3SPGA

Inward rectifier potassium channel kir2.2 r186a mutant in complex with pip2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMAAPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 94
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spgA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spgA01
3UM7A 1R3KC 5J9PC 2ITCC 4TWKA 4RO2A 4R7CA 4UUJC 3TCUA 5CBHA 3K06A 4G28B 5EBLC 1ORQC 3FB7C 2Q6AA 4JTCB 1LNQA 3KG2A 4XDJA 3FB6C 1N9PA 4MVZA 3K6NA 3E8HA 1OCCC 4MVQA 3ABLC 3T1CA 2AHYA 2IH1C 4WFEA 5B3SC 3AUWB 3AG2C 3LDCA 4MS2A 4KFMA 4QE7A 5IY5C 4WFHA 5EK0A 3K0GA 4JTDB 4WFGA 2HFEC 1XL4A 3AG3C 3SPHA 2AHZA 1JVMA 2Q67A 3LDDA 2X6BA 3AT9A 2DYRC 4RAIA 1V54C 4GX0A 3AGWA 2GIXA 3OGCC 4X8AA 3ASNC 5EC1C 4RUEA 2WLHA 3F7VC 1BL8A 1S5HC 4MVOA 2EIKC 3VOUA 2K1EA 4LCUC 3K0DA 3WG7C 2A79B 3SJQC 4XDLA 4BW5A 4RUFA 2Y69C 3E86A 4HZ3A 2HJFC 3EFFK 3OUSA 3STLC 3AT8A 3T2MA 2W0FC 3F7YC 3IFXA 1K4CC 4CBCA 3SPCA 1M56C 4I9WA 3OUFA 2WLKA 4OXSA 1M57C 3FB5C 2WLLA 2Q68A 4P9OA 4R8CA 3BEHA 3GB7C 3ABMC 4PA9A 5KUMA 4GX5A 3OR7C 4MTGA 2E4FA 2OCCC 4G27B 4PDLA 4PDRA 3ZRSA 3E8BA 3T4DA 2ZD9A 3LUTB 4QE9A 3AG4C 3TETA 2JK5C 3SPIA 5EBWC 3ZJZA 1J95A 2WLJA 4MW8A 2DWDC 4PA4A 4PA6A 1U4EA 4F4LA 3OR6C 2A0LA 3E8FA 3LNMB 3SYOA 4EKWA 4HYOA 2R9RB 2YEVA 4PDVA 2NLJC 4MVRA 2WLIA 4J9ZB 3F5WC 2IH3C 4P30A 4ZBMA 3RW0A 3STZC 3RVYA 4MTFA 3SYQA 3RBZA 4X89A 1U4FA 4P9PA 3ATEA 3VSQA 3UKMA 4GX1A 3SYPA 4R6ZA 3X2QC 3R65A 5KUKA 2ATKC 1R3LC 3K04A 4MTOA 1OCRC 2QKSA 2WLMA 5B1AC 3LDEA 4PA7A 2DYSC 1V55C 2EIMC 2H8PC 3K08A 2WLLB 2BOCC 5EBMC 1OCZC 3K03A 4XDKA 3ATFA 2ZXWC 1R3JC 2A9HA 4MW3A 2DWEC 3FB8C 2HG5C 3PJSK 3ATDA 3SPGA 2HVKC 4X88A 2EILC 4R50A 4JTAB 5CBFA 3ATAA 2KB1A 5CBGA 1R3IC 3SYCA 5E1AC 3IGAC 3JYCA 3T4ZA 3ABKC 4GX2A 4MVSA 3E83A 2X6CA 3RVZA 1KKDA 4J9YB 2WLIB 2BOBC 3ASOC 1ZWIC 4LP8A 4MVUA 2EIJC 2Q69A 5B1BC 4DXWA 4QNHB 2WLNA 4MSWC 1XL6A 3SPJA 2ITDC 5BZBA 1K4DC 5EC2C 1OCOC 3AG1C 4LBEC 2EINC 3E89A 4H37A 2P7TC 3HPLC 4P2ZA 1G4YB 1QLEC 4MVMA 4PA3A 3ATBA 2HVJC 3E8GA 3SYAA 1P7BA 4WFFA 4H33A 4PDMA 2X6AA 2QTOA
chains in the Genus database with same CATH superfamily
4JO4H 2R1XA 4J6IA 5GRWA 4L3FA 3HLKA 3JTSB 1AB3A 2IANE 4AEFA 4LNRB 4DZ8A 2LU7A 5BS0B 3K6NA 2K8QA 4F8LA 1UOKA 2UY7B 4J7ZA 3IWVA 4ELKA 4B6ZA 4U6HA 3DO7A 1RUAL 5ALCH 1UFUA 2XUMA 4LQ1A 1HDMB 5KVFE 5AW7B 1IC1A 5H37G 2DYRC 2XTJB 1FSKC 3MROA 4XMZA 4AYSA 2HRGA 1GAFL 1TDQA 5JDSA 1NLDL 4K2UH 2EXWC 3ISWA 3HRPA 3GDBA 5TH2A 2FX9L 3S4SA 3HS0B 1S5HC 1CDYA 1CL7L 4HJTA 5IB4B 4G82A 4MJ2A 2GUOB 2WWNA 3HE7A 4Y2DA 1QFOA 1ZT4B 3AAZB 5JW5B 3WEOA 4Z8FH 4UCOA 2IBGA 2W0FC 2R4SH 4UBDD 1JMKC 4PJ8B 2OXGA 1DSFH 1K4CC 3RNKA 3C6LA 4OCSL 5JPNB 3BXNB 5FM5M 35C8H 3ZR5A 1NCJA 4JV5B 3VXTA 2OIGA 1MPAH 1OE1A 2OR7A 2QWOB 3GM8A 4MAUL 5BR8B 1I1FA 3HC3H 3T4DA 4XOCA 2O6PA 4AYGA 2EDFA 5EEVA 3MAWA 3TWYA 4NENA 4JK0D 1YNTA 2LTQB 4RFOH 4MNGB 1C5BL 3CHXA 1XGUB 5HDBE 3OPZL 1WSST 1OPOA 1G9EA 4DW0A 3G71V 1I94B 2GCYB 4KWUA 4RGOH 5D6CB 3Q43A 3CFKB 3EOBA 1PCXA 5ITZB 4DP6X 4YC2B 2IQ9L 2OKMA 1JFFA 2DEYX 4NQVA 5FA4B 1SJEB 2WQAA 1ROPA 4LP5A 1BZEA 5JZ7C 4AGNA 1MI5A 3RYIB 1HVXA 2CK2A 2YKLL 3BAIA 4ODWB 2DWEC 3JTSA 4LPYA 2HLFD 3JARA 1RZJL 2BWIA 4N2KA 5JTWA 5CLTA 3Q2WA 1IAIL 1U97A 4NZRL 1EAPB 2UY7A 3T1WA 1DCEA 5KLVH 1G0XA 4NB7A 3J27A 2CUGA 3DWTA 4PPTA 1JNNL 2YEVB 3BEVB 5GHWL 5K1XA 1HDMA 4G9FB 4OAWB 5KTEH 2VQEO 2H6UA 3AG3B 1IGML 2B59B 2X5PA 5F7YC 3WB2A 5CFHA 3ROLB 1OE3A 3WY3A 3AG1C 4HS8L 2R0LH 2UUCO 1LXMA 3D39E 1U36A 3BIKB 3DGGB 4PJAB 2B8OT 3HS0A 4TV3A 4QXWA 1HT6A 3F7VB 1TT6A 3UG4A 4CKQA 5IB4A 3V4VL 7PCYA 1AXIB 4Z7OF 3EDKA 1MFMA 2GUOA 3S5YA 3AAZA 5JW5A 3JV6B 2H4EA 3NA9L 3ZL4H 2EDKA 4PJ8A 4GUPB 4D3CL 4R5VA 5JPNA 3HMXL 3PPEA 3KL3A 3E22A 2HHHO 4RDBA 3UO1L 3ZDXB 2GTWA 2TRHA 2P22C 3TJHC 2ZXCA 2GAZB 1BIHA 1X5MA 4M1CD 4W4LA 4YQXL 1P6WA 1IGIL 2BNUB 3BPNB 3EOYG 4KP4A 2V9UA 5FUCE 2Z8VC 3N42F 4MXWL 1CCZA 4PQXA 1KXVA 4ERSH 3DVFA 2B3IA 2Z35B 1T1XB 3QIWD 4RZKA 5EBWB 4K8XA 3S34H 4ANXA 3MO1B 4HJJH 4MNGA 1IZKA 25C8H 1XGUA 5DK3A 2ZQKA 4PTUB 4FM2A 4PI2A 1N19A 3ZKXC 1NEUA 1N0JA 2GY5A 5D6CA 5I2IB 3CFKA 3IAGC 4TVPE 4BUGA 4P2QA 4PJEF 5EF1A 3DGEA 4X7SH 2J2ZB 3DOHA 1KPVB 5FA4A 1SJEA 1A7QL 5SX5K 5F96L 3WEXB 2PW1B 4Z3FA 1RUQL 2Y25A 1JQ0A 2KSDA 3RYIA 1THCA 3JTBA 3DSFL 3DROA 5FUCC 2DKSA 4F58H 4MTGA 1Z9OA 4ODWA 4F93B 4HOWA 1XBDA 2W8CA 2X42A 4S0TD 12E8L 5DLML 2ZWLT 3I9GH 1TVKB 2H0FA 4NGHL 4MMZB 2EECA 3E3QC 3OAYK 4XWOC 5LBVA 1EAPA 4DQOL 3BQUC 4JQXA 2VXQL 5DECA 4W9EC 3SPVB 2JMRA 2WB7A 4B7LA 2PI5A 2YEVA 1TQVA 3BEVA 3GRBA 3MJ9H 3JTTA 1M71A 4OAWA 1L9RA 4M3HA 5IBUB 2C9SA 1S6NA 4YZFE 5GSVA 1YQVL 2B59A 4GCZA 2ZCEA 5L3GA 4PLKD 3X1FA 3VFUB 2OTJV 2AC0A 1OCOB 2A6JB 1WG3A 1PNMA 4LBEB 3KBEA 3DGGA 3VD0A 5A2QN 4GT7A 5T5FA 2GC7C 4D9RD 2DYSC 4PIRF 3F7VA 2WLLB 1RVFH 1I8KB 1ZT7A 3HNVL 3M7OA 4PS8A 4V2BA 5E6RB 3CZUB 4KRPB 2Y1ZA 4PTTB 3RILA 1KV3A 1RXLA 3ZDWA 3JV6A 3NJMA 1V3MA 3K8LA 4P9HL 4JI6B 2CA4A 3F7KA 4E41E 3P4OA 1MCBA 1NAMA 4GUPA 1QHPA 5D4JA 3UJJH 3D06A 1AR5A 3KKYA 2ROYA 4XNUL 1AVAA 5AW2B 3UZVB 4YSEA 5EB9A 2HA1A 1AY1L 2R1WB 4ZNEA 3KYNB 1QNZL 5CF3A 3UH8A 3LOWA 3T3PF 4LF5O 2BNUA 5D7LD 4XAWH 4YSPA 4Q9BA 5I30L 3KPSE 1WDAA 1LP9B 1ZCRA 3X3FH 4JPWL 3MPCA 3KYMB 2Z35A 1T1XA 4HT1H 5EBWA 4XTRD 3MO1A 3T1YO 2CO1A 4JI7B 5IZ7A 1OCWH 4YMPA 3CDFA 4CVUA 3C5SB 1BAFL 4PTUA 2APSA 1G94A 3VQ1C 4ZUVB 3JCZA 2AK4B 5EPMB 2BOBA 2NNRA 4TL5A 5F7NC 5I2IA 1F8TH 3WFBL 4XBEL 2J2ZA 1TTGA 1G9NH 3SHSA 2OJEB 4ZAKB 2QVKA 3WEXA 2PW1A 3Q2CA 1ZSHA 1F56A 2DAVA 3ZRCC 2GTQA 1J05B 4N86A 2LLNA 3BPCB 1KC8W 3TBBA 1MN4A 5B3NA 1ZUQA 2WBJD 3JWNG 3TGXA 3TEWA 1JSYA 4LFAB 1IKFL 3FCBA 4M3KB 1A6UH 4I50B 4OQ1A 4MMZA 2ZNIA 4QTIH 3ZHVA 1CGSL 3VW3H 3M7FB 2A74B 3V0JA 5F89B 1MHEA 2XZZA 1I8LC 3SPVA 1SEBB 4QMEA 1CLOH 4BZ1H 5J6SA 1SBBA 3TU6A 3H9HB 2DKMA 2VMCA 3OXSB 3P3RA 4FTVD 4I1PA 3KH3A 5AVXB 1KCBA 4Q9QH 4LFCO 1JFQL 4UYPA 3VXRB 3ZMTA 5DDHB 1P4IL 3VFUA 2A6JA 2HTKD 3MA9L 1AI5A 4CBCA 2FGWL 3CFUA 4LBEA 1NJ9B 4Q89A 4D9LH 4ZMPA 5A6LA 4DGIL 1L7IH 2WLLA 4KKCC 2GJZA 1DVQA 1H9VA 3TBTB 1N5YH 4PTTA 4RDQF 5FW6A 3WE6B 4QWWC 1CDCA 1RZFH 1DE4B 3V4VB 3QQNA 5CR8A 4DK5A 4X8XA 3OG6B 1HYSC 4Q74A 1NFDF 4OZGB 1YNKL 3PY9A 4TV8A 4FLSA 3H8NA 4H5SB 3UERA 1M42A 2QEXV 1RJYB 3QO1B 1G6RL 3UZVA 4X4YB 1GTFA 2J8UF 5KVFH 1WN7A 4S1DC 3HEIB 1N7ML 2R1WA 3KYNA 3OAAG 1FG2B 3MREB 5IFHH 3ES6B 4JHAL 4MAYD 4DP8X 4XVSH 1WFJA 1LP9A 5F21B 3SN6N 2E9GA 4CSZA 5KSVB 1F11B 3BSGA 1BP3B 1QFWH 1KCRH 3R66A 1PCSA 1AIFB 5D7LB 5F9OL 5HJDA 2HPOA 4R7DB 4UT7L 3FQNB 5F70A 3WUWG 2YXVA 3KLDA 3GVMA 4UV7H 3RJOA 4EN2A 5AUMB 2QWQB 2HRLA 4ZUVA 3PQYE 1XF2A 2AK4A 5EPMA 4E9WA 4FMVA 1EDYA 1ZV2A 3RI5K 5E4OA 1PZUB 2VUYA 3NGBB 1NCCH 2HB0A 2OJEA 4ZAKA 3I84A 3ZTCC 1CWVA 4LSQH 3L3OB 4PS3A 2WP3T 3V4UL 4DK3A 4L3CA 4FFVC 3RX8A 4DGUA 1VCBC 3BPCA 2O5XL 3M1OA 4K35A 2XX1A 4C56E 4PGJA 4LIQE 2JCCE 3QJXA 3NXSA 2F08A 5FGCB 2DLFL 3GI8H 5F7BA 4JN1L 4YSAA 2A74A 4PREB 3SO5A 1K5WA 5F89A 2BW5A 4KO5A 5GJSH 4QXVA 1OSEA 4RSYA 1JXKA 1H3VA 1EZLA 1KJ3L 4CS4A 2QQQA 3LN5B 3RQ3A 5D1ZI 1SZXA 1A66A 2D2CB 4GMTH 3C5ZC 3NR7A 3ZHSA 3VXRA 1WK0A 5DDHA 1R3IL 3G9AB 3HI6H 6PCYA 2IDUA 1WPXA 4CU8A 3NJJA 1NJ9A 4RISL 1NFKA 5HDBF 1HTYA 3JUYA 2IH1C 5SX5H 3O8XD 3U7YL 4PJXE 2WOBA 1GCFA 2JFCA 2VN5A 5LGHL 4NVPA 3TBTA 2NW2B 3I02B 1QO3B 4WV1C 5D1XE 3WE6A 1DE4A 3V4VA 4P2RB 1SHWA 3UPCA 1VAHA 1O6SB 2ZXEB 4Z1PA 1FNSH 2YRLA 2VNCA 4HIXH 4L1HA 1JV2B 3O4OC 5IVOA 1YDXA 3OAYH 1D7CA 5D71L 2AZ0A 3CFNA 3QO1A 5AAPA 2E9JA 4X4YA 2XICA 2DI8A 3HMXA 5GPRA 1LDPL 2AXGB 3FN3A 1FG2A 1Y07A 3MREA 3ES6A 2N0MA 2YEZA 5KSVA 5H37A 4LLUA 5H4YA 4DHLA 1F11A 3AJ7A 5JQIB 5I19L 5D7LA 1AIFA 2EABA 4MAYB 2QBWA 2V2WB 4R7DA 1Z7JA 2P8PA 4F7MB 4GSRA 2V4LA 2ZG1A 2AHIA 5D1XC 5E4IA 1OWRM 2EUZA 4P2OC 2AXJA 2MKWA 2F6AA 1U3HD 2ZXQA 2DQHL 1KXQE 2XU9A 1OAKH 4EDXB 1W2KT 3O3EB 1I8UA 3VM5A 4EB6A 2Q2LA 4OSUH 1CYXA 5LHGA 2JKTM 5D7KD 3DOIA 1VFMA 2B1AL 1JHKL 3L3OA 2ZE7A 2WVSA 4JFFE 3W81A 1OHHG 2EEXA 4PMFA 3JXAA 5EU7E 1XXFC 3QAZC 4YFDB 2HJLA 1W72H 4LKXB 3GJEB 4FMTA 3RVYA 5CLWA 2F1EA 2Q0ZX 3VFOB 3Q7JA 1RIHL 1EK3A 3GF8A 4NQEE 4XN1A 2WBJA 1PZDA 4PREA 2N56A 4WFGD 1RU9H 3VACA 1I8AA 3DX7A 4XNBA 3NSXA 4IU2B 3KPRD 2VXQA 2ZXWC 3LN5A 4URTB 5JHAA 4B3RO 1TA8A 2WCGA 2ZPKL 1WA2X 4DN4H 1VQNV 2YAEA 3N50A 2XBDA 3UBXG 2C34A 7TAAA 2W9DH 3TXSA 1T1YA 3TPUB 3IETB 5EU7C 1MMMA 3EJYD 1K92A 4KI5C 4E9TA 4AQ1A 3N0PB 3D2UD 2F68X 4QYOB 2EYSB 5I1EL 1HJBC 1C16B 3B5TA 4ZW6A 4XP4L 1HYRC 2WC7A 1MCHA 3N3EA 2NW2A 2UXTA 5I1KH 3I02A 1QO3A 1ZWIC 2K8MA 3GINA 2UVEA 4P2RA 1IM3B 1O6SA 4OV6F 4I9WD 3S5LG 4X6BB 1FDLH 1KGCE 4APQB 1IXMA 1US6A 4WIQA 1GH7A 4JFEB 4P2ZA 2E76C 1QUNB 4TRPH 1IBLB 3SGJC 1NCDL 1G6RB 4HJ0C 4KVNH 4J3OC 2G38A 4KO6A 2F8IA 4B0MB 3IFNL 2I27N 1G1YA 3II2A 4KJWC 2O5YH 4NCC2 4DV5B 2HJFB 2ZJSH 4AVHA 1CXLA 5AENA 1D5NA 3GPEA 4MAYA 4F7MA 2F5BL 2V2WA 1MCWM 2NNXA 3OZLA 1BFVL 4TV9A 2DZEA 1A4CA 4TTGA 1E9PA 5IYZB 4EDXA 1EGJL 3D08A 1FH5H 3O3EA 3I6LD 3QG7L 5F9WB 4F92B 4EBQH 4XCFL 4N5UA 3KXFD 1AZZC 4R0LB 1ND0B 4V1DD 4JKPL 3N1PC 3IN2A 4Y9FA 3UIYA 4N3TA 3P2TA 1IZJA 2D9QB 1OT2A 2SEBB 5IV2B 1XMOB 2HWZL 3GJEA 1VGKB 4LKXA 4UIMA 5FECB 5IOKA 3GLEA 1M90W 4L0PB 2CLRB 3FOMA 1WCQA 2AXHA 2X10A 2HX7A 3QZPA 5CCKL 2R2CA 3PRZA 43CAB 3IJ4A 2FECL 1JUFA 4IU2A 4DCQB 4KJQC 4ASUG 1WB8A 4NO5B 3CX2A 1MWOA 5I0VA 2YMXH 1K9TA 2KUTA 3ZU8A 4U1GB 5F0PB 3FTVA 3MUGB 1GM9A 2KKWA 2WTRB 3IETA 4P06A 4Q7DA 3TPUA 5HGAB 1O75A 5FPIA 2PN5A 4LF6O 1FJ1B 5DD3H 2PYFB 3AQYA 3L95B 2EYSA 3P0YH 4OCXL 1C16A 2V17L 3S98A 3Q4HB 3ZMUA 4IKNA 1KDJA 2WGXA 2X88A 3D2UB 3FOLB 3LS4H 1CQYA 3MUZ1 3O8XA 4HETA 4R84A 1IM3A 3LKNB 4WEMB 4ZHQB 3UKMA 2MQ0A 4X6BA 1N68A 2PO6B 4HU8A 5JIHA 4O4HB 4OZHB 2VZSA 3K59A 2N3JA 4OF5A 1DBJL 1FRGL 2HT3C 1QUNA 3T1FB 4U1MB 4JYCA 4B7IA 4A7UA 1O9VA 4JFHE 1OWWA 4GXFA 1G6RA 4DP7X 5FX3A 1PKQE 1ZJBA 3HCVB 4XVUD 1NLBL 4A55A 4I1RA 3CUPB 4R50A 1GJWA 1P84K 1UD5A 2X7LB 4Z3TA 5MENE 3U0TB 5GJTH 4PJIE 3IRZA 3QZWG 4MXVE 1ZGLB 3B7YA 3MA7B 2WAHA 1HAWA 1HNFA 3E83A 2F7RA 2ZG3A 3MUUA 3SODB 1A3QA 5IYZA 1IEAB 1XD1A 1BYNA 3Q8EA 3WD5L 3FBKA 3FAVB 1FGNH 3SGIA 3NTCL 1N6VA 2Y72A 5IQMA 3H53A 4IMLB 4R0LA 1ND0A 4TLTA 3MV01 4N90D 3RZWA 1CXEA 1ZS2A 1O9GA 1L9QA 1PZ5B 4X6DF 1X9LA 1FXKB 1UEMA 5KBLA 3B2DC 4V1DB 4X9HA 3A8TA 1D2PA 4WKZB 5IV2A 4X9FA 1JDAA 5FECA 3QR1A 3MUHL 2Z91A 5E7BA 3BESR 5EUOE 1OTUC 4ZW5A 3IMBA 2CLRA 3QPXH 4KY1L 2R4RH 3MV9E 4BE5A 4F2ME 1XUQA 1RKRA 1XIWD 4NQCE 3GTNA 1J8SA 5I71B 3CVDA 4NTXA 2GYSA 3AS3A 5D1ZC 5JCOC 2ZT9B 4WFGA 1MJUL 4DCQA 1T1ZB 4FQJL 4XPGH 3ETTA 5D2NA 1RJCA 2KZWA 3FXIC 4HFUL 1V54C 2VERA 5FFLA 3MUGA 3OKMB 2WTRA 1IQWH 2Y24A 1I8IB 3ASNC 5CA1A 2UUBO 2VUKA 1F90H 2ZM6B 1ZRUA 2VRAA 2Y2WA 4WU7A 1GSMA 2DQIH 1FJ1A 2PYFA 3I6KB 4FHBD 2F61A 3CCHB 3Q4HA 1RUKL 1HOCB 3FOLA 3D2UA 1CMOA 5DJ6A 3S36H 4JM2D 1W8EA 4ONFL 1WFIA 4XVOA 3LKNA 4MCNA 3TWCH 5I73C 3HZ3A 4GKSB 4DPCX 2PO6A 4R7NB 1MZFA 3QG6B 4OZHA 1R0AL 1AHKA 1L9OA 3UYOD 5A2BA 4I9WA 3GUFA 1A65A 3MRNB 4U1MA 3T1FA 4AZUA 4BUHA 5B4MC 3WAKA 1EHKB 1IIIA 4ZMNA 3MRQA 4YDMA 4ZK8A 5MHSE 1J5EO 4G83A 1WJ3A 3T1HB 1M6OB 1KWGA 5EZOL 3JT0A 1PD0A 1KFAH 3CUPA 3E8UL 4XVJL 4B9GA 2IFGA 2X7LA 1KGYE 2P49B 3U0TA 1IT9H 4LC1A 4OD1H 1EXGA 3QDHA 2RNBA 2EDXA 3QUYC 4M4RB 1KWKA 4D9QD 1XF1A 4TUOB 1RZPA 1B90A 4YVNA 4JI8B 1IEAA 1A0QL 3Q9PA 4P9PA 3F6IA 3FAVA 4ICWA 1X4ZA 4KHPB 3NIDB 5A16B 4TLSA 3BW9B 1S9VB 4YAQB 3FSWA 3OLIA 1MFVA 1ILUA 2AEIT 4FULA 4PJXF 4UCFA 1PZ5A 1G7MB 3KXFA 3X1NA 2I60H 2BOCC 1WD9A 2VJXA 4V1DA 4FG6C 2DL9A 4WKZA 5DZLA 2AXFB 3CBKB 3OEEG 4I7ZB 3FCGA 3RKPA 2ITCB 3UT5B 1SQVH 1URLA 1TJGL 1MRFH 4KNUA 5EHFA 4YDKL 2I69A 3FCTB 4XP5H 3T2LA 3ZIMA 5JQGB 1AJ7L 1LMIA 3IGAC 1A21A 4PRPE 4LEOB 4Z7VB 3O3DB 1RZKH 4XBMA 4Z0BH 1XIWB 2BVPB 1FVEA 1FYTD 1E5BA 1W8NA 1PY9A 5KSBF 4H26B 5TQ2H 1R1CA 1YSOA 2X53A 3OKMA 4WUKH 4GAJL 2NDFA 4I3SL 1U6AL 3U1QA 1EUUA 4P5TD 4JG1L 1UC6A 2XBZA 3I6KA 4PCKA 3CCHA 1A25A 4KK9C 1MY7A 4MLSA 1HOCA 1N0LB 5E79Z 1HCYA 1IBHA 2XXGA 4GKSA 3FZUD 1N70A 2PTTB 2A4ZA 4R7NA 2VKWA 3QG6A 4FKHA 4JY5L 5SV4A 3ZRWB 3GMQB 3C8HA 5MERB 4KI5F 3HNTH 4Y5YA 3NFSH 5DXWA 4QE7A 1S76D 2ZKOA 3OGOE 3CK0L 4L8DB 5BUAA 2FEEL 4U7MA 5H2BB 1H3XA 4P2AA 4FZ1A 5I1CL 1IKOP 1ZEAL 3RGVD 1M7UA 3HE6B 3L48A 5D9SB 2X4SB 5BW7A 5EC1C 5GGSA 1F41A 3HC4H 5F7DB 2WZPA 4W4OA 4M4RA 1DO6A 4L4VD 2CG9X 3GXDA 4FF9A 2MH4A 4PP1D 4DKFH 1N26A 3MBED 3CPWU 3GRGA 4J3OF 4PHXA 3LNFA 1INEL 5A16A 1I1RA 2B0SH 1HR0B 4IRSD 1EGJA 3BW9A 3CMGA 3T77A 4YAQA 3HBGA 5E1HB 3S5LB 1BW8A 1OSPH 1A6TB 1UOWA 2EE0A 3HPJA 2H9GB 1TUEB 1G7MA 1GIGH 1ZV9A 4XMPL 5IVNA 3MSPA 1VF7A 4P4KB 4RCAA 4P04A 3FU9A 2AXFA 1S3JA 3NIFB 4K3DH 2ITCA 2ADIB 3UT5A 4YHKH 5HGGS 2JB6A 3V0HA 5IQ7H 1NGPL 1XMWA 3FCTA 5JQGA 4LVNB 5HVHC 4DEUA 3QO0A 4CADA 2F1AA 1KY6A 1UZ8B 3O3DA 5LCVL 4Z7VA 5JMOC 1XIWA 2BVPA 4KK6D 3H9SD 3TIEB 5D8JL 5IFJB 1MCPH 4H26A 4PEEA 3MLRL 3MLVH 5B1BB 4DAGL 1L0YA 3UTTE 1GGUA 2YXHA 1HEZB 2J12B 3B09A 2ED6A 1JYXA 4LOEA 2LW3A 3DVIA 4UAHA 4KOCA 3QRFM 4P5TB 1TITA 2ZCZA 1ACCA 2AABH 3U79A 4NRZB 1RL1A 4JJOA 5I18H 2PTTA 1H3PH 1RUML 2ZYSA 4LSRL 3OEHG 3ZRWA 4IIQC 4JM2A 4L8JA 2BY2A 3GMQA 5K69A 2XRAH 5C0CE 5MERA 4KROB 1QI3A 5I1LB 1UA3A 4DO2A 4DPRA 4ZIBA 1V05A 4XCYB 3NH7L 1XNQB 5H2BA 1AP6A 5KAFZ 3WIFB 3QPQC 3IPBA 4MJJA 2NQCA 5T3ZD 3HE6A 4QRUB 5D9SA 1Z9SA 2X4SA 2XQ0A 3UBXA 4HKBB 1K3IA 4OF0A 4JFZH 5F7DA 3RGVB 4K5MA 1ML0A 3SKJL 3F65A 4N3UA 2R2EB 4BZ2L 3I55V 2BIIA 2YUWA 1NL0L 2HX9A 5EO0A 3WG7B 1OLZA 1ZTMA 2WNKA 4L4VB 2BDNH 5AB2A 1SN5A 5DA4A 3MBEB 2IPTL 3P30A 3S5LA 1U42A 1A6TA 4OX9B 2H9GA 4UANA 4DZBB 3G6DH 4JI2B 1IC5L 1MJ7H 2BNRB 4LAQL 4P4KA 4WFHA 4W9DC 1HQRB 4IMKC 2IFFH 1WICA 2JIXD 1PEZA 4J6RH 3QFJE 2ADIA 4MJIB 2YXYA 4ELME 1DVTA 2BNQE 4MDJB 5EEUA 4MLIA 3O6ML 4FZEH 2ITEA 5FFOA 4BCXA 5ICYB 2FB4H 3GYRA 1FUNA 3P69A 3SO3C 4QRPD 4JG5A 3QQ4B 4BHUA 4K7PH 4YO0A 1UZ8A 2X44D 3UMNA 5I1GL 4B60A 1QNMA 3EJPA 5G5DB 3AMLA 4GINA 4HUKB 4O4JB 5IFJA 5CSGA 2CCVA 3W11C 2QPUA 3HW7A 3L5WB 2X9XA 3ZUNC 3H9SB 5FKPB 1HEZA 3X2QB 4XHJC 2V6HA 1HH6B 1U8IA 2ATKB 4OIIL 1DJXA 5IJBC 4UDTB 5BXFB 3QRLA 4ICXA 1NCUA 3MGOB 4MS6A 3ARPA 4P5TA 5TFSH 1PP9H 2L6LA 4QTHB 2BJML 3JCUZ 2NYZA 4NRZA 1S5IL 1BD2D 1UKSA 5EF3A 4J8RB 2CQVA 3SPIA 4JUSA 1MCCA 5LGUA 1A3LH 3IJ9A 2BVEA 4KBPA 3GEWB 2HFFA 2EDTA 3AS0A 4CBZA 2B20A 3VVWA 5I1LA 4XCYA 5EUOF 3DRQA 4ALAL 3WIFA 4AVJA 2DQFB 3GK8L 4JFXA 1R6NA 2XKNB 3PXLA 3ZW3A 3KVPA 5ACLA 3ZR6A 2C9VA 3CFJB 2KLRA 2Y07L 1WP6A 4ANWA 4GX1A 1BMFG 2P47B 3MLXL 1ODAA 4QHLB 4QRUA 5DJ2B 4DO4A 4YHZL 1M1XB 4QO1B 3TESA 3FTGB 4OPAA 1KB3A 2G2NA 2P7TB 3RGVA 2FUQA 4BFNA 1UM4H 2VLJE 5IQ9B 4WF9V 1AYOA 2R2EA 2RQEA 4F2FA 5AB0A 2FSEB 4XHQA 4Y5VB 2BIHA 2UZYB 1U3YA 4L4VA 1E9QA 2EBOA 4XNZC 2JVUA 1RY7B 4Z7WB 1HIML 4OLYL 4HPYH 2V9TA 2DLTA 2VL4A 3MBEA 1TO4A 4NUMA 4N9OB 3JYCA 1U21A 4IRSA 4DZBA 4DV7O 1EBPA 3ZN1A 3ABKC 1LLAA 2BNRA 3QR2A 4X4ZA 3AG2B 5DT1H 4WF7A 2IMMA 3H1ZA 4XMWA 1DUZB 3H42L 5EYPB 3TBCA 5KBDA 1J9QA 4FQXD 5E5LA 1CFVH 3RBGA 4EN3D 4RETB 4FYRA 4MDJA 1G7LB 1MCEA 2JIXB 2DQJL 4CC4A 5KS9E 5AW8B 3T6XA 4TNEA 3CN2A 5ICYA 1CFSB 2E27H 3OKNB 3QQ4A 3QZWA 5KHIA 1FNLA 4PJ5B 4WSJA 4IJ3C 3QK0A 1NGQH 3PAZA 2C9RA 1RZGA 3CVIH 3BISA 3ARRA 3IDIB 3L5WA 4NRXB 3H9SA 4X8JB 3CXCU 2DPKA 2Z6FA 1HH6A 2ATKA 4G6KL 1M56B 1F51A 3AUWB 4UDTA 3PWPE 5BXFA 5HSFA 5E2WL 2DMKA 4GB9A 5FDWB 4Y16C 3TT3H 4KUCD 4QTHA 4Z76B 2CPCA 4J8RA 1OZ0A 3LDBC 3DBXB 1TMCB 3BAXA 1L4IA 4HW6A 2Y22A 2NY0B 5AOKA 1MJ8H 1G4RA 3QJFB 3U9UB 2VJ0A 4K7FB 3DTXB 1GMEA 3GWJA 4QF1B 1YQ2A 1F0LA 1WZKA 5IROD 4DR5O 3RUGF 4TF4A 3SJQC 2DQFA 4LFBB 2XKNA 4X0KA 1CD9B 1WJZA 4B08A 4X66O 1X4YA 3CFJA 4M7ZC 2V7HB 3E9UA 4ZD3L 2DTMH 4G42B 4QHLA 5DJ2A 3HB3D 4EPSA 1M1XA 4QO1A 3L6FB 3QR0A 3ICXA 1Q9OB 3FTGA 4KX7A 1VESA 5ID1B 2P7TA 3E35A 2H6OA 3C5JB 3M17B 4ZO7A 2IV8A 2ZUQC 2MWCA 1F4XL 2NSMA 2FSEA 3AUVA 3D1MC 4PS4L 4Y5VA 1MRDL 1DVFB 1NBZA 3IBEA 3RJQB 3FFDB 2PLTA 4H7VA 4GRWF 4R3SB 4Z7WA 1M2VB 3V7AE 5EIBC 4ZXBC 4PA6A 4R4BB 1KYOK 4YHHB 2WANA 3BUPA 3AY4A 1FCGA 5EU6E 2F19L 1J9SA 1DUZA 5EYPA 1G1KA 2FX7H 4PV8B 2HR3A 2Z3FA 4PYGA 5AG9A 4PGZA 2BSCA 1JZIA 5K9OA 4PJ7A 1G7LA 2JIXA 3CHQA 4WWID 2HUHA 5SX4H 4FQXB 2DE0X 1CFSA 2HSIA 2Y7NA 5D7IE 3OKNA 4BQCA 3QRGL 3H1JH 3ZE1B 2O6CA 4HPHA 1VQKV 5GXBB 5BJTB 1FAIL 3HZVB 1DQVA 1T83C 4Z7NB 1DQQB 5KYUB 4LARH 4NBZB 3PWLB 1GN3A 3HBPA 3APFA 4TOIA 2V5SA 4QRPA 1HC1A 5LCVA 4DV3B 4ZFOL 4MA8H 5LWYL 4I0PC 3MHHC 1KJ2L 2RR3A 3BUBA 3IDIA 4X8JA 5MEPB 4ZX6A 1V7NH 5AOJA 3L7FB 4TSCH 5CBGA 4OD2B 5H4ZA 2HLEB 3BUDA 4P9MH 4CGTA 5TGBB 1NSNH 1DBAL 1J1PL 1JI2A 5FDWA 2VXVL 4NWUH 3ZVVA 2W0LA 2VMFA 1SVBA 1MEXL 2YKKA 2FL4A 2N05A 1A5FH 3FBQA 5FL7G 4XCNB 3DBXA 1PG7H 3KPMB 3MJ8B 1GAXA 3L8QA 1TETL 3U9UA 4K7FA 4WCYH 5B3JE 3DTXA 1P9MC 3U7WH 4QF1A 2X6AA 1DBBH 5KYXB 4JAUA 3QDJE 3EG9B 4V2CB 2OZNA 5ABDE 4TWKA 1J9TA 4JVWA 2VLKE 1OP4A 2DWTA 2FAUA 4KO7A 2X4NB 2V7HA 3UXFA 4OI7A 2ODMA 1KN2H 4G42A 1WLHA 1AS6A 4GSUA 1S78D 1HILA 3U0PB 1Q9OA 4K9EL 3N1QC 5GS2H 1I75A 5ID1A 3QTCA 4E9YA 3C5JA 4GSXA 1QX1A 2EP6A 3M17A 1E65A 1K3ZA 5DMYA 4RWUA 2DM3A 2EADA 4AQYO 1SHXA 1DVFA 1MVUA 1PZAA 2DIJA 3QAQA 3FFDA 3HZKB 4LVOB 4Y4HC 5FUZH 4NM8H 4BZ2A 4R3SA 2AJVH 3HAEG 1M2VA 2O5ZL 2DLGA 3U2IA 1LO0H 5L4MA 4LSSH 1FORH 4CSTA 1FPTH 1PSKH 2VLRE 3P3NA 4R4BA 4OIFA 4UQ3B 1MCOL 1XSOA 3AFLA 5TE4L 5DHXB 3ZOAA 4EO5A 1KNOB 4PV8A 4AVKA 4LCWB 1A7BA 3VSUA 3T8XB 3Q6FB 4LEBA 3EFFK 3BD5A 3VWKD 4OGXL 4Y4KB 1CG9B 1RD6A 2R0ZL 4FQXA 4DR3O 1E4XI 3SOBH 3HZYB 4Q4EA 4X6CE 5BJTA 2HXAA 2X0LA 2APWA 3HZVA 5F8RC 2LAGB 5B22A 2YUVA 5KYUA 3PWLA 4JQIH 4MX7B 2OCCC 5F7AA 4KTDL 5MEPA 3V4PH 3UO3A 3GZKA 2NYYD 5EA0L 1V9PA 3L7FA 1O9ZA 4OD2A 1QA9B 2AJUH 1N10A 4HX1B 2EJ1A 3RW0A 4CC5A 1ET5A 2HVBA 2ORBH 1A8JH 3D3VD 3QISA 5C08E 3WNIA 1XGYL 3C6EA 3B8MA 1CL7I 1OAZH 2ICCA 4XCNA 3SKMB 3G08B 5DURB 4N0UE 5L6YL 1J5OH 3KPMA 3SR2C 5EORH 4OJAA 5DZPA 2AQ2A 5KZCD 2CHNA 4QTFA 3WKPA 3O45A 1GYVA 4ZOCA 2XAJA 1NGXB 1QTYT 1OGSA 3UQ8A 3EG9A 4E9LA 3E38A 4ELMF 3QIUC 2JKSA 4Z1MG 1CBVH 1S7QB 2EZOA 1DR9A 2FEDD 5IROA 1F7YA 1GMIA 3MAQA 3KE0A 4GUQA 2UY6B 1AQDB 1NC2D 3U0PA 2AJYL 2Y4TA 1KIRB 2C3GA 3L4WA 3VGBA 1OPGL 2C9QA 3E9TA 4D7BA 4FP8L 3TCTA 1I1YA 2QADC 1GYCA 1T2XA 4PUBL 3ZKMD 2UZIL 1FNEA 4FLTA 2UXDB 3V6FB 5H5NA 4Y1AD 4K3EL 5TK4A 5DVNA 3WEMA 4NSKB 1D9KC 4RZCB 4KOBA 4LHJB 1UH3A 2QWNB 2EINC 3IRCA 4N1CA 4N8VG 3CVHL 3IS0X 2A38A 4CS2A 3BVNB 1Q4NX 2BINA 1F4HA 1KNOA 4O5LH 4LCWA 4Y9EA 3GQFA 3T8XA 2BCCH 5DK2B 2IU3A 3WFHB 3U9PL 3OJ2C 4TQDA 2VM3A 3MLUL 2XA8L 4JO1L 2C9AA 4Y4KA 5E5MB 5DM6V 1GR7A 2CHZA 3HZYA 2HCZX 3ZL1A 2UUAB 3TBSB 1EEUA 3T0AA 3HI1B 4MX7A 4I9XA 5KBPA 2NXYD 3OMIB 3ERXA 4ZFOB 2F2HA 2WQSA 3IU4H 3S35H 3HFMH 3GSUB 1KJ2B 5JXAL 1YPZF 3OX8B 3F00A 2P3YA 1XI1A 4HX1A 1JDCA 1QKZL 4LT7A 2IH3B 2N7BA 4EUPG 3JWDL 3NAAL 3ARGC 1RMFL 3QEGH 1HKLL 3SKMA 2ZNXA 3G08A 4M7LH 4R2GB 4DKTA 1UACL 2WAMA 4OGAD 1QHTA 3A47A 4NWTL 5C0AD 5DRNB 4M6NH 4NXMB 3BC9A 1QSED 1ED3A 2Z92A 2ICWB 2IGTA 3ABZA 3BZDA 5TDNB 4MJ4A 1K33A 1NGXA 2J8OA 3TL5A 4HJUA 3UEZA 1S7QA 4RGNE 4NUPA 5I0DA 2F66C 2K7PA 4A7TA 2GJRA 2UY6A 1AQDA 1CLYH 1E42A 2WVTA 3BDXA 2E5EA 4B27A 1EHLL 4KXAA 1KIRA 3ARSA 1NIAA 2Y1VA 3K2UL 2HUEA 2LU5A 4ACPA 2IF7A 3D4CA 4A2LA 2LFSA 3VFSA 2QR4A 3LQZB 1B6UA 4L48A 3V6FA 1ASPA 2Y2YA 1DK1A 3NCCB 3ZHNA 4DW1A 4NSKA 4RZCA 3IN0A 1OP3K 5HI5D 1A6WL 3IDMA 4Y1AB 1AXTL 1BM3L 3SGDH 4QR7A 5HI4C 4Y4FD 2BE3A 2BCKB 1S3RA 2G2PA 2IC2A 2XBTA 3I50H 4ODSL 5C09E 4DOHE 4RGNC 3BKCH 5CIPA 3RVXC 4ZTOL 4PRID 4MS8C 4JQVC 4IKJA 4FKKA 2XPGB 4G3YH 4HS3B 4JW3A 5DFVC 5DK2A 3U9WA 1H3TA 3WFHA 1MG2C 5ADPL 4PIBA 4FFWC 5E5MA 4IBSA 2RN9A 3QARA 2CHWA 4JB9L 1E28A 3C3TA 1QP1A 3TBSA 4NKGB 2YK1H 3T2NL 4JS7A 2QKAA 2NTSP 3GIZH 1K4DC 3BCFA 4ZFOA 4NQDD 4E9VA 3UG5A 2W9EH 1KJ2A 2DQEH 3GSUA 3OGCB 3QDME 2NZ9C 2AEOA 4HUNB 4YXKL 2E0PA 2ENPA 3OX8A 4OM1H 5L0QB 4B3MO 3FFCE 1T5XB 2FJHB 4N8CH 2IH3A 1KCVL 5HFMA 3DURB 1CI3M 5FPRA 2CGRL 4FYTA 2UXFA 3SDXF 3EXAA 2P5EE 2QSCH 3EXJA 4HXBH 3HC0A 1AKPA 2MW2B 3FN9A 2ICWA 5IY5C 4GXVL 3ARED 2B9AA 1IB5A 1A4JB 4UTBL 5TDNA 1IC7L 2OULB 5AKTA 1QSEB 4JFPA 5A6IA 1NCWL 1GZQA 4HZ1A 1BEYH 1RM1B 2QZQA 4C59B 5D7IF 3O4LD 1VENA 2WLHA 3L75H 4BWTA 1SN0A 1USQA 3GLAA 1NC2A 5E9DE 4N22A 5CJ5A 1U2CA 3LQZA 3CU1A 3O0RL 3VA6A 3QYCA 2Y69C 1JL8A 5J6GB 3EYUL 1UD3A 4GI8A 4XNAA 3ZKNC 4NS0A 1SXCA 4Y1AA 5INCB 5FLVA 1IGFL 3ECVA 4LE8A 5GRZA 1SC5B 4CVWA 5TQ0H 4HD9A 5GS0C 1NKOA 3CVHB 4ZTEA 1F86A 1QVGU 1LO2L 2F18A 1RPRA 2G2RB 5H8DA 1TXKA 5HHNB 3UZQB 3VG0L 3WNMA 4HS3A 5HDQL 3FSAA 4YGAB 4PRIB 3VI3E 1MOFA 3Q06A 1QMUA 2FGZA 2MOQA 4MQXD 2BP8B 7PAZA 4ZOLB 1ETB1 3UIZA 1KY7A 3WN5B 3BT2L 1Y66A 4EKWA 3QA3A 3UPRB 4ORGB 3Q44A 3GHEH 4JCMA 1NCHA 2C7UA 3CC7V 3C5XA 4PJBB 1KB5H 5BO0D 1BPLB 2VE6B 4IKIA 4KAQL 5EFIB 4DN3H 3V6ZB 2N7AA 1NIDA 5I1JH 3HAEB 3KCWA 4I87A 1JF6A 3ETBJ 3OGCA 5DFAA 1CDHA 3V0GA 3KEHA 3DSNB 3FQRB 4QRTB 2UWEE 3LZLA 3SEPA 1NZ6A 5KAQF 3ZK0A 4NUJB 4Q0XH 1T5XA 4YBLB 2FJHA 1FIEA 3NACL 4UZSA 3DURA 3DX8A 4Z3HA 2DI7A 4R90L 1QFHA 2HVKC 3ZDZE 3LIUA 2R9HD 3DDGA 4A66A 4LGRB 2VH5L 4OGYL 1TKWB 3GBML 3RVWC 3AU0A 1UYWH 3O0LA 4EE2A 1TJHL 1W16A 2IVFC 4QXUL 4UIKL 1CYGA 5IP4A 3PDDA 5JNYA 4NFDA 2OT5A 1AGFB 1EERB 1A4JA 4XBGA 3CC4V 1QSEA 2XWJB 2DH3A 1MA1A 5DMGC 1ONQB 3AREB 2P4KA 4FLZA 4JRWA 4X6CF 2RB8A 5LP6C 3BKML 4BGDA 2YUAA 2A1WH 3QCTL 4OZIF 3QHFL 2YXFA 1U3JA 4FLVA 3OD3A 5KHKA 2DWSA 5JXEC 3SDLA 2XN9B 4NLHA 4LLYB 4Y9BA 5J06A 3B83A 3BWUC 2ISDA 5J6GA 1XO8A 4P23C 5DEGB 3EYQD 4MHHI 4J80A 2YIAA 5INCA 2P8LB 5D4QA 3CLEH 2CH8A 3RWDB 3JWOH 5FUOL 3KYOB 2D03H 2EDBA 3CVHA 1YNTF 1BVLB 5F3HB 1B0GB 3N85L 4KKBC 3UZQA 3MCG1 1QYGL 4Y2OB 1NU1H 5CILH 4PRIA 2GIXA 4UB0L 3SSGA 2QHRH 4OLUH 5F6HI 4XPHL 4DEPB 1FLRH 2BP8A 1PV0A 5JO5B 1NMBH 3WN5A 4MVOA 3OR6B 3UPRA 1EO8H 1H6UA 4ORGA 4ATTA 4ODVL 4G7YL 7FABH 1BSIA 4PJBA 5JR1L 2ETWA 4L9DA 4FVMA 4UB6Z 3E86A 3RYCA 2VE6A 4RRPM 4Z95H 5EFIA 5J4MA 3L70H 3V6ZA 3HAEA 1WC7A 4JDVB 5GGQH 2ZONA 4NTYA 3DSNA 3FQRA 4YLQT 1QLEH 2W88A 2AEQH 1KCUH 4N2CA 4NUJA 5IJ9B 1U8MB 4LBAA 3IDYB 5BQ7A 4G6JL 1OTSD 1X9RA 3T09A 4LASL 3A4DA 3HG1D 5B1JC 1C7SA 1F5WA 1TKWA 1HZHH 4ELDA 5JHMA 1SF9A 5TPWH 2XWRA 1JPGB 4PGDA 4XO9A 3VFNA 4ENED 5BMFH 4G7QB 4ZYKB 1ZL8B 3D09A 3PAUA 4HCRL 1AGFA 3TCLA 4IK7A 1ZLZA 4A67A 1GW6A 2XWJA 4XN9A 2ICES 5LNGA 1A7NH 1ONQA 2XN2A 3AREA 2EIJB 2OK0H 4HP5A 3OZ9H 2UU9O 2P6JA 2W0KA 4OM0L 3MLPA 1L9NA 4POYA 3VB8A 2ZCKL 4JANB 4PJGB 2RMKB 4WFAV 4GSDL 4PA7A 5M95B 4WY7L 5T3XL 1IARB 3GHPA 1JMZA 3O4LA 4V11A 2Z31B 2UV3A 2EEDA 1NUDA 3B2MA 2XN9A 3ETBF 4WGKA 1EVUA 1ANUA 4EUPB 2WNGA 1SZNA 5DEGA 2K9PA 4PG2C 2COQA 2APVA 4ISVB 3A3YB 5T1LD 3U4BH 4YSRA 1KUQA 1L9TA 2P8LA 3NGBC 4JVUA 4N2AA 1HCFX 3RWDA 2R51A 2HKAA 4JZJB 1KP3A 4EQ2A 5I8CA 2B4CL 4GBXD 4YXWG 2AQSA 1BVLA 5F3HA 1B0GA 2OI9B 3VD3A 1HNZO 5FF6B 2H2SC 2YZ1A 3S8GB 4N2LA 2YPVL 3J7AU 2ZUUA 4Y1SA 2NY7H 1AZUA 3O9OA 1JPFB 5JO5A 2WA4A 3OR6A 4XN5A 2NX5B 4OLWL 3LKOA 4ANUA 3ILDA 3IXAA 4J8QA 2YUZA 3V7MA 5CB4A 5EIIB 1WTGT 4X5LA 2FYUH 4CS3A 2TSAA 5D6DC 4ZI7B 2XY2A 3VXMD 1GC1L 4GUOA 3OJDB 3BOVA 1S7XB 5DC0A 2XKUA 1SOKA 1OQXA 4FA7B 3MRGA 3WSQH 1QUPA 2YD9A 5IUSA 5HD8C 1AHMA 3LEYH 5FYLE 3PP4H 1U8MA 5IJ9A 2J88H 1E5UI 2FX8L 3GB7B 1VQ5V 3UCQA 3CCJV 2PNDA 5I75B 3FUEA 1JNJA 3DUSB 3HG1B 4DV6B 1WYJA 1JPGA 4XPAL 3SE3C 4ZYKA 1ZL8A 4PJAF 1DQJB 1RURL 2ETNA 5L9DL 2XTAA 3F5WB 3TT1H 4HU2A 4UTBA 3DX9B 4RUFA 2KERA 2WY3B 4K2UL 4PY7B 1AJPA 3DECA 3RL1B 5HHXH 5C0RH 4KL1A 4JANA 4PJGA 3V6BR 5T3XD 3JATB 2J20A 1O6VA 4UI2A 3UJIH 3P54A 2F1BA 1BMWA 4HD5A 5K33A 3VNYA 4K9JA 4PBWD 3O6FC 1JZEA 4C47A 3ZRSA 1WZ1H 3RL2B 5F7EH 1MFBL 1ERNA 4EUPA 1XX9C 3KVQA 4ISVA 5EBLA 3VGAB 1QLFB 2C1PB 4OB5L 4JZJA 1WITA 3KYAA 2IAMC 3BPLC 1YEEH 4UQCA 4IRZH 3KJ6H 1TQUA 3TFKC 5JW3H 3WGUB 4WWKC 5ABAA 4EI0A 4ONOA 3SYPA 5I17B 2IWEA 3DC5A 3DX0A 3KYKH 4WAFA 1HXMB 2F53E 4HJGB 5D7EA 3VFWB 3KWVA 4XMLH 5HHMB 3QXUA 4JO3H 3JSLA 1J87A 5EIIA 1WCBB 2R70A 1UH2A 1FNHA 4ZI7A 1W2BU 1PNLA 1GGCH 4LWSB 3OJDA 4N85A 4M9OA 4NN7C 4FQ2H 2Q8AH 3MLSL 1OOAA 5J1SC 4H4NA 1M9SA 1RQ5A 5HHOD 3DXAE 1NCIA 1DJIA 2EICA 5AOZA 1B3JA 1MJJB 1JPTH 4HWEL 2F54E 2J6EH 2Q9OA 3FTZA 3LD8C 3EFDH 1CGXA 3DMMC 2PXYB 2VO8A 3D85D 1OALA 1ZXQA 4X65O 3DUSA 3HG1A 7CGTA 3QEQE 4LESA 1MF2L 5DHYB 1OTTD 1DL7H 4TTDC 1OAQH 1JCVA 3G80A 1DQJA 2IMNA 2YWZA 4WJ5B 4XR8C 2DQCL 5KAIZ 4XP1L 3V5DB 2VDMH 3DX9A 3L1OL 1D5ZB 4IOFD 4X6EB 3W57A 1BF5A 4G59C 4KX9A 3RL1A 1GCYA 3GWOA 3DTDA 1Q38A 4TUKL 5E4EB 3MJ7A 3Q5YA 3K1DA 3N5AA 4NKIL 3JATA 4EQ3A 1OAYL 3VRLF 3CDYA 5LNDA 4OI8A 2J1KA 1NZRA 4UYQA 4M5ZL 3MRMB 3ZL4L 4DP2X 3HHSB 5FGBC 3RL2A 3CSYB 4RAIA 1JDDA 1AQHA 4ESKA 5CLZA 4YGVB 5MEOB 1QLFA 2UWEF 3QCVL 1KBWA 3B9KD 5T1LA 3EBHA 2MNWA 4HIIB 5L2KB 2FIRT 3TN0C 4LCUB 2VYRE 3ZMSA 3CS5A 1WPCA 4B9FA 1JNHB 4M7KH 4BWAA 1NCBL 2GBUA 2VMEA 3S34L 2RCSH 1OT1A 1JZ6A 5B38G 1RH8A 1YMME 2WQRA 3PL6C 4WW1B 4WWPA 5I17A 4HJJL 3BWUF 1AZCA 1VB9A 2ADPA 2WWMC 4EJ1C 4HJGA 2V5YA 2W6IG 1Y7VA 3JV0A 3VFWA 2WZ5A 4LDCA 1B6DA 4FE9A 4MJ6B 4NT6B 4KQ0A 4RDQG 3VXNB 3UACA 5KUMA 4QHKI 4TSBH 4X9IA 4MA7H 2W38A 3UTPD 5T33L 2ADFH 4UUJA 4QE9A 4BSJA 4GO9A 3TIDA 1Z2GA 4OQTH 3PN1A 3H01A 1XHHA 1OO2A 4CMHB 5J6HB 4JJHA 5BRZD 1XSIA 3VXMA 3DUHA 1IBMO 3TOPA 3FN0L 5HHOB 3I9GL 4BBWA 1UM6H 4EFBA 4JYYA 3LIZH 4R97C 1AIZA 2PXYA 2IJHA 2HFTA 1E5AA 3EF7A 4OGQC 1AR4A 1P6FA 1YSCA 3LPPA 3CRQA 1A1MB 1YVWA 3UZEA 5DHYA 1H2SB 3MXVL 4GNKB 4QJ5B 3PWJB 5J5EA 3KL0A 4AOFA 5CR1A 3OF6D 2D31B 3V5DA 1FFNB 1U8CB 4HCRA 4AC2A 4X6EA 1D5ZA 2MKLC 3GSXA 4JCLA 1QASA 1N59B 2I5YL 4NKOB 3GNML 2WZ0A 1UXSB 2J3SA 2XSKA 5G2NA 4OZGF 5BVPL 2G0LA 3HZMB 3MNVB 3O2DH 3K3WA 1WAZA 4H88H 3C60C 4BQ6A 1DANU 4LU5L 3DK0A 3CSYA 4HHAB 2DN9A 2GK2A 3BKYH 1UKTA 2VR5A 4L4TE 2NSQA 1KLUB 4YGVA 1O0VA 2FTAA 1TZHB 1ZKAA 5I9QC 2OFQA 2GUYA 4HIIA 4Q8BA 2LHAA 4UVBA 3FH7A 4JG0H 2ZCLL 4CSSA 4PCTA 1OE2A 1Z2KA 4K55A 3ULUE 1OGAE 3B5HA 3QWQB 3Q6GH 5KOMC 4U6VH 4WW1A 5AG2A 1CC3A 3FB7C 2DEXX 1X7QA 4YDNA 2K1MA 1Q90D 3EFFB 1J48A 1NQBA 3W9DB 2YPVA 3FTSA 2VXUH 4MD4B 3EYSL 3WEAA 5CAYB 2WWWA 4MJ6A 2DWYA 3VXNA 3FB5B 5E8DL 4XNYH 2GB2A 4HIHB 4FQIH 1TJIH 4DGYL 5GZOD 1CEZA 3UYRL 1G9NL 3WMQA 1DF4A 2FLRT 1OK8A 4LSPH 3U1SH 2H3KA 4JI1O 2BC4B 3VX1A 1VGEH 2IH9A 2WQVA 3ULVH 1YNLH 4IS6B 4FX5A 2A3QA 3ULUC 4ODBD 4ABMA 1U3ZA 1OV9A 3VWJD 2CRMA 4GQ9H 5HHOA 4WKXA 5GGVH 1FKAO 5SV3A 1QTPA 4WFFE 3X13B 4WJKB 3U25A 3HC2A 2L8AA 3K46A 3QUGA 3DV4B 3RU8H 2DQGL 5AVSB 3D0VA 4HAMA 1JV5B 4BZ1L 3D85A 3WL9B 1A1MA 5JVDB 1N18A 2GK0B 3RY4A 4WHDA 4LQFL 3TO2B 2XAHA 2HMID 1B04A 4FQCL 1T7ZA 4H1LG 4XOEA 3IYLW 2D31A 3O6LH 4Z7OB 1LNUA 3LZFL 1U8CA 2AKRB 2VDRH 1LWJA 3E8BA 1F6FB 2ARJB 3IDJB 4K94C 4YK4C 4D9LL 5E08L 1N59A 4NKOA 2YPLB 1SEQL 3NA4A 3IXTB 1H2KA 3D8MA 1UXSA 5D4HA 3UAAA 3PHQA 2N4IA 3AM8C 4FERA 3VG9B 2V8LA 3MNVA 1RZFL 1MHPL 3CMOH 4BXSV 3B2UD 3UTOA 1K9MW 4F7PB 4KZDH 2W9LA 3S2AA 4HHAA 1S77D 3MZGB 5C3LD 4YJ3B 1XMQB 1EMTH 3LRSB 3S3CB 3N42B 1KLUA 1E4HA 4L9LC 1TPXC 1TZHA 4KZCA 4G6ML 2E7LA 3N9GL 4W6YB 4EI6B 2XT9A 4L2LA 1YEGH 4J2QA 4YR6A 4XDKA 5IHLB 3LEVH 1DO5A 3B9KA 5IVZA 4PRHE 5DK0B 2R8SH 5C93A 1CDGA 1W0YT 3QORD 4IEFB 1QD0A 1WF5A 4PJEB 4CN6A 3AXLB 1TLMA 1RFDH 3KLLA 3EFFA 3W9DA 3RGHA 2NNAB 3AGVA 3CSXA 4MD4A 4PLJD 3NDZE 2IM9A 5B3SB 3FB5A 4OCRH 4HIHA 4XAKE 4FC3E 4QNHB 2CTQA 2Q7HA 3TA3C 5LYJB 4LSQL 5JIKA 1F2XK 1HHHB 4LFHG 1NGYA 2BC4A 4OY9A 4PJFB 3BYYA 1I5XA 5E8NB 3QXAB 1E50A 4JM4H 1AI1L 3A5VA 5BRZA 3U36A 4NBXB 3X13A 3WHE0 5EEXA 3AS1A 3L3DB 3VWJB 2BY3A 3DV4A 4AQAA 1UVQB 5DUML 3APDA 3N40P 4AKOA 1JRHL 3GSVB 1JV5A 3VFPB 3WL9A 3QGVA 3CD6V 5JVDA 2GQHA 3ESOA 1NM4A 2BPBA 2PI4A 4AEIL 2AKRA 2FLBT 1YYLL 5CGBA 3OR7B 2A4EA 3LDDA 3IDJA 1IE5A 2JVDA 3TASA 2YPLA 4M61B 3IXTA 3RA7H 2K0RA 4JRYD 3QUXD 1E9OB 4FYQA 4KMTL 5FKAB 3A0OA 3RRQA 3MFGB 3MQIA 1RLWA 3SGKA 2P26A 4F7PA 5T1KD 3T3PB 1FL5B 4Q97A 3VMNA 1PZCA 4S1RH 4DVRH 2FT7A 4HISA 5CGMA 3LRSA 1TTUA 3UMTA 3U30C 4RQEA 1JPST 3DX2A 1WPBA 3GSOB 3OUFA 3WAJA 2VL5B 3TURA 4JZOB 4AENB 3CFBB 4PA9A 2XI9A 1WNSA 5DK0A 3DXRB 2B5IC 2ZE8A 3IJYA 4P59H 5FC9A 4A39A 1H3GA 3DOSB 4IEFA 4PJEA 4CDGC 3AXLA 4Q58C 4RMBA 4MW8A 2NNAA 3QORB 1ZX3A 2UXBB 2NNUA 3P11H 4LFAO 4KJPC 1AD0B 1Q90A 5IFAL 4U1LB 2ZE6A 1WGOA 4A7SA 2V3FA 1N0XH 2NY1B 1MDAA 1U4FA 2DQUH 5LYJA 1FO0H 3EJZC 3KM1A 5HI3C 4AC4A 1DBKL 5GZOA 1HHHA 2WYTA 5JZ7D 1X4TA 5FR3A 3CWGA 4AYBA 3T4AC 5E8NA 2GSGB 3EAKA 2ZIDA 2NY4D 1S7TB 2QFPA 5I1IL 1DLBA 4NZUH 4WFEE 5EBMC 3B2VH 1XXDC 1ZMYA 4KK5C 2HT2C 4KKQA 1T2JA 1HWWA 1CICC 3ZRVA 3FNKA 2FATL 1QFUH 3L3DA 3VWJA 1SLXA 1RU9L 3BDYL 1SM3H 1UVQA 4UILH 1VZGA 4QOKD 1KCWA 5B38B 2WXIA 3GSVA 4UTAL 2R15A 1YUHB 2PWHA 3MTRA 3PAVA 4RFEB 1T7YA 4JAVA 4TVPL 2ZD0A 3APCA 3WTTA 5CEZH 1WP7A 5GGRY 1TR7A 3GBDA 1CGTA 2W9DL 4LP8A 3OR7A 3B7UX 3BWZA 1E8WA 4LEEA 3MYZA 3WJLA 1NFDB 4M61A 2DYRB 3BZ4B 3I9PA 2XZCL 1FSKB 4F7KA 1M1KW 1VACB 1E9OA 5I1KL 2LT9A 5FKAA 2N01B 2EIEA 2J8UB 3C75A 1S5HB 4JRYB 4I5BB 2PPDA 1T6BX 1WEJH 1E1QG 2IANB 3IAYA 2YD0A 3AC0A 3HG5A 1QSVA 1FL5A 4GY4A 1BWMA 1KB9F 2O1AA 1RUPH 2EO1A 1RFYA 5ENWB 1QR1B 4RFNC 5LHIA 1R47A 1DZ0A 1R5WA 4X98B 3GSOA 2Q7YB 2TSBA 4JFYB 1K4CB 3GO1H 2X4OB 3TJHD 4EOWH 2NNFA 4JZOA 3L81A 4XXWC 4RBPK 3CFBA 4AENA 1X5GA 3RYHB 4PJHE 1KMGA 5CJXC 2WO3B 3DXRA 3KR3H 4DR1B 4GKJO 1T1WB 1SUJA 1J5DA 3DOSA 4JY4B 1YMHB 2LFEA 4PRBB 2V33A 3SBWA 2IBZH 1B4RA 5IOPB 4POZC 3QORA 5DWPA 5CXPA 1AP2B 4MB1A 2YAOA 4HFWB 2EE6A 1AD0A 2EC9U 3MCLH 3CIQA 2BSED 4U1LA 1FNGB 5CP7B 4B9YA 5FK9B 3FD9A 2HJKB 4QHNB 3V0WL 4B41A 3K2KA 4ZMQA 4M93C 1XGPA 5J11C 1JGUH 3B34A 1TVBB 2QHLA 3TS8A 2X3BA 1N4XL 4ZSOE 2MCG1 1SZTA 2CDFA 3ARFD 1VF6A 2GSGA 2MHAB 4F24A 1S7TA 1P7KB 3IMVA 3BEHA 1DLHB 1G9MC 3ULUH 3ZHQA 3CH1B 5EUKB 2DLEA 2AJSL 4N8PA 5DUJA 1NR1A 2DWEB 1WZLA 2FBJH 5B38A 3BQUD 4CUCA 4ZO8A 5GISH 3RTQD 5HDBB 1YUHA 4RFEA 1EJOL 3MX0B 1MCFA 4KI1A 4QOKB 4TVPD 1UA7A 1MOEA 2I26N 2R1YB 3D34A 4G7VL 1DN0B 4W1TA 1JZ3A 2VR3A 1JVLA 4P3CL 3SY0B 2VMDA 1FIGH 3BAEH 4LFHD 4XNQB 1NFDA 5DQDH 2YRPA 3SZKC 3BZ4A 3OHXB 5DMIL 1UB6B 3AG1B 1VACA 5DA0B 3LS4L 1Z9PA 4JRYA 2J8UA 1G5AA 1S5HA 1EPFA 3QHZL 4TULL 4XGZA 3WGVB 1PM9A 2IANA 4FQHB 4DV1B 1ID5I 1Y18B 1U8LB 3U48A 5L88L 5ENWA 1NTKH 4QHKJ 4HALA 3STZA 3EYVB 1E2VA 1QR1A 4L8CB 4X88A 5T1KA 4FLWA 3CFEB 1EEYA 4X98A 2W0FA 2IJJA 4JFYA 2CBTA 1K4CA 2X4OA 5CSZA 1NAKH 5INDB 1CVRA 3TEXA 1MAML 1KKDA 3JYBA 3RYHA 1EUTA 5ACMA 4H1LB 1HINH 4N4YB 1T1WA 4TN9A 3D39B 5I74C 5DR5H 2F23A 2YI9A 1YMHA 2F8VA 4PRAA 3F2LA 5AL0A 3ECUA 1TSHA 4JKKA 3NIDF 4W9IC 4PV9A 3Q1EA 5IOPA 1AP2A 4ZJ9A 1BX2A 1BDYA 5B1OA 4HFWA 2XZAH 2N04A 2BRRH 3ZL2A 1OAJA 1FNGA 5EU5B 4KTEH 5CP7A 5FK9A 1R3KC 2HJKA 4QHNA 2DJUA 4P5KB 3ZKXB 4GLXA 4BIUA 1I7ZA 4OCYL 1N9PA 4KQ3L 1SXNA 3BUYB 2ZDIC 3K6DA 5LN8A 5JIIA 2MHAA 1ICTA 2Y5TA 1P7KA 5G4OA 3QS3A 1IBKB 4FABH 1DLHA 2DBLL 3A6BH 1GZHC 2R4RL 3COOA 1YZBA 3FAXA 2X40A 1FXHA 5EUKA 2D3LA 2DWEA 4X4ME 5IGXL 4JE4B 4HIEA 3BLBA 1E6JL 3BKJH 1XH0A 2A9NH 4YY3O 3WKQA 4LF4B 5CCGE 3MX0A 4QOKA 4DK6A 1BL8A 1U9KA 2W92A 2R1YA 4BE6A 4OF7A 1MIML 5C07E 3NBNA 2MCPH 4J3OG 2G0KA 1U8QB 3SY0A 1F90L 3MNWA 4FNTA 1IBLO 3PV6A 4RH4A 4XNQA 3SQOH 5DEZA 1UB6A 2HFGH 4LCVA 3ZHLA 2OPCA 1HCZA 1IFRA 4LIQL 6FABH 5IHBA 5LGKA 3T9WA 4QLRA 3VDAA 3TWCL 2NY6C 3MOAH 4AIZB 1Y18A 1U8LA 1HYSD 2VITB 4R4FL 1J8HE 3EYVA 5JDJA 4K7PX 2A9MH 4IDJH 4O4IB 1R3HA 3CFEA 5AB9A 1RPQA 2J5LC 1UWEL 4M6OL 3SKOB 2LLGA 2RQ8A 1XAKA 1JGDA 4S1DD 2Q3XA 3DV6B 2CAKA 3ZE0E 1ACYL 3HNSL 2EVGA 3VB9A 4H1LA 3D39A 4OD1L 3W56A 3KMDA 4J5VA 3UABA 1UJTA 2PWEA 2UYLB 4PHZA 3E7JA 2E6JA 1UJ3C 3BFOA 4LLMB 3VD7A 4E41B 3NCYP 3AG7A 4FFZA 4H8HA 1AI6A 3NIFF 2VWJA 5DUPL 3OKKB 2I60L 3BUYA 2EVJA 4IBLT 5IJKC 5CGYC 5C0BE 3A67L 1BIIB 1JXFA 4PJCF 1PX3A 4MYWB 1SGKA 1SPDA 2QV2A 3ARFA 4NZTL 4OTXH 4RBPH 1UZ6F 3GS0A 2WVVB 4P3DB 1N6QL 2R23B 1FE8H 1KN4L 1TAEA 4MSWC 4N0CD 3SD2A 4EIGB 2YIBD 2F4VB 1KIPA 1MW2A 3VD2A 1SXSA 4O02H 3ZGHA 3BQUA 4UTAA 3TCXA 3WTVA 3VFGH 1U8QA 2XWZA 1BQRA 2W59A 3C5ZD 2KQXA 3VTTA 4IOSD 1A1NA 2XIDA 5LA6B 1YJDH 2MCMA 5KJRH 3VGEA 4W70A 2WW8A 4OVUA 1KENH 4BQ8A 5EU4B 5FOBB 3NN8A 2DIEA 5DJDA 3HKCA 1ZSDB 1XCQB 1SHMA 2LU3A 3CPUA 1R73A 2ZWNA 3HN5A 4N5EC 3X12B 4LNVA 4J2XA 1AP5A 2QDWA 3EIFA 3GBEA 4JPVL 3PAYA 2Y23A 4DK0A 5D1QC 4FXGC 4AIZA 1BG1A 5LNEA 1GHFH 1DCLA 2VITA 5CS7A 1VQPV 4U3CA 3UPAA 3J2PA 3U83A 4O4IA 2WLZA 5IBLD 4O9HH 5A6MA 4F7CA 3SKOA 1VRSA 4RUEA 2XWCA 3EGXB 4LOVA 2GTAA 1TTAA 3WJJC 3DV6A 5EZIH 1NGZB 2VN3A 2XV6B 4ADJA 3FO2B 1F13A 1GOFA 1NCAH 2ZXGA 3QI9B 1CGVA 2YIDA 1IFHH 2R0WH 5ESVB 4N6QA 4FQ1H 4OJFH 1NBQA 4OLZL 4QNPF 5LQBL 2J5WA 2X09A 2WGNB 4MDIB 5D1XD 5C7XL 4DKFL 4P2OD 3H2QA 5DRZA 2X0WA 4GSQA 2UYLA 1HU8A 1Z1WA 1JA8A 3DGDA 5C3IA 4RWYH 3RWFB 3IMTA 2FIKB 4LLMA 4WI8A 4NTWA 5TE7L 1D5AA 1FFQA 1ASOA 4R96B 1OSPL 3NRQA 4UM8B 2N7SA 4E41A 1VKXB 3C08H 3RDTD 1KEGH 3OKKA 3II1A 3S88H 5J1TC 1BA9A 4UT6L 1ZANL 2UXCB 1ITCA 4JFOB 3FT4B 3WOVA 3ZYOA 3ETGA 3NRFA 3DETD 4I2XE 1MNUH 2OL3L 2VDNL 1BIIA 4MCMA 4CVZB 5KVDE 1S7WB 4YHKL 4HAKA 3LH8A 1QEXA 4P30A 4GW5A 1TMQA 4A1RA 5IQ7L 4BFIB 2Q0OC 2JJWA 2WVVA 1G9MH 4HQQL 2R23A 3KLSA 4TOYH 3TC9A 4YE4L 3WB1A 1WS7A 1AH1A 1OM3H 5F0LB 4H8WH 3UO8B 1P4UA 1NH6A 2WLMA 4BEIA 4GOSA 4YHYC 4PJHF 4O4LB 2BSSA 1I8LA 3D8CA 3PQYB 2Q2EB 4QRFA 1AQ8A 2PYED 1TF4A 3Q2LA 3CQQA 4DP9X 1ITBB 3IMUA 3WEBA 3EBIA 5LA6A 2FB5A 1F3JB 2XWBB 3KS0J 4KI5D 2Z0UA 3C5ZB 5EU4A 1MIEL 5FOBA 4KZEH 5CN1A 4DUZO 2C3VB 1ZSDA 1NMAL 4S11A 1UWYA 3FUKA 3X12A 1TZIB 1B9ZA 4WI3A 2CHXA 4M62H 4NNPH 1MHHB 4C56B 1N33O 5D72H 4UZGA 1EEQA 4WV1B 3LQAC 2XRAL 1PLGL 1XTLA 1XCWA 3UTQB 3VYOA 4DR6O 4NIKB 3O4OB 1Q8IA 2QE7G 1LQSR 2FR4B 2E9IA 4KHPO 4J3OD 2B1IA 1NGZA 1KYFA 3WS3B 4PCSA 3SCMC 4BK5A 4KJWD 3G4SV 3TCUA 1U93A 2C9PA 4HWZB 4HH8A 3QDAA 4LCCC 5ESVA 4M8RA 1IEHA 2FT6A 3WLBB 4WU5B 4MDIA 1EAQA 2CDEB 4PJXB 4Y7MA 4X6DA 5JJJB 5CEZD 1HQ4B 4C4UA 4KFMA 1LK3L 2BDNL 5D1XB 2PKDA 2QMJA 4P2OB 4X7CC 4Y2DC 4JTDB 1QG3A 1FBIL 2FIKA 3K6SA 4R96A 5I15H 4L1BA 1VKXA 1LO3L 2O72A 3OAZK 4K4KA 3H85A 2P5PA 1LEKB 3CZFA 2HRPH 3ETEA 4JFOA 4J3XA 3VA2C 3T3MF 2G9HB 3ARDC 4MQ7A 4CVZA 2HH0L 3FRUB 1S7WA 3H4HA 4FZ0A 1A6VL 1UCBH 4MXQC 4RWHA 4LF9B 4UT9L 5JLZB 2K45A 4BFIA 4JFUA 4K3AA 5DMKB 3QAZB 4DO6A 4U1NB 4F27A 5KSBB 1LE5B 1AGCB 3BABA 2QDVA 4YSTA 4O2CB 2OIEA 3V0EA 1HHIB 2EYTA 4K7PL 4XXCC 4B3TO 3JV4B 4HC1H 3US1A 3GS7A 2YIBA 2BFVL 2RJZA 1C5DB 1M57C 3PQYA 4K23H 1T5KA 1U0QA 4JO2H 2JEUA 2ZXWB 4FK5C 2NUTA 4A7QA 1IVTA 1XF5B 2X4UB 3FT1A 2OJZH 2E7LC 3C5ZA 5CZVL 4IOSA 4WLCA 2C3VA 2PCFB 4JFFB 2QLYA 4AXWB 1INQB 2DIBA 3KLKA 3WU2Z 1KTLB 1TZIA 2IH1A 4CN1A 4CRPA 5D5PA 4FLYA 4C56A 3ZIAG 2V7NB 3PV7A 3RHWF 4NPYB 4WV1A 4NQEB 3RWIB 3G5YB 1BVOA 3FPXA 5D4IA 3TEUA 3MOQA 2HT3D 3UTQA 1D5BB 4KITB 1MFAH 4AJWA 4MWFB 2NN4A 2Y0SA 2FR4A 3GBNL 2GJJA 2E76B 3LDEA 1I4FB 1HZLA 1JI1A 4QRRD 3WS3A 3SDCC 3GMOB 3OKLB 1IX2A 2I7OA 1P6AB 2EUXA 2F43G 1T89C 4L3ED 1WAAE 3KS0H 4HWZA 4MNQD 4OJEH 3ZE2E 5BV7C 2A6KB 3CWBH 2CBOA 1KELH 3CC1A 3WLBA 4WU5A 3CNKA 2CDEA 4PJXA 4XC1H 3VRIB 1T3FB 5I6PA 5LBSH 3OLEA 3OFNG 4KHXH 5D1XA 3MUJA 4MNGE 4P2OA 4Y9GA 1NCNA 4HPYL 3AQZA 5E8PB 5J7CC 4GUCA 1AO7D 3RZCD 4JFHD 2H3NB 4RMWA 1HI6B 3APMA 3BRDA 4P2QE 1ZV5A 4IGGA 1G4YB 3AABA 5LAXB 3RDTA 4I3RH 1A6AB 3PHOB 2G9HA 1L9SA 2ZKHL 1T03L 3FRUA 4KPHL 5G4MA 1GGIH 1CFVL 3N44F 4QKTA 5EF0A 5GRVL 4TSAH 5JLZA 5BRPA 1ORSB 2OL3B 2VDNB 3IKCB 1EO5A 1YEKH 1ZAUA 4RMTA 4XN8A 5DMKA 5KSBA 4U1NA 4AW4A 3MXWH 3WB0A 3NJNA 4FZ8L 2RMNA 4O2CA 3ZTNH 4EIBA 1HHIA 1QWUA 2X6UA 4AE0A 4XB3A 4BH8B 5JHBA 5D1ZD 1XZWA 1C1EH 1C5DA 3NCXA 4FHKA 1Y6NR 5C8YB 4K8RC 4AQ8A 3WNOA 1XF5A 2X4UA 3BFWA 3KAAA 2PYEA 5F1IB 1ZTEA 4N23A 2Y6SD 1XNQO 2JXMB 2PCFA 4JFFA 4P5SA 1INQA 1WZMA 3DVGA 1WFNA 4HAGA 1KTLA 1NKDA 2J71A 4OUUB 1MFDH 3FTWA 1RIVL 3MV9D 5DJZB 1U8HB 1B06A 1CBJA 2LR4A 4NQCD 1VPOH 4EVNB 4XRCA 1UXMA 2J7LA 4NPYA 1M9WA 4NQEA 1ZWIA 3WY2A 3RWIA 1MJ8L 3OUSA 3G5YA 3VNZA 5DHVH 2VSDA 1UFGA 1D5BA 1SLUA 4LLVB 5B4MD 2RACA 2Q6WB 1NDGB 4YSCA 2XXMB 4MWFA 3QCUH 1U95B 1I4FA 2AV1B 3UTSE 4YEEA 3GMOA 3OB0H 3OKLA 3SGJA 1J8RA 3TK1A 4ZNEE 3ELAT 3JVGC 2E9WA 4QRRB 4QAWA 2A6KA 5A2JH 1ZLSH 4D8PB 4MNQB 3ZJZA 2RCVA 2GHWB 3ZCCA 2P4VA 3QUYD 4NJ9H 1T3FA 3STBA 1JX9A 4F4LA 3VRIA 3BH8B 1YEWA 4EI5D 4GKOA 1W80A 3CXHK 2O93L 4G11A 4AYID 4MCZB 4YDIL 1NEZG 3GXMA 3MFFA 5E8PA 1AE6L 3QQ3B 4BSVA 3O2WL 4CW1A 1M5IA 4OPHA 4X89A 1I9RH 2H3NA 2CH7B 1JJUA 4P57B 1GKEA 5MHSD 1I3RB 4UBDC 5E2UL 2EDWA 5LAXA 1KBVA 5DFWH 1A6AA 3PHOA 4FG6D 4UT6A 1PKQB 2Z0AA 2ODIA 1E5CA 5C0FA 3WFCH 1HN1A 2OL3A 5LHDA 3IKCA 5F97E 3EH2A 3IFPB 1JE6A 5ANMA 5MENB 1X5HA 4PJIB 1E8XA 1PKXA 5HBBA 5TJWK 2JSFA 4W9JC 5HHPB 4KUZL 4N87A 5LMUB 1F58H 4RMVA 4BH8A 2RDCA 1T21B 4M7JH 4MA8L 1Y6XA 1LHZA 1LYQA 3OKEB 1MFCH 4KXCA 3LKPB 3I5DA 5D1ZB 2BOBC 2R69L 5C8YA 3LH2L 4LAJH 3QZBA 1KC5H 1DTUA 2PCYA 1HNXO 3OAZH 3OAWA 5IMKB 2CCLA 1V54B 1ENVA 5F1IA 1INDH 3ASNB 4NWUL 5KVDH 1QFWM 3VQYA 5HJ3B 4OUUA 1E0OB 5DJZA 2PP7A 1ZVHA 5E1AA 3QUHA 5EUOB 2GSMB 1CK0L 3NZHL 3X3GL 3MV9B 4N2MA 1AACA 3QS2A 5FYKH 4AW7A 4YSUA 2HLFC 5BZWB 4NQCB 4A7GF 5I73B 5LXVA 2OMZB 1VQMV 5TF1L 3CC2V 3F64A 1NDGA 1DBBL 4KKAD 2DF3A 1AI4A 3W39B 4HKZB 2AV1A 5CJ8A 3RX5A 4JE0A 3ZDYF 3C2SA 2CBQA 2NQDA 4XWGL 1UPGA 3PWUB 4QRRA 2VMJA 2GTZB 1ROWA 5CJQH 2EH8L 1LP9E 1CGUA 3L4XA 3OJVC 3M8OH 4MNQA 3U1PA 3U2JA 4U7OA 4N2BA 1GS8A 3M8AA 4MCZA 1XDTT 3QUYB 1KYDA 1GGYA 1ES0B 3CXHJ 3QQ3A 5K39B 2Y36H 2AJ3B 3A0RA 3VD4A 5GZNC 4U7KA 2CH7A 4P57A 2WXGA 3SDAC 3DJ9A 3IC7A 1I3RA 1AO7A 1Q1JL 3MRBB 2WMPB 5FXCH 4DR4O 3LZNA 3MV8D 4ODTH 1MVYA 1FGVL 2F7IA 2KQNA 4ZUUA 2KLSA 1BBDH 2BOCB 4NPKA 5KBNC 1IAMA 3IFPA 4UT9A 4K3GA 5ERWB 1XH2A 1SDAB 4PJIA 5C0ND 3ASWA 2I9TB 5HHPA 3QIWC 2V5MA 3POHA 1T21A 4IBQA 3X14B 3OKEA 4H13C 2R9RB 2ZP0T 1K5SA 2L0DA 3LKPA 3M86A 5D1ZA 5JCOA 3BD3A 3EW3B 1OARL 1AQKH 5AZ2L 1YZZA 5IMKA 4R6ZA 3FO0H 3NJIA 4NHCL 4QPEA 1C08A 1A32A 4LFBO 1WFUA 2QM7A 5I24A 4JZNB 4PH8A 5HJ3A 3FYEB 2PF4E 4DKEH 3RIFK 4OF8A 4PB9L 5IF0B 3TP4A 1OAZL 2IJIA 1KTCA 3OXRB 5EUOA 2H41A 3RUGB 1J0ZA 3KPOB 4GRLC 3MV9A 3BD4A 5AAMA 4D9RE 3FB8C 4KZDL 3BI9X 1EO7A 5DTFB 5BZWA 4NQCA 2EH7H 2OMZA 1EVTC 3NVQA 4PS7A 4CVXB 4HEPG 4YZWA 4LGSB 4PRPB 4QIRA 3ZY7A 4ANKA 3NSDA 2ZUTA 4OCLC 2BS9A 3W39A 4HKZA 5EF2A 3TZVD 3VCLB 1XNRB 3QPQD 4BKTC 3BGFC 3FMGL 3EFOB 4CH4A 3PWUA 3C2AH 3FO9B 3HIZA 3N06B 2GTZA 1MNNA 5DD6A 2KT6A 1P1VA 3BVVA 5DD1L 4F57H 3MRIB 4PLKC 1IZ3A 4J3VA 2F58L 2BWDA 4EKXA 1XVSA 5D7LE 5DS8B 4PA3A 5EC1B 1DVSA 3CCRV 4HOZA 1RK1B 3QUYA 3L71H 1IFGA 2ZUYA 1ES0A 3PIQB 5K39A 5J9PC 1KG0A 2AJ3A 1DLFH 3GSWB 4YLCA 5AWNL 3V55A 2QTSA 3E8VA 1G4MA 1IC4H 1PMYA 2YIHA 1AR2A 3MRBA 4PJ9C 5SWSD 1HL5A 2QSTA 3T1CA 1CXFA 1T6VN 4AM0B 2YI8A 2IQAB 5DSCB 4G7SB 4B3EA 2JDIG 2BOCA 1UWXK 4G1MA 1D7DA 4Z78B 1U8NB 1BZDA 2QZ5A 1KCKA 1T0PB 4OFYA 1B4JL 1KUMA 4JI0B 5ERWA 1G1CA 4BFFA 3WY1A 4IYKA 2AGJH 3D9AH 1T5WB 3JUZA 4ZOAA 1E7UA 5HVHB 3TV8A 3Q0HA 1XGQB 2X0UA 4XO8A 3IGAA 3UC0L 2Z93B 3X14A 1MDTA 3AXHA 1YTFD 1WAAF 3ZE2F 2BOLA 3W11D 5J12C 4J3WA 3N1GC 3QJVB 4BW5A 2C5DC 4XHJD 1DQMH 3TBYB 2WKOF 1HSBB 4BFKA 5DZVA 3MHSC 2IU0A 3FS9A 3QFJD 4FTVE 4JZNA 1YYCA 2MNJB 1WVZA 5EOCH 1UFIA 3MRLB 5IF0A 3GRWA 3RUGA 3CU7A 2DYPB 4NB5A 5EOQL 2GSIA 3GS4A 2NOYA 2WBJC 4CVXA 5LLIC 1CD1B 1F1DA 2PPEA 4PRPA 1KT2B 4IIQB 3A6OA 3VCLA 1FCCA 1NOLA 5B8CA 2ZCHH 1S3KH 5KYNA 3OE7G 1H2MA 3EFOA 1CLYL 2Q5ZA 4YFLI 5KVGL 2CK0L 3RBZA 5FYJU 3CHOA 3HHRB 3LXCA 4UOJA 1GN4A 3BRGC 3MRIA 4P46D 4AQ1C 2CUMA 2QQKL 4M1GL 5KAQG 4J23A 4LSUH 4OZFG 2Z1KA 5T5FH 5EC1A 4G43B 2EIMC 2WJ7A 4HXAL 1RK1A 1FLTX 5FYJL 3CJJA 3PIQA 3KGUA 1NTZH 2ZKWA 3GSWA 2Z7UA 1DTOA 1RPKA 3TTSA 3DBSA 4H0GA 5C0CB 5AKSA 5LBQA 1NAMH 4FYSA 3CCVV 2VQEB 4NO0B 5J2UB 1OGTB 4U1HB 2WKLA 1P7GA 4OFQA 3NUKA 1Q5OA 2IQAA 4H20H 5DSCA 2UUCB 5SWSB 2I24N 4Z78A 1D5RA 1U8NA 1Q6UA 1BG9A 3ZHTA 2VLJD 2MMXA 3SE4A 5IIEB 2Y4UA 3NFPB 2VAAB 1T5WA 4ODUB 3KZIZ 5A2KH 3H0TB 2VO5A 1XGQA 3SO3B 2KL6A 4I89A 1MFEH 2VOTA 3GMRB 4LGPB 1EZVH 3CCUV 4PDMA 4LCYB 3P77A 4QHUB 1W15A 1TGOA 1PY0A 2FSDA 4FNLH 3KBPA 1NEZB 1T2QH 2W9EL 2VQUA 3H4FA 5D55A 2HHHB 1YTFB 1BREA 2R69A 4XZUA 3TBYA 1HSBA 3NJHA 4OM1L 2ARHA 2HYMA 4U4BA 1ACXA 1JAEA 1MCJA 3F05A 4Y16D 2OXHB 4IHOB 3CZKA 4KDVA 3MRLA 1OL0A 3QFJB 2DOSA 1BLNB 2FYYA 5JHLL 5I16B 1MQ8A 1HL4A 15C8L 2BNQB 2DYPA 3PGFL 1Q0YH 4ELMB 1PIFA 1BVNT 2V2XB 1N34B 2Q5BA 4P49A 4RESB 1A9BB 3GI9L 4Z7QF 1CD1A 2UXDO 3MD0A 1BMGA 1FVCB 1KT2A 3QP3A 1JD9A 2P42B 2WWKT 1YEHL 5F71A 4KNSA 4YBQD 2JJTA 4LCUC 2QQNL 4XXDB 2OLDA 1RUAH 4Z3IA 2B16A 3HN8A 3PWPD 2J72A 2BHYA 5DZJA 2KG7B 3STLC 4G5ZL 3FQWB 3ABGA 3GFUA 4G9DB 5C97A 4YSDA 1QI4A 3MR9B 4IQHA 4OJYA 1GAFH 1XAUA 1NLDH 2EC8A 5FYJD 2FX9H 3O8XC 4FM1A 3RX7A 5KANI 5KHHA 1RLBA 4HMCA 1LMKA 3QQ9D 1NVPD 2H26B 2PTMA 2UUAO 4S10A 4XNZB 5KWYC 3DO3A 4ZXBD 2VDQL 1MRCL 2JE8A 5C0CA 1Z3GH 2HRHA 3NCBB 2XC8A 4HLZH 3VDBA 1CPYA 4NO0A 3ZQXA 5J2UA 1OGTA 4U1HA 2OZ4L 5EN3A 1KULA 4Z3EA 3QJQB 1MLCB 3K5RA 4OCSH 2GUZA 5A40E 2GEQA 5SWSA 3ABKB 4DJMA 5D7KE 5KG9B 2G3NA 4MAUH 2GKIA 1D5IL 2WXMA 4ZPVB 4FN0A 4A2EA 5ILTL 2VLJB 5HYJD 2VAAA 2X1PA 1N64L 4ODUA 2JK5A 1G0YR 2MTAA 1OF2B 1YPZB 3R06B 5DN6G 2EVHA 3GMRA