1N4CA

Nmr structure of the j-domain and clathrin substrate binding domain of bovine auxilin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
182
structure length
182
Chain Sequence
GPLGSPEFSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the functional fragment of auxilin required for catalytic uncoating of clathrin-coated vesicles.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
molecule keywords Auxilin
total genus 27
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1n4cA01
1IURA 2DN9A 2EJ7A 3UCSC 2CTQA 2M6YA 2GUZB 2GUZA 2QWQB 3APQA 2QWPB 1BQZA 3AG7A 2CTWA 2CTPA 1XBLA 2N04A 2YS8A 4IT5A 2PF4E 2KQXA 1WJZA 4J7ZA 1N4CA 2CUGA 2LO1A 2N05A 2QWOB 2Y4TA 3BVOA 1HDJA 2DMXA 2CTRA 2LGWA 2OCHA 2Y4UA 2QSAA 3UO2A 1BQ0A 1NZ6A 1FPOA 4J80A 4RWUA 2YUAA 2QWNB 3APOA 3UO3A 1GH6A 1FAFA 2QWRB 2L6LA
chains in the Genus database with same CATH superfamily
1SZTA 2WLLA 4D7TA 3OMAB 2Q73A 1VQPV 3ABKC 2KG7A 4O4HA 1XOUA 1FS0G 1HDJA 5LXTB 2QJ1A 1EZVH 1E79G 2H3OA 3C3SA 5B5EZ 3R66A 3AK3A 2WPDG 4DR4O 1K92A 1MZEA 3CRQA 2YIAA 4DR2O 3U10A 4LF7B 2HVKC 3S3XA 1NBMG 2EINB 3ABLB 4IT5A 4P2ZA 3B40A 4X1KB 2W6IG 1EZJA 2F4VO 3SYQA 1GN3A 5K1XA 5LL6Y 5CBHA 1KQSU 3OD4A 4JZGA 2XNDG 1FD9A 1U96A 1XNRO 1TA8A 1PD3A 2OIEA 1URFA 2YIBA 3RYIA 1QR9A 2F43G 1KMIZ 4QE9A 5B1BB 1SRYA 3ZJZA 2F23A 4JI7O 4GX5A 4H44B 5KHHA 5ITZA 1WP7A 2Y4UA 3N2GB 4GYCB 4LFCB 4JPRA 4JTAB 5LHHA 4DR3B 4FMTA 4HBNA 3W7WA 4X62B 1MABG 3H1JH 4P9OA 4MVOA 2XTAA 3CC2V 1VQLV 4E4EA 4LF4B 1DGSA 3JSLA 2AZ2A 4O4IB 5IJ9B 2DW4A 2QKSA 2W0XA 3WB1A 3H9VA 3P3NA 5JH7B 4U7OA 5EBMC 1SA0A 4B3TO 2VS0A 4YY3O 2GTSA 4RO2A 4JI0B 1N0JA 3FB6C 5EYPA 1NH2B 1YF2A 4X64O 2YSUB 3OE7G 2Y69B 3E8GA 4DV6B 5JH7A 2DYSB 3SYAA 5CA1B 3I5DA 4GX0A 2YIBD 3K5MA 4PDRA 1P49A 1P4RA 2Q69A 3ABMC 1VF7A 1PPJH 1M93A 2G38A 4IYHA 3W7SA 1AILA 2E75B 2AHZA 3CCQV 1VQ8V 1IBMO 1CXZB 1K9MW 5B1OA 4WBNB 4EFEA 1GKFA 2P4KA 3JCZA 5JVDB 3CE2A 1GM8A 4OX9B 3ETGA 2WLMA 1F51A 5ITZB 5C93A 2PYJA 5GW7A 3CMEV 2ZM6O 1QCEA 3CRRA 4O2AA 1US6A 5CBFA 5EZYA 1I5YA 1K34A 2UUBO 4NVPA 3OGIB 2YDEA 5LOVA 2JJ1G 2ZIMA 3KG2A 2ARHA 3OTOB 2XT9A 3H1LH 3IC9A 5KAFZ 4O4LB 4LC1A 2QWRB 3ZHVA 1N34O 3FKSG 5B1AB 1H2MA 4DV2O 1KECA 4FLYA 2P22C 2VQEO 1FFXB 2LP7A 4I55A 3WG7C 3ZHUA 5GTIZ 1QLEB 2DYRB 4DR4B 1E1RG 2Y4TA 2OTJV 4ABMA 3H01A 1IBLO 4NXMB 2UU9B 1YJNV 2QR4A 3QO7A 1W59A 5DM6V 4DV1B 1ZX3A 2UXCO 1K4DC 4WFHA 2QKCA 4MVUA 4F6EA 1KP3A 3MHHC 5LGNA 3J80N 1Q8IA 1GM7A 3SJBC 1MZFA 1K3EA 1ENVA 3K03A 3OFNG 4P9PA 2CH7B 1XI1A 1P7BA 2CE4A 2QGNA 3MAQA 1R1BA 4G2KA 3QO8A 2RJZA 5IJ0A 3TGUH 1K97A 2QTSA 1H8HG 3K5LA 4O4JA 3HKDA 4IGGA 1N36B 5L3CA 2M6YA 1HNWB 5FNVA 3E22A 3L71H 3ABLC 3T1HB 4LH7A 3I55V 3FD9A 5LOVB 4JI1B 1V9PA 4JYBA 4U3JA 1ORQC 5DN6G 3F5TA 5KHJA 1Q5OA 4CBCA 5L3BA 2A0LA 4LWSB 2EIJC 5IYBO 3T1YB 4DR6B 1JJOA 2LW7A 1NVPB 2GUZA 5B3SB 4YHHB 1XMOO 4DV1O 4BIOA 4YHHO 1XMOB 4TUYB 1JR9A 3ZCCA 3T4ZA 4UV9A 4X62O 5JVDA 4HZ3A 4X8AA 1YJWV 4UUJC 1Q82W 4K0KO 4JI3O 4JI5O 5FPOA 3HKBB 4FZ0A 4Z1VA 2HR3A 1AR4A 4DV5B 4X66B 1N33O 2DYSC 1D5NA 3L73H 1F4MA 2X6AA 3FB7C 3JD4A 4UCVA 1H2SB 4CS4A 3FYEB 4PA7A 4LP8A 4DV7B 3E89A 4LF5B 1VARA 5LMUO 4LF9B 1JFFB 1UJWB 4DV0O 3CP1A 2LFRA 4CS3A 5EK0A 3ZX6A 2BTQB 5E1AC 1S5LZ 2UUCO 5EYPB 4GKJO 2H94A 5IWAB 3BA8A 3F7YC 3BVOA 4N21A 3SGIA 3F7VC 1IDSA 4L87A 3JAWB 4GX1A 1T5EA 3G6EV 4X89A 5KA5A 1XL6A 4K3AA 1P84F 3AG1C 1K8AW 4AQYB 3ZMVA 2R70A 5JQGA 5A2QN 5KHKA 1AR1B 2ZD9A 1S0VA 2GDSA 1YDXA 2WA3A 3K59A 1EFRG 4Z2WA 1EN4A 2ZE7A 3K58A 4PA3A 2QTOA 1RFYA 3LSQA 2Y69C 1BZKA 2W0FC 4JTDB 1KUQA 4JI1O 2CGNA 3RYHA 4X20B 4IL6Z 3KZIZ 3GB7C 3HKEB 3ZRWB 2QWPB 1Q6UA 2YXHA 3RVYA 1NKDA 2BTOA 3O65A 1THZA 3L9DA 4BWAA 1NZ6A 2YI8A 1KB9F 1IXMA 3OTFA 3CCEV 4LF6O 1XNQO 1K73W 4FLXA 1V55B 2R72A 2GBOA 3KCYA 4LFAO 4O2BB 4LF4O 2VWKA 2DOSA 4BW9A 4NYKA 1OCZB 1ZLZA 2QM7A 4L8JA 1Y74B 4U7NA 4FFKA 4J9ZB 3X2QC 1Q90D 3CCMV 1IURA 2ODMA 1W2BU 5JJJB 4RAIA 3Q4HB 4JYYA 2RN9A 1UPGA 1YTFD 2CTWA 2JGDB 3FAVA 2YIDA 3CRCA 3LNMB 2N04A 4QGPA 1D2DA 2IBZH 3VQYA 1L0NH 4WCEV 4MTGA 2B1GA 4TQDA 4MTOA 4QPJA 4GLXA 2F95B 4JV5B 4KHPB 1TUBA 4JAVA 4MT8A 4JZ2A 4ZOLB 1R3LC 1L8DA 1FXKB 2E3CA 1MNGA 1XHXA 2ZXWB 1BCCH 4NTYA 4YJ3A 3TJTA 4BW5A 3RW0A 3JD2A 2VQEB 4ZIBA 1M4UA 4EEQA 1KD1W 2UXXA 2D2CB 1L0LH 2LQTA 2E76B 2IW5A 4QE7A 1RSOA 3E86A 3UKMA 3E8HA 1AR5A 3QTCA 2JGDA 2GUZB 4QNHB 5J2TA 2E74B 3Q4HA 3ZHSA 2DE0X 3CD6V 1BSMA 2F66C 3GVMA 1OCCC 4GKKB 1Y4MA 3IC7A 3SPGA 2LFSA 1IVSA 1SQGA 4DR2B 2A9HA 3AK1A 1FAFA 3DC5A 4A5UB 1SQVH 2ZT9B 3QNEA 5B3SC 4PA6A 3N2KB 3OW2U 4UV8A 4CH6A 4JI4O 5LMNO 3RYFB 1Y76B 4X65O 3IJ4A 3WU2Z 2RQ6A 3HKDB 5E79Z 5LGTA 4DV5O 1HNWO 3P3PA 1GM9A 1JQ0A 1Y6XA 3SJCC 3EXAA 1UFIA 3JD1A 2BSKA 1S5HC 1HR0B 1R3IC 3JALA 2EIKC 5BR8O 3BHPA 4HAMA 1RM1C 2Q7GA 1YHQV 1HNZB 4QJFB 2M7WA 4XBFA 1ZTEA 3ETDA 1M90W 4UB6Z 4DV6O 3CCUV 3N27A 2Q8VA 4X20A 3JYCA 4MVSA 3CX5F 4JYAB 4JI8B 4JF3A 4CS2A 5J2UB 4MS2A 3CCLV 3K06A 4BIZA 5LP6C 4RQEA 1S3JA 4DUYB 5KHIA 3CRAA 1Z5VA 1I5XA 3DGEA 3TETA 1SERA 5KMGA 1R6KA 1S5JA 1G8MA 4JI6B 3ZRVA 1VQ6V 4WFBV 3JAWA 1PNMA 3AG1B 5EBWC 3SPCA 1PL4A 2YICA 3DXRA 3VBBA 4KFMA 1VQMV 1QQCA 4LNUB 3SR2C 1W0JG 3D8CA 1A32A 4UB8Z 3D3IA 1R73A 5IE9A 4UVCA 3B8MA 1R3KC 1NR1A 5L3FA 2OCCC 2QSAA 2VWJA 3CRMA 3F5WC 4DR1O 4FZ1A 3ZN1A 4NXNB 3CHXA 3L72H 1VQOV 1SQQH 4DR7O 4PI0A 3VOUA 2XASA 2WLNA 5IYDO 4I50B 1O9GA 1I94B 1WAZA 3D36A 4FM2A 1IBMB 1YTFB 2P7TC 4TT3G 1AVMA 4FIPC 3RGBA 1TVKA 4MW8A 3B8NA 4FM1A 2UXCB 4GX2A 4UCUA 2VQFB 5BMVA 3GWKC 1LUWA 4DUZO 3WB0A 4ZI7B 3BAAA 4X1IB 2OTLV 3H1KH 3DTUB 1J5EO 3WB2A 2JDIG 2Q0OC 2AXTZ 1FJGB 2AHYA 1SETA 2IJJA 1PKXA 3FFQA 3DXRB 3JASB 1SA0B 1HW7A 1KYOF 1AB3A 3OM3B 3ZRXA 3E22B 1PL0A 5LBQA 4X65B 3G4SV 4NXNO 4FM0A 1H2LA 3AG3C 1N33B 1GRJA 2V1DA 5IY5B 1L1FA 2PI4A 4X66O 3J7AU 1WA8B 2P6JA 3E35A 1GTOA 2A79B 1SQBH 3APOA 2K9PA 4GUNA 2H8PC 5J2UA 1XMQO 3T4DA 4XDJA 2HJDA 4GKKO 1SF9A 1XQ8A 2YS8A 1Q6HA 4HNAA 2A7WA 2KSDA 3HKCA 4W4KA 4EFBA 2P5OA 1WB8A 2CK3G 2IM9A 1IX9A 1FXHA 1RPOA 1MMMA 2F1MA 4I55B 1NTKH 2ZE8A 3RYIB 1R6NA 1F7YA 3CEIA 3O9OA 4DUYO 5CMUA 5GONA 3T1HO 4B3MB 1OCOC 2IU0A 4ASUG 2EBOA 2ADQB 4DV2B 5B1AC 2CTRA 1HNXO 2N74A 3K08A 1Q7YW 1N34B 1AI7A 3E8FA 3A8TA 3MD0A 1NVPD 1GH6A 2EZOA 3RBZA 3B09A 1S72V 1OCCB 4O2AB 4ZI7A 4MSWC 5LGUA 4I7ZB 3K57A 4R8CA 5KAIZ 2R9IA 3OR6C 4B7EA 2V7QG 4LF5O 2KKWA 4GKJB 3OMNB 3SYPA 4PD4F 3ETQA 1OCRC 5IYZA 3WFVA 5CA0A 3UM7A 1RSOB 5LXTA 1BS3A 3BEHA 1N8RW 1TGOA 3G6BA 2Q5ZA 5L3EA 2KG7B 2HHHO 2KB1A 4B3RB 5KUKA 1XBLA 1AROP 1IZ3A 3K5NA 1RM1B 4ZOLA 4K0KB 2OCHA 4I4TA 4PDVA 5FLXN 3CYOA 4I0XB 2P90A 1XL4A 4K35A 4AQYO 4FLVA 1GMGA 3OUSA 4TQFA 3JAMN 4TWKA 1MA1A 3LSUA 1D5AA 2P06A 3APQA 2RNBA 3L75H 1AJQA 3J81N 3EVKA 1AP6A 2XAHA 1E1QG 3FAVB 2UXDO 4UFZA 2NLJC 5FPRA 4DUZB 1B3QA 4B3TB 5LA6A 1H38A 3TK1A 2YXLA 3X2QB 4YIOA 1Q43A 3ABUA 1S77D 1EBOA 2P67A 4LFBB 1PM9A 3GWOA 3RFRA 4DW1A 1J95A 3CXHF 1IBKB 4MW3A 3I56V 2FL4A 1YIJV 1P7GA 2Q7EA 1M57B 4PA9A 3ZHRA 3FB5C 4JAAA 4LR3A 1M5IA 2ZINA 2EJRA 5HFLA 4TV9A 4JGSA 1DTOA 1VIBA 4Z1MG 5LYJB 2L35A 1QLEC 2UXNA 2HKOA 3M8AA 3CCJV 2ITCC 2JEUA 4QPKA 2QE7G 5D5QA 3AG4C 4PI2A 4LBEC 3U11A 1JJ2U 2YEVB 2UU9O 3C90A 3AK2A 1JX9A 2A06H 1U97A 4IIJB 4LH6A 2YEVA 3ABKB 3NR7A 4BIUA 5F2VO 1EN5A 2EIMB 2CTQA 2WAMA 2RMKB 2BSKB 3AG7A 2GSMB 2JRIA 2HHHB 1AI5A 2UUAB 1HP8A 5LHGA 3CCVV 1G1XB 4JI4B 1TUEB 3RYFA 1XNRB 1IBKO 1V55C 4J80A 2XOKG 4J9YB 1YI2V 3JATB 4QIWF 1LNQA 5JQGB 4DRXB 4DV4O 5H2FZ 3OEEG 1I7FA 4PDLA 2JVDA 2EIJB 4TV8A 5FL7G 4J7KA 2YXYA 4JASA 4J10A 4ICGA 2Y0PA 5J2TB 1JA8A 2BTQA 3AEIA 1K33A 5C8YB 1Z2GA 3T1YO 1M56C 4LF8B 2X6CA 4B3SB 1N32O 2LJ2A 4PV1B 3ZMUA 2UXBB 2PGGA 4R6ZA 3SPJA 4J7ZA 4P30A 4UXNA 4ZKIA 4I0XA 3ZS8C 1WPXA 3S3WA 3QG5A 3SPIA 2CAZC 4CH5A 1TUBB 4X88A 2L6LA 3W7TA 2MW2B 4JYCA 1OCZC 3M99B 2HEPA 3CC4V 2BE3A 1MOFA 5EIBC 3ASOC 4FLTA 4KL1A 1YVWA 2WLIB 1BGYH 1H8EG 2Q6AA 4RQFA 4X64B 1N4CA 5CA0B 4DV0B 4TUYA 2IJHA 5LMUB 2RCVA 4K8XA 3ETEA 4R7CA 5J9PC 1FPOA 1KBHA 4WFFA 2LW1A 1G4YB 2IU3A 5JJNB 4YIPA 1DLBA 1SC5B 1Y74A 2DWDC 4DR6O 2QA4V 4D7SA 5CA3A 2JIZG 3ASOB 5TISZ 1WP8A 2FMLA 4MVMA 1BHBA 2QDOA 1EM1A 3JATA 2BOCC 2WLIA 4CC5A 4B3MO 1GK9A 3ASNB 1ROPA 3LDCA 4FK5C 1VQ5V 3K3WA 3JSNA 2UUAO 5KX5A 1XNQB 1DK1A 1QBZA 4DV3O 4J41A 4MVRA 2PY5A 2F4VB 2WLHA 1VF6C 2HP8A 4ZHQA 1XMQB 3FX7A 4HYOA 1NQTA 1NU1H 2OCCB 4X1YB 3A0RA 4UCOA 4G27B 4KXRA 1FXVA 1GN4A 3HKEA 4X9QA 1FFTB 3G67A 4OPAA 3W7UA 2FYUH 1W0KG 2OWOA 1WLEA 3K04A 3VQVA 4JI2O 1FYJA 5KLVH 1JMKC 3ABTA 2ZIOA 4DR7B 4NTWA 3BPZA 5KUMA 5IYCO 5LMNB 1WA8A 4TV8B 3W7XA 1I94O 1AJNA 3PJSK 3BABA 4RUEA 4PHZA 4PELA 1FKAO 3LSSA 1M57C 4DO2A 1V54B 2P4VA 2IJIA 2JEXA 3CJHA 3RYCB 1HNZO 3DC6A 3UO2A 4RWUA 3ZBHA 5BMVB 4LF9O 1CPYA 2NN4A 3L70H 1PV0A 2NR5A 1YCIA 2ZM6B 1TVKB 1KKCA 2DQ0A 4Q20A 2ZR3A 1V54C 3HPLC 4DYLA 2V4DA 4K8ZA 2EZPA 1LUVA 2WLJA 3ICXA 1F4NA 4H0LB 4WBNA 3QVNA 1R6TA 4I4TB 3STZC 1N36O 2BOBC 4LCUC 5LYJA 2E5LO 4WF9V 1PP9H 5IT9N 2A3QA 4TV9B 3HKBA 2ZE6A 3SYOA 2Q7HA 4AHCA 2EULA 1PNKA 3SJQC 1ZUQA 1SESA 4NTXA 2LO1A 2Z5UA 1K5SA 1YZBA 2MK3A 3JARA 4WFAV 2QWNB 2XAJA 4LFCO 4JI0O 1ZL8B 3CB2A 1ZWIC 1GO3F 3RWRD 3T1CA 1KC8W 1KU9A 2Q9LA 2ZR2A 2XAGA 2AGAA 2YC0A 4U3JB 4EKWA 5B1NA 1BE3H 4B3SO 3OTOO 1GN6A 4KHPO 3OUFA 4JYAO 4N23A 5FNVB 1BT8A 2JS5A 1VQ9V 5IJ9A 2EINC 4O4IA 2YUAA 1KKDA 2ZKOA 4W4LA 2Q68A 1M1KW 2FKXA 3SDLA 2EIKB 5K1PA 2XAQA 1ZSPA 5KHGA 3STLC 2FTKA 5EBLC 1WN7A 3ABMB 2XAFA 1RPRA 1KP2A 1H2GA 5IDJA 2IH3C 1MSWD 3TXQA 4MVZA 3FYIB 3N2GA 5IYZB 2ATKC 1O9HA 1K7DA 1QR8A 1VF6A 3E8BA 5A9GA 1VQ4V 4FPPA 1VMGA 1FFXA 2Z3YA 2UXBO 5JCOA 1PNLA 4DR1B 3TXSA 2LGQA 3UO3A 3KCXA 3ZIAG 2DJVA 2OIGA 4O4LA 4DRXA 4BR6A 2OYQA 4B08A 1NH2D 1JCHA 3IAYA 1HR0O 3JASA 3TCUA 3CXCU 1HNXB 3CMAV 2ETNA 5EZYB 5GONB 3ASNC 3AG2C 2DYRC 3NXSA 3K79A 1IXBA 2IH1C 3SJAC 3VQWA 2ILMA 4DR3O 3HR0A 4OXSA 3QF7A 3IFXA 1QVGU 1X4TA 3MHSC 4HNAB 4B3RO 4DR5B 4G28B 3K0GA 1BL8A 4O4HB 1JOYA 1J5EB 1SS3A 4YJ3B 5B1BC 1GAXA 2WLLB 2Q67A 4JI8O 1DF4A 3OT7A 5CB4B 2AZ0A 1BMFG 1YJ9V 2EIMC 4DW0A 1BQZA 4OGQB 5EIBD 2DQ3A 2ZDIC 5B66Z 3L74H 4UCSA 5CA1A 1XILA 3KKYA 2ZNJA 1I08A 2HFEC 4C7UA 1AI6A 2PTMA 4LNUA 4JI7B 3JAKB 5LA6B 3DSQA 1M56B 5H6RA 4X1IA 4CC6A 2PF4E 2GV9A 3OMIB 3BRCA 1ZL8A 3K5OA 3B77A 4F6RA 3JARB 3G71V 3ZRSA 3ZEDA 5CBGA 3MDSA 3A0HZ 3HB3B 4LFBO 2X6BA 2ZQMA 3RVZA 1XHZA 1OJHA 5CN0A 1Q86W 2B5UA 4DK0A 3ZMSA 1SQXH 1H2NA 1Q6IA 2ZDIA 1Y67A 4KP4A 1VQNV 3H1IH 3CSXA 4MVQA 3RN4A 1QHTA 1JPXA 2Y0IA 4NKGB 1EN6A 4I50A 4BAYA 4JI6O 4DV7O 4J7JA 3UCSC 3CPWU 5JWPA 5DEDA 4PDMA 2EX3A 1XUQA 2ZXWC 3ZRWA 3K0DA 4JTCB 1XREA 5BR8B 1B06A 5LP6A 2JGUA 3LDDA 4AILC 2GTAA 4I9QA 1N32B 2HLDG 4NB5A 4Q6GA 2JJ2G 4GZRB 1BQ0A 1TAEA 1OCOB 4EB6B 4H37A 4FFBB 2XHBA 4J11A 3AG4B 1LR1A 5H6QA 1WNSA 2ADPA 1VQKV 2EJ7A 1BHAA 3CJHB 5H5NA 5BXZA 3N2KA 4I9WA 4PA4A 2B9ZA 2X7RB 4X1KA 1MSDA 5KMGB 2JK5C 1OCRB 4WFEA 4OX9O 1NR7A 4XDLA 2R9RB 4NR1A 4YJ2B 3ZHTA 1JVMA 4NXMO 2NNUA 1G6UA 5H9CA 5BY1A 3CCSV 3BFRA 1Q81W 3OR7C 3HKCB 4R50A 1B04A 1K5QA 1WJZA 3VQXA 3M7MX 1YSCA 2QM4A 2PZSA 1JFFA 2DMXA 1N0NA 2Z0AA 3FB8C 2PI5A 3B4SA 4DK1A 1YITV 2Q0AA 5JCOC 2XUMA 4MTXA 1OHHG 4IHJB 3SYCA 1S76D 4X1YA 1QVFU 3THOA 1QNMA 2UUBB 2EILC 2PUSA 3PN1A 1SKVA 3JD0A 1H2KA 2WWWA 2KQXA 4J42A 3ZMZA 3QO5A 3LDEA 3LUTB 3UT5A 1XDCA 3G80A 1OZ0A 5D5PA 2Y48A 2QWQB 3P30A 5LHIA 2ZNIA 1NTMH 5BZBA 2C2AA 5L3GA 1M9NA 3A2FA 3IGAC 3AG3B 4DR5O 1XEQA 4XDKA 3T2MA 2VQFO 2GHYA 2BCCH 2QEXV 4TSFG 4JI5B 4JI3B 3UT5B 5IY5C 4KUMA 1VP7A 4FLWA 2R9AA 4OPHA 1NS1A 1NT2B 1FXKC 3OEHG 1VF5B 3BCCH 4RUFA 4E2LA 5DECA 1FXKA 1OV9A 2IJKA 1WB7A 3D36C 1NI8A 1X59A 4DV4B 2CH7A 4UVAA 3WG7B 3ZHQA 3OGCC 1GN2A 4LFAB 3K9SA 4GT1A 3RT3C 2WA4A 5EC2C 2HVJC 2AW9A 2ITDC 1AJPA 4FJCC 1Q3EA 2ZE5A 3P32A 1IBLB 1DF5A 2CTPA 2YI9A 1FJGO 5HFMA 3RYHB 2QKAA 4CH3A 5GTHZ 4GCZA 3EHBB 1QU7A 2Q4PA 2O57A 1F23A 4PJ0Z 5C8YA 1CP9A 1YEWA 4IYIA 4LF8O 1HWYA 2CDYA 4D6TH 1WPBA 4JI2B 2VRZA 3ML0A 3RYCA 2W6JG 4LF7O 3SPHA 4I5SA 4YJ2A 2UUCB 3K9AA 3R65A 3BA9A 1SZXA 4ZBMA 2WLKA 1QLNA 5EC1C 4FLUA 3E2EA 3A0BZ 5JJEB 4O2BA 1MG1A 1K4CC 5AG2A 2PYLA 3H1HH 4UCTA 2HJFC 3E83A 2DN9A 1SQPH 4FFBA 4H13B 4EB6A 2K1EA 3CCRV 5L3DA 1Z5WA 3C3TA 2EILB 2N05A 1Y66A 5LP6B 1I0HA 3BY6A 1R3JC 4IIJA 4CZZA 4CH4A 4AI8A 2WSSG 3ZMTA 3LNNA 4LF6B 1NJIW 1VEWA 3JALB 4UVBA 3OAAG 1CEZA 2FB5A 2ZCEA 3JCUZ 4DV3B 4ZHQB 2D3OW 4FLZA 2QWOB 2F93B 1AI4A 1VQ7V 2LGWA 3CS5A 5KX5B 1Y76A 2HG5C 4B7KA 4U3FH 1YXBA 4F4LA 3CC7V 3UQ8A 1SQFA 2DWEC 2JS3A 3D3QA 4FVMA 1AP5A 4F6RB 4JAUA 1ZAUA 4YY3B 4LWSA 4YXWG 4TOIA 2B1IA 3JAKA 5IWAO 2QM8A 1RP3B 4WFGA 2OT5A 4DXWA 3AG2B 1COWG 2X0LA 1NTZH 2UXDB 4UCRA 4JV5O 2RDCA 4O4JB 3EFFK 2E5LB 2CUGA 4MTFA 5IJ0B 4H33A 2CGOA 3CWBH 3JD3A 5KA6A 3ZN0A 1B6QA 3B2EE 5CB4A 3U0ZA 4IHJA
chains in the Genus database with same CATH topology
1IURA 2DN9A 2EJ7A 3UCSC 2CTQA 2M6YA 2GUZB 2GUZA 2QWQB 3APQA 2QWPB 1BQZA 3AG7A 2CTWA 2CTPA 1XBLA 2N04A 2YS8A 4IT5A 2PF4E 2KQXA 1WJZA 4J7ZA 1N4CA 2CUGA 2LO1A 2N05A 2QWOB 2Y4TA 3BVOA 1HDJA 2DMXA 2CTRA 2LGWA 2OCHA 2Y4UA 2QSAA 3UO2A 1BQ0A 1NZ6A 1FPOA 4J80A 4RWUA 2YUAA 2QWNB 3APOA 3UO3A 1GH6A 1FAFA 2QWRB 2L6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUR A;  2DN9 A;  2EJ7 A;  3UCS C;  2CTQ A;  2M6Y A;  2GUZ B;  2GUZ A;  2QWQ B;  3APQ A;  2QWP B;  1BQZ A;  3AG7 A;  2CTW A;  2CTP A;  1XBL A;  2N04 A;  2YS8 A;  4IT5 A;  2PF4 E;  2KQX A;  1WJZ A;  4J7Z A;  1N4C A;  2CUG A;  2LO1 A;  2N05 A;  2QWO B;  2Y4T A;  3BVO A;  1HDJ A;  2DMX A;  2CTR A;  2LGW A;  2OCH A;  2Y4U A;  2QSA A;  3UO2 A;  1BQ0 A;  1NZ6 A;  1FPO A;  4J80 A;  4RWU A;  2YUA A;  2QWN B;  3APO A;  3UO3 A;  1GH6 A;  1FAF A;  2QWR B;  2L6L A; 
#chains in the Genus database with same CATH topology
 1SZT A;  2WLL A;  4D7T A;  3OMA B;  2Q73 A;  1VQP V;  3ABK C;  2KG7 A;  4O4H A;  1XOU A;  1FS0 G;  1HDJ A;  5LXT B;  2QJ1 A;  1EZV H;  1E79 G;  2H3O A;  3C3S A;  5B5E Z;  3R66 A;  3AK3 A;  2WPD G;  4DR4 O;  1K92 A;  1MZE A;  3CRQ A;  2YIA A;  4DR2 O;  3U10 A;  4LF7 B;  2HVK C;  3S3X A;  1NBM G;  2EIN B;  3ABL B;  4IT5 A;  4P2Z A;  3B40 A;  4X1K B;  2W6I G;  1EZJ A;  2F4V O;  3SYQ A;  1GN3 A;  5K1X A;  5LL6 Y;  5CBH A;  1KQS U;  3OD4 A;  4JZG A;  2XND G;  1FD9 A;  1U96 A;  1XNR O;  1TA8 A;  1PD3 A;  2OIE A;  1URF A;  2YIB A;  3RYI A;  1QR9 A;  2F43 G;  1KMI Z;  4QE9 A;  5B1B B;  1SRY A;  3ZJZ A;  2F23 A;  4JI7 O;  4GX5 A;  4H44 B;  5KHH A;  5ITZ A;  1WP7 A;  2Y4U A;  3N2G B;  4GYC B;  4LFC B;  4JPR A;  4JTA B;  5LHH A;  4DR3 B;  4FMT A;  4HBN A;  3W7W A;  4X62 B;  1MAB G;  3H1J H;  4P9O A;  4MVO A;  2XTA A;  3CC2 V;  1VQL V;  4E4E A;  4LF4 B;  1DGS A;  3JSL A;  2AZ2 A;  4O4I B;  5IJ9 B;  2DW4 A;  2QKS A;  2W0X A;  3WB1 A;  3H9V A;  3P3N A;  5JH7 B;  4U7O A;  5EBM C;  1SA0 A;  4B3T O;  2VS0 A;  4YY3 O;  2GTS A;  4RO2 A;  4JI0 B;  1N0J A;  3FB6 C;  5EYP A;  1NH2 B;  1YF2 A;  4X64 O;  2YSU B;  3OE7 G;  2Y69 B;  3E8G A;  4DV6 B;  5JH7 A;  2DYS B;  3SYA A;  5CA1 B;  3I5D A;  4GX0 A;  2YIB D;  3K5M A;  4PDR A;  1P49 A;  1P4R A;  2Q69 A;  3ABM C;  1VF7 A;  1PPJ H;  1M93 A;  2G38 A;  4IYH A;  3W7S A;  1AIL A;  2E75 B;  2AHZ A;  3CCQ V;  1VQ8 V;  1IBM O;  1CXZ B;  1K9M W;  5B1O A;  4WBN B;  4EFE A;  1GKF A;  2P4K A;  3JCZ A;  5JVD B;  3CE2 A;  1GM8 A;  4OX9 B;  3ETG A;  2WLM A;  1F51 A;  5ITZ B;  5C93 A;  2PYJ A;  5GW7 A;  3CME V;  2ZM6 O;  1QCE A;  3CRR A;  4O2A A;  1US6 A;  5CBF A;  5EZY A;  1I5Y A;  1K34 A;  2UUB O;  4NVP A;  3OGI B;  2YDE A;  5LOV A;  2JJ1 G;  2ZIM A;  3KG2 A;  2ARH A;  3OTO B;  2XT9 A;  3H1L H;  3IC9 A;  5KAF Z;  4O4L B;  4LC1 A;  2QWR B;  3ZHV A;  1N34 O;  3FKS G;  5B1A B;  1H2M A;  4DV2 O;  1KEC A;  4FLY A;  2P22 C;  2VQE O;  1FFX B;  2LP7 A;  4I55 A;  3WG7 C;  3ZHU A;  5GTI Z;  1QLE B;  2DYR B;  4DR4 B;  1E1R G;  2Y4T A;  2OTJ V;  4ABM A;  3H01 A;  1IBL O;  4NXM B;  2UU9 B;  1YJN V;  2QR4 A;  3QO7 A;  1W59 A;  5DM6 V;  4DV1 B;  1ZX3 A;  2UXC O;  1K4D C;  4WFH A;  2QKC A;  4MVU A;  4F6E A;  1KP3 A;  3MHH C;  5LGN A;  3J80 N;  1Q8I A;  1GM7 A;  3SJB C;  1MZF A;  1K3E A;  1ENV A;  3K03 A;  3OFN G;  4P9P A;  2CH7 B;  1XI1 A;  1P7B A;  2CE4 A;  2QGN A;  3MAQ A;  1R1B A;  4G2K A;  3QO8 A;  2RJZ A;  5IJ0 A;  3TGU H;  1K97 A;  2QTS A;  1H8H G;  3K5L A;  4O4J A;  3HKD A;  4IGG A;  1N36 B;  5L3C A;  2M6Y A;  1HNW B;  5FNV A;  3E22 A;  3L71 H;  3ABL C;  3T1H B;  4LH7 A;  3I55 V;  3FD9 A;  5LOV B;  4JI1 B;  1V9P A;  4JYB A;  4U3J A;  1ORQ C;  5DN6 G;  3F5T A;  5KHJ A;  1Q5O A;  4CBC A;  5L3B A;  2A0L A;  4LWS B;  2EIJ C;  5IYB O;  3T1Y B;  4DR6 B;  1JJO A;  2LW7 A;  1NVP B;  2GUZ A;  5B3S B;  4YHH B;  1XMO O;  4DV1 O;  4BIO A;  4YHH O;  1XMO B;  4TUY B;  1JR9 A;  3ZCC A;  3T4Z A;  4UV9 A;  4X62 O;  5JVD A;  4HZ3 A;  4X8A A;  1YJW V;  4UUJ C;  1Q82 W;  4K0K O;  4JI3 O;  4JI5 O;  5FPO A;  3HKB B;  4FZ0 A;  4Z1V A;  2HR3 A;  1AR4 A;  4DV5 B;  4X66 B;  1N33 O;  2DYS C;  1D5N A;  3L73 H;  1F4M A;  2X6A A;  3FB7 C;  3JD4 A;  4UCV A;  1H2S B;  4CS4 A;  3FYE B;  4PA7 A;  4LP8 A;  4DV7 B;  3E89 A;  4LF5 B;  1VAR A;  5LMU O;  4LF9 B;  1JFF B;  1UJW B;  4DV0 O;  3CP1 A;  2LFR A;  4CS3 A;  5EK0 A;  3ZX6 A;  2BTQ B;  5E1A C;  1S5L Z;  2UUC O;  5EYP B;  4GKJ O;  2H94 A;  5IWA B;  3BA8 A;  3F7Y C;  3BVO A;  4N21 A;  3SGI A;  3F7V C;  1IDS A;  4L87 A;  3JAW B;  4GX1 A;  1T5E A;  3G6E V;  4X89 A;  5KA5 A;  1XL6 A;  4K3A A;  1P84 F;  3AG1 C;  1K8A W;  4AQY B;  3ZMV A;  2R70 A;  5JQG A;  5A2Q N;  5KHK A;  1AR1 B;  2ZD9 A;  1S0V A;  2GDS A;  1YDX A;  2WA3 A;  3K59 A;  1EFR G;  4Z2W A;  1EN4 A;  2ZE7 A;  3K58 A;  4PA3 A;  2QTO A;  1RFY A;  3LSQ A;  2Y69 C;  1BZK A;  2W0F C;  4JTD B;  1KUQ A;  4JI1 O;  2CGN A;  3RYH A;  4X20 B;  4IL6 Z;  3KZI Z;  3GB7 C;  3HKE B;  3ZRW B;  2QWP B;  1Q6U A;  2YXH A;  3RVY A;  1NKD A;  2BTO A;  3O65 A;  1THZ A;  3L9D A;  4BWA A;  1NZ6 A;  2YI8 A;  1KB9 F;  1IXM A;  3OTF A;  3CCE V;  4LF6 O;  1XNQ O;  1K73 W;  4FLX A;  1V55 B;  2R72 A;  2GBO A;  3KCY A;  4LFA O;  4O2B B;  4LF4 O;  2VWK A;  2DOS A;  4BW9 A;  4NYK A;  1OCZ B;  1ZLZ A;  2QM7 A;  4L8J A;  1Y74 B;  4U7N A;  4FFK A;  4J9Z B;  3X2Q C;  1Q90 D;  3CCM V;  1IUR A;  2ODM A;  1W2B U;  5JJJ B;  4RAI A;  3Q4H B;  4JYY A;  2RN9 A;  1UPG A;  1YTF D;  2CTW A;  2JGD B;  3FAV A;  2YID A;  3CRC A;  3LNM B;  2N04 A;  4QGP A;  1D2D A;  2IBZ H;  3VQY A;  1L0N H;  4WCE V;  4MTG A;  2B1G A;  4TQD A;  4MTO A;  4QPJ A;  4GLX A;  2F95 B;  4JV5 B;  4KHP B;  1TUB A;  4JAV A;  4MT8 A;  4JZ2 A;  4ZOL B;  1R3L C;  1L8D A;  1FXK B;  2E3C A;  1MNG A;  1XHX A;  2ZXW B;  1BCC H;  4NTY A;  4YJ3 A;  3TJT A;  4BW5 A;  3RW0 A;  3JD2 A;  2VQE B;  4ZIB A;  1M4U A;  4EEQ A;  1KD1 W;  2UXX A;  2D2C B;  1L0L H;  2LQT A;  2E76 B;  2IW5 A;  4QE7 A;  1RSO A;  3E86 A;  3UKM A;  3E8H A;  1AR5 A;  3QTC A;  2JGD A;  2GUZ B;  4QNH B;  5J2T A;  2E74 B;  3Q4H A;  3ZHS A;  2DE0 X;  3CD6 V;  1BSM A;  2F66 C;  3GVM A;  1OCC C;  4GKK B;  1Y4M A;  3IC7 A;  3SPG A;  2LFS A;  1IVS A;  1SQG A;  4DR2 B;  2A9H A;  3AK1 A;  1FAF A;  3DC5 A;  4A5U B;  1SQV H;  2ZT9 B;  3QNE A;  5B3S C;  4PA6 A;  3N2K B;  3OW2 U;  4UV8 A;  4CH6 A;  4JI4 O;  5LMN O;  3RYF B;  1Y76 B;  4X65 O;  3IJ4 A;  3WU2 Z;  2RQ6 A;  3HKD B;  5E79 Z;  5LGT A;  4DV5 O;  1HNW O;  3P3P A;  1GM9 A;  1JQ0 A;  1Y6X A;  3SJC C;  3EXA A;  1UFI A;  3JD1 A;  2BSK A;  1S5H C;  1HR0 B;  1R3I C;  3JAL A;  2EIK C;  5BR8 O;  3BHP A;  4HAM A;  1RM1 C;  2Q7G A;  1YHQ V;  1HNZ B;  4QJF B;  2M7W A;  4XBF A;  1ZTE A;  3ETD A;  1M90 W;  4UB6 Z;  4DV6 O;  3CCU V;  3N27 A;  2Q8V A;  4X20 A;  3JYC A;  4MVS A;  3CX5 F;  4JYA B;  4JI8 B;  4JF3 A;  4CS2 A;  5J2U B;  4MS2 A;  3CCL V;  3K06 A;  4BIZ A;  5LP6 C;  4RQE A;  1S3J A;  4DUY B;  5KHI A;  3CRA A;  1Z5V A;  1I5X A;  3DGE A;  3TET A;  1SER A;  5KMG A;  1R6K A;  1S5J A;  1G8M A;  4JI6 B;  3ZRV A;  1VQ6 V;  4WFB V;  3JAW A;  1PNM A;  3AG1 B;  5EBW C;  3SPC A;  1PL4 A;  2YIC A;  3DXR A;  3VBB A;  4KFM A;  1VQM V;  1QQC A;  4LNU B;  3SR2 C;  1W0J G;  3D8C A;  1A32 A;  4UB8 Z;  3D3I A;  1R73 A;  5IE9 A;  4UVC A;  3B8M A;  1R3K C;  1NR1 A;  5L3F A;  2OCC C;  2QSA A;  2VWJ A;  3CRM A;  3F5W C;  4DR1 O;  4FZ1 A;  3ZN1 A;  4NXN B;  3CHX A;  3L72 H;  1VQO V;  1SQQ H;  4DR7 O;  4PI0 A;  3VOU A;  2XAS A;  2WLN A;  5IYD O;  4I50 B;  1O9G A;  1I94 B;  1WAZ A;  3D36 A;  4FM2 A;  1IBM B;  1YTF B;  2P7T C;  4TT3 G;  1AVM A;  4FIP C;  3RGB A;  1TVK A;  4MW8 A;  3B8N A;  4FM1 A;  2UXC B;  4GX2 A;  4UCU A;  2VQF B;  5BMV A;  3GWK C;  1LUW A;  4DUZ O;  3WB0 A;  4ZI7 B;  3BAA A;  4X1I B;  2OTL V;  3H1K H;  3DTU B;  1J5E O;  3WB2 A;  2JDI G;  2Q0O C;  2AXT Z;  1FJG B;  2AHY A;  1SET A;  2IJJ A;  1PKX A;  3FFQ A;  3DXR B;  3JAS B;  1SA0 B;  1HW7 A;  1KYO F;  1AB3 A;  3OM3 B;  3ZRX A;  3E22 B;  1PL0 A;  5LBQ A;  4X65 B;  3G4S V;  4NXN O;  4FM0 A;  1H2L A;  3AG3 C;  1N33 B;  1GRJ A;  2V1D A;  5IY5 B;  1L1F A;  2PI4 A;  4X66 O;  3J7A U;  1WA8 B;  2P6J A;  3E35 A;  1GTO A;  2A79 B;  1SQB H;  3APO A;  2K9P A;  4GUN A;  2H8P C;  5J2U A;  1XMQ O;  3T4D A;  4XDJ A;  2HJD A;  4GKK O;  1SF9 A;  1XQ8 A;  2YS8 A;  1Q6H A;  4HNA A;  2A7W A;  2KSD A;  3HKC A;  4W4K A;  4EFB A;  2P5O A;  1WB8 A;  2CK3 G;  2IM9 A;  1IX9 A;  1FXH A;  1RPO A;  1MMM A;  2F1M A;  4I55 B;  1NTK H;  2ZE8 A;  3RYI B;  1R6N A;  1F7Y A;  3CEI A;  3O9O A;  4DUY O;  5CMU A;  5GON A;  3T1H O;  4B3M B;  1OCO C;  2IU0 A;  4ASU G;  2EBO A;  2ADQ B;  4DV2 B;  5B1A C;  2CTR A;  1HNX O;  2N74 A;  3K08 A;  1Q7Y W;  1N34 B;  1AI7 A;  3E8F A;  3A8T A;  3MD0 A;  1NVP D;  1GH6 A;  2EZO A;  3RBZ A;  3B09 A;  1S72 V;  1OCC B;  4O2A B;  4ZI7 A;  4MSW C;  5LGU A;  4I7Z B;  3K57 A;  4R8C A;  5KAI Z;  2R9I A;  3OR6 C;  4B7E A;  2V7Q G;  4LF5 O;  2KKW A;  4GKJ B;  3OMN B;  3SYP A;  4PD4 F;  3ETQ A;  1OCR C;  5IYZ A;  3WFV A;  5CA0 A;  3UM7 A;  1RSO B;  5LXT A;  1BS3 A;  3BEH A;  1N8R W;  1TGO A;  3G6B A;  2Q5Z A;  5L3E A;  2KG7 B;  2HHH O;  2KB1 A;  4B3R B;  5KUK A;  1XBL A;  1ARO P;  1IZ3 A;  3K5N A;  1RM1 B;  4ZOL A;  4K0K B;  2OCH A;  4I4T A;  4PDV A;  5FLX N;  3CYO A;  4I0X B;  2P90 A;  1XL4 A;  4K35 A;  4AQY O;  4FLV A;  1GMG A;  3OUS A;  4TQF A;  3JAM N;  4TWK A;  1MA1 A;  3LSU A;  1D5A A;  2P06 A;  3APQ A;  2RNB A;  3L75 H;  1AJQ A;  3J81 N;  3EVK A;  1AP6 A;  2XAH A;  1E1Q G;  3FAV B;  2UXD O;  4UFZ A;  2NLJ C;  5FPR A;  4DUZ B;  1B3Q A;  4B3T B;  5LA6 A;  1H38 A;  3TK1 A;  2YXL A;  3X2Q B;  4YIO A;  1Q43 A;  3ABU A;  1S77 D;  1EBO A;  2P67 A;  4LFB B;  1PM9 A;  3GWO A;  3RFR A;  4DW1 A;  1J95 A;  3CXH F;  1IBK B;  4MW3 A;  3I56 V;  2FL4 A;  1YIJ V;  1P7G A;  2Q7E A;  1M57 B;  4PA9 A;  3ZHR A;  3FB5 C;  4JAA A;  4LR3 A;  1M5I A;  2ZIN A;  2EJR A;  5HFL A;  4TV9 A;  4JGS A;  1DTO A;  1VIB A;  4Z1M G;  5LYJ B;  2L35 A;  1QLE C;  2UXN A;  2HKO A;  3M8A A;  3CCJ V;  2ITC C;  2JEU A;  4QPK A;  2QE7 G;  5D5Q A;  3AG4 C;  4PI2 A;  4LBE C;  3U11 A;  1JJ2 U;  2YEV B;  2UU9 O;  3C90 A;  3AK2 A;  1JX9 A;  2A06 H;  1U97 A;  4IIJ B;  4LH6 A;  2YEV A;  3ABK B;  3NR7 A;  4BIU A;  5F2V O;  1EN5 A;  2EIM B;  2CTQ A;  2WAM A;  2RMK B;  2BSK B;  3AG7 A;  2GSM B;  2JRI A;  2HHH B;  1AI5 A;  2UUA B;  1HP8 A;  5LHG A;  3CCV V;  1G1X B;  4JI4 B;  1TUE B;  3RYF A;  1XNR B;  1IBK O;  1V55 C;  4J80 A;  2XOK G;  4J9Y B;  1YI2 V;  3JAT B;  4QIW F;  1LNQ A;  5JQG B;  4DRX B;  4DV4 O;  5H2F Z;  3OEE G;  1I7F A;  4PDL A;  2JVD A;  2EIJ B;  4TV8 A;  5FL7 G;  4J7K A;  2YXY A;  4JAS A;  4J10 A;  4ICG A;  2Y0P A;  5J2T B;  1JA8 A;  2BTQ A;  3AEI A;  1K33 A;  5C8Y B;  1Z2G A;  3T1Y O;  1M56 C;  4LF8 B;  2X6C A;  4B3S B;  1N32 O;  2LJ2 A;  4PV1 B;  3ZMU A;  2UXB B;  2PGG A;  4R6Z A;  3SPJ A;  4J7Z A;  4P30 A;  4UXN A;  4ZKI A;  4I0X A;  3ZS8 C;  1WPX A;  3S3W A;  3QG5 A;  3SPI A;  2CAZ C;  4CH5 A;  1TUB B;  4X88 A;  2L6L A;  3W7T A;  2MW2 B;  4JYC A;  1OCZ C;  3M99 B;  2HEP A;  3CC4 V;  2BE3 A;  1MOF A;  5EIB C;  3ASO C;  4FLT A;  4KL1 A;  1YVW A;  2WLI B;  1BGY H;  1H8E G;  2Q6A A;  4RQF A;  4X64 B;  1N4C A;  5CA0 B;  4DV0 B;  4TUY A;  2IJH A;  5LMU B;  2RCV A;  4K8X A;  3ETE A;  4R7C A;  5J9P C;  1FPO A;  1KBH A;  4WFF A;  2LW1 A;  1G4Y B;  2IU3 A;  5JJN B;  4YIP A;  1DLB A;  1SC5 B;  1Y74 A;  2DWD C;  4DR6 O;  2QA4 V;  4D7S A;  5CA3 A;  2JIZ G;  3ASO B;  5TIS Z;  1WP8 A;  2FML A;  4MVM A;  1BHB A;  2QDO A;  1EM1 A;  3JAT A;  2BOC C;  2WLI A;  4CC5 A;  4B3M O;  1GK9 A;  3ASN B;  1ROP A;  3LDC A;  4FK5 C;  1VQ5 V;  3K3W A;  3JSN A;  2UUA O;  5KX5 A;  1XNQ B;  1DK1 A;  1QBZ A;  4DV3 O;  4J41 A;  4MVR A;  2PY5 A;  2F4V B;  2WLH A;  1VF6 C;  2HP8 A;  4ZHQ A;  1XMQ B;  3FX7 A;  4HYO A;  1NQT A;  1NU1 H;  2OCC B;  4X1Y B;  3A0R A;  4UCO A;  4G27 B;  4KXR A;  1FXV A;  1GN4 A;  3HKE A;  4X9Q A;  1FFT B;  3G67 A;  4OPA A;  3W7U A;  2FYU H;  1W0K G;  2OWO A;  1WLE A;  3K04 A;  3VQV A;  4JI2 O;  1FYJ A;  5KLV H;  1JMK C;  3ABT A;  2ZIO A;  4DR7 B;  4NTW A;  3BPZ A;  5KUM A;  5IYC O;  5LMN B;  1WA8 A;  4TV8 B;  3W7X A;  1I94 O;  1AJN A;  3PJS K;  3BAB A;  4RUE A;  4PHZ A;  4PEL A;  1FKA O;  3LSS A;  1M57 C;  4DO2 A;  1V54 B;  2P4V A;  2IJI A;  2JEX A;  3CJH A;  3RYC B;  1HNZ O;  3DC6 A;  3UO2 A;  4RWU A;  3ZBH A;  5BMV B;  4LF9 O;  1CPY A;  2NN4 A;  3L70 H;  1PV0 A;  2NR5 A;  1YCI A;  2ZM6 B;  1TVK B;  1KKC A;  2DQ0 A;  4Q20 A;  2ZR3 A;  1V54 C;  3HPL C;  4DYL A;  2V4D A;  4K8Z A;  2EZP A;  1LUV A;  2WLJ A;  3ICX A;  1F4N A;  4H0L B;  4WBN A;  3QVN A;  1R6T A;  4I4T B;  3STZ C;  1N36 O;  2BOB C;  4LCU C;  5LYJ A;  2E5L O;  4WF9 V;  1PP9 H;  5IT9 N;  2A3Q A;  4TV9 B;  3HKB A;  2ZE6 A;  3SYO A;  2Q7H A;  4AHC A;  2EUL A;  1PNK A;  3SJQ C;  1ZUQ A;  1SES A;  4NTX A;  2LO1 A;  2Z5U A;  1K5S A;  1YZB A;  2MK3 A;  3JAR A;  4WFA V;  2QWN B;  2XAJ A;  4LFC O;  4JI0 O;  1ZL8 B;  3CB2 A;  1ZWI C;  1GO3 F;  3RWR D;  3T1C A;  1KC8 W;  1KU9 A;  2Q9L A;  2ZR2 A;  2XAG A;  2AGA A;  2YC0 A;  4U3J B;  4EKW A;  5B1N A;  1BE3 H;  4B3S O;  3OTO O;  1GN6 A;  4KHP O;  3OUF A;  4JYA O;  4N23 A;  5FNV B;  1BT8 A;  2JS5 A;  1VQ9 V;  5IJ9 A;  2EIN C;  4O4I A;  2YUA A;  1KKD A;  2ZKO A;  4W4L A;  2Q68 A;  1M1K W;  2FKX A;  3SDL A;  2EIK B;  5K1P A;  2XAQ A;  1ZSP A;  5KHG A;  3STL C;  2FTK A;  5EBL C;  1WN7 A;  3ABM B;  2XAF A;  1RPR A;  1KP2 A;  1H2G A;  5IDJ A;  2IH3 C;  1MSW D;  3TXQ A;  4MVZ A;  3FYI B;  3N2G A;  5IYZ B;  2ATK C;  1O9H A;  1K7D A;  1QR8 A;  1VF6 A;  3E8B A;  5A9G A;  1VQ4 V;  4FPP A;  1VMG A;  1FFX A;  2Z3Y A;  2UXB O;  5JCO A;  1PNL A;  4DR1 B;  3TXS A;  2LGQ A;  3UO3 A;  3KCX A;  3ZIA G;  2DJV A;  2OIG A;  4O4L A;  4DRX A;  4BR6 A;  2OYQ A;  4B08 A;  1NH2 D;  1JCH A;  3IAY A;  1HR0 O;  3JAS A;  3TCU A;  3CXC U;  1HNX B;  3CMA V;  2ETN A;  5EZY B;  5GON B;  3ASN C;  3AG2 C;  2DYR C;  3NXS A;  3K79 A;  1IXB A;  2IH1 C;  3SJA C;  3VQW A;  2ILM A;  4DR3 O;  3HR0 A;  4OXS A;  3QF7 A;  3IFX A;  1QVG U;  1X4T A;  3MHS C;  4HNA B;  4B3R O;  4DR5 B;  4G28 B;  3K0G A;  1BL8 A;  4O4H B;  1JOY A;  1J5E B;  1SS3 A;  4YJ3 B;  5B1B C;  1GAX A;  2WLL B;  2Q67 A;  4JI8 O;  1DF4 A;  3OT7 A;  5CB4 B;  2AZ0 A;  1BMF G;  1YJ9 V;  2EIM C;  4DW0 A;  1BQZ A;  4OGQ B;  5EIB D;  2DQ3 A;  2ZDI C;  5B66 Z;  3L74 H;  4UCS A;  5CA1 A;  1XIL A;  3KKY A;  2ZNJ A;  1I08 A;  2HFE C;  4C7U A;  1AI6 A;  2PTM A;  4LNU A;  4JI7 B;  3JAK B;  5LA6 B;  3DSQ A;  1M56 B;  5H6R A;  4X1I A;  4CC6 A;  2PF4 E;  2GV9 A;  3OMI B;  3BRC A;  1ZL8 A;  3K5O A;  3B77 A;  4F6R A;  3JAR B;  3G71 V;  3ZRS A;  3ZED A;  5CBG A;  3MDS A;  3A0H Z;  3HB3 B;  4LFB O;  2X6B A;  2ZQM A;  3RVZ A;  1XHZ A;  1OJH A;  5CN0 A;  1Q86 W;  2B5U A;  4DK0 A;  3ZMS A;  1SQX H;  1H2N A;  1Q6I A;  2ZDI A;  1Y67 A;  4KP4 A;  1VQN V;  3H1I H;  3CSX A;  4MVQ A;  3RN4 A;  1QHT A;  1JPX A;  2Y0I A;  4NKG B;  1EN6 A;  4I50 A;  4BAY A;  4JI6 O;  4DV7 O;  4J7J A;  3UCS C;  3CPW U;  5JWP A;  5DED A;  4PDM A;  2EX3 A;  1XUQ A;  2ZXW C;  3ZRW A;  3K0D A;  4JTC B;  1XRE A;  5BR8 B;  1B06 A;  5LP6 A;  2JGU A;  3LDD A;  4AIL C;  2GTA A;  4I9Q A;  1N32 B;  2HLD G;  4NB5 A;  4Q6G A;  2JJ2 G;  4GZR B;  1BQ0 A;  1TAE A;  1OCO B;  4EB6 B;  4H37 A;  4FFB B;  2XHB A;  4J11 A;  3AG4 B;  1LR1 A;  5H6Q A;  1WNS A;  2ADP A;  1VQK V;  2EJ7 A;  1BHA A;  3CJH B;  5H5N A;  5BXZ A;  3N2K A;  4I9W A;  4PA4 A;  2B9Z A;  2X7R B;  4X1K A;  1MSD A;  5KMG B;  2JK5 C;  1OCR B;  4WFE A;  4OX9 O;  1NR7 A;  4XDL A;  2R9R B;  4NR1 A;  4YJ2 B;  3ZHT A;  1JVM A;  4NXM O;  2NNU A;  1G6U A;  5H9C A;  5BY1 A;  3CCS V;  3BFR A;  1Q81 W;  3OR7 C;  3HKC B;  4R50 A;  1B04 A;  1K5Q A;  1WJZ A;  3VQX A;  3M7M X;  1YSC A;  2QM4 A;  2PZS A;  1JFF A;  2DMX A;  1N0N A;  2Z0A A;  3FB8 C;  2PI5 A;  3B4S A;  4DK1 A;  1YIT V;  2Q0A A;  5JCO C;  2XUM A;  4MTX A;  1OHH G;  4IHJ B;  3SYC A;  1S76 D;  4X1Y A;  1QVF U;  3THO A;  1QNM A;  2UUB B;  2EIL C;  2PUS A;  3PN1 A;  1SKV A;  3JD0 A;  1H2K A;  2WWW A;  2KQX A;  4J42 A;  3ZMZ A;  3QO5 A;  3LDE A;  3LUT B;  3UT5 A;  1XDC A;  3G80 A;  1OZ0 A;  5D5P A;  2Y48 A;  2QWQ B;  3P30 A;  5LHI A;  2ZNI A;  1NTM H;  5BZB A;  2C2A A;  5L3G A;  1M9N A;  3A2F A;  3IGA C;  3AG3 B;  4DR5 O;  1XEQ A;  4XDK A;  3T2M A;  2VQF O;  2GHY A;  2BCC H;  2QEX V;  4TSF G;  4JI5 B;  4JI3 B;  3UT5 B;  5IY5 C;  4KUM A;  1VP7 A;  4FLW A;  2R9A A;  4OPH A;  1NS1 A;  1NT2 B;  1FXK C;  3OEH G;  1VF5 B;  3BCC H;  4RUF A;  4E2L A;  5DEC A;  1FXK A;  1OV9 A;  2IJK A;  1WB7 A;  3D36 C;  1NI8 A;  1X59 A;  4DV4 B;  2CH7 A;  4UVA A;  3WG7 B;  3ZHQ A;  3OGC C;  1GN2 A;  4LFA B;  3K9S A;  4GT1 A;  3RT3 C;  2WA4 A;  5EC2 C;  2HVJ C;  2AW9 A;  2ITD C;  1AJP A;  4FJC C;  1Q3E A;  2ZE5 A;  3P32 A;  1IBL B;  1DF5 A;  2CTP A;  2YI9 A;  1FJG O;  5HFM A;  3RYH B;  2QKA A;  4CH3 A;  5GTH Z;  4GCZ A;  3EHB B;  1QU7 A;  2Q4P A;  2O57 A;  1F23 A;  4PJ0 Z;  5C8Y A;  1CP9 A;  1YEW A;  4IYI A;  4LF8 O;  1HWY A;  2CDY A;  4D6T H;  1WPB A;  4JI2 B;  2VRZ A;  3ML0 A;  3RYC A;  2W6J G;  4LF7 O;  3SPH A;  4I5S A;  4YJ2 A;  2UUC B;  3K9A A;  3R65 A;  3BA9 A;  1SZX A;  4ZBM A;  2WLK A;  1QLN A;  5EC1 C;  4FLU A;  3E2E A;  3A0B Z;  5JJE B;  4O2B A;  1MG1 A;  1K4C C;  5AG2 A;  2PYL A;  3H1H H;  4UCT A;  2HJF C;  3E83 A;  2DN9 A;  1SQP H;  4FFB A;  4H13 B;  4EB6 A;  2K1E A;  3CCR V;  5L3D A;  1Z5W A;  3C3T A;  2EIL B;  2N05 A;  1Y66 A;  5LP6 B;  1I0H A;  3BY6 A;  1R3J C;  4IIJ A;  4CZZ A;  4CH4 A;  4AI8 A;  2WSS G;  3ZMT A;  3LNN A;  4LF6 B;  1NJI W;  1VEW A;  3JAL B;  4UVB A;  3OAA G;  1CEZ A;  2FB5 A;  2ZCE A;  3JCU Z;  4DV3 B;  4ZHQ B;  2D3O W;  4FLZ A;  2QWO B;  2F93 B;  1AI4 A;  1VQ7 V;  2LGW A;  3CS5 A;  5KX5 B;  1Y76 A;  2HG5 C;  4B7K A;  4U3F H;  1YXB A;  4F4L A;  3CC7 V;  3UQ8 A;  1SQF A;  2DWE C;  2JS3 A;  3D3Q A;  4FVM A;  1AP5 A;  4F6R B;  4JAU A;  1ZAU A;  4YY3 B;  4LWS A;  4YXW G;  4TOI A;  2B1I A;  3JAK A;  5IWA O;  2QM8 A;  1RP3 B;  4WFG A;  2OT5 A;  4DXW A;  3AG2 B;  1COW G;  2X0L A;  1NTZ H;  2UXD B;  4UCR A;  4JV5 O;  2RDC A;  4O4J B;  3EFF K;  2E5L B;  2CUG A;  4MTF A;  5IJ0 B;  4H33 A;  2CGO A;  3CWB H;  3JD3 A;  5KA6 A;  3ZN0 A;  1B6Q A;  3B2E E;  5CB4 A;  3U0Z A;  4IHJ A; 
#chains in the Genus database with same CATH homology
 1IUR A;  2DN9 A;  2EJ7 A;  3UCS C;  2CTQ A;  2M6Y A;  2GUZ B;  2GUZ A;  2QWQ B;  3APQ A;  2QWP B;  1BQZ A;  3AG7 A;  2CTW A;  2CTP A;  1XBL A;  2N04 A;  2YS8 A;  4IT5 A;  2PF4 E;  2KQX A;  1WJZ A;  4J7Z A;  1N4C A;  2CUG A;  2LO1 A;  2N05 A;  2QWO B;  2Y4T A;  3BVO A;  1HDJ A;  2DMX A;  2CTR A;  2LGW A;  2OCH A;  2Y4U A;  2QSA A;  3UO2 A;  1BQ0 A;  1NZ6 A;  1FPO A;  4J80 A;  4RWU A;  2YUA A;  2QWN B;  3APO A;  3UO3 A;  1GH6 A;  1FAF A;  2QWR B;  2L6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...