3SPGA

Inward rectifier potassium channel kir2.2 r186a mutant in complex with pip2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMAAPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 94
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spgA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spgA01
2JK5C 2X6AA 4MVQA 4RUEA 2R9RB 2KB1A 1OCOC 3X2QC 3TETA 3SPHA 3E8FA 2AHZA 3SJQC 2EIKC 4DXWA 5B1AC 5B1BC 3LDCA 2A0LA 4X8AA 3SPCA 4MVRA 2Y69C 4MVMA 5J9PC 3FB6C 4PA4A 3SPJA 4GX0A 2HJFC 1OCCC 3R65A 4XDLA 2OCCC 3OR6C 2EINC 4X89A 3E89A 4JTDB 3IGAC 5IY5C 2ZD9A 4R50A 4PDRA 4P9OA 5KUKA 4EKWA 2DYSC 4PDVA 4G27B 4PA9A 1V54C 5EK0A 4LP8A 3T4DA 3ZRSA 4GX1A 2WLKA 3K03A 4PDLA 2Q6AA 4BW5A 4WFHA 3ABMC 1G4YB 4G28B 1QLEC 1JVMA 4MTFA 3ABLC 2ZXWC 2HFEC 5EBMC 5EBWC 4HYOA 3OR7C 3GB7C 4HZ3A 3AUWB 3ATFA 1LNQA 1P7BA 4QNHB 3PJSK 2NLJC 3RBZA 3RVZA 2WLNA 3F5WC 2DYRC 3FB5C 2BOBC 4RAIA 4MW8A 2W0FC 1U4FA 3STLC 3STZC 3ATBA 4RO2A 2WLHA 3OUFA 4MTOA 4MVUA 2Q67A 3ABKC 3T2MA 2H8PC 3SPGA 2ATKC 3K08A 4J9ZB 3K04A 4JTCB 4PA6A 1ORQC 4GX2A 2Q68A 5KUMA 3JYCA 5CBHA 4P9PA 2EIJC 4X88A 3SPIA 2WLLB 3E83A 4MVSA 1BL8A 2WLIB 3LDEA 3SYOA 3UKMA 5CBGA 3ZJZA 2A9HA 4PDMA 3K6NA 2HVKC 4H33A 1V55C 2K1EA 3T4ZA 1N9PA 1R3KC 3E8HA 3SYPA 4RUFA 4R8CA 3FB8C 2BOCC 2HG5C 4P30A 5EC2C 1U4EA 4JTAB 4WFEA 2EIMC 3AG4C 3ASNC 2IH1C 3SYAA 2ITCC 1XL4A 4H37A 3BEHA 4GX5A 3TCUA 3LUTB 3ATEA 2WLIA 3FB7C 3KG2A 3ATDA 3OUSA 4LCUC 2WLJA 3F7VC 1R3LC 4J9YB 4F4LA 3VOUA 2P7TC 4P2ZA 3LDDA 4R6ZA 4R7CA 1ZWIC 3UM7A 2YEVA 4CBCA 2E4FA 3ATAA 1R3IC 3K06A 5B3SC 1KKDA 4KFMA 4LBEC 3AG2C 5EBLC 4MVOA 2AHYA 1K4CC 2IH3C 4MSWC 4MW3A 3SYQA 4MS2A 2A79B 4MVZA 3EFFK 3IFXA 5EC1C 5BZBA 3AG3C 4QE9A 1S5HC 3K0DA 3OGCC 2DWDC 4PA7A 1OCRC 3HPLC 4XDKA 3K0GA 2GIXA 3E8GA 3WG7C 2X6CA 1XL6A 2EILC 4I9WA 4WFFA 1M57C 3AT9A 4PA3A 3T1CA 4WFGA 5CBFA 2QTOA 4OXSA 2QKSA 3RVYA 3AGWA 1M56C 1K4DC 3E8BA 3E86A 3AT8A 3SYCA 4XDJA 4TWKA 2WLLA 4UUJC 3RW0A 3AG1C 4QE7A 4MTGA 3F7YC 5E1AC 3VSQA 1R3JC 1J95A 2Q69A 2WLMA 1OCZC 2DWEC 3ASOC 2HVJC 4ZBMA 2ITDC 3LNMB 2X6BA
chains in the Genus database with same CATH superfamily
2E9IA 1J1XH 1PY0A 3LRMA 4KXRA 1KGCD 5F72S 5L8LB 5D7IA 1G9NH 5B1AC 3EADA 1G0YR 1HIML 3AS2A 2XG5B 2R0LH 3L5JA 1NTKH 4Q58C 1RUMH 2DOSA 3S98A 4WF9V 1ADQL 3E22B 1J5EO 1NC2A 2HKHH 5HI4C 5HXMA 4UDUA 4HWBL 1X5LA 1I3GH 4Z7NE 3WTXA 2W81C 4NZ8A 3CWBH 4XMUA 3WNMA 4QRQA 3UO1H 4AI8A 4PDRA 5G55A 3DXAD 4F7CA 4FLHA 3FT3B 1NFDB 2B8OT 3CN2A 4F80A 1WPBA 5DJYB 4CILA 3F2LA 2MRYA 2Z7YA 3EH4B 3MRRB 3T77B 4YHLH 2VISB 2WXMA 1GVIA 3DOSB 5EN2B 1JVMA 1AVMA 2ZXWC 3FCSA 2FJFB 2E6JA 1L3WA 3F01A 4XPFH 4RMSA 2LU3A 5C08A 4W6XB 3GSVA 3NXSA 2DZEA 1RUML 2K1MA 2PWFA 4PRIB 1MAJA 2HKHL 3ZMRA 2ICWB 2EIJB 4GEIA 4X98A 4YDNA 1QOKA 5BZZA 2QWOB 1MZFA 4J3UA 2X70B 1JV2A 5J56B 2OMTB 5GZOA 4MJ6A 4RESB 2JELL 2YA2A 1A6AB 3GXTA 2CLVA 4IHBA 4DK6A 3ZGIA 2XACC 1M7IA 3MJ9H 2XV6B 3C3SA 2ZUQC 5HYSB 4X66B 1CUOA 1EGJL 2F53E 4RRPA 4MXVF 4JI2B 3RGVA 5J8OA 2R1WB 1T5KA 2CR6A 1TQCB 3FOMA 4UTAH 3VFMB 2BSKA 1S78C 3AG4C 3D06A 3L4WA 4E41D 5KX5B 4NYLB 2Q0AA 4HPYH 1V5JA 1NTDA 2DLHA 2E8ZA 1OGAA 4Y7MA 4F58H 4BXVA 3TXQA 1PZDA 3B2VL 4FM0A 3JTSB 1HHJA 2B59A 4NRYB 4Z7UE 2IMNA 2CIKB 4WWKB 3NMEA 1K5QA 4GQRA 3KXFE 2HRPH 4D0CB 3WXWL 5IFJB 4I5SA 1A3RH 4ZI8A 1IGMH 3MJ9L 4AE1A 3P9LB 1FZJB 1AVAA 1CD0A 3P40A 4HJUA 1WP6A 1NGYA 3IPBA 3OGCC 1MFUA 4EEQA 5IW6B 5MENB 1QSFB 1MI5D 3K0GA 1MHHB 1B0GA 4WU7B 4LSSH 5DZ9A 2SEBA 2VN3A 1PG7W 4J3OC 3ZRWB 1O0VA 3SQRA 1DJGA 1VQ8V 1KIPB 2VW6A 5F7NC 4DT2A 1JPSH 1X6LA 4HPYL 1GKOA 5EPMB 3QT2A 2KQXA 5DJ8B 4F58L 2VDRH 3T1YB 5BOPA 1G7HA 2ZKXA 1LQBC 3TNNB 2PZSA 3II2A 4JI0O 1HVXA 3JD4A 1TO4A 4L1DA 3ZDXE 2LO1A 1WLHA 5EN3A 3E6FB 1A3RL 2J72A 1ULVA 1HTYA 2VLLB 3N1FC 1Z3GH 3GSUB 5AOLA 4CGUB 2EINB 1TQVA 4UBDD 4JI3O 3T1FA 1SLWA 4ZUVA 5ITBH 4HULB 2LU4A 1ACZA 2F54D 4TNFA 3MBED 3EZ8A 4FNRA 3G08B 2QMKA 4XAKD 4U05A 4EN3D 4UINH 3KPMB 4XPBH 2VL5B 3OQRA 5INCB 1JPSL 3R0NA 2AGJL 4HK0A 3ZE2E 2APVA 5TE4H 3UROR 3FB8B 4ENEC 1VADA 4G7QB 3W0WA 2YRBA 1CYGA 4MBOA 2HP4A 1NH2D 3VI4B 2BZDA 4FLUA 3IFOB 2ZE7A 3ABLC 3VFSB 3TEWA 5I16B 2HZHA 4X20A 3GMOA 5LNDA 3NJLA 5AEAA 3TA4D 4TPRH 1M05B 1WBZB 1WTGT 5KA6A 1KXHA 2ARJQ 5C0JA 2Y25A 2ZICA 3PNWB 5BVPH 1NMAH 5DEGA 1WE5A 4X4ZA 5D93B 3DX7B 5ENWB 5IROD 1U8OA 1XF3A 2F53A 3CSYB 3LV3B 4F7PB 1IGJB 2MOVA 4QRTA 1A1NA 4GRWH 4YLCA 1H9VA 4AEFA 4RNRB 1W6WA 3NJFA 3Q8EA 4NJ9H 2V17H 3WTTA 2OYQA 4JZ2A 1HYRC 3QI9B 4XVTH 4ACTA 1I1RA 3BOVA 3P0VL 1GGCL 4BSWA 1WBYA 1KXQA 2G60L 2WIIB 2UU9O 1A5FH 3K6NA 4QOKB 1JXDA 5FDWA 4Z7UA 4V33A 4X4KA 5DFWH 3I50L 4TPRL 4DUZB 1KGYE 3DSNB 3H9SA 1BHGA 1DJWA 3KXFA 5BVPL 2YZ1A 2M6YA 3MRJA 5IJCC 5IJVB 2CDGA 4C4KO 1REIA 4HOXA 2AW2A 3CX2A 3KWWB 2W5PA 2A1WL 2XTJD 4ZJ9A 1XQ8A 3U6XA 4WI0B 1B3IA 3ZDYB 1PFCA 4J41A 4R7VA 1P7QA 2R9AA 3O3EB 2V17L 4IYIA 3BGMA 4PBXA 3NAAL 3LHAA 4XVTL 3AXLB 4NQCE 3P9MA 1A5FL 1KCUL 4CC1A 4TS6A 3MLRL 1DQKA 1SLVA 4NBXB 1SF9A 1AGCA 4QRUA 3E8BA 1LYQA 2RCSH 2A3TA 3BP5B 3DVFA 2DKMA 1MSWD 3V4VH 1KWKA 4WHTB 3ZLQC 1JI2A 4I0PD 4CDHA 4NFCA 4DN4L 3SDDC 2FJHA 35C8H 3H85A 1JWMA 4AJVA 3MUZ1 3FX7A 5SWQA 2JMRA 5GGVH 3WNIA 2P7TA 4HIJA 2QWRB 3K46A 5EOCH 3VXTB 4BH7A 1KIQA 15C8H 1OP5H 4B9CA 2B08A 4BFNA 4FTVB 1FG9C 1DTOA 2ITDA 3FQXB 4WW1A 5DRWB 3C75A 5EO1B 1UXWB 1U3HD 3PWLA 5FC9A 5JIKA 3STBA 2EYRA 3BAEH 5DFAA 5LBQA 2BSRA 4KI5D 3H1KH 4IJ3B 5CN2A 3CZGA 3C6LA 1WFTA 3QVNA 1VF6C 4GT1A 1S7UA 3ULVF 4W4LA 1OTUC 4HLJA 1HEZA 3CVHA 4TVPH 4G6KH 1BMZA 1II4E 1JHTA 2CDFB 3T5WA 3RWFA 4QPJA 3BP6A 3T0DA 5IHZA 2RCSL 2VXUH 4YDJB 3GXMA 1YN6A 5GIRA 1BD2D 1G7JA 4H5SB 4JANA 2EICA 4UMSA 4WUUE 1RZGA 4M00A 4U1MB 5IHHA 3CSTA 4QF1B 2QMJA 1J0KA 2L04A 5IQNA 5IW3A 5CZVH 5EOCL 1J5DA 1VACB 15C8L 3CRRA 4PD4F 2CAZC 1X7QB 2DB8A 4TQHA 2XVBA 5EULV 5GGVY 1ZTXE 5AG9A 2VUYA 4HIQA 1KIUA 3OR7C 3BAEL 5FWQA 4BKLA 3LVEA 4JFSA 1N7MH 3A23A 5IOPB 4XBPB 5D7SL 4R6UA 1W72L 1P6AB 2XLLA 3IKKA 2YS8A 2N4IA 3L16A 3IDXH 1I8IA 1TKWB 4PJDF 3SDAD 4TVPL 4G6KL 3MX0A 1QUNB 4F9PC 2G5BA 3JWDH 4GUCA 4M43H 3OV6A 5TGBA 3S35H 1XNRO 1WFOA 2QADC 3TBTB 4G42A 5J1SC 4AHCA 5GISH 3KPPB 3ZQWA 5IW1A 4Y2DC 5CZVL 5KA5A 2YA0A 1JNNH 2WLIB 1DBJH 1GZHA 2HSIA 1J9SA 5AQ0A 1N9PA 2J2ZA 2YXYA 3N6YA 4DFIA 1N7ML 5DUBA 4BWUA 4YHHO 4YDIH 4ZW7A 1IBDA 3DIVA 3QRGL 2WAMA 4YDLC 3IDXL 3JV4B 4PS4H 4OIBA 2BOBA 5K59F 4W9LC 3VXPB 3V0DA 4AQ8C 3JWDL 5AW2B 4M1GH 4M43L 1QASA 5B1BB 3AS3A 3L5WB 4RWHA 3CUPB 1S7VB 1NJ9A 4R8WH 1AJNA 2W6IG 1DF5A 4Y5VA 1BVZA 2VJ8A 1KTLA 4J3OG 4JY4B 4ZMZA 3S3SA 2CO3A 1INQA 1CGYA 3NT0A 5DRXA 1F3RB 5F3BB 4KKAD 5DJ0B 4KUMA 1I1AD 1S5HA 4QJFB 2RA1A 1IM3B 2NSXA 4GUOA 4Q0XL 2KL6A 4N2KA 2WBKA 4QHKJ 4O02B 3GKWH 4NLAA 5CJXA 1MZZA 4MKMA 4JAAA 2QWQB 2I26N 1CDIA 3PWVA 4PS4L 5HD8D 4PGEA 1YYML 3ZRVA 4K8XA 2MJWA 3TF4A 1LDPH 2B39A 3MFFB 3CDGB 3GUTA 4R8WL 3HZVB 3KWUA 2Q2EB 2CGYA 3ARTA 1J88A 1F4HA 1FG2A 4HJSA 5JJEB 3H4FA 5EF1A 3F62A 3JTTB 1T04A 5ICXA 5AD0B 4HALA 5IB2A 5ITFB 4Q9CA 3MLWH 2GW5A 5J12C 3CD6V 2Q20A 1A7QH 3HG1D 4P2RB 3QHFL 4P3WA 4PJAB 4ZSOE 4GXUN 2D31A 5BRZE 5BMVA 2NY2B 1X5IA 3VXRE 2UUBO 4ODUA 4B5EA 2JCWA 3QXTA 4IJTA 4MQ7B 4XNYH 4ECNA 3KPQB 5I5MA 5CJ5A 2VITA 4S1DD 2N7AA 1JNHB 2CO4A 2JLLA 4KKBC 3ZDXB 4ZQTA 3NZUA 5F7WC 2QDVA 3DO7B 3L5XH 4YXLH 3EYVA 3E9TA 2ZUTA 1XF4A 2HT3D 3D85A 1LP9E 3K5RA 4KKRA 5CLTA 1Z5YD 2H8PB 1JZHA 5F2VO 2BVQB 5DSCA 2AJVL 3WIFB 3G5ZA 1T21B 2X7LB 2WNGA 3B9VA 3D12B 2R9IA 4LF8B 3J7AU 1H15B 3MLWL 3M1BA 5A2LH 3BRFA 3DUSA 3VRLE 5E2WH 4AEHH 3A0HZ 3FHEA 4F2ME 3CLEH 1EO7A 2NMSA 3GTVA 1WITA 1K2DB 1V55B 2IU3A 4NP4L 4LHQB 4POUB 3B3IA 4UIMB 1JG9A 1K8DB 5TQ0H 4YNYA 9CGTA 4NSKB 4UT9A 1XZ0B 3LPGA 4LEOB 1BL8A 2IV9A 4KHPB 3L5XL 2P48B 4YXLL 5HDLA 2OL3B 3MRHB 3QJVB 3APNA 5DR5L 4ABWA 3VWJC 2HLDG 1HHGA 5D7LD 3MCKA 3K3WA 4J27A 3W39B 4QWWD 2YPKB 4IIQA 3CNKA 3GWOA 3JSSA 3U0PB 4JRWA 4ONHB 1X5MA 1GN2A 4R7LA 4DP0X 3D4GA 5D7JD 4WW2A 1O7VA 2G3MA 3SDCD 4D8PB 2NZ9D 4TT3G 5E2WL 3GPEA 4F2MA 1U91B 5TE6L 3A0RA 4K94L 2ILMA 2IWFA 5A7EA 3BAAA 1EEZB 4NPYB 3A4AA 1T83A 5L0QC 4MCYB 1AJ7L 2ZAGA 4JHVA 5TQ0L 1A9EB 4YHYB 3F5TA 1OQOA 1K4DB 3P1VA 1QWUA 5E8OA 1UD8A 2CCVA 5L4MA 2X89A 4L8CB 1FYTD 4XDKA 2VZSA 4Z8FL 2F8VA 4MTXA 1CLCA 2YUAA 1LO4L 4AIEA 4RQFA 2IOMA 3LQZA 4IDLA 4EPSA 3SE4A 1PAMA 3LNHA 5B39A 3VXOA 4EUPA 3ML0A 5ESAB 4F57H 1EZUA 5L88H 5KYXB 2WJ7A 1LK2B 5J6GB 1XEUA 3IFNH 4LOFA 2E8YA 2O6DA 3WO4C 1X5XA 4RISL 4S1QH 3QEQD 1JCVA 2MPVA 5LKNA 3MLVL 1AKJD 3HE7C 3Q7JA 3GI9H 1YQVL 3P0YH 4LSDA 3TT1H 2A7BA 3POCA 4NQCB 3ARSA 4XN5A 7FABH 2X4UA 1GXEA 1C5CH 2QPFA 4JCWA 4JMNA 2O5ZH 1MW0A 2HFGL 3FBQA 1WJ3A 1XFPA 2XICA 3MZTA 4M93B 5DK0A 1VF5C 3IJ7A 4JPWH 5CLZA 3B8MA 3VH8B 1VMGA 5DVPA 4OF5A 1FO0A 3TYFB 5ADPH 3I02B 3UTTB 5L88L 5LGJA 3BSHA 1LP9A 2X42A 1J8HE 3IFNL 3PG2A 1YNLH 4GKNB 1DBAL 3KEHA 2FYVA 5KEZA 4AQAA 3O3BB 3EBIA 3F5WB 4X7DC 3WY2A 5MEQA 5C8JB 1ONQA 2GY5A 3LRHA 4GIAA 4S1QL 1QLEC 1K85A 3SJVB 4CJ1A 3GI9L 1GCYA 3CVCA 4XMWA 1BQHG 3P0YL 3TT1L 3V5KB 4HYOA 7FABL 2JJTC 4ZFQA 1U2CA 3GI8H 4P4KD 3H1HH 3UBHA 1ZA6B 4TOYH 3WY4A 4C54A 4IHJB 1KBGH 1F42A 2F18A 1KLGA 2WUBH 2D7OA 4M5YH 4Z3EA 5J57B 5ISZA 4PJCF 4JPWL 2R51A 1ZCRA 4WUUB 3FF8A 1I3UA 3L9YA 4BE6A 3GO1H 3H4HA 5FYKH 3S6CA 1HK6A 3HKCA 3RVXC 4ZOLA 4PA6A 4XODA 3ZL2A 1CURA 4PHXA 3JYCA 2DN7A 2XY2A 3HRPA 4I88A 4JKWA 1P84K 3CVHH 1K9TA 2QFRA 5E2TL 4DV1O 3RVVC 1NR1A 3CXCU 3GI8L 4GBXD 5EC2C 2RNBA 1N0JA 2BVPA 1KBWA 4RWYH 3K4AA 3SKNB 3VFOB 5MHSE 1HNYA 5E08H 1KBGL 4M5YL 5K39A 2WUBL 4N9GA 1SYSB 2F43G 4KI5E 3NGBB 5IB3B 1COBA 2BSSB 2IC2A 1NBCA 1VQLV 2H1XA 3H2WA 5IJ9B 1GKEA 3N44B 4BIOA 4UCSA 5IJ0A 3GO1L 2AZ2A 1HKLH 2VOTA 4JZOB 1UCBH 1YNTB 4J5VA 1NPJA 1ZRUA 2D7NA 3NDZE 4N0CD 2EXYD 4L0YA 2C7UA 4O4HB 2H3KA 2DQ3A 3DX1A 3CVHL 4FHBD 5AUMA 3VUAA 5DZJA 1BQLL 4PM1A 4K4KA 2G5UA 1N67A 2EAEA 4N2EA 1TF4A 3S96B 1WFMA 2HX9A 2HVJB 3QCUH 4JHAL 1ZE3H 1KXTA 1GGIH 4NN7C 3BZ4A 2E6PA 5C93A 4FFZA 5CN0A 3QDJE 4AG4H 3QORA 1NR7A 3FQ2A 3ARDB 1G5GA 1Z9SB 1HKLL 1OJHA 1NSNL 2PTVA 1CTNA 3FAVA 1NOLA 4FNLL 1JHLL 2EECA 2PPEA 2YGQA 1GW6A 3N43F 5DJXA 2H1LM 3D2TA 3U7WL 4OLWL 1N8OE 3ES6B 1ILUA 2LT9A 5C0IB 1Q0XH 2BMKB 3GZQA 4PIRF 4MVRA 3VXQB 1J8HA 2JKRM 1DJSA 5B38G 2HJFC 3APCA 3ABTA 1H5BB 4HKJA 2A38A 3FFDA 2YEZB 2YPVA 1MMMA 3MA9H 2QE7G 5E6ID 5I6MA 4BAYA 1D5IL 5FL7G 4AG4L 4NKMA 4LF3A 3T4DA 1H3GA 2GTQA 2EIMB 4A7UA 5BS0E 3O65A 2B9ZA 4W4OA 4NQTA 4TRPH 1ZK5A 2EDBA 4BQCA 4LCIL 3SPVA 4QAWA 3BDXA 2CE4A 1U8JA 2HRGA 3TYGH 4HU2A 1JK9B 5GGRB 2XKSA 4U2YA 3LPFA 3ISWA 4AYGA 4HGMA 3IDUA 1PIGA 1Q0XL 4JDZA 2PCYA 3L9RA 3TN0C 4ZSOB 3VNZA 3K5LA 4J42A 4BK5A 2CPUA 3ZPDA 1BIHA 1E9QA 3VXRB 4ETYA 3T2NH 4E41B 3JALB 2XCMC 1X9RA 1WAZA 1H8NA 2Q6WB 1CXIA 2BVOB 2ATPA 2QQNH 1R5IA 1T7YA 1XI1A 3RYHB 3ISRA 3RFZB 3IE4A 3UCRA 1RIHH 3L7EA 1O75A 3ZE1F 1IGFH 4AVHA 1NL0L 1IAII 1XCQB 3EJZC 2LW7A 3W37A 3TYGL 1ZHBA 3Q3GA 4K7FB 1ZSPA 2FLMA 1EMTL 2WK2A 3MA7B 4HH8A 4O4LB 3O6KH 5CP3A 3T2LA 1TMCB 5E9DA 1QWHA 1KT2A 4A37A 4CVUA 5IQMA 1MI5B 3WIIL 5BMFL 1K8IB 3DTXB 1L0YA 2MNUA 3EYQD 5KTEH 2B16A 4PV8B 4LEEA 4FI6A 1FJGO 4TXVB 2OXGB 3T2NL 1IVTA 5FOBA 1CFNB 3POHA 4LQ1A 4WTZG 3ROLA 4PBWD 3NK4A 3CZLA 1DVXA 3GLEA 4G6JH 4NWTH 4WFEE 2AKRB 1QA9A 1MKFA 3N06B 4GG6F 4KFMA 4OUUA 4AIZA 3RX7A 4PY7B 1RIHL 3ZR6A 2P49B 3NP3A 1BZ7A 4NKIH 5CBEA 1DUYA 1W16A 4UILL 4P2YA 5FUOL 2H0JA 3BPOC 5MERA 1IU1A 3QDJA 1KFGA 1PG7X 1W6LA 2HX7A 1SN2A 3O6KL 2CXGA 1EQWA 1HH6A 3TGXA 4RGND 3BXNB 2G2NA 4LNRA 5KSUB 4UT9H 5I17A 5KTEL 1FFNB 3SKJH 4EN3B 4FG4A 3SKMB 4JN2A 1BXXA 3BZEA 5I8OL 4OU3A 3K2UL 2LV4A 2X4OB 2XPGB 3H53A 2IG2H 1F58H 3OR6C 2C3VA 2KLRA 5CWSA 2CHNA 3LPOA 3S88L 3H2QA 2IPTH 3BP4A 4IRJC 1QI4A 2FJGA 4RIRA 3UGEA 3OXRB 2Y22A 5I6LA 1G7QA 4G1EB 4F7EA 1NH2B 4LSVH 4KTGA 4B3VA 4YSUA 3QK0A 2EXWC 1T5XA 4FG6C 2Q1EA 4MB4A 5BS0A 4R4NC 1A2YA 1AOHA 2FEDD 2Y5QA 1ZVYA 3G5XA 4GSUA 1AR2A 4UT9L 1YDXA 3VQVA 2GBTA 2OFQA 5EMYA 3VFUA 1RSOA 2CQVA 1KNOA 2MFNA 1N0NA 4P49A 4FFWD 3HKDB 2NLJB 2FB5A 1BZ9B 3HI5L 2KI6A 1VB9A 4P5SA 1PNLA 5C0BD 2PCXA 3P4NA 1W80A 3OG6B 2Z91B 5EBWC 3S5LB 4WI9A 2CUMA 3KPNA 1NTMH 2HTLD 1E27A 1IM9A 3C60D 3BP7B 1QKZL 5LMNO 2JF1A 2BXZA 4UZUA 1KCSL 3BYTA 1XIWA 3A3YB 2FJUB 4ZYKA 2DLFH 1XWVA 4D0BB 4N2DA 4HSAC 4I1RA 1B2YA 1T7ZA 4QYOA 4GRLD 4RAUB 5SX4I 2D7TH 1Q1JH 2XTJB 4NKDB 3CCRV 2FEEL 4L4TD 3VI3B 2CD0A 2VLME 3HKEB 3QZWA 4WK0B 4GH7B 2A6JA 2ZYRA 4K35A 1WYJA 2EDLA 4ODSL 1I5YA 3E8HA 5DDHA 1BEYL 4PJXF 3FOLB 3GMRB 2CAKA 4WFEA 3FONA 1WFIA 4R7DA 3HC0A 1VPOH 1U6AH 2XRAL 1ZHNA 4H8WC 1AD0A 1MSPA 3ECWA 4OCLC 1OKEA 4QRSB 2XN0A 5CINH 3L2LA 1TSHA 1B4TA 2G75B 2O6PA 4S2SA 3BPNC 3ML8A 2Q8BL 4GJTB 1EH9A 2DLFL 4LVNC 3QG5A 5I71C 4GKLA 4KC3B 3WUWB 1CVSC 3VVWA 4GW5B 1QLFB 3G6EV 1HFUA 2VKXA 4I0PB 3SHSA 1A6UH 1BDYA 4QT5A 4AX3A 1Q1JL 3OX8B 3MXVL 5C09A 4TVPD 4UDTB 5HHXH 1I1FA 4NCDA 4MWFA 3KVDD 3ETQA 1E5ZA 4JN1L 2HG0A 1NDGB 1KCRL 1SJMA 1J87A 1O7DE 4IGBD 1U3HB 2B1HH 5JW4Q 1UQSA 1FO0L 3L81A 4LCVA 4KO7A 3E8UL 1U41A 3B9KD 1CGVA 4DFHA 1VPOL 2XPYA 2YD8A 4OZFB 5CIPB 3X3FL 3IJ8A 4DGIH 2CKNA 2C5DC 1LXMA 5CINL 2X40A 1XSJA 3MRFA 2CSPA 1XHXA 2L8AA 1URIA 2QJDA 4UCRA 1X7SA 3GMNB 3K1KC 5T3XE 1SQMA 3MPCA 2XNAA 2CRZA 1A6VH 2DLEA 5KLVH 2QTEA 1A6UL 2AW9A 2YN3A 1LD9A 2PCFB 4PI0A 3F7QA 4QXTB 1CFTA 3I6KB 4YR6A 2G9HB 1VERA 4GOSA 5D5MF 3V55A 4U7KA 3DUUB 3SPCA 4MB3A 1MAML 2UUAO 3FB6C 2B1HL 3R4DA 2QHLA 4R9HA 4ZW8A 2WXHA 2VO8A 1YPZF 3EG9B 4O2EA 1DQVA 2DW4A 4LGSB 4LLDB 4P5RA 1Q6UA 5AKRA 4EEEA 5ICZA 4FJZA 1NC2D 3O9WB 3L7FB 2A6IB 2AXJA 2VDLL 3PLYA 3SDAB 3KYAA 4NVPA 2F15A 4I0XB 4L8DB 1BHBA 5F7EH 4APQC 3IFPB 1BX2A 1OAKL 4DR5O 4YXWG 1HAUA 4AV0A 3FB7B 5KSBA 5T1LA 3BEVB 4HWZB 1HL5A 3D3VD 4LSTL 4GO9A 5A1AA 3QAZB 5EU6E 2VABB 5LBSH 2OP4H 3DK2A 1NANI 5DWUH 4EIZC 5J3HD 1PSKL 1Q9WA 1QSEE 2O72A 2ZYSA 1JAEA 1V05A 4GKKO 3LN9A 1YIJV 1UKTA 3BVTA 3M46A 5T1KD 2LFRA 5C08D 1WJZA 5JHMA 1JGDB 2DI9A 2DIJA 3O2VH 2H9GA 1AXTL 4KMLB 2XWJA 1AILA 3IGAA 4XN2A 2DD8H 4ZUSA 3LKRA 5H37G 3P77A 2QQKH 5FS5A 3KVQA 5KVFL 4PBVC 5GZOD 1NBMG 1DVFA 1CDHA 2AJZB 3AREC 3RB5A 4RSVA 4R8CA 1FFXA 5LBSL 1DQJB 3TO4D 1CEZA 2OP4L 1OCZB 2YPVH 4GAYA 2HG5A 4FFZL 3TLRA 3ASNC 2R23B 3DYOA 2WSPA 3QQ4B 1I1AB 5CA1A 5B7MA 5JXEA 4IT5A 1TT6A 2XBDA 4RMQA 4RBPK 1CFMA 3IDIB 3O2VL 5DQJA 1JXGA 1OGAD 1DLFH 4I85A 5D70L 2B3RA 4MGXA 4DKEH 4JQXC 3RUGB 5LDSA 2QQKL 1KEGL 2RFXA 4WI5A 4F7MA 3T8XA 1X5AA 4PV9B 5HDQH 3REVB 4N2AA 2PTTA 4UM9D 2HUEA 3BFQG 3D18A 1D5RA 4UT7H 4F37K 1T5WA 2VMEA 3LKNB 3QUZD 3B2DC 2YPVL 3S3XA 2QTOA 1GZPB 1VLXA 5F96L 2X4RA 1T1XB 6FABH 4NXNO 5CS7A 3UYPB 1Z7JA 5A2JH 3ZKSD 4QE7A 2AQQA 2D9CA 5E70A 3I55V 2J71A 1M5IA 4OCMC 4NKGB 1B0IA 4A2LA 1DLFL 1FE8L 1NIBA 1RZKC 2DJSA 3H7LA 5CHNA 3F05A 1RPOA 1MCRA 1OGSA 2MH4A 4P04A 3I56V 3V0VA 2WXLA 5DGQA 1IE5A 1LILA 2EEDA 3V5DB 4ZIBA 1Z9PA 2ICEB 3DV6B 3U1SH 4P9MH 5HDQL 2WD0A 1FFOA 1RXLA 1F02I 1YUHA 3LZLA 4ODTL 5I8KL 4UT7L 4DQOL 3TBWA 3VXNB 3UO2A 2Y48A 4LRNH 4EBQH 4CH5A 1P5UB 4JGUA 3FTUA 5LP6B 5SWSD 1U8MB 1UT9A 3O6FC 2AQ3A 4J28A 5KUKA 4XVUC 4KJPD 1PNDA 3AG7A 3IMSA 1QSZA 1Q94A 4UOQA 2GTWB 1AJPA 4YXKH 2ATAA 4TVUA 3GSXB 3NQIA 2JLPA 4B9IA 4O5LH 3H6JA 4X1KB 3I9PA 1RPKA 4WUKH 2X44D 3E3QE 3W0WD 4LFBB 2FH8A 2WYIA 3FF7A 4C4BA 4DP1X 1D2DA 5IMKB 4MD4A 3U1SL 1E1RG 2E7DA 1J0JA 3WMPA 5IEKA 4A2EA 1IAIL 2E9BA 2BCMA 3NZ8A 5IZ7A 3BAYA 1CBVH 5D7LB 5EZLA 1IEAA 1VKXB 4WFAV 3AM8A 4AGOA 5DRNB 4LRNL 1T89C 2MTAA 1SFDA 3S2AA 4H1LG 4EBQL 3ATBA 3H01A 1X5ZA 2WLHA 2CMRH 2NR6A 3V10A 5D7JB 2Y7MA 4AILC 1GCFA 3SDCB 1FZKB 2MQGA 4ZPTA 2AZUA 5IWLA 4K3AA 2ZE6A 4JGNA 4R97C 4AC4A 1WD9A 5CBHA 2ZONA 2Q76A 4AI7A 4G7YH 2GABA 2FQFA 4BZYA 2VDOB 3BIKB 3W9EA 5ALBL 3FCBA 4E36A 4WUKL 2N1TE 1JFQH 1P4IH 2UX6A 4PEEA 2WCSA 4Y1TA 1YEWA 5JOFA 4Z76B 2FVNA 5D1ZI 2WWKT 2DWEB 5CD5C 4IYHA 4KV5E 3SGKC 2YRPA 2RQEA 4EFBA 2IANA 2OMVB 5DJDB 3JASB 3BGFC 3UTPE 2UXTA 2WGXA 4XNUH 1CBVL 5D2LF 2CKBA 1HL4A 4GRWE 1SQBH 4M6NL 3B40A 3H9SD 2CMRL 2P8LB 2Q86A 2VMCA 1NEPA 3ATAA 4JFXB 4EO5A 4TTDC 5D1ZA 3BUBA 4MBRA 5IP4A 4JB9H 2NUPA 3G80A 2YR3A 1JGUH 3PL6A 4PJHF 4UTBA 1JSYA 2A4EA 4G7YL 2XETA 4X5WB 5F7UA 1RIVL 5MEOA 1PTZA 3PHQB 4YWGH 3ZIMA 2WPDG 1L0XA 5AW7B 3O8XA 4OGQC 3QEQB 4KX9A 4HFWB 3NJIA 5J4MA 4N2FA 4XP5H 1RZJL 1U8HB 5L2KE 5BW7C 3KWXA 3TFKC 2OSXA 2BSTA 2UXGA 5HDOA 1IAMA 1WAPA 4PGCB 2F5BH 1UJ3B 5EOTB 2F8IA 1IBMO 5E7FA 3F7YC 1XGPB 4U6XA 4LFCB 2KZ1B 1MVUB 3LIZH 5D7KE 1OAYH 2WB1A 5E1AA 4CU8A 3FUNA 1OF2B 4LP5A 3DGGB 4DO4A 4J80A 1TZGL 4MX7B 5B22A 5FYJH 3K74B 1WZKA 5F9AC 2QKIA 3CN4A 4FQIH 2OMBA 4P57B 3NIFF 5HYFA 1SDDB 4ETQA 5JIHA 2ZAIA 4YWGL 1E3FA 1OP9A 1R17A 4J8RA 3RX9A 4PG2C 3VDBA 3V0WL 5JNYA 1NAMA 2I69A 2WQSA 4XP5L 5FYKD 4ZX6A 2JGUA 5ABAA 1BGXH 4U1HB 5GRVK 3SJBC 1NIEA 3C6LD 4MNGE 4WNQB 2WQVA 2K7PA 3TV3L 4RMVA 5JORB 2DYPB 3QYNA 4ODWA 4B5ZA 3RJDA 3NJMA 1PJ9A 3LIZL 2AP2A 3EXAA 2DQUH 3Q43A 4U1SB 5KSVB 3CPLB 1QACA 1UD4A 3GXUB 2NY6D 3G9VA 2HPTA 5FYJL 1E8WA 2P8MB 2KLSA 5L3DA 4X65B 3C6SA 3FO2A 1ROPA 2RN9A 5K9KB 2EKSA 5L3FA 2Z31A 4XO4A 2CR3A 2X1WL 3DJRA 5GJSL 3WSQH 3U46A 4DVRH 1P9MA 1CDUA 1NAKL 4XCFH 1KBBA 3GZOA 4PJ8A 1EBOA 2BVEA 2HRHA 1PLGL 3QUKA 2FHFA 3EOTH 3ROOB 5F7HA 5A9GA 4MAYA 4GO8A 1QZ1A 3MU3A 3ZKXB 3VXMD 4NXMO 4DYLA 4H20L 1OCRB 1DN0B 4O4IB 1BLIA 1NMCC 1V7NH 1XH3B 4LGRB 3V9FA 5EEVA 2DQUL 4NI3A 4CC0A 1N70A 4X4MA 4ODBD 1CGUA 2BW5A 1T1WA 2EIZB 5EU6B 2YAFA 3SYPA 2RTTA 2UZYB 3CRAA 3GFUA 3WSQL 2BCKB 4CC4C 2OTWB 3FCUB 1T22A 4NO0A 1L9PA 3FT4B 2Z8VC 1QSEB 2UZXA 4XCFL 3WN5C 1VDGA 4H8HA 2OCJA 2OJEB 4P23D 3L6FB 2DMBA 3EOTL 4LAJH 5HYEA 5E2UL 1RIUH 4FLXA 4LB8A 4XNZB 1DZBA 2KQNA 3NCBB 1S7SB 4OZIF 3IM1A 3RILA 2CLRB 2QVMA 2VDMH 3UTOA 4OR1A 1A25A 2HUHA 2K4WA 5J11C 4JI4B 3CX5J 4OFQA 3U48A 5L2KA 1G7PB 4F15B 1BXUA 4XB3A 2IU0A 4NAMA 2A0LC 3UYRL 4I1PA 2B5IC 2JQMA 2O5XH 1ZY9A 1H3VA 4HS3B 5IKCB 1ILSA 1RHHB 3AK1A 2EDXA 1XILA 5CMAB 1T6WA 3PWPE 1D7BA 4OCYH 5AYUH 1BW8A 5CGBA 4UOW1 2AAAA 1T0NA 3JV6A 4U1LA 4JM0A 2Q69A 1VEPA 3BVNA 1M42A 1YVWA 4X83A 1ZWIA 2VDML 5E6IB 32C2A 5IQ9A 4BCYA 5F88B 3NBNA 3BT2H 1OAQL 2X3AA 3FHAA 3MRNB 5CBAB 4B0MM 1XB6A 3TETA 1QEWB 3IDGA 1H6UA 2EDJA 1UH3A 3NCWA 4MYPA 1DTUA 1NDTA 1M93A 2O5XL 4PGDB 3OF6A 2EEFA 4K5NA 4XZUA 4RGOL 4NBYB 1JZ5A 1NEZG 4YJ3B 3VFTA 5EZYA 3WS6C 1AGBB 4XNQA 5DS8B 5HGAB 2XAGA 2XWCA 3BHBA 5FGBA 2CWRA 3CH1B 2ENQA 3ABZA 4LHUB 5JW5B 4N0FA 4YSSA 1AZBA 3HS0B 1QU7A 2ZNJA 1J1OH 1F4AA 2ZQKA 4L29B 4LLVA 4A67A 4L0PB 4TUJA 4OM0H 3WS6A 3JT2A 5E2VH 1FA4A 4X7CC 3VQMA 3LQAC 3TNMA 2P52A 5EU5A 2XFXB 3BT2L 3ZHKA 1W0JG 1FXVA 2IJIA 2WM0A 4HZ3A 3J81N 2BINA 2ATKB 1KTRL 1CD8A 2C1PB 1HYSC 1UOLA 3CFCH 3D85D 1SFHA 3L3OA 1KY6A 2VDRB 3W1ZA 3RWJA 1S76D 1W8NA 1IIIA 2HT2C 1MABG 3O81A 1MZYA 5BO1L 2IGFH 3RY6C 4LARH 1VQ6V 4M29A 5DZLA 1NOAA 2XWBA 4LWSA 3CVBA 4OFYA 5JIPA 1MUJB 3B7YA 2VM3A 3PWNA 3OLGA 4J12A 5I1JH 4B3SB 2EIJC 2BX5A 1NCGA 5E2VL 1PL0A 3ZYJA 1GC1L 3BVUA 3MACL 4MJ5B 3QC6X 1ZT7A 3D9AH 4PJDA 3WHXA 2E56A 2DMXA 1HL9A 1MH5B 1PNCA 4QR7A 2YUZA 2ZCLH 4Z7VB 5IBTH 4G3YH 4FLWA 4ZW3A 4YBQD 3OHXA 1TG8A 2EE0A 3CFCL 4JKPL 4LZKA 2HN7A 4EIGB 1MCWW 1TTFA 1ZVSB 4FQ1H 3S2CA 4BFRA 3HCVA 1TQCC 2IGFL 3L3JB 4LARL 2YEVA 1XTMA 3IJHA 3S3CB 3OKKA 2X9XA 4OI8A 3VD7A 4I2XE 4JFWA 3RA7H 1L7TH 4G9DA 1MSDA 4JFPB 5CCGE 5I1JL 2XN9E 2BSEA 3ZTNL 4HG4K 3L2NA 3EJSA 4E9XA 4LP4A 3WIHA 1A7PH 2UY7B 1N34O 3A67L 3CJHA 3BEWA 3PWJB 4WWKC 1A3QA 4LKXA 4BD4A 2X89D 4KNSA 4HS8H 2G3XA 3BHPA 4Q6GA 2BTQB 2W0PA 5HDWA 3UP6A 4ZI7A 2BNQA 3BO8A 4GRWB 5DMGC 4CNIA 2NYYD 2PXYA 3FU6A 3MXWL 3LRSA 5F6HJ 3L3GA 3CCJV 3D25B 1WA8B 4JY5L 4Y16D 4B9GA 3L73H 3JVGC 3NP4A 4ZX5A 3QUXA 1E4KC 5E95B 4O2BA 3KBHE 5CA0A 1OP5K 2ARJB 2D2OA 3IGFA 1G6VK 4HUMB 5LN8A 1YEEH 1PDKA 3RX5A 3FRPB 1B4LA 2AXGA 2ALWA 2CKBH 1A7PL 2OTUA 3HE6A 1VQ9V 4WRLA 2FWOA 3KNBA 2ZKYA 4JFTA 4FERA 3T0EE 5TDOA 4A6YH 4EF3A 2NTFB 1K97A 3WYRA 3C60B 2EINC 2WXRA 5TF0A 3NFSL 3VXUA 4JDVB 3QO1A 2DQ0A 1JMXA 3DX2A 4NOBA 3MJWA 2KS0A 4B9PA 5AB2A 1O7SA 1GK9A 1T0MB 2PNDA 2VAAB 2R27A 1ET8A 5ILTL 4DUYB 4XCYA 1R0AL 4H26B 3Q4HA 4O4YH 5AZEH 2Q2LA 5FUCC 2UXDO 1AO7E 3K0YA 3ESNA 3QQ9C 4JG5A 3L3KA 1USQA 4MD5B 5DJAA 2KC0A 3ZYZA 4L4TB 3N2KB 4LQFH 3EJRA 4N8VB 3C5ZA 1E2WA 2CKBL 2F1EA 4QY8A 1MJJB 2WLNA 3QEGL 3V4VB 1R3HB 5CP7A 2O30A 4MNGB 4PREB 5DYOB 2P26A 4AT6A 4JAMB 1MHEB 4NZFA 3QCTL 3GMQB 1DR9A 4KXAA 3S0PA 5HYQB 3ARPA 4UTBL 4UOW0 5ISZD 4MVBC 2O5NA 4I4TA 2D3LA 3K5OA 2IDFA 4M02A 5JTWA 5SV3A 4JFDA 3B77A 1D5BA 4PSPA 5CZXC 1BYPA 5D93C 1NAMH 4JREB 4HIPA 3BKJL 4AW4A 5A3IC 4DR4B 5D71H 4F5CE 2R1YB 2ZPKL 4TNVK 2TRYA 3KE0A 4Y2LA 3GYRA 2F58H 4KQ3H 3GXDA 4LQFL 4M4PA 2HMIC 1GMGA 1E90A 2IH1C 1HWWA 4LLMB 3FKSG 1HWHB 4N5EC 1KTJA 1D9KC 4LEXL 4FQXD 4MSWB 4Q2ZB 4WWNA 1AXIB 4LSQH 3O11A 3B9KB 4V2CB 5FYKE 4TUKH 1XGQB 1JS4A 3X3GH 3P02A 4M6OH 2IV8A 4FN0A 4KGJA 1Y0LB 2Y23A 2ZM6O 1NOFA 3F3HA 4G59C 1P7HL 3CSXA 5BZXA 1A21A 2VJXA 1J9TA 1NAML 4PJ9C 3T3PB 3WY3A 2A74B 3DVNB 1MWAA 3OB0H 5BXZA 4FQPA 4ICWA 4ISVB 5TF1H 3WFHB 4AL8H 2FD6H 4FS0A 4UNIA 3VD0A 3TPKA 5IVXB 3AT9A 2YXWA 1OSZB 2MTPA 4KQ3L 3MGTA 3QNYA 3DMMD 1E6JH 1JVKA 1N10A 1FNHA 1OWRM 4OFVA 1XMEB 4K7PH 4LSQL 4I89A 2WKLA 4N6RA 3Q8AA 4MNHB 4LPUA 4R5XA 2JJ1G 2K9FB 2NNAB 3X3GL 4C4UA 2KSDA 4YHNA 4M6OL 3T0EA 4HJ0C 1JRHI 4FK5C 3DA0A 3J8F7 4U6HB 1CPUA 5E8EB 3QORD 1IDSA 5F93C 3U6RA 1B0RA 3V0IA 3WOVA 4IDJH 1EA9C 1NUFA 3IXAB 1RZFL 1FVDA 4LAQH 4QRQB 5KOMC 1GTNA 2W80C 4ZPVB 5TF1L 5D6DA 3GNML 2FD6L 3D3VB 4TNWK 4JJ5A 1H3XA 1KXVC 3PWPB 1YY9C 1M9SA 1ZD6A 1FD9A 5FNVA 4X89A 4JTDB 1E6JL 2G2RA 3CXDH 3D0VA 2ZCHH 3FCSB 1KIRA 4TNGA 1AO7A 3QISA 4UCTA 4FQ2L 4K7PL 4QGPA 3GSQB 5KYWA 5T1KB 2ZT9B 1KPRA 1JD9A 1KCVL 2QQLH 3BZFA 5DFTA 1I7FA 1TA8A 4JG1H 4UQ2A 1ZLVH 3UZVA 4GAJL 4K7PY 3BCCH 1NKOA 3MBWB 2WXOA 4WY7H 1M7DA 4YGVA 1R3LB 3APDA 4LAQL 3KGSA 4URTB 3GXPA 3FSZA 3ARGA 5KBDA 4N0UE 2DMHA 4NZDA 1BE3H 2FQGA 4BE5A 2NY7H 4MW8A 2E75B 3TO4B 5BVJB 2EUWA 2BHYA 1HXMB 4PLOB 1QR9A 3RWGA 5ETUA 3UJIH 3ML9A 3CXDL 4GSQA 2DQCH 2ZCHL 4XHJC 5F3HA 3ME0A 4F5CA 4Y7OC 4YHIB 2L7JA 1ZHKA 5HYJD 3L95A 1GGUA 3WFBH 4JDEA 4IYKA 4JG1L 2DQGH 3TZVA 3ULUC 3ZQ9A 5B66Z 4FFVD 1K9MW 3CFBA 3BWAB 3H1ZA 5LOVB 4JV5O 1G7IB 2GFBA 2N01B 4TSBL 4W9FC 4JQIH 4PJCA 2FX7H 5A43C 5E2JA 4DCQA 1RSYA 2YOAA 4M8QA 1BFVH 4HVBA 4FCHA 1O9HA 4N2LA 4UM9B 1SA0A 2CCLA 1AS7A 3G5VA 3PGCA 5FGRA 2NY7L 3TXSA 3HR5B 3QUZB 1OPGH 1PQZA 4DR7O 3DGEA 3UJIL 5E9DD 2FIRT 3MV7D 2Q5ZA 3C5SA 1Y6NR 1IBLO 4OZHF 3ULVH 4L8SA 5D2NE 2V2XB 1ZSHA 3WKMH 1GPOH 3BQUB 1RPUA 1GGBH 2WJ5A 3ZN6A 3JWNH 2P80A 4MCZB 4C4KT 3W11D 4CKQA 1FPOA 2VXVL 4QNPE 1I3RA 2CUGA 2YQBA 4JQIL 2FX7L 3EOYG 1HH9A 4Z18A 4GP4B 3MI6A 3HZYB 4PLJC 1UM4L 5FKAA 5IUSA 3SYCA 2YD7A 3PE9A 5KAFZ 2F23A 4I3RH 1E5BA 1U8NA 3RNQA 5LXGH 4AIOA 4Y2NA 3TO2A 1Q7YW 1TIUA 2QKCA 2B14A 1QPPA 4I2XB 1I7ZB 3ULVL 5SWSB 3F64A 4ES8A 1AR1D 1GPOL 3LXAA 1UA7A 3FB5B 2XN9B 4E0RB 5D9SB 1GH7A 2BVTA 1L6PA 1YMHA 1EVTC 2YA1A 1ND0A 4GG6E 2Y4TA 5FKPA 5CB4B 5LQBH 3RWEB 1IEBB 3ZT6A 4WAFA 2WHVA 1VADB 3FRUB 1A6TB 3W0WB 2LGNA 3QXDB 4NQVB 5D1QE 4Z0BH 2GK0B 5DEFA 2VLRA 4UF7C 2C3WA 3EJPA 4XB8A 3ZL1A 3SQOL 2BIMA 4H7VA 4X1YB 1X44A 3VACA 3DX3A 1PZ5A 1JGVH 2WXPA 4E4EA 5LXGL 4H13B 2C4FU 3D50A 3NCXA 1XGUA 4UV8A 2V9UA 4MNQE 1U97A 1G0DA 4N0UA 3SGJC 2WQWA 4EZLA 2QZQA 5I1LA 2XQBH 4OFIA 2NY2C 1BQSA 5C6WH 1HSBB 2HHHB 5F97E 1ACXA 2WVTA 1NKDA 3TU6A 1NGZB 4BFIB 3LYRA 4RSYA 1J11A 5H2BB 2IAMA 4TUYB 1BVOA 4Z0BL 2ODHA 3IS0X 1I8LC 5CEXA 2I32A 1IM9D 3OAYH 4DP4X 1JJUA 4XX1G 3BJLA 1NFAA 2L0DA 5KJRH 1FYHB 2H8PC 4NI6A 3ZZLA 2KUTA 4NO5B 3SOTA 1IGYA 1A9BB 2GAZB 3BVXA 2HXAA 3WIHL 5MEPB 4HUWB 3VU2A 1V9PA 4YSTA 2B3IA 2XQBL 3CCLV 2FNWA 4LR3A 2QHRL 5DVLA 1IBKO 1V55C 2N7BA 1DSFH 4PRNA 3VGHA 3SY0A 3L9BA 1CI3M 5D2NA 4AYDC 3QRFM 3FYIB 3PQYE 4JPVH 5BNXD 1FXKA 5FYJD 4AQYB 2X28A 3KDMA 2N3JA 1PD3A 1R3IL 3QJFB 3WEAA 5KJRL 2EX3A 2YFOA 3Q01A 1V10A 1UWXH 4DR1O 1P6FA 1EAOA 3NEEA 3VO0A 2DTML 3U83A 3L9DA 1FLRH 1SLXA 2XA8L 4JDTL 4G8IB 3IU3A 4EQ2A 2OPCA 1Q9OB 1K4CA 4BQBA 4YHMH 3ILPA 3KPRA 3QZOA 1FL6A 1T66C 1PYWA 3DHPA 3MNVB 2FJHB 1IGCL 1MJUH 1CZ8L 1JWMB 3SGIA 1L5GA 3E8GA 4TSCL 2UXBO 1CDYA 5F9WB 5C09D 5CR1A 4HIJB 5JQGB 4N85A 1RVFL 1FKAO 3ORJA 4YHYC 2GQHA 4IEFA 4N3UA 3S8FB 2IBBA 1AZZC 1UG9A 3QG6A 1KJ3H 1K4DC 4PJXE 3HLKA 1X5HA 4JPVL 4U3CA 2MQCA 3FFCE 5EU7E 1G9HA 3T08A 3ZE0B 2ZP8A 1FVCB 4GG6A 3SKOB 1S7UB 2WLMA 1UACL 4DR3B 3S3BB 2Y69B 2GJPA 4LCWD 3T2QA 3V6OE 1R4XA 1FLRL 3BLPX 3BP6B 3VYPA 4L23A 1YN6B 2NY6B 3CFDA 3G67A 1G7JB 3MYJB 3N42B 1CFSA 2DWXA 5D55A 5IJKC 3VJ6A 4NHUB 3VSUA 1SJEB 1QUPA 2JJSC 2XVGA 5AZ2H 1DCLA 3QDGA 4U31A 5F1KC 4X9FA 4UQDA 1KJ3L 2P5WE 2ZUWA 1SETA 4O00A 5GSRA 1OSPH 1DO5A 3MNWA 4FI7A 1E5YA 1GMIA 3I3DA 4G27B 1PM9A 3VXMB 3BUDA 5GGTA 4NRXA 4YSOA 4GQ9H 3MX0B 4I3SL 3T71A 2ZWKA 1RKRA 2BIPA 3PP4L 2PCPA 4NPKA 2D2CB 2X4QB 3G71V 3CZSA 3F65A 2D03H 2V7NB 2Y36L 3EOAA 3KGUA 4G42B 5T1LD 1C12A 4K8RC 5IW1B 3KLHD 3F5WC 4KZEH 5GRUH 1FV1A 4LLWA 5DD5H 4XWOD 4EZMA 3S3PA 1YPZE 2AEQL 2PETA 4M7JH 2ILLA 3ZN0A 1H3WM 4P23B 4LSUH 1IC7L 1PV0A 1OSPL 2AJSH 3DO3A 3KHOA 1KTCA 4OAWA 2YPLA 2VE6B 1U92B 4LDCA 1Q0EA 5E5MB 4PJBF 4GQ9L 3PQYA 4LEBA 5E99H 4J7RA 2ZWYA 4ZS6D 5JZ7D 2H94A 2KHAA 2UY6B 4CBZA 1FAIH 2D03L 1XAKA 1U36A 4NS0A 4LVHB 3U4BH 3OLIA 2AHIA 4ZMQA 2JQAA 1KTLB 4N90D 4AT6B 5GRUL 1INQB 5DD5L 2FO4A 4TUOA 3QIWA 4X6EA 4M7JL 1B2WL 3EH2A 4GNKB 3TJHD 4XCNB 2BC4A 2E5LO 1OIOA 3DC0A 3KYNA 3MOAH 4LSUL 2AJSL 2WKOF 1R19A 3WTUA 4WBNA 4P9HC 4E9LA 2J8HA 4IBVA 4LBEC 3NGBC 1B3JA 4JFVA 3IDMB 5JDSB 4KTDL 1AMYA 4HGWA 2Q3ZA 4PJXA 3WTVA 3D39D 1J86A 4J4PA 2E74B 2W6JG 1EK3A 1JRHL 3MJ6A 4PGEB 4X8JB 2YK1H 1XREA 4EI5D 1NGXA 2O5YL 3ZDXF 4X4YA 4PY8J 4IS6A 1FAIL 2Z93B 3TTYA 5DD6B 1UZGA 4WO4C 1LEGB 1S7WB 4Y5XA 3V6OA 3H3PH 2C26A 4XDJA 4TWKA 3HRZB 3D1MC 4BH8A 1FXHA 4GY4A 5CO1A 4WEBL 2Y7SA 4QHKI 1A4AA 2ZJSH 4IU3B 4Y4HB 2R0ZL 4KNTA 3BMWA 5IB2B 2HVJC 5JPMA 3DBXB 1R5VA 3IT8D 3BKMH 3MOAL 2R2EA 5BPPA 3UTZA 1S7XA 1AHKA 2GTAA 1DBMH 1OY3B 5C97A 1RUQH 4XXWC 2P5WA 3HG0A 1KF9B 3U9WA 1OW0A 4OBSA 3X11B 4N28A 3QDHA 2AQPA 2L35A 1NM9A 5IYDO 1OSYA 4HKBA 1A7RL 1TQSA 4F1ZA 4DZBA 5JYMA 3H3PL 4J23A 4PS7A 3PV7A 3EYVB 3LKOA 5C71A 3DX8A 3VTTA 4AITA 2WLYA 2HKAA 4X6CB 2P8PA 2M8XA 4WI6A 3SB3A 3G5ZB 4UQ3A 2ED9A 4OT1H 5FCUH 1THZA 2KLTA 1ZK9A 2XIDA 1ZUQA 3BKML 4U3JB 3MV7E 5D4JA 1J10A 3N40F 5D5MA 5C2BL 2DQHL 4S0TD 1AY1H 4NN6B 2CZNA 1DBML 2EO1A 1RUQL 2V8LA 4FEIA 1YPZA 4HZLA 1OEZW 2BOLA 2VWJA 3MRQA 2W38A 5KVEL 1JGEA 4P99A 1DBKH 4PRAA 4YGAB 3OJDB 2F1BA 4A38A 2X0LA 1SMDA 3X1GA 4BBWA 4IKIA 2Y07H 4EE2A 4GSRA 3D7PA 4CMMA 4F27A 2WMPB 3IPFA 2GVYA 4PPTA 4MNQB 4U1IA 4LF9O 2WINB 2K78A 4IIQB 4A66A 2K8QA 2NR6D 3NA9L 4Y4FD 3C6EA 1EPFA 4OT1L 3MUHL 1RUPL 4OSUL 3B3BA 1AANA 1LVEA 2AK4D 4YC2B 3ZJZA 1AY1L 2XXCB 3WJJC 4ABQA 2ZNWA 1OSEA 1R3KA 4DSYA 5AW0B 3T6ZA 1YQ2A 2PPFA 1OGPA 4QXVA 3RYMA 3T9WA 3TT3H 3W81A 5KBPA 3BLKA 3HKZA 1QATA 2I60H 1LEKB 2RBLA 1VQKV 1N59A 3LD8B 4S1SH 2YXMA 1TMQA 1SEQH 2IAND 2PYEA 3IRCA 1MAKA 3MREA 5EU4A 3DX9A 1MLBA 2Y07L 4U1NA 4XH2B 3SY6A 3IMTA 3N0PB 3DURA 1BMFG 1ETZB 5BZDB 4ORGB 4Y16B 5GGUB 3VXOB 3K59A 1TGOA 3S3WA 5D1ZD 3MJ7B 4YHPB 4JM2F 1OO2A 1KTKE 3PL6D 2HP8A 2ZTBA 1N12A 5FYLE 5DLMH 3ETSA 2A6DA 2FYYA 4NP9A 5DF0A 4OXSA 3M07A 4YXHH 3MO1A 3TT3L 5KJ7E 1CXKA 3DJ9A 5HGDA 2I60L 4NEHB 1VZHA 4AEIH 4YAQA 3JSLA 3G5YA 4S1SL 5C0AE 1EFRG 1DVQA 1MJ7L 1SEQL 5D5PA 4PJ7E 4R96A 4UBDC 1E5UI 2Y5TA 4ZQKA 1ZT1B 1Q3EA 3CHXA 3TOPA 5FO8A 1F18A 5I1AA 4XBGB 1TYJA 1D7FA 4LLUA 1YEDB 2KT6A 3MBEC 5HJ3B 1GHFH 4X9IA 5ADOH 4HBCL 1UXSA 4HZ1A 3QFJE 4U49A 4EN3C 2WWOA 1BJ1J 3FS9A 2OJZH 4X99B 3ZTCC 2OCFD 1NLDL 1F90H 2VLJE 3FUDA 4HT1H 3OGCA 4AUJA 1OV9A 1MCNA 1YMMA 2R1XB 1K5NB 5MEQB 1TJGL 3PIQA 3TURA 2Q3AA 3VXSD 3FFCB 3VH8G 4P07A 2B7DT 4LKCA 4AKPA 1XBRA 1FDLL 3RVTD 3O45A 4LDEB 2J44A 4HPOH 2ZR2A 5AVQB 3VFWA 4KVPA 4N0RA 3MROB 1D7CA 2GTZB 4NN5B 1AHMA 1DUZA 3RL1B 3TBSB 3AAZA 3P2BA 2KPWA 4KUZH 5ISZB 1ZEAL 1YJWV 5EUKA 2W8CA 1U96A 3GSNA 1KJVA 4JHBA 3L3HB 5ADOL 5DQDH 2XAFA 3OWRA 1DLHA 4RQQB 3EO9H 1N8ZB 2APTA 3ETTA 1ES0A 2BSCA 2DRUA 1BOGB 2QDWA 4HJTA 3HG5A 5IROC 1AP2B 5JLZA 3HKCB 2BZ7A 4M9OA 5HSFA 4ZOLB 2NLJC 1FUNA 4OFDA 3A0OA 3IDJA 2IGTA 2Z31D 5DC4B 1WB8A 2PLTA 3HB3B 1BJ8A 3PV6B 4OKDA 4URKA 3O0LA 4LHJB 4PJ8D 1BVNT 1X7TA 4B3EA 4R4FH 4ZOEA 1DEEB 4DJMA 1RQ5A 4FQXB 1F1AA 1I08A 2VLKD 3U0TB 3C8HA 1FFQA 5HHME 1UCTA 4NO2A 3FDWA 5IDJA 4X7TB 2EXSA 5JH7A 3N40P 4KUZL 1Z5LA 1ESOA 5DJZA 1KBPA 3FTVA 3T4YB 3RWDA 3LNNA 2OYKA 1Q9LB 4LCWE 2YD5A 8CGTA 3T0AA 1KLFB 3OKNA 4S10A 5IJ0B 3EO9L 5GRJH 1PD6A 2W9LA 2XXMB 4HWEH 2XTJC 2OXHB 4HUXA 4PP1D 3SODB 3TCLB 4X1IB 1NCWH 2C7UB 2R2BB 5C8YA 1CTMA 4W70A 1KN4H 4NO0D 1BBDL 3X14B 4WJ5A 5FK9B 3GLAA 1UWYA 3KLKA 3MDSA 1F2XK 1WS7A 3DMMB 2WB7A 2XJKA 5DHYA 1IGIL 2Z64C 3ARBD 2EILB 3M99B 1IKFH 3CCHA 2FX8H 3BMVA 5EIQA 1S46A 1M56B 3N85H 3QQXA 1RUKH 5DK2A 1LWJA 3HAEH 3SGDH 1MVYA 2BP8B 3HMWH 3L5HA 1YJNV 3FMGH 2V7HA 4X66O 2BP0B 1HHHB 3QORB 4HXBL 4RX4D 4DO2A 1G9ML 5D2LA 5IESH 2OZ4H 4I0PC 1RU9L 3LH8A 4HDIB 2ZDIA 4IHOA 1PW3A 5IFAL 2JKTM 3E2EA 12E8H 3M86A 4F9LA 1FNSL 5IHLB 5KVDH 5I15H 3WO3B 1KN4L 1SLUA 1BFSA 4HUUB 5GGTL 4HXAH 4PJHA 1ROCA 4MDJA 1U3HC 3C90A 2K0RA 2VW4A 4WFFE 4Z7WB 1J5OH 3T1HB 5KAQF 1IT9H 2VLJA 2WQRA 3B7SA 4IRSD 5B3NA 2BNUA 4DV3O 1UUSA 4KI5C 5KVGE 3CTTA 4G7VH 1FHNA 1T4KA 2FX8L 2EDKA 3FQWA 4PJGF 3QJHA 1I4FA 4L4VE 1LE9A 3FMGL 4LF3B 4X8AA 5IESL 1JF1A 1QX1A 4HJGB 2C4XA 2P9RA 7CGTA 4FQJH 5KS9F 3BH9B 4F8QA 1KGUA 1EAPA 1MCPL 5CR8A 3MZGB 3FUIA 1TUBA 2C34A 1DSYA 12E8L 1NWOA 1W2KT 3OF6D 2PUQT 4QRPE 1I1YB 1TFHA 4KK9D 1AHWB 5I15L 4ONOA 3KJ4B 2WNKA 1LO5A 4JVUA 4NZJA 4ANVA 3GMLA 5JOEA 2HYMA 2VTFA 3QULB 3V0FA 3WEXA 2J6WA 2JKLA 3RBGA 3WLBA 4J3WA 1FL5B 2Z4QA 4G7VL 2B1AH 3D2UB 5HYJB 1N32B 2GITB 3O9WC 4FZ8L 5JQ6H 3SDAC 2LU7A 2NN4A 2X4SA 3MODL 3LX9A 3GB7C 1R5IB 3BQVA 3GGWA 3QO0B 4YK4B 5D1XA 2G30A 3LMJL 4NDMA 4QLRA 3ULVD 3CQQA 2YD3A 3L7EB 1NGPL 2PWGA 1J05A 5L3EA 1CICA 2A83B 2JI3A 3IJ9A 1NFDF 2HJKA 3QNZA 4S11A 4AJ0A 3QAZC 4FZ1A 2PR4H 4A2DA 4I7ZC 4W1TA 1LEIB 1YEFH 4M3HA 4Z3FA 4GW1B 4ZK8A 5T1MA 2E3VA 5E9DB 1ML0A 3ZHDA 3MV7B 2Q68A 5JOPD 3BAJA 4PP2B 2DDQH 4XR8C 4QHMA 4OJDH 3KLAB 4WDIB 1JE6A 2NX5E 4OFYD 2JB5H 5IVZB 4RDQF 5JQ6L 4LU5H 3ZGHA 3VWKD 3KCXA 2BOCC 2V9RA 3OMIB 3OLDA 4Y1SA 1NBVH 4DR2B 3DRQB 4GQZA 5T1JA 4AIZB 3HHSA 3RIFK 4M3KB 3HMXH 4WCYH 3BDYH 4X0KA 2DH2A 1VQNV 1T80A 2W9DH 1PNMA 4HETA 5AG8A 4AC2A 4F9PA 1HHIA 3U7AA 3SO3B 4CH3A 3LKQA 2BY3A 4QTFA 1N26A 3WJMA 1L1FA 5EEUA 4KKAC 1I1AC 4L37B 1FZOB 1OHQA 4G1MA 1YJ9V 3BUQA 4Y2DA 2DDQL 1F23A 2WCGA 3HBPA 3A22A 1AR1B 4JG0H 4XPAL 3N04A 1HILB 4M7LH 2JB5L 3L4UA 5ESVA 3EJJX 1A02N 1E5CA 2EVFA 1TVKA 4DTGH 3IJEA 3QA3B 1YDPB 5HHOE 4AK2A 4LU5L 2BSED 5HD8C 1JYXA 4WFFA 1CU4H 4WQOA 1NBVL 2L4OA 4P3CH 5F1NA 2C3VB 3PJNA 3UJJH 2MCPH 4OF0A 4OZIA 2Q8AL 3BP4B 4DGVH 2JK5B 3FU0A 4DUZO 2FJGB 4PR5A 3BDYL 5I9QC 5B8CA 1LWHA 2W9DL 4WTWA 5TH2B 3BKYL 4L4VA 2BNQD 1BVNP 3QDME 3CFUA 4GKSB 4UAHA 3V7AG 1ZT4A 5C0EA 1KD1W 3MJGX 4GI6A 4YDKH 1WCBA 5JPNA 1G4RA 1QHOA 4DV6B 3QUXD 4JG0L 4QRPA 4M7LL 2VC2H 1HEJC 1KNOB 2FJSA 4LRIA 1HESA 4FXGB 5C0GA 4DTGL 3LDCA 4HH9A 4IRZA 2QGDA 2O57A 1CU4L 2NPLX 5GONA 2A77H 4P3CL 4S1DC 2LFSA 3NIGB 3HE6D 2A06H 3DHMA 2MCPL 2KG7A 2ICEC 4ZHQB 5C0AB 1U8CB 3KPNB 3QAQA 5KYYB 1PZUB 1WWBX 3UBXB 1QSVA 5I66A 1NCOA 2HT3C 1F3JB 1AROP 5GSVB 3VXUD 4I5BB 4D3CH 3MR9A 2Q6AA 3NSFA 3P32A 2P42B 1ZGLM 1P5UC 3P4OB 2BSDA 5LP6C 2CG9X 2FDBP 3S5LG 1UZ8B 1AQDB 3DPBB 4JRXA 4OIIH 5CKGA 4I50A 3QJRB 4JI5B 3ZMSA 2ICES 2WBJD 1SYVA 3I9GL 4P2OA 3PYCA 4XT1C 5F7AA 5LG1A 3D48R 3MNZA 3FU5A 3BISA 3TVMD 2A77L 4NXSA 4QO1A 1L6ZA 5K9OA 1QO3A 3C5ZD 3NR7A 1QHTA 1KB9K 1TYEB 1Z9NA 4GAGH 3KPSA 1UJTA 3F58L 2XAHA 4ZUWA 3LSUA 1SN0A 2Z34A 2ADJA 3HC0B 2ERJB 4LH7A 1K6QH 1NM4A 1XMWA 5F9DC 3GK8L 4K3GA 1AD0B 2IQ9L 4HIIA 1BZEA 1JXFA 1D5ZB 4QWWC 3DXRB 3S4SA 2ADIA 2ZX6A 3BPCA 4JFDD 5D7JC 5CCJA 4N2MA 3SDCC 2OWOA 1C5BH 3SDDB 1UZ6F 5F1SA 2NZ9C 2QLVB 3U36B 2ETWA 4UCVA 1Q90A 3QBTB 4XMTA 1T0OA 3UQ8A 4L9LA 5DJ6B 2VSDA 3BIAX 1RUAH 5BR8B 1HKFA 3AG2B 4PVMA 1PX3A 1I1FB 5GZND 3H54A 1WS8A 2YD2A 3GSNH 3JATB 2XV3A 4KUCF 4UYQA 2DWDB 4GAGL 3PRZA 4KKZA 5K1PA 3WUWG 3GJFH 1XBLA 2CTPA 4ERSH 3FQ1A 1QRND 3OEHG 2D3VA 1MFCL 1NCUA 1KZYA 2DLGA 5FO7B 3V6FA 2VS0A 1WUNT 4LCWB 5IT2H 3QDAA 4HHAB 3UPRB 4BFFA 1C5BL 5CGMA 4F6RB 4KXDA 4PG9A 3C2AH 3VWJA 1D2PA 2XNAB 1I7UA 2DBLH 1CF1A 1E65A 1RUAL 2EDNA 1E9PB 3E2HB 4GFXA 4JFOB 5J1AB 2WLLA 3O2DH 5E94A 1CFTB 4JZJB 3ZDYF 5ID1A 1OCOB 1TVBB 3MV8A 2YSTA 3ZZ1A 5HHNB 2FYUH 3GSNL 3S34H 4AH2A 1FRGH 2XG4A 5KHHA 1SHXA 1NWPA 2NNFA 5DMIL 1JPEA 5DO8A 5EZPA 1AE6H 4ERSL 1VJSA 2AJXH 4RUEA 1O6VA 1JNLH 3LH2H 4K55A 3SBWC 1UJ3C 2FB4L 3B6SA 3MLPA 1U3JA 4LNUA 2H47C 5IT2L 5EF2A 4DXWA 1YLBB 2D0HA 2PR9A 4PA4A 1IURA 2OM5A 4OJEH 1BX2B 4PRPE 2FUQA 3AQDA 4IOIB 4XVJH 5FFGA 1Q5OA 5CEZL 2KERA 2F4VB 2OMWA 2LFGA 7PAZA 4KNQA 5CXPA 5IMMB 4A39A 2J1ZA 1N5YL 2XNDG 3CC5A 2D7PA 3RWCA 4P4KC 5KBLA 4Z2WA 3VG0H 4FLTA 5HPMA 4W9IC 3QO7A 4FQHB 1I75A 3AT0A 1JNLL 3BUYA 3LH2L 4E9TA 2UUCB 5G5DB 3HE7A 4HEME 4S0HA 4ZUSB 3LKRB 3T04D 1QQDA 5L6YL 2WYTA 1U8IA 3AU0A 1NC4A 2ZXEB 2GC4C 3GJEA 4FLQA 5C7ZA 2AJYH 1HP8A 1CG9B 4AMKL 1BGYH 3CCMV 1KJMA 1NPUA 2W95A 1NJIW 4PH8A 2BWIA 5FYLL 2H6PB 1Q43A 1WCQA 3SGEI 3TPUA 1Q81W 3IMBA 2GUZB 4GAYB 2HG5B 3PDOA 3WCYA 3KYMB 5CILH 4QMEA 1FVEB 1USZA 4GBXC 4CGTA 3FO1B 4N24A 3VB8A 1EHKB 1JOYA 3UKMA 2YOCA 4V11A 3VG0L 1CD9B 2HVBA 4PMEA 3K6OA 4ICGA 1TVDA 4H33A 3UDWC 4CH4A 3W5MA 4OF6A 3JAKA 1ZGLP 4Z7NF 2AK1H 3OXSA 5D4IA 3CBJB 3ULUF 2JJTA 3D39B 4DN3H 5DD0H 2ITCC 3I75A 4ZDHA 2RFXB 4EI5B 1F6FB 2MCG1 2ZUSA 5EBLB 1CLOH 4HU8A 5BJTA 1FNEA 3C8KA 4X4XA 1JNJA 4N0CC 3SN6N 4CVXB 2JE8A 2EXYC 1KG0B 4KY2A 4L3EE 4NUJA 2AEIT 2ZCKH 4XVSH 5A2CA 1P5VB 3FQUB 1YITV 4UFZA 4N87A 1T1ZA 1DL7H 1WT5C 3LIUA 5CILL 2X4RB 5J2UB 4GSDH 4GT7A 2NX5B 3KZIZ 1TYRA 5LA6B 3RB7A 3L71H 3ESOA 5K1JA 4U1JB 4I0CC 1RAMA 1Y18B 2JXMA 1EUUA 4U6TA 4K2UH 4KHPO 2P80D 1J0YA 5B38B 2AK1L 2R7EB 1SEBA 4UU9A 1BQ0A 3V0VB 5DD0L 3RVYA 5DA4A 4OKVA 4N4YB 1IC5H 2BCCH 2DF3A 4H2CA 4DHLA 4F15C 2N59A 4EB6A 1AI7A 3VB9A 1QZNA 1VFOA 3MOQA 3S3JA 4UANA 3RYIB 5FLUA 3FQRA 4AE0A 3CRMA 2A9DA 3VQYA 4XVSL 4ZFFB 3APFA 3ETBJ 1XR9A 3CWGA 3WLWD 4FTDA 4H88H 5DD3L 4WGKA 1U0QA 1LO0L 4GSDL 4DW0A 2P24A 5INDB 5FW6A 3DHJA 2K3HA 1AI6A 3IN0A 4NNXA 5HHOB 2ZKHH 2EE3A 1NFIB 1GAFL 3RPIA 5DZVA 3OKDA 2BNRE 5LL6Y 2P28B 2EO9A 5E6IC 2C9UA 4CS4A 1S7QB 3GRWA 4V2BA 1E8YA 5I2IB 3B2PA 3WTSA 1IC5L 1BG1A 3ESMA 1OP3H 3CMOH 2VO5A 5TQ2H 3V6BR 1KENH 4HEMA 4XTRD 2H3NA 2MQ0A 3R8BB 3UACA 3QDMB 4LPCA 5I76A 2BWDA 3NZ8B 3RTQD 4HHGA 3UZEC 3K79A 1HSAA 2QQQA 4H88L 4XGZB 2LR4A 2V2WB 3T6QC 3GVMA 4Y4FB 5DFVD 2B0SL 2DM3A 2Q7YA 4CADA 4ZMLA 1HQ4B 3HS0C 2AK4B 5I1EL 4JE0A 4JFYB 5L0QB 2WOYA 4HA1A 2V9QA 1DQTA 1S3RA 3H7BA 4CC6A 2J43A 4OCWH 1R6VA 4X9GA 2HJFA 2RQ8A 4OGXH 2HB0A 2E7CA 4X7FC 5CEYB 2EUXA 1HU8A 1FLTX 3H9HA 3QCVL 4U6YB 5JOFB 1DO6A 4WGWB 1L8DA 5TQ2L 2JGDA 2ATKC 1MQ8A 4PW4A 1KENL 2OSLA 4OD3H 1QFWI 2OCHA 3BVOA 2IANB 3AY4C 3L3IB 3HFMH 4IRZH 2YAQA 4B9YA 2CKBB 4WV1A 3CVDA 3FCTA 4KITB 1JXKA 4TN9A 5FHAL 43C9B 1VEMA 3SDXB 4A6YB 2ED8A 3EYQC 4J3BA 4NQDA 2AXFB 1HNZO 1L9RA 2DQEL 5T3ZE 1SF3A 1RHFA 3ECBB 1QTSA 4GLRH 1AGDB 1UKSA 3CFQA 4H8QA 1U8QA 1OM3L 4OJFH 3ATEA 4JI7B 2R4SH 3WDIA 4OGXL 1JF5A 3UX9B 4AQ1B 3MRIA 3QJQB 2JIXA 4R4BA 5D6CA 1X4ZA 1I8KA 4OD3L 1YYCA 4PJFE 3WHE0 3Q6FA 3H6AA 1FBIH 4Q9BA 2QJ1A 4JZNA 3HFML 4IRZL 2ZSVA 4YZWA 1WZ1H 4RGNC 1R9FA 2EYSB 4E5XG 1PZ2A 3VMNA 2ZG3A 1KECA 5E1AB 4OLYH 2VR4A 2WTRB 2N74A 3KPRD 4NFBA 5IIEB 1WISA 3FTWA 4O58H 3GSRB 4MA1B 4OZHA 1WP7A 4OJFL 2R4SL 1Z9MA 2CO7A 2NT0A 3IETB 4X5PA 3CU7A 3X2QB 2VUKA 3VXSB 4WVRA 1H8OA 1UB6A 4IU2A 2TSBA 4MDIB 1JUFA 3SZKC 1QBMH 3UAEA 1EAQA 3GIZL 4XN4A 1OM9A 2XDHA 2I9TA 3FN0H 5LAPA 5H35A 2FEDC 3JD3A 2YXLA 1J5EB 5JR1H 2Z8RA 3DDFA 5FA4B 4NRZB 4FFYA 2MCMA 3A47A 1MHPL 5ALCL 3ZU8A 4OLYL 5FO9A 1ZLDA 2GIYA 4ODVH 3ULSB 4DW1A 1CP9A 1FFPB 2VRAA 3BD3A 4FFWC 4WHYG 3FO2B 3HI1B 3OD3A 4H8PA 5CSGA 4F93B 2RAMA 5IY5C 2Y6SD 4FE9A 3HUJE 3UCQA 2Z31B 5JHLA 3QDGD 4JS7A 4NQEE 4BFEA 4H8VA 5DJ2B 1VEOA 5EC2B 4YJ2B 4DKFH 3F7RA 2WIMA 1QBML 2HTLC 4NC2B 2WXKA 1UH2A 3JWOH 4ZS7L 3C60C 5IBLD 1EFXA 2VLKB 3IKCA 4NM8H 5IK3B 4RCAA 1PD0A 1PU0A 3AU1B 4IRJA 1WICA 3AWEA 1AFVH 3IXTB 4YOKA 3AADB 2R0WL 4PRPB 4NENA 4FL4B 4W81A 4GRLC 1U4FA 3FO0H 2YUXA 4FIPC 1CIUA 4TV8A 1T22B 1Q8MA 1PP9H 3CMAV 3SDYH 1DQDL 1AC0A 5C07E 4OGYH 5CCHE 3I6GA 3JWOL 1DJYA 2IEPA 3ARBB 3U9PH 4HKXA 5IMLA 3MAWA 2YPLD 5EBWA 3CHQA 3CHSA 4C83B 2IPKA 3QWNA 2WY3B 5CJOL 4FXTA 1KDJA 4U7OA 2E9WA 5IHUH 3BEHA 4JREC 3I9IA 3EAKA 2LFEA 3KCWA 4BSJA 1HZLA 2MOGA 3FO0L 2J4WH 4F8NA 1TFPA 2Y7QB 2C9SA 3OKMA 2EIEA 4KDTC 4R5VA 3MN8A 3E35A 3HBQA 5HGHA 4GXFA 4KH9A 4DP8X 3E1F1 4GPVA 3EYFB 4IGBC 3SDYL 4MB5A 4PBDA 4MSWC 3S37H 4OGYL 4IRSB 2XOTA 1AXSA 3B9KC 5IUCA 4H1LA 3TBYA 3ZN1A 4U1LB 5ACMA 5JIDA 2HJLA 1HAWA 2YBRB 1ROWA 2IO5A 3EO0B 3NCYP 1RK0B 4YIQB 2F7OA 1GY1A 1J18A 3GWJA 2QDOA 1RJCA 1YEKL 2XZZA 1TTAA 5IMOB 3A6CH 3N44F 4MD0B 5C0DA 1AD9A 2EDQA 25C8H 3C9NB 2A74C 1PKQE 1QCEA 1CK0L 1YNTF 3IDGB 4R7NA 4AYBA 4LLYB 3CLWA 2J4WL 2CGNA 2X2IA 4LDOB 1T2XA 3JWDC 3LZNA 3VFTB 4CVZB 1N4XH 2CK3G 3RY5A 4KP4A 4NT6A 4XNQB 5CCKL 1O5DT 2VXSL 4IOFD 5DEDA 2XKNB 2YEQA 5AOMA 4OM1H 2ED6A 1N6VA 3S8WA 4OZ4A 1L9QA 3QS2A 1P84F 2PO6A 4HEPA 4EQ3A 4ODXA 5I24A 1HXKA 1H0DB 3PDGA 1B3QA 3TNMB 1SOSA 1CR9H 1T3FA 3ZHNA 5FB8B 25C8L 3K8MA 1WSST 2J88H 3FXIC 3N50A 4P5MA 5IQLA 5LBGA 3VFVA 3WDHA 2ODMA 5I8EA 4YE4H 4D7BA 5GS2H 3O4LE 3Q8BA 1QLEL 3L3OB 4I0KA 1Z66A 2Q9OA 1N4XL 3VW3L 3AW5A 3RWJB 3JV5A 3CSBA 5GGSY 5J3HC 5IYZA 1E4XH 2J1XA 3NPSB 5F6IC 3STLB 3IVKA 1I8AA 4M5SA 1TTRA 3WGUB 3LN5B 2ZT9C 2AXTZ 1BOYA 2FO8A 1BQRA 3HIZA 4OM1L 3MRCB 3QNXA 5AW4B 3SOBH 1YECH 1J12A 3PWNB 3WELA 4Z77A 3HN5A 3JZYA 3VWKB 3I5DA 4RAIA 4OGAD 2XZCL 4MASA 4PRBA 4NZRL 5J6HB 4K3EH 3CP1A 1IKNA 1P7KA 4JPIB 4RO2A 3GBNH 4LH6A 5GZOC 1CR9L 3Q9PA 3WHXB 3BPOB 1BVKA 4F3FB 3OAYK 2J88L 4JFQB 4C56E 4YE4L 4M1CD 3OHXB 2NQCA 2ZIDA 5E5LA 1BQUA 2E75C 3TO4C 1IBGH 5AVXB 4Q14A 1OE1A 2UU9B 1CGWA 4YDVA 1IQDB 2LQTA 4WKZB 4XMPH 4JLRA 3HCVB 1MCEA 1RD6A 2CDEA 2UZPA 3B43A 1ETB1 2D3OW 1AQKH 1TR7A 4LPXA 1Y76B 2V2TB 2FZ3A 1KB5A 1HI6B 3OR6B 3SOBL 4ZMYA 1XSKA 1T03H 4WFGD 2F19H 3M7OA 3CZEA 3Q5TA 1U95A 1LE5A 2OYPA 3H3BC 1K3IA 4PJBA 5JW3H 5G4NA 2PYED 1JZ6A 3QUZC 3QIUD 3B09A 1VRSA 4OCSH 1SM3L 2IH3A 3DVGB 4E68A 4CNIB 4GKZA 1MA1A 4XMPL 2WANA 5F1IB 3CC7V 1XDTT 1QI5A 3GRWL 2UVFA 4JO4H 5KZCD 3CZNA 3VRLF 4ABVA 3JD1A 3BQUC 2CNYA 3KLDA 3QUXB 5DI8B 1LL1A 3AC0A 3NZSA 5CA0B 4Q6IA 4EVNA 1U30A 2WKOA 1T03L 5LCVH 3ARQA 5D72H 3UTQA 3U2SA 4BA0A 1ED3A 4BGDA 4FVMA 2ARWA 4PJFB 4ZMNA 5J9PB 4ZBMA 2NRDA 3O41B 4IOSA 5JW3L 1TU2A 1U8LB 4JQXA 1MNUH 3T3MB 2MCAA 3ELAT 4G8GA 2OCCB 1YSCA 2AITA 1XD0A 3B4NA 5F6HI 1NT2B 1BJMA 2OR8A 2AHZA 2IDQA 2YRLA 3HC4L 1YNKH 2NW2A 4YZFE 5IQ7L 1IC1A 5CJQH 2FT7A 4XCYB 1BQZA 1GH6A 1IVLA 2R9HD 3Q4HB 2XZAH 1ZS8B 4KJPC 5ICUA 2I27N 3HVDA 2WBJB 4Y5YA 1J0ZA 2CXKA 3ZDZE 1D5XB 1YMMD 3CH8A 3L3KB 2HFEB 4W9GC 2VCOA 3TVMB 2AS5M 4EOWH 4K23H 4JHWH 5H94A 3C5ZB 3MSPA 5HI5D 2QSAA 3EGDB 4ZFOB 1CCZA 3BD4A 2PW1A 3LDBB 3NSJA 5E8NA 3UTSE 4AEEA 2DAVA 1JZFA 2GPZA 2ZWLT 3NFPB 1S7RB 1MNUL 1QFWL 4P59H 1G1KA 3FPXA 4LVNB 4PJIE 2X6VA 2X4PA 3AABA 2OMXA 4F8TA 2CBQA 4OJYA 1YNKL 2XVKA 4K5PA 3PJSK 1ASOA 1K72A 1WZAA 4N8VG 1P49A 4X9BA 3TA3D 1D5BB 4QRRE 4WFHE 2O6CA 2WNWA 2XZAL 2Y3AA 1XNRB 1ORSA 3MRGB 4NOFA 3HUJB 4FP8H 1HXYA 4MAUL 3EH3B 2X38A 1NINA 1KSRA 2DQFA 2HVKB 3GDBA 4LNVA 3PAUA 4PRHE 4K23L 4EOWL 1W0VA 4FKKA 4BWAA 4FGMA 3NABH 3NH7L 5JXAH 1F0LA 5KBMA 4NKOB 1DQIA 2JB6A 2PWDA 3FW6A 2OMZA 3P2DA 5CEZD 1Y1DA 1NBYA 3FNKA 3IJ4A 3VRIB 2XPZA 4HCRA 1QRNB 4D0DB 3NN8A 4HKZA 5C0FB 4P59L 1WH0A 1PKOA 5C3TA 2Z8WC 3FUKA 5ITZA 1JFFA 1F3DJ 3MMEB 1SXCA 1JJ2U 3GBLA 4D9LH 4IIJA 3EGSA 5HTSA 2RALA 3QUMH 4FP8L 4G6FB 1FL3A 3ZHUA 1U2HA 4NUGH 3E6HB 4HNAB 1SBSH 1RZPA 3VI3F 4GW4A 4JY6B 1NH6A 3PCYA 2X87A 3CFEB 3VE0A 5C07B 2YZ8A 3U25A 3FSWA 3MGTB 4LASH 3PJSB 4FKHA 3NABL 5JXAL 2FX9H 4FFYL 2W07A 3MVSA 1IBYA 3L4CA 1AIFA 5KG9B 4PVNA 4QI3A 3K0DA 2FLRT 5J13B 2P5EA 4N6RB 4A04A 4JI8B 4ZMPA 4F33A 4GUNA 2WBXA 5DT1L 1N64H 2IWKA 4F7TA 4APQB 5JHLL 1XVSA 3HN3A 2CU9A 3L4VA 3QHZL 3L4XA 4PWHA 4JQVC 3T2PA 5GGQH 1D6EA 4MTGA 2YKLL 4YPGB 1PZSA 4D9LL 5F9WC 4XRCA 1EERB 4KKCD 1K3EA 1RULH 1SBSL 2X41A 4JJ5B 5JHDD 1H6TA 4AQZA 2ITDC 4JM2A 1CDJA 4ABMA 3MLXL 2L7EA 2VQ1B 3IDYB 2G2RB 3D0VB 2FX9L 2F9BT 1OE2A 1KIRB 4JFFA 5HJGA 1S6NA 3OAAG 3C6LC 4KI5F 5KYWB 1KPRB 3BZFB 2Y69C 4UQ2B 3IC7A 3ZJAA 4ZW5A 3KM1A 2YUVA 3GBDA 3LPPA 2UUBB 3NYKA 4AGLA 3QNEA 4RAVA 2R8SH 3K6FA 1HQRB 3ZHVA 2NY6C 5AVSB 1MELA 1PLAA 4XP6L 1XTLA 4GQQA 1A8ZA 4PYHA 4CRPA 1ZL8B 3F7YA 1FI8C 1U21A 2NUTB 4GG8B 4PA9A 3WE1A 1CFQB 1N18A 1UUNA 1U58A 5L2JA 1JZ8A 1FPTH 1OQXA 3LOWA 1F4WH 4W4NA 3UADA 4K7PX 4V1DE 4WFHA 4QRRA 1UM6H 4LSPH 4HIEB 5ETUB 1BM3L 4JEGB 5F3HB 5LBVA 3EFOA 1JZ7A 2Q9LA 1CLZL 3ATFA 1VGEH 5L4FA 2EDHA 5E6UB 4M03A 1H2GA 2KKQA 4PG2A