA 4CCJA 1IX9A 4AVSA 4QXKA 1BZWA 3A0HZ 3S7EA 1RP3B 1IBMO 4BK4A 3BKZA 3CCMV 3ZHUA 5A32B 4JI1O 5GW7A 1J83A 1PVXA 3ETPA 4NXMB 1NTKH 4HL0A 1FATA 2Y6GA 1OH3A 1N1TA 5FZKA 3VZKA 3AZZA 4TZDA 3RWNA 4N7IA 5JIUA 1U96A 4BWOA 1XOYA 4IW3A 5L3CA 2HWC3 1GWKA 2VG9A 1Q82W 4B3SB 2RS11 2Z5UA 3BUCA 4SBVA 1US2A 2ZD9A 2OUJA 4QWNA 1YYNA 3R66A 1QU0A 3I2DA 1LOFA 3A0NA 1GU3A 5H9CA 4UUJC 3W7TA 3MPBA 3VKMA 3G67A 5CA1B 3KQ4B 2WQZC 2VZ1A 4XMIA 4XF3A 5B1NA 3IIAA 5GJ6A 1ZLZA 4DQAA 3IDAA 3ZSLA 3KCYA 2PXJA 1XOUA 2ZXWC 3RJRA 3V0AB 1PNGA 5FWJA 2K9ZA 2DW4A 2ERFA 4K40A 5CG8A 3AZWA 2XR4A 3OGSA 3NNJA 2VVFA 1EP0A 4X20A 3FKSG 3ASNB 2YXLA 1S0DA 2DVDA 1JPXA 5JOZA 1AVBA 2GC1A 1RMU3 1VIWB 4QHZA 1VQPV 4GALA 3TYJA 4Q8LA 3KV4A 2HLDG 1OLME 1JODA 2BOJA 2XAFA 4QMAA 3N3HA 3N9NA 3ZXLA 1WMDA 1BMFG 1IBKB 4V2VA 4JDNA 1AR5A 1FFXA 1PGL1 1LOCA 3ACLA 1ZZBA 1S1AA 1YQ5A 2IWGB 3OB8A 4FXKB 4MUVA 2WKKA 4QE9A 4AEJA 2IJJA 5FPRA 4NTXA 2GH8A 3IDCB 2W95A 1FXZA 5GKAC 4KQ7A 2WLLA 4DV2B 2X05A 2UXCO 3LIGA 1Q56A 3VBRA 1JA8A 3AKRA 1J58A 5HFMA 4E27A 3TXQA 4ARYA 2W9XA 5IDJA 2XJVA 3AKQA 2BU9A 5JZGC 1H8VA 1W6NA 4OQ9A 5CVRA 2JD4A 1ENVA 1SEFA 4CCMA 1X4TA 3T09A 4B8EA 4TQDA 2W5FA 1UJWB 1JFFB 4LF5B 1C8M2 1BYHA 1FI2A 2C6SA 2UUAO 2XUMA 4BIOA 4WVZA 4UFJA 1N3QA 5JJNB 1GOGA 2K46A 4PQQA 4DW1A 3O14A 4UV9A 1HJFA 1NAEA 3W9AA 4DR6B 1NCQB 2VE1A 4RGGA 2N7GA 3M3OA 1Q90D 4GYCB 4A2UA 4PA3A 3D36A 5A80A 5F37A 2WA3A 2A3YA 3AMHA 4CDXB 4NIAA 2NR5A 5BNNC 1OOPC 2JE7A 1W8WA 4O2AA 4A6SA 2YB7A 4OFGA 1VBD1 3BCWA 3POEA 3AYEA 2VOVA 1UY4A 4CDUA 1OF3A 2AW9A 5F6KA 3AZVA 1S77D 2E6VA 2Y60A 5JI9A 2Z0AA 1NR7A 4H0LB 3T1LA 4B3TB 1OZ0A 2VMIA 1GRJA 4MGSA 2E33A 1SZXA 1JN2P 4FMTA 1G9FA 4QQPA 1Q86W 1A34A 1BSMA 4BISA 1JH5A 5B5EZ 3L72H 3ASIA 4SLIA 2NN8A 2ZAHA 4AFDA 4ZOLA 2VMGA 3BTYA 3I2KA 3OPZA 2LW1A 1UMIA 3I2JA 1CIWA 2HP8A 4PCRA 4NWVA 4BXFA 4TT3G 3QACA 3UJOA 2B45X 1YUDA 5HCBA 4JQTA 5IYBO 2CU5A 3H3ZA 4CEWB 1Y74A 3VQXA 3DPRA 4FLTA 5CBGA 1JW6A 2P5OA 5E8AA 2BGOA 1WW4A 2ODMA 1OPMA 2HEYF 2D93A 1UX6A 1AI5A 4L97A 4DR7B 3CRMA 1VP7A 2VQEO 1YFXA 3CYOA 3WG4A 3ZXEA 4RQFA 4JHTA 2NMNA 4QDSA 3B3QE 4E8DA 4UWDA 5H9PA 1VBE1 3ELNA 3CJIA 5EBWC 3SNMA 1OSGA 3CRCA 3SPGA 2D6NA 4LKEA 3L74H 2A79B 3RYCA 2VVDA 3B7MA 3N9OA 1RUG2 3MEPA 1OLMA 3PVBB 4LF4O 2GTSA 1CAWB 1Z7S1 1CESA 2BPA2 4QDRA 3UKVA 5C33A 1DGSA 3T1HO 1L0NH 1Y67A 4Y22A 1KGYA 2JDZA 2BNOA 4MGIE 4MVSA 4HPKB 4F6EA 1XE0A 4M0NA 1W9WA 1WB8A 3C90A 2RG4A 1LENA 4B4RA 3SKVA 3AMPA 3VOUA 4H13B 1LUWA 2G4IA 4FTBA 2AC1A 1QJU1 1TUEB 5JVDA 3KT7A 4P2ZA 3T4DA 4JGYB 5EIYB 1LR5A 2QWQB 4AVTA 1UQXA 5FZHA 3FWEA 4C91A 3ZXJA 2GC2A 2MK3A 4KBZA 2BFUL 3SJCC 1MQTC 2W1UA 3KT1A 4NO4A 3WFVA 5CAZA 3NAPA 2IJKA 1LODA 4G3YC 2EXIA 3LSDA 1YI2V 2CDPA 1XHZA 2WBKA 1AJNA 3MAQA 3OGGA 4AILC 2WNOA 3WVJA 1SBFA 1YVWA 1W0NA 4M4PA 4KXRA 3K9SA 4B7KA 3H42B 2QBXA 3D8CA 2XNDG 1F5JA 5JQGA 5KA5A 4QX5A 5EQUA 1XI1A 2FCUA 2W6IG 2YC2A 1VB2A 5F3CA 2R1BA 4DV7B 4COVA 3ZHQA 4OCTA 3OBTA 3WF3A 2BNNA 2Q1MA 4HKLA 2LUWA 1W6OB 3RYFB 4BMEA 2GDSA 2Z5WA 5IJRA 4FQ4A 5H6RA 5LA6B 4OMDA 1ZUQA 1VQNV 3OY8B 3SYPA 1YJWV 3ATGA 1QXRA 4MXWA 5IFPA 1SLTA 5LYJB 4XDOA 5FK7A 3M3EA 1XMQO 2X5IA 3HEIA 3ZFFA 1QVFU 2YICA 4BW5A 4DR4B 1PK6A 5J96B 4JI0O 4IEWA 5GZGA 4IHJA 1LOFC 2ZHNA 1QNYA 2PLV3 1F5FA 1UZWA 5KA6A 4MVRA 4N90A 1RUC3 3ZHRA 5J9PC 2YI8A 5FO9B 3ASOC 3SH3A 4B1MA 2EIGA 1RUE1 1UOGA 1D4M2 2JE8A 1ZX5A 2VUJA 3ZRWB 4LIVA 1GOFA 5A6YA 5LWBA 4GULA 4ITCA 1QXJA 1UAIA 4M01A 1R1A3 1KYOF 5CZKA 5LA0A 4COYA 5GZFA 2WFF1 2WO2A 3A2FA 1SQFA 4O4JA 1ZZ9A 1WMXA 4ZHQA 2WT0A 4ZU5A 4H3WA 2ZA9A 4NWWA 4PDMA 3WT3A 1OKOA 4UW6A 4YFZA 2QWRB 1O6UA 2PUSA 3K5LA 2W92A 4HXCA 3GCWA 3ILNA 1IG0A 3NL1A 5LK5A 4AAXA 3FLPA 2BBAA 2YHJA 3OTFA 4J9ZB 1ZZ7A 1RUF3 4EROA 3H1KH 1URFA 3IAYA 4O9GA 1V6KA 5F1RA 1D0HA 2PY5A 4U2AA 4O4HA 5KC5A 5JCOA 2R9AA 5C9AB 3F95A 3ZFEB 3O1TA 4X1YA 5BYNA 2E5LB 4JV4A 4YVWB 3ILFA 3SH5A 1RINA 1NOVA 1ND3B 2IUWA 5DZEA 5DAXA 4MXVA 2WYSA 5CFDB 2W1QA 3SC7X 3HKBB 4ZU7A 1K92A 2OT5A 2YPDA 1POV1 5C8WA 2E74B 2ZPXA 3RW0A 3ZMUA 2P22C 2HYKA 1WLTA 1W6PA 1EN4A 2VMEA 1JYNA 2VUDA 3N2KB 5CKMA 1NU1H 4N53B 3P3NA 3CD6V 1FXKA 3H8XA 4MV2A 5FXWA 2DN9A 4XBQA 1EYBA 5C8CB 1SKVA 2Q7GA 5JOYA 5LA1A 4A4AA 3CIHA 4PDVA 2ZAAA 4CEYA 3MDSA 3OEBA 1LR1A 2P4VA 4LHNA 2P1BA 2XBO1 4CDQB 3ZFGB 1CZSA 3HIFA 3D36C 2HHHB 3M3IA 1TVKA 4GB32 4GLXA 5FP9A 1I1EA 3MIEA 1UU5A 1GBGA 1RC6A 5FKBA 1I6XA 2BOIA 2UYAA 4GWNA 4LF9O 4RQEA 1BZKA 2J1TA 1HRV2 3LDBA 4MHRA 4O2BA 3CF6E 4WF9V 5JSOA 1OBNA 4AW7A 4N43A 4ZI7A 2UURA 1VRH3 2FYUH 1WCUA 5GLUA 2QJ1A 3AG3B 4YY3O 4Q4X1 3T0BA 3T2MA 5FYUA 4NPLA 5HXVA 4MVOA 2OS2A 2Q73A 3JBG2 2OWOA 3HWJA 2GH2A 2TUNA 1SQGA 1GICA 1V9U3 2BEOA 4DXTA 1O3RA 5T50A 3ON7A 3A4UA 4FFKA 5FXXA 4LQRA 1CAXB 4JYYA 4AVAA 4IYHA 3ZYPA 4IERA 3T4HB 2HWB2 5C4WB 3RMXA 4AF9A 4K3AA 5FZOB 5T5OA 2ZGNA 4O4IB 3M99B 3WX5A 1JYXA 1J3PA 3OCPA 2WQ8A 1N4CA 3DPRC 3ABKC 1LNQA 3K59A 2AGSA 4YJ2B 3M8LA 3RJ2X 3U78A 3ZJZA 4DPNA 5FZ4A 1ODMA 4IV1B 5CB4B 4Y5TA 1QJY1 2XL9A 1QOOA 5A7SA 3G6JB 1YQ2A 4D0QA 3CCSV 2V73A 4P9LA 4PDWB 5F3GA 3WW3A 3CJIC 1VP6A 3T1YB 1LGCA 1KD7A 1PM7A 3VBOA 5CFCB 4C1WA 1TME3 3LWCA 1FMD3 3LPGA 4YM3A 3PTRB 4KU7A 1V6OA 1WLCA 4XMAA 4JTCB 3IPVB 1S2BA 1VBA1 2BCCH 1I5XA 3FE5A 1BMV1 1REDA 1W8UA 5GZCA 1G86A 2P5BA 2XMLA 3OJBA 5CYYA 4BE3A 3I55V 5JPNB 1DK1A 2QKCA 4NPRA 2Y48A 2EIEA 2JX9A 1HNXB 1PIV3 1JTZX 4ZKTB 3LEMA 1IXBA 1AHSA 5FY7A 1UY2A 4QDQA 4HZ3A 1Q6HA 5FYMA 1C4RA 1H38A 3GZTB 3I2HA 4FK5C 4DUVA 5DAVA 2B9VA 4GKXA 2VZTA 1CJPA 1AJPA 2ILMA 4K20A 4FM2A 3NAPC 2ADDA 2WSVA 5GONB 2OX0A 1N1YA 2W1WA 1V9PA 4RL7A 5A7PA 5FBZA 3IDBB 3K03A 3ZPOA 3JCIA 3OR6C 3AP4A 3MHHC 3KMHA 5GM0A 2XAJA 3H1YA 3G6BA 3POWA 1ZREA 2RS51 1MS8A 2GMEA 2QQJA 4BQYA 2DMXA 5IYZB 4OI0A 4DV6B 1VMFA 3I2IA 4PIXA 4YG0A 5LRRA 2ZJCA 2WSSG 5FV3A 1YI9A 5F3EA 5FZDA 1QDOA 2FCTA 2DVFA 4QJFB 3HKDB 2W3JA 4YSFA 3ZN6A 1VRBA 4UBHA 3AZYA 3N4MA 5BXXA 3PUAA 1Y7BA 3BIWE 3O1MA 4R9CA 4TLGA 1W9YA 5IT9N 5DZFA 3ZYFA 1HN1A 5LA2A 2FZ2A 5FYVA 3WG1A 5JLVA 3PN1A 3WY6A 2JDNA 2IZWA 3RZJA 3FBMA 2VC9A 2A3WA 2X5IC 5FO8B 3ZFFC 5C8YA 1W9SA 2VZRA 3DN7A 3S57A 4JYAO 3QCWA 4ATFA 3JD2A 4Q0QA 1NX9A 1PK6C 3KZIZ 2RM22 4D7YA 3ZRXA 1JI6A 2HWD1 1IBMB 3H7JA 1GQPA 4BQ1A 2AEYA 5IK8A 3B93A 4CUCA 4CPBA 3K04A 3PUIA 3O1RA 3N35A 4K7JA 2G9ZA 1L7RA 4H2AA 1RUD3 4IGGA 1M93A 2FMYA 2LGWA 2JIJA 1N3OA 1DU3D 1K5MA 2LS6A 1GAXA 4RGKA 3LEGA 1PIV1 3S3XA 2IM9A 3GVMA 5CA0A 4EN6B 2R073 5EYYA 3B77A 4NOTA 4J11A 2HEWF 3K9AA 2Z69A 4Q29A 5FPOA 4B3MO 3MUZ1 4Q4V1 4YJ3A 4EN0A 3CZJA 3E83A 4QGMA 3TK1A 2IJIA 2F4VO 3RZKA 5LP6B 1Q5OA 2LQTA 3OBRA 4KUMA 5D8AA 4BU2A 5I8SA 1JCHA 1B35B 4CP9A 2VU9A 5JCOC 2OPKA 2ZZQA 4JVAA 2Y26A 2YXYA 4BH9A 4GWJA 4PJYA 4MS2A 3ICXA 3JQWA 4Y4RA 5FPZA 4U3JA 1I3HA 1AP5A 4G2KA 2UU8A 3VZLA 1NLQA 4JI6B 5DAPA 2ARBA 4ZKIA 1WW6A 4FFBA 5LOVB 2CAVA 3LDDA 2D6LX 2BE3A 2VQFB 2ZM6O 2ZKOA 4W50A 3D6EA 3NW4A 3Q4HB 4DV5B 5F2WA 2NNUA 3SPCA 1FXKC 2JVDA 1BLZA 4HYOA 1NCRB 5DMYA 1HDJA 1IPSA 4UCTA 3KGZA 4QXBA 3AFGA 2M6YA 5GLVA 2VQ0A 3NXSA 2IFWA 2UYBA 1GM7A 1UYXA 3I7DA 1POV0 4R52A 2EICA 1GQHA 4CEYC 2OCCB 2RN9A 1M57C 2UXCB 2D97A 4LK6A 1X33A 2Q0OC 3C7FA 4MYEA 2YBPA 2F4LA 2B9ZA 3E35A 4XF1A 1PKXA 2JDUA 5GLTA 5IJ9A 3LE0A 1ZTEA 5KXDA 2C24A 4KU8A 2Y0PA 1W2OA 2GC0A 1R6NA 3OBZA 1DF4A 3WF4A 3ETEA 3T4ZA 3CP1A 4AHCA 4LBNA 3N7JA 3GXUA 4N43C 2UUAB 2PHDA 1E5HA 1U5YA 3ZIWA 1E1RG 2K1EA 4FZ1A 2OZJA 4X8NA 2WLJA 2A71A 2B1IA 3QO8A 2R9IA 1OXCA 4XTMA 4EWEA 2Z79A 3LSUA 4UCSA 2D43A 5LMNO 4GCZA 3L73H 2GN3A 1N8RW 3GBGA 2ZEWA 3PU8A 3ZN1A 3BU7A 4XZUG 1H2NA 1URXA 3CCEV 1KITA 1YZBA 2WO7A 4ZXEA 2DBNA 1IS4A 2UXBB 1QHTA 4RHV2 2R72A 2YV8A 4CXXA 5HV0A 3WF0A 2YBSA 1AXZA 5EP9A 3HQXA 1K5JA 4Y1VA 4PD4F 3NSTA 3SYCA 4BMBA 4Z07A 4C0HA 2UY8A 1ZBA1 4KHPO 1PO23 5KR7A 2DUQA 5IVVA 4W6WA 3C7OA 5BPXA 2UU9O 2D40A 2NPIA 3AJZA 4YM1A 2VECA 4JRAA 3ZKYA 2DVBA 2AYHA 1ASJ1 4Q4Y3 5C6CA 3LGRA 2PTMA 5CKQA 3VBOC 1HN0A 2XLFA 4QX2A 3AMMA 1W99A 2CH7B 1WCSA 1HDKA 4CU7A 4DR2B 2WN2A 4UBGA 1OD5A 4KH9A 2VBBA 3F7YC 3SLIA 4K8FA 2ZGQA 2VQEB 1EAH3 2D3PA 2RR12 1GZTA 5BNPB 5H9SA 5E1AC 1ZA4A 2QQNA 5DDJ3 4BDVB 2QDOA 1AB3A 1X8EA 3AM2A 2YYOA 3JAKB 4DZGA 2W52A 1YDXA 2P67A 3K48A 4PA9A 3HPLC 2W08A 1AR62 4GUNA 4AVCA 4Z1MG 1RM1B 4X8PA 1WPXA 1RUJ1 2DWEC 4AK3A 2GUZB 2JG8A 1AL22 3G6EV 1ULEA 1OLQA 4LF4B 1KBHA 4Q0PA 1RUI3 4PLMA 2FD8A 1PO12 1ULDA 1Y66A 5EZWA 3T1HB 4MGQA 4BQ4A 1WW7A 5FZFA 5B1BB 1ZBE3 4UI9L 4OHYA 2D6KA 5FUIA 2IH3C 3CKHA 1FOD2 2R49A 2JG9A 1RSOA 4CS3A 3OYWB 1WCKA 4HBNA 2YC0A 2WRAA 4PF5A 1Z5WA 1KDMA 4URAA 1WLDA 4BQ2A 4B3RO 1WW5A 4LK7A 3LNNA 3AP9A 2D44A 4FZ0A 1W8FA 1KFUL 1DZQA 2FDIA 4RQPC 1TE1B 4FOWA 2GALA 1MEC2 3F5TA 3BVOA 4KWLA 3JB4C 3ZKUA 4NHKA 5ISLA 3WR0A 5ABJB 2WLHA 4CXWA 1H1AA 3AJYA 1V55B 4MVZA 3LSQA 1CQ9A 1XNAA 4CC6A 2ZX1A 3KHBA 2YU1A 2IXCA 5FZ3A 4CRQA 5FFOC 1Y4WA 1PO21 4Q0UA 3MF9A 1IOAA 2XUEA 2FDKA 1UCXA 5FP8A 1O4ZA 3THTA 1COV3 1Y9GA 5IYCO 4Q4W1 3ZIXA 3I3QA 4UF0A 1OCRB 1FAYA 1ROPA 2QQKA 3VZNA 3EXUA 4LBQA 1DIWA 4JF3A 1U97A 1A32A 1TQ5A 1FJGB 2Y6LA 5FQ0B 4RUFA 4GD4A 2ZOEB 1D5AA 5BR8O 1DGWX 3E6CC 4WVWA 2X09A 2VY0A 5L9VA 2HWE3 4MW3A 2JICA 5ACA3 4LULA 3OG2A 1AROP 1XNTA 4JKKA 4BR6A 5FYHA 4QPJA 2PHUA 1C1LA 1XPWA 3HKEB 1K5MC 1QJX3 4BA6A 1AX2A 2UWCA 4I0WB 5FO7B 3LOIA 1R082 3ZHVA 1PPJH 1XMQB 3ETQA 2JIGA 3L75H 3ZHSA 1UW8A 5K0UA 3MW3A 3RT3C 1UY3A 2WLIA 3SPIA 1G6NA 1HV1A 5FZCA 3ACFA 3WW1A 4IE5A 4JI0B 4XDPA 3MUY1 1NJIW 4TSFG 3GZAA 5A3NA 2BUKA 3I8TA 1DZTA 1Y76B 4MHUA 3OFNG 4MT8A 4O9EA 1JZ7A 1H2GA 4F7ZA 5D8AC 1B09A 4LT5A 2UUBO 5IW0A 3KB5A 2WS93 4NIDA 1IVSA 1NVPD 1ULOA 4ES8A 1ZBE1 4BYYA 5TSWA 1JZ3A 4FLZA 4DRVA 4LWSB 4FFHA 2QWNB 2Q1ZB 1RFYA 4LCUC 4LA2A 2XJUA 1VQ9V 1M1KW 4A7YA 4CDWB 4CEWA 4KWKA 3OUJA 2CTRA 3OGVA 1W6QB 4NB5A 4LE4A 3HR9A 4YYOA 4WVVA 3HD8B 2RMU3 4R7CA 2Y0IA 4KG8A 1S0VA 1UKGA 1S5HC 2F1MA 2QKSA 1QR8A 2YMZA 4Y1ZA 2J1SA 4XVHA 2WLMA 3GB7C 1VQKV 2B39A 4Z82A 3AVRA 1TMF2 1JR9A 1EPWA 3WQ7A 5JH7B 5J3UA 1OVSA 1H4HA 3N36A 3DKQA 1UZYA 3ZN0A 2R30A 4COUA 4UFMA 4JZ2A 2A6ZA 3JATA 1D2DA 4XCBA 3ZM8A 1COV1 3WQ0A 4CUBA 4LBLA 2ADEA 3CC7V 1WN7A 2VS0A 4BM8A 2ZE8A 2ZKNA 3OM3B 1G6UA 4BQ5A 2IXLA 3ZIAG 3A23A 3TWIA 1DQ2A 1YO8A 4HPKA 4GT1A 4XJ8A 4FPLA 3EHBB 1HQLA 4YARA 1FD9A 1J1TA 1GZ9A 5A7QA 5LHGA 4X1IB 4L9BA 1C8M1 4K8RB 2UY9A 1OCCC 4CP1A 4X65O 3UJQA 2HWF3 2Q8OA 4DINB 4YXWG 5IJ0B 1HXS3 4JGYA 3MLLA 3ZX6A 1UYYA 4CCLA 3PIGA 5C3QA 5IK5A 4MVTA 4UCVA 1OH4A 2A6YA 2Q4SA 3K75B 3CRRA 4LA3A 3VBSB 1S55A 2J1UA 3SEEA 4EB6A 5FLXN 4QM8A 5T55A 2MHFA 3TN92 2ZABA 3CDZB 3GCXA 3ZMNA 4A44A 1IS5A 3AP5A 3JB8A 3KT4A 1RVF3 3LA3A 4LF9B 1FFTB 4XFGA 4EKWA 1RPRA 3TETA 1XDCA 1O3TA 2XOMA 1UF2C 5E88A 4WVMB 2RS33 2Z3YA 4XXAA 2BTVC 4YY3B 3FB6C 4UXNA 3JASB 2VWKA 5EIBC 2IXHA 2OQ7A 5ANNA 3JD72 2QQIA 3CZUA 3KM5A 5LXTA 4LIUA 2WWUA 2Q5TA 5A70A 3VBHA 2QDRA 3IZOA 4JCKA 4IV3B 4H33A 1N34O 1OA3A 1AR72 4CCCA 4AQYB 2VH9A 1WLWA 3DSQA 4XILA 2KG7B 4QPWA 1JMUB 5EK0A 4JRLA 3WHUA 1G4YB 3OY8A 2V4DA 1AI4A 4QX8A 1SQ4A 3NV1A 5LEJA 3ZS8C 2VTFA 5ITZB 3SYOA 2H6CA 5BNOB 2ZIMA 4FPPA 4RO2A 3OUIA 4C1XA 2VTXA 5D21A 1Y6XA 2D7FA 1AVMA 1AXYA 1BE3H 4XBNA 4IEVA 1K3IA 4G28B 2ES3A 3LFMA 1RUH2 1FNYA 5IVCA 3AL5A 1ZL8A 3OGJA 3AKSA 1PL4A 5J09A 1CAUB 2HH9A 2GDFA 1R083 2PA7A 3CEWA 4IXLA 3WP5A 5C93A 2JG8C 4DV0O 4Q26A 2GAUA 2JJ2G 4HNAB 3J8F3 1MSWD 4XIKA 1RUG1 2XGXA 3FMGA 2DUOA 4AQSA 1VBC3 3WQBA 3USUA 2Q8CA 1W90A 5EJZB 3WW4A 2JECA 1O3QA 3WF2A 1YEWA 1HNZO 2XONA 1RUNA 5I91A 2JG9C 4YW2A 4B29A 4Y24A 5EZYA 1QQP2 1UOFA 1D4VB 4QGNA 4ISQA 1QF3A 3NKTA 2I2SA 5BY1A 4LNUA 1OCOC 1BQ0A 3RQ0A 4UVAA 3ZFEA 3D4KA 4NAMA 3CLPA 1IBLO 2VNOA 2VOXA 4TQFA 4MGTA 4YVWA 2VZQA 1PX3A 1MZ5A 1YQ8A 2QZ2A 2BZDA 4WM7B 1H4GA 4O4LA 4AVVA 4C8DA 5CFDA 2AUYA 4OULA 2VQAA 4IE7A 2XTAA 1W2AX 4X8AA 2AXTZ 4NHMA 1ZZ8A 1YJ9V 4YW3A 4R6ZA 3BHPA 3A21A 3LKJA 5APAA 4HANA 2H94A 3FL7A 3KQRA 4YVSA 1J3RA 1S4CA 1YXBA 1IURA 1NKGA 3IM0A 1R64A 4CPBD 5C8CA 3L2YA 5LRSA 3E86A 3U75A 4DK1A 2Y38A 5FNVB 5FMDA 1K7DA 2KKWA 4OPAA 1SETA 1O8PA 3BY6A 2WZR3 2PHRA 3KV5A 3I3BA 3AVSA 1VQ6V 3KWVA 2GMMA 5LCWL 4CDQA 3ZFGA 3LCPA 3WP4A 4BJ0A 4DXWA 5EYPB 2EIKB 2J42A 4UYBA 3J7NA 1SLAA 3N9LA 4GJZA 1DCSA 4LORA 5IAVA 5FXZA 1YTFD 4QB1A 3FFZA 4N8MA 1WA8A 5FZGA 1EV12 1MACA 4RSUA 1E5RA 4MX3A 1EUTA 5K0UC 1Y3TA 1KMIZ 2GP5A 4JYAB 3ZEDA 1O9GA 2WT1A 2XASA 5KAIZ 3MFAA 3JCUZ 5FAXA 4ZIBA 2OCHA 3E22B 2F66C 5FUPA 5IYYA 4WFAV 1FV3A 4INDA 2RNBA 3U07A 3VL9A 2FDGA 3TN93 3OAAG 2VZSA 5FYCA 1V0AA 2J7MA 3HNBM 3Q8BA 5A7WA 1HV0A 3ZOIA 3MZHA 3T08A 1D4M1 2YUAA 1V6IA 2VZUA 2X6CA 2P3JA 3THOA 3L70H 4OUMA 3OUFA 4I5SA 5JDBA 3R05A 3K08A 1XNRB 1MVEA 4IEUA 4BQ3A 2L35A 4BQWA 4CEWC 5I0UA 4UT5A 2Q0AA 1BBT3 4AEDA 1EZJA 1STMA 2GBOA 2P6CA 3OD0A 4B3MB 2YROA 4Y3OA 4O7XA 5L7OB 4MVMA 2F4VB 4LF6O 2RQ6A 3A0RA 4S2FA 4JDMA 1A8MA 1GM9A 2RS12 1ULFA 3E2EA 2XDVA 2ZX4A 5AC93 5FY1A 1WP7A 1W8OA 2XVGA 3B69A 4AOCA 1OFSA 4K3UA 5JXIA 3M7AA 4LE3A 4GMP1 4CSWA 5C3OA 4PDWA 5I0DA 4XJWA 1QU7A 4OHZA 3VQVA 3OSDA 4LLFA 1SFPA 5A3OA 2ZR2A 1W2TA 3G7DA 1JUHA 4E4ZA 4LP8A 5DG1A 2ZM6B 3BIEA 4EFEA 4RFT0 1R73A 2QQOA 5F2SA 1Q8IA 2JE9A 1SA0B 3FHQA 1LCLA 4LO5B 5I0TA 4QXHA 3ZYHA 4COZA 1DFQA 2XG3A 3C3SA 4IEOA 3ETDA 4E4DX 2IVIB 4I50A 1C1FA 1K73W 1M5IA 5FZ0A 1QJFA 3VQWA 2X6BA 1US3A 4FOYA 4JGYC 1FPN2 1AR82 2WNUB 2H0BA 1MNGA 5FLJA 1LHWA 3SJQC 1K5SA 5E79Z 4LJHA 4GB31 1RGSA 3WCSA 2FKXA 3ZYJB 1RPOA 1SACA 2QQVA 2NN4A 4I2OA 5EIBD 2R9RB 2ID4A 1KKCA 2JGDB 3HN3A 4Y20B 2RVAA 4FOVA 4IL7A 3H9VA 4RD7A 4E4EA 3DCQA 5LMNB 1MR5A 4J25A 4IE6A 3E6DA 4TV9B 1Y4MA 1UIJA 5JR7B 3JBG1 3LOBA 2VW0A 3ZR5A 4GKKO 1GNYA 4XJ9A 3MW4A 4QX0A 4GIQA 1DYKA 3N27A 2N74A 2VCMA 3HKDA 3VBHC 5HCAA 3IT8A 3C8XA 1MMMA 4QPIA 2G9GA 3VQYA 5LY1A 2P4EA 3CJHB 2HWB1 4YGEA 1SERA 3ABLC 2QNKA 1K97A 4FOQA 2HWC2 2R063 3STZC 3UCSC 1ZYBA 1JZ4A 5CIRA 5HPOA
chains in the Genus database with same CATH topology
5KHKA 3M2MA 5T50A 4AFCA 2RMU1 3ZMOA 3A4UA 4XF4A 1NLSA 3MIGA 2X5IB 4ATEA 2NQYA 2HEVF 4AHWA 1FYUA 5T54A 1CAXB 2VNGA 4AVAA 3WXPA 4Q4X2 4LR4A 4AGGA 1CPNA 1WUVA 3ZYPA 3LA7A 1SCSA 1JR7A 5GLZA 1NYWA 4IERA 2BW8A 2HWB2 5C4WB 3RMXA 4AF9A 1XU1A 4FPGA 3IWZA 4ZXKA 3POYA 1H1IA 3SHRA 5FDBA 1OHFA 2B46X 1RMU1 5T5OA 3FC0A 2ZGNA 1DQ1A 2WNEA 3WX5A 3JZVA 3WQ1A 1J3PA 4QQLA 4M3CE 3OCPA 1PMIA 3ZXDA 1DS0A 3DPRC 2RMU2 4FPEA 1X36A 4XOGA 1IPJA 4Y1YA 1AJOA 2PAEA 2A7AA 2AGSA 3CO2A 3GHNA 5K8SA 3M8LA 3RJ2X 1NE4A 2R043 4I3GA 4FPHA 4ZU4A 4DPNA 1D2QA 2JEMA 4D69A 1VBB2 1Z0HA 5A32A 4UW5A 2ZX2A 2YPJA 1AYN3 3R6SA 3USSA 1S0IA 2H0VA 4IV1B 1WA4A 4Q4W3 1QJY1 4JC1A 5L7OC 2XL9A 1CX4A 4YNIA 1QOOA 4MZUA 1SLLA 3RMYA 1IKPA 1LHOA 2WFPA 3G6JB 2XJPA 3VV1A 1H30A 1HIXA 1Y9QA 1R091 1XU2A 3H1WA 4K21A 1L3JA 1AR91 4P9YA 3SH4A 5KXEA 2V73A 3NJZA 5E1RA 4P9LA 3B5LB 4PDWB 3WW3A 4BPZA 3CJIC 1S0EA 3R4UA 3APBA 4HVRA 1VP6A 3VBUC 1B35C 1AR61 5I0RA 1J59A 1QJY2 1LGCA 3PVEA 1HW5A 1KD7A 1PM7A 3VBOA 2BBVA 5CFCB 4AXOA 4C1WA 4XETA 3WD5A 1TME3 2ZTNA 3LWCA 1IS6A 4EN8B 1F8VA 1S2KA 1FMD3 4GKYA 4YM3A 2HWF1 4AI0A 1Y0ZA 1HQNA 3AYAA 3MICA 1VR3A 4B3NA 2ZX0A 3WW2A 4KU7A 4XTPA 1LECA 4CDWA 1V6OA 1WLCA 4XMAA 3M1HA 1HXS1 1GFF2 1ZVFA 3QOPA 3ZO0B 1UPSA 3LSEA 4P9WA 3IPVB 1S2BA 2QVSB 1VBA1 1UU4A 3ZFEC 3FE5A 1O91A 3D0SA 1REDA 1BMV1 1W6QA 2BNMA 5GZCA 1G9DA 2AREA 1G86A 1O7FA 3OJBA 4E2GA 5I8YA 2EXKA 2QDNA 3V64A 2A6VA 4BE3A 3V0AA 3HT1A 3E5QA 4FCAA 3VHNA 3VGIA 4YVWC 2D6OX 4HVQA 1LTEA 1JBCA 4FPYA 5JPNB 1C8NA 4HSLA 1CAVA 2HWF2 3VDDC 2EA7A 4NPRA 1KDKA 2XH6A 2JX9A 1OLRA 1PIV3 1JTZX 1RVF1 2QKDA 4ZKTB 5CFDC 2WINB 2JENA 3PMEA 1DQ5A 4K1YA 1AHSA 1HXS2 1ENSA 1QY4A 2Q30A 5KHHA 1QJZA 1VBA2 1SBEA 2NMOA 2CWMA 2X53S 4XBLA 1BMV2 3WUCA 2C0ZA 5F6LB 4R9DA 1C4RA 4YZ5A 1DYPA 2Z2SB 1LULA 4TSVA 3GZTB 3H7YA 1Q8QA 4OI4A 2RS31 3VBRB 1G9CA 4AI2A 5FMOL 3AXEA 1QXPA 2WNUC 4GKXA 1O5LA 2CTVA 1GQWA 1CJPA 1GY9A 4LBQD 1V6JA 2DCYA 2B7YA 1BEV2 4HVOA 2CNAA 4YVSC 2ILMA 3A0KA 4K20A 2K0GA 1ZRFA 1RVF2 1G9BA 3NAPC 3IMNA 1NCRA 2D5HA 3WUDA 1NA1A 4J5IA 1OTJA 2WSVA 3PVNA 1N1YA 4XFHA 1NQJA 1UU6A 3WG3A 1KS4A 4RL7A 5C8CC 5L19A 5FBZA 3PJYA 3IDBB 4YZ1A 1TMF3 2E7TA 3VHPA 1XNBA 3V17A 3JCIA 4CEYB 4PQ9A 3U4XA 3AP4A 2RS32 4FPCA 2P2KA 1LOEA 4JGZA 3ZXAC 4AG4A 1AYM2 4FPJA 3KMHA 5GM0A 3H1YA 1C28A 3POWA 4BGKA 1ZREA 2VW1A 4QD2A 2RS51 1MS8A 2GMEA 3GBFA 1QJU2 4CDQC 4BHF