3SPGA

Inward rectifier potassium channel kir2.2 r186a mutant in complex with pip2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMAAPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 94
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spgA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spgA01
4OXSA 3LUTB 2QTOA 3F7VC 1M57C 4MTOA 2DWDC 4EKWA 3AUWB 4GX0A 4MVZA 3SYCA 4JTAB 3E8HA 3OGCC 3R65A 4HZ3A 4RAIA 4WFGA 4XDLA 1P7BA 2DYSC 3WG7C 2EIMC 3E86A 4MVQA 4LP8A 2X6AA 4R8CA 3GB7C 1V54C 3FB8C 5EK0A 1OCRC 4JTDB 3ABLC 4MVMA 3F5WC 4LCUC 4H37A 4X89A 5IY5C 3LDDA 1M56C 3K0DA 2IH3C 4R6ZA 1QLEC 4TWKA 3ATAA 2EIKC 3IFXA 2EINC 2R9RB 3TETA 1BL8A 1R3LC 3TCUA 3ZRSA 1V55C 3E89A 3LDEA 4GX2A 3AG3C 4LBEC 1U4EA 3E8GA 1K4DC 2KB1A 3AG1C 4J9YB 4WFHA 4PDRA 3SPCA 3SPIA 4RUEA 4P30A 4QNHB 2AHYA 2Q67A 2QKSA 3AGWA 3EFFK 3ABKC 3K0GA 4PDMA 4UUJC 3K04A 3X2QC 3SJQC 4MVOA 3ZJZA 1G4YB 1JVMA 2A9HA 4PA7A 4I9WA 1J95A 3K08A 2ITCC 2WLIB 3FB7C 5B1BC 1XL6A 1R3JC 3E8FA 3PJSK 1OCCC 3LDCA 4H33A 1U4FA 3ATDA 2E4FA 4MVUA 2ITDC 2NLJC 3KG2A 4PDLA 4WFEA 3SPJA 2HVKC 3BEHA 2WLHA 4MTFA 3OUSA 3HPLC 1OCOC 3RBZA 4MW8A 4P9OA 4XDJA 1R3IC 4ZBMA 4XDKA 3T4ZA 2GIXA 2EIJC 2HVJC 4DXWA 5J9PC 5EC1C 4PDVA 3UKMA 2WLMA 2A0LA 4RUFA 4WFFA 3T4DA 2H8PC 4RO2A 4MVSA 5EBLC 3ATEA 3F7YC 2ATKC 3AT8A 3SPHA 2AHZA 2IH1C 3SPGA 2A79B 4QE7A 2JK5C 5BZBA 3K6NA 1LNQA 2WLNA 4PA3A 2Y69C 3SYQA 2Q68A 4CBCA 5CBGA 1ZWIC 4PA6A 2Q69A 3RVYA 3RW0A 1N9PA 4HYOA 2BOCC 4MVRA 3VOUA 3FB6C 5KUKA 1S5HC 2ZD9A 5CBHA 4KFMA 4PA4A 2Q6AA 2W0FC 2HJFC 2X6BA 3SYPA 3ASNC 1K4CC 4G28B 4PA9A 4X88A 3ASOC 3T2MA 2OCCC 3JYCA 3K03A 4GX5A 2P7TC 3IGAC 3OR6C 2X6CA 4R7CA 4F4LA 4MTGA 5EC2C 1R3KC 5EBMC 2BOBC 3FB5C 3OUFA 5E1AC 2EILC 4G27B 1ORQC 3E83A 4MS2A 3ATBA 4BW5A 2WLLA 2YEVA 5CBFA 2HFEC 4MW3A 3SYAA 3E8BA 3LNMB 3OR7C 4J9ZB 3ATFA 5KUMA 4P2ZA 3VSQA 5B3SC 3ABMC 2ZXWC 2K1EA 3T1CA 4P9PA 4R50A 1KKDA 2DWEC 1XL4A 3K06A 2WLIA 3AT9A 3SYOA 2WLLB 3AG2C 5EBWC 1OCZC 4MSWC 4QE9A 2WLJA 3UM7A 2DYRC 3STLC 2WLKA 4JTCB 3RVZA 2HG5C 4GX1A 5B1AC 4X8AA 3STZC 3AG4C
chains in the Genus database with same CATH superfamily
2ZOKB 3ZN6A 4LHUD 1N4CA 2DYPA 3MJ9L 5C0BB 3ISWA 1BVLA 3UADA 2NY1D 2K8QA 4LDOB 1OAZH 3ESPA 1NFDE 3QDHA 4KHXL 4MJIB 2R8SL 1XEDA 1SUHA 2XWTA 2M83A 1E5YA 3MJ7B 3EJRA 1I7FA 5H94A 3GRGA 1MJ8L 3NJGA 5JDSA 5AEAA 2W0FA 3KPSE 3BIBX 5HY9A 5D7SL 5DD0H 1K85A 3DX8B 4OZ4B 2L4OA 3IKCB 1A6ZB 1KPRB 1WA0X 1GCYA 2BVEA 5EZOL 2YD2A 2HFGL 3NJKA 1SYVB 4I2XE 5F1NB 1HZHL 4NQQA 3HW7A 3C3TA 4YHOL 2A83B 2X88A 1D6EB 3VGAC 4HXAL 2R1XB 5E8NB 1OB1A 1GK9A 3FO0L 2ORBH 5TE4L 3EOTL 2FEDC 2KZBA 4NUGH 2NW2A 4GFXA 4PN6A 4F9PA 1YUKB 1A1MA 4JG0L 4K2UH 1J9TA 3B6SB 5DEGA 4LFCB 4L1TA 4BKSC 4ZNCD 1QBMH 3FZUC 5CZXD 4DOHB 4F58L 2Q73A 2Q76A 3OWRA 1SDDB 1TCRB 2Z7ZA 3OLEA 2RB8A 1AI6A 4OH2A 1URFA 5DHEA 5EUKA 3VH8A 4QRFA 3ZE2E 2CGYA 3L1GA 3GO1H 4Q7DA 4BKLA 1JMXA 4Q74A 2WBWB 2X4RA 3LH2L 5KTEL 1G43A 2FJFB 1AVAA 1FGNL 4HKBA 3LEXA 2PP9A 2P5OA 5F44A 4PLJC 3QQ9C 4X2UA 3FB6C 4JZNA 2ZD9A 1JWMA 2FT7A 3QUZD 3SE3C 2YIAA 2WUCL 4R0LC 4TUKH 5FPOA 3WB1A 4H5SB 5AOMA 5C0CA 5BVPL 2LAGB 3OAAG 2DBLL 2JJVA 1HHGA 4Y89A 4FI7A 3LSOB 4LCCA 4HV8A 5GGTH 1G1KA 5FECB 4JV5B 1P0SE 3DXAB 1XIWD 4FFTA 1S9VB 4JAAA 4QLWA 3K5SA 4W1TA 1OLZA 4KXDA 4L0YA 2ZSVB 3OG4B 2G2RA 1S77D 4PTTB 3IFLL 3JV5A 3I50L 4FZ8L 4XMLL 3EAKA 1TA8A 4PJ7E 5C6WH 2VL5A 5EZYA 3VYOA 3OLGA 3QI9C 1SVZA 2JJSA 4EMZA 2BMKA 5SWZA 2X89D 4NWUH 4ZO6A 5DQ9B 4KMLB 1KN2H 5HHNA 2FNBA 3T4YA 2YZ8A 3GMQA 1OO2A 3CZFB 1S5JA 4OUOA 2ARJB 2NY3C 3PG2A 4C4KT 3ARBB 3M1BA 1TEFA 1OT1A 2MOVA 4GIPD 1TYRA 2UUBO 1DVFB 3D39E 3AG4C 1ZA6B 4D94A 1I1RA 1U8IB 3V4UL 3HG3A 4NAMA 4OGAC 4QOKE 5ESQB 4R7DB 4HOZA 1GZPB 4FI8A 1D5XB 2YGVA 5A1AA 1XSOA 4NI6A 3KR3H 5T3ZD 4DV4O 4WU5B 5HHXL 4QIRA 5KS9E 3WENA 4E9QA 1U8QA 4Z1MG 1GXEA 3KJ6L 3HOGA 4ZFGL 3BJ91 2HPTA 3V9FA 4U1LA 2EACA 3V5HA 3X3GL 3D36A 3X11B 2ICEC 3KPMA 4HAFA 3H2QA 3LQAC 5EO1B 1DR9A 2YN5A 3QUXC 2BVPA 2HLFC 4X6CA 2H2SD 2L7QA 1OZUA 3NPZB 2YWZA 2XXGA 4L3CB 1SQQH 2ZX7A 4P30A 2XG4B 3DVGA 3GXFA 4FQQA 3ZN0A 2GSIB 3GBNH 5LYJA 3N1QC 2J6EA 5T1DH 4HJGA 3TO4B 3X2QC 5EA0H 2BSCA 2NT0A 5D2NA 2CU9A 3V4LA 3ARTA 3MYJA 2BZ7A 3WN5B 5KVGH 3VQWA 5IEHA 3TZVC 3JAWB 4QT5A 2P42B 2X3BA 2XVBA 4FQXB 3W11D 4YX2L 3VW3L 1JZIA 2CLZB 3GB7A 3E6HB 3E0GA 1MY7A 1EXHA 5KA6A 2EDTA 1IVTA 4FLYA 3VO0A 5EF0A 4A67A 1O9VA 1MY5A 3FPYA 5E23A 1MCIA 4NUJB 1KPVB 2XYCA 4GQPH 3RGVD 4NGHL 5LO7A 1F4WH 4F91B 4PGDA 4U4BA 3DIDA 1YECL 5DS2A 4XC3L 4F7CA 5C9KA 3LJ3A 1DE4B 5FW8A 4ZKIA 3P3UA 4YXKH 4PBXA 2YXVA 1AIFB 5C0CD 5EU7E 1M56B 2MNUA 2X4PB 4Z76A 4LWSA 1MW3A 4XCCL 1YNTB 4NPJA 4MA3B 4R5VA 1FL5B 1NBVL 3FQWA 1IGTA 1E8ZA 5SX5H 1N2RB 2KDYA 3GBEA 4WLCA 4Z3EA 1CIUA 4B7KA 2NXYC 5FUZH 5JA8B 1YITV 1KEMH 2D4FA 4WW1B 1OTSC 4Z7VB 1SXCA 1UGNA 3GKWH 3CUPB 1GA2A 4ICXA 4N68A 5J1SC 4Q6IB 3DX7B 3T65A 2P45B 3LKPA 4U6XA 3HR5A 1MRDL 2R4SH 2XWBB 3EO9L 3QG6B 1NH2D 3EYUL 4OTXL 4PWKA 5SWZD 4JB9H 3UO8B 4CH3A 1C5CH 2B4CC 5B3NA 1MHCB 5F6HJ 4NO0A 3GBDA 4RGNE 1AQHA 1EHLL 2V1DA 2TRYA 4O58H 4AC2A 2K7PA 3HKBA 1ONQA 2K3TA 3IAQA 5DJDB 5HHME 7CGTA 2DQHH 3ATFA 4WKZA 4H8VA 4QKTA 3OKNA 3D87B 3LN5B 2OZ4H 5LQBL 3OKOB 1OHQA 1AS8A 4OJCA 5EFIA 5I1CL 1P7QB 3SD2A 1LLAA 4OI8A 4PRHD 1I7TA 4FNQA 4FTVA 1QFHA 5HJDA 2H32A 2LU4A 4FKHA 1SESA 2CR3A 3DK2A 1FRGH 4IOFC 2DQDL 1W0VB 2A9MH 4P3CL 3BUPA 2EKJA 5HDBE 4ISVA 1PBYA 4OXSA 1IC7L 1ZV2A 3PJSA 3KBHE 5I73C 1CI5A 4YIPA 2OXHB 4IGBA 2Y2WA 5E2TL 2YI9A 3QDJB 3UABA 3DGEA 4R90H 4ABVA 2KZWA 3WO4C 3ROLB 2G60H 3T2NL 5C0AE 4QXGL 2ARJQ 3HPJA 5H37H 4BSWA 3NCYP 4M9PA 2IXQB 2WXNA 2LGNA 3JWOL 3KPRB 4L3EB 1CDGA 1HNXO 3WMSA 1CL7I 3C8HA 3GJFH 4OBRA 3PQYD 4YJ3A 4LSUL 4NQCA 1V55C 1H3PH 4RVBA 2P6JA 2NY6B 2WQUA 5CSZA 4E41A 3FAVA 3A6OA 5IHUH 1FH5H 1LD9A 1G5AA 2AJZB 3C6SB 1WT5C 3GHBL 2QSAA 3L3DA 2J5WA 3FHEA 1WGOA 4ZBJA 1BE3H 1PNKA 5ESVB 4EI5A 5CB4A 4ZW5A 1S7TA 3H3KA 4L4JA 3TT1H 3SJAC 3Q44A 1U3ZA 2OL3L 2GJRA 1USZA 1J95A 3FCTB 5EEWA 3I56V 3N43F 4AYBA 5BMFL 4NPYB 4GCZA 3CDGA 1OP3K 5MP6L 4G82A 3RVUC 1S0VA 1WF5A 1N34B 4GKSA 4MVUA 3O41B 3SPJA 1GOFA 1XZWA 2QVKA 1B6UA 3GMMA 3BIKB 3T2PA 5FCUL 3OM3B 1AS7A 3RY6C 5EF2A 1N32B 4E9TA 4ZMXA 1UUNA 4AG4L 1HE7A 1ZKAA 3ARZA 1WUZA 5IM7A 1UEYA 4FMTA 5L88H 4NERA 1UM4L 4W68A 2YKKA 4OLXH 5KBMA 1QSFA 1I94O 3HB3C 5IHWA 4DR4B 1KCKA 1T66C 2XFGB 4MQ7B 1VQ4V 1FZMA 2CUMA 3QNZB 2FX9H 2ZPKH 1Z9MA 2UX6A 4LAJH 1NOAA 1R75A 5HGAB 2YAHA 1CDCA 1USQA 4NO0D 3LEYH 2JKIS 1I1YA 4NO3A 3VTMA 4XPBH 2XTJB 1NGWB 3AS1A 3OKLA 2HT3D 3MRNA 1S7RB 1QG3A 3U10A 2YQ3A 2BO0A 3FUEA 4KJQD 1G9MH 3CPLA 4UF7C 1BIIA 2WKLA 2JE8A 3IBOA 4LGSB 4PBVC 1H3GA 4O9HL 5EORL 1WWWX 4FTVD 3D0VB 1KTLA 4G9FE 1HXYB 3QQNA 3U4KA 3L70H 1T20B 4Y7OC 4L3AA 2QFPA 2WLLA 3N2KA 1I9IH 4FQLH 3SDAB 3EBIA 1CGWA 2LVEA 2ZYIA 1U3HB 3L75H 3CH1B 3PHSA 5B21A 4IGBD 3K6OA 2ZJSL 4PJ0Z 4HPYH 1IKFH 3C6LB 2DMKA 2IAMB 3QDMB 4PI2A 1OM9A 3FFCE 5CEZL 1C7SA 3IPEA 4A7QA 3ULUD 1FIGH 5J2TA 4PRPE 5E1HB 5DYOB 4WO4B 1K4CA 3WUWB 1O7DE 1JD9A 2XBTA 3PWUB 1VFBB 4IT5A 4JM2C 4LVEA 4M6OL 5E5UB 4NQCD 1YEGH 2OR9H 2JTYA 4FQCL 1VQMV 1VQ5V 3MBWB 3EGSA 2QTOA 3OW2U 1RHFA 3AEIA 5BY1A 5EG6C 4HSQA 5DZLA 4I0CC 4Z1PA 4OAWB 3BVXA 4EI5D 4PUBH 1JZ6A 1WP8A 2QM8A 1F45A 2OSXA 2D7PA 5F0MB 4TLUA 2G9HB 2DOCA 4DV7O 2D4DA 4Y4KC 4Y2LA 1HEJC 2DWEA 2Q6WA 4CSPA 1E9QA 1UKSA 3VQXA 4FCHA 4U6VL 1YEKH 1DBJH 3OJVC 4ODWB 2B9AA 2GTZB 4X7SL 1E3FA 3EFFK 5GRWA 3ET9F 1HN1A 2CCWA 4PMFA 4HCRL 4XPFL 1JXGA 2EDQA 3OJDA 2CO6A 2DKMA 4PS8A 2O5YL 4GEJA 3NTCH 3K8MA 4J3OH 3WE6B 4NDMB 2IPTL 4I7ZB 2P5WB 3S3DB 3L13A 2BY3A 3EIFA 4Y8AA 2FVNA 1UD2A 2ENQA 4KVPA 4CBPA 5IOPA 3C5SB 5FPIA 2QPUA 3L73H 4AE1A 1KECA 4A7GF 1JD7A 3P4NA 1G1OA 3NJFA 1MELA 4KOCA 3VFTB 2OXGA 1GRWA 5J3HC 1AJ7H 1K8IA 5F7HA 4OV5B 3G5VB 3S3XA 1ACYL 4NP4L 3FN0H 2PYEB 1E4WL 1RK0B 4FFZL 1G6RL 4QHLA 5T5FL 3ZO0A 3E6FB 3ALWA 4BDVB 4A2FA 3K5LA 4RFNC 2YPLA 3LDBB 2V3EA 4ORGA 5F7EL 3F7YC 5JIMA 5JLZA 4W81A 2J5LC 1X7QB 5I8KH 1K6QL 2Y0PA 2FATL 4NENA 3OJMB 5C07D 1L7IL 1WBZA 2VLJE 3RVYA 3QIBC 3VRJA 4O02L 5L4JA 4J42A 2YC0A 4KXBA 1KBHA 3KYNB 5CJXC 1XF4B 2A6DA 3D8CA 1AYOA 1N0NA 5JYLA 5AKSA 1S7VB 4OCWL 4WZ9A 4RX4A 5E5RB 3OR6C 2FDBP 4TVUA 3OPUA 4E9YA 3KPSA 5FYKL 4JFEB 2BOBC 5D9SA 1BS3A 4OCLC 5ACZA 5FO7B 3FH7A 2HP8A 1T6WA 4NQVB 3DJRA 4NCC2 4Y16A 1RK1B 2PW1B 2AKRB 4I2XA 3VXMB 4M56A 1DSWA 2JJ1G 3BEWB 1A3RH 1IGYA 2ZCLH 3MRMB 3MREB 1A2YB 1AYRA 5LHIA 3GS4A 4Q89A 2BS8A 2OYQA 4E4EA 3TBTA 3B9DA 2MQCA 1OAZL 3UTQB 4DQOH 1T1YA 1TENA 3HC0A 3CQPA 4K5NA 2VE6A 1KPUA 1YNLH 2A9DA 5D5MA 3LXUX 2VZOA 3CMAV 4G9DA 5JXEC 2SODB 3AB0B 3PL6C 1IC5H 3DPBA 2FUTA 1NDTA 5DD0L 2X4QA 1NBYB 4E9XA 1JV5A 1T7XA 2BK8A 1HNGA 1IGJB 1OCRC 3QUYA 5D6CA 2QWQB 3F5WC 4WW2A 4P2QE 5H6QA 2YIBA 2Z0UA 3QYCA 3JVFC 2K9FB 2KDGA 5AVVB 5DEDA 1AXIB 3R19A 3UTTA 3MOBH 1IBBA 5DGQA 3LZQA 2LW7A 4MAYD 1QPKA 3WIHA 1YAZA 5FGBA 2H7WA 3ORJA 3KEHA 3VB8A 4B95C 4JN2B 4C8XA 2EDJA 1T22A 4HUNB 1NGXB 4NUGL 1AP2B 3ARUA 3NAAL 3FCUB 1RIUH 3I9AA 1P4RA 4FXGC 5IB3A 1QZ1A 1I8LC 3IRCA 5L8LB 4JM0A 4K2UL 1Z5LA 2AEQL 3HZMB 3VXNB 3QO8A 3VYNA 1IC0A 3DO7B 1CTNA 1QBML 1TJMA 4ZX4A 2YPLD 4FYTA 3B2EE 5JW4M 1KTKE 3WUZA 1MIMH 3ZDYB 4Z7UE 4JAVA 3BEHA 3EO0B 2IH3A 1ZS8B 3GO1L 4OZHF 2WTRA 3CIAA 5IVNA 3RP1A 3VQMA 1NEZB 3OGCB 2NSXA 2XWZA 4U1NB 4UIMA 1T6BX 3QB7C 5FM5O 1XMEB 2E7BA 1A3LH 1LHZA 3QFJE 4M1CD 3T6WA 4XN7A 4YDVA 2PF6A 5CGMA 2AXJA 1R5WA 5CNHA 5C0JA 3D39A 1JTOA 3KPSD 2FH8A 3BP6A 5AOKA 4QOKA 4IRSC 5A2IH 3ETDA 1LO3H 4AZUA 1E4XI 2R2BB 4WWKC 5H2BB 4ZAKB 3PHOB 1VQ9V 5GGTL 5E9NA 2YO3A 5GHWH 1PNMA 2BOCC 2BP3A 5A2QN 2ICES 2QWRB 1V8HA 3LQMA 4WUUB 3QO7A 2UY6A 3TO2B 1MZYA 2NYYC 2X6UA 3MRKA 1EJOH 1KDJA 3VNZA 35C8H 5KYWB 1Y74B 5HHOD 5E8PA 3N2GA 1JSYA 4H13B 4PJHE 1CF1A 1ZT4A 1TTRA 4NWUL 1YG9A 5A2FA 1KN2L 4GXFA 3LXBA 5DDHB 5J6HB 4H0HB 3FU9A 4JFQA 2P49B 3IXAA 4MTXA 4MYPA 3SCMB 1DEEA 4JKLA 4MJ5B 1EO8H 1JZ2A 2EE0A 1AZUA 4P5MB 1JNHA 4WTXA 3RWFA 2P8LA 3QUYD 4QI3A 3U2SB 3KR3L 4P2RB 2YIBD 4DVRH 3FUFA 4JO4L 3UTTD 3STBA 5FKAB 4CC5A 2OQJB 2VDQH 4IEFB 5KLVH 5AVZB 2P4KA 5LMUO 1NCOA 4MAZA 4HZ3A 4X5QA 3T8MA 4ONOA 1MCKA 3T1YO 2EDLA 1AQKH 1UXWA 4EI0A 1FL3A 1YCSA 1ESOA 5FK9A 4MS8C 1W0JG 1JDCA 5T1DL 3GWKC 1E2ZA 1KCSH 1KIRA 1FAFA 5A9GA 1T80A 4HGWB 5EA0L 4FK5C 2WNXA 4QHNB 4F6RA 5KVGL 4XNXH 3HG0A 2O26U 4AQEB 2N04A 3R66A 5I0DA 2DM7A 3BESR 5DZOA 3ES6A 1ZLEA 4HWEH 3DGDA 2JEUA 1P6AB 3F04A 4X6DF 3U25A 3OR7B 1A4JB 3HKCA 3P0YH 3CRQA 3PIQA 4BXSV 1EDQA 4Z3HA 3ZKNC 5HVHC 3HBZA 3I6KA 1S3RA 1AQDB 2V2WB 5FYLE 3H9SB 1H15A 3MGOA 5E6YA 2A73A 4Y9GA 3P9LA 4KTYA 3L1EA 5IIEA 3E8FA 4YXKL 3D39D 2YD6A 1JIBA 2Y7MA 2OX5B 2MPVA 4J5VA 3MHHC 1KG0B 4IMLA 3A6BH 1CL7H 4LF5O 1FHNA 1CFBA 1UB6B 3T4ZA 1JOIA 4BSJA 2XWEA 5DO8A 5DJ8B 5FUZL 1KEML 3AWGA 1BP3B 3DIFB 2IPUK 4C4UA 4GO8A 3GKWL 1OSYA 1SNRA 2W9LA 3N04A 1H6UA 3V4PH 4NC2B 1L9RA 3WFHB 2R4SL 1HX0A 1SA0A 1VF5C 4JB9L 1C5CL 3H1JH 2G5BB 2WN2A 1R3JA 1KJVB 1Z7JA 4LLWB 2W1NA 1M2VA 4MRBA 4FG4A 3EOAB 4W6YB 2E46A 4O58L 1J1XL 1S7WA 2W9DH 3MODH 4FQXC 5IMOB 2DQHL 1HHJB 1RHHB 2ICWJ 5CMUA 3D8MA 1P84K 3VX0A 5ITFA 4NO5A 2OTUB 3G6AA 3D0LB 3HC4H 2DJMA 4DR3O 2VM9A 2OZ4L 5DEFA 2P43B 1JXFA 3S34H 3T77B 5CZKA 2OK0H 2CDEA 4I18C 4PY7A 2DKUA 2FEJA 4DR1B 2PTMA 1WWCA 4I1NB 1FRGL 4UNTA 2FL5A 4L1LA 2YQBA 2IALA 1G7LA 1U8PA 4KQ4H 4OD2A 3BY6A 1CC3A 1EZVY 1X4YA 1P84F 1BFOB 1A5FL 1ZHLA 25C8H 2K3HA 2MH4A 2ZXWC 3O81A 3MA9H 3EFOB 4GW4A 2YQ2A 3GLEA 4HJJH 1E9OA 4R90L 1N5YH 1QBAA 5F7BA 1S6NA 1BD2A 2E76C 2G60L 4KTGA 2BWIA 4JASA 1JGEB 3WAKA 2CIIB 4ZOBA 5AZUA 3IFPB 3L5IA 3D1MC 4BBWA 1KIPA 1RFDH 3O0RH 4J8RA 4CVXB 4NNXB 2Z35A 5IMKB 5TE7H 1A21A 2NZ9D 1HCVA 5CHNB 1UXMA 1IM9B 1H3PL 1OKEA 1S5HB 3AUWB 3KDMA 5D93B 5IB2A 4MJID 5ERWB 3MCLH 4UOJA 5IHUL 1KELL 3D6GA 1CD0A 5DMKA 1FH5L 4NKOB 4P5TB 1AAJA 1VQ7V 1KWGA 4MDJA 1EO7A 1SMAA 3H4HA 4RMTA 5DJCB 1IIIA 3VVVA 3L4YA 1R3KB 2F7RA 1F4AA 3TT1L 3UH8A 4O4JA 2YMXH 4FVMA 1PD1A 2IF7A 2F1EA 1EBOA 5HHMD 5HPOA 1OT2A 3Q5YA 4HC1A 1S8DB 4RRPA 4AHCA 1QCEA 3OHXC 5LGUA 4M6AA 4ZZKA 3NSXA 4QRUA 4AUUA 2A74B 1BYNA 1KJMA 1P5VB 2H5UA 4I3GA 2QM4A 1GTOA 4KHTH 4NQDB 5JOPD 1PF3A 2DD8H 1I8IA 3MI6A 3FQRB 3GZOA 3NGBB 1MG1A 2YKLH 3VRLE 4RGMC 1YN6A 5L88L 1CDJA 4D0BB 4GKJO 3FK3A 4YBQC 2ZUQC 4LCUA 5TGBA 2BP8A 5DA4A 2FX9L 2ZPKL 2BSBA 2YQGA 3PWPB 2HN7A 4X20A 1KCRH 3FCBA 1MZFA 4MZIA 4EVNB 2D7MA 3CVHA 1OV9A 3LEYL 1WAPA 4IDLA 1QRKA 4JGMA 4PRPA 2OMYA 2VXQA 5AUMB 5KBNC 2IANA 4XPBL 3PDOA 2J1ZA 2DW5A 3WHE1 3DX2A 2NW3B 4IIJA 1X5AA 3ESOA 1CZ8H 2VLRA 2C3HA 1KYAA 4QGTA 1G9ML 4FXLA 3BWUC 4BZ1H 4H8PA 1XF3B 2P48B 1FORH 3WO3B 5DJ0A 1EFRG 2NXZB 2VWEC 1HNYA 4L9LB 3LVTA 4PGCA 4FYSA 3Q8FA 3PABB 4PREA 4AQ8C 2GTWA 4FQQB 4YLCA 2Z0AA 1SLVA 2FSEA 3N6YA 4LLDA 4YHKH 3GQFA 2QWNB 4FYRA 5LYJB 2CJSA 4XXWA 1GS7A 2EYTA 1MCNA 2IVFC 1DVZA 2PCXA 1I9IL 1MHPH 2WOBA 3NJHA 4FQLL 4JQXA 5ACMA 3TF4A 3WL9B 2I9TA 2XN1A 3RYMA 3W82A 2G9KA 3ILEA 1WCBA 5HHPB 2PNDA 3DXAD 4HPYL 3QQ4B 2YK1H 1IKFL 5C0RL 1BD2D 4P4RB 4PY8J 5EBMC 4Z7OB 5J9PA 4DR2B 5JOFB 1AD0A 3WTTA 1QACA 2B39A 1SY6H 1FIGL 2COVD 2ITDB 3N42B 3X1NA 2APSA 3FONB 2NR5A 3FCSA 1AHWA 1IAOA 2VLME 4BZ2L 1W8EA 1MFVA 1PZAA 2ADGB 2OR9L 3ARFC 2CO7B 1HS6A 3E8UH 4KBPA 2ENSA 3V0EA 5GJSH 2CMRH 2FQGA 3CCEV 2QPSA 5CIPA 5E95B 5GIRA 4APQB 4JDZA 3GMPB 1DLHB 2ATKB 3AMLA 5F88A 4PUBL 2FTKA 4JI6B 2YRPA 5D72H 5I1JH 4HFWA 4MD5B 1Q86W 5DZAA 5EN2B 8FABA 1QI5A 2QKIA 3MTRA 1VQ6V 3TN0A 1LWJA 3VI4F 3KCPA 5C7ZA 5DUBA 3GMLB 3MOQA 1YEKL 1DBJL 2BVQA 1ASQA 2HFEA 3AT0A 5CGYC 3T8XB 3MA7A 1YVLA 3MKGA 4NQEE 5CILH 2C4XA 2QQLH 3BP4A 5IVZB 2GBTA 3NTCL 3SDXA 4NUPA 3TEUA 5FO9B 1JVOA 4KKAD 4Q8BA 4PTUB 3O9OA 1WAAA 4J3XA 1EAOA 2WQ8A 4ZO9A 5DC4B 1CXEA 2EXWD 5ISZB 3TO4D 4W9GC 3GNMH 1MFEL 5F89A 2ZCHH 1ZJBA 3ZDZE 4FAAB 2XT9A 3GSRB 3NJXA 2XHBA 1XNQO 4PRPD 4WO4C 3CE1A 1YJNV 1GH7A 3RYCB 1AJ7L 2A4CA 2IAND 2IJJA 3FN0L 3ERXA 3QRBA 1T1ZA 12E8H 2VLRD 1BQHA 3B2PA 3DUSA 2HHHB 2Z7YA 3I74A 2ALWA 5EU6E 3DI2B 4LSQH 3ZXAC 5L3CA 5HI3D 5JIIA 4TQFA 3QIUC 2DYSB 5IFAH 4QYAA 3GS0A 3RPBA 4R96B 4CKVX 1BOGA 3IE9A 4KK6C 1G94A 3FB8B 3SOBH 4GUOA 1MWAB 1IGCH 4B7IA 1MFDH 3FU6A 4FEIA 3QZMA 4DPCX 3UEZA 2XJKA 2Z31B 1TIUA 3LQAH 4EAEA 1QHQA 1T1WB 1UQSB 1KLGA 1I8AA 4MCZB 4MSWB 3L3OC 2AMGA 4AZ8B 4UAOB 1SLUA 3IT8D 3GTVA 3FTZA 1GMGA 1A22B 1K5QA 4W6XB 3D33A 2OMXA 1NDMB 2EDRA 1A3RL 2R83A 2ZCLL 3RI5K 3CEIA 1CGUA 5F7KC 2E56A 3G08B 2EE2A 5EIIG 1PQZA 4DV1O 4Q2ZB 4BH8B 4DQOL 1BHBA 5I8EB 1OCWH 1JYVA 5CWSB 1YNLL 4I48B 3SYAA 5L3FA 4MQXC 1P7QD 4TLKA 5I71C 2KERA 4KKZA 5KSAC 1IC5L 2EIJB 4IOIA 2LFRA 2VZUA 1W72A 1FO0H 3KVQA 3NP4A 5AB1A 1SGKA 1KJ2A 2ZX5A 4DZBB 2X7LA 2OCFD 5A40E 2Z5UA 2HJFA 3MV9B 2EP6A 3SDCA 2HFFA 4HIHA 2WLJA 2YPVL 5I1KH 1C5DA 4JUSA 5BR8B 1A9EB 4KXRA 4GYBA 1DQQB 3VXUB 3QDJD 4YAQB 3W7SA 4LF6B 5SV3A 3MU3A 3M8AA 2OMZA 4FMKA 4OFYA 3QFJA 3S35H 2IDFA 2CBQA 3LMJH 3MOBL 4M8QA 4M62H 4JYYA 2MCG1 5JH7B 3PFUA 1UXSA 3DBXA 3KPRD 4RNRA 5F0LB 2A1WH 2RCVA 3PJNA 3E8VA 2F1MA 3CZJA 1ASOA 1M42A 1RIUL 2B4CH 4DO5A 3SO5A 1FFNB 4GRLC 2AVFA 4JPWL 1IE5A 1OW0A 3CV5A 2YSTA 5CKAA 6CGTA 4QRQA 4Z0BH 5CF3A 1R5IA 5IUSA 3WEXA 3KLHC 1D2DA 3C5XA 1MIML 4G8GE 4LEXH 4M4RA 1QZNA 4QXTB 5EOQH 5C71A 1W16A 4PJCE 2F54E 3LN4B 2LW1A 1F90H 5E70A 2AC0A 5F21B 3SJVB 2XA8H 3NSDA 1HHIB 4PJHA 2F66C 1NGZB 4AYFA 5B4MC 3D85A 1XZ0B 4Y9BA 1A3LL 1BZ7B 4X62O 1U3NA 4JANA 4OJDH 3FTVA 1U4FA 5GRUH 1F1GA 5KVGE 5HFLA 1Y76B 3UCQA 5CEXB 1NCNA 4AENA 3BLPX 5SV4A 2GAZA 2YAMA 1KTBA 5DC2A 4LFHD 3RVWC 3SBQA 1LO3L 3MBEB 2R56L 4LF4O 2XDHA 1MH5B 4LLYB 4Z18A 3CHSA 4U0RC 2BY2A 1ZHKA 3OZ9H 1NGYB 3RZCA 1N18A 2VDOH 3TBYB 1BQ5A 1YEFH 3M86A 5IOKA 2PTVA 3FQTB 5SWSA 3BZFA 4ZIBA 1E67A 4HU2A 2ODMA 5D7JA 2Y3AA 1EJOL 4B3RO 2XTJD 35C8L 3HZYB 5SWQA 2DLEA 3UEQA 3BUBA 4ANKA 4JLRB 4WUKH 1IRAY 1PAMA 2EDHA 1TVKA 4U6TA 2B59B 4GG8A 1YN7B 2PO6C 3SJBC 2HVKA 4G8FA 3V5DA 1LE9B 2FMLA 3FDWA 1K8DB 4CMMA 4X6CF 3DNKA 2IFFH 3OVUB 3KLDA 1EO8L 2OMWB 4P3DA 3QVNA 3FB7B 1VPOH 3US9A 1XB6A 1AE6H 1OLLA 3JCZA 3HRZA 3POCA 4YFLI 4AQ1C 3SDAD 4AMWA 3SPVB 4UOQA 4X7FC 3RWJB 3M99B 1LNUA 2NRDA 1ZXQA 4DVRL 1IQDB 4HIXH 5FA4A 3B34A 3QDMD 3T3MB 4OFYD 5F93C 3GXTA 5ANHA 2KG7B 2OMBA 1XHHA 1BMZA 2VDQL 3NJJA 3EYOB 3PWLA 4PYGA 5D6DA 4P9PA 3FAXA 4H20H 4F37K 1P2CA 3GSNA 4O4HA 2NZ1A 1IBZA 1IZ3A 1CD1A 3H2WA 1FPTH 3DHUA 4F5CE 3MUGB 3ZL4L 3UCRA 1QHPA 4XAWH 1KCSL 3WFEL 2FTAA 1MW2A 4AYDC 2H6PA 4XNXL 1NFDB 1ADQA 1M57C 4H25B 4NI3A 1F4HA 5DK2B 3O3BB 3G80A 1QQDA 2GHWB 1JTTA 4PQXA 5BW7C 1TQVA 2DTMH 4HWEL 2FSDA 1SXZA 1TVDA 3E3QC 3P0YL 4X0KB 3OL2A 1F41A 2P26A 5FB8B 1RVFH 2EUVA 3P73A 2Y7NA 3ETBF 4I9QA 3ZRSA 1I7UB 3T2QA 1HSAB 4N25A 4B3SO 2HMID 2DLTA 2Y1AA 1XR9A 4M1DH 1GKEA 3DX3A 2MQ0A 2OTWB 4YHIA 2HVBA 2WXKA 4FLTA 1CL7L 2AQSA 3A6BL 2ZE7A 2DF3A 4AC4A 1NUGA 3LRHA 4Z3JA 2DWDA 2BVOB 2WQRA 2PUSA 4MB1A 1M9NA 3E22B 4PJGE 3VMPA 1YIJV 3P30A 1K9MW 2G4EA 2ZSWB 1V3KA 3PJSK 3LDCA 2AI0H 1CT8B 5SWSD 4DV0O 4FIPC 2XACC 4U1MA 3G6JF 5D7JD 4YS4A 4XMXA 4WJKB 1GGCH 4ODHH 3G9AB 2PYED 5CZXC 2R7EB 5I6XB 4EKXA 4DV3B 3L3GA 3NK4A 4MCMA 4YE0A 5DJZB 3H55A 1GGYA 2XN9E 3K1KC 5DJ2B 4DGVH 1RZGB 4HLZG 3OT7A 1JN6B 1RM1C 3WD5H 3RT3C 4WAFA 4F9LA 1I9EA 4WF9V 1EERB 2W9DL 3MODL 1ZUQA 3Q9PA 3HC4L 3QUZC 5JHDE 1BQRA 2BHZA 1VENA 3ULUF 3MDJA 5KAFZ 2ED8A 1ZWIC 3D9AL 2NZIA 3S34L 1PZUB 3QXVA 2OK0L 2AJXH 4K7FB 1JBJA 4W9ZA 2WMPA 3QQDA 5FYLD 4AOFA 4CZZA 4YHHO 1BVZA 4A5UB 1F97A 5C0GA 1M6OA 1CYGA 4LCWD 4B60A 4Z78B 5J12B 1XIWC 3JBG7 5CAYB 3K79A 1N8ZA 4KQ4L 3GSOB 4A66A 4EBQL 5B3JF 1J5OL 4QAMB 3EJJX 5DZ9A 4XHJD 3MA9L 3RKPA 3K80A 4PGBA 3D5OF 1N5YL 3OPZH 3BH4A 4PJ7B 2H3OA 2XASA 1OTTC 1MREH 3HPLB 4OKDA 1OD9A 3QUMA 4HJ1A 3ZZSA 1W0WA 1RZIB 3ZMTA 4ODUA 4Z0XA 5JMOC 1DGSA 1M53A 3CFNA 1RFDL 1YEWA 3D18B 2JLLA 3O0RL 1C8PA 3NSFA 1LM8V 5LAPA 5TE7L 3QJUB 1QLFA 2BCCH 3N06B 4F7MB 3LKOA 2CO2A 2EIBA 2OM5A 3MCLL 3NACH 3MKKA 5IYDO 3ZLQC 1PCXA 2F15A 4H1LB 5DCCA 4LLVA 2V2TA 1KFAH 3J7AU 4X8GA 5AW2B 3PNRB 5C0DA 2RQ8A 4TV9A 3NJVA 2W5PA 1KMIZ 4NCDA 5DO2C 5KS9B 2YMXL 4FG6D 2DM2A 2FB5A 3K5OA 4RZCA 1E28B 1LK3H 3IRPX 4DFIA 1T4KA 2V0AA 3UAAA 5E9AA 1U91A 1NCWL 2EO7A 4JO1H 4PGJA 1F86A 4X64O 4PRBA 5E6SB 3ZUNC 2MSPA 2H2SC 4XH2A 3CPWU 2PLTA 3CXHJ 1AHMA 1XT5A 2K9UA 1H2GA 4KHTL 4ZYKB 3NRPA 4F9PC 2VDRH 2Z8RA 1M4KA 1FLTX 2E74C 2GIMA 2N0KA 2YKLL 2OMNA 2D03H 5DVLA 2I60H 1FI8C 2IPUG 2HT4D 32C2A 5DSCB 3IJ9A 2NY5C 2I07A 4O4IB 4L3FA 3W11C 1S5LZ 4E9VA 1A7RH 4PRAA 1KCRL 3DXRB 1I5YA 5CBEB 1A1OA 5KSUA 3NEEA 3V0FA 3GMRB 2ZUTA 2ERJB 1OE3A 3NK3A 3PFQA 3WB2A 4HSCX 2GCYB 2LU7A 3W2DH 4AGLA 3BUYA 1CZ8L 2BINA 1I1FA 1N36B 3KG2A 1JV2A 2ADIA 2JKXA 2XPZA 3AMKA 4W9EC 3CBJB 4BZ1L 1ZL8B 3VMNA 1FORL 3QH3A 2X05A 3B2VH 4X1KA 4LBEA 3RTQA 1TPXB 2WK2A 1EEZB 3DDFA 5J89A 1JZ7A 2PYLA 4LCCC 4OLYH 4HZAA 4YHKL 3HAEA 1DUYA 1IX2A 1MHPL 4NWTH 5JVDA 4ZW3A 3AT8A 4F6RB 3QNEA 3SPGA 4OLWH 2YLHA 4QRBA 3IKKA 2DQTH 4ZHQB 4BFNA 1KY7A 2YK1L 4DERA 5F3HA 4L4TE 5EDSA 2P24A 1SY6L 1WLEA 1K3EA 4LPUA 2O5ZH 1FNGA 1FNFA 2B3RA 5DMJB 2EVJA 2WAMA 1Q3EA 2J25A 4GRWF 1RZ8A 4RGNB 5DK0B 4FA8A 2LU3A 1G7HB 3A4FA 3RL1B 3JT2A 3LKNB 3E8UL 4XMVA 1KBVA 1YA5A 4NQTA 1U92A 5GJSL 1OOWA 1RFYA 2NQCA 3QAQA 2JH2A 1ND0A 4NNYB 1RURH 2CDFA 3IU3A 4U3SA 4TV3A 3SCMD 4MS2A 4YDMA 3FF8A 5D72L 2IFGA 1PGRB 5TQ2H 4X5XB 3RFZA 1I1AA 1XHXA 2D2CC 2D73A 2NY4B 5IQNA 1S2EA 2CTRA 3D36C 4TTDD 1X7SA 3PWNA 4JQIA 2H8PB 3MGAA 3DRQA 4L9LC 5EU6A 5HDBB 4CS2A 2YEVB 2GTSA 1PFOA 3RHWK 3OQRA 3C6EA 5CILL 2Q8VA 4IJ3B 2B1GA 4J1UB 2N74A 3MX0B 4R4BB 5C0AB 2W95A 1BFTA 2BIIA 2ZOLB 3U30C 3FX7A 2BVTA 1UZ8A 5DRZA 3WS3B 3ZTJG 2F0CA 3ELAT 3LZLA 3FJTA 4AMKH 3GNML 4OF3A 1ZLZA 4LP8A 1QPPA 3GB7C 5KG9B 2ZCHL 1S72V 1AZRA 4L8SA 2CHDA 3I9IA 3MRBB 1L0YA 4LEBA 2IPKB 4AGNA 2Y5QA 3HJ0A 1NWPA 3O0LA 5HYJE 1OP3H 3MDSA 3HS9A 1ZIAA 2P67A 3O2VL 1WUNT 3A23A 3TVMB 2Q7NA 12E8L 3JTSB 1F18A 4B9CA 4D3CH 1J0YA 3GHEH 3BKMH 3T0XA 3MCYA 4RUEA 3ZHTA 1XMWA 5FX3A 3SEPA 2FL5B 4GW5A 3PHQA 1WC7A 3P3TA 4HQQH 4LHUG 5I5IA 1GN4A 3K04A 1EBAA 1QUNA 1DQKA 1KMGA 1LP9E 4U1SB 3ETGA 4LIQH 2CGNA 4G11A 5DC0A 1KSRA 3KW8A 4X6BB 5IFAL 4LK4A 2WBJB 5T1MA 5ADPH 5ICYB 3OX8B 3C08H 5EBWB 1OCZB 2FYVA 3SOBL 1A6PA 1IGCL 1MFDL 3CRRA 3P2DA 4MMXA 4JHBA 3ETBJ 3B4NA 5DGRA 1MVFA 3F7VB 4E9SA 3LQAL 4BA8A 5D70H 1HKFA 2BNUA 2BNQE 3U6XS 2EEAA 1K2DA 2QSQA 2WCPA 5D5MF 1G0YR 4YH6A 4HOMA 2HTKD 5CN2A 4GH7B 3RX5A 3L72H 5BS0B 3PGDB 5DS8A 4B50A 4K5MA 3BRFA 2E7MA 3SQOH 4GNKB 2HT3C 2E4TA 4QXVA 1B4RA 1JG9A 2HX9A 2A0LD 2ZXDA 3IDJA 4KV5E 1OGAE 1MCFA 3L9DA 5B5EZ 4JDVB 3G5YB 4LBAA 1OY3B 4M02A 3FBKA 4XBGA 1QQCA 1OCWL 1JPTH 3UP1A 5C0IA 3B9VA 4G7QB 1TQCC 2Y25A 1B9KA 4G9FB 1A6TA 3F83A 2YRBA 4ZOLB 1SS3A 1AXTH 4GAGL 5EU6D 5I66B 3TA3A 1FO0L 3APCA 5JO5A 4DH2A 4G8GA 4IGBC 2VO5A 4NRYA 1YYMH 3QR0A 4PJCA 4UCTA 4UTAA 2E5LB 1J5IA 3GIZH 3IDUA 3SGJA 1TETH 2E27H 3RA7H 4QRRE 5I1KL 4R7LA 2PCPA 3FFCB 5BV7B 3ULUC 5FDWB 3TYFA 1GRJA 3DTDA 1N6QL 4G6AD 1KLFB 3S35L 2J44A 1DYZA 1SOQA 3LMJL 3LSQA 4GAYA 4OM1H 3OD4A 1INQB 4LOVA 5C97A 3O6FA 3L95B 4IMKA 4MSWC 2A1WL 3MO1A 1BM7A 2YEZB 1IM9D 2XVGA 3QSKB 4P9MH 3US0A 2B4CL 1Z3RA 3A47A 3QCTH 4M3HA 4K8XA 1PY9A 5B1BC 5KA5A 1I85A 1JWUB 1PMYA 4EI5C 4WHCA 1J5CA 4EI6A 1YXBA 4XGZA 4JKMA 4H26A 4Z0BL 5GS1B 4XDLA 4K73A 3UZVB 1YUHB 3BISA 1HSBA 4FXKB 3PHAA 4LEXL 5EOQL 5JW5B 2BC4A 4ZJ9A 1F90L 4K5LA 1BECA 3MTXA 4TS6A 1E5BA 2XA8L 3U0WL 5A16A 2OA9A 3MFFA 4W93A 3KYAA 2R9RB 3RWCA 3WTXA 2BSSA 1T04B 2KS0A 1MUJA 2QR0A 4G42A 4J27A 3ZHDA 4Y5XA 1IEBA 5ELIA 5HI5C 5LBQA 2DEWX 5E00A 2HH0H 5GRUL 1I7ZB 1P5UA 1XTLA 3H1KH 1RJYA 1DQJA 4DUYO 4NQDD 3SKUD 2GV9A 3ABKC 3NIGF 3P4OA 1BMFG 4CMHB 4UQ2B 3BKCH 1MCPH 1DSYA 1FUNA 1SOKA 3V0VB 1PKXA 4Q6KA 4KK8D 1QR1B 3K72A 1J1PH 1IC1A 4ZMZA 1L9MA 2WGNB 2VDOL 3ETQA 1YEFL 2EEBA 1DVSA 2E75B 4DK1A 4ZPVA 4D0DB 3G5ZB 2W65B 1WA8A 1FXKA 3DLQR 3VG0H 3ZHVA 3WG7B 1LQBC 4JFHE 4WUKL 3H0TB 5DD6A 4YSUA 2NTSP 3F6JA 5D7EA 4F5CA 1V54B 1JCHA 4OIIH 5ETUB 1N34O 2NXZD 3RUGF 1JYXA 2F74A 1WS8A 2ZWYA 1Q1PA 4KZCA 1RSYA 2VLJB 1NTMH 1GGTA 2WXPA 3F12A 5EU4B 1R3LB 1N32O 2IFFL 3VH8G 3VWJA 3P3RA 3HE7A 4BQ9A 1VPOL 1OARH 2EC9T 1TJGH 5KVEH 1J86A 1AE6L 4U1JB 1KXHA 2H9GA 4JI7B 1PFCA 3B56A 4DO6A 4FNRA 4M00A 2PTUA 5I1DA 4ELDA 1JZ8A 4NQXA 1KP2A 3C75A 1NCAH 4C7UA 4K3JL 3OAZK 5CJQH 3TWYA 2QJ1A 1K4CC 3COOA 4HIXL 4QTFA 2JKNA 3GXNA 2VRZA 2ZT9C 3DYMA 1RPQA 4PJFE 2V7NA 1E8YA 4FL4B 3LSSA 2JSFA 4PJEA 3CN3A 2HKHH 1IBKO 2AZ0A 3O6FD 2VAAA 1QFUH 4H20L 4NN6B 3LRKA 4XP1H 5BPPA 2WKOA 2PXYA 2PPEA 3KGRA 1FPTL 1NVPB 4J12A 4Y2DB 3OMNB 3RIFF 2FLMA 2P8PB 4W9CC 5K9OA 4XAWL 1A9VA 5JR1H 1R0AH 3H1IH 4PJGA 1IU1A 1II4E 5IJ0B 3L9RB 2WWKT 3ILPA 4HNAA 4GKNB 5AOIA 4D9QE 4LZKA 1TTGA 5HJBA 3VAEA 2DWEC 2KMWA 4M5TA 2DTML 2B9BA 2ZWLT 4P4KA 1BG9A 3SYOA 4G5ZH 3AG2C 4UVCA 3IJSB 3UM7A 3JASB 1AR1B 1RJZA 1FNEB 4B3MB 2XN9A 5AW3B 3V8CA 3EJUA 5CA1B 1RVFL 3JV6B 3DMMA 2FJGA 2C9QA 4GX0A 2A6JA 1MMMA 2AJ3B 4P2QB 5D1QA 1YYCA 4KROB 1ML0A 4R2GD 2ITFA 4M1DL 3MRGB 5D7HA 2Z65C 5JHDA 3DKHA 5LDUA 2KH2B 3B09A 3WTUA 4YHYC 5ISZD 4ENZA 1U8MA 1NOFA 4JZ2A 3WV0A 3MNWA 3ME0B 3B8MA 2UXDO 1F13A 2JCWA 5BJTA 5J06A 5JPMA 5IR1B 1Q43A 4AILC 2AI0L 3EOBB 3VFRB 3RURA 3S2CA 3GZQA 1W0KG 1PLAA 1HDMA 2FYYA 3MRDA 1GGCL 4ODHL 5FKPB 1SJXA 4IRZA 4DN4H 4OI7A 2OTJV 4DGVL 1KJ2B 4Z7UB 5C8YA 2X7LB 2AK1L 2OSLB 5IQLA 2HFFB 4HIHB 2MKWA 1Y67A 2EDKA 4JKPH 4LGPB 5A2AA 2P5PA 2QDOA 1XGRA 1C5DB 1DP0A 1C7TA 3O6MH 3VWJD 3OUSA 3HE7D 3SD5A 3WU1A 1O0VA 2R0LH 1MAKA 4Z7WF 1CICA 1P1ZB 1FAKT 4A63A 3WB0A 1UA3A 3SE9H 2AJXL 4OZFB 4XP9H 5LGYA 3TA4D 5TDOB 2EADA 3L3JA 3R06B 5LGTA 2Z31D 1BEYH 1HQRA 4BFBD 2C34A 2XIBA 4RAHA 2GSGB 3ARYA 3LD8B 4Y16C 1SFHA 4HUMB 1FJ1A 2GSMB 4HLZH 3BGMB 4CS3A 1T0MA 5TF1H 2A2QT 3NPSB 2XUWA 4JYAB 4L48A 4IRJB 5T3XE 2NNRA 1CK0H 3EH1A 1XB8A 1UM6L 4K07A 2IV9A 4N0UE 1ZT1A 3OPZL 3VG9B 4L1BA 5GTHZ 1MREL 4NZ8A 1MQKH 4LDEB 2XFXB 3JYCA 4GX5A 4NIYE 1DUZA 3RVXD 1JI2A 5BQ7A 1F6LL 4ZK8A 3CXCU 4KHPO 1Y0LB 1Q4NX 3U46A 4P4KD 5AOZA 1P4BH 5FYJE 3NACL 1NMCB 5DU7A 3IETB 4UIKL 5IMLA 2XN9D 3U9UA 1KFAL 1NSNH 3DMMD 3O11B 3JTTA 3QUYC 4PWGA 1B9ZA 1K5NA 2BFGA 1BIHA 4KQ3L 4WW2C 5CN3A 3B1UA 5D1QD 2EDNA 5D2LE 3BPCA 1LK3L 1TO4A 3KVDD 3LKQA 4KL1A 4JO1L 2OI9B 4RAVA 1ZGLA 1A6VH 4LT7A 5DM6V 5FGBC 2EVGA 4RIRA 3WY4A 2M6YA 1HYRC 2B0SH 1FXVA 5KSVB 1HE8A 2C7FA 2P5EA 3CC2V 2VERA 4K8ZA 2VDRL 5GISH 1YEDA 4S0TD 2D03L 2X38A 2DRUA 3NZ8A 1NBZB 4JZOB 2Q86B 1I8MA 2AQRA 1L5GA 3FKSG 2LLLA 2YPKA 1C12A 2GFBA 1Y6KR 1SN5A 4DHLA 2ZF9A 5EK0A 2FK9A 2R23B 1KTDA 1M71B 2FT8A 2QZ5A 4KOBA 2IH3C 4P0DA 1QW9A 1F51A 1JA8A 3SZ6A 3TETA 3MUY1 5LG1A 3RWGB 2JWYA 4HEME 1UJ3B 5DFVC 4LXFA 1WBXA 3ECBA 1M7DA 3W2DL 2E7LA 1WE5A 2WLYA 1CR9H 3B3IA 3IMWA 2WWOA 3RY4A 2CA4A 2JB6A 3STLA 1F3JB 4HK3N 3IJHB 5CXPA 4ODBD 4NN7B 3VFNA 3B8SA 2V3DA 1FFPA 4O2EA 4R84A 1CICD 3STZA 2VQEB 3Q0HA 2X87A 3B5TA 3B2VL 4IHBA 4RFEA 4ADGA 5C9JA 2XBZA 5DS1A 3K3QA 3PP4H 2YBRA 3MRLB 4G6JH 4DV6B 2OLDA 3UIYA 1W15A 4ABMA 4OLYL 3VXSE 4JREB 5IVXE 4N6RB 2MQ3A 1JWSB 3NIDB 3Q1SH 1DVUA 4UOW1 1D5BB 3APOA 2VLKB 1TLKA 2O6EA 3MBED 3Q2VA 1K33A 3HCVB 4OLWL 4DP0X 2DQTL 1KQSU 5DHVB 5J11C 3T4AA 2OL3B 5FM8A 4C56B 2NUTA 3TC9A 2W8CA 3WHXB 1NBMG 3DV6B 4U6HA 1J87A 2V5MA 2GKIA 4XXCA 2O5ZL 2QADD 5GXBB 4U31A 4B9FA 3UBXA 5JQGA 5E5MA 4JFDE 1A8JH 3PAZA 4JN1H 3TNNA 1JTPA 4PJIA 4R5TA 2R1YA 4FN0A 4O51B 2ALAA 3WU2Z 1F2QA 1LWHA 2CUIA 3QUKB 5J13C 2DQGH 1RURL 3SDXF 1D7DA 3MYZA 1G7QB 3ENEA 3K0WA 3QR1A 4OGQB 1BV8A 1WAAF 5HYJA 5JJNB 4K3DH 3KG5A 4QHKI 1NCHA 3MCKB 1AZBA 1A66A 1DANU 2B1AH 2HVJA 2ISDA 1J8SA 4G1EA 5IB1B 1BMWA 3MUHL 3FQUB 2NNUA 1R46A 3VXOA 1QHTA 2EILC 3K4ZA 5EU7C 2O4EA 2BHUA 4S2SA 1EGJH 4JKKA 5K39B 3DSNB 4PWFA 3VWKB 1NMBH 4H8WC 2AEIT 2P5ED 4ZSOA 3ZDXE 4ZG1A 2C1OB 1TYEB 1ZPLA 3O4LE 4HWNA 5IMMA 3ROOB 4AMKL 3SO3B 5TDPA 3QG7H 5PCYA 5IHHA 2JK5B 1GW0A 1E5AA 2R72A 3HKEA 2QE7G 3U0ZA 4KRPC 1U95A 2BNQA 1K9TA 5GGUA 1SJEA 4DKDC 2JF1A 3QP3A 1IFGA 2R29A 3NZSA 1VEWA 1X59A 1H2SB 3FU5A 4PJDB 1VARA 5E1AA 4D3CL 4AK1A 1GZHA 3GHEL 4YJ2B 1BVNT 3BKML 1E6OH 3ZGIA 4OVUA 3L16A 1Y6MR 4OZGE 1KY6A 1WG3A 3ZZQA 1JFFB 1RPRA 4HQQL 4Q20A 4NT6A 3E9UA 1COBA 3MFGB 1UPGA 1JZFA 3ZTJH 1OGAA 2QFRA 4LIQL 43CAB 3MRHA 1SJHA 3LS5L 4WQOA 1T4WA 5HYQA 1MJJA 5ADPL 3C08L 1WFNA 4JHAH 3DUUA 5ITZB 1FAIH 1JGUH 3VSVA 3N40F 1E4HA 4HZLA 1UUSA 4PWEA 4PS4L 4LVOB 5BMVB 3UBGA 2R70A 2NTFA 1O6TA 4E5XA 1IM3A 4LNVA 5D70L 3MMEA 3A4DA 4P05A 4L37B 4KZDH 5IWLA 4LLMA 3VA2C 5C8JA 1R3JC 3PPEA 3WMPA 4JGSA 2VN4A 4ES8A 3W5MA 4QRRA 4HUUA 3IBEA 2ETNA 3LH8A 4AIZB 1A3QA 4UU9A 4KK9D 4JJHA 4AQAA 3Q01A 2Y7LA 4HH9A 1YC8A 4U4IA 3MLZH 4HJEA 1MEXH 4MWFB 1BAWA 3QXDA 3S3CB 2WZAA 5I5RA 5KYXB 5T1KB 2WO3B 2XG5B 3DDGA 4P49A 3RIKA 2YUAA 1RPKA 3OG6B 4Z77A 5HYJD 3G71V 1JPTL 4Z9KB 4GQQA 2YS8A 5J4MA 1Y6XA 2VL4A 4PV1C 3TBSB 4XNZC 3ICXA 2H3NB 1DQMH 2DDQH 1EZSA 3N44B 5HDRA 3ZTNH 3UPRA 1AXTL 1OAYH 4WK2B 5F7DB 1DN0B 4FM1A 2JS5A 5MI0C 3RAJH 5KUKA 4V1DE 4WNQA 1YYML 2VB5A 2YZ1A 3PPSA 2ATAA 3GIZL 1UVQA 1U93A 1TETL 2E27L 3ESMA 1IZKA 3LXAA 3RA7L 3W0WA 1DO5A 4F15B 3KJ4B 4UV9A 4JBSA 4LL9A 4N2CA 3N2JA 1J12A 1DDHB 2F1AA 4OM1L 4O02B 1JV2B 4PCKA 4BQ8A 1C08A 4Z6AT 4JPIB 2R51A 3U36B 4AKPA 3DSFH 3L7EB 3QH3B 4DV2O 3QAZC 1VADA 4FHKA 3A6CH 5IW1A 3QCTL 4TQHA 3QEHA 3P4MA 2WQSA 3ZE0B 4NXNB 3I6LE 1AQMA 1GYWA 1FZJA 3EYVA 2XHNA 1GSKA 2OJZH 4P46A 2YAOA 2Y23A 2QVTA 1H2KA 2WXJA 1IVSA 4DR1O 1I9JH 1PYWA 3P1VA 4G2KA 3W39A 4PJBE 2PTTA 3TM6A 5J5EA 3JSLA 5B1AC 4HCIA 5IFJB 1LILA 1U8LA 4JZJA 1TTCA 2XV3A 1FYTB 5AFAA 5J7CC 4NQEB 1QSEE 1Y6NR 4LL1A 4H0GA 5E8EB 2ADFL 3BO8B 1EM1A 5GONA 2HH0L 3B2XA 1RSOB 5JIQA 2EIMC 4KXCA 4KKAC 3BMWA 3HI6H 1RZ8B 5IE9A 4N24A 1IM3D 5EIBD 3IJEA 2EXWC 4LCUC 1G1YA 1N10A 2VTFA 4X80H 4CVZA 1ZA3A 3BKCL 4TWKA 3H85A 1MCPL 4ZUTB 3GKZA 2D3NA 1MHEA 4M5SA 4K7PH 5FW6A 3ZDZB 2ILMA 3KZIZ 1J1PL 3TEWA 1GM8A 1XREA 4LF7O 3V6ZA 2WUBH 1F4XH 3WE1A 5AVXB 1O7DC 1KB5A 4PJFA 1IX9A 4WFGE 2CDYA 1UADC 5AW7B 2QEJA 4Z7AA 3VG0L 1Q72H 4M3JA 4BZYA 1U2HA 1CFTA 1TQTA 1T5XA 5HI3C 4AEEA 4OIIL 4I5BA 4QJ4B 4O2CB 4XXWC 2HG5B 3F58H 1D5IH 4JQXC 2OMUA 4GMTH 1NFAA 2MCAA 3ECWA 3F7KA 1OARL 2J2ZA 4UB8Z 1TJGL 3PWVB 4MNQE 3ZYJA 5KVEL 5DQJA 1W6LA 2D3OW 2WVVA 3MXWH 1LUVA 2I27N 1AI4A 5J9PC 3K58A 2E9BA 3O9WB 1TUPA 3BQUB 3RWIB 3W0WD 1NCAL 4H0LC 1CFMA 2JB5H 1DDTA 4PV8A 5CJQL 3WN6A 5CCKH 1AHWC 3Q4HB 3RWHA 4BUQA 1IEAA 3HLAA 1CGXA 1G4MA 2A6IA 2AXGB 1ADWA 4OUUA 4GIOA 1E3XA 2HKHL 5LXGH 2W6IG 3QO5A 4FLSA 1QFUL 3UTSB 4AKOA 1SXNA 2RCSH 2XVLA 1IC4L 3JARB 3L71H 4JL2A 3QEUA 2NY5H 2PCYA 4N2KA 3JWDC 3C2AH 4PA4A 3BFWA 1FSKC 4WI2A 4ELKB 3S8FB 1KYDA 3NJNA 5JR1L 1R0AL 1VJSA 2F5BH 2JTDA 2F5AH 3VRIA 1ACCA 3FT2A 3PY9A 3SDYL 4P46D 4LFBB 2QKIC 3EJTA 4HHAA 3HN8A 3TN0C 1RV6X 4YHLH 1J9SA 1WFJA 1NBQA 4MA1C 2Q0AA 1OXYA 4Y1AE 1Q94B 4G5ZL 4EDXB 4JFHD 3FNKA 4LOEA 1KT2A 2HFEC 1BBJA 1UENA 4U1IA 5CLXA 4UV7H 2CM6A 4JY5H 3VSQA 2ZX6A 5IF0A 2NNCA 5B8CB 4WHTA 4DR2O 2K6ZA 3LH9A 4HK0B 5FWQA 1SOSA 1TF4A 5JW4Q 2ZR3A 4LCYA 4BFOA 2ZWNA 5ID0A 3AROA 1OHZA 2AK4B 3L5WA 3HBQA 1TFHA 5IT9N 5LGNA 2GUOA 3VGBA 2WWMD 3T9WA 2EYSB 3MHZA 5GRJH 4AX3A 2ESVA 3FT0A 4KDWA 2I32A 3D3VB 3BPNC 3LOWA 4PJ6A 4YHMH 2BCKB 2CRMA 1FN4A 4PAZA 5LBSA 3K5NA 3AXLB 1HEHC 3N85L 2P7TB 5DZPA 3BAJA 4HUVA 4WGKA 4GKKB 4JI6O 1XGPA 4YO0B 3TVMD 2AJUH 1LEIB 2OMVB 1FJGO 2JGDB 3UACA 4C59B 1L6XA 4DN4L 1U8HB 2PABA 4IIQA 5E4EC 4GP8B 2OR7A 5KVFH 2CBTA 2F54B 1K73W 5DUMH 1JQ0A 3QS3A 3T4DA 1SQBH 4JKPL 3VGDA 4HS8H 4XVOA 3O6ML 5E4OA 1THAA 1VRSA 2HZHA 2WZ5A 3GEFA 5KANG 2G3XA 2VR7A 4HUXB 1VIBA 2AABH 3H9ZA 2ZICA 3IJ4A 2CXGA 3QJHB 1ZSDA 2R0LL 5K9KA 4J3VA 1MG2C 1ROCA 4UTBA 1MLBA 3SE9L 2RQEA 3ZL2A 4XP9L 4JY6B 3T6ZA 4F20A 1CGYA 4UV8A 1BEYL 4DPAX 4PJ8B 4F2EA 4KKLD 3ALXA 2J6EH 3F01A 4IM8A 1RJCA 2V37A 3IK2A 2YGQA 5DMIH 2JKWA 4KROC 1T5EA 5TF1L 2QR4A 1LJMA 1CK0L 2UXBB 2DMBA 5MENE 3QYMA 4WFFA 1UKTA 3NXSA 4FOMA 4HA1A 3S98A 2HHHO 4YHNB 3GPSA 3GM0A 4FLWA 3LZNA 3FYIB 2C3WA 2Y0SA 4ZUWB 4JFPA 1XGZA 1G6VK 5C92A 2UUDK 4NTWA 4CADA 1I9RL 1W9XA 2CHZA 5DI8A 2XZZA 3DSQA 1P4BL 3GIVA 1IJ9A 1JDAA 1EJ8A 3BPOC 4PJ5B 3IVKB 4JGJA 3TPUB 1N6UA 4MD4A 4KFMA 1QWUA 4LNRB 4ZFZB 1CE1H 3GSVB 2HJFC 1L3WA 4P2OB 1NSNL 2QLVB 3SDCC 1WJZA 3HKDA 5ESAA 1T3FA 4KI5E 5C2UB 2FJHB 4HEMA 1N3NB 3K72B 1Q0XH 4KKPA 1OCCB 1P7KA 4DVBA 1ED3A 4OFDA 4WI0B 5EC1A 5BRZE 3C9NB 3CC4V 1YDPA 4OCXL 1CDYA 1EAJA 4JG9A 1A6VL 2W60B 3MZGB 4JFFE 3TFKD 1AI7A 2ESVD 4P9HL 5BZZA 1L0XA 2IO5A 1F1DA 2B0SL 5EEUA 3I85A 5GISL 5IVXA 1LK2B 3KPPA 1OW0C 4ZS6C 1GTNA 1THZA 3AQYA 3X13A 4IRJC 3N0AA 5BXFB 4F3FB 4GG6B 3PNWA 5HYSA 5TK2A 3W1ZA 4EN3A 1JGDA 3L9YA 5DJ6B 2EXSA 3WYRA 4GEIA 3IN2A 1NC2B 3M6DA 3LIZL 5DRXA 3G67A 1CTOA 3LPPA 4NYKA 5FLUA 1JJUA 1NDGA 3S5LA 1IXMA 1SF5A 5KANI 1CR9L 2H32H 1JPFA 3JTBA 2DM4A 4D9LH 4HUWA 4M7JH 2VQUA 1RH8A 3VSUA 4JFDA 4K9JA 2ZKXA 3ARGA 4U2ZA 4X65B 5GRVK 1QNZH 5BR8O 2ZXCA 3ABTA 3QZWA 4I88A 3RQ3A 4LF6O 3GJFB 3PP4L 4KK5D 3KXFB 4G6JL 2PXYB 1VGEH 1HCYA 5FF6A 5ID1B 1OAQH 3HNSL 4OIBA 3CCHA 3Q7JA 3GLAA 4QRTA 3VFOB 1MFBH 3Q1SL 2DQUH 3ULUH 3MD0A 5KX5B 1VQPV 1E4JA 1WZAA 1OVZA 4NLHA 3RZCC 4RRPG 4KX8A 4LP5A 4I4WB 5I74C 3VMOA 3GSWA 5CMAA 2A4EA 3U2JA 1Q9KA 5D7JC 3RNQA 2MHAA 3NFPA 2AGAA 5JW3H 4WFFD 4HW6A 3I9GH 4A39A 5IT2H 3UTPE 3ZQWA 1X5FA 3GK8H 1WD8A 3OKKA 2HVKC 4X7EC 3A2FA 1EIBA 5D71H 3O4LA 4JN1L 4EIGB 4BR6A 2JMRA 5AG9A 3GHPA 4I87A 2ZUXA 3QUHA 1RZPA 5JIDA 2AANA 2DQGL 3HRZC 2JCCA 3EBAA 3GINA 4QHMA 3RILA 5JHDB 1YMMA 5CP7B 5A7BA 4YVUA 3CFBB 3S5ZA 2Q0ZX 1IAKA 4K3DL 4D9RE 3IMSA 4RQFA 2CIKA 4IIZA 5BJTB 4PJ9B 2B1AL 1NANI 1YPZB 2BH0A 3VE0B 4F7TA 2Q69A 1N9PA 5D6DC 2NQ3A 5CEYA 4F8LA 1HDMB 2E3VA 5F7UA 3RYFA 4XHJC 3INUH 3TIEA 2V6HA 1EGJL 3C87A 5HGBB 4LSRH 4UOZA 1NMBL 3DVNB 2XN0A 4O5LH 3L6FB 3CBRA 1ZLUH 4F15C 5AD0A 4QRPB 3FT4B 4JI0B 4P23B 2BP5M 3CFDB 3ISRA 2WY3B 1CE6A 4EB6A 5JQ6L 1SYSA 4PS3A 4B3TO 1IBLB 3X3FH 3QG7L 5I1LB 2C9AA 4PB0H 1YSOA 2MMXA 2PWFA 4ZUUA 2XWRA 4NCC1 5JNYA 4X6FB 2LO1A 2H1PH 3AABA 4P06A 4YSRA 5BUGA 5D1ZB 2IDTA 3TEYA 1FVCA 3BDYH 4WEUD 1E6OL 1CPUA 1AR1D 5F9WB 4X9HA 1CS6A 3ARGD 2P28B 2QL1A 4FG6C 3HMXA 2APTA 5EF1A 4ICGA 1JNNH 1MHHA 1A1NA 2DY2A 1LO5A 1JFQH 2X4UB 3AITA 1C16B 1ETA1 1FVEB 4KAQH 1NGQH 2YN3A 3RJDA 4ZD3L 2RJMA 4HCGA 2DWDC 1HH6B 4JHAL 1WIUA 5F8RC 1ORQA 2AQPA 1FAIL 1MIEH 3TBVB 3ASNB 3EHBB 4S10A 5CLWA 1DUZB 1BM3H 3IDIA 5FR3A 2WWWA 3DETD 5B39A 4JFWA 3OMAB 4R6ZA 5C3LD 2HT4C 1CDBA 2WYTA 1F11B 3JV4A 5AW0B 4KZDL 4UCRA 1KLUB 5EYPB 1KIUA 4V1DA 3AG3C 5IMLB 4HUKB 3MRQA 3U4EA 2XX1A 1LUWA 1XF2A 3EZ8A 1GGIH 4X1YA 3A3YB 2WV3A 3CSPA 1T0NA 5LCVA 4ELMA 1IIKA 4F9LC 2VMEA 1YEIH 3O4LD 1FC1A 4OCYH 5K9JH 2JIXB 1G7IA 3D4ZA 3UZEA 3IFOA 3MLZL 3EDJA 4GRMB 4PJCF 1MEXL 3HZKA 4RMBA 1SHSA 1T21B 4UNUA 3HJEA 1YMMD 5HVWA 4O4LA 4XPHH 2IGLA 5HYIA 3GWOA 1DO6A 4ANUA 1RK7A 1XMQB 1BQHG 1ODUA 1S9XA 3H4FA 3NMEA 1S7UA 5DMGC 4MXWH 2EDYA 5ANMB 3MNMA 3PU7A 1IO4C 1QR8A 1DQML 1LYQA 2DDQL 1E79G 2YXMA 3ZTNL 2QJDA 1CLOH 2APWA 1ZTXH 5D5QA 4KH9A 3KPOA 3FXIC 3B9AA 3RAJL 2CXKA 4XZUA 3L4ZA 5GSRB 4KI1A 1JF1B 4XBPA 3IDNA 4DK0A 4PJBA 4X9YA 5SX5K 4L4TB 5IV2B 2Y6SD 2CGOA 3ARDA 4TLTA 4LE8A 5EF3A 4CSSA 4DV3O 1QSEA 2C1PB 4LVOC 4ZTPH 1KGJA 2DLGA 2ZIDA 4NKDA 2CNYA 3KWXA 1Q9OA 5CA0A 4LF3A 1OALA 3WKYA 4K15A 4LFHG 5KVEE 1CU4H 3NDZE 3O6LH 4TL5A 5A43C 1P4LB 1XBLA 2B8OT 1NL0H 4KRLB 3A6CL 4B7LA 2YBRB 1JS4A 1H0DB 1V5JA 2J8UB 3GMNB 3IDXH 4GXVH 2Y5TB 2HRPH 3OF6A 5HJ3B 2BNRE 2X4TB 3TIDB 3V0JA 2AW9A 2I7SA 2OJZL 3D25B 2LAAA 1A47A 3MR9A 3OMZA 3CFJB 2Q7HA 2KLRA 1I9JL 3JT0A 4WWID 1Z2KA 4BELD 3KH4A 1DVQA 4MBRA 5CJ5A 1PZCA 4IHOB 3FRPB 1QO3A 1BPVA 1OZTG 1KKDA 4XP4H 4DEUA 4O00A 4PGEA 1CO1A 3LKRB 2TRHA 4YGAB 2EDMA 2SEBB 2ETWA 3G9VA 3HI6L 3KYOA 2HPOA 3HI5H 4AYID 2PPFA 5JUEH 4FLZA 4ZNEE 1WFMA 3JUZA 4NAQA 4UDTB 4LKCB 1CYWA 4X80L 1INEH 3IGAA 3QFDB 3CMEV 4MNQA 4NQUA 4GX1A 1VQLV 1QA9A 2YMOA 4X9GA 2WINA 3G5WA 3W3BA 8CGTA 3OBAA 1BZOA 1MXDA 2BPBA 2XKNB 4DZ8B 3LAFA 3WEBA 4K7PL 1XCWA 3IRZA 5GGRB 1IILE 3WNMA 4YIQB 3T3PE 4WGVB 2WUBL 3JALB 2VSDA 1TQWA 5GRXG 4YSDA 4OZHE 5IJ9B 1MCHA 4C83A 3S6CA 5BZWB 4PR5B 1Q72L 4XMWA 2NX5E 1H3WM 1PIFA 5I8OH 4LBEC 2DH2A 2G75A 4B5EA 3RTQC 5C6PB 5I0YA 1HILB 1LP9B 2C7UB 2IADA 4TUYA 4PJEF 2VXVH 1ID5I 4OFVA 2C9RA 4LSSH 1LDSA 5IK3A 3F58L 1T1XB 4S11A 1D5IL 1S76D 2WKOF 3QJXA 4GMTL 4XMZA 3WNLA 3MROA 3AQDA 3HVDA 4UDUB 1R1CA 5EOTB 3CIQA 3AU1B 3MXWL 1DVTA 3WIHH 4Y1AA 2VLKD 5KHJA 3JAKB 4HIIA 4GAJH 7PAZA 2Z92A 1B90A 1WP7A 5F1IB 5CCKL 2Y3NA 1Q9LB 2HG0A 1QSED 4OCSH 3D3IA 3UJTL 1NGPH 4EF3A 5G5DA 1CGTA 2QLYA 5LXGL 2V7HA 3R1GH 3W7TA 4Y2OA 2Z64C 2RCSL 4F8QA 5CCGE 5DRWA 1XQ8A 2MIZA 3LRMA 3C2AL 5ECGA 1QBLH 5D7IB 3NN8B 1OGAB 3FSVA 3ZTEA 3G4SV 2UUAB 3K6DA 3OF6D 4HCRA 5F0JB 1BZ9A 1NC4B 2Z4QB 2F5BL 2F5AL 2R4RH 4GQRA 4MASA 4OGYH 4MJHA 1RZJL 4P04A 1BF5A 1HL4A 3RFZC 1I1AC 4DR6B 1XCTB 4FFBA 1DK1A 4AQYB 3C5ZB 4YHPA 5E9DE 4YHLL 43C9A 5ILTH 5LNEA 3VOUA 3KZ8A 2MKLC 4RDQF 1XXDC 4LF8B 3U1QA 3M17B 1F3DH 5IGXH 3L5HA 1HXMB 1TZIB 3WTSA 5CJOH 1NOLA 4O2FB 3ABGA 5LJYH 3FULA 2BJMH 4UV7L 4QYOB 3VXTA 4JY5L 1RAMA 1SEBA 1V05A 3QDGE 2CGZA 3DOSA 3X14A 4FFZA 2YSSB 5F2FA 3K71A 1M7XA 1PEWA 2BSEA 3QO1A 3MUUA 1NAMB 2VR9A 1DSFH 3T0EB 3P0VL 4G6AC 2EYRA 5FGCE 5E6IA 1VAHA 2VN6A 5AWNH 3CU1A 1HHKB 4L8SC 3K91A 1VKXB 2PYFB 2WLZA 4YDJA 5DN6G 1LO2H 2BHYA 5GPRA 5CU5A 5GRJL 4YXWG 3VI3B 4RFOH 2X4SB 4JFSA 4R50A 3ZKMD 3BVNB 4DCQA 4YC2B 1DVXA 3NSJA 1GHFH 4RZKA 5C08A 4X6DE 4FQHA 2GC7C 3RYIA 3V9CA 4JM4H 1VZIA 5MERA 1WAEA 4LO9A 2Y0IA 4NJ9H 4AVHA 2AJUL 4GP4B 3TJHD 4R83A 4OIFA 5EC2A 3FD9A 3MQIA 4YDKH 2VDQB 4WNQB 1J8RA 4CC6A 1ZOXA 4NYLB 1TUEB 3FO9A 4GSQA 4WK4B 3S3BB 5DUML 3P69A 4HS8L 3P2TA 1GVIA 4JDTH 3EDEA 2BSRA 4GKOA 3KPNA 2AABL 1Z6JT 1IAMA 4MMXC 4MJ6B 2VRQA 4DW0A 4Y1AD 2OPCA 3K46A 1E9PA 2J6WA 3S88H 4R6UA 4YSTA 3SY0A 5IQ7H 4X4YB 5IVOA 4H8WH 5D5PA 2AGJH 2FJSA 2FUQA 2J6EL 1SFDA 4JI5B 4KK8C 1QRNA 5TH2A 5DMIL 1BX2A 3PF2A 1PS3A 3O4OC 1WTGT 3OZKA 4JRYE 4WJ5A 4HGMA 5BRZA 3V52L 3GDCA 5DWUH 1N0LA 4JFFA 2IDSA 4U6YA 5IB4B 4PD4F 1LEKA 3ZHRA 5KSBB 3KDPB 4WFEA 3KWTA 4UT9A 1GH6A 1KB9K 1DLBA 3O3AB 2CZNA 2PCFA 2GJ6B 4JJ5B 4RSYA 5FYKU 1D7BA 4LU5H 1U8KB 3BH8B 3DURB 2BW5A 2K70A 4X8JB 3OAZH 3T3MF 2R1WA 3M88A 5HI4D 3TA3C 2MW2B 1A4BA 4PDVA 2FECI 1GZQA 1CE1L 3VFPA 1U8JA 3QRFM 3QPXH 4IU3B 1U8CA 1SDYA 3SGJC 4LLQB 4NZTH 5EO9B 3V4PB 1MVUB 5ITBH 2BSED 3CMGA 1Q0XL 3RBSA 5IKCA 5HTSA 4TNWK 3JSNA 1XGTA 5L2JA 2R59A 5DEJA 5IW6A 1EUTA 5E2JA 3BUIA 3VXPA 1RUKH 2HLEB 3A22A 3DX6A 1KENH 3O6FC 3D0AA 2CJ3A 1HIMH 5JWPA 4UM8B 3SYPA 1F23A 1NM9A 4I0PA 1U97A 4IMKC 3JATA 4S1RH 2EUWA 4N0FB 3UAEA 1UA6H 2XQBH 1GOHA 1KNOA 4CJ0A 2X4OB 5A6MA 2QGEA 2L7JA 4NKMA 5C08D 2BW4A 1JDDA 1T89A 1UFUA 1QVOA 2FT6A 3NSCA 3A21A 3NABH 3SBRA 1KGIA 4K3GA 3RFRA 5AVWB 5F9AC 4UCOA 1H6EA 2V2XA 3KVPA 1FGVL 5MEND 5LXTB 1NANH 1IMHC 4IU2A 3CDFA 5EO0B 2CHWA 3H7BB 3P0GB 2C26A 1BLNB 5C0EA 4XXDA 4Y5XC 5FHAH 3C60D 1RZKC 4D9LL 1BJMA 1ZTMA 3BEVA 3GRBA 1P5UC 4XC1H 3TBBA 2XAJA 3HUJA 5LVEA 5IG7B 1FV1A 1IKOP 1FYTD 1QNZL 2XCMC 3BE1H 4KZ0A 5F1OB 1S3JA 4R2GC 1BQLH 3QC5X 4I85A 4XCEB 4AV5A 2IQAB 2ZUUA 1KYOJ 1VGEL 1OAQL 2GEEA 5E94B 4QF1B 4XVSH 4KI5D 2DMGA 1QRND 1MFBL 2DQUL 4PJIF 3HS0A 2V5TA 4KKCD 4JCLA 2QWPB 5B1KA 5BVJA 5LGJB 5H35B 2FWOB 3NFNA 4JE4B 2WM0A 4JFFD 4FA7B 3U6RB 3JAMN 1UT2A 2ZG2A 2CUAA 1KXTA 1FXKC 3LHAA 1YZBA 3I9GL 3U7YL 4WFED 1EEYB 5HDLA 2EEFA 3S3PA 3RTLA 5JOEA 2TSAA 3PCYA 1Z9LA 2WSDA 1WN7A 4KZEH 3GK8L 2AHYA 3IXTA 2B77A 1AY1L 3TEXA 5D71L 2JJTA 4ILDA 4Y4HA 1NCTA 4WHTB 3VWJC 2VSCA 4MNGE 4PCYA 2A4ZA 1ZVSA 2R0KH 3CFCH 3HE7C 3BT2H 3D06A 1AROP 4G80B 4HC1H 1MCWW 3UJIH 1T2QH 3QXAA 4M7LT 1I3RA 4TV8B 2CUHA 3AREB 2GUOB 2GVYA 4GY4A 4BCXA 1M05B 1PZ5A 3MV7E 3MHSC 1PZSA 5BO1H 1R6NA 1OSZB 5MEOA 5GGVH 1AVMA 4ASUG 1X3DA 3BQUD 1GC1C 1K4DA 2F1BA 4NZJA 3SKNA 4I0PD 3CZGA 3FSWA 1VQOV 1P4IH 1RQ5A 2XV0A 2PXYC 2GTQA 3INUL 4MMZA 4P59H 3HAEG 1KN4H 5D1XE 1RUQH 1E4KA 2FQDA 1CXKA 4LSRL 4O5LL 4N0UB 3OKYA 5H8DA 2X6VA 5EU5B 3E3QE 2IH9A 4MMYB 2P90A 3CVHH 3D52A 1DCLA 4OJEH 4NBYB 3GTTA 2Q1EA 2VXQH 5CBGA 4WHYG 5I16B 4OFQA 3RVXC 2DEXX 4JO2H 4UM9B 2IBZX 3DGGB 1RCYA 1Z5HA 2NLJA 1T0PB 4HHGA 4JX0A 4XP5H 4P4KC 2GB2A 3ZMUA 4PB0L 3MJ8B 2C4FT 4Z3FA 2ICWA 3BCCH 4KVCH 4KJYA 2EE6A 1RXLA 2NY7L 2O5XL 1B0GA 4J11A 2H1PL 4N4YB 3VGAB 4U1KA 4GW1A 1G87A 1GM9A 3DMMC 3KPLA 4FQ1H 5EUOE 2DIEA 2Z93A 3R7QA 3ARPA 5L2KB 3Q3GB 3BDYL 1FZKB 3QNXA 4TQIA 4RWYH 4HS3B 3ILQD 1JNNL 5D2LB 2MJWA 4KAQL 3R8QA 2DE0X 1JFQL 1JZDC 3Q8AA 4NFDA 2VDKB 4G43A 2ZOOA 1NGQL 5FV2A 4BQ6A 2PWDA 2Y7QA 4LASH 3CC5A 4LHJB 1Y1DA 2CKBB 3HKFA 4HOXA 1OGTA 3HI1B 2X1PA 1MIEL 3H9HA 4ANXA 4ZFOA 3UIZA 1MQ8A 5I76A 5JPMC 1MW0A 1KCVH 3VCLA 1BM3L 2VISB 5D96C 1M1XA 2WN3A 3WEAA 1TQSA 1FFXA 5DI8B 4QJ5B 1J8HE 1GR7A 4Z7NB 1Z2GA 3IF1B 5CIPH 2PW2A 1A9BA 4LFAB 1GM7A 1BHGA 3FB6B 3JWDH 4PRIA 3VXRD 3WNNA 4B9ZA 4ZRGA 4R0LB 1GGIL 1CLZH 4FJ6A 4R8CA 3B7SA 5K9JL 1YEIL 1CDUA 4OCYL 3ARVA 5EZPA 3LRLA 2ZXBA 1VP7A 5K33A 5JMRA 3BP7A 3I6GB 4YDNA 5ABZA 1D9KA 2Q5BA 1YDPB 4B0MM 3ZX1A 1CUOA 1CICC 5JDJA 3KCWA 3MLTB 4XPHL 3IPFA 4YGVA 3W57A 5BZXA 4L8CB 5JTWA 4EDWL 1BQKA 3C8KA 2Q67A 1EFXB 4APXB 1QABA 2WPGA 3O8XA 4MXWL 5D7LA 2K4AA 3FU7A 3P3SA 3PXHA 5F9WC 1VEMA 3VXSB 3QI9B 1CLOL 4ABUA 1ZTXL 2AF2A 1FG2B 3WTWA 3GMOB 1NR7A 2XAFA 1YQVH 1NUFA 2XSKA 4X4XA 4H33A 2PWEA 3HBPA 4M43H 3VFUA 5F9JA 4DP7X 5JJEB 1Q9WB 1SZXA 1X5ZA 1YSCA 4XCNA 5GZOC 4NZUH 4JI4B 4DESA 3AG4B 4DGUA 1E42A 3ZTDC 4QXUH 2QADC 4NRZB 3AS3A 4ZTPL 5T3ZE 4PB9H 3NA9H 3PGCA 2XUMA 2PP7A 3ECVA 4F7PA 3QWQB 4ZNEA 4U7SA 4QHUB 1DTOA 3O6LL 4RMVA 4AYEC 5CGTA 3IS0X 1NL0L 2W07B 5D4QA 4MD0A 2ICEB 1C5BH 3IDXL 4PV9B 2IEPA 4GXVL 5E5LA 2YD0A 3VQVA 4KUZH 3QUXB 4PJ5D 1BVNP 1UGKA 2HRPL 2KT6A 2Y69C 1J5EB 2X1QA 4P3WA 4PD4J 1AKJB 3GSUB 4JFYA 4P2OD 1AGEB 5IREA 5H5NA 3QIWA 2FD6H 3X2QB 4OZHA 1XF5B 2GITA 5B1JA 4ZDHB 4X7TA 3MRFB 2NX5A 3P9WB 3TZVB 5LDSA 1N67A 3CQQA 3G5XA 3GSQB 3IJYA 2NCMA 1IGFH 2IDQA 4JYAO 3K2IA 1EK3A 1QASA 1SDAB 4XP4L 3WIIH 4Y1SA 3WI9A 4XN9A 4JI1B 2EIZA 2VITB 3UYRH 5I1HH 1AH1A 4L8JA 4M8RA 3OFNG 3HI5L 4XOAA 4CC0A 3VFWA 3JYBA 2VQ1A 2FR4B 1V10A 4WEEA 1INEL 2WIIB 2XAGA 4A1RA 4XNBA 4E2OA 4PRID 4ZXBA 5B3SC 2LABA 4OM0H 4WHDA 4I9XA 4BQCA 4R26H 1FO0B 5C0CE 5K1NA 3BVOA 4QPEA 4W9JC 3RPIA 2F7QA 3EXJA 3AT9A 2CRZA 3AXIA 3QEQB 2E7LC 2UZXA 4WCYH 1NWOA 2OAAA 1NC2D 3DC5A 3STLC 1Y18A 2EVHA 1YEHH 4HKXA 3AG7A 3P9MA 3STZC 4RLDA 4OZGB 2NXYB 1W72H 1A6AB 4FFYL 4X5WA 3TLRA 4RAUA 4D6TH 4U05A 5HDOA 1KJ2H 4PP2B 5L9DH 2ARHA 1JHTA 1T5WA 2GK0B 2KPWA 3O8XD 5D7LD 2VXVL 4EEEA 1VQ8V 1X5HA 4IYHA 4LSSL 5SWZE 1AO7E 1XH0A 5FA3B 5E2WH 5F96H 4QTHB 5E9DA 3D08A 1XSIA 1JI1A 3MRCB 1JPST 1QR4A 3T4AC 3WIHL 2OT5A 1T2JA 2W91A 4DP2X 4F8NA 4J9YB 3VUAA 3LV3B 5HPMB 4GAJL 4ZUUB 1SOXA 3JZYA 5L8JB 4CVUA 5KVFE 3K0GA 1ROWA 1A7PH 2NY2D 3AWEA 4HJTA 4OCSL 5ABDE 3QDGA 5LP6A 2Z6FA 3HE6A 1J10A 1UATA 2JJWA 4RSVA 1NGPL 1XH3B 2N1KA 4PRHE 3U9WA 3MLYH 1PKQE 2FO4A 5DJAA 2ZM6B 3R1GL 4CILA 5DC9B 5LOVA 5I75C 1M7UA 3MV8B 4LB8A 3MGTA 5I6PA 3HEIB 4U7NA 4X6EA 5INDB 1QBLL 1XEQA 1NJ9B 2R2EA 2IJIA 3E35A 4X6CE 4X99B 3B5HA 1A7BA