3SPGA

Inward rectifier potassium channel kir2.2 r186a mutant in complex with pip2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMAAPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
total genus 94
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spgA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spgA01
3T4ZA 3FB6C 3SYQA 1BL8A 1ZWIC 4G27B 4MTOA 1P7BA 4I9WA 3AG4C 4MTFA 4P30A 3STLC 4CBCA 1V54C 2EIMC 5EC2C 4F4LA 4JTCB 3K6NA 2A79B 3OR6C 3SPGA 2DWDC 4PA9A 4RAIA 1N9PA 2IH3C 1OCRC 2AHYA 2ZD9A 4PDRA 3AG1C 3OGCC 4R50A 4P9PA 1U4EA 3K0DA 4G28B 3E8FA 4MVRA 2WLIB 4WFGA 2HVKC 2EINC 3F5WC 1OCCC 3ATFA 1M57C 2WLJA 3LUTB 4MVSA 1V55C 3FB5C 3OR7C 3E83A 4RUEA 3JYCA 4QE9A 2QKSA 3GB7C 3UM7A 1U4FA 3LDEA 4P9OA 1JVMA 3K03A 4MVUA 3ATDA 1XL4A 3LDCA 3TCUA 4DXWA 4R6ZA 1OCZC 4UUJC 2WLNA 4OXSA 3X2QC 3K0GA 5IY5C 4PA7A 4KFMA 2K1EA 1QLEC 2OCCC 2QTOA 4H37A 3E8HA 4MS2A 3ZRSA 2JK5C 4JTDB 4TWKA 5B1AC 3ZJZA 2NLJC 3SJQC 4PA4A 2DWEC 3T2MA 4PDLA 1ORQC 3E86A 5EBLC 5EC1C 3T1CA 4MVZA 4MSWC 3ABKC 2KB1A 4MVOA 3AT9A 2ZXWC 1XL6A 4PA6A 3K08A 3K04A 4RO2A 2GIXA 1R3IC 3SPIA 4QNHB 2W0FC 3RW0A 3ABMC 3ATEA 3FB7C 3PJSK 4MTGA 2DYSC 5EBMC 3WG7C 4EKWA 3AT8A 1J95A 4XDLA 2X6AA 5B1BC 4PA3A 2IH1C 4XDJA 5KUMA 4LBEC 4GX2A 1KKDA 3ATAA 4WFHA 2HVJC 5CBFA 2Q68A 2HG5C 4WFFA 3R65A 4R7CA 4QE7A 3OUSA 4HYOA 4PDMA 3KG2A 4MVQA 3SYCA 3IFXA 5BZBA 3IGAC 3AG2C 2WLLA 2Y69C 2Q6AA 5EBWC 2P7TC 3K06A 2ITCC 4ZBMA 3RBZA 3ASOC 5EK0A 3RVZA 3VOUA 2ATKC 3SYAA 2DYRC 3TETA 3SYPA 4LP8A 3E8GA 2HFEC 4PDVA 4XDKA 5B3SC 3F7YC 3HPLC 4GX1A 3E8BA 4J9ZB 4WFEA 3SPHA 3STZC 1K4CC 3AG3C 2AHZA 2R9RB 1R3LC 3T4DA 2Q67A 4BW5A 2ITDC 3E89A 4RUFA 4HZ3A 1R3JC 4MW3A 4X88A 3UKMA 4LCUC 5KUKA 4GX5A 1M56C 5E1AC 2EIJC 2WLMA 2X6BA 3ABLC 3EFFK 3F7VC 4H33A 4X89A 2WLKA 4MVMA 3BEHA 3LNMB 2BOCC 3ASNC 3OUFA 4J9YB 3RVYA 3AUWB 4JTAB 2WLIA 1LNQA 2EILC 2H8PC 3AGWA 3VSQA 2Q69A 1S5HC 1OCOC 2WLLB 4GX0A 1G4YB 2EIKC 2BOBC 3FB8C 1R3KC 3ATBA 3LDDA 2A0LA 3SPJA 4P2ZA 5J9PC 2A9HA 2WLHA 5CBHA 1K4DC 2X6CA 3SPCA 2E4FA 3SYOA 2YEVA 4X8AA 4MW8A 2HJFC 5CBGA 4R8CA
chains in the Genus database with same CATH superfamily
1JQ0A 1KACB 2D9QB 1ITCA 4OGQB 3FTXA 3H9YA 1YYMH 3PNRB 3SKJH 2NY6D 1S7RA 3PRZA 3T08A 1IBFA 3ILPB 3I55V 3HKBA 3OHMB 5C0ND 2I24N 2Y23A 4YZFF 4LHUA 5I6NA 4X8GA 4WWOA 2IQ9L 3L3DA 2FE0A 2L8AA 4LF7B 2H9GA 3PE9A 4PSRA 4D6TH 1LDPL 4WEBL 3P30L 3TZVA 3DUHA 2CCLA 1NH2B 2OWOA 2Z7WA 3CDFA 1JZIA 2DQCL 5LVEA 5JHMA 2QFPA 3G6AA 3AY4C 1XL4A 1LWJA 3EDKA 3PWNB 1GIGL 1WAPA 3LS4H 5FKAB 1PYWA 3EFDL 2FHBA 2DJUA 1NOAA 5EIBC 4F1SA 5KHGA 2IBZX 2Y1YA 3INOA 5F71A 3LSOB 2XY1A 3WUWB 1S7VA 1JE6A 5A2LH 2VDQH 2LOEA 2NTSP 3EFOA 1EEUA 5ICXB 1JMKC 3NT0A 4X20B 1RLWA 3L3IA 3VB9A 2VN4A 1MCOL 2ENYA 3QG6A 5LKNA 2YFOA 2CLRA 2GCYA 3SGDI 5KYWB 2ZCHL 3DTXA 3QIBB 1QBBA 3WFBH 3P77A 2IADA 2W0KA 3LRSB 4LHQB 1X5ZA 4KGLA 1U6AL 4MA1B 1I8LA 3QUZC 5CA0A 1FNEB 5EN2B 2BTQB 1W0KG 3Q6FA 3KW7A 5C8JB 2MPVA 4ELMB 3ESPA 4XPHL 2W91A 1I8KA 4PJ7F 5D8JL 5I1KL 4G8AC 4U6YB 1LO2H 2Y7MA 5GS1A 5EO9B 4AJYV 2BWDA 1DUZB 2CIIA 3D52A 2PUQT 3DUSA 4F33A 3T1HB 2FH8A 4DETA 2R1YB 4G5AA 5EZPA 1SQQH 3I6GB 2EE9A 2C2AA 1QQCA 3OM3B 5IOPB 4MDRA 3PFQA 3WXVH 3CEIA 1BVKB 4PWJA 1INEL 4DK3A 2WYZA 3D4CA 4OTXH 1RCYA 4PW3A 4Z95H 2MCAA 4M5YH 5CCJA 3SJVB 3ARED 4MHHI 5AW2B 4K5NA 2CO2A 2ZOUA 1A3LL 1BVZA 3HNTL 4PJXA 4Z7UA 4PREB 3Q01A 3UDWA 3CPLA 4E41D 4DGIL 2WXIA 5EEXA 1IVTA 4X7SH 5CR1A 4NN7B 1NFDF 2IWGA 4QJ4B 5KMGB 1JI1A 3OHXA 4G7VL 3VFTB 3CVHA 4IU3B 1N6QL 1I8LC 4WHTB 4FJ6A 5FC9A 3AGWA 5CJQL 1MCKA 3WIAA 4KVPA 1DQDH 4MDJB 1BXUA 4YBLC 5E7BA 4J6IA 1KMIZ 4R7VA 3KBEA 4TV3A 1K4DC 4TOYH 4M7LL 5KN5B 4I1NB 3APNA 4Y16D 2XJLA 1G7IB 2VYRE 3L1OL 3L9RA 1DL7H 3KR3L 4CC4C 4JZOA 4FKEA 5IMLA 1MXDA 3WTWA 3VCLB 2IJJA 5F88A 4JFZL 4L8DA 2B9ZA 1R24B 5JOEA 5DLMH 1SBBA 2CM5A 3WENA 3WN5C 1R3LA 1XR9A 2FYUH 3U83A 4J5VA 5T33H 1R1BA 3S7GA 3R06B 2OTPA 4PGZA 5I28A 4P9OA 4XP1H 4H88H 5DD6B 1DQJA 5I74C 1GHFL 3CFMA 4CJ0A 3U30C 1N2RA 2AJSH 2ZINA 3F84A 1GC1C 3U1SH 1F86A 1UADC 3TBBA 1C5CH 3F5TA 4HUNB 2ARJB 4L29B 4EI5D 1E5YA 3MSPA 1UXSA 3ZUCA 3ZJZA 4CS3A 1DVSA 3V6ZA 3IK2A 3FAXA 4E9SA 2J3SA 3MLZH 1SJHB 3PNWB 5IB4A 1K4CB 2DPKA 4O58H 5FB8B 3V7AE 4G9DB 5IMKB 1WA2X 4XOAA 3GSNA 5CHNB 3W9EB 3K08A 4I87A 3SJAC 4NENA 1X5YA 2YGQA 3QJFA 4CNIA 2Z7YA 3GBML 3VWJD 3DETD 2NR6D 4I0PA 5BXZA 1OP3H 4N3TA 2BNUB 2EIZB 3GF8A 3HBGA 1K8IA 5ISZA 4TUJB 1C5DA 4N9GA 3O6KL 4H0IA 3MRCB 4YXWG 1E1QG 1TAEA 2WBJA 1CO1A 1J88A 2DW5A 4MCZA 1UB5A 3O4LA 3SE6A 5AZUA 4FFTA 4EFEA 4XP4H 1A3QA 4ZUTB 5FYLH 4WGWB 2DLEA 4Y9BA 3GJFB 1P0SE 5HHMB 4L2YA 3E6FA 3A0BZ 4LSPH 3DX9A 3QJZA 3CC2V 1FYTA 2TSAA 2ZNJA 1M71A 4MMYA 4WW2B 3MA9L 1DF5A 2CHWA 4MB3A 5H5NA 3LZPA 3N0PB 4F9LA 1WUZA 3LH2L 5JPMA 4BYHA 4R4ND 3TH2T 3PGCB 1UA6L 1QLEH 2VRKA 4Z7UE 4PJXE 4POYA 1H6UA 3MJ8B 4CBZA 3ALXA 5J1TC 5EOCH 1N36B 1OW0A 3UGXA 1LE9B 4WFBV 2VWKA 2H8PC 4H26A 3JXAA 2WMPB 5C0AB 2ZF9A 3I56V 1SYSA 2VLRA 1VADA 4B0MM 4QRRA 3RYHA 4M1DL 4HBQA 3WFEH 5MI0C 3X13A 3RWHA 5JIMA 4N4YB 4BQ6A 1Q9LA 3ZZ1A 2B59B 3JV0A 4I18B 4RIRA 2ED7A 5C0CB 3K71A 3BT0A 3PWVB 5J11C 5HXMA 1XIWA 1YUKB 1OAUH 5J6SA 1V8HA 3QT2A 1A64A 4JS7A 4N8VG 3ZDZE 5D7JC 1T5WB 2F53D 2OJEA 3NACH 2B1OA 3PAUA 2VLJD 4Q14A 2GTWA 5CIPH 2DDQH 1RMFL 1MLCB 3BIAX 2YXLA 4X1IB 2CDGA 3BVXA 2XIDA 1WA1X 3P0YL 4LU5H 5I66B 4F7PA 4CN1A 3PDOB 3UTSB 4KJWD 4OUUA 3S98A 2FJGA 4G82A 4MGXA 3MLPA 1R3JA 1PG7H 2NY4D 1ZL8B 2RB8A 4NAQA 3DGDA 4JAMB 1XH2A 2B77A 1U8CA 2J8UA 2IO5A 2FKXA 1S5HA 5L2KB 1NKGA 3CHRA 4ZO6A 3WFZA 2R4SH 3SZ6A 4MNGA 4ACPA 5AW9B 4BFGA 5I6LA 3S96B 2YO3A 4GY4A 2ADPA 4NWTL 1FQ9C 5C92A 5AVSB 1F4HA 3AU1A 1F2QA 2BS8A 4YDVB 2FGWL 5HI3C 2W94A 2JLLA 2WVVA 3PGFL 3ZDYF 1JK8B 3EDJA 2V2TB 2NY7L 2WBWB 4MVZA 3WL9A 3AT9A 1AGFA 3T1FA 1E4KC 2OI9B 2F18A 1W72L 1JN6A 5CCHE 4QNHB 5JXAL 3GSQA 1U93A 2WKGA 3D0LA 1RAMA 4B5ZA 1EAPB 2R9HD 4JZNB 4K3HA 5C6TH 3OGCA 4PJCB 2VQEO 3WU2Z 1AAJA 5ISZE 3O3AA 3SDXB 4XC1L 3RPBA 2CRYA 2IAND 3BJ91 4KK6D 2V8LA 4PG9A 1P5UB 2LVEA 3BOVA 3VI4B 4QJ5B 1E50A 5F9WC 2X44D 3SDDD 3V4PA 1YPZA 5EF2A 2H26A 1N64H 3KPQA 4N20A 3LKPB 3FL7A 3KPSD 4U3FH 4PS4L 3O4LE 1HNZB 1IGMH 5KYUA 5IJBC 1IGFH 2DAVA 1AY1H 2HJFB 3BDXA 5LP6C 1SQXH 2QQLL 3C8HA 3L4TA 1ZWIB 3LVTA 3STLB 5CZXD 3TA3A 3VOUA 2ZR2A 4PGJA 3HZMA 2Y06H 2I9TA 1YNTA 2YXFA 3QEGL 4S10A 1FXKB 1JHKL 3QS2A 1FYTE 4UT6H 1RZJL 4GQQA 4N28A 3ZX1A 4DUVA 5MEOA 1OTUC 5KVEH 2K9PA 2COQA 2D3VA 2VLKE 1MIEL 2F54A 2L3BA 1AR1B 3IMWA 3ZO9A 5ANME 4FXLA 5INCB 4OB5H 4FHJA 5F7EL 2Z5UA 2LU7A 4DN4H 2GEQA 3OLIA 3QVNA 3IBOA 4QY8B 4FS0A 3MRQA 1HYSC 1T1YB 2B4CH 2CBTA 2EO9A 2XN9D 4FYTA 3QJSB 4OF6A 1KV7A 4X66B 2A4EA 2IM9A 3QGVA 4JKPH 3MGTB 3T6XA 4X1KA 2C1PB 1U8LA 1EK3A 3HMXH 3MOQA 5EHFA 5EU7C 4I50A 5AFAA 3EDFA 4QRRE 2VLRE 4JRWA 2WO2B 4KZDL 3NSYA 3II3A 4P5TB 4G6AC 3CHQA 1JK9A 4KPHL 3TA3C 1GGCL 1XILA 3QPXH 4UMSA 4DFHA 3WKNA 5AZ2L 1LD9B 2FBJH 3CFKB 4I9QA 2EICA 4NZUL 3CCJV 3GI9H 3V6BR 1WNSA 4B3RO 2Q7YA 3EZJB 4EPSA 3FB7B 1PNKA 4HD9A 1K8AW 1CLZH 4TNWK 3STZA 2Y07L 2E9BA 4KH9A 4GZRB 1JGLL 3ZE0B 1KF9B 1WFJA 1XSKA 1E28A 4G42A 4CSZA 3QIUB 4Z3HA 4D9QE 4LLDA 3GXDA 4BE5A 4WF9V 2QADC 3MO1A 1HHIB 2Z35B 2XRAL 3F8UB 4YHHO 4IJTA 4L4VB 3AADB 2EH7H 3VD9A 1T6BX 4PUBL 3VG9C 2E5EA 3LN4B 3GHBH 1EM1A 5JVDA 3VYOA 4U3JB 3LRHA 5IY5C 4NUJB 4C4KO 4R26L 1AGCB 3KBPA 4KROB 2J8UE 4UCRA 1WZKA 1LP9A 2GQHA 2QFRA 4K23L 3S8FB 3ZRXA 1BAFH 4DW1A 4LKXB 4DV2O 3RWRD 4MNGE 2Y4UA 1YMMD 4HKXB 3FZUC 2ZP0T 3GWJA 2ZUSA 3VB8A 1K34A 2Z9TA 3V6FB 1VFMA 1HHKB 5H2BA 2OP4L 2FL4A 3FO9B 2XBTA 3QH3B 1H9VA 2JXMA 3KWXA 2KB1A 3G08B 3CFEB 1E9PB 5JJEB 4UDUA 5D5PA 5EC2A 3DDGA 4U31A 2IWEA 3C6SA 3H55A 3KDMA 3OR6A 5H37A 1BEYL 1VF7A 1GY2A 4I7ZC 4ZW5A 4E36A 4PRNB 2NY6B 2PYEA 4XX1E 5B1BC 2NOYA 2HN7A 3S37X 4W4OA 1J8SA 1R34A 3B8MA 5DHVH 2VH5H 1Z9PA 5L0QB 3IJSB 2CH7B 3GXMA 2ID5A 5DJ6B 3RY5A 1G9ML 4X8CA 3U9WA 4M8QB 5CN3A 2HMID 4DPAX 3K3WA 1E8YA 2RQEA 2AW9A 1B4LA 2F58L 1YPZE 4ILDA 1JV5B 1P7QA 3L08A 3X3FH 4Y89A 1PSKH 4EUPG 2JIXA 1HWWA 1M1XA 3BVVA 1W6WA 2ZCLL 2V4LA 5LGNA 4R0LC 4BFKA 5C0IB 2OPCA 1MZYA 3QC6X 5FNVA 3WD5L 3SE3C 1Z2GA 2P8MA 2W9DH 1NVPD 1OHZA 4PH8A 4JV5O 2PYLA 1SEQL 3DSFL 3WEMA 2F54E 1NLBH 3VXPB 4OF7A 4RNRB 1FFNA 5J4MA 3BO8A 1A3RL 1SZNA 3SZKC 4ETQB 2H32H 1U41A 4NQEA 2R29A 5CJ5A 1RL1A 3C5SB 4DKEL 4HUWA 3GBNH 3PJSB 4FQHA 1GAFH 1I7RA 4JFTA 4U2ZA 3RI5K 4W6YB 3NXSA 2CIKB 4P9ML 4DGVL 3WKQA 1N0JA 1P4BH 4NAMA 5CIPB 2WUBL 4MTOA 5KVGH 4FEIA 3IGAA 2DJVA 3RNQA 4N8UA 4C83A 3GK8H 3RZCA 2A74B 5A2IH 5F7HA 4ANKA 1AZVA 2VR7A 1M9WA 2YUVA 3QRGL 2APSA 1OCWL 5EPMB 3AVEA 4JFQA 1RK1A 5HVHC 3WNIA 3GTTA 2B2XH 1KCRL 1KB9K 2GSGB 4GYBA 4L3CA 5CBEB 5CZVH 3RKDC 3OTFA 1MLBA 3VQVA 4MQ7B 2I32A 5I1HH 4DV7O 5EOCJ 4AYMC 1HYRC 4DO6A 2MHAB 3MNZA 3HS0B 5BXFA 1AFVH 4NM8L 4M5ZL 1R5WA 3HI1A 3KYAA 3SDCB 2OL3L 2X6UA 1RZQA 3NPSB 2GAZA 2YEVB 1HXYB 3QXDA 5FFOA 4XO3A 3BUTA 3EJYC 5DD0H 5FWQA 3RE0A 5IJCC 4JGNA 3KYOA 3T77B 5K59E 3RYFB 2HKFL 3AG2B 4YSAA 4NRZB 4XPGL 2DS4A 2XXFA 4H1LH 3MMEB 1JA8A 1FGVH 1U58B 1LP9E 1VKXB 2VXUL 4Z7QE 5I75B 1A9EB 2Q7GA 4FQJH 4GIAA 5MI0B 4HFUH 2VNCA 2RA1A 3U9PL 3BIKA 4IMKA 1J7VR 1SKVA 5FYKH 4PY8I 3ZE1B 3ULAB 4QT5A 1S7WA 1PQZA 1SJXA 4FA6A 1UC6A 4XMWA 2Z91B 1JPFB 4FCAA 5EBGA 5ICZA 3BHPA 3DARA 2O5XH 4OBSA 1BLNB 1EMTL 2PYFA 2OR9H 2PYEE 4KY1L 2XUMA 4WWKB 2IQAB 3CRMA 3JWOL 3ATAA 4YDKL 3SD5A 4BUQA 5BOPA 1ZA3B 3VDAA 1PVHA 1F6LL 1KCUH 3N3EA 4HWBH 4P3WA 3VMPA 1AHMA 4J8RA 3WCYA 3ARBD 4G2KA 3NUKA 1KG0A 2OS7A 4OUOA 3U2SA 5ETUA 4MMZC 4UTAL 4PGDB 3ARDD 1ZLUK 3KL0A 3MLRH 1DJSA 4PV9A 1TTGA 4HJSA 4C56A 5JTWA 4L3ED 4F58L 4BW5A 3U6RA 4JCLA 1QR8A 5DA0B 4X50A 4IHJA 5C0RH 1MJJA 2X3BA 4LL1A 4JKNA 1XEQA 4JFXB 3A67H 1M56C 3IFNL 4NPKA 4UAOC 2ZYIA 2DQDL 5CGYD 2MFNA 3NJMA 1N18A 4QHUB 3HZYB 1WAAA 4HZLA 5EFIA 4X9HA 5A6IA 5IWAO 2PF6A 1JXDA 4JFPA 4BFRA 4GX0A 4J6RH 5DVLA 4H7VA 3P4MB 4YBHA 2H3XC 5D7HA 4YQXL 2Q0OC 5I5JA 3GWOA 1YVWA 3QWQB 4I3SH 4B3MB 1Q38A 2L7UA 3NCCB 3ML9A 1YNLH 3BWAA 3CGTA 1RPQA 2Z31B 2HFTA 1B0GB 1HAWA 2FVNA 3ABKB 2CD0A 2CG9X 4QAMB 4DP5X 5L3BA 1HIMH 1O9GA 5DZPA 12E8L 4H0HB 3ZZQA 3U0PA 1I3GL 4IKKA 2RAMA 5DQDL 3T65B 2EE0A 5I1AB 3DMMD 2Y1VA 4LSSH 4P2RA 3PL6A 4JFYA 1H5BB 1LEIA 5J2UA 2QKIC 4U3XA 1FVEB 3BPLC 2AXGA 1IAOB 3H4HA 3NIDB 3GRBA 1HNYA 4XPAL 4YE4L 2YIBA 4P5SA 5BVJA 2J20A 1TJXA 1Q6UA 2WXRA 3QEHB 2JGDA 3S5LB 2XXGA 4I48B 1CFTB 3TYFA 2ATKB 2Y7NA 1CR9L 1SN2A 5HY9A 3V5HA 2NLJC 4K4KA 3OLGA 4AX3A 1QYGH 1MHEA 1UA3A 1T1XB 2JTDA 4MSWC 4NI3A 1E40A 3K1DA 2ZXWC 4PBDA 2H3KA 1AZNA 2ZCZA 1EHNA 3H42H 1U3HB 3LZFH 3DPBA 5BW7A 1IGJB 1H3VA 3KGUA 4HV8B 3OT7A 3TTYA 3DSNA 1X7QB 3FUDA 4OZFH 2DQIL 2FJSA 3C9NB 5T3ZL 4XDLA 1TO4A 4OD2B 5D7EA 4AI8A 4TV9A 5TD4A 5KSAA 4KBPA 2WC7A 3EHBD 4JM2F 5ADPH 3RURA 4YXHH 3ULVE 3G71V 4R7DA 1QABA 4Z7OE 4P5MA 2NY4B 3HRPA 4UB0L 5DO2D 5ERWA 4XPBL 4TNWF 4AY0A 3OTOB 5TE7H 4H0LB 4L3AA 3AU0A 1O9WA 2Q5ZA 3ASOC 2XVGA 4OKVA 4NDMA 1SRYA 4TXVB 2FATH 1IFHL 1OWWA 2E9WA 3AG3C 4PRHE 2VZTA 1ORQA 1BQRA 1YITV 4C56E 4WUKL 1GW6A 2HVKB 4HT1L 4OCLC 3ELQA 3RWCA 2XG4B 3BQVA 4YX2H 2YXVA 3UFIA 3NMEA 4FLTA 1S7XA 3F05A 2X40A 5JOPD 4JPWH 3L70H 3DVNB 4FC3E 5D4JA 2C9UA 3CCHA 3TT3H 5CEZH 5IHUL 5BRZD 1WAAE 1XHXA 2FJFB 3UBXG 5AVQB 2GSIB 5IFHL 3E1ZA 3GIVB 1K3IA 4GT0A 5D9SB 1CT8B 3OF6D 4GKSB 2IPTL 2JK5B 2O6DA 2YXMA 3E9TA 1ID5I 1MF2L 2FEDD 2OZ4A 3SDDB 1YDXA 3RNKB 2MCPH 3SKOB 1QPPA 4FYRA 1ONQA 3KPSB 3A23A 4BWTA 1VENA 4PJAF 1U2YA 4NUMA 2AJZB 5GISL 4Z7NF 2AJ3B 4NEHB 3L7EB 1GGYA 3P30A 2J1KA 2BSRB 5KW9L 1AGEB 3KXFB 4FQLL 4AH2B 2EDFA 4XPFL 3QQ3A 4Z1PA 1I85C 3AROA 5CU9A 1N0XH 2VE6A 3LNDA 4ECNA 2XETA 4M61B 4OZGE 1INQA 3BUYB 3PP3K 4NXSA 2WQAA 2JQMA 4LGSB 4UANA 4P2RE 3EXJA 2BNRA 4BK8A 4JFSA 4TSBL 3UMNA 4XXWA 3FT0A 1ORSA 1KY7A 5E2VH 4FFYH 4F24A 3QUXA 1Z5WA 2BOCA 4BZYA 2WIIB 5JIHA 4O00A 2VZSA 5BMVA 1MFMA 2WVTA 2XN9B 2EIKB 2ATPB 4IGGA 4ZTPH 1EPFA 2XWTA 4P06A 5B7FA 4H2CA 5TJWK 1RK0B 2R83A 4PSPA 4YGAB 4D94A 4LR3A 2P8LA 1IBLO 1BYOA 1T0NA 2ED6A 3HPLB 2CQVA 4P4RA 4H8QA 2WSKA 3CLEH 2IH8A 4NO5B 4HK3N 5FO7A 1GN2A 4D9LL 1T5XA 3RI5F 3U7AA 3O2VL 3FO2B 4MAUH 4KTYA 3RVTC 1IGIH 5F96L 3SE9L 3WMSA 5KYNA 2F23A 2GUOA 4GKJO 4AHCA 1RI8A 1OAXL 4RFNB 2VO5A 4RAVB 4XVSH 5T3XE 2V3DA 2FSEA 3HC3L 5IE9A 3WS6A 5C70A 1OGAD 1HZHH 1YEJL 1XQ4A 2A7WA 1WLEA 3DV6B 5E4IA 1KB9F 3QR1A 5FKPA 3SBWA 3GPSA 3V0JA 5BZBA 1F42A 5I6KA 1T89C 4BEIA 5HVWA 2E7CA 1ET8A 4FMFA 3RYIB 4HHAB 1AQDA 2FCBA 2Q6AA 4A2MA 1R1CA 4PJIF 2QBWA 2AXFA 2K45A 3GS0A 1G94A 1RSFA 2EZOA 5SWSB 1C7TA 2XWXA 4G2AA 3U1QA 4HS3B 1UD6A 4O4HA 2EO1A 3BKMH 3G6DL 3ULUH 2KLSA 4OVVA 2X53A 3NZHH 5T1LD 4YDLC 4Z3IA 3D48R 3VXNB 2F4VB 2OR8A 3TM6A 1PNLA 4B7EA 4YDNA 2Z4QA 4AIXA 1TA8A 1YEGH 2IOIA 2QM8A 3T0EB 1GJWA 3SOTA 3AM8A 4KY2A 3GJEA 4KXZH 1F58H 2HH0L 2IGFL 1L7TL 5AKSA 1GSKA 2A0LA 1HOEA 4U1IA 1T2JA 3VU2A 3SBWC 3S3XA 1MQ8A 5CBAB 2AEPH 5B1AB 5DJ8A 5FO8B 3DI2B 1JYWA 2MTPA 1IO4C 2PP7A 3GSUA 4FQPA 4ZI7A 3RGVA 4QHPA 1H2KA 1JFQL 1PNDA 2F5AL 2WWNA 3H7BA 4G1MB 4M00A 1AGDA 2BS9A 4DKAA 2D2CC 1KXTA 2AHYA 2BJML 1TZHA 4IRSA 3CZJA 4IU2A 2OIEA 1E9OA 3L5WA 2LFGA 3UG3A 2ED9A 1A6AA 3UZEC 2BINA 2NUTB 2KZWA 4XWGH 1TZGH 2WQXA 1J10A 3WDJA 3SGJC 4LLAA 1WPXA 3EXAA 1GPOL 1O7SA 1U8QB 4CVXB 2HVJB 2R0LH 4JFOA 3TO4A 4M7KH 4E9QA 4S1RH 2LJ2A 1I8IA 3GDCA 4R8WH 2UZIH 1HEZB 3JWDC 1A4AA 1B0RB 4YDIL 2IIJA 3QDJA 5IYDO 3WGUB 4IK6A 4Z77B 4OFDA 5DHEA 1GMEA 4OAWA 5IVNA 4Y4KD 1WG3A 5EO1B 1FKAO 3RGVC 4L2LA 1EN6A 3V2AR 3BRGC 3MRNB 1DUYA 5KVFH 1FJ1B 2FO4A 4CC6A 2P5EA 3TEYA 3ABLB 5I82A 1QR4A 4MTGA 5JIPA 3QULA 2DJMA 2VC2B 3T2LA 3VGHA 1NH6A 3BGFC 4YNYB 3TNMB 4YLBA 1H3PL 1EWHA 1YEDA 5GIRB 3ZMRA 2WKOA 1NUNB 1MREH 4FNPA 4X4KA 5EA0H 1Q6HA 1T1ZA 2W07B 4KQ3L 4XTRC 3ECBB 4PDMA 4AKPA 2VZOA 1KYFA 1LYQA 1Q81W 2PTMA 1XCWA 3ABGA 4FFVD 1N7ML 5DRNB 4MXWH 4FTVA 1A6WL 2ARJQ 2CE6A 2WQWA 4Z7VA 1KJ2L 2QT6A 2NY1D 3SBRA 1NEPA 3KPRD 2FO1A 3G5YA 4O4YH 3K5LA 3RWDA 5LCVL 1NGXA 2R4RH 4HIXL 3K72B 1MCNA 3Q2NA 3OKNB 3T8VA 3NP3A 4WI3A 3RPIA 2ZUYA 1KGIA 5KUKA 3EYOA 4MJIB 3S4SA 4FLSA 4M6AA 4PJ9B 3ZR5A 1UVQB 2X4UA 4ZDHA 3UJTH 1XMOO 5E9AA 4L8BB 2D3NA 1SEBB 1NDMA 3HBZA 3ZSSA 2NXZD 3NVQA 3WIIH 4GI6A 1NANH 2OAAA 1PPJH 1I1AD 4UIMB 3INUL 2V7NA 2W81C 2QV2A 4HIEB 5HYJA 5JW4M 2QWNB 3QJUB 3SY0A 3WTUA 4X5PA 3FU5A 2YAPA 1NL0L 1ZLUH 4JANB 2ZWYA 3RL1A 1TSHA 2MNUA 4MASA 4XNMB 5GS0H 1J5EB 1VFBB 5F97E 4PPTA 4EB6A 1I8AA 5GGSY 2XPGB 1NCBH 1IE5A 1DLHB 3NJXA 2LE9A 1O7DC 1CXIA 1CFQA 1MZZA 4NPYB 3QARA 2EUVA 3CXHK 1NPNA 2HAZA 2PXYA 3QIWD 4GLRH 4HJGB 5ID0A 3JVGA 4AXWA 2VIRA 2HFFA 4LCUA 1EZLA 2J25A 3G5ZA 2CGOA 4X5QA 2MQ3A 6PCYA 4XBFA 3OAZK 3EF4A 1J5IA 1QSFA 4R4FL 4K0KB 3MUGB 1EIBA 5E4OA 3F64A 3CZNA 2E74C 4ZUWB 3BSHA 3MLXL 1UM4H 2JS5A 2OCCC 2NQDA 1EO8L 1D9KA 4OT1H 4RMWA 1W72A 3IMRA 2A6JA 2J72A 3QDJE 3A24A 3GXFA 1ES0B 4UVCA 1OAQH 5ALBL 1MG2C 5HGDB 4M6NL 2Q6WB 3GEFA 2G9KA 3WB2A 2RNBA 1QA9A 2PO6C 3NCXA 3O9WC 4C55A 5IBLD 2CJ3A 1XL6A 4R3SA 2Q2LA 3UCSC 1V3LA 5EZJB 4BA0A 1L0LH 4U7NA 1OSEA 3JV6B 1CG9A 4I1RA 3QQNA 4FQIH 3JTSB 1FIEA 3K5RA 4XBGB 5T1DH 2P4KA 2P5EE 3KEHA 4DN3L 4UV7H 4XBPB 3EJZC 2WXFA 2CO6A 3FYIB 2D4FA 3DMMB 1S7QA 3TBVB 5IMOB 5DEDA 4X65O 3JSNA 1JGEB 2WN3A 4HDIB 5GRVL 1Z3GL 1MCRA 5K1VA 2L7QA 3NQKA 1AVAA 5E4EB 1HNWB 5DJ2A 3TIDA 1FVDA 4WUUA 3TVMD 3HC2A 3VXOA 5I6OA 1EFXD 3NJIA 5FO2A 2YD9A 1XF3A 3OMIB 1XNRB 2AVFA 2YN5A 2R72A 1TQBC 1DBBL 5JORB 3ZYJA 4TUUA 4FTVE 2OMXB 3D85A 3JAMN 2N7BA 43CAB 3N2KA 3ZSTA 1RVFL 1TQCC 1Y1UA 1AD9B 1GRJA 1Q0XL 2DLGA 2HWZL 4TRPH 4OV5A 1YZZA 1M57B 4KJYB 4ODVH 1V55B 2UUCO 1T6WA 1OHQA 3FB5B 5CLXA 2VW6A 1DBJL 1D7DA 2W9EH 2XKNA 4WHYG 3UZQA 2WQUA 3LH9A 3OJDB 4QAWA 2VITA 4FIPC 1Q7YW 1ZTXH 3D25A 4PJFB 5EBMA 1OF2B 2K4AA 5HHVL 1V3JA 3B2UC 4EF3A 3WTVA 3WIFA 3NQIA 4FLRA 2QPUA 3LDDA 2WINA 5CB4A 3EHBB 2MWCA 2Z8RA 1FNLA 2ZUQC 3O0RH 3BFWA 1WDAA 4R97B 1DFXA 5C0BB 3RTQA 1RZJC 2Q7EA 1AS6A 3KYNA 4XNYH 5DRZA 5IK3A 5IHZB 1ASPA 3D2UD 4BHUI 5I8KH 3NK3A 2VXQL 4QGYA 1NC4A 5KS9F 3VXUD 4X1YA 1A2YA 2QVMA 3UTTB 3VXQB 3W7SA 4BSVB 1G9NL 1TVKB 1VACB 3EYQD 1MPAH 3KWWA 3E8VA 4C54A 2ZE8A 5D6DC 4YPJA 4Y5YA 4ZMWA 5KSVA 3ETTA 2OQJB 2FWSA 1JPEA 4MD4A 4F5CA 3M1BB 3EOTH 1WTLA 4X8XA 4AQ8C 1U8KA 1YECH 4M8RA 5CEXB 3R8BB 1VF6A 3QAZB 3MRJB 2DLFH 4JDTH 2PPFA 1HZKA 3LSUA 1UM5H 2OXGB 4KUZH 4MXVF 4KZCA 1ZJBA 2BY2A 4PRDB 4J39A 4LHJB 2VDMB 1MAMH 1DQKA 2GVYA 4P4KD 3BJLA 3CFCL 5A43C 4XMTA 3TFKD 4QXWA 1W6LA 4AI7A 2BOBA 3BH4A 4PGBB 4OLXL 4IYKA 4L4TA 3J7AU 2CXGA 2KG7B 1N59A 2V8MA 2XG5B 5H4ZA 5EF1A 3MOBL 4PA4A 1MUJB 2HTKC 2ZXGA 4OX9O 2BP8B 4OI8A 2JI1A 3OAYK 3UO3A 4PB0L 3OV6A 1M7IA 5IWLC 4J1UB 1MJUL 3CFJB 2LGWA 3BQUC 3MGOB 2E86A 3IU4L 1DCEA 1XOUA 4M93B 3Q2LA 3CZKA 3TO2B 4YHKL 1FCGA 1MZFA 1GGBH 1KMGA 2X0LA 1VPOH 2VDNH 5FHAH 5AAMA 3TIEA 4JYAO 3NJGA 3JYBA 2O4EA 5J3HD 1A7PL 3BKYH 1OOWA 3EOBB 4ENEC 3OPZH 2CNYA 2XZZA 3NOIA 2QGEA 5I1CH 3ZTJG 2A77L 5B38B 4NKDA 5LXVA 3A4DA 3STBA 3CD4A 3VGEA 2NMSA 2XTJD 2XTLA 3GGWB 5EU7E 1MFBL 3D05A 2OJZH 4JFFD 5HHOD 4WUUE 1ZT7A 3UEZA 2EIMB 2UXNA 1KB9J 1SF5A 1JZEA 4NNXA 4P46B 2CK0H 5BQDA 1KYOF 1RULH 3D07A 3MV8D 2XICA 5FYJD 3IAYA 1CLYH 2B39A 5AW5B 4RESB 1JJOA 3AXHA 2HYMA 2PWDA 2VQUA 2YRZA 4JZJB 5D1QC 2R7EB 1T03H 4CN4A 3TS8A 5JQGB 3VW3H 4ZS7H 3MCG1 3O45B 5EG6C 1TUPA 3GTNA 1RZKH 1G9MC 2BY1A 5AALA 3VD5A 3U4EA 4QXTB 4XP6L 2VZUA 4N0CD 4APXB 1PCSA 1IT9L 2AV7B 2DQGL 4Q58C 3IS1X 3K5MA 1LO3H 3QG7H 1BZQK 1NOFA 3BZFA 1IEHA 3N04A 4LF8B 3OAUL 4JGJA 5IVXF 3CJHB 4K9EH 2C9PA 2HLFD 3LMJH 4LOVA 3TBYA 1DN0A 4EQ2A 5DZ9A 1OO2A 1MWAH 1HH9A 1UXWA 3RVVD 1LE5B 1KLUB 4MBOA 5GS2H 3MA7A 3MV7B 4JFDA 2H2SD 3FCSA 4JMNA 5FHBL 5MEPA 1BQZA 3MBWB 2OULB 4XVUD 3CH1B 1PZ2A 1NCWH 2KYIA 1PG7W 1FGNL 1YEEH 2ZR3A 5GGRB 1FF5A 4XO4A 5ANHA 3SBPA 4O2BA 2OL3A 3Q44A 3U4AA 3X17A 5JO5A 2D0HA 4WV1B 1AKPA 3MPCA 1QHQA 3BLPX 5K9OA 2J2ZB 5LWYL 1SDDB 2BHZA 4FLXA 2C7UA 3VGBA 1T0MB 1OGTA 3L9BA 1YEHH 4ACTA 3BD4A 5LBGA 1N8OE 4F5CE 3TV3L 4M62L 2N7SA 5EOQH 4CSPA 3C09C 4OI7A 4Y5VB 1E4XL 3BSZL 3QPQC 4XPTL 1PLGL 3WEOA 1CPYA 1LEGA 2B0SH 4IIQA 3ZTEA 5I6XB 4LSTH 3ARUA 2CRMA 2ZXEB 1FL5B 2Y4SA 2HFGH 2ARWA 4IRZL 5BMFH 1UQSB 2DMHA 3ZN6A 3M8OL 2XX1A 2ADJA 2ITCB 2YAOA 3H6JA 4RGOH 2XHNA 2O72A 1IM3D 4OU3A 3VI3B 5F7FA 1MCJA 2E0PA 4GG6B 4HS6A 3FT3B 1UCBH 1YN6A 4I3RH 1J1XH 1R0AH 2DTML 2OIGA 1NKOA 1SUJA 5DVMA 5ELIA 2N59A 3MR9A 5C6PB 5DC2A 1ERNA 1JHTB 4DEUA 4WRLA 2YKLL 2CAKA 4ISVA 1TYEB 1NWOA 2JVUA 4E0RB 5I0XA 4O4JB 5BVPH 2HSIA 4PRIB 2PMZA 1LK3H 3L72H 1WEJL 2HJLB 3BPOC 2BSSA 3RIFK 2DYPB 1PX3A 2ENQA 4NKIH 3Q5OA 2XTSA 5KUMA 3C5ZA 1TEYA 4Q9BA 3OR7A 4X98A 4UTAA 5JW5B 1W91A 1AQKL 4POZD 5FOBB 4LOFA 3UAAA 5AB2A 4MYPA 1SYVA 2VERN 3QO8A 5E1HB 2VDOH 5I24A 3IVKB 4OQTL 4M02A 3D08A 5FYLD 5JPNB 3LXAA 5D70H 4OIIH 2QPDB 2PY5A 5DZLA 3FQTA 4KK9D 4APQA 2VSMB 4MNHB 5KSBF 2ZWZA 2Y5QA 3ZN1A 5BV7H 3ARFD 2AGAA 2I7SA 5EB9A 2ETWA 4LSQH 5CSZB 2HLDG 3ZCCA 1KFAH 3JWOC 4N0YL 3MQIA 5ESAB 4GMTL 1KU9A 1WBXA 2X0VA 2OSXA 1ETB1 3V8CA 2YR3A 3WTSA 1RSOB 3B9KB 1MDTA 3RFZC 4RWYL 2X09A 4G8IA 4WU5A 1HOCB 2X88A 4LEEA 5DFAA 2QVIA 2XU9A 3P4NB 1KUMA 2QV4A 4NQDD 5IG7B 2OJ1A 2ZKOA 1K5WA 2X9WA 4K2UH 1PFOA 1ED3B 3FTGA 4LRIC 3NJHA 4PBXA 3TONA 2BIHA 2DH2A 4ZMAT 4M7JH 5I18H 2JGUA 2HG5A 4B96A 2BP0A 4ELDA 1RM1C 2QELA 2KT6A 1OQXA 1UGNA 3HKDA 3MRLB 4XB8A 4GUPA 5GRUH 1IM9A 3NIFE 5KANI 1U8IA 4EDXB 1BEXA 3L13A 1EBOA 4DRXB 4LIQE 4RMQA 4WFEE 5J1AB 3C60B 3K2UH 4QO1B 4JFDE 1HE7A 1I7ZA 5KSUA 5I1DA 1U36A 3QWOA 3BW9B 4LVNC 4O2EA 1QUNB 1GTFA 1OCRC 1SF9A 2HUHA 3B2PA 3BEVB 2GY7B 3KPRB 3D69B 2QDWA 4IW4C 5LHHA 2YPVL 3B34A 3UG5A 3E8FA 4AL8L 2WLIB 2IXQA 4V1DD 1WC7B 1BQHG 1KTLB 4KUMA 2CLZA 5CCKH 3DBXA 3WY1A 3NP4A 3KHOA 4BCXA 4KO9A 2IBGA 1WAEA 3CK0H 3QXWA 4XN8A 5D72L 3I02A 1CF1A 1I4FA 3QHZL 2ZPKL 1ENVA 2E6JA 1NTZH 5E8DL 3S34L 2NZ9D 2XVBA 4DXWA 4LPCA 4YDMA 5ECGA 4EN3A 9CGTA 3U2JA 1MI5D 3CDCA 3C6LC 1KBKA 2YBGA 3BP5A 1I1AB 4YHLH 5BO1H 4PY7A 4POUB 2Q86B 2DQEL 4FKHA 1FC1A 3O81A 2A9NH 2VMCA 4JFEE 1CLVA 3B2XA 4JGMA 4NN5C 3UCQA 4D0CB 5E24E 4JY5L 4OW6A 5B22A 1F51A 1DQTA 2ITDB 2NN4A 3QZBA 4Y2DD 4U1LA 3LSSA 5CF3A 2V2WB 4Z9KB 5JHDD 3GMPB 1A6UL 4MD5A 3PHQB 4JRYB 1Q9KA 5E1AB 2EYSB 3TBSA 5D7LA 1KWGA 2LGNA 3WUWG 4AIZA 3JV5A 2A1WH 2Y3NA 4I2XA 5EZIH 5I16B 5K9JL 5IHBA 4LBEC 1Z3RA 1R3KA 1J05B 1NZRA 4I85A 4N9OB 1JWUB 4WU7B 2ZNIA 5DMGC 1FE8H 3P9MB 1DQQB 2OV0A 1CIUA 2VJ0A 4G8EA 1OSZB 3WFCL 3ZL2A 2UY6A 2Z93A 4WNQA 2CDFA 3HEIB 3PWJA 1IE4A 1IFGA 1ZA6A 5IV2B 1OE3A 1FFXA 3UC0L 4H13B 4XE5B 1TTCA 2FGZA 1OD7A 4XAKE 4AEHH 2IH3B 2E7LA 1VQKV 1VFOA 3DXRB 1O75A 2BSTA 3OGOE 2C3HA 3BHBB 4HOMA 1K2DB 3IFOA 1HQ4B 3IDYC 3MVSA 3BYTA 1WPCA 3HRZC 2ED8A 5EUKA 1DJGA 3CXFA 2EUWA 1IVSA 1E5BA 3WE6B 2N1KA 4FFZH 2D4DA 2EXYD 5G2NA 2IMMA 4EIZC 4EEEA 1HDJA 3H1ZA 5KBPA 1I9JH 2FMLA 1GJUA 1KJVA 4EDWL 1NBVH 4UNVA 1YQVL 3UAFA 1XB6A 3QDGB 4LCIL 3AB0C 1FO0B 2Z3FA 3V0VB 4G8FB 4YAQA 3R1GH 1MAKA 4HEPA 1WRFA 1KNOA 4HJUA 4FNRA 3FB8C 1R3KC 4PI2A 5KA5A 3V9FA 3EH1A 4DK5A 4CBPA 1KJ3L 1BQ0A 1T2QL 4YO0A 3DHMA 3EO0A 4XCYB 2H0PA 3AK3A 3C3SA 3W9DA 3PIQA 2OFQA 4YS4A 4L1TA 8CGTA 3ARTA 3QHFL 1MEXL 2R0KL 5F8RC 1P1VA 2PPCA 4OLWH 2WTOA 4JTCB 1KB5H 2WZ6A 2XV6B 4O5LH 2X5PA 4XCEA 1ND0A 5FUOH 2GJ6A 3L54A 5KZCB 2F43G 2HPOA 4WI0A 2YXYA 4PJGB 2GUZB 4ODTL 1AIFA 4TTDC 5C07B 1TT6A 1ZK5A 4OCXH 5KJ4A 2P46B 1PTZA 2C1OA 4LPTA 2VXTH 3ZIMA 1FFOA 1AOZA 5F7WC 2G0KA 3L3KB 4IIZA 5JHAA 3DC0A 2B7DT 1RPRA 1XH1A 2NDFA 5FUCC 2BZ7A 4A67A 4J3BA 4D8OA 4U1MB 4NBZB 3FYEB 4JRXD 1NGYB 5DHDA 5MENB 2DQ0A 3IJ4A 4MCMA 3K0GA 4AGOA 1FAKT 5E1IA 3GMMA 3HE6C 3T0BA 4JJHA 1O5DT 2Y7QA 4PMEA 2LLGA 3U6XA 1HILA 2FWUA 3FCUB 3ZDZF 1WFIA 4FZ8L 3U7WH 3NCJH 2BSKB 4Q6IC 4F2MA 1RUML 5J12B 4OLUH 3VE0B 1NC2A 2YIHA 4KKCC 3EYVA 3NYKA 3VH8G 3QUYB 3C8DA 4LSVL 1AI1H 2GBAA 5AW6B 5AW4B 1S9WB 5MERB 3V7MA 4LOUC 1QU7A 5LDSA 5MP6L 4PP2A 4CH4A 2GPZA 4QRQB 1HHJA 5D7LE 5DWUL 1IC0A 3RAJL 4XN4A 4F8LA 1VQ8V 1QTYT 3OSVA 4I2XE 4X9BA 3CDGB 3T4AA 3S8GB 4I88A 3NRQA 5JHLL 2YAEA 4AZ8B 2A83A 2KHAA 4QMEA 5J9PB 3A8TA 3VFUA 3NIGF 4I3GA 2HG0A 3DX7A 2APFA 2IF7A 4RMSA 5FK9B 4RQQA 1ACXA 1OARH 3OAYH 4PLNC 4ZS6C 1JZGA 1AO7A 4W4KA 1T21B 3PUCA 5F6HI 2VXVL 2GJJA 3FMGH 3QUHA 5K93A 5F72S 4A6YL 3LQMA 2CCWA 1OSPL 3LIZL 2BLFA 2ESVB 4JF3A 3L6FB 3E8BA 1WCBB 3PLYA 4O4LB 2XWJA 2VMFA 3TBTB 2QEXV 4OF3A 6TAAA 3PABB 2WOBA 2QMJA 4DWHA 4TVPE 1JZ7A 1EHKB 4QNPF 1GZQB 3OXSB 4MVMA 5HHXL 2R56L 3E35A 3NRFA 1BZ7B 3ILPA 5DJ0B 3FTVA 2BDNL 4X6BB 5FPOA 4HCFA 3ZTCC 1I1YA 2IH1A 2JKNA 4BZ2L 4XI5D 4FABH 5JQHC 1J8HB 1ZE3H 2CO7A 3VFWB 5B1KA 15C8L 1HS6A 3SPCA 4GBXC 3CVHH 4E9RA 3PWNA 5FKAA 5DR5H 3M7FB 1TPXB 3RIFF 2JKIS 4QXUL 4XCCL 2XTJB 5HJDA 5I0WA 3QTCA 1MNNA 1DQLL 3LSOA 4P0DA 1EHLL 1NFIB 4WTXA 2D7PA 4N2KA 5KBLA 1YI2V 4ZD3H 4BM7A 2Z8SA 3HHRB 1HYSD 2F7PA 1X6NA 2GBTA 2Y22A 3OKYA 4GMSH 4JO1H 3IMBA 2GJ6E 3K74B 4PJ8B 5C7XH 3ZKNC 2DM7A 5KYWA 4GXVH 4DTGL 4P23C 4F92B 3QCTH 4OIBA 2HT3D 2P80D 2UXBB 3WSQH 3LRSA 2B5IB 4G6AD 3GIZL 1IBKO 1EERB 3OXRB 3B9EA 5EN2A 2BTQA 3O6FC 3TXAA 4ELMA 1IC4L 2P7TA 3I9GH 2ICES 1FH5H 4U6YA 4MS2A 5EO9A 1IURA 5LLIC 4PGCB 1DUZA 1FNFA 1JHLL 4P2QA 5GGQL 2HTLD 3WNOA 4DCQB 2R1YA 1LVEA 3I6GA 3Q4HB 3P3TA 4F2ME 1XSJA 2P4AB 5IOPA 4G7YL 4IKIA 5F1OB 4FI8A 1T2XA 3N40F 5FYKD 4ZMPA 2QM4A 3FU7B 2DI9A 4N85A 1R9FA 4E2OA 2VO8A 1WA0X 4N2EA 1BGYH 2X4OA 4LCYB 3T0AA 4JO2H 3SJVA 4QWWD 4F9PC 1LUVA 4MYWB 5DD3H 4LVOB 1JGDB 4PREA 3GSNH 4OLZL 4AMKL 4LDCA 4NZRL 1E4JA 4EEQA 1CFSB 3RDTD 4Z3EA 1DTOA 1NEZB 1MABG 2J8UF 5CEYB 3TBWB 5KMGA 4Q0XL 3FZUD 3VFTA 3K3QA 4IU3A 2M83A 2DWSA 3MBEB 4WHTA 1SJEB 5DI8B 3GRWA 5IQ7L 2Y2WA 5E6SB 3SBQA 4MDJA 1P7KA 3MJWA 2P7TC 4MJHA 3K4AA 2F1EA 3KZ8A 1HXMB 3BH9B 1AO7E 3CXHJ 5T1KD 4GX1A 2V37A 4HC1L 1G7IA 3D7PA 3P02A 2A73B 4QHLB 3DECA 4IBLT 3NESA 2EE3A 1XH3A 3CFTA 1T80A 1E6OH 2AK4D 4RLDA 3VCLA 1CXZB 4AVHA 4G72B 1KCKA 1VGEH 2X7LB 3U36B 1UKTA 5FAAA 4JO8A 1A4KA 4OCRL 5GZNA 4NCC1 4B9CA 3LOWA 3JZ7A 1SQVH 4YSPA 1YPZF 3R06A 1EANA 3MRKB 4OF5A 1OOAA 1R3IH 2KZKA 4BKLA 4BWWA 5DD6A 3CZLA 3EAKA 4UV9A 3C5JA 2XQYG 1G1YA 1RZFH 1NOLA 1PY9A 3C6EA 4ZOLB 4I9WA 3Q1SH 4DK6A 3K79A 1IZKA 1IBHA 1KFGA 2ARJA 1Y6NR 4L29A 1P7HL 3KG5A 4KJQD 4WTWA 2DWDC 3QA3A 4K7PH 3WNPA 5D1XC 4IEFB 3UTQB 2ZCKL 5KHHA 1S7RB 4Y4FD 1BCCH 1G84A 3F7RA 4S0SD 2V17H 3OQ3B 1FNAA 3PCYA 3HKBB 3HZVA 4OCMC 4PJEB 3PNWA 5FB8A 1RZIA 4G9DA 5IMKA 3VQMA 3Q2CA 1HQRA 5CMAB 5GGRY 2E5LB 5CHNA 1IJ9A 3QUZB 3W9EA 1DFBL 1TIUA 3HCVB 3QUML 5CJOL 2UVFA 2CKBL 3L9EA 5C08D 4N68A 3G6AB 3SE8L 4GRLC 2EIZA 1KZYA 4DESA 1J5HA 1SA0B 2AEOA 4TUJA 2AJVL 3ZTNH 1J5CA 3FHAA 3X3GH 1ET5A 3MRCA 2K9FB 3VD4A 1O6TA 3HLKA 4ELME 3IS0X 5KAFZ 4M03A 4FNLH 3QWRD 2H1PH 5EU3B 2VISB 4ZUTA 1H8HG 3TCTA 5JQ6H 3N44F 3KPTA 4P2QE 5LGYA 5A2JH 1L0NH 3L3IB 1BZEA 4JFHE 4GW5B 2NW3A 3GT6A 1BX2A 2GCYB 1S0VA 2F0CA 4WW2A 1JXFA 1XMWA 3D0VB 4HPOL 3VGDA 3T1YB 2EXWD 3K6SB 4CMHC 4K3JH 1DSWA 1L9MA 3SKMB 3SODB 2OMZA 1KBHA 3PGCA 1J9QA 3SJVE 1E90A 4V1DB 4CSSA 5FYKU 1I8KB 4YBLB 1M3IA 3QFJA 3MJ8A 1AILA 1K3ZA 1TENA 1K97A 1CGXA 3BVNB 4DZ8B 3NSDA 4FMKA 2CIIB 1BQLL 2NNCA 3P40A 1K4DB 4WVRA 4F33B 3IM1A 1N33O 2KUTA 1BMWA 2V5YA 1Q94B 1ZSHA 4A37A 2PW1A 3KLKA 2WMPA 2WQRA 5C0AA 2P47B 4TQPA 4LF9O 1P4UA 2MMXA 4QPEA 3V6ZB 4AWJC 2F5BL 3SPVA 1Q1JL 3V4PH 4A55A 2B59A 4G9FB 4PDVA 4I18A 2DI7A 5DHYB 3S5ZA 2ZOOA 3PWVA 1A5FH 2FD6L 4RMRA 3S97C 1XHZA 2OMTB 1XZWA 4Q56A 5SWQB 3WN5B 3TGUH 3K57A 4N23A 3UROR 1T5WA 1FORL 4KKAC 2F8VA 4S0HA 4NWUH 2GBVA 1MLCA 2ZICA 3LKSA 4FG6C 5SX5K 5KYXA 1WE5A 4X1IA 5I66A 5I74B 5DZNA 5CD3B 5DD5H 5CA1A 3PDOA 4FDWA 3DC6A 2VXQA 3N55A 3UTSA 3LNNA 3CHPA 1QRND 5FPRA 1KTRL 2D0FA 5GRWA 1ZL8A 1AR5A 5CBHA 2HLEB 3FQUA 4KP4A 1N3NB 4JAMA 2EDDA 3L9RB 2A38A 4DR5B 3CN1A 4K94C 5D4IA 1JAEA 1WUNT 4EBQH 4CBCA 4JZOB 1BFVH 3B7UX 5DK0A 4KJPC 4KV5E 5JIDA 2IBZH 2KL6A 1E7UA 3S96A 1RUAH 4BZ1L 2QSCL 4YDVA 4K3DL 3PN1A 2JDIG 1M05A 2V2TA 1FRGL 1XR9B 2K3TA 2IOMA 4HOWA 3ATFA 3HKCB 2HRPH 3QR0A 1F90L 4ZAKC 4QRPD 2VW4A 3W2DH 2DKUA 1EAPA 3K03A 3K7UA 4JZNA 4LARL 4PJCA 3ZRFC 2G60H 3O8XD 1BM3H 1SOQA 5K39A 4P5KA 2FK9A 3SDXA 2O57A 1YEIH 1QBLL 4LLUB 3CC7V 3HZ3A 4NO2B 5IW1B 1P4IH 5HFLA 2CJUL 1P5UA 3ENEA 4DEWA 1FLRL 1C8PA 5DEGB 4JM2D 1SLUA 3QFDB 3PWPD 3LKPA 2F7RA 1RP8A 2FB4L 1NCOA 4AW7A 2HJFA 2K3HA 1ZWIA 4KRLB 5DMYA 1X5XA 3AQZA 3GSNB 1UH2A 1F6FB 3HJEA 4NENB 1DVZA 1RJCA 2QVTA 3S2CA 4AE1A 4ALAC 3CC4V 1FXKA 2WM0A 1CDYA 2VR6A 3RU8L 4B3VA 2CZNA 3O6LL 4KKLC 5ISZB 3MLSH 2KLTA 1K8IB 1JVOA 4JI2B 3L74H 4MWFB 3PXJA 3FUFA 3ARXA 3IXAB 1IKNC 5DK3A 1QP1A 3B9AA 5H37H 5HHNA 3CG8A 4D3CH 4F57L 4F7TB 4HWZB 2QQNH 5C1MB 2FUQA 1UB5B 2C9VA 2JI3A 5L3FA 1GCYA 1LQSR 2WV3A 1GYVA 3FJTA 3QFJE 2L7JA 5EEUA 3SYCA 1T1YA 3CCRV 2X1WL 3NCWA 4QRFA 1AXTL 1FIGH 3E6FB 5J11B 4XODA 3MGTA 3CDYA 2C1PA 1FYTB 5MEQB 4H8VA 3CS5A 1PJ9A 2VCOA 5D7JB 1CN4A 4HA1A 2KZ1B 2VLKB 3FSWA 3HMWL 3AAZA 3QW9A 5E6ID 5ANMB 2LU3A 3ULUD 2XKSA 1LJMA 2JJVA 4P5TA 1BBDL 4MQSB 4LSUL 4RRPG 4F7EA 1LD9A 3MODL 1KYUA 3CFKA 3VFOB 5AG8A 3ARGC 4HJ1A 3ULVF 1XGTB 4GG8A 3FB7A 4PJ5D 1CE1L 1QWNA 4BUHA 1QBZA 2EILC 3B2MA 2XAGA 3T6WA 3QI9C 4ZPTB 2YI8A 4LQ1A 2YIAA 4NTYA 4IJ3C 1JOIA 4BELD 2CLVB 1YC8A 1VADB 5GSRB 3RYHB 1BVNT 2P24B 4KMTH 3UTSE 1HHIA 5IROD 2Z35A 3NH7L 3WNMA 4PGEB 2VQFO 1Q9LB 1P84K 1IV8A 4L4VA 3MLWL 3BN3B 5GZOA 3LN4A 3SGDH 2XA3A 4U3JA 4NUJA 5C09A 1JF1B 1RIUL 3KCWA 4MVBD 4NLAA 4Y4HC 5D93C 1AGCA 1QEWB 2VSCA 3KLHC 4DGUA 3ZHUA 3QZWB 5E23A 4LKXA 3QXUA 4J4PA 2X4NB 1ZEAH 4Q2ZB 3BSZA 2XSKA 3V6FA 3DOSB 2GG1A 4XB7A 3FO9A 4L4JA 3QH3A 4F7PB 2JJ1G 3FUIA 4R90H 3V55A 3CSYB 3G08A 4IRZA 5DECA 1E9PA 1OAKL 1R3JB 1MOFA 2JMRA 2Y48A 1WAAF 3N1FC 2Y72A 1UGKA 1BM7A 4JN1H 1KEML 1JTOA 5HGAB 1D3CA 2RBLA 4PRNA 5F9WB 1U8CB 4YDJA 4UUJC 3GS4A 1K9MW 1YEKH 3CTTA 2XHBA 4LVHC 4KKQA 3CQFA 4AEFA 5LP6B 3B4NA 1KPRB 4NIYE 5EIIB 3ARSA 3SDXE 3IJSA 2CH7A 3UBHA 5DJ6A 4ZBJA 3JAKA 2AHIA 1AD0B 3F83A 1XNQB 3DXAB 5D96C 2RN9A 4G8GD 3PHAA 1UD3A 1ZHLB 1JV5A 5DQJA 3D4YA 5GSVB 3TEWA 4DP6X 3VFGH 1KGCE 4P3CH 5AVYB 1AI7A 2EABA 1ZPUA 4X6FB 3S5LG 4XN9A 3OVUB 3HZKB 2N0MA 3OGCB 4EKWA 2QGNA 4FE9A 4OJEH 2VWEC 2BIQA 4W9EC 4XNUH 2VL5B 3ZT7A 5C0IA 5K9KB 2I85A 2DL2A 3O3AB 4F3FB 2AJYL 1CDCA 4X5XB 4PJDB 4PJHE 3VXPA 1GMIA 2OX5B 4JFVA 4RNRA 4AGQA 4R7CA 4TL5A 5KAQF 2CJSA 5FLXN 3GZPA 4ONHB 2X1XR 3KPQB 3IAGC 4ETQA 1AGBA 4GO8A 3ULVH 4XVTH 1J9TA 3C5SA 3HNVL 1ETJA 3GQFA 3PJSA 4M6ML 4ZFOB 5JUEH 3CC1A 2Y69C 3IKCB 1CL7I 4Q9QL 1TTBA 1XCQB 3FRPA 3TA3B 3BWUC 5FR3A 4NZTH 5LN8A 4DR7O 1YNTB 3D39D 4FXGC 2ICWJ 2D3OW 5B3SC 3GTVA 1JFFB 5GGSA 3ESOA 1IXBA 4JAAA 3QDMD 1WBYB 5SX4I 4PIRF 1WP7A 3SO3C 2P45B 4L1BA 5I71C 4BJLA 1NU1H 3CXCU 1WGVA 2A74A 4HXAL 2UXDO 2QADB 1QR1B 1D5RA 5EPMA 2IU0A 4A7QA 1I1RA 2GSGA 2CRIA 2MOVA 5CBEA 2JB5L 4JR9L 4MQ7A 1SY6L 4UOW0 5IQLA 3VG9B 1KENH 3AREA 2VN5A 2JF1A 2MHAA 5DZJA 5IY5B 5E70A 3H9SD 4BK4A 1U8LB 5D71L 3ZE0E 5L8LB 4KX7A 4JPVH 4DIXA 4J3SA 3MV01 1IC7L 2YEVA 1HXYA 1H15B 2LHAA 3IE9A 1QAWA 3FKUS 3O2WH 4KI5E 4AEIL 1XB8A 2E3VA 4L4VE 3UC2A 5ITBH 4MTFA 4PWIA 5B7MA 4O2AB 1A7NL 4FQXD 3G5WA 4XBEH 4NRZA 5C09E 4GIOA 4P2OD 3T2QA 4YLCA 4DV5O 2EECA 3I6SA 3MMEA 4XB3A 5GS0D 4FG0A 1T3FB 1U58A 1VKXA 2Q7YB 3CZUB 2XT9A 1A9EA 4CW1A 3BWUF 4ZPVA 4I7ZB 2APXA 4Y16A 2X4TA 4WI4A 4KX9A 1JPTL 5LGUA 2GIYA 1E28B 5B1BB 4G42B 1CGSL 1M1SA 2VWEE 5I15L 4QE9A 2C26A 4X62B 1QW9A 1ZVHA 5TF1L 4IBUA 4NP4L 2Z91A 1JPFA 5BNXD 4MVUA 4Y1SA 5J8OA 4JVPA 1MSDA 1U92A 2WLNA 2ODHA 4EVNB 4OXSA 1F3JB 1Y0LB 1BLNA 2O26U 2YGOA 3BLBA 1DVFD 1N0LB 4WWKA 4P59H 3CZEA 1LP9B 3LPOA 1UD4A 4Z7QB 1ZA3A 3DIDA 4ADGA 2EDQA 2JJSA 4WO4D 2ZNXA 2D03H 1U8HB 3E86A 5H2BB 2V3EA 4H1LG 5KX5A 1G43A 3BCFA 4G71B 2DWXA 4H8WL 4HJJL 3SQOH 5JZ7D 4WK0B 4UDUB 1B88A 5EC2B 1QO3A 3GM0A 4KRNA 3KDMB 1Z9SA 3NCYP 2I60L 3UJIH 2UXCB 1A47A 4EI5A 3BRFA 1HNXB 4AQZA 3K8MA 4Z5RB 2ZE5A 2DYSC 4MZ2A 3BWZA 1PX4A 5AOMA 4ZTOL 5FM5M 4A7TA 1CFBA 2Q4PA 3BFRA 2Z0UA 1CF8H 4OPAA 5F89A 5T3XH 3W0WD 3DIVA 1MKFA 4QHUA 3WNJA 3ZE2B 3V4UH 4AE0A 1A1OB 3HZYA 3BKCL 3VWJA 1BQUA 2YBRA 1G6RL 3CCEV 1P7QB 3KPOB 3KNBB 4AYID 3D36A 4EI6B 3P4MA 4NQUA 1QW8A 4MLSA 1AE6H 3AUVA 1LILA 4QTHB 2HRHA 2XV3A 4H0GA 3AQXA 2W6IG 1UACH 4J9ZB 5FX3A 3P54A 1NSNL 1IAIL 3UG4A 4YIOA 4FZEL 4CMMB 5HVHB 4JFWA 4KI1A 1NZ6A 3FAVA 3AQDA 1DGSA 5HGBB 3W56A 5CKAA 4FQ1H 3O3BA 2EDBA 4EI5C 3SCMC 2QLYA 1ML0A 5LUMA 4GQ9H 2L4OA 2VDRL 4X6EB 1QD0A 3T65A 5I1AA 1SHMA 5EOTA 4NJ9H 4HUWB 5B8CA 1BREA 4KQ4H 1UT1A 5L6YL 1FVEA 3AT0A 3LX9A 5A2KH 1ICTA 3QISA 1VQMV 1IAOA 3RUGB 3DUUB 3G04B 3FTSA 5E08L 3BAIA 3EH5B 5KG9B 3DETC 2NR6C 3WLBB 5GGVL 1DZBA 1JPSL 3KAAA 3QEHA 3REVA 4R2GC 2B3RA 2W65B 5FUZH 4NM4H 4RMBA 2XVKA 4I48A 4MMXC 3VWKC 1BMFG 4PA9A 2ATKA 2J44A 3ZBMA 5J6HB 3JVFC 2DRUA 5JR1L 4JFQB 2OZ4H 4L3CB 3MAQA 4PB9L 1MCIA 1W0VB 3PHOB 5SX5H 1UD5A 2A9AA 4P9HL 4OLYH 4F20A 5B4MC 3R18A 4XZ4A 4L1DA 3N27A 5DTFB 2AQQA 1IGJA 2F53A 2NX5B 2XV0A 4HV8A 1QWHA 1V7ML 3OEHG 5B1JA 3AWFA 3UYPB 2GAZB 1X7QA 4B41A 4PEEA 3C9NA 5JXED 2OK0L 4OD2A 1GIGH 3VD1A 4PRPB 1EBPA 3EFDH 4R4NC 3N0AA 3S37H 5DJXA 3WKML 4MMZB 5K1XA 3E8HA 1S3KL 1G87A 3WEXB 25C8H 1PCXA 4C4KT 5IZ7A 3HFFA 3U25A 1F00I 3TF7C 1QLRB 2WA3A 5AL8A 4OJFL 1W0WB 1KELH 4FMTA 1NAMB 3S3SA 1JUFB 1F1AA 2Z1PA 4QT5B 1S5IL 1S7WB 4TUOA 2VDKB 4YIQB 3SOBH 3ME0B 5E99L 2W0FC 1I08A 1M56B 1MRFH 2ZCHH 2Q10A 4U4IA 5ICZB 1SMDA 5JOFB 2QTVA 3FD9A 3GXIA 3V4VL 1U6AH 4DV2B 7TAAA 4BIUA 2HVKA 2PYFB 4DR2B 2DBJA 3EJSA 4Z7OB 1HKLL 7FABH 4XPHH 4GX2A 2X3AA 2PWHA 4LF4B 2O6EA 3PAYA 4J3WA 4A6YA 4J8RB 1MCFA 3DVNA 3RL2A 5ETUB 1ODUA 5HBBA 5AOZA 4DF9A 2PF4E 3KJ6L 2OKMA 2BRQA 1X4XA 3O9WD 1S3RA 4KJWC 4LCVA 4X2UA 5BZDB 2GSIA 1IGCL 1M2OA 5D7SH 5E03A 2R15A 3GIVA 3G6JE 3BGAA 1INEH 3PFUA 5D9SA 5JCOA 3MCLH 2LGQA 5E6ZA 4WJ5B 4GKSA 4PRHB 4PV9B 4XDKA 3SQBA 3NSJA 4E9LA 4QRAA 3SDDA 4FLWA 3RNKA 3ZL1A 1FO0L 2BVPB 3EJZD 3SKOA 1A3LH 3HNTH 1F5WA 3KPSA 4LNUB 2R39A 1MJJB 1SJMA 1URIA 3GI8H 3NJLA 2AJZA 3DHJA 2AJ3A 2PCYA 4BZ2A 3F58H 3P11L 2BSRA 1MCEA 3BPLB 3KXFA 5TE4L 4AH2A 3JT2A 3QJOA 3GLZA 4H8UA 4AIOA 1LNQA 5CJQH 3UO1L 3QNEA 1BD2D 4PHXA 4JI4O 5T1JA 3IDIB 1D5ZB 1CC3A 3VXRD 1R6NA 4O02H 4Z7VF 1CZ8H 2N56A 2R9HC 3NIDE 1FA4A 2NLJB 2WIIA 3SHSA 2ZAHA 1QNMA 3WXWH 4KDTA 5GS2D 1PKQB 2XN9A 5CU5A 2Y25A 4AK1A 2VQTA 4X6DF 1JZHA 2ATPA 5JCOC 3AXLB 1P9MC 4MSWB 5EBWA 4KK6C 3KWUA 1RK0A 2ZXWB 4A7SA 4JFZH 1CFVL 3HC0A 2Q76A 3U0PB 3L2MA 4ZXBC 4OZGB 1R6KA 3HPLA 4G28B 5JW3L 3PL6B 2WAMA 2GIMA 4NO5A 1LEIB 5J2UB 5F93C 4G6FD 4O4IB 5CZXC 5J1SC 2QKSA 1VHPA 1EZSA 4B60A 3D3VD 4U0QB 1XV8A 3TT1H 2OT5A 5BVJB 2F53E 3HG2A 4RAVA 3T1WA 4PJAB 4ORGA 2XXMB 4PJ5B 4Z7NB 2BSEA 4L8SC 1JX9A 1UXLA 2Z7UA 4WK2B 2EDXA 1ZAGA 3L7FA 2AANA 1YYML 3DV6A 4ODSL 3V5HB 2GJPA 5DDHB 1F1DA 3MRBB 2R8SH 1XDTT 3D30A 1YEFH 4LKCA 1GYAA 1KGXA 2QGCA 5CJ8A 3RYIA 3AG3B 4JX0A 4UM9B 1MCPH 4Y2NA 1FVCB 1F6AB 5SWSA 3KJ4C 1GZHA 3VXMD 3O2DL 4P57B 4L8CB 3S8WA 1YYLL 4HS3A 2F1AA 1A8ZA 2L6LA 3ZHFA 4BH8B 1UYWH 5KHIA 1YMMA 3SEPA 1J95A 3IKKA 5EZOL 3KBHE 3NEXA 1BYNA 5KSAB 3GS7A 1XXDC 3HAEB 3VJ6A 4DV0O 1S9VB 1X7SA 3JV4B 2JFCA 2OMVB 4TOIA 3H9VA 4F8QA 1PLBA 3DROA 3FDWA 1ZTMA 2PWEA 3FK3A 4HCRA 5ERWB 1AC6A 1MVUB 3HOGA 1X5LA 1K5QA 1LWRA 1KEGH 1WITA 4IRJC 2BPBA 1NCNA 1FYJA 4N1HB 4FZ1A 4S0TD 5LGKA 1NJ9B 4A2DA 1UUSA 1NMBH 2O6FA 3BEWA 2FWLB 2EP6A 3ZKQD 5CBAA 1F56A 4JB9L 5FO8A 3FF8A 2IANE 4JQIH 3IPEA 3LKQA 4NERA 3WFBL 1ORQB 1IQWH 4M9PA 2PLTA 4N2BA 4ENED 4ZI8A 1UA6H 4RWUA 4TQFA 4LE8A 4LFBO 1BIIB 1MOEA 3AFLA 3RWCB 3KPSE 4G1MA 2HX9A 1OT2A 1S7XB 2VW7A 3ABMB 1KPUB 5AAWA 1QFWL 2J71A 3KXFE 3FU6A 4PJIB 1KP3A 3DTDA 4QEGA 4DUYO 4NQTA 2NUTA 2BVYA 2V9TA 5D7IF 4LFHG 4B7IA 3R7RA 3BESR 1HTYA 3HHSB 3MBXH 4XR8C 4M1DH 4D9RD 4EKJA 3WXVL 5I1EH 4CVXA 4Q9RL 2HVJA 4ZZFA 1RPOA 4OTXL 5FYJL 4JI3B 4Z95L 1DBAH 1N26A 4M5YL 1BGXL 3FB6C 4OFIA 1WWBX 5D1QD 5DJDB 1ONQB 1HEZA 5D1ZD 2F61A 5BOZG 2L35A 3QBTB 2XN9E 1AJQA 3LEYH 3BPCB 4LCWD 4X7SL 5E00B 4CDGC 3QUMA 1RMFH 4Z77A 1L6ZA 1YRKA 3P0YH 2VE6B 4RGND 5EO1A 2ZKXA 3MJ9A 3MRNA 3TX4A 1PEWA 4IHBA 1IAII 1ORSB 5CJXC 4U1SB 1MW0A 1OLLA 4TOYL 3K6IA 4YNYA 3TNMA 1JDDA 1JF6A 2A6KA 4NNYB 1DL7L 5BMVB 3B7TA 3POCA 5GIRA 4LBAA 3AK2A 4PTTB 1ZSDA 2QSVA 3SY6A 3ECBA 5KBDA 5T5FH 4LF5O 3TK1A 5EMYA 1UWYA 2GT9B 1T0NB 1BW8A 2AKRB 3PGFH 5A6LA 1SESA 1H3TA 3OSKA 1ZGLM 3I3EA 1G7MB 4RCAA 5LG6A 1T5XB 1E3FA 3E3QE 4AQ1C 4RVBA 4YDLB 1DP0A 1QKZL 1W72H 3VXTB 3SE4A 5T33L 4KHPB 2CHDA 2GUOB 5D4HA 3BP6B 2EXTA 5DCCA 5SWSE 2RALA 4XP1L 3KEDA 2FSEB 2EVGA 3O41A 3SGKC 1YMME 3U1SL 1D7BA 4GRMB 2MNJB 4B3TO 4QHKJ 4PJ9A 4X8JA 1G6VK 1U2CA 4CUCA 3LEXB 3SDAC 2AQSA 1X4YA 1I7UB 3FFDA 3BDYL 4S1QL 1SEBA 1KBGH 5KHKA 2GKIA 4JPKL 4X80H 3OC5A 3MLZL 4UIMA 2R2BB 1DDTA 2OSLA 2AXFB 4HKZB 5EIVA 4L9LC 3SKNA 4J80A 4BINA 2RQ6A 1Q82W 2WVUA 4UIKL 4O2FB 4HU2A 1JHKH 4FP8L 4JPQA 2OMNA 4O4HB 3ZHRA 2D2CB 1WISA 3BZDA 2E47A 3QB7C 4JANA 5FM4A 3ARBA 4OJYA 4QHMB 3OB0K 1I9IL 4N2OA 4RBPK 4CL7A 4XE0A 5ITZB 1VFBA 4HSAC 3LNFA 5DJAB 1G9EA 1WWAX 3IDXH 1K9TA 1QI3A 1PP9H 2AITA 2XPGA 2Z4QB 3ARDA 4H5SB 5K1JA 1OPGL 1HR0B 1W2KT 3B1TA 3DX8B 4Z23A 1MN4A 4XP4L 4IOSA 4L3EA 2UZXB 4N90E 3QC5X 5FYLL 3P2TA 1A9VA 2CDEB 2H7WA 3F6IA 1CGWA 1T6VN 3BZ4A 2YAFA 3PAVA 1FFQA 4MJ6A 2VMJA 4KAQH 2KPNA 3ELAT 4XWOC 5E8NB 1TVDA 5FLUA 2VDLB 3MUGA 1SQMA 4ZUWA 1CQYA 2B08A 2UWEA 1QLNA 1MRDL 3NA9H 1ILUA 1NBMG 3RGVB 5IB1B 4HKBA 3N43B 1BFOB 1QLEL 3H7BB 3ABTA 1L3NA 1CDUA 3COOA 1B04A 1TZHB 3BAEL 5ABAA 1ES0A 3L5WB 1TR7A 1WFOA 1G7HB 2ISDA 3VD3A 5EOCL 1S3JA 1JGLH 3LS5L 3MFFA 3M88A 1LEKB 4U6XB 4OD3H 1NIFA 4MTXA 1NUGA 1JD9A 2ZAIA 3JV6A 4ODHL 1F3DH 3WFEL 4JFOB 4MJ4A 3JTSA 4XBGA 1TOXA 3KPLA 5DRXB 3LDCA 4PUBH 4XBPA 3FTZA 3QJRB 3P69A 3DMMA 4K3AA 2NXYB 2DY2A 3LTVA 5KWYC 4R26H 5IMOA 1OAUL 1JGEA 3PP4H 4HDIA 4K55A 2EZPA 2JEXA 4FI7A 1D5NA 3BAAA 4FM1A 4OAWB 4GAAA 1Q0YH 1DE4A 1UWEH 1X9LA 3HUJF 2NR5A 4LU5L 3KLSA 1EXUB 4X9GA 4JI1O 1DUYB 5ACZA 5JORA 2FO4B 1T7VA 1BEYH 4JYCA 4M6OH 4OM1H 1TF4A 43CAA 1JWSB 4U49A 2YAQA 3QDAA 5ESVB 2IV9A 3WOVA 4DK1A 2ZX9A 4FXKC 5EEYA 1JPGB 1ZLEA 3C6LD 1G5GA 1P84J 3O65A 4HW6A 3J7HA 3CFUA 4UVAA 1HSAB 3Q3GA 3FB5A 4KJYA 4KRMB 1QZ1A 4XNQB 2R4SL 4NVPA 4BK5A 2AS5M 3ASWA 4OJAA 5D5MF 3MRRA 5EORL 3PPSA 4J7JA 4DKFH 3OJDA 1EJ6A 1F02I 2DTSA 2F58H 1US6A 1TJMA 3QCVH 4B0MB 1XWVA 5DK2A 3G5YB 1WWWX 3B5TA 1K7DA 3P1VA 4N0UE 5GRZA 2GBOA 5IGXH 4BFOA 3RWDB 3P3PA 5IHZA 1IFRA 1E7VA 3EOAA 3OWEA 2DMXA 4IGBC 1VESA 5C6TL 4LFAB 3ARWA 1GC1L 5C2BH 2PW2B 4X83A 1OGPA 1CDIA 2BNQD 3DSFH 5LMUO 4KVNL 3VXQA 5I0VA 3UKMA 1CTOA 2OM5A 3EYOB 1TVKA 5ABDE 5CLYA 1GTNA 1VACA 2R69L 5B1CA 2X4UB 4ZDHB 1MY5A 1V27A 3IJ7A 4ZW7A 2OQJA 4AUYA 4CC1A 3HR5B 1N64L 3RB7A 4DKEH 3HB3D 3M1BA 1IGML 4AVIA 4J11A 2E74B 1CTNA 1IGFL 2RH0A 5CEXA 4L3EE 2COVD 3MRJA 4DGVH 4P9MH 5I2IB 3IDUA 1AMYA 4UT6L 2HKHL 4PRDA 1KT2B 4XXCC 1QASA 4E5XG 3IFLH 4X7FC 4Q52A 1FZJB 3T6QC 5BRZA 2PO6B 3A6CH 5BZXA 2A6IA 2UWEE 3O9WB 4PGBA 4NN6C 1DBMH 1RP3B 1DJHA 1W0YT 2CBPA 3QRGH 5FM5O 4EB6B 1OCWH 2FHCA 2XG5A 2ZJSL 4XO8A 4LIQH 4ZFZA 1A66A 1MUJA 1S76D 1NCIA 4MDIB 2BP8A 4RRPM 1CFQB 4HUMB 1QHTA 1WHPA 3KHQA 3CFJA 4N2IA 4RDBA 2NSMA 4JKPL 1P1ZB 3UM7A 2OL3H 3HMXL 2YC1B 2Z8WC 4XMKH 32C2B 5DVKA 4LF7O 4PY8J 3EOBA 2HKFH 3KL5A 1BD2B 3UABA 3V6OC 1K5NB 1MCHA 1QFWI 4GAYB 4R96A 4XPGH 5F1KC 2KQNA 1TQBB 3SDYH 5L3CA 4WGVB 5B38A 1W72B 4A68A 2EYRB 2FBJL 3EBAA 1PZ5A 2IWFA 1RFYA 2VXUH 5JQIB 3GFUA 3GI9L 3GGWA 5IW6A 1CLZL 4OFQA 1TQCB 4ZO7A 3U9PH 1K3EA 1UB6B 4ZFQA 2C5DC 3NTCH 2KQMA 1WV7T 1ZS2A 4P46A 4KMQA 5E2UL 2MOQA 2V9RA 4P07A 4AKQA 1YZBA 2IV8A 2EH7L 2ZDIA 4JZJA 4BXVA 2R7EA 3HE6D 5JQGA 1J0KA 4RWHA 4YDKH 3IRPX 2BWIA 4KL1A 1Q86W 3LPFA 4QXTA 4YVNA 2ZUQB 3O6MH 4I0PD 3ML8A 2Y1ZA 2DMCA 3BUPA 5DURD 1FVDB 2AV7A 4WUUB 2X9ZA 3DOIA 1ID2A 1XF3B 4WEUD 1A7QL 2YZ1A 2ZZUT 1U8OB 4UTAH 5ESQA 1ZLSL 3H0TA 3CJHA 1OGAA 2WBJD 5H94B 3UPRB 1U97A 3T1HO 1E27B 3O4LD 3U7YH 2HFEC 3ISYA 5J6GA 4LOUD 4DR6B 1LE5A 4YSSA 1KLUA 2K7QA 4KTDL 3D50A 3S3CB 4HD5A 2VDPB 3V95A 4ONFH 3MBWA 4OV5B 3CH1A 5IYCO 3VA2C 3V0HA 2GABA 4F37K 5E8EB 5GGRA 2DQDH 1C9SA 2DQHH 4KKNA 4H33A 2VH5L 3BH8B 2HJKB 2J2ZA 1SDDA 3JCUZ 1SPDA 1T0MA 5C3TA 4BKSC 3WIFB 3S9DB 2CU9A 4A7GA 2WINB 3ETSA 4YLQT 3RVWD 3X3FL 4C47A 3LNHA 3LQAC 1JNLL 4JQVC 4EE2A 4K07A 4U3SB 2WTRB 3QJVB 4NJAH 2V5MA 3BVOA 3RX9A 4QRUB 1FL5A 1NC4B 3NJFA 5JOPE 1A2YB 2PN5A 3US1A 1XTMA 1ADQH 4QRRD 5I9QB 3H4FA 1T1WA 2ITCA 1KTKE 1BT8A 3BQUB 1UXMA 4PM1A 3APCA 4QYOA 3VI3A 3O3EB 3S0PA 5BRZE 1NLBL 1OM3H 1I3GH 4GG6A 4QRBA 4Y5YB 4PN6A 4J3OF 4MD4B 4JM4L 4JE0A 2DQUH 1M5IA 2IMNA 3C08L 3AS2A 3X1EA 3F04A 1GY1A 4N6RB 1WFMA 1JHTA 3S48A 2YQ2A 4M3KB 1DLFH 2VM9A 2HP8A 2AQ2A 2E4TA 3GJFK 4E0RA 4O4JA 1Y67A 1T0OA 2B1HL 3MREB 3IJ9A 3ZTJH 4HWEH 2HJLA 1P4BL 1OCZC 1VQ7V 3O3DB 4FM2A 4HHGA 5GRVK 2FL5A 1G1OA 1IKFH 1NPUA 3J07A 5BY1A 2BOBB 3U82B 2MKWA 5C3LD 2W5PA 4RFEA 3GK8L 5FOBA 3QXTA 1CR9H 2FSDA 3UP6A 3HKFA 3K0YA 3IVKA 4YK4C 3L17A 4Z7WB 5JPNA 2J6WA 2B2XL 2PTTB 3T3MF 3T5WA 1ANUA 5CZVL 4HAMA 2CJTA 3P4LA 1KIUA 5D1QB 4AK2A 5I1HL 5KEZA 1U8PA 1Q90A 3Q48A 2BX5A 4P23D 1H2GA 1AFVL 2GIXA 4MNHA 1BAWA 3ETDA 3E8UH 2TRYA 1IAMA 5I23A 1UEMA 2DQIH 4N8PA 1F3DJ 4L5FL 1SHXA 3CC5A 5DD0L 5CSZA 4HGKC 5ESAA 4BRJA 3PJLA 1CE6B 1RSOA 1E8XA 3B9KA 1FZKA 1JRHI 2O6CA 3KG2A 1KPVB 3JTBA 3KYKH 5SWZB 1HOCA 5EU6B 1L6XA 1FGVL 1T83C 3MZGB 1BBJB 2IPUK 2YPLB 3RWGB 3P4NA 1BECA 4HIJB 4FQJL 2QQKL 1IEAA 4HFUL 1ZT7B 1FCCA 5FEBA 2WPDG 1ED3A 5L8JB 2A6DA 4HISA 5FYKL 5T5NG 3SYAA 1RIHL 1BVLA 2B15A 4NNXB 1WICA 5C8YB 2FX8H 4B08A 4X0NA 1OGAE 2QL1A 5LN4A 3MRLA 2IGTA 4D7BA 5FPIA 3KGSA 2AK1H 2R9RB 1S2EA 4YXKL 5BR8B 4R4BA 3T3PF 4BFJA 1FBIL 1YUHB 1NIBA 3DJTA 2CR0A 3C60A 1HC1A 2O5XL 4QO1A 2OR9L 4YFEA 3S35L 2X2UA 3BW9A 5TQ2H 3BY6A 1UT9A 4L0PB 1B0WA 2QVFB 3BEVA 3C09B 3KPRA 1W8NA 2ROXA 2DQFB 1KCUL 1XGYH 1WCQA 4HWBL 4Y4KC 2WLIA 3VX0A 4BFIA 3ZIYA 1HK6A 4DR3B 4HJ0C 2YAHA 5IHUH 4TVPH 2F54D 4PJBB 3MRPB 4DOHE 5IOKA 4GT1A 5HYSG 4J3OH 4TNFA 1TU2B 1RFDH 1N36O 3TBYB 1OAZH 2IPTH 1B2YA 1GN4A 1MF2H 1UXWB 2RQ8A 4WFGD 5B39B 3MLRL 1V3KA 3L2LA 4OSUL 5HYEA 1GJIA 2PR9A 3MA7B 3FCSB 1EHXA 2XY2A 3CE1A 3FTYA 1JMZA 5GISH 1I1AA 5C0RL 5D7KD 3MUUA 3QQXA 3OB0H 4PWKA 4RBPH 4W1TA 4AYDC 4FQLH 2Q86A 2ZD9A 4P48A 5JO5B 5CAYB 4D0CA 3VI3E 4TQEL 3HVNA 4HLEA 5K9OB 2HHHB 2Q8AH 2ZYHA 3F3HA 3OJVC 1N68A 3BPOB 5ICYB 4YL4A 4J6RL 2V2WA 1JG9A 1PL4A 3L4CA 4JRYA 2AJXH 5E1AA 2EYSA 4HUCA 5LOVB 4UBDD 1A0QH 1B4JH 5IYZA 1VZGA 4I3SL 4Z3TA 5I16A 2JNZA 1AP6A 4ZFGL 4B9GA 2XZAH 3TU6A 3VRJB 3EGSA 3QIWA 3I50L 4JFEB 1J05A 1W80A 4WGKA 5D1XD 4BQCA 1JWUA 1D6VH 2OCHA 1HIML 3P9MA 4MQXD 1DQQA 5LA6B 1HHHA 1OSZA 1YN6B 3DHPA 2NXZC 3L3JB 5D2LE 4XRCA 3V4VA 2XBZA 3ETQA 1A14L 3EOYG 3GNMH 2J4WH 4LSSL 3S3PA 3HIZA 4D9LH 2AGJH 5DMJB 3WFDH 3EJQA 4NN7C 1E5AA 1J87A 1TETH 3SE9H 4FLZA 1U42A 2IH3A 1RPKA 4R7NB 3BHBA 3OZLA 5DUPL 1K2DA 3VM7A 2BSSB 1A7OL 4KQ0A 1EDYA 3HC3H 1YO4A 2FECL 4I5BB 4HS8L 4TSAH 3WE6A 3OR7B 1J5OL 1TTFA 3BPNC 4K8RH 2XQBH 1YSOA 4ELMF 2UYLA 2YWYA 2PYED 3HKEB 2H5UA 1E30A 3QDGA 4U1GB 1FO0A 5DUMH 3RLSA 1U33A 3V0VA 2PUSA 1AHWA 3G6BA 1TTRA 2V9QA 3JWNE 3QIWC 3MV9B 3FQTB 3WHE1 1I75A 1O6VA 2XFXA