1N4CA

Nmr structure of the j-domain and clathrin substrate binding domain of bovine auxilin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
182
structure length
182
Chain Sequence
GPLGSPEFSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxilin
publication title Structure of the functional fragment of auxilin required for catalytic uncoating of clathrin-coated vesicles.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 27
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1n4cA01
2Y4TA 1N4CA 1XBLA 2N04A 3APOA 3UCSC 1FAFA 1NZ6A 2GUZB 3BVOA 4RWUA 2CTQA 3AG7A 1BQ0A 4J7ZA 1GH6A 2DMXA 2EJ7A 2N05A 2LGWA 2QSAA 2QWNB 2CTRA 2QWOB 2DN9A 2M6YA 2CUGA 2YUAA 2QWRB 2QWQB 2Y4UA 2QWPB 2L6LA 1HDJA 2YS8A 3UO2A 1WJZA 1IURA 1FPOA 2GUZA 2LO1A 2PF4E 2KQXA 4IT5A 4J80A 2CTWA 1BQZA 2OCHA 3APQA 3UO3A 2CTPA
chains in the Genus database with same CATH superfamily
1Q82W 4DR5B 4UCRA 4MVMA 2X6AA 2W6JG 1AB3A 4OPHA 1XMQO 2WLLA 4HYOA 1TA8A 2WLIA 5EZYA 4DW0A 3ZMUA 5EBLC 2PI5A 2F4VB 3T4ZA 3R66A 4LH7A 3ABUA 3G4SV 2QWPB 3JD3A 3UO2A 4J9ZB 5LBQA 2HJDA 2W6IG 1WB8A 3VBBA 5EBMC 1AP6A 3WB2A 2N04A 4X88A 5LYJA 4IIJA 2E74B 2YXHA 1XL6A 5KA6A 1WLEA 5LP6C 2GTAA 3AK1A 3RYCA 3G6BA 3K0GA 4W4KA 2CH7B 3CP1A 1Z5WA 4Q6GA 1K4CC 1F4MA 3P3NA 5L3DA 1AI7A 4MVQA 1YTFD 1RFYA 4O4IA 4DR5O 1F4NA 4FFBA 5IYDO 2BE3A 2F66C 3VQXA 1L0LH 4O4LA 4Z1MG 1GH6A 5H6RA 1ZL8A 3G6EV 1UJWB 3FX7A 4OXSA 1VQ9V 4DR3B 4J42A 4ASUG 5JCOC 2P90A 4X65B 2F4VO 1RM1C 4B3MB 4DV3B 4N23A 4O4JB 1M57C 1M56C 2ODMA 1IURA 1OJHA 3OTOO 3E35A 2Q0OC 2QKSA 2H94A 1YHQV 2MW2B 4TWKA 2OCCC 3SDLA 1U96A 5KHJA 3OUFA 4JI0B 3E2EA 3GB7C 1YJWV 4L8JA 2XAQA 4TUYB 1HNWB 3ASOC 3BY6A 5EK0A 3SYOA 3A8TA 3TGUH 1YEWA 5LP6B 3DTUB 4DYLA 2UUBB 3DSQA 4DR3O 5ITZA 2YC0A 4PELA 4B3MO 3L9DA 5J2TA 4DV3O 3OTFA 2CDYA 4TV9A 1G4YB 3HKDB 2UU9O 3E89A 2X6CA 1L1FA 1Y4MA 4CH3A 1ZTEA 1N0NA 1FYJA 4H0LB 4MVZA 1R73A 4JI0O 1E1QG 4FIPC 2IU0A 1PNMA 4KHPB 1M56B 2Q68A 1HNWO 1UFIA 2A3QA 3UQ8A 1KYOF 2YUAA 4WCEV 1EZVH 1NS1A 3CCRV 4L87A 5CB4A 3QO5A 1DF4A 1SRYA 3TJTA 1NJIW 5BR8B 1FFXB 3QNEA 2UUBO 1OCOC 4JAVA 5JQGB 1AROP 1QCEA 1SKVA 4JPRA 3FB5C 4GX1A 4H37A 5E1AC 1W0JG 1XMOB 1JX9A 1URFA 3OR7C 4TV8A 1X59A 1O9HA 3D36A 3MDSA 3OGCC 4UUJC 4MW8A 3E86A 2PY5A 4KHPO 5LMUB 2EILC 1WPBA 4LR3A 3U0ZA 3RFRA 1TUBB 2DYSC 5KMGA 1K3EA 5H2FZ 5C8YA 1HW7A 1Y76A 1ORQC 3BA8A 5BXZA 3A0RA 2Z5UA 2PI4A 3NR7A 1QHTA 3E8FA 3ZRSA 5A2QN 3TXSA 4TQFA 1IBKB 5GTHZ 4Z2WA 1JJ2U 1XMOO 1AILA 4DV5B 4PV1B 3OUSA 4IHJA 1SQQH 2JJ2G 1HWYA 1N33B 2IBZH 3B2EE 1SZXA 4I4TB 4NXNB 4I50B 1OCOB 3K9AA 1ZAUA 5KA5A 4MVRA 3FB6C 3JSLA 3ABMC 3R65A 2ZE8A 2UXNA 4J9YB 5EYPA 1MZFA 1OCRB 5L3EA 2YS8A 3B4SA 2WLIB 4DV0O 2ITCC 3Q4HA 1OV9A 5H5NA 2EILB 5LHHA 2DYSB 4W4LA 1BL8A 4DV5O 1JMKC 3GWKC 4NVPA 5LYJB 4IIJB 4G2KA 4NXNO 1J5EB 1KUQA 3RYCB 3S3WA 2PZSA 5IY5C 1XNQB 2WLMA 4O2AA 4DR1B 5IJ0A 4AHCA 4O4IB 4MS2A 1NTMH 3SYPA 1XDCA 3JD0A 3LDCA 5JWPA 4FFBB 4FLXA 4RUFA 3IC7A 4WF9V 3CYOA 4O4LB 1NR1A 3LDDA 1ZL8B 3ABMB 3B40A 3KCXA 4DUYO 1K34A 2ZE6A 4P9OA 2CTWA 3KCYA 2QM4A 2VWKA 3SYAA 1Q8IA 3BEHA 2DJVA 2PGGA 5BY1A 1MZEA 1NU1H 2GSMB 5EBWC 1J5EO 3CWBH 4G28B 1H2KA 1J95A 3CXCU 4UB6Z 5KHHA 3DXRA 2ZIMA 4BAYA 3N27A 2YIBA 1K8AW 3H1IH 2OIEA 2E3CA 2ZIOA 2N74A 2Q7HA 2ZR2A 2CTRA 3K58A 3K5LA 4B3RB 5IY5B 2HVJC 5BZBA 1R3JC 5ITZB 2R72A 4FVMA 1K4DC 5J2TB 1MA1A 1S3JA 1R3KC 5EIBC 2GDSA 3CCLV 1CXZB 4TV9B 2YIAA 1A32A 3ASNC 1BS3A 1WB7A 2EJ7A 4AQYB 3TK1A 4JI5B 2QTSA 2JEXA 1QBZA 3E8GA 3T4DA 2H8PC 5IYZA 2ZM6B 4R8CA 3UO3A 4PI2A 1SS3A 4K8XA 2CE4A 1B3QA 2P7TC 4MT8A 3IC9A 3SPIA 2VS0A 5CB4B 3ABKC 1CEZA 3K5NA 1W2BU 1BT8A 3L70H 1H2MA 2CAZC 4B3RO 2DQ0A 2UXXA 2XTAA 4DR7B 3M7MX 4GX2A 3CRQA 4IT5A 5FNVA 2Y69C 1NH2D 3ZJZA 4TV8B 3KG2A 4JI5O 1GN2A 1Y6XA 4K3AA 1JPXA 2DYRC 1PV0A 4MTFA 4RQEA 3ASNB 3ZIAG 2ZNJA 2ZM6O 4DUZO 2AW9A 5KMGB 4UCTA 2EIMC 2ZXWC 4DV1B 3CD6V 5C8YB 1IBMO 1Y76B 3EXAA 1FD9A 4HNAA 2AXTZ 5GTIZ 1AR4A 5DECA 1EN5A 2G38A 1YF2A 4DR7O 2ZDIA 4JYAB 2W0XA 1GN4A 1XILA 2ADQB 2IU3A 1HNZB 4PA7A 4F4LA 4QPKA 5CMUA 1Q6UA 4IHJB 3H9VA 4H44B 1SC5B 1D2DA 4XDLA 2DMXA 2UXCO 2ETNA 2UUAB 4PA9A 2ZCEA 3OR6C 2Y69B 2GBOA 5IE9A 3CC4V 5EYPB 2OYQA 2F95B 3SR2C 2WLNA 4DV1O 1N4CA 3K3WA 3QVNA 4BWAA 4UVCA 3ZHSA 1BSMA 3SJAC 2Y48A 4X66B 5JJJB 2EJRA 2Z3YA 2NR5A 4JYAO 1LNQA 3ZMVA 5JJEB 1QLEC 1HNZO 2WSSG 2YXYA 3M8AA 2EIMB 3VOUA 4MTOA 4OX9B 1XOUA 2EINC 4HBNA 1TAEA 4JI6B 1BMFG 4CZZA 3APOA 1WP8A 3DC5A 1BQ0A 2UUAO 4A5UB 3L74H 4IYIA 1VQ7V 1SERA 4O2AB 5IJ0B 1MSWD 1WA8B 3RBZA 3BCCH 4IL6Z 2UXDO 3E83A 1SQXH 4TSFG 2Q5ZA 3AK2A 4U7NA 4DV6O 4UVAA 3CCJV 1Z5VA 1GM7A 4QIWF 2Z0AA 4X66O 3THOA 4UXNA 3WG7C 1VQ6V 3FYIB 3LSUA 2Q4PA 3U10A 3DGEA 2R9AA 4O4HA 1G8MA 3L71H 4OX9O 1IDSA 1Y74A 4QE9A 3U11A 3W7WA 1N32O 5H9CA 3SPHA 4JI6O 1NKDA 3QO7A 4JI4B 3UCSC 4QNHB 1WPXA 3DXRB 1K73W 1TVKA 2YXLA 3RYHA 4B08A 2QGNA 4P2ZA 3I55V 4I5SA 4MVUA 3T1YB 5KHIA 3CRMA 5L3GA 1Q90D 5KUKA 2PYLA 3CCMV 5B1NA 3TCUA 4BIOA 3J81N 4EB6B 4BR6A 3CPWU 2ZKOA 1XEQA 4J11A 4FZ1A 5LXTA 4DW1A 1I94B 1PP9H 1V54C 2JIZG 3K08A 3WG7B 2JS5A 4JI4O 2QDOA 2AZ2A 1GK9A 4EFEA 5IYZB 1GKFA 2ZDIC 1ZUQA 4JI7B 5KHGA 2B5UA 2RN9A 3K5MA 3E8BA 1EN4A 4LC1A 1AJNA 1KD1W 3JSNA 3M99B 1Z2GA 2ZE5A 2F23A 3T1YO 3CB2A 3AK3A 2Q69A 3FYEB 1R3LC 1SETA 3X2QC 4YJ3B 3L73H 2EZOA 5FNVB 2IW5A 2ZT9B 5CA0A 1U97A 1FXHA 5CA1A 4X65O 4WFEA 4G27B 2RMKB 4DR6B 4FZ0A 3MAQA 2E5LB 1CP9A 3ZCCA 1H2SB 3CX5F 4LF9B 5LGNA 2RCVA 1DGSA 1SQFA 4X89A 4JI7O 2BOCC 3BPZA 3SJQC 1K7DA 2ZD9A 1RM1B 2Q9LA 1VF6C 2XAFA 4GX0A 3CRRA 4FLYA 1M57B 1MSDA 2Q7EA 4HNAB 2CUGA 1UPGA 1AP5A 4TQDA 2OCCB 4GCZA 2VRZA 4H13B 1S5JA 4DR2B 3JAMN 3E22B 4JGSA 3A0BZ 3ASOB 4JAUA 1VMGA 2F93B 2XOKG 3ZRVA 3ETEA 3PJSK 1S0VA 2LW7A 2E5LO 3IAYA 3X2QB 2QA4V 4DO2A 3WB1A 1JOYA 2LFRA 4LF9O 4UFZA 2K1EA 1P49A 4FK5C 5HFLA 2AHZA 3ZS8C 4UV9A 1WNSA 3P3PA 4D7SA 1Q6HA 1VP7A 2EULA 1YSCA 1QQCA 4JZ2A 3CEIA 1OZ0A 3ZMZA 2WWWA 2QKCA 2OCHA 4DR2O 5BR8O 1F7YA 4NTWA 3ZMSA 1THZA 2BSKA 3HB3B 1EBOA 4DK0A 1ZLZA 3G71V 4QE7A 3BHPA 3TXQA 4FJCC 1R6NA 4PDVA 1VIBA 3GVMA 3EVKA 1E1RG 2YI8A 3F7VC 1S5LZ 5DN6G 2V7QG 1OCCC 2EX3A 5LMNB 4UCVA 1FJGB 1E79G 1VQOV 1YVWA 5LMUO 1PM9A 3FB7C 4X1KB 3CCQV 5E79Z 1D5NA 3BA9A 3T2MA 1YDXA 2NN4A 3MHHC 4CBCA 3K59A 1H8HG 2PF4E 3ZHQA 1BGYH 4O4HB 4JYCA 3K06A 3APQA 4EEQA 3SJBC 4J7JA 1Y74B 2Y4TA 4R7CA 1X4TA 1IBKO 1EM1A 1VQLV 5LHIA 4WFFA 5EC2C 3PN1A 1SQBH 3K79A 3QO8A 4J7KA 2QM7A 4K8ZA 1VQ4V 1N33O 5CBFA 3UT5B 1TVKB 4KUMA 3RYHB 1FKAO 4BIUA 2OIGA 4Q20A 3LNMB 4LP8A 3LDEA 4JASA 2VQEB 2P6JA 1YI2V 3SYCA 1KP2A 3SPJA 1WA8A 1GAXA 1VQKV 1XNRB 4MW3A 3CXHF 3HKEA 4FLVA 1KB9F 3CMEV 1G6UA 3G80A 5LOVA 2XT9A 5L3CA 4EFBA 2KG7A 3ABTA 2XUMA 3AG2C 2D3OW 3WFVA 2BTQA 5LXTB 1RPOA 1NR7A 4QGPA 3CHXA 3JALA 4FFKA 1I7FA 1H2LA 5JH7A 2MK3A 4DK1A 3DC6A 2O57A 4I7ZB 1RSOA 4YIOA 4X1YA 1JCHA 3I56V 2IH3C 1I5YA 2P4VA 4X1IA 1PNKA 4DRXA 4CH5A 1XNQO 5KX5A 2VQEO 4X64B 4DR1O 4CH6A 2JK5C 2FMLA 1ZX3A 2WA4A 1Y66A 3H1HH 1XNRO 5KAIZ 4B3SB 4ZOLA 4MVSA 4HZ3A 3OGIB 3HKBA 5J9PC 3RN4A 2WLJA 5J2UA 5A9GA 1YTFB 3ZMTA 2YDEA 4I0XA 1AR5A 4DR4B 1BHAA 2IJHA 3K9SA 4FM1A 2L6LA 5CA0B 2UUCB 5CA1B 5CA3A 1XL4A 2ZNIA 1SA0A 4EB6A 1NQTA 1FXKC 1SZTA 1DTOA 2YEVA 4JTCB 3JAWA 2FTKA 1IZ3A 5IYBO 1PNLA 1GTOA 3JATA 2KKWA 3T1HB 3C90A 4LF5B 4O2BA 4P30A 1K92A 1FAFA 2DOSA 1N8RW 2BCCH 2XAGA 1H2GA 2V4DA 4LF8B 2FKXA 4DR4O 1Y67A 2Q8VA 1JJOA 4ZKIA 2UUCO 1Q7YW 4YJ3A 3UM7A 2GUZA 3JYCA 4FPPA 4OGQB 4LFBB 1H38A 3ZHUA 3IFXA 4WBNA 3WB0A 3ETDA 1QR9A 3AG7A 3AG4C 4AQYO 1WAZA 1B06A 1SQGA 2W0FC 3QF7A 1FXKB 5LL6Y 1AI5A 4F6EA 3LNNA 2QKAA 5GW7A 4LF8O 5B1OA 4XDKA 2ADPA 3FKSG 1ZSPA 4N21A 1IBLB 3B09A 4KXRA 2BSKB 1IVSA 3MD0A 5KHKA 2BOBC 1V55C 2JS3A 3N2GA 4X9QA 3E22A 3CMAV 4LFBO 4K0KB 2WAMA 1ENVA 4RAIA 3ABKB 2XASA 1WP7A 2PTMA 5JJNB 4RQFA 3ML0A 3JD2A 1NT2B 1NTKH 2B9ZA 4I9WA 3BAAA 3W7TA 2EIJC 1GN3A 4YIPA 3NXSA 2M6YA 3SPGA 2KSDA 3MHSC 3CS5A 3ICXA 3TETA 3AG4B 4ZBMA 4NTYA 5JVDB 2E75B 3N2KB 2P4KA 3JAKA 1AI4A 3ZHTA 3UKMA 4R6ZA 1VARA 3F5TA 2CTQA 2DYRB 1M90W 1Q3EA 4UB8Z 2Y0IA 1M1KW 1I08A 2P22C 3ABLC 3QG5A 2A79B 1EZJA 1KU9A 1IBLO 3LSSA 2QM8A 3A2FA 1OCZC 4YHHB 1VF6A 4QPJA 2JEUA 5IDJA 4LFAB 2QWRB 4YXWG 2ZXWB 4K0KO 3H1KH 1ROPA 4QJFB 3ZBHA 2KQXA 3OM3B 3FFQA 4GT1A 3RVZA 2Y0PA 3CJHB 3HPLC 2LFSA 1NZ6A 3K57A 5CN0A 2LQTA 1V55B 3QTCA 4WFHA 3O9OA 4MTXA 5F2VO 2GTSA 3HKEB 1VQ8V 1TGOA 4JZGA 4CC6A 3RGBA 5LOVB 2FYUH 1MNGA 2KG7B 3JASA 3ZRWA 4X1KA 2EIJB 1IX9A 2HVKC 2BTQB 2QJ1A 3OFNG 4H33A 2DQ3A 1LUVA 4YHHO 2Q0AA 3JALB 1PL4A 4LFCB 4B7EA 4JTDB 4D7TA 4BW5A 2XNDG 5JH7B 1VF7A 1XREA 5FLXN 3WU2Z 1GMGA 1RSOB 1S72V 4X1YB 1XUQA 1R3IC 3ABLB 1S77D 1AI6A 1QR8A 4X1IB 1QNMA 1OCZB 1L0NH 1PPJH 2IJKA 1QLEB 2AGAA 2DWDC 2P06A 4DRXB 4EKWA 2JVDA 1NVPD 1P4RA 2HKOA 5KX5B 3UT5A 3CCVV 4YJ2A 2EINB 1W0KG 5LA6A 4ZOLB 1B04A 1KQSU 2QWQB 4YY3B 4DV4B 2GHYA 3HKBB 1B6QA 3K04A 1YZBA 4PDLA 5J2UB 3OTOB 4I0XB 4J10A 2QTOA 1GM9A 5B5EZ 4MSWC 3B8MA 2ATKC 2A9HA 2DW4A 1KC8W 1COWG 4UCUA 1SA0B 1OHHG 4UVBA 2A7WA 4LFCO 3LUTB 2YEVB 5GONA 1Q6IA 1WN7A 3JAWB 3FD9A 2IJIA 1HDJA 1FPOA 3W7XA 3JATB 5DEDA 4BW9A 4U3FH 4ZHQA 3CRCA 4J41A 2BTOA 1AJQA 4LWSA 2QE7G 4O2BB 2YI9A 5LGTA 4X20A 1LUWA 3VQVA 1PL0A 5H6QA 1P84F 2C2AA 2R9RB 1JR9A 3OEEG 3AG3C 1H8EG 4YY3O 4DV4O 3STZC 3FAVA 4F6RA 2ZE7A 2ZINA 5FPOA 1YJ9V 2IM9A 2UU9B 3CCEV 5L3BA 1TUEB 4NXMB 4I55A 2GUZB 3OMNB 2ARHA 5D5PA 2D2CB 1N34B 3VQYA 4WBNB 2E76B 1O9GA 1P7GA 2FL4A 4PDRA 1JQ0A 2EZPA 4OPAA 1K5SA 3AG1C 1QU7A 1I94O 2XAJA 3ZHVA 2DE0X 4JI2B 2WLKA 1Q43A 2JDIG 1N36B 2P67A 3A0HZ 1P7BA 5B1BC 4DV2B 3HKCA 3ETQA 3CE2A 4E2LA 1VQNV 4TOIA 4FLUA 4LBEC 4LCUC 1V54B 2YIDA 3JARA 3OMAB 3GWOA 5EIBD 2QR4A 4B7KA 3RT3C 5CBHA 2R9IA 4NXMO 4IGGA 3N2GB 1QVGU 3AG3B 4U3JA 1XQ8A 3STLC 2UXBB 1N34O 4FM2A 4FM0A 2N05A 2QWNB 2F43G 1S76D 1KMIZ 4DR6O 3S3XA 4UCOA 5HFMA 3OD4A 2HFEC 4GUNA 1NH2B 4FLWA 1DLBA 3B77A 3RWRD 4JI2O 1MABG 1W59A 1N36O 1DK1A 3ZHRA 4I9QA 4DV2O 5EC1C 5DM6V 2X0LA 4NYKA 4LH6A 1FXKA 3AG1B 3JAKB 2Q6AA 3F5WC 3RYFA 3SJCC 1YITV 4PI0A 4CS2A 3F7YC 2HLDG 2WA3A 2JJ1G 1YXBA 3OAAG 5B1BB 3ZN0A 3D8CA 1BCCH 4ZIBA 2RJZA 1BQZA 1OCRC 1I0HA 4XBFA 3W7UA 4TT3G 2UXBO 5KAFZ 5B1AC 4IYHA 2JGUA 2RNBA 5K1PA 1EN6A 4WFBV 2PYJA 1NI8A 1MG1A 3D3QA 4GKKB 2LO1A 4ZI7A 1KKCA 4DV0B 1GRJA 1Q86W 2AZ0A 2JGDA 2B1IA 3JCUZ 1PKXA 2Q73A 3BVOA 4J7ZA 1EFRG 3RYIB 2P5OA 3JASB 3H01A 2EIKC 3HR0A 2LGWA 3H1LH 4JF3A 3ZRWB 1KKDA 2NLJC 5JVDA 1JFFA 4KP4A 1L8DA 3N2KA 1GO3F 2IJJA 1VQMV 1SQPH 2CK3G 1AJPA 4JI3B 1V9PA 5IJ9A 5B3SC 1YJNV 4KL1A 1KECA 5CBGA 1S5HC 2HG5C 3C3SA 4R50A 4RUEA 5BMVA 5KLVH 1JA8A 4D6TH 2LJ2A 4LF7B 3EHBB 2QSAA 4JYYA 1XHZA 1RPRA 1FXVA 1Q5OA 4GKKO 3JD1A 3CJHA 2WLLB 4JI8B 4DUYB 4PDMA 4YJ2B 5B1AB 5EZYB 2LP7A 5LA6B 3CC2V 2RQ6A 3OE7G 4C7UA 5LMNO 1FJGO 5D5QA 2A06H 2Q67A 1AVMA 4JTAB 4LNUA 2YIBD 3IGAC 3K5OA 4PA6A 1OCCB 5GONB 4JI3O 2VWJA 5IT9N 1BZKA 4ICGA 1RP3B 1K9MW 2CTPA 2PUSA 4KFMA 2EIKB 1XBLA 2OWOA 4RWUA 4X62B 2WPDG 4LF6B 1K97A 1D5AA 4HAMA 4ZHQB 2HEPA 4LF7O 1M93A 2QWOB 4NKGB 4LWSB 3ZX6A 1US6A 4NB5A 4U7OA 1VQPV 2ZR3A 2K9PA 4JI8O 4X20B 3I5DA 3J7AU 4GKJB 4WFGA 4DXWA 2OTLV 5B3SB 2HP8A 4DV7B 2OT5A 3AEIA 5TISZ 4UCSA 3BRCA 3KZIZ 1NVPB 3FAVB 4F6RB 3ZRXA 2L35A 4BIZA 1G1XB 3H1JH 2B1GA 1F51A 2LGQA 1BHBA 3P30A 4P9PA 2ZQMA 3VQWA 4CC5A 4I55B 1FFTB 1MOFA 2XHBA 3E8HA 3B8NA 1WJZA 2IH1C 4PD4F 1M9NA 2CGNA 2R70A 1VEWA 1YIJV 3K03A 4X62O 4LF6O 3SGIA 4B3TB 2CH7A 2V1DA 4JV5B 1VF5B 2GV9A 1K5QA 3OEHG 3AG2B 5B66Z 5IWAB 1Q81W 3HKCB 3D36C 4NR1A 4GKJO 2HHHB 4DV7O 2X6BA 4JI1B 4UV8A 2A0LA 3CSXA 4X64O 3JARB 4PJ0Z 1JVMA 5C93A 4B3SO 1IXMA 1MMMA 3CRAA 5FL7G 4WFAV 4O4JA 2YICA 3L72H 4X8AA 2WLHA 4ABMA 2DWEC 2H3OA 4U3JB 1ZWIC 2Q7GA 1HP8A 1T5EA 3ZEDA 2CGOA 4DUZB 4CH4A 4B3TO 4TUYA 3J80N 4JV5O 1IBMB 1R6KA 1BE3H 4CS4A 2RDCA 2ILMA 5IWAO 4MVOA 2EBOA 4RO2A 2HHHO 1H2NA 5LP6A 3T1HO 1N0JA 1SQVH 2F1MA 2FB5A 2LW1A 3D3IA 4LF5O 4JI1O 3RYFB 4MTGA 2NNUA 1YCIA 1M4UA 2AHYA 4CS3A 4JAAA 1QLNA 3K0DA 2UXCB 3HKDA 4AILC 1KP3A 2HJFC 3CCUV 5JCOA 5KUMA 4PA4A 2ITDC 1FS0G 2QEXV 1R1BA 1CPYA 3EFFK 4LF4B 3BABA 4ZI7B 1AR1B 4XDJA 3FB8C 3RVYA 1NBMG 2JGDB 1NTZH 3ETGA 1HR0B 4GYCB 3SPCA 4PA3A 2OTJV 3BFRA 2X7RB 1FFXA 2JRIA 1LR1A 5JQGA 1SESA 1VQ5V 2VQFB 1HNXB 4PHZA 1JFFB 3SYQA 1GM8A 3T1CA 4FMTA 2XAHA 4JYBA 1F23A 5IJ9B 3RW0A 3LSQA 1K33A 1M5IA 3W7SA 5BMVB 2UXDB 2Y4UA 4E4EA 3IJ4A 4DV6B 4J80A 5K1XA 4GLXA 4NTXA 4AI8A 3JCZA 4LF4O 4K35A 3C3TA 1TUBA 3Q4HB 4GX5A 3OMIB 3KKYA 5FPRA 1XI1A 5LHGA 1HR0O 4GZRB 5L3FA 1I5XA 1XMQB 1KBHA 2DN9A 5IYCO 1IXBA 1GN6A 4LNUB 2YSUB 5AG2A 3CC7V 4FLZA 5LGUA 2VQFO 1DF5A 1HNXO 1N32B 2KB1A 3O65A 3G67A 3RYIA 3OW2U 2HR3A 4I4TA 4I50A 3L75H 4FLTA 3CCSV 4LFAO 1XHXA 3ZN1A 3P32A 3OT7A 1R6TA 1QVFU 4Z1VA 1SF9A 2M7WA 1PD3A 3JD4A
chains in the Genus database with same CATH topology
2Y4TA 1N4CA 1XBLA 2N04A 3APOA 3UCSC 1FAFA 1NZ6A 2GUZB 3BVOA 4RWUA 2CTQA 3AG7A 1BQ0A 4J7ZA 1GH6A 2DMXA 2EJ7A 2N05A 2LGWA 2QSAA 2QWNB 2CTRA 2QWOB 2DN9A 2M6YA 2CUGA 2YUAA 2QWRB 2QWQB 2Y4UA 2QWPB 2L6LA 1HDJA 2YS8A 3UO2A 1WJZA 1IURA 1FPOA 2GUZA 2LO1A 2PF4E 2KQXA 4IT5A 4J80A 2CTWA 1BQZA 2OCHA 3APQA 3UO3A 2CTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  1N4C A;  1XBL A;  2N04 A;  3APO A;  3UCS C;  1FAF A;  1NZ6 A;  2GUZ B;  3BVO A;  4RWU A;  2CTQ A;  3AG7 A;  1BQ0 A;  4J7Z A;  1GH6 A;  2DMX A;  2EJ7 A;  2N05 A;  2LGW A;  2QSA A;  2QWN B;  2CTR A;  2QWO B;  2DN9 A;  2M6Y A;  2CUG A;  2YUA A;  2QWR B;  2QWQ B;  2Y4U A;  2QWP B;  2L6L A;  1HDJ A;  2YS8 A;  3UO2 A;  1WJZ A;  1IUR A;  1FPO A;  2GUZ A;  2LO1 A;  2PF4 E;  2KQX A;  4IT5 A;  4J80 A;  2CTW A;  1BQZ A;  2OCH A;  3APQ A;  3UO3 A;  2CTP A; 
#chains in the Genus database with same CATH topology
 1Q82 W;  4DR5 B;  4UCR A;  4MVM A;  2X6A A;  2W6J G;  1AB3 A;  4OPH A;  1XMQ O;  2WLL A;  4HYO A;  1TA8 A;  2WLI A;  5EZY A;  4DW0 A;  3ZMU A;  5EBL C;  2PI5 A;  2F4V B;  3T4Z A;  3R66 A;  4LH7 A;  3ABU A;  3G4S V;  2QWP B;  3JD3 A;  3UO2 A;  4J9Z B;  5LBQ A;  2HJD A;  2W6I G;  1WB8 A;  3VBB A;  5EBM C;  1AP6 A;  3WB2 A;  2N04 A;  4X88 A;  5LYJ A;  4IIJ A;  2E74 B;  2YXH A;  1XL6 A;  5KA6 A;  1WLE A;  5LP6 C;  2GTA A;  3AK1 A;  3RYC A;  3G6B A;  3K0G A;  4W4K A;  2CH7 B;  3CP1 A;  1Z5W A;  4Q6G A;  1K4C C;  1F4M A;  3P3N A;  5L3D A;  1AI7 A;  4MVQ A;  1YTF D;  1RFY A;  4O4I A;  4DR5 O;  1F4N A;  4FFB A;  5IYD O;  2BE3 A;  2F66 C;  3VQX A;  1L0L H;  4O4L A;  4Z1M G;  1GH6 A;  5H6R A;  1ZL8 A;  3G6E V;  1UJW B;  3FX7 A;  4OXS A;  1VQ9 V;  4DR3 B;  4J42 A;  4ASU G;  5JCO C;  2P90 A;  4X65 B;  2F4V O;  1RM1 C;  4B3M B;  4DV3 B;  4N23 A;  4O4J B;  1M57 C;  1M56 C;  2ODM A;  1IUR A;  1OJH A;  3OTO O;  3E35 A;  2Q0O C;  2QKS A;  2H94 A;  1YHQ V;  2MW2 B;  4TWK A;  2OCC C;  3SDL A;  1U96 A;  5KHJ A;  3OUF A;  4JI0 B;  3E2E A;  3GB7 C;  1YJW V;  4L8J A;  2XAQ A;  4TUY B;  1HNW B;  3ASO C;  3BY6 A;  5EK0 A;  3SYO A;  3A8T A;  3TGU H;  1YEW A;  5LP6 B;  3DTU B;  4DYL A;  2UUB B;  3DSQ A;  4DR3 O;  5ITZ A;  2YC0 A;  4PEL A;  4B3M O;  3L9D A;  5J2T A;  4DV3 O;  3OTF A;  2CDY A;  4TV9 A;  1G4Y B;  3HKD B;  2UU9 O;  3E89 A;  2X6C A;  1L1F A;  1Y4M A;  4CH3 A;  1ZTE A;  1N0N A;  1FYJ A;  4H0L B;  4MVZ A;  1R73 A;  4JI0 O;  1E1Q G;  4FIP C;  2IU0 A;  1PNM A;  4KHP B;  1M56 B;  2Q68 A;  1HNW O;  1UFI A;  2A3Q A;  3UQ8 A;  1KYO F;  2YUA A;  4WCE V;  1EZV H;  1NS1 A;  3CCR V;  4L87 A;  5CB4 A;  3QO5 A;  1DF4 A;  1SRY A;  3TJT A;  1NJI W;  5BR8 B;  1FFX B;  3QNE A;  2UUB O;  1OCO C;  4JAV A;  5JQG B;  1ARO P;  1QCE A;  1SKV A;  4JPR A;  3FB5 C;  4GX1 A;  4H37 A;  5E1A C;  1W0J G;  1XMO B;  1JX9 A;  1URF A;  3OR7 C;  4TV8 A;  1X59 A;  1O9H A;  3D36 A;  3MDS A;  3OGC C;  4UUJ C;  4MW8 A;  3E86 A;  2PY5 A;  4KHP O;  5LMU B;  2EIL C;  1WPB A;  4LR3 A;  3U0Z A;  3RFR A;  1TUB B;  2DYS C;  5KMG A;  1K3E A;  5H2F Z;  5C8Y A;  1HW7 A;  1Y76 A;  1ORQ C;  3BA8 A;  5BXZ A;  3A0R A;  2Z5U A;  2PI4 A;  3NR7 A;  1QHT A;  3E8F A;  3ZRS A;  5A2Q N;  3TXS A;  4TQF A;  1IBK B;  5GTH Z;  4Z2W A;  1JJ2 U;  1XMO O;  1AIL A;  4DV5 B;  4PV1 B;  3OUS A;  4IHJ A;  1SQQ H;  2JJ2 G;  1HWY A;  1N33 B;  2IBZ H;  3B2E E;  1SZX A;  4I4T B;  4NXN B;  4I50 B;  1OCO B;  3K9A A;  1ZAU A;  5KA5 A;  4MVR A;  3FB6 C;  3JSL A;  3ABM C;  3R65 A;  2ZE8 A;  2UXN A;  4J9Y B;  5EYP A;  1MZF A;  1OCR B;  5L3E A;  2YS8 A;  3B4S A;  2WLI B;  4DV0 O;  2ITC C;  3Q4H A;  1OV9 A;  5H5N A;  2EIL B;  5LHH A;  2DYS B;  4W4L A;  1BL8 A;  4DV5 O;  1JMK C;  3GWK C;  4NVP A;  5LYJ B;  4IIJ B;  4G2K A;  4NXN O;  1J5E B;  1KUQ A;  3RYC B;  3S3W A;  2PZS A;  5IY5 C;  1XNQ B;  2WLM A;  4O2A A;  4DR1 B;  5IJ0 A;  4AHC A;  4O4I B;  4MS2 A;  1NTM H;  3SYP A;  1XDC A;  3JD0 A;  3LDC A;  5JWP A;  4FFB B;  4FLX A;  4RUF A;  3IC7 A;  4WF9 V;  3CYO A;  4O4L B;  1NR1 A;  3LDD A;  1ZL8 B;  3ABM B;  3B40 A;  3KCX A;  4DUY O;  1K34 A;  2ZE6 A;  4P9O A;  2CTW A;  3KCY A;  2QM4 A;  2VWK A;  3SYA A;  1Q8I A;  3BEH A;  2DJV A;  2PGG A;  5BY1 A;  1MZE A;  1NU1 H;  2GSM B;  5EBW C;  1J5E O;  3CWB H;  4G28 B;  1H2K A;  1J95 A;  3CXC U;  4UB6 Z;  5KHH A;  3DXR A;  2ZIM A;  4BAY A;  3N27 A;  2YIB A;  1K8A W;  3H1I H;  2OIE A;  2E3C A;  2ZIO A;  2N74 A;  2Q7H A;  2ZR2 A;  2CTR A;  3K58 A;  3K5L A;  4B3R B;  5IY5 B;  2HVJ C;  5BZB A;  1R3J C;  5ITZ B;  2R72 A;  4FVM A;  1K4D C;  5J2T B;  1MA1 A;  1S3J A;  1R3K C;  5EIB C;  2GDS A;  3CCL V;  1CXZ B;  4TV9 B;  2YIA A;  1A32 A;  3ASN C;  1BS3 A;  1WB7 A;  2EJ7 A;  4AQY B;  3TK1 A;  4JI5 B;  2QTS A;  2JEX A;  1QBZ A;  3E8G A;  3T4D A;  2H8P C;  5IYZ A;  2ZM6 B;  4R8C A;  3UO3 A;  4PI2 A;  1SS3 A;  4K8X A;  2CE4 A;  1B3Q A;  2P7T C;  4MT8 A;  3IC9 A;  3SPI A;  2VS0 A;  5CB4 B;  3ABK C;  1CEZ A;  3K5N A;  1W2B U;  1BT8 A;  3L70 H;  1H2M A;  2CAZ C;  4B3R O;  2DQ0 A;  2UXX A;  2XTA A;  4DR7 B;  3M7M X;  4GX2 A;  3CRQ A;  4IT5 A;  5FNV A;  2Y69 C;  1NH2 D;  3ZJZ A;  4TV8 B;  3KG2 A;  4JI5 O;  1GN2 A;  1Y6X A;  4K3A A;  1JPX A;  2DYR C;  1PV0 A;  4MTF A;  4RQE A;  3ASN B;  3ZIA G;  2ZNJ A;  2ZM6 O;  4DUZ O;  2AW9 A;  5KMG B;  4UCT A;  2EIM C;  2ZXW C;  4DV1 B;  3CD6 V;  5C8Y B;  1IBM O;  1Y76 B;  3EXA A;  1FD9 A;  4HNA A;  2AXT Z;  5GTI Z;  1AR4 A;  5DEC A;  1EN5 A;  2G38 A;  1YF2 A;  4DR7 O;  2ZDI A;  4JYA B;  2W0X A;  1GN4 A;  1XIL A;  2ADQ B;  2IU3 A;  1HNZ B;  4PA7 A;  4F4L A;  4QPK A;  5CMU A;  1Q6U A;  4IHJ B;  3H9V A;  4H44 B;  1SC5 B;  1D2D A;  4XDL A;  2DMX A;  2UXC O;  2ETN A;  2UUA B;  4PA9 A;  2ZCE A;  3OR6 C;  2Y69 B;  2GBO A;  5IE9 A;  3CC4 V;  5EYP B;  2OYQ A;  2F95 B;  3SR2 C;  2WLN A;  4DV1 O;  1N4C A;  3K3W A;  3QVN A;  4BWA A;  4UVC A;  3ZHS A;  1BSM A;  3SJA C;  2Y48 A;  4X66 B;  5JJJ B;  2EJR A;  2Z3Y A;  2NR5 A;  4JYA O;  1LNQ A;  3ZMV A;  5JJE B;  1QLE C;  1HNZ O;  2WSS G;  2YXY A;  3M8A A;  2EIM B;  3VOU A;  4MTO A;  4OX9 B;  1XOU A;  2EIN C;  4HBN A;  1TAE A;  4JI6 B;  1BMF G;  4CZZ A;  3APO A;  1WP8 A;  3DC5 A;  1BQ0 A;  2UUA O;  4A5U B;  3L74 H;  4IYI A;  1VQ7 V;  1SER A;  4O2A B;  5IJ0 B;  1MSW D;  1WA8 B;  3RBZ A;  3BCC H;  4IL6 Z;  2UXD O;  3E83 A;  1SQX H;  4TSF G;  2Q5Z A;  3AK2 A;  4U7N A;  4DV6 O;  4UVA A;  3CCJ V;  1Z5V A;  1GM7 A;  4QIW F;  2Z0A A;  4X66 O;  3THO A;  4UXN A;  3WG7 C;  1VQ6 V;  3FYI B;  3LSU A;  2Q4P A;  3U10 A;  3DGE A;  2R9A A;  4O4H A;  1G8M A;  3L71 H;  4OX9 O;  1IDS A;  1Y74 A;  4QE9 A;  3U11 A;  3W7W A;  1N32 O;  5H9C A;  3SPH A;  4JI6 O;  1NKD A;  3QO7 A;  4JI4 B;  3UCS C;  4QNH B;  1WPX A;  3DXR B;  1K73 W;  1TVK A;  2YXL A;  3RYH A;  4B08 A;  2QGN A;  4P2Z A;  3I55 V;  4I5S A;  4MVU A;  3T1Y B;  5KHI A;  3CRM A;  5L3G A;  1Q90 D;  5KUK A;  2PYL A;  3CCM V;  5B1N A;  3TCU A;  4BIO A;  3J81 N;  4EB6 B;  4BR6 A;  3CPW U;  2ZKO A;  1XEQ A;  4J11 A;  4FZ1 A;  5LXT A;  4DW1 A;  1I94 B;  1PP9 H;  1V54 C;  2JIZ G;  3K08 A;  3WG7 B;  2JS5 A;  4JI4 O;  2QDO A;  2AZ2 A;  1GK9 A;  4EFE A;  5IYZ B;  1GKF A;  2ZDI C;  1ZUQ A;  4JI7 B;  5KHG A;  2B5U A;  2RN9 A;  3K5M A;  3E8B A;  1EN4 A;  4LC1 A;  1AJN A;  1KD1 W;  3JSN A;  3M99 B;  1Z2G A;  2ZE5 A;  2F23 A;  3T1Y O;  3CB2 A;  3AK3 A;  2Q69 A;  3FYE B;  1R3L C;  1SET A;  3X2Q C;  4YJ3 B;  3L73 H;  2EZO A;  5FNV B;  2IW5 A;  2ZT9 B;  5CA0 A;  1U97 A;  1FXH A;  5CA1 A;  4X65 O;  4WFE A;  4G27 B;  2RMK B;  4DR6 B;  4FZ0 A;  3MAQ A;  2E5L B;  1CP9 A;  3ZCC A;  1H2S B;  3CX5 F;  4LF9 B;  5LGN A;  2RCV A;  1DGS A;  1SQF A;  4X89 A;  4JI7 O;  2BOC C;  3BPZ A;  3SJQ C;  1K7D A;  2ZD9 A;  1RM1 B;  2Q9L A;  1VF6 C;  2XAF A;  4GX0 A;  3CRR A;  4FLY A;  1M57 B;  1MSD A;  2Q7E A;  4HNA B;  2CUG A;  1UPG A;  1AP5 A;  4TQD A;  2OCC B;  4GCZ A;  2VRZ A;  4H13 B;  1S5J A;  4DR2 B;  3JAM N;  3E22 B;  4JGS A;  3A0B Z;  3ASO B;  4JAU A;  1VMG A;  2F93 B;  2XOK G;  3ZRV A;  3ETE A;  3PJS K;  1S0V A;  2LW7 A;  2E5L O;  3IAY A;  3X2Q B;  2QA4 V;  4DO2 A;  3WB1 A;  1JOY A;  2LFR A;  4LF9 O;  4UFZ A;  2K1E A;  1P49 A;  4FK5 C;  5HFL A;  2AHZ A;  3ZS8 C;  4UV9 A;  1WNS A;  3P3P A;  4D7S A;  1Q6H A;  1VP7 A;  2EUL A;  1YSC A;  1QQC A;  4JZ2 A;  3CEI A;  1OZ0 A;  3ZMZ A;  2WWW A;  2QKC A;  2OCH A;  4DR2 O;  5BR8 O;  1F7Y A;  4NTW A;  3ZMS A;  1THZ A;  2BSK A;  3HB3 B;  1EBO A;  4DK0 A;  1ZLZ A;  3G71 V;  4QE7 A;  3BHP A;  3TXQ A;  4FJC C;  1R6N A;  4PDV A;  1VIB A;  3GVM A;  3EVK A;  1E1R G;  2YI8 A;  3F7V C;  1S5L Z;  5DN6 G;  2V7Q G;  1OCC C;  2EX3 A;  5LMN B;  4UCV A;  1FJG B;  1E79 G;  1VQO V;  1YVW A;  5LMU O;  1PM9 A;  3FB7 C;  4X1K B;  3CCQ V;  5E79 Z;  1D5N A;  3BA9 A;  3T2M A;  1YDX A;  2NN4 A;  3MHH C;  4CBC A;  3K59 A;  1H8H G;  2PF4 E;  3ZHQ A;  1BGY H;  4O4H B;  4JYC A;  3K06 A;  3APQ A;  4EEQ A;  3SJB C;  4J7J A;  1Y74 B;  2Y4T A;  4R7C A;  1X4T A;  1IBK O;  1EM1 A;  1VQL V;  5LHI A;  4WFF A;  5EC2 C;  3PN1 A;  1SQB H;  3K79 A;  3QO8 A;  4J7K A;  2QM7 A;  4K8Z A;  1VQ4 V;  1N33 O;  5CBF A;  3UT5 B;  1TVK B;  4KUM A;  3RYH B;  1FKA O;  4BIU A;  2OIG A;  4Q20 A;  3LNM B;  4LP8 A;  3LDE A;  4JAS A;  2VQE B;  2P6J A;  1YI2 V;  3SYC A;  1KP2 A;  3SPJ A;  1WA8 A;  1GAX A;  1VQK V;  1XNR B;  4MW3 A;  3CXH F;  3HKE A;  4FLV A;  1KB9 F;  3CME V;  1G6U A;  3G80 A;  5LOV A;  2XT9 A;  5L3C A;  4EFB A;  2KG7 A;  3ABT A;  2XUM A;  3AG2 C;  2D3O W;  3WFV A;  2BTQ A;  5LXT B;  1RPO A;  1NR7 A;  4QGP A;  3CHX A;  3JAL A;  4FFK A;  1I7F A;  1H2L A;  5JH7 A;  2MK3 A;  4DK1 A;  3DC6 A;  2O57 A;  4I7Z B;  1RSO A;  4YIO A;  4X1Y A;  1JCH A;  3I56 V;  2IH3 C;  1I5Y A;  2P4V A;  4X1I A;  1PNK A;  4DRX A;  4CH5 A;  1XNQ O;  5KX5 A;  2VQE O;  4X64 B;  4DR1 O;  4CH6 A;  2JK5 C;  2FML A;  1ZX3 A;  2WA4 A;  1Y66 A;  3H1H H;  1XNR O;  5KAI Z;  4B3S B;  4ZOL A;  4MVS A;  4HZ3 A;  3OGI B;  3HKB A;  5J9P C;  3RN4 A;  2WLJ A;  5J2U A;  5A9G A;  1YTF B;  3ZMT A;  2YDE A;  4I0X A;  1AR5 A;  4DR4 B;  1BHA A;  2IJH A;  3K9S A;  4FM1 A;  2L6L A;  5CA0 B;  2UUC B;  5CA1 B;  5CA3 A;  1XL4 A;  2ZNI A;  1SA0 A;  4EB6 A;  1NQT A;  1FXK C;  1SZT A;  1DTO A;  2YEV A;  4JTC B;  3JAW A;  2FTK A;  1IZ3 A;  5IYB O;  1PNL A;  1GTO A;  3JAT A;  2KKW A;  3T1H B;  3C90 A;  4LF5 B;  4O2B A;  4P30 A;  1K92 A;  1FAF A;  2DOS A;  1N8R W;  2BCC H;  2XAG A;  1H2G A;  2V4D A;  4LF8 B;  2FKX A;  4DR4 O;  1Y67 A;  2Q8V A;  1JJO A;  4ZKI A;  2UUC O;  1Q7Y W;  4YJ3 A;  3UM7 A;  2GUZ A;  3JYC A;  4FPP A;  4OGQ B;  4LFB B;  1H38 A;  3ZHU A;  3IFX A;  4WBN A;  3WB0 A;  3ETD A;  1QR9 A;  3AG7 A;  3AG4 C;  4AQY O;  1WAZ A;  1B06 A;  1SQG A;  2W0F C;  3QF7 A;  1FXK B;  5LL6 Y;  1AI5 A;  4F6E A;  3LNN A;  2QKA A;  5GW7 A;  4LF8 O;  5B1O A;  4XDK A;  2ADP A;  3FKS G;  1ZSP A;  4N21 A;  1IBL B;  3B09 A;  4KXR A;  2BSK B;  1IVS A;  3MD0 A;  5KHK A;  2BOB C;  1V55 C;  2JS3 A;  3N2G A;  4X9Q A;  3E22 A;  3CMA V;  4LFB O;  4K0K B;  2WAM A;  1ENV A;  4RAI A;  3ABK B;  2XAS A;  1WP7 A;  2PTM A;  5JJN B;  4RQF A;  3ML0 A;  3JD2 A;  1NT2 B;  1NTK H;  2B9Z A;  4I9W A;  3BAA A;  3W7T A;  2EIJ C;  1GN3 A;  4YIP A;  3NXS A;  2M6Y A;  3SPG A;  2KSD A;  3MHS C;  3CS5 A;  3ICX A;  3TET A;  3AG4 B;  4ZBM A;  4NTY A;  5JVD B;  2E75 B;  3N2K B;  2P4K A;  3JAK A;  1AI4 A;  3ZHT A;  3UKM A;  4R6Z A;  1VAR A;  3F5T A;  2CTQ A;  2DYR B;  1M90 W;  1Q3E A;  4UB8 Z;  2Y0I A;  1M1K W;  1I08 A;  2P22 C;  3ABL C;  3QG5 A;  2A79 B;  1EZJ A;  1KU9 A;  1IBL O;  3LSS A;  2QM8 A;  3A2F A;  1OCZ C;  4YHH B;  1VF6 A;  4QPJ A;  2JEU A;  5IDJ A;  4LFA B;  2QWR B;  4YXW G;  2ZXW B;  4K0K O;  3H1K H;  1ROP A;  4QJF B;  3ZBH A;  2KQX A;  3OM3 B;  3FFQ A;  4GT1 A;  3RVZ A;  2Y0P A;  3CJH B;  3HPL C;  2LFS A;  1NZ6 A;  3K57 A;  5CN0 A;  2LQT A;  1V55 B;  3QTC A;  4WFH A;  3O9O A;  4MTX A;  5F2V O;  2GTS A;  3HKE B;  1VQ8 V;  1TGO A;  4JZG A;  4CC6 A;  3RGB A;  5LOV B;  2FYU H;  1MNG A;  2KG7 B;  3JAS A;  3ZRW A;  4X1K A;  2EIJ B;  1IX9 A;  2HVK C;  2BTQ B;  2QJ1 A;  3OFN G;  4H33 A;  2DQ3 A;  1LUV A;  4YHH O;  2Q0A A;  3JAL B;  1PL4 A;  4LFC B;  4B7E A;  4JTD B;  4D7T A;  4BW5 A;  2XND G;  5JH7 B;  1VF7 A;  1XRE A;  5FLX N;  3WU2 Z;  1GMG A;  1RSO B;  1S72 V;  4X1Y B;  1XUQ A;  1R3I C;  3ABL B;  1S77 D;  1AI6 A;  1QR8 A;  4X1I B;  1QNM A;  1OCZ B;  1L0N H;  1PPJ H;  2IJK A;  1QLE B;  2AGA A;  2DWD C;  2P06 A;  4DRX B;  4EKW A;  2JVD A;  1NVP D;  1P4R A;  2HKO A;  5KX5 B;  3UT5 A;  3CCV V;  4YJ2 A;  2EIN B;  1W0K G;  5LA6 A;  4ZOL B;  1B04 A;  1KQS U;  2QWQ B;  4YY3 B;  4DV4 B;  2GHY A;  3HKB B;  1B6Q A;  3K04 A;  1YZB A;  4PDL A;  5J2U B;  3OTO B;  4I0X B;  4J10 A;  2QTO A;  1GM9 A;  5B5E Z;  4MSW C;  3B8M A;  2ATK C;  2A9H A;  2DW4 A;  1KC8 W;  1COW G;  4UCU A;  1SA0 B;  1OHH G;  4UVB A;  2A7W A;  4LFC O;  3LUT B;  2YEV B;  5GON A;  1Q6I A;  1WN7 A;  3JAW B;  3FD9 A;  2IJI A;  1HDJ A;  1FPO A;  3W7X A;  3JAT B;  5DED A;  4BW9 A;  4U3F H;  4ZHQ A;  3CRC A;  4J41 A;  2BTO A;  1AJQ A;  4LWS A;  2QE7 G;  4O2B B;  2YI9 A;  5LGT A;  4X20 A;  1LUW A;  3VQV A;  1PL0 A;  5H6Q A;  1P84 F;  2C2A A;  2R9R B;  1JR9 A;  3OEE G;  3AG3 C;  1H8E G;  4YY3 O;  4DV4 O;  3STZ C;  3FAV A;  4F6R A;  2ZE7 A;  2ZIN A;  5FPO A;  1YJ9 V;  2IM9 A;  2UU9 B;  3CCE V;  5L3B A;  1TUE B;  4NXM B;  4I55 A;  2GUZ B;  3OMN B;  2ARH A;  5D5P A;  2D2C B;  1N34 B;  3VQY A;  4WBN B;  2E76 B;  1O9G A;  1P7G A;  2FL4 A;  4PDR A;  1JQ0 A;  2EZP A;  4OPA A;  1K5S A;  3AG1 C;  1QU7 A;  1I94 O;  2XAJ A;  3ZHV A;  2DE0 X;  4JI2 B;  2WLK A;  1Q43 A;  2JDI G;  1N36 B;  2P67 A;  3A0H Z;  1P7B A;  5B1B C;  4DV2 B;  3HKC A;  3ETQ A;  3CE2 A;  4E2L A;  1VQN V;  4TOI A;  4FLU A;  4LBE C;  4LCU C;  1V54 B;  2YID A;  3JAR A;  3OMA B;  3GWO A;  5EIB D;  2QR4 A;  4B7K A;  3RT3 C;  5CBH A;  2R9I A;  4NXM O;  4IGG A;  3N2G B;  1QVG U;  3AG3 B;  4U3J A;  1XQ8 A;  3STL C;  2UXB B;  1N34 O;  4FM2 A;  4FM0 A;  2N05 A;  2QWN B;  2F43 G;  1S76 D;  1KMI Z;  4DR6 O;  3S3X A;  4UCO A;  5HFM A;  3OD4 A;  2HFE C;  4GUN A;  1NH2 B;  4FLW A;  1DLB A;  3B77 A;  3RWR D;  4JI2 O;  1MAB G;  1W59 A;  1N36 O;  1DK1 A;  3ZHR A;  4I9Q A;  4DV2 O;  5EC1 C;  5DM6 V;  2X0L A;  4NYK A;  4LH6 A;  1FXK A;  3AG1 B;  3JAK B;  2Q6A A;  3F5W C;  3RYF A;  3SJC C;  1YIT V;  4PI0 A;  4CS2 A;  3F7Y C;  2HLD G;  2WA3 A;  2JJ1 G;  1YXB A;  3OAA G;  5B1B B;  3ZN0 A;  3D8C A;  1BCC H;  4ZIB A;  2RJZ A;  1BQZ A;  1OCR C;  1I0H A;  4XBF A;  3W7U A;  4TT3 G;  2UXB O;  5KAF Z;  5B1A C;  4IYH A;  2JGU A;  2RNB A;  5K1P A;  1EN6 A;  4WFB V;  2PYJ A;  1NI8 A;  1MG1 A;  3D3Q A;  4GKK B;  2LO1 A;  4ZI7 A;  1KKC A;  4DV0 B;  1GRJ A;  1Q86 W;  2AZ0 A;  2JGD A;  2B1I A;  3JCU Z;  1PKX A;  2Q73 A;  3BVO A;  4J7Z A;  1EFR G;  3RYI B;  2P5O A;  3JAS B;  3H01 A;  2EIK C;  3HR0 A;  2LGW A;  3H1L H;  4JF3 A;  3ZRW B;  1KKD A;  2NLJ C;  5JVD A;  1JFF A;  4KP4 A;  1L8D A;  3N2K A;  1GO3 F;  2IJJ A;  1VQM V;  1SQP H;  2CK3 G;  1AJP A;  4JI3 B;  1V9P A;  5IJ9 A;  5B3S C;  1YJN V;  4KL1 A;  1KEC A;  5CBG A;  1S5H C;  2HG5 C;  3C3S A;  4R50 A;  4RUE A;  5BMV A;  5KLV H;  1JA8 A;  4D6T H;  2LJ2 A;  4LF7 B;  3EHB B;  2QSA A;  4JYY A;  1XHZ A;  1RPR A;  1FXV A;  1Q5O A;  4GKK O;  3JD1 A;  3CJH A;  2WLL B;  4JI8 B;  4DUY B;  4PDM A;  4YJ2 B;  5B1A B;  5EZY B;  2LP7 A;  5LA6 B;  3CC2 V;  2RQ6 A;  3OE7 G;  4C7U A;  5LMN O;  1FJG O;  5D5Q A;  2A06 H;  2Q67 A;  1AVM A;  4JTA B;  4LNU A;  2YIB D;  3IGA C;  3K5O A;  4PA6 A;  1OCC B;  5GON B;  4JI3 O;  2VWJ A;  5IT9 N;  1BZK A;  4ICG A;  1RP3 B;  1K9M W;  2CTP A;  2PUS A;  4KFM A;  2EIK B;  1XBL A;  2OWO A;  4RWU A;  4X62 B;  2WPD G;  4LF6 B;  1K97 A;  1D5A A;  4HAM A;  4ZHQ B;  2HEP A;  4LF7 O;  1M93 A;  2QWO B;  4NKG B;  4LWS B;  3ZX6 A;  1US6 A;  4NB5 A;  4U7O A;  1VQP V;  2ZR3 A;  2K9P A;  4JI8 O;  4X20 B;  3I5D A;  3J7A U;  4GKJ B;  4WFG A;  4DXW A;  2OTL V;  5B3S B;  2HP8 A;  4DV7 B;  2OT5 A;  3AEI A;  5TIS Z;  4UCS A;  3BRC A;  3KZI Z;  1NVP B;  3FAV B;  4F6R B;  3ZRX A;  2L35 A;  4BIZ A;  1G1X B;  3H1J H;  2B1G A;  1F51 A;  2LGQ A;  1BHB A;  3P30 A;  4P9P A;  2ZQM A;  3VQW A;  4CC5 A;  4I55 B;  1FFT B;  1MOF A;  2XHB A;  3E8H A;  3B8N A;  1WJZ A;  2IH1 C;  4PD4 F;  1M9N A;  2CGN A;  2R70 A;  1VEW A;  1YIJ V;  3K03 A;  4X62 O;  4LF6 O;  3SGI A;  4B3T B;  2CH7 A;  2V1D A;  4JV5 B;  1VF5 B;  2GV9 A;  1K5Q A;  3OEH G;  3AG2 B;  5B66 Z;  5IWA B;  1Q81 W;  3HKC B;  3D36 C;  4NR1 A;  4GKJ O;  2HHH B;  4DV7 O;  2X6B A;  4JI1 B;  4UV8 A;  2A0L A;  3CSX A;  4X64 O;  3JAR B;  4PJ0 Z;  1JVM A;  5C93 A;  4B3S O;  1IXM A;  1MMM A;  3CRA A;  5FL7 G;  4WFA V;  4O4J A;  2YIC A;  3L72 H;  4X8A A;  2WLH A;  4ABM A;  2DWE C;  2H3O A;  4U3J B;  1ZWI C;  2Q7G A;  1HP8 A;  1T5E A;  3ZED A;  2CGO A;  4DUZ B;  4CH4 A;  4B3T O;  4TUY A;  3J80 N;  4JV5 O;  1IBM B;  1R6K A;  1BE3 H;  4CS4 A;  2RDC A;  2ILM A;  5IWA O;  4MVO A;  2EBO A;  4RO2 A;  2HHH O;  1H2N A;  5LP6 A;  3T1H O;  1N0J A;  1SQV H;  2F1M A;  2FB5 A;  2LW1 A;  3D3I A;  4LF5 O;  4JI1 O;  3RYF B;  4MTG A;  2NNU A;  1YCI A;  1M4U A;  2AHY A;  4CS3 A;  4JAA A;  1QLN A;  3K0D A;  2UXC B;  3HKD A;  4AIL C;  1KP3 A;  2HJF C;  3CCU V;  5JCO A;  5KUM A;  4PA4 A;  2ITD C;  1FS0 G;  2QEX V;  1R1B A;  1CPY A;  3EFF K;  4LF4 B;  3BAB A;  4ZI7 B;  1AR1 B;  4XDJ A;  3FB8 C;  3RVY A;  1NBM G;  2JGD B;  1NTZ H;  3ETG A;  1HR0 B;  4GYC B;  3SPC A;  4PA3 A;  2OTJ V;  3BFR A;  2X7R B;  1FFX A;  2JRI A;  1LR1 A;  5JQG A;  1SES A;  1VQ5 V;  2VQF B;  1HNX B;  4PHZ A;  1JFF B;  3SYQ A;  1GM8 A;  3T1C A;  4FMT A;  2XAH A;  4JYB A;  1F23 A;  5IJ9 B;  3RW0 A;  3LSQ A;  1K33 A;  1M5I A;  3W7S A;  5BMV B;  2UXD B;  2Y4U A;  4E4E A;  3IJ4 A;  4DV6 B;  4J80 A;  5K1X A;  4GLX A;  4NTX A;  4AI8 A;  3JCZ A;  4LF4 O;  4K35 A;  3C3T A;  1TUB A;  3Q4H B;  4GX5 A;  3OMI B;  3KKY A;  5FPR A;  1XI1 A;  5LHG A;  1HR0 O;  4GZR B;  5L3F A;  1I5X A;  1XMQ B;  1KBH A;  2DN9 A;  5IYC O;  1IXB A;  1GN6 A;  4LNU B;  2YSU B;  5AG2 A;  3CC7 V;  4FLZ A;  5LGU A;  2VQF O;  1DF5 A;  1HNX O;  1N32 B;  2KB1 A;  3O65 A;  3G67 A;  3RYI A;  3OW2 U;  2HR3 A;  4I4T A;  4I50 A;  3L75 H;  4FLT A;  3CCS V;  4LFA O;  1XHX A;  3ZN1 A;  3P32 A;  3OT7 A;  1R6T A;  1QVF U;  4Z1V A;  1SF9 A;  2M7W A;  1PD3 A;  3JD4 A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  1N4C A;  1XBL A;  2N04 A;  3APO A;  3UCS C;  1FAF A;  1NZ6 A;  2GUZ B;  3BVO A;  4RWU A;  2CTQ A;  3AG7 A;  1BQ0 A;  4J7Z A;  1GH6 A;  2DMX A;  2EJ7 A;  2N05 A;  2LGW A;  2QSA A;  2QWN B;  2CTR A;  2QWO B;  2DN9 A;  2M6Y A;  2CUG A;  2YUA A;  2QWR B;  2QWQ B;  2Y4U A;  2QWP B;  2L6L A;  1HDJ A;  2YS8 A;  3UO2 A;  1WJZ A;  1IUR A;  1FPO A;  2GUZ A;  2LO1 A;  2PF4 E;  2KQX A;  4IT5 A;  4J80 A;  2CTW A;  1BQZ A;  2OCH A;  3APQ A;  3UO3 A;  2CTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...