2YDEA

Factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ydeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ydeA01
3P3PA 4B7EA 1H2MA 2ILMA 2YC0A 2W0XA 1H2LA 2Y0IA 1YCIA 1H2KA 1MZEA 3D8CA 5JWPA 4Z2WA 4NR1A 3P3NA 4BIOA 2WA3A 3KCYA 4AI8A 3OD4A 1MZFA 4JAAA 1H2NA 2CGOA 2CGNA 3KCXA 2XUMA 2WA4A 4B7KA 4QU2A 1IZ3A 2YDEA 4Z1VA
chains in the Genus database with same CATH superfamily
4QNHB 4ZHNA 1L1FA 1TE1B 2LQTA 5H9CA 2UUBO 2OUJA 2IUWA 1V9U2 3JZVA 2IFWA 1ZL8A 3OW2U 1OUXA 2AC1A 2VMCA 1MVEA 4DRXB 4CCLA 2FCUA 4H33A 5IYDO 2V72A 1COV3 1MS3A 4DNYA 1ZWIC 1N32O 1US2A 5EHDA 2ZE5A 1W3XA 2ADQB 2NZ9A 2Y6FA 1UF2C 2P06A 3AXEA 2JXAA 4HXCA 1IBKO 2Q7EA 3ABLC 3A0HZ 4K6BA 2V5YA 5FZ9A 1F4MA 1R3IC 1JYWA 2RQ6A 3OJBA 2Y69C 3H8UA 3B8NA 4XJAA 5FQ0A 2UUCB 4LITA 4RQFA 3MBWA 1NLRA 2JGDB 4LWSB 2LW1A 2UY8A 1LOGA 2FDKA 1J95A 1RUNA 1CAXB 3VBOC 1BMV2 4Q0PA 2P90A 2RMU1 3BA8A 4X20B 4LOSA 2L6LA 5IJ0A 2UU9B 4Y20A 5FIXA 3RYHB 3ZKYA 1GM7A 4QPJA 2DMXA 3BA9A 2FBEA 2XBO1 1QJEA 4OZXA 1GMMA 5DAWA 4WVZA 2JKXA 2QCSB 1WJZA 3MW4A 1CWPA 3MUZ1 3M8AA 4HVOA 1B09A 3ABKB 2A70A 3AKRA 3B3QE 4DV3O 3MIGA 1AL23 4BYYA 3I5DA 4RN5A 5FYIA 1QLEC 3TN93 5GONA 4KNCA 4XE9A 1PVXA 5EZWA 5E1RA 1ZRIA 1K7DA 2ZHLA 4PLNA 3ABZA 2DU1A 3OD4A 4Y3OA 5C9AC 3VHNA 1QOSA 4COYA 4DO0A 5B1BB 5DG1A 5A1LA 5LA0A 1N3QA 1FATA 1XQNA 1NZIA 1GM9A 1JYCA 2Y8KA 4PCRA 3RVHA 4IESA 1HXS1 1AI6A 1AR82 1EPZA 4PHZA 1JPXA 1RUF1 2P2KA 1R73A 3RI8A 2GN3A 2ZX0A 4OUMA 4P9XA 1LCLA 3E35A 1DYPA 1RUH1 1JOBA 3ACLA 3JCZA 1G8WA 4BLJA 2DVFA 3ETQA 4K9SA 3NNFA 2W47A 1ULGA 2VZ1A 3ZFFC 5EIBC 3X2QC 3RYIA 4YW3A 3R4UA 1EY2A 1QU0A 1RMU2 3ZFEB 5JAXA 1M06G 5LHIA 2ZAAA 3THTA 5KXCA 4LR3A 3K3WA 1MSDA 2QZ2A 1FYUA 4HN1A 1OCOC 1DQ4A 1NVPD 4YXWG 5FPZA 4J7JA 3JD4A 2E51A 2RDCA 3W7XA 2RM23 5CKNA 2UWCA 1D4M1 4P9IA 1F23A 2HWD2 3I2OA 1TME2 4UCRA 3JASB 2J1AA 2ATFA 1NA1B 5IUQA 2WLNA 2AGAA 5B3SB 2YYOA 3OEHG 5APAA 1U96A 2UXDB 2AHYA 4N53A 4X64B 1YQCA 4LE3A 3TEXA 4PBOA 1S5LZ 1OOPA 3ZXDA 1W9WA 1BSMA 2VO5A 4YWAA 1VBE1 4AHYA 5J09A 2HJDA 1UQXA 1Y76B 3E6CC 1BJQA 3MW3A 1WMDA 4QD2A 4BB3A 1KC8W 4WZCA 1MS5A 2A5ZA 3VBSB 1G9FA 1IBLB 1NCQB 4BAYA 4HFSA 4JGZB 5LA6A 3TJTA 4QXHA 3BTZA 3VBHA 4JASA 4TT3G 3VKNA 1J1LA 3C90A 2LUWA 1GNHA 3I8TA 2VCAA 3VBRC 3POFA 1NUKA 2VUJA 5H6RA 5JMOA 2IXCA 4DO2A 3FWEA 2CL2A 2BVBA 1SEFA 4X65O 1JZ7A 5F1RA 4QB6A 1URXA 3X29B 2HKXA 2Q9LA 4M3CB 1QR9A 2HLEA 2ZM6O 3RWNA 2OPKA 3C7GA 3AJZA 4QHOA 1NQJA 4DR6O 4FLUA 4ET7A 3ABTA 2Q5ZA 2XLFA 1ZSPA 4X66O 4UF0B 3WF2A 2O14A 1W9FA 3LDCA 3DYOA 1S5JA 1EBOA 4GX2A 5C3QA 3E2EA 3DXTA 4I9QA 2EIKC 2LFSA 3DKWA 5GZFA 2VQTA 2C26A 2XAGA 4OPHA 4ZHQA 1TNRA 2VTXA 4RQPA 4YVSC 2FCVA 1R1A1 2NYYA 4Y1UA 5FNVA 2F6BA 4FPFA 4JPRA 1DGRA 2ATKC 1M93A 2W91A 3KB5A 4CCKA 2VW2A 3SPJA 3CB2A 2ERFA 4CPBD 3J8F1 1K92A 5FKCA 5GW7A 4B4RA 3ILFA 5BR8B 5J48A 3QNEA 3LDEA 3EJKA 4OHWA 4TTGA 4CCCA 2WO7A 1GZTA 3VKLA 3WF1A 3TXSA 1SACA 1AXZA 4O4LB 4M01A 4CCJA 4MO3M 4HYOA 1MABG 4J11A 3KV6A 3ZJZA 3C3SA 1JN2P 5ITZA 1UU4A 1HDJA 4AEDB 1AYM3 3DPRA 5F5AA 3QBQA 2R9IA 4DV1O 2D3PA 5LOVA 5GLVA 3WNXA 4JYBA 2AEZA 3LNMB 4RS5B 3ZOIA 4MGKE 3T09A 4UV9A 4IV1C 2DFBA 5LBBA 2ENRA 5F5IA 5KC5A 2WZ8A 5DDJ1 2XAFA 2ZBJA 3B94A 3PMEA 4EN7B 5L7OA 2H94A 4K8ZA 4MT8A 1VB4A 4CS3A 4LBJA 4KGGA 2ARHA 5H9SA 4YW2A 5H2FZ 2D5FA 1VF5B 3ZRWB 5KX5A 2V7QG 4W6YA 3U37A 3LDRA 5IJ9B 4YNIA 1QJU1 1PVC2 2QJ1A 4QU2A 4JI1B 4P9JA 2HHHB 2VW0A 3FAVB 2SLIA 4K21A 4JGSA 4QKNA 1QJZA 1V9U1 4BW5A 4GA9A 2JENA 2MW2B 2VECA 4HSLA 3IJ4A 1MEC1 3MIFA 2JDNA 1ZZ9A 3KVBA 4IEPA 3RZKA 2QDNA 3H50A 1ODMA 3A7QA 3FLRA 1XDCA 3N9QA 5LA1A 4CCMA 4IV3A 2ZE7A 3CHXA 4L0PA 3GWKC 3G71V 4DV6B 1CX4A 2BOBC 1AB3A 3B00A 5FPXA 3ZHRA 3C8XA 4XURA 1ZBA2 1KQRA 2Z69A 4WM8C 4ES8A 4RA0A 3BODA 1C3HA 2FMYA 4CDWA 1Y43B 4LUMA 1AR72 3VDAA 2FKXA 5IY5B 2P4KA 1NG0A 2ET1A 4BR6A 1BMV1 3ZO0B 3WX5A 3ZHTA 4JYYA 1PZ8A 4ZXEA 4BWOA 4LLOA 3I3EA 2IXHA 1ZRFA 1FKAO 2EIMC 1UIJA 3BOPA 1VF7A 2A0LA 1AL0G 4BQ4A 4XUPA 2NLRA 4HNAA 4IE4A 2AH2A 5JCOA 3K9SA 3LOBA 2EJ7A 4I0XA 3A22A 5A3MA 2HP8A 1RTVA 1XYOA 5J96B 4UW6A 1LOBA 1W06A 5A33A 2DWRA 3AKPA 4QM8A 4I50A 3E8HA 3WG7C 4AFMA 2ZMLA 3BGAA 4GT1A 5FY1A 3UGHA 2GNTA 2NP0A 2WSUA 4D6TH 4GLXA 2JE8A 1EV13 1V70A 5EFUA 4BK4A 4CEYB 1UN1A 5E1AC 5JH7A 2VMIA 3AZYA 3JQWA 1ZYBA 4P02B 4I5SA 4B3RO 3N9OA 4FLTA 4LO7A 4MW8A 2KR2A 1NI8A 4H3WA 3CCQV 3OPZA 3OGSA 3E5XA 4ASMB 5BMVB 1AR81 3RRDA 5FFOC 3AXDA 1BS3A 1VBC2 1OLQA 1BEV2 1CXZB 3ABMC 5CZKA 2XVKA 4MADA 1JYXA 2FHRA 2XJRA 1MNGA 1OBNA 4I55A 2DTWA 4NMIA 4NHLA 1US3A 4QJFB 5A3TA 5IVBA 1RM1C 4XIKA 5H6QA 1POV3 4QPIA 4ZU5A 2ZDIC 3J7HA 4URTA 5LK5A 4IT5A 1RXFA 4DW0A 2E7AA 2O0OA 3ZMNA 2YC0A 1W0KG 4JI7B 1TUBA 3OOXA 3ETEA 3C7FA 2VCCA 1EYBA 2PLV2 3UT5A 4QPGA 5DMYA 5FY8A 4O4IB 1OA2A 4UXNA 1YXBA 2BSKB 1GP4A 1K5MB 4YJ2B 3GJAA 5BNOC 2V1DA 4YHHB 1WZXA 2WKKA 3E5QA 2G1MA 1UD1A 1R1ZA 4JGYC 4QHZA 3HKEA 1F8VA 3BAAA 3O1UA 1XRUA 3WW4A 2OCCC 2P3JA 2NLJC 1EN4A 3H3UA 2HWD1 4KUMA 1TME1 1BHBA 3UJQA 2XQXA 1DG6A 4CH5A 3HAGA 1AJQA 5FZOA 3K51A 1CAUA 1H0BA 3JYCA 3THPA 3PMSA 2DCTA 1HX6A 2VZSA 1OHHG 3LAGA 3WINE 3OTFA 4DR1B 2WZR2 3CZUA 5C3RA 3UJOA 3WDWA 2VRZA 1PGW1 4KG8A 2YROA 5LEKA 3B02A 3K46A 3Q8CA 3G4SV 4LNUB 1FXKB 3CEIA 1D0HA 2AXTZ 1PZ9A 5F2SA 4J25A 3AG3B 3OGVA 4IUGA 1IQDC 3VZKA 5H5NA 1LR5A 3EXUA 4XDPA 4IEVA 1WLTA 1OJHA 2W5FA 5A6ZA 1ZX3A 5KHKA 4MVTA 5CA0B 1R1BA 5FZDA 1RJ8A 2BDRA 4C1WA 1WP8A 3U14A 1OMIA 1OXCA 2Z0AA 4E2GA 2QGNA 3F7VC 3LEGA 5J7MA 5HV0A 4KXRA 2D6LX 3AYAA 1NTZH 3ZHVA 3ZMSA 2P3IA 1RUC3 1R083 1HN0A 2ZX3A 5F3EA 1HNWO 4AHXA 3WNLA 3H9AA 1UXXX 3NMBA 2PAKA 4W50A 1H2MA 3NR7A 4NPLA 5BNNA 1OLMA 2PQQA 4P9PA 2JDUA 4XJ9A 1AP6A 3NSTA 3FLPA 2HWF2 1HRV3 1RVF1 4CEWA 5K0UB 3ZR6A 1RSOA 3AZZA 5B1AC 1RUI2 4YM1A 2XUEA 5IYYA 3AKSA 1XOUA 2QWPB 1SHWB 4YVWA 3BPZA 2PHDA 1NE4A 1VBD2 3SITA 3OM3B 5D8AA 1GYKA 3IB3A 3CSXA 5JIAA 5EZYB 1PK6C 3ZRSA 1H8EG 2K2SA 3CJXA 3CXHF 2VC9A 5FZMA 2O1QA 4DR3O 5JLVA 4B3TO 4S2GA 1UWWA 2A75A 4X88A 3E8BA 1IS4A 3PJQA 4BM8A 3NNLA 2RDSA 1PNKA 4EEQA 1BKZA 4TZDA 1Q8SA 4I3GA 2BGCA 1W6QB 3SCHA 2XVGA 3GZEA 5FXVA 1ODNA 4UVBA 4OQ8A 2D6KA 1UY2A 4R7CA 2QR4A 1ZLZA 1VRH2 1NBMG 3JALA 2RS52 1GP5A 3CCVV 4WM7C 2HJIA 4NTXA 3O1TA 4QDRA 5FYYA 3ZS8C 1IXMA 3CS5A 4H55A 1LODA 2C1FA 2NPIA 2HWB2 1F4AA 4CDXC 5E8AA 2JG9A 2ZKNA 4LMFA 3GB7C 4QQ2A 3J4UH 4R50A 2X5IC 1KJRA 2QM7A 3VV1A 2UXBB 4Q0QA 2UXCB 5M0TA 4D7SA 2O8OA 5GZEA 4Q0UA 1SLAA 2GUZA 2BFUS 4FVMA 4IGPA 2WO3A 1ZBA1 2XWJB 4U3JB 2VQFO 3LIGA 2X10A 3U75A 1QH7A 2YI8A 1KGYA 1MQTC 4AI3A 2V4VA 1YXWA 4QDQA 1JYIA 3LOIA 2R9RB 1WLWA 5T52A 3AFKA 5BNPB 4GX0A 1AR71 3INAA 1RHI3 2XOMA 1M57B 3C2UA 5JR2A 2Z4FA 3IDEA 3PNAA 4WFEA 5C33A 1N32B 4LK7A 2Q7GA 2UY9A 1ZZBA 2BPA2 4AHCA 1IBKB 5HPOA 2OIEA 4LCUC 1R092 1YHQV 4Y22A 1H1MA 5C4WA 3U1XA 4JKLA 3LB9A 3P32A 1O4TA 1W04A 2RM22 2AEYA 1AI7A 2I2SA 5FPOA 5FREA 5L9RA 1GKFA 3DF0A 1KU9A 2IH1C 4GZRB 4IYIA 4E4ZA 3ETDA 5JZGC 1EFRG 2JRIA 4CZZA 1S0FA 4E2QA 5A3NA 3NRUA 3ZSEA 1QIQA 5IVFA 3TOJA 1SQXH 2ZIOA 1N3OA 4LH7A 3FN9A 1H2GA 2XLAA 4YG3A 3E22A 1DQ2A 4DV3B 1SF9A 4XEZA 2IVIB 3JD3A 3THOA 4F7ZA 3C7EA 3K03A 2JK5C 3T1HO 3AMHA 3ZM8A 5E79Z 2KB1A 4J1WA 2OS2A 4I4TB 3K4DA 3KV5A 2Q8EA 2YEVB 4E8CA 5JQGB 4FLZA 2DYSC 2WN2A 3HOBA 4CU6A 2W9XA 1PD3A 4FPHA 3M99B 2XH6A 1LU1A 1WBLA 4RUEA 1WWYA 2JDIG 1C4RA 1JYVA 3ACHA 4W4ZA 2N04A 3ZSJA 3FLTA 3ZFGC 4QX2A 3M1HA 5BV6A 5LEJA 4GH4C 2IXKA 1REDA 4JI2O 4JI4O 2PLV1 5FZGA 4CH3A 1LGCA 4GWMA 3CIHA 1WW7A 2UWAA 1JW6A 5ACA2 2A71A 3TYJA 1X8EA 1PNFA 4LT5A 2JS5A 1LOEA 5JDBA 2FMLA 2VZOA 1SQGA 2VMHA 4P5YA 4CCEA 2D3OW 5IYZB 4XDKA 3WG1A 2ZXQA 5FMCA 1M56B 1XXNA 5LW9A 1V55B 4XIOA 1UIKA 3O1OA 2ZEXA 2OIGA 2WBKA 5J36A 4QX0A 1O9GA 2MEV3 3WB2A 2JG8C 2Q6AA 4RHV2 3M4FA 5C8YA 2UWBA 1VALA 3OY8B 4LR4A 5L73A 3HEIA 3QO5A 1UMIA 2RS33 3BUCA 4GXLA 1KEXA 4FFKA 3N7MA 4CP0A 4EJRA 4CCNA 5FPLA 2HWE2 3RYPA 2WL1A 1RUD3 4QQHA 4YGBA 2WS93 1SLLA 4HZ3A 2B46X 1QQCA 4H7LA 2F93B 3AKTA 4HANA 2VR4A 3LEKA 1G6NA 3B8MA 3SKVA 4P9YA 1VQ8V 5CB4B 1OT5A 3LD8A 4F6RB 5D21A 5EYPA 4X8NA 2OPWA 4P9OA 3HKBA 2WLHA 5LK7B 1LNQA 2GTAA 4N43B 2BOCC 2Q69A 4H2AA 2QBXA 2D6NA 2Q8OA 2KA3A 1PL0A 3HN1A 1D5AA 1MS0A 4JV5O 3JSLA 4NTYA 2BWAA 2W95A 1IDSA 4B3MO 3RW0A 4XMIA 4ICGA 4X65B 2HWF1 1PIV2 3VDDA 1KKCA 4J1XA 3JUUA 2ZM6B 5DUUA 1C1LA 4HPKA 3KHCA 5DN2A 4FLWA 4DR6B 2WNVB 1X33A 2HVKC 1OQDA 1VBD1 3OGJA 1PO12 4OHVA 3UO2A 4X66B 4NHKA 1Z7S3 2Y4TA 3IDBB 1JHNA 3CMAV 5CA3A 1JCHA 3E83A 2X53S 3IPVB 1S77D 2MHFA 3PIGA 5EPAA 2LGWA 1AROP 2H0BA 4Q4X3 4ASKA 3B77A 1GZWA 4XC9A 4GX1A 1RUG2 1YFYA 3I56V 3T1YO 5CA6A 4BW9A 2PAEA 3LDBA 1ND2A 3H1HH 1WW4A 4J41A 1NCRC 3AC0A 5EK0A 4E27A 1KQSU 2JD9A 4IEXA 5TISZ 1VRH1 1YI7A 5GLZA 5LRSA 4EN0A 3SH5A 5LMNO 3TCUA 2FDHA 2RS51 3K5MA 3S7IA 4LFCO 3J9SA 3SJCC 5J2UA 2EXHA 1VQKV 1OF3A 1OHFA 1BHAA 1J58A 3RYFA 2YV8A 1MOFA 4RR3B 1EV12 4FOWA 4AVVA 1DF5A 3BHPA 4DV1B 1KBHA 5C8CA 1H8VA 5C3SA 5C9AA 2OKXA 4XDOA 3CL1A 2B9UA 4DXWA 4XF3A 4H13B 5EWSA 3S3WA 4SLIA 4Q4V3 4XFIA 4AGGA 1YQ8A 1H2KA 4FP2A 3SKJE 1QQP1 2BV4A 3S6PA 4QGNA 4WFGA 1NZ6A 1OCRC 5AC92 4AYUA 2CH7B 5D5QA 4XF4A 3SCFA 3UETA 1SLIA 4MGQA 5TSWA 3SMHA 4FOVA 5JJNB 3H42B 1W90A 2HWC1 1KD7A 3IIIA 2YFZA 2IH3C 5I8YA 5CADA 5DUWA 4JI5B 3ZKUA 2EIGA 1GFF2 2WQ8A 3K04A 2PHLA 1PMJX 3KF5A 4AR2A 3ZFFA 4LBLA 1PZ7A 3JD72 5DAXA 4UB6Z 4FP3A 4C90A 4EB6A 5FDBA 2CUGA 4BCUA 1JBCA 3N3HA 4AL9A 2RMU3 4LFAO 1NTKH 4J80A 3APQA 2NMNA 2F66C 3T4HB 1N34O 1CZSA 2PHUA 2VY0A 3ZXEA 1CIYA 1JUIA 1REFA 1VMJA 2DE0X 1CVNA 4O9EA 2XBO3 2IJJA 3BI3A 2FDFA 4XJUA 3ZXFA 1Q5OA 4QXBA 2YBPA 4XZUG 4N7UA 3EVKA 1ZZ6A 3POYA 1UKGA 2VD7A 2Q1ZB 3H1IH 2EJRA 3D5OA 1GV9A 2ZAHA 4JAUA 2FZ1A 4PDLA 1DQ5A 4RD7A 1AJKA 1QMJA 2WZPP 3SJAC 1AR1B 2P67A 4FPYA 1PGSA 5DUVA 4R9CA 3JAMN 3T4DA 1M4WA 1OA4A 5FLJA 1AR63 2DJVA 5EJ1B 2ZGNA 5HV4A 3V0AB 3LA7A 1HLCA 1HXS3 2YU1A 4RQEA 1EN5A 1LAJA 3ABKC 1NT0A 4CDUC 2WAMA 1Q86W 4A45A 1J83A 2Q73A 2HR3A 1W9YA 3JQXA 1H38A 3VBRA 4JI0O 2LFRA 3W7UA 3T3YA 3ABUA 4B3RB 1SZTA 4R9AA 4DINB 2SBAA 2VZ3A 3KMHA 4AVBA 4JYCA 2YBSA 2E7QA 4L9BA 4CXWA 4NWVA 5JVDB 1D2QA 4FFBB 2LW8A 3ASNB 4R6ZA 1RUC2 2EINC 4DK0A 2CGNA 5ACA1 3WNMA 5CFCB 3CNAA 4DFSA 1ZM1A 4ZOLB 2TEPA 1DYKA 3W21A 4FFIA 2R70A 3PIJA 2EIDA 2X6CA 4J42A 2EIJB 3FBMA 1VQMV 1TVKA 4DMIA 5LGTA 1LB2A 3PTYA 1JOPA 3MLKA 1YJLA 1JI6A 4KBZA 3HKDA 1CR7A 4I0BA 1WW6A 1D4M3 2E76B 2HYXA 4YZ5A 3I2GA 4BQYA 3U11A 2VUAA 4MXVA 1XL4A 2M6YA 4XFBA 1FFXA 1EPWA 5B1OA 4O65A 3RYCA 1JU4A 3I7DA 4BMEA 3ZVXA 4IQPA 3OFNG 4RHV1 4QE7A 1QH6A 4NPMA 3F7YC 4GCZA 1J59A 4YM0A 4KFMA 2IU0A 5FL7G 2ZACA 1ENQA 4GX5A 3T0BA 2Y6HA 4AGVA 5F39A 2F1MA 4JVAA 1PGL2 4J9ZB 2WJSA 2DU0A 4ZBMA 2HWE1 1B35B 2RVAA 2QTWB 2ZXWB 4NROA 1RUE2 3IBMA 2E7TA 3BU7A 4ONUA 3VBHC 3KZIZ 4IV1A 5JCTA 3KHBA 3VHPA 1NA1C 4AQYO 5DZGA 1H1IA 2N7GA 3B7MA 3RWKX 2QFEA 5IK8A 4COWA 2WWWA 1SQFA 1YVWA 5A7WA 2ORXA 3VBBA 3G6EV 1W0JG 1YFXA 1QXPA 4PD4F 3QD6A 2GMMA 1X50A 3GHNA 3FJSA 4ZY9A 4DUWA 2C24A 1U5ZA 1V6KA 3LKJA 2A3XA 1NCQC 4QKBA 3PN1A 2VZUA 1PIV1 3H1LH 4JGZC 3NAPA 3W7SA 2YMZA 4RQPC 3ZMZA 3NO8A 1DGSA 2X7RB 1W9SA 5LBEA 4Q4W1 2W52A 1PNMA 1R1A3 5CG8A 2RDRA 1DP0A 5GLUA 3IAQA 4BA6A 1NXD1 1GBGA 5A3LA 2WSVA 4LC1A 5LBCA 1PX4A 3J8F3 4WM8A 4LTAA 4J9YB 3JARB 5KXEA 1HNWB 2O57A 4U3FH 4CUCA 4AAXA 1S55A 1DBNA 2QUOA 1XMQO 1PP9H 3O0XA 3CJHB 1N1YA 1WA4A 4GKXA 5I93A 4AQSA 2R49A 1GWKA 4ZU7A 2ZX1A 5FWJA 1RUG1 4Q4Y3 1HP8A 4G28B 3H7YA 4YJ3B 1BVP1 1I5ZA 2QTOA 1O5LA 1JYTA 1W2OA 2VH9A 3PVOA 4IEQA 2B4KA 4Y1VA 4W65A 1KECA 3IWZA 3LA2A 4L87A 4KWLA 3POSA 3KM5A 5K9YA 3PU3A 2PELA 4R4XA 4DR3B 3VD9A 4B3TB 3WDXA 1I08A 5LGNA 3MAQA 2ZKOA 3D4KA 1MPXA 3KCCA 2VZVA 2Q0OC 1J3PA 1IKPA 1TNFA 3S7EA 4CXXA 4MGZE 5LMUO 1QJU3 4LPLA 4ASUG 4LF4O 2QJVA 4QB1A 5I91A 4RGAA 1V9U3 5FXXA 3S3XA 1FMD2 4FPGA 1MEC3 3K4AA 3I3QA 1GOFA 2GAUA 2XDVA 4RS5C 5LP6B 4JTNA 3IC9A 4YLZA 4CCOA 3CMGA 1I9RA 2EICA 1FT9A 1MA1A 4Q27A 2R16A 2KSDA 3ME2A 2B5HA 4K35A 2BJSA 2AREA 2YS8A 5IATA 2YC4A 4N23A 5LZ6A 3PU8A 1ONAA 3E86A 5FXZA 4U7NA 1QDCA 2C4XA 1OFNA 1WD4A 3H1JH 3T1LA 4CP9A 1JFFB 1QXRA 3JD71 2BW8A 3SHRA 4WBNA 5A80A 4PDVA 2D3RA 2ZDIA 3SH4A 4NOTA 5JIUA 3K77A 2EBOA 4LP8A 4K0KO 2ODMA 1ASJ2 3MIDA 1XNTA 2DWEC 4I3PA 1IBMO 3JATA 2VQFB 3U4SA 1PMHX 3GCWA 4FZ0A 3HPNA 3JB8A 2XG3A 1UPSA 3AYCA 3EFFK 2UYBA 5D1IA 4AI0A 3GGLA 2J1VA 4JGYA 5IVYA 5FZCA 2Z79A 1B3QA 5SV8A 4GAZA 1IS5A 2YU2A 1VEWA 1GWMA 1YIPA 2P6JA 5IY5C 1MZEA 3JAWA 2DFCA 4FO9A 3I97A 4B4PA 2OUHA 4Y5Z0 4UVCA 2JEXA 3ZIAG 4DV5B 1LTEA 4HK8A 1C1FA 3OUFA 5LYJA 2W1UA 5J37A 2WNUA 4UBGA 2XKOA 1OLRA 3RVYA 1AR83 4LORA 1RUD2 4WVMB 2E3CA 2IFRA 1MS1A 4LBNA 3A0BZ 3WW2A 1TUEB 1VQ9V 1GANA 2R072 3CCEV 1XU2A 4LBQB 1WKYA 2C5DA 2YIAA 1XOYA 4FPOB 4CEYC 5FAXA 4GKYA 4UOJA 1HW5A 1H2LA 3M3IA 3T1HB 1RMU3 4QPGC 4MZUA 2JDKA 1VAKA 1PPJH 4OHXA 3STLC 4BMBA 1ND3B 4MGYE 3NVCA 1ZA7A 1HR0O 1F15A 5A32B 4S2HA 3G67A 4HZFA 1K5QA 3DC6A 2J42A 1D0GA 1LOFC 5JPMB 3FUQA 5GZGA 3O7OA 4JRLA 3Q4HA 4QPKA 4QX5A 3TNQA 1ZUQA 4XOGA 2HWD3 1TME3 3RYRA 4JI2B 4JI4B 4HT1T 3THDA 1KJLA 2RG4A 2D6PA 4YGCA 1K33A 4CCDA 2XONA 1UNBA 3D6EA 1X7NA 3O1SA 5FR3A 2RNBA 4IHJB 2G4IA 4RL7A 5A6XA 3Q8EA 5GZDA 4R9DA 1PGL1 1KFXL 1W0OA 1K5MC 5C3OA 4URAA 4IEOA 4AI2A 2VTFA 4QX3A 4LK6A 1XNCA 5T55A 2C9KA 4TV8B 2VJXA 4AI1A 1BXHA 3TEZA 2ZGOA 5GZCA 4F8AA 4QKFA 1ULPA 4LO6B 5CBHA 4ARXA 2ADDA 5T3NA 1SERA 4E4SA 4LKSA 4CUBA 3CC4V 4WM7A 4CP2A 5BZBA 4PDWB 2BOJA 1N1VA 3MLLA 2FQPA 1KRIA 4XABA 2LP7A 3DXRA 1SFYA 5LXTA 3K59A 1VP7A 2WAOA 2KD7A 4ZIBA 4X1YB 1G9AA 3OGCC 1L7RA 4CDXA 2F4PA 3VBFB 3H7JA 4BIUA 4DUYO 5BNNC 3AG3C 1I6XA 3CBNA 2QZ3A 3IMNA 4W6WA 5JWPA 2X5IA 3HPLC 2WDBA 1SLCA 2Q68A 4A42A 2WT2A 1MMMA 4FOYA 4XBNA 2HEPA 5A7QA 4FPEA 4X1IA 3W20A 5FZIA 1WCQA 4F3JA 3RDIA 4LKDA 1WA8A 4YVWC 2GC2A 1MACA 4BQWA 1RYYA 1G8MA 4KHPO 1SLBA 1MQTA 2IW5A 3FHAA 3K5OA 1SCRA 1HB4A 3UK9A 4DUZO 5LA2A 1JZ8A 5FYSA 4JV5B 1ZNPA 3WNNA 1GZ9A 3J7AU 4UCVA 3ZSKA 1YF2A 4I09A 4B3MB 2W3JA 4Q8KA 2OA2A 3ZR5A 1Q8OA 5DAPA 2RS12 3HQXA 1GM8A 3DCQA 1K4DC 2RMU2 4YZ1A 4X1KB 3T30A 5F7UA 2BBVA 2XOKG 2VMEA 4XJZA 2IU3A 5CA1B 4PQQA 3BVCA 3P5BA 3FHIB 3VBUB 3F5WC 3ABLB 2XBO2 2X29A 1XE7A 1UOGA 3IDCB 3ENRA 1RB8G 5FZ7A 2BGOA 2Q67A 3B93A 4EFEA 3SEPA 4DR4O 4OULA 2E5LO 2A06H 1NXMA 5JOXA 4BDVB 1L7QA 3GYDA 1SKVA 2VBPA 1ROPA 5JZGA 3ZYRA 1W6OB 4MXWB 4D6SA 3I2IA 2ITCC 1YZBA 5JSOA 2GC1A 3OMAB 3T1YB 4LIVA 3VBOB 4YW7A 3LSSA 2P6HA 5FZEA 2KG7B 2G9FA 4M00A 4KP4A 1OCCC 4ZPIA 2Q8CA 2JG9C 4ZI7B 4LXLA 1FMD1 5F6LB 1CQ9A 3AB0A 2GU9A 4MTFA 3Q9OA 3J26N 5DM6V 4LFCB 5CFDB 3TAYA 3ML0A 1RUF2 4HN0A 1SG3A 5FO9B 1FXZA 2QQJA 3WP5A 2QQVA 4LQRA 4JZ2A 1QLEB 2WIIB 1X82A 3N27A 2Q30A 3KQRA 5I8TA 5E6HA 4DQAA 3B2EE 4XF0A 1Q43A 1RUH2 1ZBA3 3J7NA 4IIJB 1PM7A 2PMWB 4XJWA 3VN4A 2GNBA 2A7WA 2AHZA 3CCSV 4NIIA 2WLIB 3OR7C 2DW4A 1YFUA 2MPFA 4ITCA 4PA4A 1ZRCA 4AF9A 5JUVA 3LUTB 1FJGO 4QXCA 3RN4A 3CWBH 3GZAA 1AR73 3MLJA 3HKCB 3N35A 3ZFGA 1R3JC 3CJIA 1W8TA 4CA9A 1Q8VA 1W6MB 4TV9A 3BIEA 2PF4E 2G19A 4IYHA 1AL21 4S2FA 1GQGA 3EO6A 1ULDA 3TN91 3V0BA 2DUOA 4OX9O 2D3SA 1AILA 3H1KH 1LGNA 3Q8FA 4XACA 1IVSA 4D94A 1ZBE1 3SPGA 5BNPC 3D0SA 2R062 4LNVA 3JAKA 1S76D 2E31A 2OX0A 2XWBB 1WLEA 3X2QB 1M57C 4NHMA 2WLKA 4YY3O 2DYCA 1Y4MA 4LFAB 3FX7A 5CNAA 2ES3A 4UFHA 5FZAA 1N34B 2RE9A 2XXZA 1FNYA 4NR1A 2JG8A 5SV5A 1TG7A 3HT2A 1BZKA 3AYEA 3WCRA 2WQZC 3WP4A 1OCOB 1DQ0A 5H9PA 1VBE2 5J98B 4XW3A 3GBGA 2G9GA 5DAQA 1DGWA 1VBC3 3AZWA 4PBPA 1V6IA 1BEV3 2XB6C 3VDCA 3OEEG 2A3QA 1Y9GA 4DV2B 4L11A 5EBMC 3O5SA 3WW3A 2Q7HA 2WA4A 2A9HA 4Q1PA 5FZ8A 5EP9A 1HN1A 4FTBA 1BLZA 3OG2A 1YFWA 3M3QA 5FMOL 4R9BA 1FAYA 3RBZA 1GH6A 4A41A 1CAVA 2XKPA 3RYKA 4OYUA 2JIZG 1XL6A 3IT8A 2UUAO 4HKWA 3LE0A 5FY4A 3BKZA 3L9JT 1TQ5A 2VUDA 4E9KA 5A3OA 1Z78A 2PLV3 1QCEA 2DURA 3E8FA 1GR3A 4W4KA 1Q56A 4OMCA 1Z0HA 4GULA 2CAUA 4JI0B 4UCUA 5EXOA 2CTRA 3PVNA 2A73B 1YQ5A 4ZS2A 2GDFA 4QQLA 1LECA 2XL9A 4L8QA 5JOWA 5L9BA 1UOBA 2DBNA 1G6UA 4XBQA 3ILNA 3VZLA 1GQHA 5B5EZ 2QE7G 1WB7A 4ABMA 3OBRA 5C5TA 3J8F2 4O4HB 2JEMA 1AUYA 1WLDA 1YEWA 3PUIA 3AL5A 4C1XA 2PTMA 1AXYA 3OB8A 2LGQA 1YIJV 4G4FA 4XQDA 5LL6Y 4JDMA 4FSJA 3H1WA 3KV9A 1RJ7A 3VZMA 2ZIMA 3WSOA 5K8SA 4YVSB 2BQPA 2Y6GA 4AZZA 2VPVA 1EP0A 3OPTA 4F83A 3V64A 4FCAA 3KZ4C 4GB32 1NCRA 1UU6A 2WSSG 5FYCA 1C8NA 2Y26A 2Q1FA 4MVQA 4HSJA 4YM3A 1APNA 2F95B 5DDJ2 4JHTA 3OUHA 4OMDA 2ZGKA 5LHGA 1HV1A 4FM2A 5B1NA 4FLXA 2NN8A 2CAVA 1MVQA 2JX9A 3PLQA 3GF6A 4CZSA 3ZMTA 3PDQA 2LROA 1QJU2 3ASOC 3W59A 1SPPA 1Y74B 2GBOA 2ZTNA 2BCCH 2ZX4A 5LY2A 3AEIA 5IYBO 3AG2B 4PV1B 3N2KB 1MEC2 3I2HA 4Q26A 5KWRA 2JGUA 1QJX1 1GNYA 4AQYB 4LE4A 3JD1A 1HKDA 3VDDC 4META 4W6XA 2BTQA 4MVMA 2WLQA 1EM1A 4LIUA 3USUB 2HWF3 3AMPA 3R4SA 2X6BA 1N36O 4MH0E 4YM2A 3I3MA 1RUI3 3OGIB 2VMDA 2P37A 1VBD3 5HI0A 4IGQA 2ZE8A 3N2GB 5T5PA 4BLIA 3ZYIB 1YDXA 3FB5C 4N43C 3MV01 1XUQA 2B9ZA 3UQ8A 4BE3A 2ZHMA 3O0WA 1MR5A 2RS11 2P5OA 3WR0A 3IFXA 4DRXA 3TBDA 2R30A 2R6QA 2YB7A 1ND2C 1EAH2 3CX5F 2PHTA 4GWNA 2YBKA 2PI4A 4MOAA 1KB9F 1H1AA 4YZ2A 5FMOS 5FP3A 2RHPA 1HB3A 1ULEA 4O2BB 2W6JG 3H1MA 1HW7A 4FVVA 1VRH3 3MYXA 1JZ6A 2JDAA 2G38A 3WF4A 4JI3O 5KHIA 1YWKA 1XMQB 5F3IA 4PJ0Z 2RS53 5FZHA 3M8LA 2JGDA 4LWSA 5KLVH 2ZHKA 3QTCA 3B4SA 2CDOA 2PXJA 3KT4A 3RMXA 2OZJA 1LHVA 1GMGA 5C8CC 4O61A 1RINA 5F37A 1VQ5V 1CAXA 1XNDA 5FXWA 3VQXA 1Y6XA 3CC7V 1NR7A 3A8TA 5ANQA 2ZEYA 4PI0A 4X20A 3G7DA 2HWB3 4N8MA 2EIMB 1CPYA 3OBZA 4TWKA 3U4XA 4PELA 3VQYA 3RYHA 2D2CB 4IL6Z 3ZN4A 1JX9A 1DLLA 1GO3F 3W5MA 4AG4A 1NLSA 3CKHA 3VKFC 2Z2SB 5EQUA 1ZZ7A 2VUCA 1Q8QA 3ON7A 3GM8A 5KAFZ 1QQP3 2QWNB 1UX7A 4LOTA 4CDUA 2X8KA 3TEYA 4TQFA 1UY3A 3WG7B 1UU5A 1NYWA 3UCSC 5IJRA 1IPSA 3NJZA 2AACA 5LMUB 3FB8C 3OCPA 4RR3C 4LF4B 3IM0A 2GALA 4IE6A 4P9LA 1VQ4V 3GCXA 2F23A 3BIWE 2R042 4K8RB 3LWCA 4Y26A 3F2ZA 3E8GA 4LF7O 4GKKO 1JVMA 1WGPA 1XSRA 5C3PA 1UZYA 2ARXA 5FY5A 4IGGA 5FMBA 2QWQB 4KL1A 5F6KA 3ZPOA 2Q1MA 4Z92B 4GZ9A 1ORQC 1R093 4XFGA 1FNZA 2VMFA 1ZA4A 2AZ2A 3U0ZA 4AVAA 4NXMO 4RFRB 4AFBA 3FKSG 3MIBA 1OH3A 5FRAA 2RJ2A 1ZREA 1ZRRA 3BPSA 2R061 2J1UA 4K0KB 3R0RA 3J81N 1I94O 1ZZ8A 2ID4A 3IGAC 1SS3A 2A6VA 2YPJA 2GP5A 1IBMB 1VIWB 5B4XA 2P6CA 1XYPA 1WW5A 3ZFEA 4E4HA 1KS5A 1V0AA 2HFEC 4ZU4A 1QOOA 3ZYBA 3P3NA 1PGW2 4A7ZA 5BNOB 4C7UA 5KR7A 4NKGB 1W6NB 2Q0AA 3I3BA 5T5JA 4KWKA 4G27B 1DGRN 1CZTA 3UNPA 4JDNA 5K1PA 2VOKA 1UX6A 4UFMA 1UZVA 2WLLB 4IERA 4FMTA 1HDKA 5FKBA 1P7GA 3JASA 5F2VO 3MHHC 4NVPA 4BU2A 1NA1A 2BP6A 2W92A 3V56A 4YGDA 4OLLA 2WR9A 3W58A 3VDBA 4PJYA 4XUNA 5JI7A 1HJFA 4GIQA 3E5UA 3NV4A 2RMKB 3LSEA 3ZLIA 4WFBV 1MS4A 5FZ4A 2CU5A 4JI8O 1UY0A 2WT0A 4JCKA 5FPUA 2UXNA 1YI9A 5IE9A 2C6SA 3CF6E 1M4UA 2P22C 4LULA 1SESA 2I07B 5KXBA 4X89A 3HB3B 4MHUA 1Y76A 4O2AB 5FO8B 2YXHA 2XJQA 5ACA3 1G9CA 4TUYB 1OH4A 3VBSA 1H8TB 1NCQA 2OZ6A 2Z42A 2VQUA 4JGZA 1U5XA 3KS7A 4CDQB 1DK1A 2IC1A 4AAPA 1RVF2 1MZ5A 4CC5A 4YIPA 1SDWA 4M3CA 3BY6A 1GU3A 3L70H 4BK5A 2DCYA 4JAAA 3VB9A 2E63A 3RQ0A 3N9MA 3MPPG 3K0GA 1S0VA 3ASNC 2XGXA 3ZN6B 2RJKA 4UF0A 1HR0B 3CCJV 5KMGB 3ATGA 4RHV3 5CFCC 2X05A 1LUVA 1WBFA 1JU3A 5FLHA 1AR4A 1F31A 4OFGA 2VVFA 4MTOA 2OTJV 1CZVA 4L92A 2VE1A 2NMOA 2EIJC 4DR7B 2DBIA 2JJ1G 3FFQA 1X9PA 4WFHA 1Q3EA 2QQOA 3RSJA 4GB31 1NS1A 3QLQA 2HWE3 5B1AB 1CAWB 5KHGA 1LEMA 3NV1A 3AG1B 1LGBA 2A6ZA 2ZGMA 5H9RA 1QBZA 2CV6A 5FWEA 1F5FA 3MDSA 1OA3A 4YPJA 1H2SB 4IDZA 1C28A 2JKBA 1PK6B 3T08A 1JTZX 4JTCB 1LUWA 2YXSA 4O4LA 1P84F 4RO2A 1JHJA 4A3ZA 4Y24A 1AR5A 1N8RW 1P8JA 1A3KA 2E75B 4IE0A 3DL3A 1W0NA 4F4LA 1F2NA 4PLOA 1DGLA 1NTMH 3AL6A 3WB1A 4AEDA 4JI5O 1G9BA 1U97A 1B35C 2ZXWC 3OAAG 1W59A 1HQWA 4RS5A 3NAPC 4Y1XA 3H0OA 2P7TC 2IZWA 4NHXA 3CRMA 1HIXA 2QQKA 5BY1A 1PIV3 1D7PM 1LEDA 5GLWA 4Y1ZA 4H44B 2WC2A 4WVWA 1EZJA 2PFWA 1V6NA 3IMMA 3POBA 1BCXA 1FOD2 1A34A 3L2YA 3EMRA 3QH6A 4LA3A 2DOSA 4HKOA 1PO13 2WINB 4PF5A 1LOAA 2YDEA 4QIWF 3ZRWA 3QVNA 5IJ9A 4Y5SA 5A1AA 2LTNA 4CSWA 4DUYB 5IT9N 3FAVA 5LGUA 3D3IA 4FOQA 3VD7A 1PO22 2YPDA 2ZNIA 4MS2A 2WT1A 1Q6UA 1GNZA 1IPJA 5C8WA 1XHXA 4I0AA 2QDOA 4PA9A 3T2OA 4G2KA 4XHXA 3NV3A 1EAH1 3D3QA 5K4LA 1RUG3 1PNLA 4PA3A 1O6UA 4NIAA 3I59B 1US6A 4KHPB 1DQ6A 5FY9A 5A2QN 4MGSA 4DXRA 2J1EA 4UUJC 1S0CA 4DUZB 1NZCA 1E79G 3OEBA 3HMYA 2QM8A 4JHZA 4R8HA 4C0BA 1YIFA 1S0IA 2EILB 2VVEA 5JR7B 1W03A 1XC6A 1UKRA 5L3BA 2B9VA 3LEIA 1MS8A 5T5OA 2BRTA 1W8WA 1VJ2A 4EV0A 3TEWA 1K12A 3VD5A 3NWKA 3OYWB 4DEQA 3NJYA 4IEZA 4UW4A 3ZYGA 4LJHA 4O4JB 1LULA 2J22A 4DR4B 2E5LB 4DXSA 2RV9A 5AC93 2JE9A 3P1IA 2ZEZA 4DOUA 1GAXA 1X9TA 2XLGA 3CC2V 2XJVA 2RCVA 3J80N 4JKMA 2PN5A 4HBNA 2R041 3G6JB 1YNAA 4YG0A 1S2EA 1KP3A 4CEYA 1JJ2U 3GWOA 3OTOO 5CEHA 3SYPA 5CG9A 4XFFA 4B7KA 2BYVE 4LF5O 3NW4A 3JD73 5A1FA 3SR2C 2WYFA 4BXSV 1SA0B 5BMVA 1XNQO 1M90W 5LP6C 2ZOEB 3PTRB 1UFIA 4AK3A 1B04A 1XI1A 1YLLA 5HCFA 3RNSA 2ZNJA 2YXLA 2DYSB 1GLHA 1YJKA 1LOFA 1CD3G 3R05A 1FJGB 1UJWB 2K1EA 1O91A 3GALA 4NXNO 4MW3A 3N7JA 3DUIA 3CDZB 5T50A 2BFUL 2QWRB 3F5TA 1O9HA 4RAIA 4GH4B 1VMHA 1FPN2 1YHFA 3KCYA 3ES1A 3E6DA 2DWDC 1DU3D 3LDKA 2MK3A 5KA6A 3WOGA 3MFAA 2EZOA 3ORJA 4OX9B 4O4IA 3TETA 2ZCEA 2BSKA 1O3TA 1K5MA 4YJ2A 2WNUC 3K48A 1DZRA 4PIZA 1PNGA 4HG6B 5IVCA 1WB8A 1GQPA 2A6XA 1XJAA 5ISLA 1HNZO 3SYAA 2D44A 3WG3A 1K42A 4YY3B 4N90A 1F5JA 3LIHA 4IE7A 1N1TA 3EXAA 2ZZJA 1CPMA 3K3NA 1N33O 2I45A 4J6GA 3MHZA 2ZINA 3RVZA 4JAVA 2VBBA 4OPAA 1SZXA 4LUKA 5FY0A 3JBG1 4J7KA 3POEA 5BXXA 1W6PB 3WNKA 4DXZA 4CU8A 4LNUA 1FXKA 3GHMA 3SCGA 1AX2A 1DIWA 1NY71 4NRMA 3ALQA 1DDLA 5JSRA 3MICA 4M3CE 5GKAC 2PYJA 1NH2B 1VBA2 3HN3A 5ABJB 3CXCU 1XNRO 5CA0A 2MEV1 1G7YA 5IW0A 2UUAB 1Q82W 4CU7A 4XTMA 4C0HA 1SZBA 3ACGA 4QKDA 3TXQA 3VHOA 5EIYB 3WZ1A 1N1SA 2HBUA 1UPIA 3PUHA 3HBZA 5DG2A 3WHUA 4PA6A 2W1QA 4B29A 2R0HA 4AVCA 3MEPA 3TWIA 3N9NA 1YTFB 4BIZA 1S0EA 2RJLA 5AG2A 1OV9A 1OVPA 2V5DA 2K9PA 1YQ2A 2ZGPA 3WF0A 1DCSA 3VQWA 1D5NA 2W87A 2W0FC 3OMIB 2HEVF 3I2JA 3AM2A 5K0UA 1Q8IA 2PYLA 1RUE3 4TN7A 4CS4A 1RUJ2 3DGTA 2HBTA 4XUTA 2H6CA 2F4LA 1ENXA 5FOJB 2GMPA 1UAIA 4OI4A 3DV8A 3OUIA 1UY1A 2XVLA 1DF0A 2JVDA 2OTLV 5J2TB 3CE2A 5IVEA 5EZYA 5E89A 1C5IA 5I0DA 4Y1YA 3MV11 2V73A 3U07A 5DAVA 2WO2A 4M4PA 5L19A 2WNEA 3K75B 3I2FA 1E5IA 2ZKLA 2YIDA 4KQ7A 4XPVA 5D5PA 2D6MA 2WFF1 2ZT9B 4YYOA 1NT2B 1FX5A 2MNGA 4JTOA 1TMF2 4TWTA 4EZ4A 1W6QA 4FFHA 1FXVA 2EAKA 5FMDA 3ZMUA 1UZZA 4LBQD 1W2AX 2LJ2A 1QQP2 2GZWA 1H6XA 1GRJA 3OUSA 2C2AA 5EC2C 3KV4A 1TAEA 1NKGA 3GDBA 5CKMA 1FOD1 2XTAA 1LHOA 4HVRA 2W08A 5FY7A 2JEUA 2QKAA 3R65A 1U0AA 2FD8A 3RZLA 2YSUB 3WEZA 1MSWD 2ARCA 3T2MA 4FM0A 3B9IA 2HWC2 1K4CC 4D6QA 4Q4X1 4ISRA 3K08A 5A6YA 1AYN1 1W99A 5FUIA 4QWNA 3SYOA 2EA7A 2VOTA 1SBDA 1PO21 4ASLA 1PMIA 4OI2A 4IGOA 4Q5OA 1ZL8B 5CBLA 5F9TA 1DF4A 3VBFC 5B2GB 1MZFA 5A3UA 4YZ3A 3IIAA 3FD9A 2RR11 4LF6B 1UZ0A 1UMZA 2FTKA 1N36B 5HCBA 1GTOA 3N9LA 1JODA 1K5SA 2QQUA 4QX8A 3L74H 4GMP1 1G86A 1OQEA 3CP1A 2B42B 2CDYA 3CCMV 4DV5O 2R7EB 4FLYA 1O59A 4U3JA 5CYYA 4FK5C 5FQ0B 2GSMB 1AP5A 4UXAA 1YJWV 3OEAA 5BNPA 3OD0A 2WAAA 4FJCC 1VMFA 3PUSA 4Q4V1 2VNGA 4FAHA 5HFMA 3AG4B 2B39A 3BU0A 4UWDA 4PLMA 3ZXGA 1RXGA 3AK3A 4SBVA 4NHYA 5IJ0B 1W28A 1IG3A 2Y6JA 4ZZ8A 5JJJB 4Y20B 4PF1A 3RJ2X 1IXBA 4QGLA 4WFFA 2JE7A 4DR5O 2WUHA 3OSDA 3CD6V 1RC6A 1FMD3 2EALA 4E8DA 2KM2A 4XHBA 4JI3B 1RPOA 3VBUC 3HNMA 2W94A 1XU1A 1L3JA 1QOTA 3T0AA 2XL7A 2GMEA 4LHSA 2VOWA 4BIFA 4N21A 2ZR3A 5GONB 2W1WA 2XPJA 5FYTA 2EVXA 4GMP0 3CMEV 1C5HA 4E2SA 3I55V 2QQIA 3ZXKA 3SLIA 3C7HA 3M3CA 5I0SA 4EQVA 3LSDA 3G80A 3CJIC 1UXZA 1GOHA 1ASJ3 5CFDC 2NR5A 1THZA 4CDUB 3PVBB 2W46A 4UYBA 3OUJA 5FZ6A 1PV0A 3JD0A 4I4TA 4RGGA 2VZPA 4UCSA 4XCBA 2YEVA 5JQGA 1BVVA 3E1F1 4IL7A 1PL4A 4W4LA 3EYPA 4LF7B 5C7GA 1Y7BA 4GKKB 4Q29A 3WQ1A 1GICA 1F4HA 2XHKA 1ZBE3 4MGIE 4JDOA 4JZGA 5GTHZ 2QEXV 3RYIB 5JOYA 2B5UA 1L0LH 1FPN1 3M3EA 3WLUA 3KQ4B 2A79B 4AFCA 3F95A 2E26A 4COVA 5DXDA 1VB2A 2EINB 1AR61 4H0LB 4UB8Z 3D3AA 4BIOA 4ZKIA 1DZQA 1AJPA 5CBGA 4NXMB 2F4VO 4XTPA 2JDZA 1I3HA 3UT0A 4M4RA 5LA9A 2JDMA 1DTOA 5BNQA 1NLQA 1WP7A 1M1KW 1BQPA 3RFRA 3ZX7A 5CIRA 1I94B 3FYIB 1ENVA 4FFFA 2QA4V 1KYOF 3TNPB 5IYZA 1T2XA 3IDAA 3J7LA 3RJRA 4QPYA 4Z82A 2R073 4N53B 1YITV 3K4ZA 4DV7O 4JQTA 2IWGB 3HNYM 1V9PA 3K79A 3AMNA 4A3XA 2JWPA 3BABA 3T1MA 5IWAO 1GK9A 2E32A 3DN7A 1SFPA 3HBKA 1OOPB 2EZPA 3S5QA 3OY8A 1OLME 4WF9V 2ZA9A 3ZEDA 1FAFA 5A6QA 4D3WA 1AR92 3VL9A 1I5XA 5KBFA 1N0NA 1H9WA 1O4YA 2CAZC 4PQ9A 1QVFU 4NAOA 1SQ4A 5LA6B 1YUDA 3VBHB 4OHYA 4D0QA 4GYCB 2CHHA 1BYHA 1V6LA 1K3IA 3N36A 1VBA1 4MYEA 4OXSA 3UL2A 2LW7A 2ADPA 4FBFA 2W1SA 4JI8B 4Q4W2 4NWWA 1R6TA 2OQ6A 1C57A 4G3YC 2DDUA 3FHQA 2HEWF 3O9OA 5CB4A 4F6RA 3WB0A 1WAZA 3BFRA 1IKQA 2H3OA 1CESA 3AP5A 3TB0A 3RMYA 1HRI2 2XQRA 3ICXA 4N43A 5JXHA 5CMUA 1FXHA 4Y33A 5JXJA 1VBB2 4FQ4A 1AVBA 3KKYA 3OR6C 3H8OA 1O8PA 3SDLA 3FE5A 1QNWA 4ZHQB 1WLCA 4GWIA 2X6AA 2DV9A 3H8RA 4RQPB 3SGIA 5FNVB 1VP6A 2ZD9A 2A1XA 4NIDA 4D8MA 5EIBD 1F9KA 1RUJ1 2UYAA 4YGEA 4HAMA 3T1CA 4XBLA 2WNVA 2KXLA 1ULFA 1HB1A 3W5NA 1OI6A 1QY4A 4FLVA 2DCZA 2UU8A 3A0NA 4K8XA 1H2NA 2YIBD 1I0HA 4FZ1A 4UAPA 4KG0A 4QX1A 2QTSA 3CYOA 3JD2A 3SXWA 3ZYHA 3DYMA 3IPVA 2FDIA 1A6CA 3T0DA 5ITZB 4OCTA 3DPRB 2VULA 2VZQA 3AJYA 5LOVB 2R0FA 2AZ0A 1TMF1 2XAQA 2GN7A 1H30A 3IZOA 1UYXA 3ZN1A 3MI8A 5FV3A 3OBTA 1GN6A 3VHRA 1QJX3 2J1RA 5C93A 1REEA 1MG1A 1BE3H 1E57A 4K3UA 3NXSA 4B3NA 2HYKA 5L7OB 2VCBA 2LS6A 4G9SB 5ERLA 3L9DA 3ZBHA 1YYNA 4CUAA 3CLPA 2HKOA 5KX5B 3K2OA 4JZRA 4RR3A 3UKVA 3T2QA 4AW7A 3ZXAC 2WN3A 2AUYA 4A4AA 3Q8AA 5K1XA 3ZSLA 1EZVH 4Q4Y1 2EXIA 4YW4A 4DUVA 2IXJA 3SISA 1YQ6A 4FTSA 1UYPA 3AG2C 3W9AA 5HFLA 5BUVA 4R8CA 3ZX6A 4CRQA 3C3TA 5CVRA 4EWAA 3WFVA 1XEQA 1JOYA 4IV3B 2RS13 1F51A 4DRRA 4CE8A 1XMOO 3BYWA 3PUQA 1S0JA 1Z5VA 1QJY1 4JQRA 5AVPA 2CH7A 2K9ZA 1BBT1 1ZTEA 5LRRA 3NNGA 1DQ1A 4OZOA 2JDHA 4YFZA 4CDWB 1BK1A 4DV2O 1ZVFA 2OIIA 4K8FA 3B09A 4LH6A 3WCSA 3RI9A 1RP3B 1KMIZ 2EAAA 3FFZA 4CPBA 1BT8A 5J1XA 1URFA 2CE4A 4TXWA 5KA5A 2HLDG 4HLTA 1G9DA 3HR0A 4KU7A 1LNSA 3J7MA 4AVSA 4HNAB 3PVEA 4BQ5A 1XBFA 2PZSA 5BY5A 2BEOA 2EIBA 2A3YA 4I0XB 1JMKC 4EE2A 1RUF3 4LFBO 2QKSA 2QVSB 3ITQA 5A33B 3VZOA 3P3PA 3STZC 4MHRA 4I50B 1JZ3A 1NE6A 2BERA 1YCIA 1X8MA 3AVRA 4QXKA 4NUBA 3VKOA 1W8ZA 2FB5A 3I4IA 1FYJA 2A6YA 5IVJA 5DPNA 1RUH3 5JH7B 1K5JA 1FV3A 4HL0A 2KQXA 5L3CA 2NM1A 2R1DA 4F6EA 5B1BC 2OVUA 3QOPA 3RWRD 2JIGA 4B4QA 5C6CA 2CYFA 4UFJA 2YGLA 2ZGTA 1Q7YW 4X62O 1ULCA 1ST8A 4Q2FA 4XXAA 2VOVA 4Z2WA 2Y38A 4XF1A 1VMGA 1CX1A 4AOCA 5FK8A 3V0AA 4I55B 2V4DA 5CN0A 1L0NH 1C8M2 4A2UA 3C7OA 1YRZA 1T5EA 3O1PA 1LU2A 2VZTA 2Y48A 3OTOB 3HVDA 1OSGA 2BU9A 4H7MA 2P4EA 3AK1A 3NJXA 2R1BA 5FP9A 4LF5B 3H01A 3O1RA 3AP9A 4FPJA 1E5HA 5AVAA 5EV7A 3WU2Z 2R063 4QPIB 1XNQB 2ZGLA 1K97A 5JVDA 4FFBA 1DHKB 3CRRA 1TUBB 3AYDA 4NB5A 3HNBM 3ZFEC 3ZXJA 4Q1RA 3UT5B 4D7YA 3EHBB 4QPGB 4UFKA 5CFCA 1OKQA 3WDVA 1R3LC 4ZOLA 3MDPA 1SC5B 4QPWA 1VBE3 2L35A 2DVDA 3HKEB 3B01A 3KLSA 3RT3C 1VQOV 2CTWA 4NXNB 4J10A 2QE3A 1AJNA 4ATEA 1VQPV 4AQTA 3M7AA 1W2TA 4MLOA 4LBEC 1WMFA 4XYXA 5FZOB 1CAUB 3UV9A 4DV4O 5B3SC 3GJBA 3OGRA 1RMU1 5A3PA 5FUPA 1YI2V 1ZZCA 4D69A 4IW3A 2ARBA 4OI0A 3ETGA 1DYOA 2HEYF 1HNZB 1AR91 2Y34A 1F7YA 1VF6A 4UFZA 1Q81W 3WY6A 1B35A 2DTYA 4XFHA 3VBSC 1R6NA 4MVZA 3BN6A 1N33B 1LRHA 3RPQA 1LESA 5BPXA 3HQUA 4NRQA 5LB6A 5DUXA 3OMNB 4IEYA 2ZMNA 3WDUA 1L8DA 4V1PA 5LCWL 2DF7A 3LF7A 2D98A 1WN7A 4CVUA 1PHMA 1NU1H 4BPZA 3CRQA 4LO4B 1SCSA 3SH3A 1HRI1 1SRYA 5IYCO 2WWSA 3AVSA 4PDMA 1VBB1 3ETPA 2WA3A 2Z5WA 3ZPYA 5GLTA 3B5LB 3TK1A 1DGWX 4EROA 4NRPA 3DC5A 3T2PA 2Z3YA 2YZ4A 2H6BA 5BNNB 4W8JA 4ZONA 5AFEA 4M0NA 1XNRB 1W3VA 1H8TC 4HMZA 1O8SA 1H6YA 1XHZA 4X8PA 4CEWB 3T2TA 4CDQC 4I9WA 1RSOB 1SLTA 2R9AA 5L3EA 4FT8A 1WPXA 3KGZA 4XAAA 1SQBH 4B1MA 2WABA 5FJKA 5FP4A 4GB33 4YVWB 4CXYA 3MFCA 4BJ0A 1WCSA 5D8AB 1WMEA 1Y9QA 3O14A 5DDJ3 3UYJA 4LBKA 3JARA 4YW6A 1I5PA 2D93A 5IFTA 4P08A 1UCXA 5HCHA 3APOA 4AILC 2LM3A 3VZNA 1QR8A 4QX7A 1UMHA 3CJHA 3AP7A 1NAEA 3WT3A 4LF9O 1COV2 4JV4A 3ASIA 4AEDC 5FZ0A 4DPNA 2ZZQA 3L71H 3HR9A 4O9GA 3WUDA 3FYEB 4YJ3A 3M2MA 4X6RB 3VKMA 3ZIWA 2GH8A 1CJPA 4EKWA 2WNOA 2VAUA 4I02A 3AG1C 2P34A 3L73H 2K0GA 3RZZA 3JALB 2QQWA 3RGBA 1W8NA 4PIXA 3UO3A 3BTYA 3VZJA 1KDKA 4NJ4A 3WG2A 1FD9A 3K3OA 4DB5A 3AP4A 1S0GA 2WPDG 1AI5A 5DZEA 3CU7A 1OKOA 4MGTA 1OCCB 4TLGA 3AZVA 2JG9B 2GNMA 4LKEA 2YG0A 5FLIA 3LFMA 2VNOA 3S30A 3P6BA 2VS0A 4XDJA 5FZBA 1D2SA 2DCKA 1VLNA 5LP6A 1AXKA 4GJYA 1AL22 4KWJA 3UKTA 5J3UA 2GUZB 1EAH3 3TN92 2DYRB 4BQ3A 2VU9A 2BTVC 3ILRA 1GZCA 4I2OA 1D2DA 3T4VA 5I0UA 3SJQC 1PVC1 4XZPA 4FM1A 3AP6A 3D0JA 2ZMKA 5L3DA 1ZBE2 3S0MA 4QAWA 1KS4A 2VL4A 4LHKA 4B8EA 4HOOA 4XDLA 1WD3A 1JFFA 5LY1A 2UXXA 3ZCCA 4QGPA 4DS0A 4Z2AA 1XB9A 1Q6HA 2HH9A 2Q8DA 4KWUA 4A6OA 4WVVA 1YJ9V 4HETA 1DLCA 4Y22B 4BHPA 1LOCA 5C4WB 2ZGQA 4QQPA 2VXJA 1WUVA 1FV2A 1TA8A 4N9HA 4LF8O 3POJA 1X59A 2TNFA 3A2FA 2UUBB 3JXSA 2EILC 3B69A 5E16A 2JIJA 5A70A 2B1GA 3B40A 2PUSA 1UYZA 3U78A 3OGGA 4H14A 5EJZB 1XREA 4DR5B 3NNMA 2R043 3ZYJB 1PX3A 4PT6A 3CZJA 2JS3A 1KUQA 3E22B 2AGSA 3MZHA 1WCUA 4FPCA 3SYQA 3BCCH 5CISA 2BNNA 1O3SA 4DW1A 5FPVA 3MHSC 1C8M1 4WVMA 2AR6A 1EUTA 4FQZA 1NKDA 1XE8A 1FS0G 4LBOA 4XILA 5CU1A 3T4ZA 5A9GA 3SC7X 3TGUH 1W9TA 1DLBA 3UESA 4DR7O 4LBQA 4C8DA 2JECA 1V54B 1JYNA 3WNPA 1V6JA 5FPAA 4XMAA 4FTEA 3LNNA 4DUXA 5C71A 2B45X 3WDYA 2W6IG 1LJ7A 3M3OA 2FDGA 3CPWU 5GM0A 1D4VB 1JJOA 2E9QA 4U2AA 5DEDA 2WRAA 1VBC1 3AG7A 1BEV1 3GXUA 5FZFA 1UYYA 2TBVA 3EBRA 1R64A 2BBAA 1O4ZA 1VQ7V 4M0HA 2XHNA 4WZFA 1ND3A 3FBYA 4E4DX 3A21A 2I74A 3R6SA 1RUOA 1B06A 5T5LA 4YFWA 1KKDA 5A32A 3ZMVA 3LDDA 1OCZB 1LR1A 4K20A 1W2NA 3RZGA 1J3QA 4EN9B 4JYAO 1Y3TA 1GN4A 1OURA 5FBZA 2ZX2A 2X09A 1VE0A 4AQ2A 1OC1A 1SDDB 2PYTA 2GH2A 4CS2A 2F4VB 3PURA 1T6GC 4TSVA 4BZ4A 2Y0PA 3LSUA 4A6SA 1TZOA 5C8YB 3KT1A 4IHJA 5BXZA 2VBDA 3KT7A 5FZKA 3JBG3 4DV0O 1PM9A 4X9QA 3D36C 4UCTA 1FXKC 5H9QA 4JC1A 3KGLA 4TV8A 1Y66A 1W8FA 1QJX2 1KD1W 1JA8A 1SBFA 4AXOA 1BQ0A 1S5HC 2BOIA 4DV7B 3PJYA 2VNRA 3V65A 3CCLV 4OUSA 5JVVA 2P1BA 3DTUB 1OD3A 1IZ3A 5IWAB 1RVF3 1SETA 1VRBA 3FB6C 4PDWA 5DECA 2XJUA 2WZR1 4N9IA 5EYPB 4V2WA 3EB7A 1B6QA 4DR2O 3ASOB 2OT7A 3H3ZA 3HKBB 2FMDA 2L9LA 1AYM2 3KVAA 2D7FA 3BTXA 4RGKA 3WHTA 1BCCH 4X1YA 3VBFA 1V6MA 4TLFA 5G05L 5A7PA 4R4ZA 4MX3A 5L3GA 3VDDB 3JCUZ 3FC0A 4AEJA 1STMA 3FZ3A 3D82A 3N7KA 4JX0A 3TRSB 2GC0A 4HPKB 5JMCA 4QMAA 5K0UC 1I1EA 5ABJC 1W2BU 5HCAA 2F17A 5JPNB 2Z5UA 1E1RG 3HQRA 3ACIA 4OVEA 3L72H 3OT7A 2Y69B 4TYSA 2ETNA 2O8QA 3P30A 1RIRA 1J84A 2QDRA 1W05A 3K06A 5FYMA 3OPWA 5JI9A 2CGPA 3GNEA 3NL1A 3IN9A 1OUSA 4Y5TA 3ZYPA 3LPFA 2ZCWA 1COV1 1WPBA 2IJKA 1GZWB 1S72V 3UGFA 2XJPA 1ULOA 1UL9A 4X1KA 3O65A 1ND2B 3NKTA 2B7YA 4AI8A 5CA1A 2FYUH 2WFF3 1RUI1 2VQAA 4CTEA 2DUPA 3VBUA 2VVDA 1CEZA 5I8SA 1R6KA 4C91A 4XXPA 2NNUA 1F4NA 1NVPB 2OWOA 4YW5A 5J2UB 1CONA 5AFBA 1V6OA 1K34A 1A8DA 4JI6O 1AX1A 3RYFB 1FOD3 1V00A 2CGOA 2WQ4A 4DXTA 1W6OA 4MXWA 3K5LA 4R52A 5C8CB 2IXIA 5C9AB 2PHXA 4KH9A 3VBOA 1OQ1A 1AYN3 5KXDA 3WVJA 2KG7A 1RGSA 1QWRA 2OXBA 2WLMA 4WBBA 4YRDA 3H8XA 4ZI7A 1HJGA 1PO23 2HG5C 2EIEA 3K9AA 1NH2D 1RITA 1VR3A 2E53A 4DY3A 3PL0A 4P2ZA 3E97A 3N4MA 5A7SA 4P9WA 2RR13 5CFDA 1KP2A 4L2NA 3AKQA 1BL8A 3NNJA 4QU1A 5F32A 4GMP3 1AJOA 1N4CA 3FL7A 1DFQA 3C3VA 3W7WA 4U36A 1COWG 2WLJA 4UW5A 3ECQA 2WLPA 4AVTA 4IIJA 4UV8A 3LFIA 1BK0A 1OD5A 2WLIA 1YTFD 2JDPA 1J5EO 2HWB1 1GOGA 3ZFFB 1JUHA 1JZ4A 4LO5B 4QM9A 2J1TA 4Q6GA 4EB6B 4D6RA 3HKCA 3R66A 4MVRA 2Q5TA 3CEWA 1XMOB 4EYUA 4LHNA 3H1YA 1W6MA 5ANNA 1MS9A 3O1MA 4XAEA 1NR1A 1NX9A 2BNMA 1IOAA 1VPHA 3G6BA 1Q90D 2BE3A 2ITDC 2WWUA 2CTQA 3E89A 2YGMA 4MTXA 2YUEA 2B8MA 2ARAA 3WUCA 3IAPA 4E4EA 3MGUA 2D5HA 3WG4A 3I2KA 2VQEO 1ZX5A 3AG4C 1FFTB 5A7NA 4TOIA 1I5YA 4E2LA 2PI5A 4TSFG 3VD4A 1I7FA 1R091 1JOJA 4DY5A 1UZWA 1N3PA 3ST7A 4EN6B 2YIBA 1YJNV 1GWLA 2W39A 4XBFA 4LFBB 1M5IA 1N47A 4FFGA 2RM21 3SYCA 2QQNA 3VL8A 1CP9A 5IWFA 5LASA 1KXGA 4EWDA 4Q0VA 3H3LA 3BCWA 3SJBC 3VBRB 1HQLA 5C5UA 1SMVA 2A6WA 2PAMA 4GWJA 4ZXKA 4UW3A 4CU9A 4YW1A 1A8MA 2V09A 1BHGA 3AZXA 4MSWC 3NKGA 4UFIA 4U7OA 4X62B 2BWCA 3BB6A 2Y6LA 1M9NA 4RUFA 4WCEV 4IEUA 4AEMA 1FPN3 2W68A 4KU8A 4Q20A 3IKWA 3WQ0A 4XF9A 1AF9A 3ELNA 4MG2A 3MUY1 1W8OA 5LBFA 4DZGA 2EIKB 4XQ4A 1QHTA 2ZGSA 2HVJC 3PJSK 1JMUB 3GBWA 1TVKB 2WFPA 1GKBA 5JOZA 4BQ2A 3USSA 1SFNA 3HKDB 1Y4WA 2PA7A 1TGOA 2JJ6A 1S3JA 1JXNA 4WV8A 5F2WA 2QNKA 1PM4A 4MVOA 1XNAA 3M70A 1M56C 4O4HA 1FFXB 1HNXO 1V55C 3RYCB 2Y6KA 4IEWA 1AVMA 1CJDA 1R082 2P5BA 1OF4A 4AFAA 4A44A 4I01A 3ZXLA 4GKJO 4QDSA 3UM7A 4XVHA 5JXIA 2QQMA 1BQZA 4B3SO 1BZWA 2P17A 4B08A 5B66Z 1GN3A 2D97A 4L97A 4NN0A 1HRV2 1CN1A 5A7OA 4YVSA 4NIHA 4IE5A 2QKCA 2J1SA 3BOWA 4DV4B 4IV1B 4RYDA 5FPRA 4FXGB 3WXPA 2LO1A 2GV9A 4FPLA 4EWEA 4LF6O 1VBA3 1QNMA 4N53C 5FPBA 4MVUA 3LZZA 1ENRA 2QQPA 4D7TA 1HWYA 2CWMA 1A32A 5A7WB 1IGOA 1OOPC 5GALA 1AYM1 1IPKA 5GTIZ 1Y74A 3RS6A 3N7LA 3K0DA 3N2KA 4X8AA 2Y0IA 3QO8A 3NAPB 4A7YA 1W8HA 4HONA 3ZDVA 1CPNA 2DVBA 2D43A 4AHWA 5FP8A 3USUA 3ZHQA 2BZDA 2WNVC 2CY6A 1S0DA 4K1YA 3THCA 3ZHSA 1XYNA 1RUJ3 4WM8B 2Q4SA 2YC2A 5EYXA 1VAVA 3ZN0A 5EJ3A 3SPCA 3K58A 3FMGA 4Z1MG 4GALA 5C70A 1IS6A 3N2GA 1W39A 1QU7A 1PKXA 1ALYA 1F35A 4MUVA 1VARA 2UUCO 2X0LA 2XMLA 2GP3A 1U12A 3SEEA 5FYZA 1U5YA 5IK5A 4P30A 2BNOA 5I0TA 1G1XB 2DQ0A 2DCJA 1E5SA 4RFT0 2Y0OA 4UVAA 3BALA 4CUGA 1TMF3 2ZQMA 3WW1A 5K7PA 1R3KC 2XR4A 1PO11 4PIYA 2UU9O 1S4CA 3RZMA 5LWBA 3L75H 1N0JA 4O2BA 5KAIZ 4OHZA 2XAHA 5FZ3A 4AQ6A 3BVOA 1K8AW 4B1LA 3RZHA 1RHI2 1K45A 4LF9B 4PI2A 4DYLA 4LEJA 2IJHA 1EN6A 1NOVA 1ENSA 2HWC3 3ACFA 4Y4YA 4IETA 4L8JA 2XJSA 2QSAA 4DEVA 3VGIA 4CH4A 2F43G 3DPRC 2D40A 2J7MA 1NQTA 2FZ2A 5FZLA 2VZRA 3QCWA 3OBAA 5G04L 5F5CA 4COUA 1SQVH 4LA2A 4CH6A 1ZRDA 3ABMB 3WDTA 2PGGA 4YIOA 5D2AA 1LENA 3L2HA 5FUNA 1UOFA 5L7OC 2ZE6A 3ZMOA 4OI1A 3VOUA 3JSNA 1QJY3 1EV11 1BBT3 3QF7A 2CDPA 2CTPA 3WQBA 1QEXA 1K9MW 5FLXN 2VXRA 5GJ6A 3DGEA 2GDSA 3LA3A 5F5QA 4AE2A 1JZ5A 2YFUA 3OF1A 4CP9B 1XNKA 2QKDA 4NO4A 5B4NA 1RM1B 4WBNB 4P14A 3AX4A 2PHRA 2VGDA 3BTAA 4QE9A 1O3RA 3WNOA 1IQAA 1UW8A 4B7EA 4IV3C 5AC91 3JATB 1A78A 1WNSA 4MTGA 1LKNA 5L3FA 2ETEA 2BTOA 5FTTC 3CRAA 1FPOA 2DN9A 4CYDA 2GHYA 4JGYB 4BOWA 3LGRA 5IVVA 2OCCB 3NV2A 1P49A 1POV1 3GVMA 4CDWC 3R4DB 2Q8VA 2JB8A 3VLBB 4Q0SA 4A5UB 5I0RA 3JAWB 3LCPA 2R32A 4OGQB 5A3WA 2ZPXA 3FUOA 5IK7A 4NAMA 4YSFA 2UXDO 3WQ7A 3MIHA 1JH5A 1QDOA 1X36A 4X64O 3JBG2 5LYJB 4LF8B 2WNUB 2H8PC 3DYPA 5BNOA 2YHJA 1OVSA 5BYNA 2WO1A 2PY5A 2EXJA 1K73W 1CIWA 1OFSA 2D6OX 1W6NA 5JCOC 1GUIA 1LHUA 4FAGA 4ISQA 5IT6A 1L7LA 3Q8BA 1NY72 1WCKA 3POGA 3UGGA 3KWVA 5IHRA 1WA6X 2OW4A 3JB4C 2WLLA 2C9AA 3I2DA 1IBLO 1W2UA 1OPMA 1VQLV 3HWJA 2DQ3A 3MO4A 2MEV2 2JB4A 4KI5M 3ZSMA 4H37A 3ZDSA 4FPKA 4Z8BA 3GZUC 3HJRA 5CB7A 1QKQA 1POV0 2RS32 4CP1A 3ES4A 1H9PA 4XETA 1GN2A 2Y33A 1P4RA 2V4AA 2JD4A 1WMXA 5IAVA 4O2AA 3PHMA 2IM9A 4KGQA 2WS92 2VG9A 4TUYA 3JU9A 4NIGA 2Y60A 1H8TA 3CRCA 2RDQA 4CDQA 3AK2A 2DVAA 3MF9A 3W7TA 1RL3A 3Q4HB 4BISA 1YC61 1U5IA 4EFBA 1XE0A 2VWKA 5IAXA 4JTDB 3A0RA 2GSYA 4AHZA 4QPIC 4Z1VA 1XSQA 4OQ9A 2C0ZA 5KHJA 1RUC1 1R081 4GQ7A 3DEMA 3UKNA 2XASA 1ZAUA 4I0WB 3ZIXA 5BR8O 3ZN6A 1E5RA 5HXVA 2H0VA 3K5NA 5KMGA 5KHHA 2FDJA 2PHWA 4LBMA 5DN6G 4AWDA 3AMMA 4O7XA 1HRV1 4XFAA 2RN9A 1VQ6V 1VF6C 1W8UA 4JYAB 3I3DA 5FO7B 4HVQA 4KMQA 2WFF2 4INDA 1AR93 4XUQA 3VQVA 3KG2A 2Y4UA 1CAWA 3VD3A 1MZ6A 4XDQA 2N05A 2VCMA 1Z7S2 2ZEWA 4ZZ5A 4YG6A 4WM7B 2NN4A 2EX3A 4Q4W3 1PK6A 1S2BA 2JJ2G 3IAYA 4DV0B 3DXRB 4Q8LA 5LXTB 5FJHA 2VTXJ 5CBFA 4Q4X2 4I7ZB 5F3GA 4UCOA 4P00B 1AYN2 3FX3A 2YI9A 3S5AA 3M7MX 4CDXB 1HRI3 3HT1A 5FYVA 4JI1O 4FXKB 3ZN5A 5IK4A 1VBB3 4XUOA 5EC1C 2HHHO 4ARYA 1S2KA 1RUE1 2K46A 2EULA 2X5IB 3WP3A 1LHNA 3E6BA 5KUKA 2BGPA 2RR12 4CBCA 2YICA 4X1IB 3ZRVA 1S0BA 1BMFG 2AENA 1O5UA 2CK3G 1WA8B 3DKQA 3N9PA 2ZGRA 4NPRA 4DR2B 1AI4A 3BRCA 4DV6O 4RWUA 2ORZA 2Y64A 1MQTB 2E6VA 3OE7G 5FOBB 5J9PC 2AW9A 1CGPA 3MIEA 2GC3A 4K1ZA 1KFUL 3O12A 1O3QA 4PDRA 1GP6A 1RFYA 1NQDA 4Q4V2 4OUEA 4J7ZA 3KSCA 4BXFA 2TUNA 1JR9A 5FYUA 3CO2A 5EYYA 3ZRXA 3S57A 1XBLA 4EN8B 4XCAA 1WCDJ 2CNAA 2YY1A 3MF6A 5EBLC 4CEWC 1IHMA 3I49A 1XILA 1XNBA 4Y4RA 2RDNA 1Z5WA 3I59A 1BGYH 4BQ1A 3URFA 2YUAA 4JTAB 4YARA 4IXLA 1SQPH 5T54A 3H9VA 4JRAA 1VIBA 2XHBA 5D8AC 2P4VA 2PQSA 2WYSA 2VQ0A 3QO7A 4L99A 1RHI1 1RPRA 2VOXA 5JZGB 4NTWA 1NJIW 1G4YB 1QF3A 5DABA 2A3WA 1IURA 1JZ2A 2ZR2A 5FCCA 3K57A 1S1AA 2ZGUA 4ZKTB 1KDMA 4QB2A 2E33A 2ZJCA 4ES9A 3CQOA 3FB7C 4MV2A 2IBZH 4RSUA 1LHWA 4S2DA 4M3CF 3OYWA 2XAJA 3RG0A 3NQHA 2P3KA 1O7FA 4O4JA 1W0PA 1UY4A 4ORFA 4JI6B 5E88A 2B1IA 1GSLA 2LRPA 3DSQA 3GZTB 2GNDA 4HK9A 3CCRV 4JF3A 4P9GA 2BVVA 4UFLA 3SPHA 2VWJA 1SQQH 4A7KA 5FYBA 5LHHA 3D8CA 2OYQA 2FCTA 2IVJA 4UBHA 3PUAA 4Z07A 1PVC3 4DK1A 1IX9A 3O1VA 5L9VA 3ZFGB 3LSQA 4NE9A 3CJIB 5FK7A 2VM9A 1VAMA 5JXGA 4TV9B 5LMNB 1AR62 1SA0A 1QGLA 1K3EA 2IXLA 1HXS2 5CKQA 1JS9A 4JI7O 1IG0A 2OT5A 4DIQA 2ILMA 1Y67A 3V0BB 5CAZA 2ZABA 2DYRC 4BQXA 4XQWA 2RJZA 1X4TA 5FBJA 3QG5A 1J5EB 2EF6A 4YHHO 1H4GA 2A7AA 5FYHA 3O0VA 4K7JA 2P3YA 2BUKA 3DXUA 3B9CA 5DQ0A 3JAKB 1POQA 1EUUA 2G9ZA 4CC6A 3A23A 1J1TA 3SQOA 4BWAA 1T6BX 2LALA 1SBEA 3GBFA 3LPGA 2HJFC 4QQOA 3NJVA 4DRVA 4GH4A 4GJZA 1ASJ1 4LO8A 5JSPA 2JG8B 3AFGA 4MSVA 3MW2A 4XJ8A 2CWSA 3BEHA 1JQ0A 4X6QB 5C4WC 1Q6IA 4DR1O 1QXJA 3D36A 4I30A 2M7WA 3EQEA 1QVGU 1QNYA 2DUQA 1QHDA 2UURA 1P7BA 4FI9A 3SPIA 4KBBA 1D4M2 1C8M3 2OQ7A 2VQEB 1DZTA 3EHKA 1UO9A 1IS3A 1XQ8A 4WFAV 2OCHA 4AEKA 3WP6A 2VW1A 4BH9A 2PHFA 3CCUV 5IFPA 5EBWC 1CAVB 3QH7A 3LEMA 2AYHA 2JDYA 1J3RA 5L36A 5F8PA 1QJFA 2QM4A 4AGRA 1Z2GA 2E74B 2RS31 1E1QG 3I54A 4N7IA 1UPGA 4UT5A 2EXKA 2ADEA 4HKLA 1W6PA 2OYZA 4QHBA 1RUD1 3KF3A 2YXYA 5JJEB 3WD5A 2WS91 4ZS3A 3POIA 1ND3C 2WWJA 3ZHUA 1TEIA 1KITA 3MPBA 4GD4A 4MVSA 3IC7A 3AK0A 2KKWA 2R071 4XFCA 4AFDA 1QLNA 4COZA 5LBQA 4PA7A 2N74A 2ET7A 5IDJA 3POWA 5ABJA 4NYKA 2NQYA 4ATFA 2GTSA 3A4UA 1V54C 5KUMA 4JKKA 2ZS6B 1OPOA 3WF3A 4QGMA 3VUOA 1ACCA 1YSCA 2CTVA 3WV6A 3A0KA 3KD4A 1AX0A 3APBA 3DECA 1Q8PA 2DVGA 4YZ4A 4QT6A 4LLFA 2WZEA 1OCZC 4GUNA 5HBAA 2Q4PA 1R1A2 1NCRB 2W2IA 1VQNV 2QWOB 1FI2A 4AI9A 1HNXB 4LKFA 1Z7S1 3KCXA 5F3CA 4P5HA 4GKJB 3HIFA 1HQNA 3ROUA 4TQDA 4V2VA 3ZYFA 5J2TA 1TVGA 3U10A 1XPWA 2XJTA 4PDWC 4FIPC 4B3SB 2AZ5A 5FP7A 3LQCA 3UKMA 5DZFA 1AHSA 4LHLA 5LATA 1Y9MA 2XUMA 4UI9L 2ZHNA 1SPPB 3RZJA 2WZR3 4K40A 5HXMA 1H8HG 4Q4Y2 3HD8B 3JCIA 2W0XA 1H4HA 3SNMA 5FZ1A 4K3AA 1HV0A 2JICA 2QQLA 3MD0A 2BTQB 3AMQA 1OZ0A 1OCRB 1HB2A 2VNVA 2CSGA 1AZDA 1YO8A 1QJY2 5KC6A 2R72A 2IJIA 2FL4A 2UXBO 1BBT2 2UXCO 4EZHA 2XT9A 4FPPA 1UOJA 3QACA 2VMGA 2XNDG
chains in the Genus database with same CATH topology
2B45X 3WDYA 1LJ7A 2LTNA 2E7QA 3M3OA 4M2CA 4L9BA 5GM0A 1D4VB 4NWVA 1D2QA 1TE1B 2OUJA 1RUC2 2E9QA 4FOQA 1V9U2 3JZVA 4U2AA 2IFWA 1PO22 1VBC1 2CGNA 1BEV1 5ACA1 2TBVA 1MVEA 5CFCB 2WT1A 1GNZA 3CNAA 4DFSA 1IPJA 5C8WA 3EBRA 1ZM1A 2TEPA 1DYKA 4I0AA 1O4ZA 1COV3 4M0HA 4XHXA 1MS3A 4WZFA 4DNYA 1ND3A 3FBYA 4E4DX 3NV3A 2I74A 3R6SA 1EAH1 1RUOA 1RUG3 3FBMA 5T5LA 2NZ9A 4YFWA 3I59B 5A32A 1UF2C 1DQ6A 3AXEA 4DMIA 1LB2A 2JXAA 4K20A 3PTYA 1J3QA 3MLKA 4K6BA 1YJLA 2V5YA 1S0CA 4EN9B 1NZCA 3OJBA 1Y3TA 3HMYA 1CR7A 4I0BA 1WW6A 3H8UA 1D4M3 5FBZA 4XJAA 2ZX2A 1OIJB 4R8HA 1YIFA 4C0BA 1S0IA 4AQ2A 4YZ5A 5FQ0A 2PYTA 2VVEA 3U11A 5JR7B 2VUAA 1NLRA 4MXVA 2GH2A 1UKRA 4XFBA 1EPWA 2UY8A 1LOGA 1T6GC 4TSVA 3I7DA 4BMEA 4BZ4A 3ZVXA 1MS8A 4IQPA 5T5OA 4RHV1 1QH6A 1RUNA 1CAXB 1DRTA 1J59A 1VJ2A 4YM0A 3KT1A 4EV0A 3VBOC 1BMV2 2ZACA 1ENQA 4Q0PA 4AGVA 2RMU1 3KT7A 4JVAA 3JBG3 1PGL2 4Y20A 3NWKA 3OYWB 2WJSA 2DU0A 2HWE1 4IEZA 4UW4A 5H9QA 1B35B 4JC1A 3ZYGA 2FBEA 2XBO1 1LULA 3KGLA 4OZXA 1GQWA 1RUE2 4WVZA 3IBMA 1QJX2 2E7TA 2QCSB 3MW4A 3BU7A 4ONUA 1SBFA 3VBHC 4AXOA 4HVOA 1B09A 2A70A 3AKRA 3B3QE 4IV1A 5JCTA 3MIGA 5AC93 3PJYA 1DS0A 2VNRA 3V65A 1AL23 4BYYA 2JE9A 3VHPA 4OUSA 1NA1C 5JVVA 4DOUA 3TN93 5DZGA 1IZ3A 1H1IA 2N7GA 1RVF3 2XLGA 3B7MA 2XJVA 4KNCA 4XE9A 1PVXA 2QFEA 5EZWA 5IK8A 4COWA 5E1RA 4PDWA 2OG6A 2PN5A 4HBNA 2R041 2ZHLA 2XJUA 4PLNA 3G6JB 1YNAA 2WZR1 4N9IA 4YG0A 4CEYA 2DU1A 3OD4A 5C9AC 3VHNA 4OJ8A 1QOSA 4COYA 5CG9A 5DG1A 3H3ZA 4XFFA 4B7KA 2FMDA 1YFXA 1N3QA 1FATA 1QXPA 1XQNA 2BYVE 1AYM2 3QD6A 2GMMA 2D7FA 1X50A 3NW4A 3JD73 3WHTA 1JYCA 3FJSA 3GHNA 4PCRA 4IESA 3VBFA 1HXS1 1V6MA 1AR82 1U5ZA 1V6KA 1EPZA 4TLFA 2ZOEB 1RUF1 3LKJA 2A3XA 1NCQC 4R4ZA 1PIV1 4MX3A 4JGZC 2P2KA 3NAPA 3VDDB 2YMZA 3FC0A 4AEJA 4RQPC 3RI8A 4AK3A 3FZ3A 3D82A 1YLLA 2GN3A 2ZX0A 3N7KA 3NO8A 3TRSB 5HCFA 2GC0A 4OUMA 3RNSA 4HPKB 5JMCA 4P9XA 4QMAA 5K0UC 1I1EA 1LCLA 5ABJC 4Q4W1 2W52A 5HCAA 1GLHA 1DYPA 5JPNB 1R1A3 5CG8A 1RUH1 5GLUA 4BA6A 1YJKA 3ACLA 1NXD1 1G8WA 1GBGA 4BLJA 1LOFA 4OVEA 1CD3G 5A3LA 3R05A 2DVFA 2WSVA 3ETQA 4TYSA 4K9SA 2O8QA 1O91A 3GALA 3J8F3 4WM8A 4LTAA 1ULGA 3N7JA 5KXEA 1RIRA 3DUIA 2QDRA 3ZFFC 5T50A 2BFUL 5JI9A 4YW3A 2CGPA 3O2GA 1S55A 4GH4B 1DBNA 3R4UA 1FPN2 1YHFA 3KCYA 1EY2A 1QU0A 1RMU2 2QUOA 3GNEA 3NL1A 2OG7A 3ES1A 3IN9A 3E6DA 3ZFEB 5JAXA 3O0XA 1M06G 2ZAAA 1N1YA 1Y0ZA 3ZYPA 3THTA 1DU3D 1WA4A 4GKX