2YDEA

Factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
b'MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
molecule tags Oxidoreductase
source organism Homo sapiens
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
total genus 107
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ydeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ydeA01
1IZ3A 5JWPA 3D8CA 3P3NA 1H2MA 2WA3A 4AI8A 1MZEA 4QU2A 4B7EA 4B7KA 4BIOA 2YDEA 1MZFA 2CGNA 2W0XA 4JAAA 2CGOA 4NR1A 2WA4A 3KCXA 3OD4A 2Y0IA 1H2LA 3KCYA 1YCIA 1H2KA 4Z2WA 2ILMA 4Z1VA 2XUMA 1H2NA 3P3PA 2YC0A
chains in the Genus database with same CATH superfamily
1H4HA 3W5NA 4AQYO 4I01A 2GALA 1H4GA 2E6VA 1GNYA 4XDKA 1EN5A 1M1KW 5FL7G 3TBDA 3J26N 3W5MA 4YPJA 1CESA 4FXKB 2ZGUA 4AQ2A 3H9VA 2UY8A 1R3KC 3TEXA 3WP3A 3RZLA 2D43A 3O1RA 5CFCC 4RQPB 3JAMN 5EIYB 1AR83 3ETQA 2ARBA 5EYYA 2WT1A 4OHZA 5BNNA 5IVVA 1SBDA 1WMFA 2VBDA 1GOGA 2BDRA 4I3GA 1S1AA 1PK6B 2XB6C 4HVQA 4K3AA 3JU9A 3K5NA 1FFXB 1KD1W 3VBFC 4A7KA 3STLC 4MGKE 2PHDA 1PZ7A 2D93A 3O1PA 3RYIB 4AVBA 3SGIA 2YROA 1J84A 4NPLA 1EPWA 4IV3B 3F5TA 1FPN3 3NO8A 3VDDC 4PBOA 5A2QN 1CAWA 1X4TA 5IWFA 1S2EA 1HB1A 3CJIA 4KFMA 1Y9QA 3GBFA 4J6GA 1JYIA 5BY1A 4OPAA 4BA6A 2QE7G 2EXIA 1JH5A 3W7SA 2OUHA 5DPNA 3H1IH 2XKPA 2IXKA 1LHNA 3JSLA 1RM1B 4RL7A 4ZONA 3DGEA 4TYSA 2YXHA 3UQ8A 4MXVA 3Q8AA 4O9EA 2K9PA 1OD5A 4GXLA 4HL0A 4AHXA 1QNWA 4W4LA 3BN6A 5IYBO 3JCIA 2CV6A 5LZ6A 3K3WA 4H3WA 3D82A 4XDQA 3ZHRA 3AMMA 3OEBA 3E22A 3RYCB 4X8PA 5D8AC 3AL5A 1FXZA 5ACA2 1PMHX 3APQA 2BVBA 1R092 3KT7A 4QDRA 4WBBA 2DOSA 4XW3A 4PDWA 3BU0A 1AL22 4KMQA 4CVUA 2HHHO 5FK7A 5BNPB 2GTSA 5K7PA 3W59A 2F4LA 4DK1A 2AENA 5L19A 3JAWA 3ZFEA 3MW3A 2SLIA 5LA6B 4FOYA 1SACA 1OOPC 2IZWA 4TV8B 4E2LA 1GOFA 4JKMA 5F3EA 3W7XA 3K2OA 3SH5A 3WNXA 3OMAB 1XXNA 3HD8B 1NCQB 3HQXA 3RI8A 3DC5A 4WFBV 4OGQB 4YZ3A 2ATKC 4CXXA 4Q8KA 2CAVA 1NVPB 2ZXWB 3E6BA 4BE3A 4LNUA 2X6CA 3MIBA 3K03A 1W6NA 1M90W 4LBLA 5BV6A 3K04A 1LOBA 4IEPA 3FB8C 2P3YA 1SQBH 1XNAA 3OJBA 3I54A 1GTOA 3RN4A 1O5LA 1Q6IA 5J37A 5HCHA 1D0HA 4I3PA 1BHAA 3T30A 1XBLA 2XWJB 4ZIBA 5I93A 4K7JA 2D3RA 4ES8A 3VZOA 1YWKA 2L6LA 3N2GB 1RITA 3S30A 4Q0VA 4A41A 4PQ9A 2ZGTA 5C9AC 3P6BA 1VPHA 2ZXWC 4NUBA 2RMU2 1AB3A 2AR6A 3BKZA 4ZZ5A 2X29A 1RUC3 4AEMA 3VKFC 1DGWA 1J5EO 3CBNA 3NKTA 1UZVA 1MOFA 1ZUQA 4WBNB 3VBOC 3HMYA 2R9IA 5ABJB 2PI5A 1Q56A 4HZFA 4L0PA 4B3TB 2WO7A 3OAAG 1UOGA 5FYIA 1RUJ1 3CXHF 4WF9V 5A1AA 2WUHA 1N34B 4X1KB 2BNOA 3O1MA 3WX5A 1VMFA 1MMMA 5FZDA 4JYCA 3K75B 1ROPA 5FZBA 1ZZ9A 1O59A 2R0FA 2GH2A 4L11A 3VDDB 5J09A 4NPRA 5FZKA 1HKDA 3FHIB 2E51A 3BAAA 2P34A 4JC1A 2EX3A 5DAXA 2FDJA 1KMIZ 4XVHA 2VMEA 4YZ2A 1VQPV 1RUOA 1DBNA 4WVVA 2WAAA 1BEV3 5A70A 1JYCA 3PTRB 1PK6C 3FX7A 2ZGMA 1CJPA 1JX9A 4QKBA 1JU4A 4LF6O 3P30A 4JX0A 1RUD1 5DM6V 5E8AA 5KBFA 4H7MA 2UXNA 3A2FA 1IBLB 4JI6B 1NLQA 1YVWA 2ZGQA 3DKWA 3SLIA 3H3UA 3LA3A 4JCKA 4CC6A 4V2WA 4AQ6A 2QQKA 3UKTA 5G04L 4JTCB 1MQTB 2CL2A 2IXIA 2AREA 2RJ2A 4MGTA 2QKAA 2LW7A 1GN3A 4GIQA 3MZHA 2FYUH 5I91A 3A21A 2HYKA 4CCNA 1TMF3 2YC0A 1TME2 4MZUA 5CISA 5L3GA 5FZAA 2K1EA 1DLBA 3HKEA 4JAAA 4QD2A 3CLPA 1XC6A 1P7BA 2BEOA 4XZUG 4IEWA 4F8AA 2P3JA 1S55A 1FJGO 4LHSA 4J10A 2BZDA 1ND3C 1WPXA 1JZ8A 1VF5B 5CFDA 2MK3A 1JOYA 5JLVA 4U36A 1YRZA 4RD7A 4AYUA 5IYYA 5FZMA 1H9PA 3JARA 1FPOA 3VZNA 1URFA 2QZ2A 1WAZA 1X8EA 3ZXLA 1JZ3A 4ZS3A 3HKCB 2ES3A 1P4RA 2G9ZA 1MS9A 3E83A 1IS4A 2PYJA 1VBC1 4E2QA 3E97A 3ENRA 1WCSA 1GKBA 3T2TA 4QPWA 4FPHA 5LYJB 3ZKYA 1QLEB 1JZ2A 2VQFB 2JDNA 3LSEA 2C9AA 2JK5C 3MIDA 4PCRA 4QWNA 4NE9A 3M70A 1XHZA 1N1SA 5FOJB 4AI0A 2R9AA 3IZOA 1ZZ7A 5LA2A 4NHKA 2BTQA 5AVPA 1K3EA 4DNYA 5EZWA 1V6KA 5D2AA 3QCWA 2JXAA 2CAUA 3WQBA 4LUKA 5IE9A 1CAVB 4ZHQB 4NAMA 2ZZJA 4FPOB 4YM3A 1IQDC 4AHWA 4FVVA 1JMKC 1ENXA 1ZM1A 1H8TB 5F6LB 2VPVA 1AYM2 1URXA 3KCYA 4RGAA 3S7EA 3HT1A 3K08A 1CAUA 4IETA 4NTXA 1DIWA 3ASNB 4NN0A 1R082 5C3RA 4WV8A 4UCVA 4EQVA 2RQ6A 3BUCA 3BRCA 5KR7A 2NP0A 4GX2A 1SPPA 5K1XA 3PUQA 4X8AA 3C7GA 2X6AA 2J7MA 1HNWB 2QEXV 3LSUA 4Y20B 3H3LA 2EVXA 2OPKA 3WP5A 3RW0A 4O2BB 2H6CA 4OQ8A 3ACIA 1HW7A 2KSDA 1YLLA 3T2MA 3H1HH 5ANNA 4D8MA 5T5LA 4XFBA 4DV3O 3OUJA 2OTLV 2DVDA 1W0KG 1PNFA 3VBRC 3LSQA 3VQYA 4C0BA 1UIKA 5M0TA 4X6RB 5I8SA 5FZ3A 4R52A 1GP4A 2NMNA 5DZEA 4EB6A 1HXS2 1JW6A 5JXIA 4M3CE 5CU1A 2WNVA 1NH2B 2WSUA 1NOVA 1JA8A 1ZNPA 2RV9A 4QPIA 5KX5B 4B4QA 1UJWB 1JUHA 1Q6HA 4FVMA 1QXJA 3VBHC 2Z4FA 3IC7A 4KU8A 1UL9A 1SEFA 2CGPA 4Y1ZA 4LBJA 2JE8A 4NXNB 1OC1A 4PV1B 4OI0A 1YJLA 4LA2A 4N43C 1L0LH 3VBSC 5IVJA 3MBWA 3WF4A 2XAGA 1T6GC 3E5QA 4N7IA 4ARYA 3SPJA 4P9WA 3WU2Z 1DQ6A 4BZ4A 2OT5A 4Q2FA 4EZ4A 1VBB2 3THCA 1XNCA 2VMDA 2QR4A 2IW5A 1XU2A 5LASA 5J2UB 2EALA 1JOBA 2FZ2A 1FXVA 4QJFB 1GP6A 4JI3B 3UGHA 4C8DA 5IATA 3Q4HA 4K8ZA 3CZUA 2VMIA 2X8KA 5FMOL 1WBLA 4CP0A 3LIGA 1NG0A 2D6LX 2ZEWA 1DQ5A 3ZSLA 4IEYA 5L3BA 1WLEA 4RQPA 3T1HO 1Z5VA 2DWDC 4Y3OA 4O2AB 4FK5C 4GH4C 2XVLA 4LTAA 5GW7A 3D36C 5KXBA 1BCCH 2UURA 1J58A 5IJ0A 4XACA 2ZCWA 4YYOA 4BQ4A 4WM8C 3LWCA 3DF0A 1OCRB 4U7NA 1M57B 2OT7A 5J98B 4KGGA 1S5JA 1DP0A 2Y4UA 2DYSC 1N4CA 3KWVA 4QKNA 3JYCA 1Y9GA 4GKYA 4D69A 1XYPA 1ASJ1 2HJFC 2JG9A 3RWRD 1VEWA 2W47A 5KHKA 4F3JA 1BLZA 1TMF2 4DV4B 2W39A 3NL1A 1XHXA 1U5IA 4P5HA 5GLZA 4UOJA 3KQRA 1DYOA 1W3XA 2XGXA 4ZHNA 3EXAA 1EFRG 5FZ8A 3P32A 2QQIA 2FTKA 3AG7A 4BIZA 2B9UA 4ZXKA 3DYOA 4LE3A 5ITZA 3A0KA 3C90A 3VBSB 4N43B 4OUMA 4JV5O 1XDCA 1LHUA 1S77D 4DRXB 3EXUA 2ZE7A 2VQTA 3OT7A 1SQVH 4NHMA 1NU1H 1Q6UA 2WLLB 1WN7A 1AL21 1XSRA 3IDEA 2JGDB 1QJEA 2P4KA 4RSUA 3B8MA 1XNDA 1UQXA 5FO9B 3FBMA 1VF7A 3F5WC 3CP1A 3SYQA 1NCRC 4AK3A 4CDQB 5JOXA 5DQ0A 1WKYA 5CKMA 1RMU2 4DR5B 3ES4A 4M0NA 5L7OC 3O12A 1HN0A 4A5UB 2A3QA 2EIMC 1VQ8V 4LFCO 3JAWB 5DEDA 4CRQA 5E6HA 4LNVA 3N27A 4YM1A 4PLNA 4FPEA 1MS8A 4AGVA 1SS3A 1M4UA 3PURA 4LFBO 1HXS3 3ON7A 4RFT0 4E2GA 3ML0A 4Q4X1 4XJZA 1JHNA 5LBEA 3FD9A 1VAMA 2VMGA 4PDLA 1NA1B 4RR3B 4IGGA 4MVSA 4WM7B 1S0BA 1EAH3 2HKXA 2BYVE 2WC2A 3BALA 3ASNC 1GZWB 1YI7A 1OCOB 4NRPA 5LMNO 2RS33 4BIOA 3CU7A 2CK3G 5EYXA 4YLZA 5IK7A 4G2KA 2NZ9A 1N47A 3K59A 4PHZA 3OMIB 4NHXA 2EJRA 1XBFA 1VQNV 3AKRA 4G28B 1AR71 3FAVB 4C1XA 2DURA 1NAEA 2WS92 3C7OA 2B9VA 1K92A 2WAOA 1LOFC 4DUXA 2E63A 1CD3G 4YGEA 3AK0A 4FOVA 2NQYA 2UY9A 2W94A 1RTVA 3SDLA 1WCKA 2D6NA 4TWKA 3WY6A 2WWJA 5BPXA 5FP9A 1NQJA 4X89A 3L71H 2JRIA 2FDIA 4NKGB 1IG3A 4AR2A 1UZWA 2PHRA 3TGUH 5FY1A 5FMCA 4NXNO 1C8M1 2RE9A 1PKXA 1SQGA 3T08A 3T09A 2HBTA 2XJUA 2JEXA 1W6MA 1GLHA 1DZRA 2V4AA 5GALA 1M9NA 4LITA 4XDPA 2KKWA 2AW9A 1PP9H 4KUMA 4I4TA 1G6NA 1EYBA 1W8FA 3K79A 1LHOA 3ZIXA 3WT3A 2TNFA 1UFIA 2QKDA 2P17A 1TUBA 2BNNA 5J3UA 4P9YA 2ZABA 2RN9A 1RUD2 3OGJA 4LIUA 2XQXA 2MW2B 1SCRA 1NXD1 3POYA 4PIYA 5E1AC 2R062 3W58A 2JG8A 5FKCA 1RUI1 3ROUA 3KS7A 2LP7A 4DB5A 3U1XA 4OUEA 1GMMA 4MGZE 3IJ4A 4JI2O 5D5PA 2GUZA 1K73W 4FCAA 3P5BA 3T0BA 5FZGA 3VD3A 3LFIA 2ZEYA 3JZVA 3JALA 2YEVA 2HP8A 2BUKA 2X7RB 5FZIA 2MEV2 1MQTA 2ARCA 4MO3M 4QT6A 3SXWA 1Q8OA 5DAVA 3QD6A 4BQWA 2GC2A 4X1IA 1IGOA 3UJOA 1MSDA 4J42A 4CEYC 1XU1A 4ASLA 1TEIA 5EHDA 4CYDA 4J7KA 2JDIG 5T5OA 5B2GB 5LP6B 1AROP 1XMOO 4MHUA 2UXDO 3NJZA 2ZT9B 2QQMA 4WM7C 1G4YB 2Q73A 1HW5A 3U11A 1NA1C 3KVAA 3O5SA 2R1DA 3OUSA 3EB7A 4QGPA 2VXRA 3B09A 1XUQA 1Y43B 1PNLA 4Q4X2 1US2A 1NLSA 1NTZH 2EIKC 2VU9A 1Z7S1 4KI5M 4YWAA 5B3SB 2O57A 5FREA 2CE4A 2GNMA 2V5YA 5H9SA 5H9CA 2IXHA 5JOZA 5JVVA 3ZR5A 1SLTA 2CGNA 4XF3A 3B7MA 4XUPA 1CONA 5FPOA 5HBAA 1OLRA 2ETNA 3OBRA 4DO0A 3MHSC 3MIGA 3OYWA 3NJVA 4R9DA 3FHQA 4OMDA 1YQ8A 4MTGA 5KXDA 3ST7A 1LB2A 4K8RB 2P4EA 1RINA 3F7YC 5J96B 3IWZA 3UK9A 3SEPA 3ZFGA 1S4CA 2IBZH 3OGIB 5AFBA 2YB7A 4LJHA 3FLTA 4TQFA 1QWRA 5F2SA 4CUGA 4E8DA 2M7WA 1C3HA 3STZC 4Y33A 4F83A 5H9QA 2C5DA 4HPKA 1HWYA 3H1JH 2CH7B 3N35A 2JD4A 1AP6A 1C1LA 3G6BA 4FTEA 1YXBA 3ILFA 4LCUC 4AL9A 2GH8A 2PHWA 2JB4A 1VQ6V 4FPYA 1UU6A 5FYHA 4Y1XA 1C4RA 3VL8A 4X65B 4OHVA 3QTCA 3VBUA 3OCPA 4QQPA 4MUVA 3J7MA 3LOIA 2ZMLA 4DV6O 1QLEC 3MIHA 1REDA 1MZ6A 5LEJA 1FPN1 4FM1A 3NJXA 3ZR6A 5DAQA 5KA5A 1EAH2 1WP7A 1NCRA 4KBBA 3ASOB 5F6KA 4JDOA 4FFBB 1VR3A 1LRHA 1O5UA 4CPBD 3FFZA 1JYTA 2UU9O 3POJA 4D7SA 4HONA 5A7OA 4HFSA 2C2AA 1DFQA 4CUCA 4BR6A 4UFMA 3KQ4B 2H0VA 4JYAO 4UF0A 4CS3A 4EB6B 2RHPA 3AYEA 4DXSA 1KS5A 2DVGA 3AK1A 3MD0A 1SERA 4FTSA 3B3QE 1MACA 4JZGA 2ZE8A 1AVMA 2Q8CA 5JXGA 5J7MA 5IY5B 4COVA 3FWEA 2JE9A 4AG4A 4DIQA 2FKXA 1OURA 1MS1A 2W08A 5FYTA 1XB9A 5D5QA 1R093 5JH7B 2VUDA 4C0HA 1KFXL 4XBFA 2DVBA 1QQP2 2BGPA 4XTMA 4JV5B 5JR2A 5J48A 3E89A 2BNMA 1CP9A 1IBLO 2D40A 5BZBA 4XBQA 2W3JA 2ZGOA 3OUIA 3T1LA 1ZA7A 4PI0A 4XF4A 4XCAA 2AGAA 1S72V 2WWSA 3FBYA 2UXBB 2PXJA 4UFKA 3HJRA 3Q4HB 3ATGA 2YV8A 3O1SA 4KHPB 4B4PA 4XFHA 3L2HA 4YW2A 4XJAA 2XASA 2JIZG 1T2XA 4F6RA 3D36A 3O0VA 4B29A 4WVZA 1DGWX 2B5HA 1W06A 1A3KA 5JPMB 4AQSA 1S0JA 3IMNA 4XJ9A 4MX3A 2PHTA 3I2IA 4IEUA 3ZN6A 2WBKA 4NO4A 5KMGA 3INAA 1RFYA 5A7NA 1AR1B 1WUVA 1IPSA 3SKJE 3JD0A 2PGGA 1L7QA 4U3JB 4LHLA 4Q1RA 3UM7A 1DF5A 3PUAA 3K57A 1J5EB 3SYAA 4PELA 4TSFG 2ZMKA 1APNA 4NIGA 3WCRA 3TRSB 5HCFA 1RIRA 3VLBB 3KHCA 1XE7A 1FNZA 3J7HA 1YXWA 4HKWA 4YIPA 4K8FA 1LOGA 2IXCA 1AR4A 3WW2A 4XQWA 5AC93 4DR4B 1OJHA 3H9AA 1Q3EA 4S2HA 2YYOA 1H1AA 4DXZA 2WN3A 1R1A3 3UJQA 5C4WC 2P67A 1RUI3 3SHRA 5FXVA 3CC2V 3JBG1 2WNVC 2H6BA 4KNCA 3O0WA 2OPWA 2ARXA 1WJZA 2K9ZA 3NWKA 3AK3A 4P02B 3WF2A 4BAYA 1CZSA 3M2MA 3BCCH 1S0GA 5FYSA 3ZHTA 1GM9A 3BCWA 3UCSC 5J2TB 5C33A 1E5SA 5DZGA 4Z8BA 1YCIA 1RJ8A 2AH2A 5IVYA 5BNPC 5FPLA 2VY0A 5EPAA 4HXCA 1EN4A 5JVDA 1Q8SA 5LY1A 1UOBA 3MI8A 2A79B 2ZDIC 1GRJA 4XOGA 3ZDVA 5FJHA 1W2OA 4LORA 2WNUB 1D2DA 4HAMA 4S2GA 5FLIA 4BQYA 1POV3 3BTAA 2ZX4A 3HEIA 4GWJA 4RQFA 4J7ZA 3MYXA 2FDKA 3UESA 3K58A 2BOIA 4OI1A 1AR61 4Y4RA 2QE3A 4O4JB 4Q4X3 4PDVA 2VWKA 5FMOS 1OCOC 4RR3A 2QSAA 5A80A 1VBA1 3PVOA 1XL6A 2B9ZA 1AR72 1W9FA 4IGOA 4WVWA 3CCUV 4N8MA 4Z07A 2ZIMA 1C8M3 1H8HG 4RS5A 4TV9A 3QG5A 5LK5A 2EF6A 1I5ZA 5C8YB 4I30A 1N3OA 3CCQV 3TYJA 3RG0A 1K5QA 1XNKA 3DV8A 1K42A 2GTAA 2Q5ZA 4AI9A 1Y74A 5CN0A 3E5UA 1RM1C 5A7WA 4XUTA 3ZYHA 1B35B 1IOAA 2J1SA 2WZPP 2W2IA 1YTFB 3URFA 4YIOA 2Q69A 4FAGA 3DXRB 2XLGA 2XAJA 1K4CC 3NV1A 4DR2O 1ZL8B 4NIAA 4X8NA 2WLKA 1AYM3 2ZJCA 1TNFA 4BJ0A 4PDRA 2CTVA 5J9PC 3OGSA 2LGWA 5IYDO 1RUD3 4LF4O 3LE0A 4NIHA 2Y33A 4XFCA 3VZKA 1MZ5A 2P5BA 4Q4V3 5I0RA 4MSWC 3KV4A 4QHOA 4CCLA 1GSLA 1ASJ3 4YFZA 1XYNA 3RFRA 3OY8B 3SPCA 1NBMG 3WD5A 3OF1A 4NMIA 1TUBB 4UV9A 2C0ZA 5BMVA 3DYPA 1UZYA 3WNNA 4KWUA 2Q7GA 1WB7A 3BFRA 2YY1A 3TXSA 3OB8A 1QU0A 5C3SA 1IVSA 2RJKA 1W9SA 1AX0A 3DSQA 1E1RG 1SQXH 3ETGA 1DDLA 1T6BX 3RMXA 1VBA3 1V6NA 2CWMA 1WA8A 2GUZB 4Q6GA 5CBGA 3DEMA 2EINC 1RVF1 2RR12 4XILA 4HG6B 2RS52 3OGVA 1XNQO 1PK6A 3AP7A 3C3VA 1Q86W 4LLFA 4QX7A 5CKQA 1FFXA 4IE5A 3VZLA 5EZYA 2VWJA 3T2PA 2YXLA 2VZ3A 1E5HA 1GQPA 3IDAA 3NW4A 1W28A 5FY0A 4PA9A 3NNGA 4DV3B 1C28A 2F17A 4I55B 1N1VA 3HNMA 3HBKA 4PF5A 4JI5O 4MVMA 1NQDA 3DC6A 1MEC3 4RS5C 1VQMV 4OXSA 3MF6A 1NCQC 4Q0SA 3T1MA 1NE6A 4ZXEA 2VZVA 3T2OA 5LGTA 1VQ5V 4PA4A 3ZHQA 2DCKA 3E86A 2WQ4A 5KA6A 2CAZC 1ULFA 3HNBM 2ZGLA 3H1MA 4FP3A 3CCSV 3TN91 4JI0B 1CVNA 3JBG3 1QIQA 2CDPA 2BSKA 5C9AA 4LFAB 4BIFA 3MDPA 1O9GA 4DUZB 3VV1A 2RVAA 3JQWA 4IQPA 2XLFA 3SJQC 1UIJA 3AZWA 2R7EB 3MV01 1OSGA 3MPPG 2Q1ZB 4HANA 4BCUA 2QQJA 2XOMA 2UUAO 2DFBA 3ZMZA 2PA7A 1TA8A 3ZEDA 1CX1A 4IL6Z 1XJAA 3A0NA 4XFAA 3GDBA 1EV12 3ALQA 3IT8A 1PIV2 3PVEA 1H1IA 3IMMA 3JCZA 3I59A 3POWA 4NR1A 3T3YA 5BNPA 4MTXA 4RHV2 4Y1VA 1O6UA 2E3CA 4CDWA 4V2VA 3HN3A 4X20A 2QQPA 2X6BA 4TV8A 3HKDB 4GWMA 2OX0A 4CBCA 2E31A 5HV0A 3EFFK 4EN8B 5A3UA 1PVXA 4IIJA 4META 3MHZA 4LE4A 2Y0PA 3UO3A 2R061 1ULPA 2V73A 4TLGA 2IJIA 2QM8A 1KJLA 1I1EA 3ECQA 1ZAUA 3LOBA 5A1FA 3J81N 5KWRA 3CMGA 4PDWC 2E5LO 1KD7A 3PJQA 1UYZA 3USSA 1LCLA 3S57A 5D8AA 4YW7A 4FLXA 2YIBD 4L97A 5IFPA 3N7MA 1KXGA 3N2GA 4DR3O 4I50A 1SF9A 1HQNA 2D3PA 2XMLA 1AI7A 2B4KA 1BE3H 4LC1A 4ZBMA 4JTAB 2N05A 1L3JA 5JXHA 2F95B 4YY3B 5B1AB 4GB33 1PM4A 4OHXA 2VCCA 3P3PA 4ZS2A 2CSGA 3I4IA 5LK7B 1FMD3 1AXZA 5DUVA 2ADPA 3CRRA 4JI4O 5LBQA 4PI2A 4G9SB 4WBNA 1DGLA 3S6PA 1J1TA 3CJHB 4HNAB 3ITQA 4BXSV 1CAWB 5AC92 2O8OA 4JI7O 1UX7A 3WCSA 1KFUL 1X59A 2PY5A 1WD3A 1CN1A 4DPNA 5CMUA 2OKXA 2IVIB 1UYYA 4LULA 3WEZA 4JKLA 3O1VA 1G8MA 1RYYA 1GN6A 5BNOB 4CDUA 3KKYA 3KGZA 5C4WB 2VH9A 5FLXN 4BK5A 3MEPA 2ORZA 3ZJZA 3VDDA 1JZ5A 2FDGA 3RVYA 3CNAA 1BKZA 3G4SV 2DYSB 4MH0E 3OW2U 3U4SA 2VQEO 1EM1A 3LUTB 1ONAA 5FLJA 5B1AC 4DO2A 1JJ2U 3NV3A 1NR7A 3BIEA 4FLWA 1PGW1 3ILNA 4E8CA 3V64A 2P90A 5EQUA 1WLTA 2QJVA 2PELA 2QZ3A 1O3QA 1Y3TA 4YY3O 1JU3A 3UO2A 3CDZB 4I9QA 4DV1B 1PZ8A 2OYZA 1PPJH 2ZIOA 2AACA 1B35C 1DZTA 2CTWA 5I0DA 5T52A 2XXZA 4PDWB 1VP6A 4R9AA 1UY1A 2QM4A 2PAEA 2P06A 4PQQA 1F4NA 4DXRA 2HWD2 5IAXA 4FP2A 3A7QA 3ZFEB 1US6A 1EZJA 4Z1VA 3O7OA 1HNWO 3DTUB 4DRVA 3AMPA 3ZKUA 2BGCA 1FMD2 3RZKA 4B7KA 3ZYGA 3CCVV 3M8AA 4LF5O 1BHBA 3K51A 2TUNA 1F5JA 5IW0A 1AXYA 4R4ZA 2Q8OA 3RYHA 4GB32 1GYKA 2WLIA 1XREA 4YHHB 2Z2SB 4XHBA 2ATFA 2BFUS 3AP6A 2ARHA 2CDOA 2PHLA 3VBUC 1H2MA 2BJSA 1A6CA 3L75H 5F3CA 2WZEA 4EROA 5KLVH 2ZOEB 2H3OA 4FFKA 3WDTA 4ZU5A 4D6QA 4MW3A 4JRLA 2R72A 2DMXA 4JI6O 1U97A 1QNMA 1Z7S3 3H8OA 5IJ9B 1Z5WA 1KKDA 3CCLV 5IY5C 1N3PA 4JV4A 3WF1A 1SA0A 1K5MB 3ZDSA 3CWBH 2VOXA 3CL1A 4ET7A 5K0UC 2EULA 4JI0O 3NAPC 5EYPA 2Q4SA 1NKGA 2VZSA 4K3UA 5H6RA 4EWEA 3C7HA 1FOD2 3KF5A 1EY2A 5F39A 3ZFGC 2C24A 4OUSA 1RUE2 4A44A 3BY6A 2WO2A 3M4FA 5H2FZ 5FY7A 2D3SA 1MS4A 2R16A 3LDCA 5DMYA 1YFUA 2NN4A 5FYCA 1RUJ2 2GMEA 1WBFA 5FYVA 4RA0A 2FCTA 2JS3A 2ZNIA 3CMAV 1ACCA 3A0RA 4E4EA 1KJRA 3CZJA 5FY8A 5FZCA 4M01A 5F5QA 4NXMB 1QR9A 2R063 3AKSA 2R70A 2YBSA 3CCJV 1ND2C 1NX9A 1L0NH 3OD0A 4YARA 1WZXA 3GZTB 1JN2P 1Y76B 5GLUA 1SPPB 1ZBE3 4QB2A 4RS5B 3R05A 2OQ6A 4FMTA 5C8YA 5EBWC 3VDCA 1CJDA 4LO7A 5IK4A 2ZXQA 2FL4A 3IM0A 1W0OA 4CEYA 3RJRA 3I55V 2ZAAA 1U5YA 3S3XA 1Y74B 5A7WB 2QBXA 5J36A 1BXHA 4Q4W3 4YVSB 3PL0A 4DR1B 1RSOB 4CA9A 4DR4O 2WNVB 2WQZC 1KC8W 1YQ6A 3ZMTA 2ETEA 3WF0A 4XBLA 4NB5A 4A2UA 5GLTA 2UXBO 5EJZB 3RZJA 5LBCA 4Z2AA 3PMEA 3RPQA 5F3GA 3WHTA 4UXNA 4MT8A 2YFZA 4WFEA 1GH6A 3WG1A 4X1YA 3AL6A 4K8XA 1F4AA 2VQ0A 5C8WA 3MV11 4YZ4A 2RS53 4OMCA 3KVBA 3OGGA 4GMP3 4FFIA 2MHFA 4XC9A 2IVJA 4E27A 3LSSA 1HDJA 1J95A 1XL4A 1IBKO 5JJJB 3HKCA 1VAVA 5BXXA 2N7GA 2XJQA 2HLEA 1H30A 2VBBA 2ILMA 1VQ9V 5LBFA 1SQQH 1R6KA 1WCQA 2GMPA 3WHUA 5BUVA 1BQZA 2XDVA 4K0KO 1UY3A 3WUDA 2DUPA 1PM9A 4JAUA 2PN5A 2UU9B 4AAPA 2QDNA 2NLRA 5I0SA 3LAGA 4YGBA 5B4XA 1VRH1 4N53B 1SG3A 4KH9A 2Q8DA 3UGFA 3ABMC 1V54C 1VB2A 5EJ3A 1HR0O 1EZVH 1CAVA 3CYOA 3SH4A 3EVKA 1V6JA 1I7FA 4H0LB 5IWAO 1I6XA 4FO9A 4QKFA 3O65A 2ENRA 1YITV 2Q8EA 4I55A 1QJFA 2LQTA 4GQ7A 4LBEC 4YSFA 3CRMA 1H8TC 2B46X 2Q1FA 5FDBA 2AXTZ 1W2TA 4PDMA 1SQ4A 1MZEA 1G7YA 1H6YA 4DR3B 4QX5A 4EZHA 3J9SA 3FLPA 1WA4A 1NE4A 2D6PA 2W9XA 3ZN4A 1JYNA 3ZHVA 1Y67A 2WO1A 4FPKA 1JTZX 5L3FA 1WW5A 1E5RA 2W6IG 2XT9A 4DS0A 3C8XA 2Q7EA 5C9AB 4XXAA 3GM8A 2UWAA 2YU2A 1VRH3 5FNVA 4C91A 2Y6HA 1R1A2 4CP2A 4L8QA 3TAYA 1UY2A 3WINE 2ZTNA 4AVCA 1HV1A 2XR4A 2XWBB 1QJX1 3O14A 1DG6A 1KRIA 2RMKB 3NAPB 3NNLA 1XSQA 1V9PA 2GNDA 1IBKB 5KX5A 5JSPA 3MIFA 1M4WA 1AYM1 1GFF2 2EA7A 2NM1A 3HKDA 1A8DA 5IJRA 1TME3 5DG2A 3E35A 5FPXA 2PLV3 4I0XA 3K5MA 1IZ3A 4BXFA 2ZHKA 5LOVA 5JJEB 2N74A 3JD2A 3I2JA 3FB5C 1ALYA 4FBFA 4XJUA 1YEWA 2EIKB 5A3LA 3DGTA 5LW9A 2X53S 1K97A 1JZ4A 3KHBA 2C1FA 3SCFA 1NT0A 3ZMVA 3UKNA 5H9PA 1N36B 2DCYA 1YNAA 3ABLC 4Q5OA 4QGLA 5T5PA 4IEXA 3TN92 2A3XA 3K9SA 2ZE5A 4BHPA 4P00B 3ZFFA 2Y64A 1Q7YW 3MPBA 1AL23 4COWA 4K20A 1OHHG 3GWOA 5JZGB 4OZOA 5T50A 4B3MO 1JMUB 2YS8A 1S0CA 4NWWA 4I50B 4XTPA 3ZYJB 1OBNA 2D6OX 3VL9A 1W8ZA 4B3RB 2G9GA 4W8JA 1RXFA 4MLOA 5F8PA 2WLQA 1RC6A 2AZ2A 2JIJA 4WZCA 2ERFA 4GH4A 1SZXA 1VQKV 1QY4A 1UAIA 4J41A 1UPSA 4W6WA 2VZ1A 1DF0A 1SFPA 2BPA2 2EIEA 1GR3A 5FUPA 1V55B 1HLCA 1R1ZA 4IXLA 4LFBB 2ZD9A 4CDXA 4FFFA 3QH6A 5JQGA 3USUA 2WT2A 1PNMA 3ZPOA 2EIGA 1PVC2 2BWAA 3K9AA 1BBT2 1UKGA 2W0FC 1VP7A 4BU2A 4B3NA 2YICA 1PX4A 2WFPA 4JI7B 2E9QA 3IC9A 3SPHA 3I2KA 1X33A 2ADEA 3VBOB 4LPLA 4BB3A 4I0AA 3QH7A 2ZGSA 3AG4C 2WSVA 3ES1A 3CC7V 2DWRA 5ANQA 3VBSA 1N3QA 4N43A 4FPPA 1S0VA 3N36A 4DUWA 1B09A 1ODMA 1D4M2 1RUH3 4XDJA 3FFQA 3VBHA 1MVQA 3LPGA 2JIGA 3IPVA 5FPAA 1QJZA 2QTOA 4CC5A 2QQLA 3SEEA 2VOKA 3GCWA 1X8MA 4RHV1 3NQHA 2DQ3A 1UZ0A 5CAZA 1DQ2A 2WSSG 1U5ZA 1VMHA 4X65O 5A33B 1ENRA 2QDOA 2C6SA 3O1OA 4BQ3A 1S0FA 3KCXA 1VQLV 1E79G 3TETA 4C90A 4E4DX 3IDBB 3PLQA 2VCBA 5LMNB 2WRAA 2KXLA 2CWSA 1TVGA 3U10A 3ZFFC 4Q4V1 3LFMA 3A0BZ 4JZRA 3V56A 2B42B 3NV2A 1BSMA 2EIBA 1LR1A 4U2AA 2Q9LA 1UU5A 4UFZA 3ZRVA 2Z5WA 1RP3B 2WLIB 4X64O 4XPVA 2GP3A 1SZBA 1GQGA 1Q8PA 4TT3G 4LO6B 2A06H 1GZWA 1KDMA 5C3OA 4O4IA 3FUOA 4UFJA 4DY5A 3M99B 4FI9A 4D6TH 4UW5A 3U14A 1CXZB 2JX9A 1P84F 1R73A 2PHXA 4SLIA 4QU2A 3FAVA 1K33A 3DXUA 1ZTEA 1W6QA 4LWSB 1XEQA 3AM2A 2ZPXA 1C5IA 4DV2O 5IJ9A 1OA3A 5E89A 1XQNA 2WPDG 3IN9A 4M4RA 1ZVFA 2QTSA 2LJ2A 1AILA 1YI9A 2DCTA 4MSVA 1PHMA 2AGSA 2JDPA 3AK2A 1JFFB 2EXJA 5EYPB 1NQTA 2JDAA 2ZBJA 3L72H 3E8FA 3VN4A 3TN93 3ZBHA 4PIZA 1BJQA 4MGYE 2CYFA 2D98A 3AYAA 4CE8A 3OOXA 3PIJA 1YIPA 3HR9A 3QNEA 4WZFA 4ASKA 2PQQA 1X9TA 3AVSA 2EILB 4JRAA 2F4PA 1T5EA 2PFWA 1H8EG 2UXXA 3LEIA 3ORJA 3AG2C 4QHZA 1MEC1 1JQ0A 2CH7A 2Y4TA 2VD7A 3THDA 1WP8A 5A3WA 4XBNA 1HNZB 3POFA 2Q6AA 1E1QG 3T1YO 4R7CA 1NS1A 3H01A 3WUCA 3KLSA 3ZRSA 2J1AA 4A6SA 2WO3A 3VBUB 1AF9A 2VOTA 1OXCA 3A8TA 4OYUA 3KM5A 1FFTB 3JB8A 5CA1B 4INDA 2V7QG 3D0SA 2UYBA 3T1CA 4UFIA 5L9VA 1COV1 4XAAA 3NXSA 1THZA 1I5PA 1SQFA 1UW8A 1HR0B 1Y66A 3FC0A 4IYHA 1VJ2A 4YW3A 3ETEA 3J8F2 2UWBA 4QMAA 3WQ7A 4KU7A 4WFFA 2J22A 5FUIA 3AB0A 4CEYB 3AKTA 1ZBA2 1W3VA 2YEVB 2E53A 1ZZCA 5CA3A 3EMRA 4CH4A 3NNFA 4DR6O 2KA3A 4COYA 2ZMNA 5KC5A 4AE2A 1HB3A 1PO13 3AXDA 4AI1A 1YTFD 2V09A 3GWKC 2E76B 3RYIA 1ORQC 3F2ZA 4LOTA 5IYZB 5I8TA 2XAQA 1OCRC 1W6OB 2XJVA 1YIFA 5KAFZ 1ENQA 1N34O 1DLLA 4YW4A 2PQSA 2VVFA 4UXAA 4OI4A 5GONB 2Y26A 1ZA4A 3VD5A 4UFHA 4A45A 3CMEV 2I2SA 4NROA 4RYDA 1OUSA 1K4DC 1NTKH 5CA0B 4N9IA 3GBGA 3K0DA 1LU1A 3L9DA 3AG4B 4XQDA 3VHOA 3H50A 3B69A 2VQFO 3WDVA 2BV4A 2Q5TA 2XAHA 1R6NA 2E7AA 4BDVB 1E5IA 1W6PA 4M3CA 1M5IA 1DLCA 1ZBE2 2VOWA 1TVKB 2AEZA 1NZIA 4TUYA 2HWF1 4DV5O 3ZS8C 2YUAA 3MFAA 2GSMB 4WCEV 2DE0X 1QOSA 3DXTA 5LA1A 3AYDA 2RDRA 4PA6A 2PF4E 4LFAO 1LENA 1R3LC 1COV2 2ZM6B 1N0NA 2HWF3 2GBOA 1QJU3 2JDYA 2VW1A 2VG9A 4K1ZA 2GNTA 4QE9A 2VAUA 3CCRV 2D2CB 3HVDA 1I5YA 4MTFA 5FWEA 4ZOLA 2A6YA 4H7LA 2QTWB 2JJ6A 1KGYA 2R0HA 1IX9A 3I3EA 2BQPA 3ZMSA 1HIXA 1EV11 3K48A 4RQEA 1IDSA 5C7GA 5JAXA 1JZ7A 3NR7A 5CA6A 5LXTB 2W1QA 1OFSA 1LGBA 3RGBA 5CNAA 2GSYA 1JOPA 4BWAA 4K40A 3DUIA 2ORXA 2ID4A 3N9QA 1MNGA 4XMAA 1AR82 4CP9B 4X62B 1JHJA 4LHKA 4EFEA 3A23A 4NAOA 5LCWL 1CAXA 2YSUB 2Q0OC 2P5OA 1TGOA 2OYQA 2V5DA 1NCRB 1AXKA 3ABUA 5FIXA 2Q0AA 4FFBA 2QQNA 1NZCA 1G6UA 2J1RA 3RWNA 3MAQA 1PD3A 1ZZ6A 2IC1A 1LECA 3P3NA 3ZFEC 3OPTA 3APBA 4OVEA 5A6YA 5FNVB 3SJCC 2ZX0A 1R091 2RMU1 3K0GA 2RS13 2V1DA 4AOCA 3AXEA 1OH4A 4XIKA 2VW0A 5L36A 3ME2A 3NAPA 4UCTA 5K0UA 4UWDA 4FQ4A 5DDJ2 5FPBA 3I3MA 2VE1A 4DR5O 4HMZA 1GO3F 1VBD1 1A8MA 3AG1C 3CXCU 2YMZA 4FM0A 5HFMA 2HWB3 1YQ5A 5HCAA 3O1TA 1SDDB 2EINB 3JD1A 2VCAA 3JASB 2VZUA 5F7UA 2PZSA 1OKQA 3ZXKA 2A70A 2FBEA 1F31A 1EAH1 2ZGNA 5FPRA 1Z2GA 3DPRB 3S0MA 1VF6A 5CBLA 4Q20A 2F4VO 2HWB2 1ND3B 1H2GA 3B5LB 4DK0A 2AHZA 1RUH2 1TMF1 3S7IA 3ZRXA 3FE5A 2F43G 4Q4W2 5C8CC 1RMU1 1F4HA 1VLNA 3FX3A 1ASJ2 4GAZA 5EV7A 2YIDA 1GOHA 2ZR3A 3SCHA 2KG7B 1QGLA 3WW1A 3AMHA 2WLPA 3AG3C 3JATB 1OUXA 3VDAA 4B8EA 4AI8A 1MS5A 2BW8A 3KB5A 2RS31 3VUOA 2W0XA 1CEZA 1CX4A 4LKSA 1B35A 1HB4A 1YJNV 3OTFA 1F2NA 2BGOA 3C7EA 4EWDA 4U3JA 1PGW2 4DV0O 2FMDA 4RFRB 2JWPA 4IW3A 3J80N 1B3QA 5HXMA 2LW8A 4GH4B 3V0BB 1D2SA 2JEUA 1UX6A 3PHMA 1XMOB 1X36A 3LB9A 2GDSA 3OBTA 1YJ9V 1I9RA 2ZINA 2ZEZA 5CFCA 3ZN1A 3X2QC 4EYUA 4AFDA 1ZWIC 3FMGA 2YHJA 4JKKA 1LESA 2RJZA 1CWPA 2YGLA 1H2LA 3MFCA 3OE7G 3N2KB 1V70A 4ZKIA 1AYN2 2HWD1 2Y34A 2HLDG 3JARB 5JSOA 1GQHA 4H14A 1D4M1 2IFRA 3HPLC 1N8RW 1AX2A 5HCBA 1F23A 2AZ5A 2NN8A 4NRQA 4P9LA 2CTRA 4N90A 1W39A 4IHJB 4JI3O 2QWOB 1VBB3 2JDMA 3VHPA 5FO7B 1G9AA 2WT0A 2MEV3 2P22C 4FLUA 5LEKA 1F7YA 3EHKA 3F7VC 4JI4B 1UY0A 2CHHA 3PVNA 1VF6C 2OS2A 5LHHA 4L9BA 5LYJA 4NOTA 2XJTA 2P37A 1AR5A 5JMCA 3VBHB 5A6ZA 4CEWA 2PYLA 3D6EA 3T2QA 3RNSA 2BFUL 1OZ0A 1Q90D 4K0KB 5DECA 4CXYA 4P9GA 3MDSA 1XI1A 4BH9A 2PAKA 2C9KA 5KC6A 5A7QA 1ZBE1 4NJ4A 4DR2B 1LNQA 5LB6A 3OBAA 4G27B 3OUFA 2ET7A 2WNUA 4IE0A 3WG7C 2HYXA 5ERLA 4D6RA 4D0QA 4I09A 4JYYA 4G3YC 3JB4C 4XF9A 1WW7A 4XJ8A 3SMHA 4KQ7A 1V6LA 2VJXA 4BIUA 4YVSC 3K3OA 2WDBA 3OGCC 1VBE2 1KS4A 1O4YA 2GN3A 3NKGA 1OCCC 4AAXA 2QJ1A 4X9QA 1IKQA 5GZCA 1RUI2 3ABLB 4O4JA 2DYCA 3ETPA 1OKOA 2JEMA 2I74A 4YW1A 1B04A 1D7PM 2MPFA 2WABA 2EIDA 2BBAA 5JI7A 1W03A 3AJYA 4AILC 4COUA 2ITCC 4YJ3B 2BRTA 1NXMA 4UV8A 4X64B 4R8CA 5F3IA 1SHWB 2WZ8A 4LWSA 4G4FA 2V4VA 3AP4A 1RPOA 4AVSA 2LGQA 4NVPA 2OWOA 2Q1MA 1KU9A 4QX3A 1OPMA 2KR2A 2D6KA 3UT5B 2P3IA 1JFFA 1ENSA 2WLHA 2X5IA 5KUKA 1YDXA 2HEWF 4B3SB 2XTAA 4Q1PA 2ITDC 2A1XA 4WVMB 4JGZC 1H1MA 5DUWA 4AEJA 3DXRA 3B02A 4QQHA 4NTWA 4QGMA 4QKDA 5B66Z 2DFCA 3K5LA 4FPFA 4CDWB 1B06A 3LZZA 3M7MX 2QWPB 3I7DA 3K4DA 2F4VB 5BXZA 1FXHA 4D94A 5B1BB 1XNTA 3BPZA 1VBA2 1H9WA 1YIJV 1RUF3 3N4MA 1E57A 1P8JA 4P9JA 1W05A 1O8SA 1AX1A 5FZ9A 2GP5A 5J2UA 1C1FA 3R65A 5FZOB 3SISA 4QX2A 2WZR2 1LOEA 2JDUA 2PLV1 5I8YA 1AR73 1PGL1 3NMBA 4LMFA 2XHBA 4CS2A 1OVPA 3BEHA 5LMUB 5JR7B 3WNMA 4K35A 2R042 3GB7C 3QVNA 5HV4A 2ADQB 3C2UA 1AYN1 4ZY9A 3G71V 1XNRB 2GDFA 3GYDA 4J1WA 4L87A 4P9XA 4Q0QA 1W9YA 2R30A 1DK1A 4XETA 4BYYA 3VBFB 1ZRFA 3ETDA 1HRV1 1RGSA 3E6CC 2YG0A 3OG2A 3S3WA 5FZ6A 4CCDA 4S2FA 5CVRA 1FKAO 2RNBA 1V0AA 3RYFA 4HK8A 4WFGA 5EZYB 4FLTA 4MTOA 2W46A 2A75A 4FOWA 3ZXDA 5IYZA 4Y5TA 2D97A 1QHTA 4AFBA 4JHZA 4U3FH 2VXJA 2D6MA 5LA9A 1Y4WA 2DTYA 1MG1A 1ULDA 2A6ZA 2YGMA 1BEV1 5E16A 4UYBA 3SC7X 5GTHZ 1ENVA 1N32B 5GTIZ 4CDUB 2IJJA 4GUNA 3MW2A 2DBNA 2PTMA 4NIDA 1WW4A 3T1YB 2A71A 3A22A 3LNNA 1ZRDA 3L74H 3CD6V 1SLAA 2ZE6A 3N9MA 1YFXA 4B3TO 1Q8QA 2AYHA 4MHRA 2E74B 1LU2A 3AZVA 2J42A 5B1BC 1J3RA 2CDYA 1VBC3 4IV3A 1PMIA 3DPRC 3QBQA 4LF7O 3T4HB 4MGSA 1UOJA 2NR5A 5TSWA 3RZGA 5FZ0A 4HZ3A 2WNEA 1M93A 1FPN2 4DXWA 2O14A 1FOD3 4LOSA 2E33A 2F66C 3ZO0B 1O9HA 2RDQA 1FAYA 2R043 2YPDA 1PM7A 2VZOA 3FN9A 3VZMA 1JUIA 4JZ2A 4EV0A 3LA7A 4D3WA 2YC4A 5GLWA 1ODNA 5FYUA 1AR93 3SQOA 2G19A 3G6EV 4YHHO 5A9GA 1XOYA 2WINB 2FB5A 2VNRA 1AR91 1DU3D 1JXNA 3ACHA 4N9HA 4R6ZA 4KGQA 1C8NA 4CCCA 5FFOC 5FZ4A 4KXRA 5IVBA 1W8UA 3VHNA 3K77A 2K0GA 4CU8A 4BM8A 1NYWA 4FPCA 4UCSA 5FQ0B 1QJX3 3V0AB 2F23A 4DEVA 5A7PA 4MXWB 1FXKA 4DW0A 2VM9A 1UY4A 1K8AW 2Q7HA 2JICA 3ZVXA 3H42B 4OHWA 4CXWA 2P6CA 2GC0A 3KZ4C 4F7ZA 2OZ6A 4I02A 2XL7A 1TZOA 1AJKA 3WFVA 3EYPA 4UVAA 2WYSA 4Y26A 2Y6KA 3LKJA 3FB7C 2Y6GA 3W7UA 4MV2A 3AMQA 4ASUG 2Z69A 4OZXA 2WLJA 1S2KA 3KGLA 5DDJ3 1P7GA 3D0JA 1STMA 4AHYA 5E88A 2BOBC 5IFTA 2BBVA 1LHVA 2VS0A 2ZM6O 3SR2C 4PT6A 5JOWA 1RUJ3 2EILC 1HRI1 3PJYA 3U07A 4EN6B 5A3PA 2EZOA 1UYXA 4GX0A 1J83A 3RMYA 1SFNA 1AYN3 3G67A 3TXQA 1RUC1 2BOCC 1LR5A 1C8M2 1J1LA 1KEXA 3BA8A 4GB31 4Q27A 4NTYA 3MIEA 1X50A 1G1XB 3C3SA 3ZN0A 5BNOA 3HKBA 1S0EA 5C4WA 5FY5A 3E8GA 2IM9A 3WQ0A 5B3SC 4R50A 2Y6JA 2YC2A 2DUOA 1WGPA 5T55A 4PLMA 5B5EZ 5EC2C 1W8HA 4K9SA 4XFGA 5IT6A 1B6QA 4EKWA 5ISLA 2PHFA 4AF9A 1BEV2 3HPNA 4L92A 4LK7A 2IU0A 1PGL2 1QOOA 2ZKLA 3SYCA 3ACFA 2VECA 4CUAA 4BW9A 4TWTA 4A42A 3JBG2 4Y1YA 3DYMA 1GUIA 5FYBA 4PA7A 2QM7A 1H38A 1XE0A 4AFCA 4UFLA 1ZX3A 3OUHA 4LF9B 4X62O 5FCCA 2VTXA 3M3OA 4Q4Y1 1GAXA 4YVWC 2X09A 4A7YA 1L1FA 4PBPA 3HBZA 4X1IB 3GJAA 5E79Z 2EXHA 2ZGRA 1ZX5A 1XNQB 1CIYA 1XOUA 3CRAA 3V0BA 4YVWB 1HRI3 2VMHA 4Q0PA 5G05L 3FLRA 5LA0A 1IPKA 1W2AX 3O0XA 1BYHA 3WNPA 2VTXJ 2GC3A 3O9OA 1RPRA 2H0BA 1BQ0A 2ZCEA 2XPJA 3L9JT 4X66O 3E5XA 3ILRA 4LBOA 1GWMA 5IK5A 3K4ZA 1YFWA 4BPZA 3ABKB 1SCSA 2WN2A 5FYYA 4BMEA 2VRZA 4DV5B 4D7TA 2DQ0A 4PD4F 1TNRA 3LGRA 2ZX3A 5B1NA 4I0BA 1SA0B 3UETA 3I3QA 1NKDA 1N33O 5AFEA 3VKLA 1MR5A 1PO12 3WB2A 4MGIE 4UW4A 4O4LB 5FYMA 4FPLA 5H6QA 5LGUA 3BPSA 3WR0A 1I94O 1S0IA 1RHI2 3JD71 4QPGC 4W65A 4GALA 1A78A 3ZX6A 3AVRA 5LMUO 1EUUA 3CC4V 1S76D 5DAWA 3EJKA 3D8CA 2HEVF 2ET1A 3I8TA 5FZ7A 2ARAA 1YJWV 2R6QA 3CKHA 5CZKA 1UWWA 4GX5A 2WLMA 3VHRA 1ZBA3 1YC61 3WNKA 1YHFA 3J7LA 1G9BA 4Y5Z0 2V4DA 4P2ZA 3JXSA 2KB1A 3GBWA 5A3TA 3HQRA 1U5XA 5DN2A 4GYCB 5CYYA 4TOIA 3BABA 4LKDA 1QH6A 4Z1MG 2H94A 4CCOA 1IG0A 5EIBD 4HK9A 1PIV1 2DBIA 5FP8A 2D3OW 4ZZ8A 2HEYF 4YG3A 4QPGB 2QVSB 5L73A 3ZRWB 1Y76A 2NPIA 4DQAA 2HJIA 2F1MA 3GVMA 1COV3 1ULCA 4QHBA 1OPOA 3MW4A 4Z2WA 3LDKA 2W5FA 4O4HB 4LKFA 4E2SA 3VQVA 5IUQA 2DYRC 4CUBA 3UKVA 2WFF3 1W99A 3BOWA 3B4SA 1I3HA 1H8TA 2HWC3 4DINB 5C71A 2JD9A 2EZPA 2X5IB 1V6MA 2VZPA 2EAKA 1NJIW 1L8DA 3UGGA 3MO4A 4JGYA 4DUYB 1JBCA 2VCMA 1TE1B 1AJPA 3NNJA 1P49A 1EN6A 1D5NA 5FKBA 3ASIA 4YW5A 2UYAA 3OM3B 4PF1A 4LBMA 2WAMA 4EEQA 1GANA 2WIIB 3H7YA 2YI8A 1JR9A 4Y20A 5JPNB 4JQTA 2UUCB 4FPGA 4K21A 4O2BA 4IGPA 1QQP1 3ABKC 3MUY1 4I0XB 4XUOA 3T4ZA 2XBO1 3OPZA 5GZEA 1UZZA 4R9CA 1Q8IA 3MF9A 5F5AA 1UXZA 5F37A 1LEDA 3SNMA 1NH2D 1HRI2 3VD9A 1DTOA 3TCUA 3JAKB 5FZOA 1AJOA 1WLDA 4F4LA 1SZTA 2ZS6B 2X10A 3TEWA 5FMDA 1H6XA 4YG0A 2WNOA 4QPIB 5FWJA 3ZM8A 2DN9A 1FYUA 4MYEA 3SJBC 1GN4A 1WLCA 4DUZO 4RUFA 4URTA 1SKVA 2LFSA 4W6XA 3T4DA 2JGUA 5E1RA 1GWKA 5C3PA 3H8RA 4GMP0 4JQRA 3VGIA 1US3A 3J4UH 1F4MA 1MS3A 5KMGB 2UU8A 1M57C 2LUWA 1KP3A 3ABZA 1ZRRA 5EIBC 4ZI7B 3Q8EA 1MQTC 4L99A 4N53A 3R4DB 5FP7A 3M7AA 1NLRA 1W2NA 4DEQA 3H7JA 5FZEA 3ZCCA 4D7YA 2WR9A 1BVP1 1QNYA 4OQ9A 3B9CA 1WMXA 1ST8A 4B7EA 2Z42A 4N53C 1N0JA 3CRCA 4UCOA 4N7UA 1MZFA 5DG1A 2DCZA 2RR13 4UBHA 2DV9A 4CDXB 1RUE3 4QQ2A 3CX5F 3HR0A 2VR4A 4MW8A 3QO5A 4DXTA 1FS0G 3I56V 1QLNA 1OH3A 4FLVA 5FP3A 4D6SA 2JKBA 3WLUA 1QXPA 4XCBA 1X9PA 3IFXA 3ZXJA 3PTYA 1G9CA 2DYRB 4CS4A 4UUJC 1WWYA 4EN0A 3PIGA 5L3CA 2PLV2 2GC1A 4FZ1A 1O4ZA 4BW5A 4QU1A 4QXBA 5C3QA 4UCUA 4P30A 1LUVA 2YIBA 5FXXA 3TB0A 1M06G 1I08A 1NVPD 1VE0A 4K6BA 2A3YA 3ZMNA 1I5XA 5JCTA 1BGYH 4FLYA 3N7JA 3JD3A 5LWBA 3THOA 3RSJA 2JG9B 4O61A 1QJX2 1AR81 4J7JA 2PMWB 1REFA 1W9TA 2VTFA 2Y6LA 1MSWD 5CEHA 1EP0A 3BHPA 4MVRA 1VRH2 3POEA 3GCXA 3OGRA 2QKCA 1WA6X 2AUYA 4MVZA 1IBMO 3PUIA 3N9NA 2A7WA 4JYAB 4KHPO 1AZDA 4MADA 2FHRA 3NNMA 2JDKA 2P6HA 5SV5A 5CG8A 4CH3A 2ZHLA 1K34A 3IAPA 5A1LA 4JGYC 4S2DA 1A34A 2ZAHA 1IXMA 2JJ2G 1R64A 4A6OA 5CG9A 5A6XA 2WZR3 2BTOA 4HSLA 3DKQA 3HN1A 1VQOV 1QU7A 3LEKA 5DUUA 1Q5OA 5LOVB 1RJ7A 3W7TA 2WLLA 5BYNA 1GNHA 2B45X 1XILA 1UMIA 2QNKA 5GLVA 3H8XA 1OT5A 3LEMA 1DYKA 3AZYA 4GULA 4GJZA 2A6VA 3ZMOA 1V9U3 3W7WA 1BMFG 3WZ1A 4BK4A 1YUDA 2FZ1A 3T1HB 1LGNA 5JMOA 1YJKA 4DOUA 1UCXA 3OR6C 2OXBA 1F15A 4H37A 1ND2B 3HT2A 3J8F3 2ZKOA 2ZHMA 1JI6A 3IBMA 2BE3A 5JDBA 5L7OA 5FZ1A 1N36O 2UUAB 1OQEA 1HQLA 2HJDA 5FYZA 4QQLA 3WW4A 4Q26A 5FPVA 5FZLA 4HOOA 4OI2A 3RWKX 4FZ0A 3GGLA 2W91A 5IYCO 4E4SA 3PN1A 1BVVA 2UXDB 2OVUA 4QPKA 3GF6A 3SYOA 3W9AA 2YIAA 1H2NA 1R6TA 2HKOA 3IAYA 3FUQA 1QJY2 3KSCA 1OA4A 1S5HC 4H44B 4E9KA 1LGCA 1N1TA 3SKVA 5HI0A 1AR62 5A32A 4FOQA 1UNBA 2W92A 1JCHA 4TQDA 4LHNA 3T0DA 4XFFA 3KV9A 3HKBB 2OIGA 2ZEXA 3WDYA 3M3QA 3PU8A 4MVTA 3A0HZ 5FXWA 3CPWU 2LFRA 4CH5A 5T5JA 4YJ2A 2O1QA 4LR3A 4ISQA 3I97A 1R1BA 4QB1A 5FXZA 2G1MA 3EO6A 3FYIB 4FAHA 2OQ7A 2Z5UA 3PUHA 3Q8FA 2XLAA 1G8WA 2JG9C 1UOFA 4UW3A 4UCRA 1V55C 1WA8B 1VIBA 4KG0A 4B3RO 1UD1A 4XDLA 3WG3A 4H55A 4ZU7A 4Q4Y2 5GZFA 1GBGA 4CDUC 4WM8A 3FHAA 1O8PA 1RUG3 2DW4A 4JTDB 1RXGA 3D3IA 5C93A 4XJWA 3HOBA 5I0UA 2YXYA 1Z0HA 2VQAA 2J1TA 1V6OA 2DU1A 5SV8A 1LULA 2JVDA 1SC5B 3OR7C 3RZZA 1VALA 3KV5A 3E8BA 4JGSA 2YPJA 2TBVA 4RQPC 1RHI3 5KHJA 4YVWA 3HIFA 1Z78A 4PJYA 1MEC2 1W6OA 1REEA 2A9HA 3X2QB 2BU9A 2R072 4JDNA 4UBGA 1K45A 2RMU3 1ZZBA 1OQDA 4GD4A 3X29B 3I49A 3AG3B 4EN9B 3JALB 3CEWA 2VULA 2XHKA 2JJ1G 4JTOA 1PL4A 4FSJA 1Y4MA 1NT2B 1NTMH 4JGZB 3BIWE 2KD7A 1ZYBA 3EBRA 2VZQA 3ELNA 2L35A 4IDZA 4AQYB 4XUNA 1S3JA 4OHYA 2DWEC 2P2KA 5KAIZ 2HHHB 2ZGKA 1VQ7V 1CR7A 4JYBA 3AFKA 1TVKA 4LKEA 4YM2A 4IT5A 1WCUA 5LP6A 2QQOA 2AC1A 3CJIB 3DN7A 1IKPA 1OMIA 2GN7A 1RUNA 1D0GA 4O4LA 1KBHA 3GZUC 1Q81W 3VB9A 3WB0A 1PNKA 1TUEB 3TEZA 3WG2A 2QUOA 1VBD3 3AX4A 2VW2A 1FT9A 3Q8CA 4CZZA 4FT8A 3WSOA 4XZPA 5BR8B 3BTZA 2FMLA 4CDWC 5KHGA 2RM22 2QQWA 5EC1C 1C5HA 1BT8A 4X20B 2W1WA 5IVCA 2PHUA 1NY72 1OCCB 1U12A 2DJVA 4UB6Z 3RBZA 2ZZQA 4XF0A 1K3IA 3N7LA 3CHXA 2VMFA 1HNXO 3AP5A 3RVZA 3J7AU 3VBBA 1SRYA 3ZSKA 5T3NA 2R49A 1GZCA 2NYYA 3GNEA 3E22B 1QOTA 5KXEA 5L9BA 1V00A 3KMHA 2Z0AA 4DY3A 4YNIA 1H8VA 4B3SO 4QAWA 5FBZA 4DR7B 2JB8A 1SFYA 1FXKC 4NHLA 4KP4A 2HWE1 5CA1A 3G6JB 4EE2A 4N23A 5LL6Y 3A4UA 3ZYFA 4DW1A 4MG2A 4I2OA 4IEZA 2D5HA 5D8AB 4O4HA 4FTBA 1YO8A 1DCSA 1H2SB 2XL9A 3QACA 5GM0A 2WA4A 1PO11 2WQ8A 2VVEA 4XFIA 1NCQA 5EBMC 4HKOA 1NUKA 4DV6B 5JCOA 3HWJA 1V6IA 4IV1C 3I2HA 4BQ5A 1V9U1 1W0JG 1W6NB 2CTQA 4P08A 4GKJB 3T4VA 3BOPA 5CB4B 4I0WB 1KECA 3IAQA 4YFWA 3H1WA 3N9PA 1CGPA 5LBBA 1ZREA 3CJHA 3ABMB 5IVFA 2G4IA 1GM8A 4LBQD 5IWAB 1UXXX 4BQ2A 3SCGA 5HPOA 2LTNA 4CU9A 5LGNA 3R4UA 4B08A 3UNPA 1SESA 5IT9N 1WD4A 5FMBA 4K1YA 3RVHA 3WP4A 2HWC1 1PGSA 2MNGA 5BNNB 3BU7A 4LF5B 1I94B 4OX9B 1F5FA 3RZMA 3DPRA 2RM23 3MICA 4IV3C 5CFDC 1PO23 1AL0G 5CA0A 5ACA1 4UF0B 4JHTA 4ISRA 1ND3A 2R071 4QX1A 3ZYIB 2ODMA 4I7ZB 2Y0OA 3BTYA 5JXJA 1W6PB 4M3CB 3LD8A 1BK0A 4BMBA 4MOAA 4DV4O 3ZYRA 1SLLA 2HWF2 2VNOA 3JATA 2OCCC 4RUEA 2RG4A 5L9RA 2VO5A 2W95A 3IKWA 3N9OA 4X1KA 2ZKNA 4Q29A 1ZRIA 2Q68A 2XAFA 3PU3A 2R041 4Y1UA 3CQOA 3M3EA 4X88A 4RGKA 4NIIA 3VQWA 5H5NA 1L7LA 5F2VO 3LCPA 2P4VA 5T54A 4Y22B 2XNDG 4AI3A 3PDQA 3WP6A 4U7OA 1VIWB 1N32O 4LO8A 1QVGU 4F6RB 3UKMA 1YI2V 3JSNA 2A3WA 2Y6FA 3I2GA 1MS0A 3THPA 3RYHB 2E5LB 2EAAA 4CZSA 2FDHA 2E26A 2YU1A 4QXHA 1Q82W 1XNRO 2UWCA 2Y8KA 4JI5B 4IE7A 2EIJB 5LXTA 2EICA 2RDNA 4LF9O 4YGDA 2VQUA 4CP9A 1OCZB 4IV1A 2XJPA 2XHNA 5JCOC 2WFF2 1NZ6A 2XVGA 3LNMB 4Z82A 4R8HA 2F6BA 3HB3B 1LHWA 4Y5SA 2FCVA 1QKQA 4H2AA 4IHJA 5K1PA 2WS91 2OW4A 4JI2B 2J1UA 5K9YA 4CCKA 3HKEB 4GCZA 4HVOA 4JI8B 2QCSB 3IIAA 1LUWA 4QPJA 3I2FA 3BVOA 4RR3C 1WCDJ 5HXVA 3EQEA 1OFNA 3HAGA 1ZLZA 4AI2A 3SJAC 1JPXA 2P1BA 2YBKA 1UYPA 1A32A 1XPWA 1BMV2 3VD4A 5F9TA 4GA9A 1SMVA 1XE8A 5BR8O 1JJOA 2KM2A 1JYVA 1UO9A 3I5DA 2O8QA 1QQCA 3OTOO 4YZ1A 4AEDB 5DUXA 5K0UB 4KWJA 4AHCA 3VD7A 2LM3A 4XDOA 2QWRB 3NVCA 1IS5A 2WJSA 3RQ0A 2DTWA 3JD73 3OPWA 1JZ6A 2ZDIA 4FLZA 1BZWA 1J59A 1G9DA 1KP2A 1WNSA 1S0DA 1GWLA 1IBMB 2W52A 4M3CF 5EJ1B 2H8PC 1O4TA 1W0NA 4CTEA 1W8NA 4JF3A 3D5OA 3VKNA 4ORFA 4Q8LA 2IJKA 4YG6A 3B77A 4BLIA 2LW1A 2RS51 3ZLIA 4GKXA 2BTQB 3WDUA 5FTTC 2VL4A 3UL2A 2OIIA 1WLWA 4LXLA 4DV2B 1IS3A 3M1HA 1RUF1 2C26A 1GICA 2GAUA 2A73B 1QJY3 3PJSK 4LBNA 3LA2A 3N3HA 4P9IA 3SPIA 1OOPA 4IEQA 1RUC2 5LP6C 1O91A 3POIA 1FNYA 4N21A 1AVBA 3GZAA 5IVEA 4E4HA 3S5QA 4CPBA 1OLMA 4ZKTB 1IQAA 1DGRN 3BI3A 4AZZA 5L3DA 4X66B 5I0TA 4L2NA 5L7OB 3ZYPA 4YVSA 4QXCA 4CCMA 5FR3A 4DV7O 5BNQA 4ABMA 1RSOA 4BISA 2XG3A 4DRRA 4HBNA 2JS5A 2HBUA 1K9MW 1HV0A 1F9KA 1FD9A 1VB4A 3D4KA 5C5TA 2VNGA 4JVAA 5CFCB 2E7QA 2VUAA 3AFGA 1DYPA 3DL3A 4GZ9A 4CCEA 1OLME 2YFUA 3HNYM 2DVFA 1HB2A 3I3BA 4AW7A 1KUQA 2OZJA 4B1LA 3TEYA 1DF4A 3RYPA 5EXOA 4CU7A 1GKFA 4HN0A 1W2UA 1W04A 2YUEA 1DQ1A 3QO8A 3G7DA 3CB2A 3I2DA 1D5AA 1GM7A 1UN1A 4XUQA 4YZ5A 1HXS1 3IDCB 5FO8B 4YJ2B 2J1VA 5CIRA 4W4ZA 4IE6A 3GJBA 1OCZC 1JYXA 5ACA3 1ZL8A 4LP8A 4LF4B 5A3MA 1AHSA 1PVC1 3ZMUA 1I0HA 3AKQA 1VBE3 3DCQA 4HSJA 3VBFA 3R0RA 2YDEA 5FY4A 4WM8B 1AUYA 4FFGA 4MVUA 2FQPA 5CFDB 5FBJA 3SITA 2VZRA 3K06A 4JI8O 1YQCA 2WWUA 4LF8O 4XEZA 5A3OA 1QCEA 1BZKA 1POV0 4JI1B 1QEXA 4QB6A 4RO2A 5BNNC 5GJ6A 4KWLA 1R3JC 3OY8A 3L2YA 5BMVB 4FFHA 3TWIA 1XQ8A 1EBOA 1L7RA 5A3NA 2WKKA 1LAJA 2IH3C 1MA1A 4ARXA 1D4VB 3ZSEA 3E8HA 2VUCA 3TNPB 3JD4A 3VBRB 5FZHA 4M0HA 3C3TA 4O2AA 1UMZA 1FAFA 4MVQA 4AFMA 2WZR1 4GJYA 4XAEA 3KCCA 2HEPA 1K5SA 1CPNA 1R083 4L8JA 1IXBA 5C8CA 2BP6A 3HQUA 4COZA 2JDZA 2QQVA 4XXPA 4J9YB 4NWVA 1W59A 5IAVA 1ZRCA 1K12A 5EFUA 2Y69B 5HFLA 3AG2B 4GX1A 1IPJA 5KXCA 4PIXA 3D3AA 1CZTA 2CGOA 2XONA 1F8VA 4H13B 1HRV2 3K5OA 3UT5A 2XUMA 4LH6A 1VAKA 2Y60A 4GKJO 2XOKG 1COWG 3BYWA 5EWSA 3ABTA 4WVMA 1PX3A 4TXWA 2EJ7A 4R4XA 1PL0A 1U96A 5LY2A 1HNZO 2VBPA 1VBE1 2YXSA 4QXKA 1BMV1 2BOJA 3W21A 5GZDA 2LRPA 2JDHA 2HVKC 5ITZB 3LF7A 4LF7B 2G38A 1WW6A 2YI9A 1YYNA 1KB9F 2BSKB 2Y38A 4OX9O 1LOAA 2CTPA 4FQZA 3W20A 3BVCA 1WMDA 3RRDA 5F32A 4GZRB 3JD72 1W8WA 5A7SA 1FATA 1PNGA 3ACLA 3H1KH 1MABG 1W8TA 2Z3YA 2XJSA 2JKXA 1AI6A 2DU0A 4CDQA 1DQ4A 4HYOA 4EWAA 5FQ0A 3V0AA 4DUVA 3AJZA 5EP9A 1VQ4V 4LEJA 1FXKB 1AP5A 3OMNB 2HH9A 2YBPA 4IEVA 5DZFA 5JZGA 2EIJC 1HDKA 1NI8A 1BHGA 4XMIA 4UB8Z 2A5ZA 1OD3A 1FMD1 2XQRA 1OLQA 1VBC2 2XKOA 2ZX1A 3F95A 4LA3A 1NA1A 3E1F1 1OV9A 4LO4B 1PV0A 3MLKA 4WM7A 1H2KA 4XF1A 3UYJA 2XJRA 5BY5A 4XQ4A 2BVVA 1GMGA 1K7DA 2XUEA 1FYJA 3RYFB 1RB8G 4P9OA 2DDUA 2OUJA 2IXJA 4B3MB 3KT1A 3U37A 3ZPYA 5CB4A 1IHMA 3AYCA 1EUTA 4JPRA 4AGGA 2RDCA 1FI2A 1MPXA 3USUB 1HX6A 1QBZA 1HRV3 1HJGA 3WNLA 4AFAA 4F6EA 2LALA 4FXGB 3E6DA 1S5LZ 2ZGPA 4DZGA 3WG7B 4B1MA 3RZHA 1V54B 2EXKA 4IEOA 3ZIAG 2I45A 2OCCB 1CIWA 4LO5B 4LBKA 1Q8VA 4Q4Y3 1QQP3 2MEV1 1ULGA 2JG8C 5IJ0B 3WQ1A 3B40A 4HT1T 3LDEA 5DABA 1IS6A 4QDSA 4ITCA 1XRUA 1RVF3 2WLNA 2BTVC 1R3IC 4HNAA 1G9FA 1SETA 2CUGA 3IPVB 1W6MB 1AJNA 1ULOA 1NY71 1ULEA 4KBZA 1R1A1 4EN7B 1F35A 4LF8B 2A7AA 2Q8VA 5JOYA 3PMSA 1VMJA 1PO21 2B39A 2WL1A 5FOBB 3AP9A 1Y6XA 2FCUA 2O0OA 2IU3A 4Y4YA 1SBEA 2OIEA 2HWC2 4Y22A 2JECA 1HJFA 1GZ9A 3Q9OA 4CU6A 3JUUA 2AHYA 2JG8B 2XVKA 4Q4W1 2J1EA 5LRSA 2X0LA 2RS32 4IGQA 2VVDA 2AZ0A 4DRXA 1QMJA 4O9GA 1PIV3 2R1BA 5CBFA 2A6XA 4TTGA 4O65A 4DV0B 4YGCA 5FK8A 1JVMA 4ASMB 2YZ4A 1LOFA 3RI9A 4YM0A 2JGDA 5KHHA 1QHDA 2P3KA 4A7ZA 1MVEA 3ASOC 4LR4A 3CCEV 4O4IB 3V65A 2Z79A 1OQ1A 4V1PA 2CNAA 1FOD1 3KT4A 3P1IA 4IV1B 5DDJ1 3H3ZA 4MXWA 2R9RB 3CO2A 4RAIA 1BK1A 1VBD2 3GHNA 2EBOA 3WDWA 3RDIA 5JWPA 1W6QB 5K8SA 3FL7A 3N7KA 2GU9A 4OLLA 1DGSA 1OVSA 5ABJC 2XBO3 3KZIZ 3AZXA 3ZHSA 1GV9A 2IWGB 3NSTA 1QJU2 3RYRA 3E2EA 2E32A 5FV3A 2RM21 2VOVA 3BGAA 4Q0UA 4LUMA 3VKOA 5GKAC 1PVC3 4W6YA 4IL7A 3LQCA 5FRAA 5AG2A 2B5UA 2W6JG 3OEAA 4Z92B 4C7UA 4AEDA 1KYOF 1XYOA 3GXUA 5KHIA 2ZHNA 3KV6A 4TSVA 2JENA 3RS6A 3ZSJA 4DR7O 4Q4V2 4IUGA 2BCCH 2XH6A 2HFEC 3OEEG 2VC9A 1JOJA 3AKPA 5DXDA 3OYWB 4KG8A 2RS11 2QWQB 3POSA 2B7YA 1HN1A 4NXMO 1LODA 4GWNA 1K5MA 2OA2A 4LH7A 4EJRA 3N9LA 1VMGA 5LATA 4AVTA 5JSRA 4LBQB 5FPUA 1QJY1 1VBB1 3ZFGB 1CPYA 4QPGA 4DFSA 1PZ9A 4UAPA 5DAPA 3WVJA 3ZRWA 2OCHA 1R081 4W4KA 3VOUA 4WFHA 5AVAA 1SLBA 1EPZA 2IUWA 1HP8A 1O7FA 4J11A 4TZDA 1H0BA 2NLJC 1AI5A 3WB1A 2K2SA 4XHXA 3IB3A 2W87A 4HPKB 2ZX2A 1OOPB 1XMQB 4ONUA 2K46A 3OEHG 3S5AA 1HQWA 2HWE3 4RWUA 1JODA 4AGRA 3IGAC 1EV13 4I4TB 3SYPA 4I9WA 2D7FA 1YSCA 1UKRA 4BOWA 1CPMA 5CBHA 1FV3A 1RVF2 4GKKO 2RR11 4JGYB 1S2BA 4IESA 1D2QA 5TISZ 4ZPIA 1O3RA 4H33A 1Z7S2 4MVOA 3B00A 3FJSA 4J1XA 5F5IA 1LTEA 2FD8A 1QJU1 1BBT3 2F93B 1TG7A 4QX0A 3MLJA 3ZN5A 2JE7A 4UI9L 3VDBA 1ZZ8A 2LO1A 5EK0A 3M3CA 1KQSU 4URAA 4QIWF 2B1GA 3WDXA 4MS2A 1CQ9A 2VMCA 5GONA 2R32A 5C70A 4LF6B 1SLCA 2QGNA 1X82A 4YRDA 1UU4A 2NMOA 3TOJA 4TLFA 4AXOA 4DV1O 5CB7A 3KF3A 3JAKA 4BLJA 3T0AA 2CU5A 3K3NA 4BQXA 1YZBA 1RUG1 4LFCB 3ZXAC 1QF3A 2E7TA 4QNHB 1AR63 3TJTA 1K5JA 3POGA 3BTXA 4TUYB 4EFBA 1AJQA 3JQXA 2Q30A 2PYTA 2FDFA 5JH7A 3LDRA 1OF3A 5F5CA 1BCXA 3SH3A 2TEPA 1KQRA 3CJXA 1W90A 4X1YB 2LROA 2DUQA 3R66A 3H8UA 3SPGA 4O7XA 2OTJV 1SBFA 1Y9MA 4CDXC 4ZI7A 2QA4V 3CIHA 2BWCA 1LNSA 2WWWA 3C7FA 5IHRA 2N04A 1WB8A 2WS93 4XIOA 2UUCO 4LLOA 2SBAA 3OD4A 4RGGA 5BNOC 4QPIC 2DCJA 3KG2A 4ZOLB 1BQPA 1GZTA 4JDMA 3PVBB 2Q67A 4P9PA 4C1WA 3CS5A 3LDDA 2W1UA 3BB6A 4GT1A 5D1IA 2ZA9A 4DMIA 3EHBB 1IURA 3VBRA 3K46A 2WFF1 4AQTA 3ZN6B 3RYCA 3TK1A 1J3QA 3FKSG 4XYXA 3L70H 4OPHA 1AI4A 4FJCC 3Q8BA 4AVVA 3APOA 2ZNJA 1XNBA 4XURA 5C8CB 2GNBA 2R073 1CAXB 5JJNB 1GK9A 1RL3A 5LA6A 3ZXFA 3CRQA 2VUJA 1RHI1 3AMNA 5LRRA 4J9ZB 2QQUA 1YF2A 1HNXB 4J80A 4XE9A 3B8NA 3UV9A 2BERA 1SLIA 1D4M3 2P7TC 2UUBB 4OFGA 3I3DA 2QWNB 2UUBO 5JIAA 1WMEA 4P14A 4LNUB 1DQ0A 5JIUA 4UT5A 3AG1B 3CF6E 2HWD3 3UT0A 1JS9A 2DVAA 4PLOA 2HR3A 3U78A 1K5MC 4XABA 5AC91 3OTOB 4KL1A 4HKLA 5D21A 2GZWA 3B01A 3GALA 3ZXEA 3U75A 2NNUA 4JAVA 3J7NA 3OBZA 1TAEA 2B1IA 2DF7A 1N1YA 5FPZA 1DGRA 1QXRA 4SBVA 3WOGA 4AEDC 4CP1A 2UXCO 3JASA 2IXLA 1UMHA 3WXPA 4R9BA 4J25A 2RS12 4FM2A 5JVDB 1POQA 4NPMA 3MHHC 3FB6C 1TQ5A 3ZOIA 5L3EA 4JTNA 3QO7A 4QGNA 2ZR2A 1YHQV 2FMYA 3B94A 1TME1 3KD4A 4QPYA 5ABJA 4ZU4A 2KG7A 5FJKA 3ZHUA 3PNAA 4NHYA 5KUMA 3M8LA 4OULA 5IDJA 3QLQA 1QDOA 4ATEA 1RUG2 4WFAV 4LT5A 1AR92 3R4SA 1UPIA 1VRBA 4A4AA 3ZSMA 4PA3A 3ZXGA 3DECA 3BA9A 4FIPC 1YFYA 4HLTA 4UW6A 2PUSA 3CSXA 3CCMV 2HWE2 5B1OA 1UF2C 4GMP1 1KKCA 4BQ1A 1W0PA 4ES9A 1DZQA 3ZFFB 4NYKA 4QX8A 2G9FA 1RMU3 2W1SA 4DV7B 5FLHA 2GV9A 3H1LH 2VNVA 5A32B 2IJHA 2XBO2 4W50A 4DYLA 1V9U2 1M56B 3N2KA 1WPBA 4QE7A 2Q4PA 4LQRA 5CKNA 3ACGA 2A6WA 4A3ZA 3GZEA 4LIVA 5LHIA 1X7NA 2WA3A 2VGDA 2HVJC 2ZACA 2WYFA 1FX5A 2GMMA 1POV1 4LK6A 3FYEB 2HWB1 4JI1O 3RYKA 1O3TA 2RCVA 5FAXA 4GWIA 5JQGB 3AC0A 3B9IA 4QM9A 1QR8A 4CEWB 1KDKA 1C57A 1W8OA 2I07B 2B8MA 3VQXA 3AEIA 5J1XA 4AHZA 1BBT1 3O1UA 2AEYA 5C5UA 4A3XA 4DUYO 4I5SA 1DHKB 4IYIA 3H1YA 4P5YA 4AWDA 1BL8A 1QVFU 1ZSPA 2Y0IA 3WG4A 3VBOA 5GZGA 1FV2A 5F1RA 5FUNA 1QH7A 1F51A 3JCUZ 1M56C 4X6QB 1RUE1 4E4ZA 1W2BU 3WV6A 1CZVA 4M4PA 3NV4A 5EBLC 4YW6A 2D5FA 4B4RA 3MUZ1 3POBA 3ZIWA 4AEKA 5J2TA 5F2WA 3U0ZA 3B93A 1GU3A 4KWKA 4Y24A 3OFNG 3K4AA 3FZ3A 2X05A 3RT3C 5FY9A 1Q43A 3D3QA 2IH1C 4ATFA 3B2EE 1OHFA 2LS6A 4ICGA 1RUH1 3PUSA 4JGZA 4JASA 3WW3A 3LSDA 5A33A 4YJ3A 3QF7A 4AVAA 1LJ7A 5LHGA 4DR1O 3RJ2X 3M3IA 2X5IC 4GKKB 3NRUA 3I2OA 1GNZA 4CH6A 4ZHQA 4MGQA 5JZGC 3G80A 4TN7A 2C4XA 2L9LA 4UVBA 1U0AA 4HETA 5FZFA 1ND2A 5JI9A 3U4XA 2HG5C 1LKNA 4QDQA 1PO22 4UVCA 1SQPH 1LOCA 1GP5A 1KITA 2KQXA 2Y69C 3IIIA 2ADDA 2Y48A 3NJYA 2PAMA 2P6JA 2IFWA 3WNOA 4CDQC 3MLLA 1LEMA 1CAUB 2QKSA 4RN5A 3THTA 3H0OA 3GHMA 4IE4A 3WF3A 2RJLA 3BODA 2M6YA 4GLXA 1OI6A 1PMJX 2QDRA 2VQEB 4TV9B 1W9WA 1RUF2 5IK8A 3ICXA 1VARA 2EIMB 3L73H 4BWOA 3AZZA 1BS3A 1Y7BA 3OSDA 2GHYA 4HN1A 4RHV3 1JYWA 5APAA 2UXCB 4YXWG 1ZBA1 1SDWA 2A0LA 1OF4A 2RDSA 2VZTA 3MGUA 1NR1A 3J8F1 2QFEA 4IERA 2WNUC 4LBQA 2CY6A 5FP4A 4OCTA 3ZYBA 3TNQA 1XMQO 5H9RA 3QOPA 3CE2A 5DN6G 3I59B 4NRMA 1G86A 5A6QA 5C6CA 1OA2A 1FJGB 4CEWC 4M00A 4FPJA 4PJ0Z 3LEGA 4CCJA 4DR6B 5CADA 3VKMA 1O3SA 5B4NA 4CSWA 1QDCA 1J3PA 2PI4A 4QQOA 3VZJA 2V72A 3LPFA 3LDBA 4HVRA 2W68A 3LIHA 1YQ2A 2E75B 3R6SA 5JUVA 1UPGA 2D44A 4QM8A 5K4LA 4IIJB 1GN2A 1N33B 3ZX7A 2ZQMA 3CEIA 3CJIC
chains in the Genus database with same CATH topology
1QGLA 3WW1A 3AMHA 2WLPA 1H4HA 1PGSA 2MNGA 4X8NA 5BNNB 3BU7A 4I01A 4B8EA 4AI8A 1MS5A 2BW8A 2GALA 3KB5A 1F5FA 1AYM3 2RS31 2ZJCA 1H4GA 2W0XA 1TNFA 3VUOA 2E6VA 2CTVA 3DPRA 2RM23 3MICA 4IV3C 1CX4A 3TBDA 3J26N 5CFDC 1PO23 1AL0G 1CESA 4FXKB 5ACA1 2ZGUA 4ISRA 1ND3A 1B35A 4AQ2A 1RUD3 4XFCA 3VZKA 2R071 1OIJA 2UY8A 3OTFA 1F2NA 3ZYIB 1MZ5A 4EWDA 3WP3A 1PGW2 2D43A 4Q4V3 2FMDA 2Y0OA 5CFCC 4RQPB 1W6PB 4M3CB 5I0RA 1AR83 1GSLA 3ETQA 4GH4B 4BMBA 2ARBA 1ASJ3 5EYYA 3ZYRA 2WT1A 1D2SA 4OHZA 4YFZA 1SLLA 3V0BB 2HWF2 2VNOA 1XYNA 1UX6A 3PHMA 5BNNA 3OY8B 1X36A 3LB9A 3WD5A 1SBDA 3OF1A 1WMFA 3OBTA 3IKWA 2C0ZA 1I9RA 4I3GA 1UZYA 1S1AA 5CFCA 5KEUA 2ZKNA 4Q29A 1PK6B 2XB6C 4HVQA 2YY1A 3JU9A 1OIJC 4AFDA 3FMGA 2YHJA 1QU0A 2R041 1LESA 2YGLA 4Y1UA 1H2LA 1OS7A 2RJKA 3MFCA 3VBFC 1AX0A 4A7KA 1V70A 1DDLA 4MGKE 2PHDA 1PZ7A 2D93A 3RMXA 4AVBA 1VBA3 2YROA 1AYN2 1V6NA 3M3EA 2CWMA 1EPWA 4IV3B 2HWD1 1FPN3 3NO8A 3VDDC 4PBOA 1CAWA 3LCPA 4J5IA 5T54A 4Y22B 5JSOA 4AI3A 3CJIA 1GQHA 1Y9QA 4H14A 3GBFA 4J6GA 1JYIA 3WP6A 1RVF1 2RR12 4BA6A 4XILA 1VIWB 1D4M1 2RS52 2IFRA 2EXIA 1JH5A 1AX2A 5HCBA 2OUHA 4LO8A 2AZ5A 1PK6A 2NN8A 3AP7A 3C3VA 4N90A 4P9LA 4LLFA 2A3WA 1W39A 1VBB3 1MS0A 3THPA 3VHPA 2XKPA 5FO7B 2IXKA 2WT0A 3VZLA 2MEV3 2EAAA 4CZSA 1G9AA 1LHNA 5LEKA 3EHKA 3PVNA 2UWCA 4RL7A 4L9BA 4NOTA 4NE0A 2XJTA 2P37A 4YGDA 4TYSA 5JMCA 3VBHB 3NW4A 4CEWA 3D6EA 3RNSA 2BFUL 4MXVA 1C28A 4IV1A 2XJPA 4O9EA 1N1VA 1OD5A 2WFF2 4P9GA 4PF5A 2XVGA 4GXLA 1NQDA 4HL0A 4BH9A 4AHXA 1QNWA 2PAKA 1MEC3 4Z82A 4R8HA 2F6BA 5KC6A 1LHWA 3JCIA 1QKQA 1ZBE1 4RS5C 3MF6A 1NCQC 4Q0SA 2CV6A 3T1MA 1NE6A 2WS91 2OW4A 3WP4A 2ET7A 2WNUA 4H3WA 5K9YA 3D82A 4XDQA 4HVOA 2QCSB 3IIAA 3AMMA 2DCKA 2WQ4A 4I09A 1ULFA 4RR3C 4G3YC 4X8PA 1WCDJ 5D8AC 5HXVA 3EQEA 3JB4C 4XF9A 1WW7A 1OFNA 3HAGA 4XJ8A 2ZGLA 4KQ7A 3SMHA 1V6LA 3H1MA 1FXZA 4AI2A 5ACA2 2BVBA 4FP3A 1R092 4YVSC 3KT7A 4WBBA 3TN91 4XW3A 4PDWA 1CVNA 3JBG3 1VBE2 1AL22 1KS4A 1O4YA 2GN3A 3NKGA 1BMV2 3N6WA 5BNPB 4C5WA 5F9TA 1IKQA 5GZCA 1RUI2 5C9AA 4BIFA 4GA9A 5K7PA 3MDPA 1SMVA 1XE8A 3W59A 2DYCA 2AENA 3VV1A 5L19A 3ZFEA 3MW3A 2KM2A 2JEMA 2O8QA 3JQWA 4IQPA 2I74A 2SLIA 4YW1A 4FOYA 4YZ1A 4AEDB 2XLFA 1SACA 1OOPC 2IZWA 1UIJA 5DUXA 5K0UB 3AZWA 2MPFA 1OSGA 3MPPG 4KWJA 2Q1ZB 4HANA 5JI7A 2LM3A 3NVCA 3AJYA 3SH5A 3WNXA 1IS5A 2WJSA 3RQ0A 4BCUA 1XXNA 3HD8B 4COUA 2DTWA 1NCQB 2DFBA 2PA7A 3JD73