3SPGA

Inward rectifier potassium channel kir2.2 r186a mutant in complex with pip2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMAAPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 94
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spgA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spgA01
4X89A 3F7VC 2JK5C 3AG1C 5KUKA 3E8FA 4UUJC 2K1EA 2DWEC 3SYPA 4DXWA 1OCRC 3KG2A 2HJFC 5EC2C 4JTAB 4OXSA 1R3LC 3ABKC 1M57C 2HG5C 3VSQA 2DYRC 4MS2A 3JYCA 3K08A 3AG3C 1OCOC 2EINC 3SYOA 2E4FA 3ASNC 4MW3A 5CBFA 4MVUA 4ZBMA 2W0FC 3OUFA 3X2QC 2GIXA 4R50A 3E8HA 1R3KC 4WFGA 2IH1C 5EK0A 3AGWA 3RBZA 3AUWB 3T4ZA 3ZJZA 2AHYA 3AG2C 1K4CC 3BEHA 3LDEA 1LNQA 3R65A 4PA7A 1XL6A 3E8BA 3T2MA 1M56C 3UM7A 4PA3A 1N9PA 4MTFA 4TWKA 4R7CA 4H37A 1OCCC 4X8AA 2ATKC 4P2ZA 2X6AA 4WFFA 1ZWIC 4QE9A 4XDKA 5B1AC 3SPGA 5BZBA 3K03A 3SYQA 5J9PC 2ITDC 3LDDA 4P30A 3OR6C 3LNMB 3EFFK 4MVZA 2X6BA 2YEVA 3SPCA 5CBHA 3RVZA 4LCUC 4CBCA 2NLJC 2Q67A 3E83A 2ITCC 4F4LA 2WLHA 2DWDC 3AG4C 1R3IC 3E89A 4I9WA 1S5HC 4P9OA 2A9HA 5B3SC 3TETA 2WLLA 3K6NA 4MVOA 2Q6AA 1G4YB 2A79B 3OR7C 3ATBA 4MW8A 1R3JC 2QTOA 3OGCC 3ATDA 4GX0A 3VOUA 4PDLA 3OUSA 5CBGA 5EBWC 4G28B 1P7BA 1V55C 2WLIB 2AHZA 1OCZC 3K0DA 1KKDA 3ATEA 4RUFA 2WLIA 5KUMA 2BOBC 2WLMA 3STLC 2ZD9A 2EILC 4R8CA 4HYOA 3SJQC 2KB1A 3PJSK 3STZC 3FB6C 2IH3C 4PDMA 4GX2A 2WLNA 2WLKA 3SYAA 2WLJA 4G27B 3AT8A 1ORQC 4RO2A 5B1BC 3T1CA 4MVMA 4JTCB 3ATAA 3FB5C 2H8PC 4H33A 4RUEA 2WLLB 1V54C 1U4FA 4PDVA 3IFXA 4PA6A 1XL4A 4MSWC 2Y69C 2HFEC 4JTDB 1BL8A 3SPIA 4WFEA 5EC1C 3SPJA 3UKMA 4KFMA 3LUTB 4XDLA 3FB7C 2Q68A 5IY5C 1K4DC 3K04A 5E1AC 2ZXWC 2DYSC 3K0GA 2R9RB 2BOCC 3F7YC 2HVJC 4GX1A 1J95A 4GX5A 4P9PA 4PDRA 4R6ZA 4X88A 5EBMC 3LDCA 3RVYA 3SPHA 2QKSA 4RAIA 3WG7C 3AT9A 4BW5A 4J9YB 4MVSA 4LBEC 2P7TC 2HVKC 2X6CA 4MTOA 3ASOC 4HZ3A 4J9ZB 2EIMC 4MTGA 3F5WC 4WFHA 4LP8A 3K06A 4QE7A 3SYCA 3HPLC 3IGAC 4EKWA 1JVMA 4XDJA 3E86A 4MVQA 4QNHB 4PA4A 4PA9A 3ABLC 2Q69A 3ABMC 3RW0A 3ZRSA 1U4EA 2EIKC 1QLEC 2A0LA 3GB7C 2EIJC 5EBLC 3ATFA 3E8GA 3TCUA 4MVRA 2OCCC 3FB8C 3T4DA
chains in the Genus database with same CATH superfamily
1B4TA 3QQDA 2IW5A 1M1SA 3JWNH 3V0DA 3DVNA 4G8FA 2VITB 4PJ7E 1BLNB 1PSKL 3QXWA 4G8GE 4WWID 1A2YB 4OXSA 2CDEA 3MFGB 3L4VA 3QRFM 1QPKA 2X4UB 3ESPA 2ED8A 4JKPH 4KFZC 3DTXA 1BIHA 4N1EA 1J5IA 1D6VL 2DMCA 3LRMA 3BDYH 1CF1A 4J3BA 4WFHD 4IOIB 3RWCB 1DQDH 2W95A 5JQHC 3NZHH 3A6CH 4QOKD 2D9QB 2XX0A 4G71B 4OW6A 3CZFB 1Z5HA 4QMEA 4Y4FA 3VX0A 1FAIL 4AW4A 3BKCH 5M94B 1B3QA 4IDLA 2GHYA 2YD7A 3G5ZB 2ENJA 1EFXB 2NQ3A 2NZ9C 1HDMB 5JW4Q 3HS9A 5LYJB 4H8PA 2WN3A 3APCA 1NLBH 5IB2A 1XNQO 3RN4A 2UYLB 3B2DC 2XTAA 1BECA 1K92A 3W7TA 2X3AA 3BIKB 4IDJH 3T2LA 2YO3A 3TT3H 3O6FA 4N9OB 3PIQB 5GS0C 4OB5H 3CLFL 4ACTA 3JCUZ 5CEYB 3RZCB 1S46A 4JANB 4NFBA 3LNDA 1HOCA 3ASWA 4GMSL 4JZJB 3MLXL 4ZDHB 5I66B 2DPKA 2A9NH 2J1ZA 3H6AA 4QO1B 3C90A 2CR6A 2VLRD 5CGYC 2N1KA 4OVVA 5CFHA 1KJ2B 3Q1EA 2IGFL 3JARB 3SYAA 4GIPD 4PHXA 4YHML 1I7FA 1PD6A 3UPCA 4DP0X 2BSRB 5L9DH 5C08A 2J6EL 2R51A 2PCYA 3MGAA 4B7LA 3CH1A 2UXDB 1F86A 4BWUA 1ITBB 4DVBB 1IM3D 1Z5YD 5DQ9B 5IT2H 3QA3B 4NM8L 4XMVA 3KLHD 3IN2A 2QVKA 1AKPA 1WBZB 3BESR 2VXUH 4WFGE 1D2PA 2CLRB 5IJ9B 3SDCB 4Q6IA 4YJ2A 2VQ4A 4YLBA 1YECL 1XQ8A 1CGVA 2NY7L 2QGEA 3IMVA 4I2XE 1DVFD 3EXAA 2V5YA 1NBVH 4GSRA 1A65A 3QJFB 1BQ0A 1AC6A 2FECL 1H8SA 2QGBA 3EBHA 3IJHA 3QP3A 4LPCA 4LBEC 5FO2A 3MYJB 1VESA 4ZUWB 4MNGA 3KPOB 5DFAA 5F70A 4EEQA 4HUXA 4IMKA 3IGLA 4QJFB 4I7ZC 3CS5A 2HVKA 1X7QA 3PGDB 4X99B 1JHLL 4KX7A 4BGLA 1QHTA 3U4KA 5TGBA 4J6RL 4G8GA 4JG5A 2EJ7A 4XAKD 3RA7H 3OGOE 4LDLB 2Z7WA 3SDYH 1A3RL 5KVGL 4JL2A 1MPAL 3B7SA 5KSVA 2XXMB 2C3GA 4A7VA 1YN7A 4KJYB 3VE0B 4M5ZL 4I2XA 1J8HB 2GUOB 4K9EC 1GZPB 5ISZA 3ZHNA 1X5XA 4U1HA 3O2DA 2WQRA 4DOHB 1RFYA 1UM6L 3BH8A 4XMUA 4G8IB 2WSSG 1J05A 3VSQA 2H3NA 5JHDD 3BPLB 5TISZ 4A5UB 3T6QC 5J6GA 1NKGA 4JI8O 1TCRA 3ML8A 2YN5A 4TV9B 3O3AA 2ZX5A 1JF6A 3B8SA 3D36C 4R50A 1IBLO 1OSZA 2BP3A 1AZVA 3SGEH 5ETUA 5GSRB 5BO1L 3OMIB 4OZFA 3KPNB 1MJ7H 5C7XL 2XWJA 4LQFH 3WIHH 1KNOB 1S9VA 3T4ZA 1FNLA 1M1XB 3VYPA 1M56C 4FZEL 5HHOD 5EZLA 5CBAB 2JEXA 4N4YB 3W0WB 5IF0A 3HMXH 2R2EA 4U1GB 1TTBA 5F1SA 2BCKA 2BE3A 1G9HA 3RNQB 2P80D 2YBRA 4LNRA 4R97C 3WBDA 3V6OE 4FLYA 5IFHL 1LK3L 1G7QA 1FVDB 2DQTL 3IDXH 3GXIA 2WLHA 4JM2F 2PXYD 3S5LB 3UJJH 3TETA 2A9HA 2CTRA 2DMHA 2YD0A 5A3IC 4Z7UA 4P04A 5KYWA 4OLZH 1QLFA 3KHQA 5IYBO 3SJVB 1G87A 4PTUB 1Z5LA 5C7XH 1GN2A 1J8HE 1MHCA 3CFUA 3MV8B 1ZCRA 3G04B 2JGUA 2P8PB 3BAEL 5C0CE 3VH8B 4BFGA 3PG2A 2GBVA 2PCFB 1K85A 1DBJL 3TT1H 4M3HA 2A9BA 3GLAA 3O45A 4OD1H 4ODVL 1A9BB 3PQYE 3HKEA 1WGOA 2ADJB 5BOJA 1UURA 3D52A 2ZM6O 1XQ4A 3D85A 4KHXH 6FABH 3ARGC 1PYWB 2DBJA 2EEFA 4LMQE 3A4EA 2OSYA 3RGVA 4P0DA 1YPZE 1FV1A 1UA6L 1RUQL 1OOWA 2K3HA 2HUHA 4HIEB 5I76A 5TQ2H 3HR0A 1F1DA 1BHBA 1QVOA 4CW1A 3NH7H 4NPJA 4NQEB 4GMSH 1QBAA 3HN5A 4UQCA 1LYQA 4DKFL 3JD4A 3V0IA 5I75C 1A25A 5LL6Y 3BA8A 2WBJB 2ADIA 4IU3B 4LFBO 5C09D 3E2EA 3MTRA 3E2HB 1I85A 3LV3A 1HL5A 3DV6B 3CLWA 4O5LL 2W94A 2F1AA 3CWGA 3DGGB 1RURH 2OR9L 4IIJA 1W0KG 3BT2H 3ROOA 1EO5A 1DBAL 1AHWC 2ZWZA 2HT2C 5CA1B 1FNEA 2XVBA 1XAKA 2WVVB 3E35A 5LHHA 5EBWB 1MXDA 1IMHC 1QW8A 3OJDA 5DMIL 4V1DD 3NIFE 1FYTD 4G6FB 3MFFB 5DJ6A 3S6CA 1VF5C 2DQEH 2H2PD 4WGKA 5ADPL 4HBCH 4KTDH 2OR8A 3B1UA 2XTSA 4OZGF 2F8IA 3A4DA 3WEXB 5IWLA 4R4FL 4QPKA 2AGJL 2JIXB 1U93A 2VJXA 4HS3A 4X9IA 2EACA 5D96C 5IR1B 2WQ8A 3AUVA 1QKZL 4NRXA 1BZ8A 2XUMA 1VACB 2EVGA 1I1AA 5EZJB 3X2QC 3L1OL 4AENB 2R27A 1K5SA 2QV2A 3P4LA 4RISL 4W9IC 4M00A 3MLWL 1CXLA 1L5GB 5C70A 4N2NA 4Y4KA 4OIBA 2AK4D 5FYJD 4GG6B 1GRJA 3CLFH 3OSKA 2G38A 5D7EA 3S4SB 5JHAA 2CDYA 2ZWYA 1RIVH 4WUUE 2KG7A 3SE4C 2CPCA 3EOBA 4YXWG 1B0IA 2GAZB 1GXEA 3KWVA 4YHNA 3VG0H 5GS1A 3IXTB 5J2UB 2QKIA 4Y9CA 1E4XL 3MLUH 1U9KA 3OR6C 3Q1SH 3I6KA 3FCBA 3C60B 1MW0A 3I3DA 3MRKA 1XR8A 3SQOH 3REWB 1SF5A 4OUOA 3CFTA 1II4E 1GOFA 3VXMB 4NM4L 5LNGA 2JK5B 3C9NB 4MCYA 1TJIH 4NC0B 2NY0B 1U8KA 4KROB 1KC5H 4B0MB 4D0CA 3HHRB 1CXIA 4FHJA 4HIIA 4PDLA 2IANA 1PG7H 4WTQA 1TEGA 3L8QA 3MLYH 5AAWC 4HPYL 1ZPUA 3M46A 3BCCH 1RM1C 3LSQA 5KN5B 4AQ1C 3ZTJH 4J1UA 1KELH 4F2ME 4LZKA 3VWKD 1TTFA 2C1OA 3O3EB 4JV5O 4ZZFA 1KFAL 1UWGL 4KUCD 2Q4PA 1BIIB 2LU7A 1YMHA 4QEGA 5K39B 3H9HB 3BSZL 2V9UA 4KKBD 5D7IE 2ZP8A 3DYMA 3PAYA 3WXVH 3WG7B 4PJEA 3PXLA 3NOIA 5C0AE 3CX5K 2BOCB 3V79C 3FB7A 2Z0AA 3T5WA 2OXGA 4L4TB 4U6XB 2D3JA 4JEGB 5GGVH 1MUJB 4U1KB 3W2DH 4AQ8C 5AD0B 3ULUL 2ZYRA 5KBKA 2JCCA 4L8DB 4UT9L 2XDHA 3BFQG 5BMFH 2HVJC 1NAMA 2WTRA 4F57L 2JVUA 3FFCE 3LZFH 4OIIH 4EB6B 3X14A 3AK1A 1SQPH 3BIAX 1G7IA 3KE0A 1E5YA 4WFGD 3ZE0E 3ZE2E 3S8WA 2HN7A 5B3JF 3WFDL 2A6DA 1KPUB 2VZTA 3GMNA 1SMDA 3SBWA 1D7CA 4DCQA 2W60A 1N34B 1AQMA 4F8NA 5I1IH 1R4XA 4HHAB 5FF6A 3BHBA 2P44B 3MMEB 4MZRA 3V6OC 3ZXAC 4JRYD 4X7FC 4ODTH 3P0YH 3ECQA 3J07A 3ZW3A 3GB7C 1W0JG 2Z5UA 2F08A 1N0XL 2D03L 3L1GA 1TO5A 4L0PB 4KOCA 3S36X 2E47A 2HTLC 5C0AD 3UTPD 4ZFGL 1KC5L 1TTAA 3D0VB 4I85A 1EJFA 3DA0A 2F5AH 1WSST 4FTVE 4ZUUB 5C0EB 5DVKA 5GGTH 4PGBB 4PJXB 3IU3A 1BWWA 2ODIA 3GSWA 1GJIA 5MEQA 4PRIB 3QR2A 4O4HB 3MRNB 1NIBA 2E7LA 2CIIB 2FT6A 2FX8L 1K3IA 1HIML 4KXAA 4UUJA 1U8LA 4WJG3 3GQFA 3WUZA 5DEJA 1VFAA 3J80N 4ZBMA 3BAIA 1RJYB 2JKWA 4DR4B 2HPTA 5TDNB 2GV9A 2W9LA 4XNMA 4R7NB 4XO3A 3DX9B 3UXFA 1I7TB 5KBNC 2DLTA 2OQJB 3Q6FA 5KBMA 4GT7A 1OAXL 4MJHA 5LGJB 2EABA 2YXYA 3AWFA 1T0PB 1VRSA 3QVAA 4ZFOB 1KCVH 4LF6O 4DT2A 1JRHH 1A6AA 3FU6A 4UU9B 3MODH 4A38A 1PFCA 5AVXB 2I9LB 1OD9A 2WUCH 4MD4A 5EB9A 2DQ0A 4LSRH 4OBSA 4FG6C 1INDH 1WS8A 4LCUC 2AGJH 4JY5L 4N9GB 4WUKL 4CILA 1V8HA 4WFFE 4NFCA 2D31B 1IC0A 3OKNA 3ZDYF 3S3WA 4DO6A 5E1AA 4X83A 4M93B 3ESMA 5E6UB 5D1QE 3N43B 3ZSSA 4XBGB 1CFNA 1RUQH 2AXGA 5DMIH 4YWGL 3FN0L 4XP4L 3RY5A 4JE0A 4X8JB 4V11A 2H26A 2QKAA 1JPST 3L08A 3CSYA 2WLJA 1AGCA 3VTMA 4WO4A 4OLVL 5IQ9A 2QSAA 5EIIB 5ESQA 3U7YL 2DWDB 1OF2A 2WZ6A 4WBNA 2RD0A 1ZLWK 5D72L 4BCYA 2IPKA 5T1KA 1GAXA 4XOEA 4EN3A 1R33A 2BP8B 1NIFA 2VZVA 5IBUB 5JUEL 3SKJL 4KVCH 4GG8B 1WBXA 4AGQA 1N5AA 3BQUA 3RTLA 3R7QA 2GPZA 1JZEA 3UDWC 1PKXA 1BV8A 2VDQL 3U46B 3UO1H 3T0DA 1C5BH 4K5LA 5DQJB 5IM7B 5LBVA 1MREL 1QFHA 5KOVC 3WY4A 1URLA 4IRJC 1SQVH 3F7YC 2NTFB 3NIGB 1T0NA 4C54A 2VAAA 2DKMA 1YYLL 2X4TA 3QH3B 3NYKA 4OAWA 3CN3A 5TQ0L 4KO6A 4MYWB 2WQWA 2QPUA 4LSQH 3RURA 3S36L 2ICCA 3H3PH 1KIPB 3OFNG 1JD7A 1WIPA 1JZ5A 3DC6A 1P2CA 1QBLL 2JKSA 3EG9B 2XWCA 4MMZB 1F42A 4EKWA 3KL3A 4DGIL 3UCSC 1AROP 2Q6WA 2H32H 1S8DB 2FHCA 3BP6B 3CDYA 4AJWA 2GY7B 1TTCA 3O41B 1MCOH 4JFHD 5C2UB 4I0PA 2B0SL 3C5ZA 4N26A 3H9SE 3J7AU 4JFDD 3HUJB 2J25A 3MUY1 4UTAH 1KCBA 2Y7OA 5D7KD 1DK1A 2CK0H 4TUOB 5F7MC 5J3HC 5TE7H 3ZDXE 3E8FA 1NGYA 3T0EC 2NLJB 5AZUA 3KG2A 2P48B 3EOTH 1GS7A 2Y36H 4WSGA 4NXNB 1AO7E 1GMEA 1U8JB 2XKSA 1MIEH 2IAAC 2BVOB 3C5SB 4FQXC 2C26A 2OKMA 4M3JA 3SGKA 5CU5A 3QAZB 2F8OA 2VDKH 1KCWA 1NICA 3HS0C 1VEOA 3ASNC 5KVGH 4EFEA 1JUFA 4IKJA 3D8CA 3MN8A 5IZ7A 1NEZB 1NR7A 4QRFA 4ZAKB 5FS5A 5T5FH 2NY5H 1IE5A 1KN2H 2ZXWB 1IGFH 4TUJA 1MVFA 3U82B 1AR5A 3II2A 3L5WA 3W1ZA 3GWOA 1FH5L 5A9GA 1NL0L 4LVNB 5K59E 3LZRA 2KZBA 1SEBB 3ZKXC 1ZVSA 1JZ4A 4FTVB 2EYTB 4L5FH 4NYLB 4O2FB 1IJNA 1NJ9B 3DURB 3BD4A 1F3DJ 2G0LA 1ZS8A 1QYGL 1HR0B 2DQDH 2JJSA 5ELIA 4N2HA 3TYGL 4JAMA 2B2XL 3RPIB 3V4PH 3MAQA 1ETB1 1TDQA 5IBLD 1NBMG 3WEMA 3K7UA 3QIBA 1DE4A 5I0WA 3WTSA 3NDZE 1LE9A 3P9MB 4KL1A 5I1GL 2B77A 4X0NA 4OLXH 5T5FL 3TA4D 2ZE0A 1HL9A 1R75A 3VXRD 1I1FA 4BQ9A 3FB6C 2QM8A 4FQPA 4M61A 4EBQH 4XVUC 5EF2A 1CFSB 5CP7A 4APXA 5CZVH 3UX9B 3ZE2B 4KPHL 4RO2A 4UB6Z 3T1CA 4B3RO 1KB5H 1UXSA 4R9HA 3FUDA 5DD0H 2HSIA 2P7TB 4N20A 5IQOA 1AQ8A 4BSVB 4Z7WE 4U1IB 5TPWH 3MNMA 4NUPA 4M8VA 4KY1L 1OVZA 1U3HA 4ETQB 3FH5A 4W4KA 1Z9MA 4PLKC 1KGIA 1VIBA 2OMBA 3IAGC 3QIUD 4Y2OB 3VGFA 5B1NA 3D87B 1F0LA 4AGLA 4AEHL 12E8H 1W15A 1U8OB 3MRRA 4IRJA 1G5AA 2WZ0A 1BQLH 2HJKA 5DJYA 3JCZA 4XDLA 2ISDA 4ZS7L 1TZGL 2AW9A 4IK6A 4IRZH 3TNMB 3QHZL 4AIOA 3HKDA 4GW1A 3RWJB 1TPXB 3OKEA 4BA0A 5LGHH 4X1IB 1HH6A 3E8VA 2Y72A 3FQTB 4R6ZA 3O6MH 5AW3B 4AMKH 1BJ8A 3R18A 3N41F 2AJYL 1AR2A 3OF6A 2GJ6B 3LEYH 4IGBD 4FHBD 4M5TA 1NGXA 1XGYL 2QPDB 4DZBB 5B4MD 4PP2B 2IG2H 3JV6B 3SPVB 4JHWH 2JDIG 3C8KB 3WNJA 1W2KT 1W8OA 3ULVC 2AXFB 4YR6B 4IHJB 5GGSB 2Q69A 3P9LB 4RDQF 3V7AG 4H88L 2KZ1B 3JTSA 5ICZA 1CO1A 1XSKA 4R7DB 2BPBA 3ATFA 3BDYL 3TCUA 5D6CB 3FB8C 3QJHA 1MCQA 1UKTA 3QR1A 4PJBA 1K97A 1A2YA 5HPMB 3GMMA 4IDJL 5EC2C 5BMVA 3C6LD 3MJ9H 3RHWF 2VSDA 4FQXA 4KGJA 1B3JA 4GFTB 4FOMA 3WLBB 1VQ8V 2JQZA 3MUHL 3KW7A 3DXAB 4P46A 3MXVH 4PRDA 4WHCA 4PJ5B 3WFBH 2QWNB 2O5YH 5BRZE 1EHLH 1JJ2U 3FAVA 3RY6A 3SJCC 1GMIA 3O4LA 1NH2D 1OTUC 5MI0C 2FE0A 2WQXA 4AL8H 4NSKA 4HFWA 3ATBA 4NJAL 4Q89A 2VMEA 4ODHH 2F5BH 1I8IA 3HPLA 3FUKA 3AXLB 3QHTC 5DT1L 5IQ7H 5T5NG 3IPFA 3MUUA 1YZBA 3K3WA 5I71B 3CEIA 3GRWL 4OFDA 3PL6B 4FFBA 1FLRL 1M6UA 1KB3A 3EGXA 1OTUD 3AMLA 3K6NA 1V7NL 3NAAH 2ATAA 2NQCA 4EN3D 4G9FE 2Z31C 2AQNA 4MX7A 3K1DA 4AMXA 1FFRA 4HDIB 1UM4L 3OUSA 3QQ4B 5I26A 1JA8A 3DOSB 2JCCE 1KIRB 3ULAB 1SY6A 2P8MB 2NDFA 3MBEA 5DC4B 4C83A 4Z7WA 4XCYA 5HDWA 5LCVH 1I9RL 4NOFA 4R8WH 1MWAL 3SR2C 1UADC 4P2OC 1ZHBB 5HY9A 3HN3A 5C08B 1TVKA 4QHPA 2CCWA 3EKCA 4J7JA 2AXWA 3W5NA 3Q0HA 1N19A 3WS6A 4DVBA 5DFWH 1T0OA 1WUNT 2VM3A 4B3MO 3ARDD 2A2QT 3Q4HA 4WQOA 1L6XA 4ZT1A 1DJZA 3QWOA 1A21A 1B0GB 4W9FC 2XACC 5DA4A 4BQCA 1IDSA 3RWHB 2Q8VA 1RH8A 2BVTA 4OM0L 5EU6A 2YSSB 4NNYB 1IKFL 5SV4A 4JFVA 4M4PA 3P0YL 4AC2A 3VWKB 43CAB 4BGDA 2ESVA 2J57A 1NC4D 2Y0SA 2A9CA 4W9EC 3L72H 2QDWA 4KI5F 1OQXA 1EFQA 4Q14A 5B4MC 5K9KA 3BDBA 1XGTA 4XPFH 5E8OB 1RSYA 5AUMA 5HGAA 1XMQO 4PRPE 4ZNCD 4NN7C 3NZ8A 1JMXA 4FM1A 1E3FA 3PQYB 3RILA 5SWSB 4FMKA 5HJDA 2GHZA 5HI5C 4JI2O 2PPDA 1B9KA 3MGTA 3R06B 2IDCA 3ULUF 3TJHD 3HE6D 3GZQA 3SCMA 3RWDA 3L95A 4HT1L 1CXZB 3ARFD 4RAVB 5EORH 2J2ZB 5EOTB 1GOGA 5GGVL 5JQGB 4WUUA 4UT6A 4YNYA 4MQXC 4CADA 3F7VC 3ZTNL 2ZUYA 4MKTA 4P23B 3CX5J 1I1CA 4J41A 3LRLA 1BFOA 3GFUA 1CQKA 3PJSA 4Q9BA 3RIKA 5LP6B 3E80A 4XPFL 2VLJA 1F97A 3L16A 3NFNA 5C07D 1KELL 1F45A 4XPAL 4CGUB 3CPLA 4XAWH 4O2AA 1JFFB 1WVZA 2H47C 3HNVL 5ABDE 5IHUL 4PCTA 2EC9T 2CAKA 5I6OA 1M1XA 5I1JL 5HHQA 1Q5OA 4RIRB 4ZPTB 3V52H 4I9XA 5D7KE 3X1BA 4LHUA 1MCBA 1TLMA 5CGBA 5FGBC 3RNQA 4ANUA 2WP3T 4JHVA 4FLXA 4XVJL 4ZI7B 1KULA 3ZQ9A 1RPOA 1FNSH 4I9WA 4MS8C 25C8H 2QQNH 2C3VB 1CD8A 2OL3A 3UROR 1I3GH 2Q7GA 4LKXA 3MKGA 5HYJD 3D69A 1QTPA 1DEEA 3MLVH 5IW6B 4R4BA 5CKAA 3D4YA 3AFLA 2NNRA 3HCVA 3VI4B 1RZKC 2AANA 1DZBA 1VQ7V 4WCYL 4FFKA 3ENEA 4RISH 3WHE1 1HVXA 2P45B 1MJ8H 3BVNA 3KBEA 4GKNA 2J44A 1CLZL 4HLZG 1LE5A 4N0UE 4HC1A 7CGTA 5BUGA 4QTIL 4LGPB 5GHWL 1N70A 1RJLA 3DIFA 4NUGL 4YBLC 2NXYD 2XLLA 5DI8B 5F1KC 3U0ZA 4JJOA 4M3KB 1IGYA 1JYWA 1N67A 3CDFA 1IAKB 2Z6FA 5C7ZA 4XNYL 5EU6D 1FV1B 1NOFA 1XGYH 1MI5E 4GKOA 3B2XA 3U9PL 3VBBA 5CBEB 3P0VH 7TAAA 5E8NA 4PTTB 3TV8A 1BVOA 5DK2A 1HCYA 1SJVA 1WE5A 2BFVH 3O6ML 4AMKL 4ZQTA 2DQEL 3CFMA 3GJFH 1PW3A 1SQQH 3QQ9C 1DN0B 3DTDA 4PCYA 4OVUA 2Q9OA 3RBGA 2D3OW 4LSTL 1DVFA 4U2ZA 5H8DA 1ETA1 1KLGA 2KL6A 2OX5B 4UQ2A 4ZOLA 4H0IA 1A6WL 4UILL 4AK1A 1EA9C 4DUWA 4IRJD 4JM0A 2ZOLB 3K4AA 2UY6B 1NCIA 2OP4H 1BSMA 4OKVA 4Y4HB 3SGJC 2AXTZ 5JDSB 5FLXN 5DJ0A 1JXJA 4LF5B 5KSBE 4LOVA 1PZ3A 1TEYA 1YRKA 3I50H 1HFUA 2NY2D 3FT3B 2XI9A 2AI0H 3DX3A 3QJVB 5L3CA 2CRIA 4ETYA 4DN4L 2OMYB 3GZPA 1ZT1B 3B1TA 3FQNB 3HC3L 1E50A 3TPKA 3O9WB 4YFLI 2AEPH 4CZZA 4NQVA 3UH8A 1IEBA 1M2VB 2FEEI 3MV9B 3EDDA 4OT1L 5IR1A 4WJ5A 3WHXA 1AI5A 1YNKH 4O00A 2BK8A 3WYRA 1BVNP 2D2CB 3TC9A 5A6MA 4KZEH 1JHKH 4DK5A 1GJWA 2X9WA 1U8PA 2DQJL 3H9SD 4NIYE 3WLWD 3HHMA 1K3ZA 3ZHTA 1N0LB 4PRAB 5L3EA 2EINC 4K7PH 3INOA 3W82A 4F33A 4FADA 2R8SH 5J6HA 2J1XA 2XN9D 4JUSA 4PBXA 4X80L 4KK8D 4L05A 4ELDA 2AQQA 2IH3A 1XBRA 3OXSB 2IH1C 2NUPA 5HGGS 3EYFA 1IGFL 4ENEC 2J8UE 2NW3B 1N8ZB 5FYKH 1RZFL 3K6DA 1S72V 3EYVA 1FE8L 4W9GC 1ADQA 4F9LA 2Y7QA 4NENB 4BE5A 2VXQL 2XOKG 4KY2A 3CDCA 3WNPA 3VU1A 1HILB 3VQ1C 3H0TB 4RZCB 4V1DE 1WA0X 3S5ZA 4MQSB 5GIRA 3E89A 4GKKB 5E94A 4K94C 1BP3B 1U2YA 2RNBA 3GLEA 4HK0A 5HI3C 3QYMA 4AUJA 1KG0B 1ML0A 4XCFH 4FLVA 3KMDA 4AL8C 1ZSHA 4O2BA 2MIZA 2MTPA 4JCWA 2B2XH 3CVHL 2OK0H 3GMQA 5DEFB 3TBTA 2XZQH 5I30H 2IH1A 5KVFH 4YLCA 1PV0A 1IBDA 1U36A 3VXTB 1AILA 2VS0A 3WMSA 2ICEA 3BWAB 4IMKC 4BCZA 1JPFB 3K72A 4JL1A 2H8PC 2AXHA 4OLYL 4P49A 4TVPD 2WLLB 1G5GA 4MGXA 2BP0B 3O3DB 3CCUV 5HDQH 4QHLB 4D94A 2CGRL 1JJOA 2LAGB 4JQVA 4ABMA 4CMHC 3E6FB 1F4WL 4KVNL 1MFMA 4FFWC 4GQ9L 4QXGH 4NQDD 2IIJA 2FX9H 4FQCL 4PJ7A 5IB4B 4I48A 2H0EA 3BH4A 1I53A 1U92A 1DZ0A 2FJGB 2J55A 1BCIA 1X5LA 3RIAK 1BM3L 4DUZO 3ZL1A 3TBYA 1CYGA 3QUZD 3CV5A 1U97A 1DL7L 1S7VB 1XF5B 5C8YA 32C2B 3D39B 4J9YB 5CCHE 4F80A 1B04A 5CD5D 1CXFA 3PWJB 4MAZA 4O4IA 1E27B 3LNEA 1VAHA 3EOAA 1USQA 2R4RL 3G5VB 2J73A 5IUCA 2VQ1B 1E4WL 1JGIA 2GIYA 3MCLH 4D8PB 2EO1A 1XXDC 1T04B 4B3MB 4MXVF 4LFAO 2HJFB 2IOMA 2W80C 3R0NA 4S10A 3BKJL 4W9HC 4ZTPL 3T0VA 2FEDD 5BRZA 3TGXA 3LHPL 1R47A 4ZPVA 2XY2A 4LARH 1F13A 3UTQB 1V55B 5HYSG 4EUPG 3O4LE 2BJMH 3ESUF 2VZ3A 1Q38A 4RMVA 3VQMA 5C0GB 2UUAB 2KZWA 1ZLSH 1GZQB 2VE6B 3DPBB 4GAYA 3NJIA 3IMUA 4KKBC 4DTGH 4UQIM 4UQBA 1KBKA 4L48A 1IURA 4QRUB 1Y67A 3E8UH 4MASA 5ID0A 2XYBA 2K1EA 3GSWB 2HP8A 2B1GA 3FZUD 4JY5H 4OF8A 3WL9B 3CFKA 2D0HA 3LS4L 2CIIA 5KMGB 4V2CB 1U8LB 2HT3D 4HGMA 4YX2L 5DUBB 5IK3A 1S9YB 3QQXA 4D7SA 4BZ2A 2NR6C 4YC2C 2OYPA 1DFBL 1RZJH 1B4LA 1RJYA 5FB8A 4ZKIA 3RFZC 2YIAA 1E4HA 1KCVL 5F97E 4CVZA 1ILSA 4PJDB 3NUKA 3GM0A 4CUCA 3JUYA 3D4GA 3CMGA 4KMTH 3TEWA 2RB8A 4H8UA 2EBOA 1FIEA 3UM7A 4TSAH 4JI6O 5E99H 4DNLA 3NJLA 4UB0L 25C8L 2QQNL 4OR1A 2HMID 4WFFA 4L4JA 5IFAH 3LNNA 4XVOA 4BIZA 4X9FA 4UNTA 4LVOB 4TUKH 2VN6A 4X42A 2ZXAA 2R15A 4PJ5D 4V33A 3P3UA 3GJFK 2LFRA 2ROYA 4FFYA 1JR9A 5JMRA 4YHLL 4JM4H 4LBEA 3ULVE 2B4CL 1LEKB 3ZMTA 2EH7L 1CTMA 5DUJA 3FN0H 3NN8B 1U3HD 5IT9N 4UOW1 1VIWA 3RU8H 4J2XA 4HUUB 3LRSB 3U36B 1AKJB 3VXSB 3T6ZA 4U3FH 4MZ3A 2ETNA 2EDEA 5D1ZD 2MCAA 4B9ZA 5C8JB 4WUKH 4Z3JA 4K94H 2VWJA 1EGJA 1NDMB 4X4MA 5IQ9B 4WKXA 4KVPA 4PRPA 3MD0A 4G7QB 4G9FB 2D3VA 3L2NA 4HAFA 1Z9LA 2IPKB 2N0KA 4QRPA 2WD0A 5IVXA 5J7CC 1OT1A 4EN3B 5FEBA 3RUGA 1N33B 2H2PC 3B7UX 4KUZL 4JKMA 2Z65C 3KLSA 3VGAC 5KLVH 5LMNB 1PG7W 2O5ZH 3ET9F 2VQEB 2ZWSA 3QARA 5DHYB 2HKHH 1CIUA 2GCYA 2P5WE 2AERT 3S35H 5LOVB 3AM8C 3DX2A 4G42B 2OMXB 2GC7C 1WFMA 1FL3B 2P42B 2V5RA 2GFBA 1WGVA 4AE0A 4OJFL 1INEH 4S1DD 1NCGA 3N1GC 5L3GA 4MCZB 2P90A 2E3CA 1R6KA 2HFEB 2J5LB 4PS4H 3GWKC 4BEIA 1J95A 4AEFA 3OHXA 3HMXA 4K3JL 4XNXL 2UU9O 2D9CA 4P57A 5HJ3B 5AOLA 2WC7A 2Z8VC 4LPWA 4MMZA 3DXAE 1E8WA 4CVXA 1UJ3B 5E56A 3RVVD 4JI5O 4FNRA 3HW7A 3KZ8A 3OKLA 5FO9B 2MOQA 1ODAA 1WNSA 3T04D 5HYFA 1JX9A 4XH2A 3VI3E 3CHOA 1Q90D 2CSPA 3CDZB 3QJRB 4RGNE 2VDRL 1I5XA 1W91A 2J7LA 3PGCB 4J3XA 5G5DA 5TE4L 2VZSA 3N2GB 3CQQA 4O02A 4MD0A 1OJHA 1NGYB 5FHAL 1E4JA 3DNKA 3LQZB 3NCCB 1MFDL 4PGJA 2YUAA 4MMXC 2ZPKH 4YSOA 1QNZH 1LILA 5LG1A 2V4LA 3BUTA 1U8CB 3G5XA 5F89A 3F58L 1SYSB 3BUIA 5BMFL 4PMFA 4PJAA 1Q82W 1VGKB 2B39A 1EN5A 3JWOL 4U7OA 4UT9H 4MVUA 4X50A 5EBMB 5EUOA 3POCA 1A1NB 4LHQB 2LQRA 3HI5H 2DEYX 4OGXL 4RFOH 5FHBL 1N5YL 4JFYA 3DVNB 4G8FB 1OARL 2IDFA 4RNRB 1FFPA 4DZ8B 4E42A 3PRZA 2D4FA 4D6TH 5GONA 1BFTA 4APQC 3UTTA 1CUOA 5HYJE 5SV3A 5AW2B 4BKLA 5KX5A 1DBBH 1SXAA 2WB1A 3HE6C 2XTJE 4QCIB 3MJ8A 2APBA 2GYSA 3HMWL 2X4UA 3MLZH 4Z7VE 4JREB 5E08H 3DURA 4MZIA 4CU7A 1H3PH 2R83A 5T3XE 3IMTA 4U1MA 2HB0A 4H13C 2J72A 3IN0A 2YK1L 4FP8L 4JAMB 1I1AD 2B5IC 2PPAA 3SBPA 2W91A 5L2KD 1WTGT 2YR3A 4FFZL 4WI9A 3H7BA 1VF6C 2F8VA 1RZKH 3B2MA 1ZA3A 4FA7B 3PLYA 1EHLL 4QNPF 3MREB 1OTTC 3BGFC 3EH4B 1O9HA 3MOBL 1FFQA 5F9WC 5LXGH 4Q9RL 2QKCA 1U8NB 4IOFD 1Q0YL 4UQ3A 2IPTH 3RP1A 2PCPB 2B3RA 4TSFG 4NX0A 4PREA 4E0RB 2KBGA 3KCPB 4HZLB 5JPMA 4X7SL 3BMVA 3O2WL 4PJ9B 4EDWL 4LLDA 5HYJB 2PF4E 3EYQD 3FOMB 4OSUH 1HX0A 2OULB 1GA2A 4YE4H 4L8JA 3FHEA 2VQEO 1KTRL 2WK2A 3MOAL 3PWNB 1BQHA 2E9JA 2XG4B 4F93B 2QGNA 4ZXBD 3ETSA 3NJMA 3F64A 4JZJA 5DJDB 3ZJAA 4DKFH 2ADFL 3IMWA 4X5XA 2HR3A 1XBDA 2ZSVB 4RQQB 5IMOA 2RFXA 4M6AA 2C4FT 3N85H 1UFUA 4JO4H 2LW1A 2E6JA 3K0GA 3QO0B 2C9UA 4W9LC 1XF3A 3MRLB 3IJEA 4GUPA 2NOYA 1VFUA 5IYZA 5BV7H 1G9NL 1G7LA 3FT4A 1Y0LA 2F18A 1P4BH 2V37A 4LOUC 4AK2A 1PJ9A 1NBZB 5AENA 1T7WA 5IMMB 1NGWB 1CGXA 2AXFA 3T0BA 1P84J 1CI3M 1JS4A 5GS2H 2Z7UA 2OZ4L 3N50A 1HINH 4NT6A 1FN4B 3IETB 1CFTB 1UOWA 3OV6A 5MERB 1KBHA 3WFHA 4AWJC 2LW3A 1KBVA 1MNUH 2WOYA 3ARSA 1URIA 1GSMA 2AEQL 3BSZA 1S7UA 3KPMA 4M7KH 4AIZA 5HTSA 3SE3C 4MNGB 1SZXA 3JAWB 4XOCA 1PLGL 2BO0A 4KRPD 3DO7A 1MLCA 4LVOC 4KP4A 5B38G 4EIUA 3B9EA 1U3HC 4ELMA 2PTUA 1E43A 4M7JL 4DPAX 1U8HB 3EO0B 2R2CA 4KTYA 3MCKA 1XXFC 4K23H 4WHDA 1AIZA 4GKSB 1GKOA 3UBGA 1PZUB 1DLBA 2CLVA 2DTSA 5D6DC 2RN9A 4P2QA 5KSVB 3V0JA 2E75C 3VE0A 1K8AW 3R66A 3TK1A 3IAYA 4HMCA 4GAFB 5I74C 1N59A 1NAMH 3GZKA 2DQDL 2OM5A 1FNHA 1ENVA 2F53E 3VFWA 3C12A 3D50A 1JNNH 2X1WL 5BS0B 1NGPL 4OZIF 3LRGA 3QIWD 5J6GB 3MA7B 5E4IA 3WIFB 3QUML 2CBPA 4TV9A 1NBYB 4M6NH 4FA8A 2A6KB 5E6IC 4KKRA 3FHAA 2D0FA 4KQ4L 1PD3A 3E3QE 2UX7A 1GSKA 3KPNA 3NQKA 2R59A 4YK4B 5L4MA 1X44A 4QR7A 3RAJH 5K9OB 4B7IA 3BT0A 1Y1DA 3HZYA 4NPKA 4AQAB 1HKLL 2LGNA 1IFRA 4B9KC 2CGYA 3S97C 3LQMA 5D1QB 1SJEA 5IEKA 3RVTD 4LDOB 3VXPB 4X6CB 1F3JA 1C1EH 4PJ6A 1G7QB 3S3BB 2EVIA 4E9TA 5AW7B 1BDYA 4PP1C 2ED7A 2QFRA 2VXQH 3EFOA 4HCRL 3SDXB 3AY4A 5J89A 1U2HA 5M95B 2ZR3A 1RZFH 2H32B 1M7IA 5ECJE 5SX4H 1NBVL 3IJSA 4BSWB 3BPCB 3TJEH 4UTAL 3QR0A 4ZMNA 3IWVA 2ZM6B 3TV3L 1N7MH 3NCFB 2D7NA 2ZOUA 1NIEA 4CMHB 3QJFA 1AXTH 1IBHA 4DR7O 2GIMA 2VC2L 4WO4D 4AIEA 4I0PC 3MJ7A 2CCLA 5DZAA 3ZDZF 3D85B 2E27H 3K0WA 1E4XI 1ZGLB 2WZAA 1NFDB 2Q3AA 4MTOA 3RPBA 4JN1H 3RVWD 2AV7A 4E9QA 5CWSA 4F37K 1GGCL 2P67A 5DDHB 1M1KW 3JAKB 5ENWA 3L95B 3K80A 4QDGA 3SZKC 5ACZB 1H3VA 2ZIDA 4YHHO 3EUUA 3QG6A 1ZD6A 1I8KB 5DEGB 1EO8H 1L3NA 3D39D 7FABL 3BWZA 4DV1O 1CGSH 4XE0A 5D2LA 3SOTA 1N0JA 2F1BA 1AP5A 1YEJL 4QUOA 5BZZA 2NY4B 3SKJH 1ZANH 3PJSB 4ZZKA 1Q9OB 3VI3B 3PJNA 4EZMA 3BVOA 4U3SB 1NH6A 3ML9A 1R3LC 2MPAH 3NFNB 3CGTA 4U1SB 4JZOB 3LIZL 3PPSA 3T3MF 1CDUA 4BM7A 1TR7A 1HP8A 1HXKA 3TGUH 1C8QA 5LXGL 5CJBA 1JOYA 3CSBA 1LVEA 3VFUB 4R0LA 1OAYL 2IDUA 2NDGA 3C6EA 3U4BH 4OZFB 2AEOA 1IFHH 3X3GL 5C1MB 1GCFA 2JJ2G 4U1JA 1MWAA 1NCTA 3B2UD 4UI2A 1EVTC 4J8RB 4PWEA 5J5EA 3GTNA 5DS1A 4LHUB 2EKJA 2KQNA 1TTUA 1AGDA 1RK1B 4N1HB 1WTLA 4JI7B 1IM9B 2KLRA 4N8CL 3ZX6A 1IFGA 2XXFA 4OQTH 2OMWB 1D6VH 4L3CA 4U3SA 5CJQL 1NFDF 4IRSD 5GRYA 3A4AA 4FN0A 4LSRL 1GC1C 2F23A 3UC0L 1LTXA 5CEZL 1I1YA 1L4IA 1JF5A 5D7IB 1XF2A 1M7XA 3MODL 3Q8BA 4NN5B 5D1XA 4H0GA 4OCSL 1L5GA 4S1QL 3GSQB 3NP4A 3UZQB 2QTOA 1GGYA 3PHAA 4JDVA 5DGRA 2ZXEB 1NVPD 4CVUA 3GI8L 3T0EE 1MEXH 3BVNB 1YEKL 1IBMO 3TT3L 1F1AA 3CX5F 3EOBB 2Y07L 4RDQG 1YJDH 1RZ7H 3HLAA 2UXDO 4Y4HC 3MQIA 3S98A 4XHJC 2VLRE 3WKML 4TQHA 1FJGO 2IADB 2UX6A 3KPSB 4UWQB 4JR9L 1JV2B 3FB5C 1VEWA 5B3JE 1U8KB 4WJKB 5IJ0B 1WT5C 5FKAA 3VRLE 2N7BA 3JASA 5DGQA 4ZFGH 2G3MA 5I76B 4HIIB 3ZGHA 3TCLB 2UUDK 15C8L 5DRWB 4MDJB 1WO2A 4LOEA 4XMWA 4D0DB 2CM6A 5DSCA 1EXUA 1FG9C 1BZ7B 3L6FB 2HLAB 4L1SA 1HH9A 2DBLL 5E2JA 3D08A 1H2GA 2W07B 1BF5A 5HHOA 1VARA 3BZ5A 1EEUA 3Q43A 4IU3A 4JI4B 1A4JB 5KHHA 4MVSA 3VW3L 5L8KB 3MV9E 2UY6A 3QCVH 3JWDC 1CD1A 5AWNL 3WNOA 4AYFB 4GRMA 1JWMB 4K3JH 4XDJA 1BFVL 2OJEB 4RRPA 4NZRL 4PJCA 1T2QL 1ZHLB 3P02A 4QF1B 4ZFFB 5EBWA 4NQCA 5CZKA 3CCSV 3Q5TA 2CA4A 2EIKC 2A0LA 4JHAH 5EF1A 1VFMA 1QFPA 2N74A 2JJTC 3S35L 3Q8AA 3KLKA 1JZJA 2AHIA 2BSKA 4G3YL 3HPJA 3R0MA 1P4RA 1PDKA 4EB6A 1ZY9A 3D5OF 3X14B 4AQ8A 3OJVC 2NUTA 3SBQA 1DQTA 2JIXA 4HS3B 4WSJA 4F9PC 3SJVD 4ZYKB 3ULSA 2EIMB 4WNSA 3N1QC 2R2BA 5DFVD 3ZHKA 4PRAA 3H54A 1S6NA 1UT2A 4B7EA 1K2DB 3I75B 4CGTA 5E2TH 1FF5A 2IEPA 3LVEA 4N0CC 3WNNA 3MLYL 5DHVH 4OM0H 5CJOL 4G7YH 2GJPA 3V4UL 1QRND 3ZJZA 3AG3B 1D7BA 1IAIH 1CE1L 3L3GB 4PCKA 5AAWA 5AAMC 2Y5TA 1K8DA 3RL2B 1KWKA 1NMBH 4HWEL 1L8DA 3PWVB 4WGWB 2QADC 5H2BA 2XN2A 4K5NA 5TF1L 4LIQH 5FFLA 1ONQA 3D3QA 1J5CA 1SESA 3C9NA 4MCYB 1NEUA 4P23C 4KXCA 5F3HA 4IM8A 4NBXB 2AFNA 3MRDA 5BV7C 3DSNB 3L1EA 3CVCA 3EJPA 2K8QA 3HC4H 3MRMA 4P05A 5IDJA 1BQ5A 1RZ8B 4FKHA 2OA9A 2WBJD 3SE4A 3GRGA 4JN2A 4GLRH 3TBTB 4DEPC 1RJZA 4G7VL 4QLRA 3KYKL 5FK9B 3RVXD 1UWEH 3VFNA 3VNYA 4Y4KC 3VMNA 1V10A 1DFBH 2DN9A 1K9TA 1K73W 1LWHA 5CM1A 1YMHB 2DQCH 1J10A 1JPFA 3H9HA 2A77H 3ARFC 5EN2B 1DLFH 2FYYA 5AKVA 4JMNA 3V6ZA 1UYWH 2OPCA 1KY7A 2D31A 3OKNB 4V1DB 3E8UL 4EE2A 4NJAH 4JY4A 1AJQA 5E7FA 5EU4A 4DW2H 4ZMVA 1Y7VA 1LMIA 1CFNB 3VWKC 4JGNA 1E5UI 3X3GH 2DTMH 3QDJB 5JHDA 5ESAA 3TBVA 3CFJB 5E6ID 2H26B 4KKLD 1EN4A 1LUVA 3OX8B 1HTYA 1JF1B 4N2MA 4HBNA 1Y18B 2CO4A 2H1XA 5GRZA 2YRPA 5EIQA 1OM3L 5TJWK 1OT2A 2O93L 4OJCA 1E1QG 2BP8A 5I1DA 1SETA 4GG8A 4FKEA 4M48H 4WFED 1U3ZA 2J4WL 2MOGA 1CGSL 3UTQA 35C8L 3I56V 4HKZA 4TVPH 4QRPE 3STZA 2AEIT 2IFGA 3I6GA 4JGUA 5BRQA 3RL1B 5BPPA 1QATA 4XN9A 1JVLA 3LKSA 4PJ8B 1PX8A 2FATL 2BRQA 2EIJC 2Z31B 2XWDA 3C60D 3N9GL 2IBZH 2JIZG 2WYZA 2MCPH 3MLRH 1ET7A 1H2LA 1Q1JH 3QH3A 4JFSA 4LFAB 3DHMA 5EG6C 3WL9A 1KSRA 3PL6C 1XBLA 4PJXA 3SYPA 2NRDA 2CWRA 4PRIA 3LVTA 4BBWA 4GB9A 5MP6H 3GJEA 4LCYB 2YWYA 4HIJB 1CR9H 4X5RA 3BSGA 5KVEL 3LXBA 2CJTA 3PGFH 4H8WH 1UVQB 1M9NA 4Y9BA 5D7JA 3T1WA 5T8IA 1I1RA 1UFGA 2K70A 4JG0H 2SODB 4U0RC 3QIWA 5MI0B 3UIYA 5AKRA 3ETQA 2CALA 2PXYB 3MHZA 4ODWA 4WEBH 5T1DL 1A5FH 1SBSL 4EI0A 4FE9A 5FNVB 1UD8A 4TOYH 3JWDH 1UH2A 2AZAA 3HNTH 4XP1H 4YEFA 4KHTH 3DSFH 3SDAA 4ODUA 3L3DA 5I8EA 3FYEB 4L4TD 1KMIZ 1UT9A 3B9KB 3OWEA 3CWBH 3T4YA 3CBKB 3TNNA 2F7RA 4J7RA 1QFWH 1OSPL 3RX5A 5D7SL 3CNKA 1YF2A 3S0PA 5LQBL 2YQBA 4ZAKA 3VFRB 3VJ6B 4JI0O 1ROPA 1K5WA 4HUUA 4L37A 2YRZA 3GTTA 4XBGA 3TBSB 5C0CA 4OZ4A 1IX2A 3K91A 1O9ZA 1U58B 4GBXA 3BVVA 3T6VA 2WZPA 2E3VA 4P4RA 1ACXA 2PWHA 4YL4A 2NW2A 5EUOE 4FFVC 5JW5A 2WBXA 4YBHA 4AT6B 4IBVA 1FXKC 3OR7B 2Y3AA 2GTWB 3WKQA 4ZODA 1AJNA 1SOXA 3RUGB 1MOEA 3EBIA 3QTCA 5D70L 2X09A 4Y5XC 4IYKA 1V54C 4B3SB 4F15B 3GPEA 5H6RA 2GKIA 2ITDB 3ZTNH 4F2MA 2C9QA 1EZVH 4BHUA 1MPAH 5GRVL 2FL4A 1P4IL 3UO8B 3HUJF 2G5BB 5A1AA 2NY5L 1AR1B 4FEIA 4IGBC 2ENPA 4NAJA 3U25A 1CGYA 4Y9FA 3LY6A 1RP3B 3OHXB 2VDKL 4LEOA 2W0XA 3OSVA 1C5DA 3L75H 2H94A 2X9YA 2P7TC 3U30B 1FH2A 2OAAA 2BMKA 3EG9A 4IBSA 4TV3A 4P2AA 4K8RC 3LEXB 4WW2B 4FMVA 4M5YL 1RIHL 3GPSA 3FB6B 5EU7C 1SNRA 3O6FD 2BSSB 4FG0A 1EGJL 2APVA 3F01A 5L2JB 4QRRD 3QQ3B 1MABG 3ALWA 1NOAA 4ZW7A 4P59H 4C56E 2VH5H 2EULA 3C75A 4X98A 1H6FA 4ZUVA 4DGIH 5HHVH 4XP6L 2VZUA 5BOZG 1CFVH 4Q6IC 2EKSB 4B9YA 4YSDA 1XEDA 2CA3A 1AXSA 3MRGB 1U3JA 4EOWL 1SXSA 1MNGA 1BVNT 4XPHH 3UTPE 3QEHA 2GJ6E 4PW4A 5GJTH 1RVFH 2Y2TA 5E4EC 1QR9A 1KXVC 3V5HB 4Q9QL 3L3JA 2VSCA 4MNQB 1CDBA 1FRGH 4HWNA 5AZEL 4MDRA 1NBQA 5ERWA 5GGSA 5SWSE 4D9QD 2JKTM 2X3CA 5F3BA 3Q2VA 3TJTA 3RKDC 1THCA 3HR6A 1JOIA 1Y6MR 4LLWA 4OFYA 3P40A 2ZZUT 4M1DH 3CDGB 3CRCA 3MLVL 1U6AL 3BA9A 2OTWA 3DX7B 4YPGA 4PJBB 5IVNA 2H4EA 2ERJC 4YE4L 1NWPA 1EEYA 2XWBA 4KK5C 3RVVC 5JPNA 4FQXB 1IC4L 3NRPA 3V5DA 3DJ9A 4NI3A 2L8AA 2XBTA 4X9BA 2YAMA 4OLVH 3EFFK 2FK9A 1BVKB 4ZOEA 1WISA 1SDYA 1K5NB 3DXAA 3OAZH 5DJAB 2NLJC 4BELD 3GMRB 3OZ9H 2W9DL 3HG3A 5AL8A 4S1DC 5B7MA 2PI4A 4AM0A 4CSSA 2WOBA 4QRBA 1ZK9A 1Z6JT 4I4TB 2QQLL 4PV9A 1QI3A 2N3JA 3MJ6A 1S7TA 3FO1B 2EYSB 1SQXH 4U7MA 2YPLD 1MG3C 5GJSL 4XAWL 1S3RA 2BIMA 4ONFL 5KUMA 1RU9H 4HWBA 4MMZC 3JUZA 2YA0A 1YUHA 3KCPA 4HZLA 3QZLA 2YS8A 4OF0A 1PZSA 1FXVA 2AKRB 3MGOB 4NRYB 5HDLA 4LGSB 1QTSA 5KSBA 2F53B 4Q2ZB 4A2LA 3FL7A 3EGXB 1V9PA 3N04A 4ZFQA 3BQVA 1ANUA 5D1ZC 3FCSB 4IRJB 4M43H 2IOIA 2HJKB 1SUJA 1GOHA 3B2VH 1PEZA 2V9RA 4Z0XB 4OZFH 5EYPA 1FVCB 1CI5A 1BQRA 1E30A 3VGEA 5ECGA 2Y06L 4X1IA 5IY5C 4FL4B 4PUBH 1KEML 5EDSA 1IO4C 2LE9A 1Z9OA 3VXNB 1IB5A 2ZOOA 3KCYA 3QCUH 4DPCX 3WELA 4R7VA 3A67L 2VITA 3JV6A 1N33O 3SPVA 2O5ZL 5F9JA 3KBPA 3CHSA 3FQ1A 3TTYA 5A2AA 3WB0A 1OK0A 4RX4D 1ITCA 5F0PB 1L9QA 4ZO6A 1U95A 5EIVA 4RH4A 1TVHA 1HL4A 1GO3F 3VFMA 5AVQB 3H9SB 1OANA 3AXHA 4UQEA 3VQ2C 5GGUA 1SVBA 2BERA 2D7TH 3GSNL 3UPRA 4FTVD 2VDOH 5K9KB 4MA1C 2IU0A 4AIZB 3JAWA 2BVEA 3ZL2A 2JE8A 2KKWA 1MLCB 2B08A 4PYHA 1NGQL 3SKUD 1HEJC 1DF5A 1J9QA 3ILQD 5TFSH 1VFBA 3G5ZA 4LHUG 2CBOA 1BWMA 4K15A 3NIGE 3ASOB 4Z7QF 5D1XE 1AO7D 4W4LA 1OAJA 3KPRA 3N6YA 1X5JA 1T7VA 4WW1A 4JFEB 2RCSH 4WNQA 5BCAA 1UH3A 5FR3A 1O5DT 4RAVA 5L88H 1UCBL 3WFEH 2J2ZA 1BQKA 1GS6X 2EE2A 3CE1A 2YC0A 3IDUA 5MEOB 1NAKL 3O3BA 3QORD 1MELA 1HOCB 4EO5A 2GEEA 4HU8A 2GQHA 3UZEC 3BPOC 4RFEA 4F58L 2XCMC 2EDHA 2W9EL 3IK2A 1AD9B 3JARA 1JPSL 1WIUA 1U41A 1L0NH 3QUZC 2A6KA 5JXAL 2Q67A 3LTVA 2ITCC 1H8HG 1RVFL 4JHUA 4ODHL 2Q6AA 1YJ9V 2AJUH 5E9DB 4AZ8A 4LF3A 3QQ4A 1I3UA 4R7XA 4BZ1A 4W68A 4JRLA 1IC5H 2GJ6D 4HGKC 3FTYA 1DGSA 4AJVA 4F6EA 3QJTB 2CLRA 3UGXA 3IKKA 1L9NA 5AVSB 1I8MA 2WLMA 4GYBA 2GTAA 4UCUA 2B1AL 2WKOF 3OJMB 3U0TB 2KB1A 4D7BA 2J12B 2XV3A 4ORGB 4YHZL 1FXHA 4WUUD 3Q1SL 1FYTA 4A37A 2K9FB 3GXDA 5C0CD 1U96A 3K2UL 4NQCD 5LAXB 4P5TA 1LWRA 4XMKH 2HVJB 3ZK0A 2F7OA 5ILTH 4PVNA 1AOHA 1A9EA 5IMKB 5TE6H 4F5CE 1Q86W 3FCGA 4Y0GA 3PDOB 4HCGA 1R5IB 4WK4B 2C9XA 3FQWA 3CRRA 3SSGA 2EX3A 3B3IB 1KWGA 2BOCC 3ZYOA 3FH8A 1FZMA 1H5BA 1M05A 2H8PA 2IOOA 1QOKA 3P73B 5FYKD 5TTRA 1WAAF 4PRIE 4R3SA 3ZO0A 1H38A 1GZPA 2XETA 2ARJA 5DWPA 5IEHB 4OZIB 1I9IH 1FYTE 2A7BA 2QSQA 5DMJB 2CH7B 4EOWH 4NWTH 5E8NB 4JV5B 1OIOA 4J3SA 3N1PC 1KB9J 2UUCO 3UJIL 1JNJA 5D2NC 2LP7A 4DV3B 3JWNC 4V2BA 1YUKB 3DC5A 4B9CA 1RM1B 3BAYA 3B9DA 4ZS6C 3PXJA 5BJTA 2DEXX 3DIVA 3Q8CA 3CB2A 4NKMB 4I88A 1HNWB 3Q9PA 2VXTH 4TF4A 5IB5A 3PWPB 4XBPA 4PH8A 3BKJH 2NY0C 2Q76A 5DZ9A 1KNOA 1PL3A 2JK5C 4GO6B 3FPXA 3ABMB 4OX9B 5DXWA 1YXBA 3SGKC 3AU1A 3FS9A 2R4RH 4RSVA 4Y5YC 4KKAC 3K8KA 1Q1PA 5CINH 5T33H 1BOYA 4ISVA 1K6QH 2HWZL 1P9MC 2Z0UA 3HHSA 4F91B 1DL7H 4ZW8A 4XP5H 1ZLUH 3OD4A 4FYRA 4YGVA 2VDMB 1FVDA 5GISL 1TSHA 5B39B 1UEYA 5GRUH 3DX1A 3GBLA 4Z7UB 1N6UA 1E6OL 2WGNB 4L4TE 4A67A 3TN0C 3JD1A 5LDSA 3QGVA 3CLEL 4XVSH 2CMRL 2P49B 1W6LA 2K1MA 4OD2A 1F2XK 1KTDB 3ZRVA 2G3XA 4BUGA 3KKYA 3U10A 1DQKA 1IEBB 4RGOH 4EKJA 3PFQA 3QXUA 2BW4A 4FQ2L 2ATKC 5A2CA 1BD2D 4FI7A 1FWXA 4WV1B 4EF3A 3FU7B 3P9WB 1X4XA 2PTTA 2VM4A 2HG5B 4KHXL 3ZGIA 2VL5A 5BXFB 1R5VA 3C8DA 3C6SA 3BFWA 5C0BA 1YEIL 1H3TA 3MBWB 1NUGA 1L3WA 2V2WA 4OI9A 4OFVA 3HG1E 1I31A 2VN7A 3P32A 3WNMA 4IIQB 2NW3A 3MV11 5JJJB 5E6ZA 3CRAA 1F6FB 4DK0A 4O02H 4EFBA 2VYRE 3UDWA 4DN4H 4QAMB 3TZVC 1MZEA 4FMFA 2WAHA 3PWLA 4NENA 3VXME 1A6TB 4ZTOL 4XXWA 5CJ5A 2BOLA 1JGDB 2A99A 5K33A 1CU4H 4Y16C 5A2JH 1I0HA 1WHOA 1R9FA 3QT2A 5I1EH 5AB1A 4JO2H 5LBQA 2WBJA 3S3JA 2PUQT 5FKAB 5E94B 3UTSA 3DARA 1U4FA 2ETWA 4L8SA 4W4OA 1A6WH 1W0YT 3KYAA 3P3SA 4XR8C 3TCLA 4JPVL 4LBAA 1KG0A 4JZNA 4MMYB 4XNZC 3RIFK 4ANWA 1RERA 3RE0A 4M6OH 4JLRA 1PU0A 2BW5A 3TZVA 3LSUA 4XCCL 1D2DA 4FZ8L 3NT0A 4I3SL 5H9CA 3MU3A 3QNZA 5SWZD 3WTUA 5E1AC 5C9KA 4ODBD 1AVAA 1YN6A 2G3ZA 4P9PA 4PWKA 3STBA 3OG6B 1BS3A 1N3NA 2BFVL 2OX5A 4JDEB 4RESB 4HALA 5MP6L 3EO9H 1W8EA 2O30A 3CXHK 3L3IA 2ZOLA 5D7JC 3M17B 3MLSH 4AYFA 4LCWB 5LHGA 3L5XH 1VENA 2OJEA 3HBQA 2V2XB 3L2LA 4YH6A 4I0XA 1AR1D 3P4MA 2NY6C 3QI9A 4E9RA 2G5RA 4GQRA 2BINA 4KK6C 5LUMA 3LX9A 1JCHA 3UO1L 1ODUA 4ZW5A 1JZGA 3T2NL 1KGCE 1T3FA 4F3FB 4DO5A 4RWYH 2CPUA 1ZT1A 3FQNA 1NUFA 2AJXH 2DQMA 2OCCC 1ZIBA 3KYMB 1YEDA 3SDAD 4LSUH 1NSNL 5KSAA 3HRZA 5FUOL 4GG6A 3MV7E 4PD4F 4R7LA 2XQYA 5FECB 2X9XA 2F95B 2FBRA 4PCSA 4OZHB 3PPEA 4QYAA 3FBQA 4U1GC 2FIRT 1ASOA 3MV7D 3ZKSD 3JYCA 4XVJH 1XVSA 3MRKB 4Y5YA 1Q81W 2Q10A 3SDCD 2FH8A 5IBUG 3GHBL 4RLDA 4Z77A 4HS8H 2JI1A 3FFCB 3LH2H 1CD0A 2IV9A 4MB4A 1ZV2A 4QRQA 2QBWA 4B60A 5JO5A 2PW1A 3LDEA 2BC4B 1H15B 3P11L 3LZOA 4JBSA 1EPFA 4Y4FD 3BE1H 4XC3H 3SBWC 3CFKB 4GY4A 4WI6A 4YQXH 2R0KL 5A2IH 4LWSA 3HG1A 5D2NE 5JIMA 1TCMA 3I9PA 1ORSB 1HZHH 5J11C 3BP7A 2FQDA 5FYJL 1O5PA 1TJGH 1R5WB 2B9BA 1LK2A 2K7QA 1IV8A 1BXVA 3CCHB 3V6FA 3M8OL 4ZO7A 4JPIA 4L9LB 5I16A 1JN6A 3S96A 3GBMH 3Q6GL 4U6XA 4MQ7A 3NEOA 4XP9L 1KKDA 1XZWA 2GUZA 3GEWB 5T3ZD 1KPVA 1VGEH 3SJQC 4L8DA 3PJSK 1F11B 3BWAA 1AS6A 1S7RB 5IWAO 2YAQA 4LIQL 3BYYA 4ZHQB 3ZPDA 1AGBA 2OYMA 3WS3B 1JZ8A 2G2RB 2IMNA 1G7IB 2ZUQC 4JO1H 2RJMA 2VLKA 1PBYA 1EERB 3NIDF 3S5LG 1FFTB 2AMUA 3DMMC 4DCQB 1CVSC 1GGTA 4QRAA 1T83C 4JX0A 2WWWA 1DSYA 1KBPA 3KDPB 1A8ZA 5AAMA 2ICES 1G6VK 4EIZC 2R23A 3BI9X 4JFXA 3O81A 4JFHE 3IC7A 3HAEH 3GSXA 5C0DB 4GX5A 4AUUA 3QG7L 2X41A 4XRCB 2YDEA 1I8LA 3D0VA 3D0LA 4KTEL 2K4AA 5ICXA 1T6BX 3FBKA 3WDIA 1R3HA 1B90A 4JO1L 1OWRM 4J4PA 2F68X 3RLSA 3B4NA 3OAUL 3SDXE 4KKNA 5L7XH 4QE7A 2FJFB 3D34A 1XCWA 3A67H 1HNZB 1DCEA 4ZPVB 2QADD 2FVNA 4JZGA 3KR3H 1FL3A 4MRCA 5DR5L 3V95A 3WIHA 4GAYB 2D3NA 5FUZH 3BVXA 2HFEA 1WCBA 2VDLB 4Z78A 3NJGA 1AY1L 1HOEA 1I7TA 1O7SA 5DYFA 1S7WB 5C0FA 2BIOA 3NCJH 2BIPA 4NBZB 4BRJA 3GJEB 4LCYA 4UIMA 1QHPA 3H4HA 2RCVA 2VR5A 2WWNA 2D0GA 4GI8A 1QLNA 3LCYA 5DZNA 1JPTH 4Z6AT 1JWUB 1U21A 3ZBHA 1X5ZA 3ZE1B 3GIZL 3QIWB 2N1TE 5AW1B 3EAKA 5FLUA 3OUFA 4ODWB 3OM3B 2P5WA 4JS7A 1QVFU 2QELA 1SPDA 2QV4A 4PJ0Z 5E1AB 5EZYB 1L0LH 4H7VA 3TO4D 3FXIC 1PTZA 3GMOB 4NQEE 1H9DA 2WQAA 4GXVL 5DO2C 5HYIA 5G2NA 1AZNA 4S1RH 4QNPE 2JB5L 1W72L 3V4VL 5K5YA 4GP5B 4XNZB 4Z7UE 4JR9H 5EDXA 3CSYB 5D1QD 3LDDA 4X20A 2O26U 4AVKA 3U6XS 5CBHA 3FH7A 4FXKB 2H1PH 2A4EA 4AKQA 1NFKA 2PTVA 1IAII 4WBNB 3FB5A 2IC2A 1TZIB 2FKXA 1HI6B 2WNKA 5LCVL 3RQ3A 3GLZA 3V0FA 4OZ4B 4YBQD 1MJUH 4PWFA 4BUQA 1QLEB 3CVHB 3S37L 4AT6A 3ARED 1S9XA 3MV8E 3ZKQD 4JI0B 2DWXA 2EEBA 3TP4A 4LR3A 1J1XL 4P2QE 4X5WB 2UVEA 1N6VA 4OLEA 1X5MA 4UT7H 4U1MB 5D1XC 3WO4B 5INDA 1EAPB 1PZBA 2JCWA 3GSUA 1XIWA 1NTMH 4E4EA 1A1OA 1T5EA 1DVTA 1ZRUA 1NC2A 2XN9A 4WV1C 3L73H 5DD1H 2ATKB 1KECA 2Q86A 4NC1C 2XWXA 5HHVL 2Q6WB 3U0PA 3GLDA 1NGZA 4GPVA 2QHLA 4Y4HD 4KXDA 1FL5B 1EIBA 1XREA 3G80A 2WHVA 2YARA 4G80B 3FCTA 4R2GC 2L04A 5DHEA 2L7EA 3W9EA 5AOJA 2KZKA 5CEZE 12E8L 3OKDB 2UXCO 3Q06A 2Y6SD 5JPMB 1E4KA 4XBEL 5J2TA 3WIIH 2X0LA 3IC9A 2EJRA 4RWUA 2JLLA 1JSYA 3D3IA 2WV3A 3KH3A 4EEEA 3VFSB 3E38A 2QPFA 4YIQA 3RDTA 4O4YH 4Z7NF 5J06A 3FUMA 1RZIB 2FH6A 5F0JB 1K34A 2BOBB 2VO8A 1L0YA 2DE0X 1EJ6A 3ABMC 2UXXA 4YHIB 1NCWH 2C7FA 2DICA 4B41A 3K6OA 4BFFA 3K6IA 4WHYG 5F7DA 5JQIB 3BEWA 3UEQA 2UUAO 2CCVA 2L0DA 1E9PA 5JXED 2Y1YA 3L7EB 4OLXL 2JJSC 5E4OA 1AIFA 3LQZA 1UFIA 3VSTA 4GSQA 2X6VA 3G08A 1ROCA 4LF8B 1F00I 1AVMA 3LHAA 4JN1L 1G9ML 1CICC 3QFGA 1IXBA 4HWZB 4G6KH 1R46A 3LNGA 1M57C 4ZO9A 1D7DA 3HJEA 2YD8A 3QDGE 1VGKA 4MS2A 2KQMA 3VWJA 2DS4A 4ODVH 4PRHE 1MOFA 1G1YA 4PJBE 5JZ7C 3DTXB 5INCA 5EIBC 2Y1AA 1DBKH 5AZ2H 5EHFA 1PX4A 1BT8A 1NCAL 3EJQA 4EI6A 5ID1A 5LGUA 4YJ3A 3JZ7A 3IDYC 3LDBC 1M53A 2UZYA 1DE4B 4CS2A 4HEME 4NZTH 4K3HA 4XCEA 1HWYA 3DUSB 2HRGA 1P49A 5DWUL 2UY7A 4IKLA 1E6OH 4KJPC 2QGCA 4LASL 1RPKA 2X6AA 3OKYA 5KBPA 4PB9L 4X2UA 1I94B 3QXDB 5DJAA 3F00A 5CUSH 4W93A 1CFSA 4MA8L 5CP7B 4APXB 3ARTA 1DSFH 3TWCL 3DV4A 2Y3NA 4HIQA 1DSFL 1S5HA 2WO2B 3G6AB 3LN5B 3TWCH 3PJLA 3BZ4A 1YYCA 1ZLUK 4RAUB 2UXBO 2HWZH 4PB9H 4GUCA 4MVBC 4WW2F 4M62L 2CLVB 3N44B 1A6ZB 1IGIH 4LRNH 4Y2DA 3ATDA 2OSWA 4URKA 3L7FA 2MQ0A 4XNQB 4ODXB 4G6JL 3MREA 2JELL 1OCZC 3K0DA 4UQDA 4IYIA 3CZKA 3TCXA 4F7PA 5FXCH 1JTTA 4ZDHA 2WWMD 4JYAO 4IBTA 1QR1A 4GXFA 1CZ8L 1NGPH 3GHPA 3PGFL 4H8WL 4F7TB 4O4JA 1EBAA 43C9A 1FNGB 1PQZA 3FT1A 2GJ6A 5D5PA 2ZCLL 1BMFG 4U33A 3CZLA 4QOKA 1BHGA 4OCNC 2AJZA 5DJ8A 4DZBA 1MHPH 3WIAA 4AKOA 2FQFA 1OGAB 5JDJA 4UOQA 1YJDC 1PIGA 4IKNA 3OW2U 3V6BR 1NMCC 4ALAH 1J5OL 2VDMH 4L8CA 4R96A 5DK0B 1K4DB 4BKSC 4LKCA 4IHJA 4J7ZA 4G1MA 1SXCA 4NAMA 1L6PA 2EIZB 4J6RH 2GJZA 1MREH 3LQAL 1C5BL 3Q5YA 4HH9A 1FFXB 2GSIA 3T8XB 1PP9H 3ZN0A 1AFVH 3RDTC 5CCKL 1RUKL 4YHKL 4PRPD 3DO3A 4N8PA 4I0KA 3B5GA 3V5KB 4JAAA 4TNWK 4I1PA 3H85A 2BNRE 2D73A 3LZLA 4K0KO 5IB3B 2R1XA 4L1LA 6PAZA 3WU2Z 1KYAA 1S3KH 1Z5WA 5FO8B 1TAEA 3T3ME 4LSVH 3IGFA 3UBXB 1TUEB 3LSSA 3QPQD 4AQEB 3KNBA 1T6VN 1AJ7H 3IS0X 4U6HA 5IJCC 1HEZA 4TUYB 1PIFA 1XUQA 4PJFE 3QYCA 4IOIA 3RWCA 1R6TA 2P47B 1VB9A 5KAFZ 2VDLL 3MNWA 3ISRA 3QNFA 5LAPA 4JGSA 4NM8H 1KACB 4C59B 2B1HL 2ZONA 1EX0A 2RHEA 3ZBMA 2NY1B 1XR9B 5LWYH 3GC3A 4OJEH 1GM8A 1NC4A 4AX3A 4H2CA 3OQ3B 1I4FB 1D5IH 4BH7B 3JT0A 3HC2A 4TQEL 1ZA6A 2EEXA 2H3NB 3DXRA 1RUML 1JPSH 2UYLA 4EDXA 4GSDH 5ESVA 5CZRA 4N8VG 3BIKA 1F3RB 1NQBA 4UNVA 1A7QL 5IQLA 4DV5O 2XWTB 5IMLA 1O6SA 1Q7YW 2MNJB 3RBZA 5GSRA 4E9XA 5D2LB 1VQOV 2E7MA 1MJUL 4JFQA 4G2KA 3EZ8A 1CDIA 1WA2X 5DZJA 1KCUL 2P8MA 1NTKH 1OW0A 4QO1A 3DRTB 4Z7WB 1U2CA 1EV2E 3LKQB 1P1ZB 3INUH 5HY9B 4UCRA 5JIHA 2L35A 3PN1A 4I50A 2IPTL 4OBRA 1KP3A 1Q0YH 3AY2A 1NBYA 4YN3A 4FK5C 5TF1H 2JKXA 4AZ8B 4B9GA 3WKNA 1INQB 3KPQB 4KV5E 3LS5L 4OH2A 1CBVL 3VRLF 2N7AA 2C8NA 3OGCC 2W8CA 1MWAB 5DQ9A 1MCLA 1B0GA 2F58L 1I08A 1AQHA 2ESVE 2OFQA 1X6LA 1RIUL 1UWXK 4Y4FB 5KJRL 1FQ9C 1RK1A 2MCG1 3IDIA 3RY4A 3L3OC 1O7DC 3VWKA 2P8PA 1JP5A 3VH8A 4N90E 2BIQA 1AZCA 3KG5A 4ODTL 1EFXA 4PFEA 1VF6A 1VEPA 4YGAB 1WH0A 5FV1L 1HDMA 3UTTD 1KCRL 3OLGA 4ZXBC 2ENSA 3VTAA 1KC8W 4IOSA 1AI7A 1A9BA 2PR4H 3SDXA 2WZ5A 1DBBL 1A0QH 3IF1B 2XU9A 3I3EA 4NLHA 2I7OA 4PJHE 3ZRCC 3RYIB 5SWSA 1EK3A 3WDJA 4MXWH 2EDBA 2RQ8A 2P3YA 2E6PA 4FJYA 2XBDA 1XH0A 5CEYA 4JANA 5CJXC 4M03A 4DR3O 3D39E 4YEEA 2ARWA 4YUEH 3FB7C 1NM9A 1H3WM 3KS0J 4GXUN 3F05A 2E76C 3HLAB 1M05B 5F7NC 3NCXA 4MSWB 5IW1B 4TULH 2Z3YA 2BNQD 3H55A 1J8HA 2VJ8A 4NP9A 1F23A 5HP5A 2VN5A 2Q9LA 1OP4A 1IILE 3GEFA 4GUQA 1HHJB 1JHTB 2QVIA 2VLJE 3IJ8A 5G4MA 3UBHA 2DH2A 2MRYA 1FJGB 4GYCB 1J05B 4A7GA 3RYCB 3E86A 3RUGE 4G83A 4YIPA 1WBZA 3DGGA 3BN9D 4D0DA 1DUZA 3LN4A 4AGOA 1JXFA 2NSQA 1ZJAA 1OSZB 2WXPA 4OM1H 1LD9A 1C08B 1V3JA 2OJZH 3NSDA 4EMZA 3WNKA 2CGNA 1X9UA 3CN1A 4NDMB 3T4DA 5BS0D 2GW5A 1XEUA 2OMUA 4G6AD 4ALAC 4LF7B 2JV6A 3HB3B 5I5IA 4DUZB 4HCIA 1CDHA 3WN5C 3FU9A 3GWJA 5CLWA 5IHBA 3DBXB 4PV1B 3G6DL 1RLWA 5I8CB 4PBDA 3B3BA 1OCOC 4S0TD 2XZAH 1AQDA 3B6SA 1WLEA 4GT0A 4UB0H 3QRGL 4K7FA 1AANA 2EZ0D 4NNPH 1QR4A 3LN9A 3OHXC 3RIAF 1AGDB 3ZE1E 4IGBB 3TA3C 1MHCB 1AR1C 3MV8A 4ECNA 1DUYA 4NRZB 4CBZA 4TRPH 1ZEAH 1KB5A 1OP9A 1QFOA 2AJSH 4FNTA 1NCBL 1QWHA 4NQUA 5B1AC 3VQVA 4S1QH 3CD6V 5BXFA 5J9PC 3JATA 2GAZA 1RV6X 4AH2A 2YPLA 5D7IA 1V54B 5F7YC 1BOGA 5HFLA 2EIEA 1ZV9A 1TCRB 3IE4A 2B16A 1OAKL 3VGHA 4KNTA 2ZUTA 2XTJD 2CR3A 2DLFH 1FXKB 3OR7C 1D9KA 3CC5B 3HEIB 2I32A 5KSUA 4H5SA 4HC1L 3BKYH 1NCJA 3D85D 4MAYC 1P7BA 3V0WH 4MA3A 1M71B 3SCMB 1A6TA 5KS9A 2J3SA 1OGSA 2VDLH 1IVLA 5E1HB 2R2HA 1X7TA 2EH7H 3IKCB 4XB3A 3ULUD 5EU5B 3IXAB 1T1ZA 2O5XL 2EZ0C 2JXMA 4FLQA 1DVZA 5DMKA 1FZKB 2WSPA 4NKIL 2IQAB 4JZ2A 2EO7A 2C1OB 4OZGB 4L8SB 1J8KA 1EXGA 4J10A 1DQJA 2APFA 3HRZC 4AM0Q 2J8OA 5JYMA 3BFOA 1JZ6A 3LD8C 3ZUCA 3JV5A 5C3IA 4JDTH 4PJEB 4ERSH 1BF2A 5EC1C 3G9AB 4DR6B 2IWFA 2OTUA 1UH4A 2F74A 5B8CB 2V8MA 4TSBH 4L4TA 2PCFA 5EA0L 1PNDA 3QI9C 4U1KA 4PELA 3O45B 2HLFD 3FTSA 3BEVA 4GSDL 4U0RB 3EYSH 2R4SL 4RAIA 1AS8A 3L3IB 2VRZA 1I9EA 3FK3A 3FU8A 5GS0H 1T66D 2WTRB 3RI5K 1D5IL 1M2VA 3L5XL 4YDZA 3NFPB 2MQCA 4PRHA 4M7ZC 2A6DB 1SFHA 3FTGB 2XIIA 5EH1A 5DEDA 4HIEA 5MHSD 2YI9A 1RHHA 3LPWA 4FRWA 2G0KA 4MNQD 4DFIA 4J3VA 2GI0A 1TO4A 4N68A 3TBVB 1FC1A 3BHBB 4NQEA 1YEDB 2PLTA 2BSKB 2VW4A 1Z5VA 4C4KO 1I94O 2NUPB 4KKQA 3GBDA 3TJEL 3ZTDC 1AI6A 1Q6IA 1N8ZA 3VI4E 2R9AA 3AG1C 4IBYA 5FECA 4K3DH 4AEEA 1JNHA 2DMKA 2ZUXA 3JSLA 4YHNB 1QHQA 4WRLA 1GKFA 1WWAX 4IIJB 3ROOB 1CGWA 3BO8B 4EIBA 3FFCA 4HUKB 1F5WA 4G7SB 1S7XB 1P4LA 4NZUH 2RJZA 1VFAB 2J88H 3CFIC 3UG4A 4D0CB 1E2VA 2CNYA 2VISA 2ZKYA 4H40A 4K3GA 4WFGA 4N0RA 1YO4A 3KPSD 3QC5X 1RPQA 4QWWD 3L3GA 5TDNA 4J12A 5EOCJ 4JFOB 4G5ZL 3TH3T 1NCAH 2YD3A 1JGLL 2ZIMA 1NPJA 1OCCC 4JI8B 3ELQA 4JKKA 4LWSB 1R3IH 2JLPA 2LFSA 4R4ND 5ICUA 2ICEB 2AC0A 3BP7B 3OZLA 4GAGH 2EQDA 5JHMA 4GAGL 5T1MA 3DIDA 1UZGA 2XN9E 2AITA 4FCAA 5ES4B 2OR7A 1E7VA 3C5XA 4G6KL 3AAZA 4HJUA 1ROWA 4JQXC 4U3JA 4Y5VB 3O3DA 1XIWD 3TN0A 4HPHA 3CC7V 2N56A 1I7UA 5CD5C 3LXAA 4Y4KB 1P7QD 2ZX7A 1EUUA 2KC0A 5JIDA 5FK9A 1JERA 1KPVB 1PNCA 5K1PA 3CXFA 2H5UA 3L2MA 4PIBA 5E1IA 4HUVB 4PJEF 4Z8FH 2PYFA 2APSA 3C5JA 3AS2A 1MN4A 5DA0B 3UL4A 4X6DA 3KJ4B 1NCWL 5BV7B 2ZCZA 2G2RA 1ORQC 4KNUA 1KXQE 2BZCA 3D39A 1MCPL 1IGMH 4WO4B 5J12B 2KMWA 4P3WA 1A7PL 2A7WA 2X2HA 2F1MA 4G70B 5I1KH 4JCLA 3ESVF 1MCSA 5K93A 4ZMWA 5EEZA 1KPUA 3GMNB 4XT1C 5I1CL 2YMOA 2R72A 1BMWA 1QLRB 5DJCA 3QDMB 1QG3A 3QDJA 1EEQA 2XV2A 4ZFOL 3ZHFA 3PHOB 1JK8A 5EPMA 2DM2A 5GS0D 4I4WB 1OAQL 3OX8A 3EO1A 2FBJL 4J1UB 3O8XC 3U46A 3E6HB 1WB8A 1HINL 4KZEL 2XFXB 2QTSA 5ID0B 4TL4A 2OI9C 3T0AA 2X42A 3RYHA 3NZSA 4XNYH 1YVWA 2EIMC 3GTVA 4ANVA 2MNUA 2Q2LA 3QULB 1LMKA 3STZB 2GY5A 4JB9H 5FB8B 2PI5A 5LHDA 4JI3B 1WAPA 1ZSDB 5EF3A 4HJTA 4JRXD 4BWWA 2PF6A 4FNPA 1BEYH 1NAMB 1ND0B 2FX7H 3QUYC 2BMKB 4KK8C 2GB2A 4LF4O 4FNQA 4JKWA 5BW7A 3CXDH 3P77A 1BZOA 4QKXB 1Q9LB 5FA3A 3SGJA 3P3NA 1U8JA 1T5KA 1TYEB 4HHAA 3VFPB 3C5SA 3S3XA 2NY7H 5AOZA 1NC2D 4XWOD 3S34H 1I5YA 1YA5A 3VM5A 4CVWA 2VXUL 3ZIAG 1NPNA 4DV6B 1MF2H 3CU7A 2EVFA 5EEXA 3AW5A 3WJLC 4AEIH 3NR7A 5EC1A 5LNDA 1K33A 5B5EZ 1CC3A 3CIAA 3IWUA 4Z95L 1VHPA 1MWOA 2NY2C 4X8JA 1NDMA 5L4IA 3QDME 3L3JB 3X1NA 4CBPA 4EI5A 5EIIA 3LB6D 3FB5B 3OB0K 4DUXA 1J1XH 1WQVT 2IBBA 5F3BB 3GRWA 3SZ6A 2W9EH 4L37B 4R5TA 1ZSPA 1ETZB 3ECBB 2AJSL 5JWPA 2P26A 5C0CB 4TXVB 4R7NA 3QUXB 3MRPB 1TT6A 3BQUB 3ARBB 1QMUA 1C12B 2AVFA 2ED9A 3KYNA 4CC1A 1CFBA 4JY6B 1OTSD 3BD5A 2KS0A 2DEWX 4NJ9H 1SVZA 5DQJA 5IM7A 4HT1H 1YEWA 4ZW6A 5HVFB 2CLZA 5DTFB 3B40A 4BQ8A 4NN5C 3JVGA 4M61B 4TNVF 2YMXL 4OGAC 3AK3A 5SWZA 5GZOA 5EIBD 3UJTL 4HXAH 4DV0O 2XN9B 4PJ8D 1T5WA 1WZAA 1S9KC 2FQGA 3CHXA 1XX9C 2Y69C 3NFSH 4X4YA 3UBXG 5JW4R 4FQLL 2YKLH 3D18A 1AHKA 3O4OC 1N36O 2AJVL 2OL3H 2ZXCA 3VVVA 2VDQB 5IHUH 4C56D 3ZUNC 4AMWA 3B77A 5TE4H 1ZV5A 4AQYB 3OGIB 3B2PA 5BVPL 2F4VB 3W9EB 5G5DB 4R5VA 3DBSA 4L4VA 3ESNA 1OAUH 1WFUA 4IBQA 3PWPD 3DOIA 2WO4A 5AG8A 2VLRA 5CMAB 4RMQA 2V17H 1ILUA 1NCCL 4FULA 1JZHA 1JPGB 2JI3A 3JBG7 2HLFC 2FO1A 4HK3J 4PP2A 1P7QA 1N5AB 4LEXL 3NIGF 1IX9A 2AS5M 4Z0XA 5EYPB 3QQ3A 3CN0A 3ZRSA 5T1KD 3S3SA 4N0YH 4X98B 2QDOA 4UM8B 1WP6A 4LH6A 1O7DE 3K2IA 3B9KD 2IBZX 3GUFA 2H45A 2GBTA 5A2LH 5IV2B 1QSEA 2XAQA 1S2EA 3L54A 4OI8A 1NI8A 1QSZA 3F5WA 3OAUH 3JT2A 4Z7VB 4DR1O 2R7EA 5AQ0A 4OCMC 3QDAA 4KDTA 4LCIH 5KVFE 3VWJB 4CC6A 5FYJH 5ERWB 3RYMA 1KLUA 1CLOL 2DYRC 4P3CL 3MROA 4HEMA 5E6RB 5I19L 4ASUG 1IARB 5C93A 2MMXA 4OGQB 2P5ED 4U4BA 1TKWA 3O41A 1G9EA 3O3UN 2ORBH 4M1CC 3WE1A 4NNXB 3Q3GB 3SE8H 4A6YH 2WKLA 3HTLX 3RPIA 4IS6A 1FYJA 3SGDH 2QZQA 5GJSH 1KTLA 2KPWA 4FF9A 4QT5A 4AC4A 4UVBA 3BP5A 3VRJA 4BFNA 5CJXA 4H2AA 5IBTH 3WSQH 5GSVA 1T2XA 2NLJA 4N0YL 1VP7A 2E74C 2O5YL 3U4BL 3QZBA 4PEEA 2HHHO 4NUMA 3GBNH 4HAMA 2H6PA 1DO5A 4WHTA 3R8QA 4AGMA 2XWEA 3GMRA 1BVZA 2IGTA 1L1FA 4F4LA 5F21B 5JPNC 5IKCA 5B66Z 1AGFB 1R3IC 4PJ9A 2ZF8A 2LTQC 4YSAA 5IFAL 3MJ9L 1E0OB 1CL7H 3DX8A 5TH2A 2A4ZA 2JTDA 4XNQA 2EYSA 4J23A 4N5UA 2A73A 4M7LL 3PWNA 3EYUH 4P2OA 1UM4H 3WFZA 4KMTL 1J1OH 1EZLA 1KTKE 4GNKB 4NO5B 1LP9F 4HIHA 3UABA 3NAAL 4X5XB 1QR1B 3AACA 2AABH 2RGSA 2ODHA 3JWNG 4GW1B 1E8YA 3TO4C 4F7TA 4X65B 1NUDA 2YIDA 3HZVA 4NTWA 3QO0A 3UYPB