1N4CA

Nmr structure of the j-domain and clathrin substrate binding domain of bovine auxilin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
182
structure length
182
Chain Sequence
GPLGSPEFSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Auxilin
publication title Structure of the functional fragment of auxilin required for catalytic uncoating of clathrin-coated vesicles.
pubmed doi rcsb
source organism Bos taurus
total genus 27
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1n4cA01
2CTQA 2PF4E 1NZ6A 1XBLA 1GH6A 3BVOA 4J7ZA 1FPOA 3UO2A 2LO1A 2LGWA 4J80A 1BQZA 2QWRB 2N05A 2QWNB 2CTWA 3APQA 1HDJA 2GUZA 3UO3A 2QWQB 1FAFA 2KQXA 2OCHA 2YS8A 2QWOB 1BQ0A 2Y4TA 4IT5A 2GUZB 2M6YA 2CUGA 2L6LA 4RWUA 1WJZA 2QSAA 1N4CA 2CTRA 2DMXA 2QWPB 2YUAA 3APOA 2Y4UA 2N04A 2DN9A 1IURA 2EJ7A 2CTPA 3UCSC 3AG7A
chains in the Genus database with same CATH superfamily
3FYEB 1B04A 4FJCC 4ZBMA 5KHGA 2QE7G 1E79G 2Y0PA 3CCEV 1M56C 1PL0A 2OTJV 2L35A 4LF9B 4X1YB 3ZRWA 3ZRWB 4DV3O 1Q5OA 2P4KA 3H1KH 4HBNA 2IU3A 1SA0B 1Y6XA 3K03A 1H38A 1SQVH 5LA6A 4I0XB 5J2TB 1Q8IA 2AZ2A 1WB7A 2N05A 5AG2A 3APQA 3OEEG 3HKEA 4NXMO 2CDYA 4O4LB 3RYHB 4WBNA 4X88A 3ZHSA 1VQ8V 1THZA 1SQXH 3JD1A 1GTOA 1S72V 3ETDA 5FL7G 3OTOO 4H33A 3ZMTA 1GM7A 5LOVA 3Q4HB 3D36A 4UUJC 2AHYA 4R6ZA 1JR9A 4JI5O 2Q5ZA 1IXMA 5L3DA 1IBMO 2PI4A 5CBGA 4ICGA 5GONA 4TT3G 3CMEV 3L72H 4PA6A 1Q82W 4TOIA 4X1KB 3H1IH 2ZDIA 4UCUA 2E5LO 4EB6B 1W59A 3A0BZ 1QLNA 3ZBHA 2YEVA 2R9AA 4L87A 3SGIA 2EBOA 5EBLC 2CAZC 2UUAB 2HHHO 4UV9A 3KCYA 5JCOA 4O4JA 5JH7A 4QPKA 2NNUA 4O4JB 2ZD9A 3PJSK 4BWAA 1GMGA 3ETQA 4LF5O 3ZX6A 4KHPB 4X64B 5LXTB 5KLVH 1LR1A 3FD9A 1R3JC 2HLDG 2ETNA 2AXTZ 4Z1VA 3ABMB 4WFGA 3SJQC 2P67A 1UFIA 2XTAA 3OR6C 3EFFK 3DC6A 2ITDC 5H6RA 4AILC 1QVFU 1AI4A 2GSMB 3S3XA 1OCOB 5IDJA 2Q4PA 1IZ3A 3WFVA 1HNWO 3G71V 3JAKB 1AP5A 3FFQA 1VMGA 1F4MA 2JK5C 1K97A 5KX5B 5LGUA 1K8AW 4GYCB 3PN1A 4C7UA 5CA1A 2K9PA 3RT3C 4IHJA 2HKOA 1IURA 2CTPA 3FAVA 2F23A 4JYAO 1VQKV 2Q8VA 3FAVB 1K7DA 2CH7A 1NVPB 2CH7B 1Y66A 1SKVA 4K8XA 2AGAA 1W0JG 2MW2B 1TUBB 1OZ0A 4IIJB 1WN7A 2RN9A 1SETA 2YDEA 4PA9A 5CA0A 3JATA 1QCEA 2DQ0A 3JATB 4O4HB 1Z2GA 5J2UA 3ICXA 4B3SB 2OTLV 1OCCB 3MHHC 4JI2O 4DV7B 4DV1B 3N2KB 1DF5A 1D5NA 3SYCA 3CXCU 3JD4A 2PYJA 5KHKA 1T5EA 3L74H 3C90A 2ZXWC 1OCRB 1XMQB 4JV5O 2IU0A 4KL1A 1Z5VA 2UXCB 4PI0A 2EINC 1ZWIC 1CXZB 4JAUA 3ZJZA 3G80A 2WA3A 2HEPA 1K3EA 1R3KC 4F6RA 2R70A 1MSWD 1ZTEA 3H01A 5B1BB 1LNQA 4YJ2B 4EEQA 5KUKA 5LP6C 1MA1A 1SERA 2YIBD 1M5IA 4JAVA 2H3OA 3ZRVA 4JI6O 2A0LA 1IDSA 4MW8A 2YXHA 2Z5UA 1X4TA 2JVDA 3SPGA 2VQEB 2ZIMA 4TV8A 2QWRB 4LF9O 4LFAB 4TQFA 2EIMC 4MTXA 4PELA 4QE7A 5IYZA 2VS0A 4J11A 3EXAA 5IYZB 4JI7O 3ZHVA 1HWYA 4BR6A 3ZMUA 4QGPA 2X6BA 3AG4C 1K34A 2X6AA 3CCJV 1KECA 1ZL8B 2YIBA 1ZX3A 1N32B 1PM9A 1Y74A 3FX7A 4KP4A 5GTHZ 4CS2A 1ZAUA 3K5LA 2WLLB 2FB5A 5CBFA 2OCCC 4KFMA 1WLEA 2YIAA 4JYCA 5LMNB 4X1IA 2BOBC 2VQFB 1KD1W 4DR6O 3APOA 1FFXB 5IY5C 1PL4A 5CBHA 1RSOA 2PUSA 1DLBA 4LF8B 3E2EA 2ITCC 1VQNV 3JARB 4XDLA 5B1OA 1KYOF 4Z1MG 3H9VA 4HYOA 4X65B 4J10A 3G67A 3LNMB 1PNMA 3SYPA 4I7ZB 2LP7A 2V4DA 3K5MA 4XBFA 1NZ6A 2QJ1A 1N8RW 4OXSA 3CCLV 1COWG 1VARA 2UXBO 3E8FA 4DW0A 2RJZA 1I94B 2B9ZA 2JGUA 5EYPA 4D7TA 1XQ8A 4U3JA 1FFTB 1AJNA 1UPGA 4PV1B 3EVKA 3W7XA 1EN5A 1AI6A 1LUVA 4JI1B 2UUAO 4WFFA 3E22A 2QEXV 1U97A 3CWBH 2BTQA 3E22B 3GWOA 5F2VO 4B3MO 2BTQB 4YXWG 3ZS8C 3LDDA 2ARHA 2JGDA 4RO2A 4GKJB 1YJNV 3P3PA 1XUQA 2JGDB 2ZCEA 1YF2A 2IM9A 1S77D 5B66Z 4NXMB 5LHHA 3L70H 4NTWA 4FLTA 4PI2A 3CJHB 4UVCA 1FYJA 5IJ0B 1YTFB 3OTOB 4ASUG 2H8PC 3WU2Z 3RYIB 5D5QA 5IJ9A 4JI5B 1I0HA 4NXNO 4JZ2A 1IBMB 4DW1A 4A5UB 1NTMH 1PD3A 4MVRA 1VQLV 1FD9A 4GX2A 2JEXA 3BEHA 1XILA 4FPPA 3OTFA 1D5AA 4J9ZB 1FXKB 3B8MA 1RFYA 1W0KG 3JSLA 3C3TA 3AEIA 5JVDA 3SYOA 3ZRXA 5BR8B 5H5NA 4X20A 1Y76A 1VEWA 4X20B 3BY6A 4ZI7B 3D8CA 2WLHA 2LQTA 2D3OW 1VQMV 2HVKC 2DWEC 1BMFG 3BCCH 2QM4A 2PTMA 2HHHB 1NS1A 2DYRB 3CRAA 3ABMC 4B3SO 3I55V 4X62B 4MVQA 5KHIA 2GUZA 2YS8A 1QHTA 4YY3B 3VOUA 1M9NA 3NR7A 3OMAB 4LFBO 3IGAC 1AROP 1KB9F 1OCOC 1IBLO 1H2SB 4IYIA 3X2QB 2Q73A 4CZZA 1XMQO 1WA8A 1SQPH 2NLJC 5K1XA 1JJOA 2YC0A 1FAFA 1QVGU 2QWOB 1HNWB 4DRXA 1P49A 1VF6A 3IC7A 2X7RB 3DXRA 1J5EB 4JI0O 3THOA 4FLUA 3RBZA 5EZYA 3OUFA 4JYAB 4LF6O 3CPWU 3MDSA 4LFAO 4B7EA 1AR5A 4P9OA 5ITZB 1L0LH 4DV2B 4W4KA 1PKXA 5CMUA 3HR0A 3K0DA 4LNUA 4GCZA 2Y0IA 4LNUB 5LP6A 2HJDA 3ASNB 2EILB 1ROPA 5CB4B 2Q6AA 5EBWC 3STLC 3ZIAG 3SYAA 1SZTA 3QVNA 5BMVB 5LMNO 3CB2A 1TVKB 3N2GB 4JI2B 1OCRC 2M6YA 1AVMA 3JD2A 2R72A 3FB8C 1KU9A 3ETEA 3CC7V 4J7KA 4TSFG 2IJHA 1M1KW 2ZINA 4MVMA 1E1QG 5B1BC 3CSXA 4WCEV 4J7ZA 1TA8A 2Q7HA 2EIKB 2XAJA 4X65O 2DYSB 5EK0A 3P3NA 2N74A 3OW2U 3CS5A 3OR7C 4TUYA 2HJFC 3AG1C 4YJ3B 2GBOA 5HFMA 4LH6A 2JDIG 4F4LA 1XHZA 1GAXA 2ZNIA 4JI6B 1QQCA 3DSQA 4CBCA 4J80A 2LJ2A 1I94O 4MS2A 3ABUA 3T1HO 4RWUA 4DXWA 4JI1O 4JI7B 3R65A 3B40A 3FB6C 4U7NA 2Q9LA 1DK1A 3KKYA 4UXNA 4GKJO 1V54B 3CRCA 3ZN1A 5LA6B 3K5NA 2QTSA 2CGNA 3HKEB 4WBNB 2QSAA 3D3IA 4DR6B 2PI5A 4JGSA 3E35A 1DTOA 5A2QN 2YI8A 1K4DC 3CD6V 3JALA 3TXSA 4B3RO 1QNMA 4I4TA 3CP1A 4UCSA 1YEWA 5LOVB 3SJAC 1YVWA 4CC6A 1M90W 3NXSA 4EKWA 5GONB 4YIPA 1K4CC 4DK0A 1RPOA 4AHCA 1I08A 4G2KA 5JQGA 5KMGA 1YITV 5JQGB 4J9YB 2VWKA 4Q6GA 5BR8O 2ZNJA 2LO1A 3LUTB 3ZCCA 2R9RB 2PGGA 3OGCC 3ZN0A 2UXBB 3RYFA 1YXBA 1QR9A 5FNVA 1AILA 5B1AB 2YEVB 5KUMA 4DUYB 4I9WA 2X0LA 4GUNA 1B3QA 3E8BA 3SYQA 4B08A 3SR2C 1P7GA 3LSSA 2VWJA 1AR1B 4L8JA 1M57B 4X62O 5D5PA 4B3MB 5LHIA 5JH7B 5FPRA 4YY3O 2B1IA 2WLIA 1JPXA 2DW4A 1XEQA 3K57A 3AG2B 4FLYA 1JQ0A 2W0XA 4FM1A 3UKMA 4MT8A 1VP7A 1PP9H 4BIOA 1N0NA 3CEIA 4DR7B 4HNAA 2RCVA 1O9HA 4DV0O 1FXKC 4HNAB 1NKDA 4B3TO 4NXNB 1Q3EA 2HR3A 2ZE6A 1GN2A 1NU1H 4UVAA 1J5EO 4K0KB 4G27B 2N04A 3OGIB 2ZR2A 5H6QA 3UCSC 2EX3A 5CA1B 4D6TH 3JAWA 5EC1C 4IHJB 3K59A 1SQBH 5KHJA 4JTDB 2QA4V 1VIBA 3W7WA 5E79Z 2IH1C 1I5YA 4E2LA 4DV2O 2DYRC 4IL6Z 2KKWA 5JJJB 3P30A 3SJCC 4TV9A 3HKCA 3HKCB 2F4VO 5CA0B 4PA4A 5IYCO 1Q6UA 4TWKA 3RYCA 3HPLC 2V1DA 1HNZB 1A32A 1P4RA 4ZHQA 2H94A 4K35A 5J2UB 5L3FA 2K1EA 3T1CA 3ZHQA 1KP3A 3X2QC 2Q7GA 2YXYA 1MG1A 3CRMA 4W4LA 4OGQB 4LFBB 2CK3G 4FM0A 3SPHA 5LBQA 1IBLB 2IBZH 5J9PC 1XNQB 3ZMSA 4J7JA 2EZPA 1NI8A 1YIJV 1KMIZ 4O4IA 1Q81W 5B3SB 1NH2D 3UQ8A 4WFHA 2X6CA 4F6RB 3DC5A 3RVYA 4X8AA 3SPJA 1KKCA 4ZOLA 2EJ7A 4JYBA 4JI0B 1GN4A 4MVOA 4TQDA 3K3WA 1KUQA 3HKBA 1BS3A 1BCCH 4LF6B 1CEZA 3K58A 2KG7A 1N0JA 4TV8B 3CC4V 3M99B 3ASNC 1S5HC 2R9IA 2EILC 1SQGA 5IE9A 1JOYA 3W7TA 1NH2B 4I55A 4UCVA 1MSDA 1W2BU 1DF4A 1YI2V 1H8EG 1JFFA 1SC5B 2FYUH 1Y74B 1HNXO 4JYYA 4MTGA 4N21A 2QWQB 5LL6Y 2WAMA 1RPRA 3B8NA 1H2KA 1KQSU 1M56B 4DR2O 2CTRA 1WP7A 3F5TA 4H0LB 4X1IB 4IYHA 2Q7EA 3QTCA 2EIKC 1BZKA 2DYSC 2EJRA 2WSSG 3UT5A 1EBOA 1XNRO 3K79A 1RSOB 1PNKA 4JI3O 5JJNB 3BPZA 2E3CA 2CTWA 2Q0OC 3BFRA 2BTOA 3OMNB 2LW1A 3ABKB 3TGUH 1JJ2U 1P84F 1VQ7V 4H44B 4FLZA 1WPXA 3GB7C 2P90A 4FFBA 1RM1B 2RMKB 3CRQA 3T4ZA 1BQZA 1AB3A 4U7OA 2KB1A 2ZR3A 4WF9V 5EYPB 2QGNA 4DUYO 1AJPA 4QIWF 3T1HB 4U3JB 4LC1A 5LYJA 2GHYA 1V54C 4DO2A 2P6JA 5B1NA 5LYJB 3T2MA 3K9AA 5EC2C 1YHQV 4JI4O 3WB2A 2A79B 1RP3B 5JJEB 3OAAG 1OJHA 2YSUB 1O9GA 4Z2WA 2IW5A 4FMTA 2QKAA 4UCRA 3D36C 2ZM6B 3EHBB 3OUSA 4H37A 2ZE8A 2OYQA 2ODMA 3KCXA 4B3RB 4DR7O 5EIBD 1V55B 1YJ9V 1L8DA 3BRCA 4MVZA 5IJ9B 1UJWB 4PA3A 2KQXA 4FVMA 2DWDC 1J95A 3CCQV 2A06H 2JRIA 2ZDIC 4K0KO 5IWAB 3R66A 1XMOB 3JAMN 2Y48A 5BXZA 4NVPA 3QO8A 3B4SA 1S5LZ 3J80N 1H2LA 4PDLA 5JVDB 2OIGA 2XASA 5DN6G 1VF5B 1Y76B 1VQOV 3AK1A 5JWPA 1N4CA 1EZVH 2P06A 3JD0A 1M57C 2GTAA 2WLJA 5JCOC 4X66O 1P7BA 3HKDA 1YZBA 1HP8A 1NQTA 3SJBC 1HNZO 1I7FA 1N36O 4J41A 3AG2C 2EIJB 1R3IC 4GX1A 3G4SV 3LDEA 5KAFZ 4MSWC 1QLEB 2QKCA 1MZFA 2GUZB 3K5OA 1Z5WA 5C8YA 1L0NH 4UB8Z 5BY1A 2MK3A 2M7WA 1B06A 1US6A 3FKSG 4PDVA 1XNQO 4DR3O 2AZ0A 1KC8W 1WA8B 2LGQA 3K06A 3FB5C 4JI8B 2OWOA 1VQ5V 3B2EE 4LBEC 1GN3A 4DV0B 1MZEA 3ABLB 3RW0A 2PY5A 4B3TB 1NT2B 5GW7A 5DECA 1F51A 4O2BA 3LDCA 3TJTA 4DRXB 2Y4UA 3DXRB 3JSNA 4FZ1A 3BAAA 1Q90D 3MAQA 1NTZH 2QR4A 5EZYB 1XDCA 1VF7A 4NYKA 4DR4O 1K5SA 2AHZA 1HDJA 3CCUV 4UCTA 3LSQA 4LP8A 3CHXA 2KSDA 3ETGA 1K33A 3O9OA 1OCCC 4JZGA 3W7SA 2F4VB 5LP6B 1BE3H 1GRJA 1AJQA 3BA8A 3WB0A 1PNLA 1BT8A 1WPBA 3STZC 4UV8A 4AQYO 2JJ2G 4RQFA 1H8HG 2UXNA 4ZIBA 3OE7G 3S3WA 3OFNG 1JCHA 2IJJA 2ZQMA 1FJGO 1GO3F 4CH5A 2Z3YA 2A3QA 5B3SC 3E8GA 4CH3A 4ZKIA 4MTFA 5DM6V 1S0VA 1Q6HA 3CCRV 2NN4A 2ILMA 1WP8A 1Y67A 4MTOA 3VBBA 4BAYA 3CCSV 4G28B 5A9GA 2IJKA 2EULA 2FL4A 3CX5F 3CCMV 3B77A 1XI1A 1FS0G 4TUYB 1U96A 2FTKA 2QDOA 3AG7A 3IAYA 4O2AA 4I50A 1XBLA 4E4EA 4O2AB 4I50B 4UB6Z 1GM8A 1YSCA 1ORQC 1IBKO 1QU7A 4RUFA 2UUBB 4R7CA 2Q0AA 3TETA 3VQVA 2E75B 5L3EA 2RQ6A 3OMIB 1TGOA 2RNBA 2WLMA 5LGTA 4OX9B 3KG2A 4MVSA 3A8TA 2CTQA 4ABMA 3K08A 4RUEA 4DYLA 3IJ4A 1D2DA 2LFRA 2YIDA 4X1YA 2Y69B 1HNXB 4UVBA 2RDCA 2F1MA 4KUMA 3A0HZ 2P7TC 5KA5A 3L9DA 4CS3A 4Q20A 1SRYA 2QWPB 1SA0A 4DR2B 4GT1A 2JIZG 2ZM6O 4GLXA 2BOCC 1OCZB 2DOSA 4I0XA 5J2TA 1XNRB 4BIZA 3ABKC 3JALB 1YDXA 2LGWA 4I4TB 4YHHO 2Q69A 4O4LA 3RYHA 2QTOA 2QWNB 4JI3B 4FFKA 1BHAA 1RM1C 2UXDO 2CGOA 2ZIOA 4BW9A 5TISZ 1G8MA 5IWAO 3KZIZ 1XMOO 2UU9O 2ZKOA 2XHBA 3Q4HA 5KMGB 4K3AA 4NTYA 1X59A 4CH4A 3QG5A 2ATKC 3SPCA 2WLKA 1BQ0A 2P22C 5EBMC 3RYFB 3ZMVA 4JPRA 4GKKO 1NBMG 4WFAV 5LMUO 5FNVB 5FPOA 4X1KA 5H2FZ 5L3CA 4DR1O 4BIUA 4EB6A 4HZ3A 1F4NA 3L71H 4QNHB 5IYDO 2YI9A 4IGGA 4JTCB 4JI4B 2F66C 1OHHG 1NR7A 3A0RA 4FK5C 4IT5A 4DV6B 2WLIB 1JVMA 2QM8A 5LGNA 5C93A 1E1RG 1V55C 1XL6A 1IXBA 1SQQH 2YICA 4JAAA 1GM9A 3H1JH 4MVUA 3RWRD 3E89A 5L3GA 2EZOA 1YJWV 1FKAO 5LXTA 3RVZA 3ZRSA 4JI8O 3P32A 1AR4A 5BZBA 1WB8A 1N34B 2E76B 2P5OA 4FLXA 4N23A 1S3JA 4FLVA 4JTAB 1NVPD 1SQFA 2W6IG 5EIBC 4LF4O 3UM7A 3JAWB 3ML0A 3K04A 1AP6A 3JAKA 3G6BA 3U11A 5KX5A 2JS5A 1KKDA 4PJ0Z 2Q68A 4DV5B 5L3BA 2EIJC 1GKFA 4F6EA 1SZXA 4DUZB 2WLNA 1R73A 4X66B 1QLEC 4TV9B 1URFA 4DV4O 1N36B 2XUMA 3RYCB 1FXHA 3A2FA 4ZHQB 4LF7O 1CPYA 1B6QA 2JJ1G 1TUBA 4IIJA 3WG7B 3J81N 5CN0A 3OM3B 3M7MX 1S76D 1R6KA 1AI5A 4PDMA 3K0GA 4O4HA 4P9PA 2ADPA 3ABLC 4OPHA 1MABG 1PPJH 2DE0X 4DR3B 1VF6C 3GVMA 2ZE5A 3N2KA 3OT7A 2A7WA 5FLXN 1HR0B 1XREA 3TXQA 2Y4TA 3OEHG 4JF3A 2HG5C 2F93B 3VQWA 4X89A 4O4IB 1VQ6V 2ZT9B 1XHXA 4ZOLB 3ZHRA 1GH6A 2XT9A 1MNGA 1WNSA 1NTKH 1YCIA 2UUBO 1JX9A 1N33O 2XNDG 5DEDA 3T4DA 3ASOB 4KXRA 3HKBB 1MMMA 4DR4B 3JCZA 4FLWA 4YJ2A 4PHZA 2KG7B 1DGSA 1CP9A 2NR5A 3ZEDA 1Q7YW 4HAMA 4NR1A 4QE9A 4OX9O 3AG3B 4XDJA 4I55B 3CYOA 2GV9A 3AG1B 4GX0A 1JFFB 1GN6A 2C2AA 4LR3A 3E83A 1NR1A 3DTUB 2PZSA 2L6LA 4AQYB 1ZL8A 3U10A 2QM7A 2D2CB 3AK3A 1VQPV 3CCVV 4LFCB 1SESA 4FZ0A 5IYBO 2WLLA 1V9PA 3T1YB 1FJGB 1G6UA 3UT5B 5K1PA 3MD0A 3CMAV 2IH3C 1OV9A 3K9SA 4NTXA 4DR5B 1FFXA 3CXHF 1S5JA 5B5EZ 3RN4A 3JARA 5KAIZ 3CE2A 2PYLA 2UUCB 4FFBB 4CC5A 3D3QA 3F7VC 1IBKB 2XOKG 2YXLA 1H2MA 3RGBA 5IT9N 4I5SA 3E8HA 4EFEA 1M93A 4X9QA 2E74B 2Y69C 2O57A 1R3LC 3L75H 3W7UA 1EZJA 4LCUC 1ZUQA 1QBZA 2OIEA 2WWWA 4OPAA 1K9MW 3F7YC 4R8CA 1L1FA 1F7YA 1Q6IA 3RFRA 1KBHA 2VRZA 4U3FH 4DV6O 1EFRG 1OCZC 4J42A 1Q86W 4DV3B 4PA7A 1YTFD 5E1AC 1G4YB 2YUAA 3QO7A 3FYIB 2OT5A 2HFEC 4UFZA 3HB3B 1TAEA 2GTSA 5H9CA 1BL8A 4KHPO 4PD4F 4X64O 1BHBA 2G38A 4YHHB 4K8ZA 1ENVA 3O65A 3UO3A 3L73H 1N34O 1H2NA 3ABTA 1KP2A 4GX5A 4FIPC 2DJVA 3CJHA 2UXDB 5IJ0A 4NKGB 1FXVA 2Z0AA 1VQ4V 4LH7A 2UU9B 1LUWA 2Q67A 3RYIA 4MW3A 1JA8A 1ZSPA 3JD3A 3B09A 5B1AC 4CH6A 1PV0A 2WPDG 1EN6A 2B5UA 4AI8A 2P4VA 1BGYH 2UXXA 1WAZA 3TK1A 4DV5O 1QR8A 3F5WC 5KA6A 4GKKB 1FXKA 5LMUB 1MOFA 4DUZO 1GK9A 1K73W 1M4UA 3JASA 4DR1B 2GDSA 2XAQA 2CE4A 2ZE7A 3SDLA 1F23A 2E5LB 3JASB 3I56V 3SPIA 3HKDB 3TCUA 3J7AU 2A9HA 4ZI7A 2AW9A 3FB7C 3M8AA 1Y4MA 1WJZA 5C8YB 2DMXA 2HVJC 3E86A 2QKSA 2W0FC 4D7SA 1I5XA 2LFSA 1SS3A 3LNNA 1IX9A 3VQXA 1G1XB 1R1BA 3JCUZ 2JS3A 4JASA 3WB1A 4DV7O 1K5QA 1XL4A 3ZMZA 4DV1O 3GWKC 1HR0O 4LF5B 4P2ZA 4RAIA 4GZRB 3H1LH 2BE3A 3IC9A 1EN4A 3MHSC 4O2BB 3OD4A 5LHGA 1R6TA 3H1HH 1VQ9V 1TUEB 5HFLA 2FKXA 2XAGA 2UXCO 4XDKA 4LF4B 4P30A 2F95B 3CC2V 2HP8A 1Q43A 2OCHA 2ZXWB 1K92A 4B7KA 2EINB 2V7QG 1AI7A 3LSUA 2PF4E 3BA9A 3BVOA 1JMKC 2VQEO 4UCOA 3UO2A 3WG7C 4DV4B 1BSMA 2WA4A 3VQYA 5ITZA 4PDRA 4RQEA 3BABA 2B1GA 4LF7B 4WFEA 1IVSA 4FM2A 2BCCH 2XAHA 1N32O 2EIMB 4LFCO 3ZHUA 5CB4A 3C3SA 3QNEA 5KHHA 4DK1A 3T1YO 3BHPA 4QJFB 2FMLA 2W6JG 4QPJA 5BMVA 3AG4B 1TVKA 3N2GA 3ZHTA 4CS4A 4DR5O 4I9QA 4EFBA 4R50A 2VQFO 2CUGA 2OCCB 3N27A 2DN9A 3ASOC 5GTIZ 4LF8O 5CA3A 2UUCO 3CRRA 4WFBV 1HW7A 1FPOA 4JV5B 3I5DA 3IFXA 4BW5A 3DGEA 4LWSA 5IY5B 4NB5A 4H13B 3AK2A 1NJIW 3AG3C 4LWSB 1XOUA 1ZLZA 3G6EV 1SF9A 1H2GA 1N33B 2F43G 1EM1A 2LW7A 2DQ3A 3JYCA 2XAFA 2BSKA 3QO5A 1R6NA 4YJ3A 4YIOA 2IJIA 2BSKB 2ADQB 3QF7A 3U0ZA 2JEUA
chains in the Genus database with same CATH topology
2CTQA 2PF4E 1NZ6A 1XBLA 1GH6A 3BVOA 4J7ZA 1FPOA 3UO2A 2LO1A 2LGWA 4J80A 1BQZA 2QWRB 2N05A 2QWNB 2CTWA 3APQA 1HDJA 2GUZA 3UO3A 2QWQB 1FAFA 2KQXA 2OCHA 2YS8A 2QWOB 1BQ0A 2Y4TA 4IT5A 2GUZB 2M6YA 2CUGA 2L6LA 4RWUA 1WJZA 2QSAA 1N4CA 2CTRA 2DMXA 2QWPB 2YUAA 3APOA 2Y4UA 2N04A 2DN9A 1IURA 2EJ7A 2CTPA 3UCSC 3AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  2PF4 E;  1NZ6 A;  1XBL A;  1GH6 A;  3BVO A;  4J7Z A;  1FPO A;  3UO2 A;  2LO1 A;  2LGW A;  4J80 A;  1BQZ A;  2QWR B;  2N05 A;  2QWN B;  2CTW A;  3APQ A;  1HDJ A;  2GUZ A;  3UO3 A;  2QWQ B;  1FAF A;  2KQX A;  2OCH A;  2YS8 A;  2QWO B;  1BQ0 A;  2Y4T A;  4IT5 A;  2GUZ B;  2M6Y A;  2CUG A;  2L6L A;  4RWU A;  1WJZ A;  2QSA A;  1N4C A;  2CTR A;  2DMX A;  2QWP B;  2YUA A;  3APO A;  2Y4U A;  2N04 A;  2DN9 A;  1IUR A;  2EJ7 A;  2CTP A;  3UCS C;  3AG7 A; 
#chains in the Genus database with same CATH topology
 3FYE B;  1B04 A;  4FJC C;  4ZBM A;  5KHG A;  2QE7 G;  1E79 G;  2Y0P A;  3CCE V;  1M56 C;  1PL0 A;  2OTJ V;  2L35 A;  4LF9 B;  4X1Y B;  3ZRW A;  3ZRW B;  4DV3 O;  1Q5O A;  2P4K A;  3H1K H;  4HBN A;  2IU3 A;  1SA0 B;  1Y6X A;  3K03 A;  1H38 A;  1SQV H;  5LA6 A;  4I0X B;  5J2T B;  1Q8I A;  2AZ2 A;  1WB7 A;  2N05 A;  5AG2 A;  3APQ A;  3OEE G;  3HKE A;  4NXM O;  2CDY A;  4O4L B;  3RYH B;  4WBN A;  4X88 A;  3ZHS A;  1VQ8 V;  1THZ A;  1SQX H;  3JD1 A;  1GTO A;  1S72 V;  3ETD A;  5FL7 G;  3OTO O;  4H33 A;  3ZMT A;  1GM7 A;  5LOV A;  3Q4H B;  3D36 A;  4UUJ C;  2AHY A;  4R6Z A;  1JR9 A;  4JI5 O;  2Q5Z A;  1IXM A;  5L3D A;  1IBM O;  2PI4 A;  5CBG A;  4ICG A;  5GON A;  4TT3 G;  3CME V;  3L72 H;  4PA6 A;  1Q82 W;  4TOI A;  4X1K B;  3H1I H;  2ZDI A;  4UCU A;  2E5L O;  4EB6 B;  1W59 A;  3A0B Z;  1QLN A;  3ZBH A;  2YEV A;  2R9A A;  4L87 A;  3SGI A;  2EBO A;  5EBL C;  2CAZ C;  2UUA B;  2HHH O;  4UV9 A;  3KCY A;  5JCO A;  4O4J A;  5JH7 A;  4QPK A;  2NNU A;  4O4J B;  2ZD9 A;  3PJS K;  4BWA A;  1GMG A;  3ETQ A;  4LF5 O;  3ZX6 A;  4KHP B;  4X64 B;  5LXT B;  5KLV H;  1LR1 A;  3FD9 A;  1R3J C;  2HLD G;  2ETN A;  2AXT Z;  4Z1V A;  3ABM B;  4WFG A;  3SJQ C;  2P67 A;  1UFI A;  2XTA A;  3OR6 C;  3EFF K;  3DC6 A;  2ITD C;  5H6R A;  4AIL C;  1QVF U;  1AI4 A;  2GSM B;  3S3X A;  1OCO B;  5IDJ A;  2Q4P A;  1IZ3 A;  3WFV A;  1HNW O;  3G71 V;  3JAK B;  1AP5 A;  3FFQ A;  1VMG A;  1F4M A;  2JK5 C;  1K97 A;  5KX5 B;  5LGU A;  1K8A W;  4GYC B;  3PN1 A;  4C7U A;  5CA1 A;  2K9P A;  3RT3 C;  4IHJ A;  2HKO A;  1IUR A;  2CTP A;  3FAV A;  2F23 A;  4JYA O;  1VQK V;  2Q8V A;  3FAV B;  1K7D A;  2CH7 A;  1NVP B;  2CH7 B;  1Y66 A;  1SKV A;  4K8X A;  2AGA A;  1W0J G;  2MW2 B;  1TUB B;  1OZ0 A;  4IIJ B;  1WN7 A;  2RN9 A;  1SET A;  2YDE A;  4PA9 A;  5CA0 A;  3JAT A;  1QCE A;  2DQ0 A;  3JAT B;  4O4H B;  1Z2G A;  5J2U A;  3ICX A;  4B3S B;  2OTL V;  1OCC B;  3MHH C;  4JI2 O;  4DV7 B;  4DV1 B;  3N2K B;  1DF5 A;  1D5N A;  3SYC A;  3CXC U;  3JD4 A;  2PYJ A;  5KHK A;  1T5E A;  3L74 H;  3C90 A;  2ZXW C;  1OCR B;  1XMQ B;  4JV5 O;  2IU0 A;  4KL1 A;  1Z5V A;  2UXC B;  4PI0 A;  2EIN C;  1ZWI C;  1CXZ B;  4JAU A;  3ZJZ A;  3G80 A;  2WA3 A;  2HEP A;  1K3E A;  1R3K C;  4F6R A;  2R70 A;  1MSW D;  1ZTE A;  3H01 A;  5B1B B;  1LNQ A;  4YJ2 B;  4EEQ A;  5KUK A;  5LP6 C;  1MA1 A;  1SER A;  2YIB D;  1M5I A;  4JAV A;  2H3O A;  3ZRV A;  4JI6 O;  2A0L A;  1IDS A;  4MW8 A;  2YXH A;  2Z5U A;  1X4T A;  2JVD A;  3SPG A;  2VQE B;  2ZIM A;  4TV8 A;  2QWR B;  4LF9 O;  4LFA B;  4TQF A;  2EIM C;  4MTX A;  4PEL A;  4QE7 A;  5IYZ A;  2VS0 A;  4J11 A;  3EXA A;  5IYZ B;  4JI7 O;  3ZHV A;  1HWY A;  4BR6 A;  3ZMU A;  4QGP A;  2X6B A;  3AG4 C;  1K34 A;  2X6A A;  3CCJ V;  1KEC A;  1ZL8 B;  2YIB A;  1ZX3 A;  1N32 B;  1PM9 A;  1Y74 A;  3FX7 A;  4KP4 A;  5GTH Z;  4CS2 A;  1ZAU A;  3K5L A;  2WLL B;  2FB5 A;  5CBF A;  2OCC C;  4KFM A;  1WLE A;  2YIA A;  4JYC A;  5LMN B;  4X1I A;  2BOB C;  2VQF B;  1KD1 W;  4DR6 O;  3APO A;  1FFX B;  5IY5 C;  1PL4 A;  5CBH A;  1RSO A;  2PUS A;  1DLB A;  4LF8 B;  3E2E A;  2ITC C;  1VQN V;  3JAR B;  4XDL A;  5B1O A;  1KYO F;  4Z1M G;  3H9V A;  4HYO A;  4X65 B;  4J10 A;  3G67 A;  3LNM B;  1PNM A;  3SYP A;  4I7Z B;  2LP7 A;  2V4D A;  3K5M A;  4XBF A;  1NZ6 A;  2QJ1 A;  1N8R W;  4OXS A;  3CCL V;  1COW G;  1VAR A;  2UXB O;  3E8F A;  4DW0 A;  2RJZ A;  1I94 B;  2B9Z A;  2JGU A;  5EYP A;  4D7T A;  1XQ8 A;  4U3J A;  1FFT B;  1AJN A;  1UPG A;  4PV1 B;  3EVK A;  3W7X A;  1EN5 A;  1AI6 A;  1LUV A;  4JI1 B;  2UUA O;  4WFF A;  3E22 A;  2QEX V;  1U97 A;  3CWB H;  2BTQ A;  3E22 B;  3GWO A;  5F2V O;  4B3M O;  2BTQ B;  4YXW G;  3ZS8 C;  3LDD A;  2ARH A;  2JGD A;  4RO2 A;  4GKJ B;  1YJN V;  3P3P A;  1XUQ A;  2JGD B;  2ZCE A;  1YF2 A;  2IM9 A;  1S77 D;  5B66 Z;  4NXM B;  5LHH A;  3L70 H;  4NTW A;  4FLT A;  4PI2 A;  3CJH B;  4UVC A;  1FYJ A;  5IJ0 B;  1YTF B;  3OTO B;  4ASU G;  2H8P C;  3WU2 Z;  3RYI B;  5D5Q A;  5IJ9 A;  4JI5 B;  1I0H A;  4NXN O;  4JZ2 A;  1IBM B;  4DW1 A;  4A5U B;  1NTM H;  1PD3 A;  4MVR A;  1VQL V;  1FD9 A;  4GX2 A;  2JEX A;  3BEH A;  1XIL A;  4FPP A;  3OTF A;  1D5A A;  4J9Z B;  1FXK B;  3B8M A;  1RFY A;  1W0K G;  3JSL A;  3C3T A;  3AEI A;  5JVD A;  3SYO A;  3ZRX A;  5BR8 B;  5H5N A;  4X20 A;  1Y76 A;  1VEW A;  4X20 B;  3BY6 A;  4ZI7 B;  3D8C A;  2WLH A;  2LQT A;  2D3O W;  1VQM V;  2HVK C;  2DWE C;  1BMF G;  3BCC H;  2QM4 A;  2PTM A;  2HHH B;  1NS1 A;  2DYR B;  3CRA A;  3ABM C;  4B3S O;  3I55 V;  4X62 B;  4MVQ A;  5KHI A;  2GUZ A;  2YS8 A;  1QHT A;  4YY3 B;  3VOU A;  1M9N A;  3NR7 A;  3OMA B;  4LFB O;  3IGA C;  1ARO P;  1KB9 F;  1OCO C;  1IBL O;  1H2S B;  4IYI A;  3X2Q B;  2Q73 A;  4CZZ A;  1XMQ O;  1WA8 A;  1SQP H;  2NLJ C;  5K1X A;  1JJO A;  2YC0 A;  1FAF A;  1QVG U;  2QWO B;  1HNW B;  4DRX A;  1P49 A;  1VF6 A;  3IC7 A;  2X7R B;  3DXR A;  1J5E B;  4JI0 O;  3THO A;  4FLU A;  3RBZ A;  5EZY A;  3OUF A;  4JYA B;  4LF6 O;  3CPW U;  3MDS A;  4LFA O;  4B7E A;  1AR5 A;  4P9O A;  5ITZ B;  1L0L H;  4DV2 B;  4W4K A;  1PKX A;  5CMU A;  3HR0 A;  3K0D A;  4LNU A;  4GCZ A;  2Y0I A;  4LNU B;  5LP6 A;  2HJD A;  3ASN B;  2EIL B;  1ROP A;  5CB4 B;  2Q6A A;  5EBW C;  3STL C;  3ZIA G;  3SYA A;  1SZT A;  3QVN A;  5BMV B;  5LMN O;  3CB2 A;  1TVK B;  3N2G B;  4JI2 B;  1OCR C;  2M6Y A;  1AVM A;  3JD2 A;  2R72 A;  3FB8 C;  1KU9 A;  3ETE A;  3CC7 V;  4J7K A;  4TSF G;  2IJH A;  1M1K W;  2ZIN A;  4MVM A;  1E1Q G;  5B1B C;  3CSX A;  4WCE V;  4J7Z A;  1TA8 A;  2Q7H A;  2EIK B;  2XAJ A;  4X65 O;  2DYS B;  5EK0 A;  3P3N A;  2N74 A;  3OW2 U;  3CS5 A;  3OR7 C;  4TUY A;  2HJF C;  3AG1 C;  4YJ3 B;  2GBO A;  5HFM A;  4LH6 A;  2JDI G;  4F4L A;  1XHZ A;  1GAX A;  2ZNI A;  4JI6 B;  1QQC A;  3DSQ A;  4CBC A;  4J80 A;  2LJ2 A;  1I94 O;  4MS2 A;  3ABU A;  3T1H O;  4RWU A;  4DXW A;  4JI1 O;  4JI7 B;  3R65 A;  3B40 A;  3FB6 C;  4U7N A;  2Q9L A;  1DK1 A;  3KKY A;  4UXN A;  4GKJ O;  1V54 B;  3CRC A;  3ZN1 A;  5LA6 B;  3K5N A;  2QTS A;  2CGN A;  3HKE B;  4WBN B;  2QSA A;  3D3I A;  4DR6 B;  2PI5 A;  4JGS A;  3E35 A;  1DTO A;  5A2Q N;  2YI8 A;  1K4D C;  3CD6 V;  3JAL A;  3TXS A;  4B3R O;  1QNM A;  4I4T A;  3CP1 A;  4UCS A;  1YEW A;  5LOV B;  3SJA C;  1YVW A;  4CC6 A;  1M90 W;  3NXS A;  4EKW A;  5GON B;  4YIP A;  1K4C C;  4DK0 A;  1RPO A;  4AHC A;  1I08 A;  4G2K A;  5JQG A;  5KMG A;  1YIT V;  5JQG B;  4J9Y B;  2VWK A;  4Q6G A;  5BR8 O;  2ZNJ A;  2LO1 A;  3LUT B;  3ZCC A;  2R9R B;  2PGG A;  3OGC C;  3ZN0 A;  2UXB B;  3RYF A;  1YXB A;  1QR9 A;  5FNV A;  1AIL A;  5B1A B;  2YEV B;  5KUM A;  4DUY B;  4I9W A;  2X0L A;  4GUN A;  1B3Q A;  3E8B A;  3SYQ A;  4B08 A;  3SR2 C;  1P7G A;  3LSS A;  2VWJ A;  1AR1 B;  4L8J A;  1M57 B;  4X62 O;  5D5P A;  4B3M B;  5LHI A;  5JH7 B;  5FPR A;  4YY3 O;  2B1I A;  2WLI A;  1JPX A;  2DW4 A;  1XEQ A;  3K57 A;  3AG2 B;  4FLY A;  1JQ0 A;  2W0X A;  4FM1 A;  3UKM A;  4MT8 A;  1VP7 A;  1PP9 H;  4BIO A;  1N0N A;  3CEI A;  4DR7 B;  4HNA A;  2RCV A;  1O9H A;  4DV0 O;  1FXK C;  4HNA B;  1NKD A;  4B3T O;  4NXN B;  1Q3E A;  2HR3 A;  2ZE6 A;  1GN2 A;  1NU1 H;  4UVA A;  1J5E O;  4K0K B;  4G27 B;  2N04 A;  3OGI B;  2ZR2 A;  5H6Q A;  3UCS C;  2EX3 A;  5CA1 B;  4D6T H;  3JAW A;  5EC1 C;  4IHJ B;  3K59 A;  1SQB H;  5KHJ A;  4JTD B;  2QA4 V;  1VIB A;  3W7W A;  5E79 Z;  2IH1 C;  1I5Y A;  4E2L A;  4DV2 O;  2DYR C;  4IL6 Z;  2KKW A;  5JJJ B;  3P30 A;  3SJC C;  4TV9 A;  3HKC A;  3HKC B;  2F4V O;  5CA0 B;  4PA4 A;  5IYC O;  1Q6U A;  4TWK A;  3RYC A;  3HPL C;  2V1D A;  1HNZ B;  1A32 A;  1P4R A;  4ZHQ A;  2H94 A;  4K35 A;  5J2U B;  5L3F A;  2K1E A;  3T1C A;  3ZHQ A;  1KP3 A;  3X2Q C;  2Q7G A;  2YXY A;  1MG1 A;  3CRM A;  4W4L A;  4OGQ B;  4LFB B;  2CK3 G;  4FM0 A;  3SPH A;  5LBQ A;  1IBL B;  2IBZ H;  5J9P C;  1XNQ B;  3ZMS A;  4J7J A;  2EZP A;  1NI8 A;  1YIJ V;  1KMI Z;  4O4I A;  1Q81 W;  5B3S B;  1NH2 D;  3UQ8 A;  4WFH A;  2X6C A;  4F6R B;  3DC5 A;  3RVY A;  4X8A A;  3SPJ A;  1KKC A;  4ZOL A;  2EJ7 A;  4JYB A;  4JI0 B;  1GN4 A;  4MVO A;  4TQD A;  3K3W A;  1KUQ A;  3HKB A;  1BS3 A;  1BCC H;  4LF6 B;  1CEZ A;  3K58 A;  2KG7 A;  1N0J A;  4TV8 B;  3CC4 V;  3M99 B;  3ASN C;  1S5H C;  2R9I A;  2EIL C;  1SQG A;  5IE9 A;  1JOY A;  3W7T A;  1NH2 B;  4I55 A;  4UCV A;  1MSD A;  1W2B U;  1DF4 A;  1YI2 V;  1H8E G;  1JFF A;  1SC5 B;  2FYU H;  1Y74 B;  1HNX O;  4JYY A;  4MTG A;  4N21 A;  2QWQ B;  5LL6 Y;  2WAM A;  1RPR A;  3B8N A;  1H2K A;  1KQS U;  1M56 B;  4DR2 O;  2CTR A;  1WP7 A;  3F5T A;  4H0L B;  4X1I B;  4IYH A;  2Q7E A;  3QTC A;  2EIK C;  1BZK A;  2DYS C;  2EJR A;  2WSS G;  3UT5 A;  1EBO A;  1XNR O;  3K79 A;  1RSO B;  1PNK A;  4JI3 O;  5JJN B;  3BPZ A;  2E3C A;  2CTW A;  2Q0O C;  3BFR A;  2BTO A;  3OMN B;  2LW1 A;  3ABK B;  3TGU H;  1JJ2 U;  1P84 F;  1VQ7 V;  4H44 B;  4FLZ A;  1WPX A;  3GB7 C;  2P90 A;  4FFB A;  1RM1 B;  2RMK B;  3CRQ A;  3T4Z A;  1BQZ A;  1AB3 A;  4U7O A;  2KB1 A;  2ZR3 A;  4WF9 V;  5EYP B;  2QGN A;  4DUY O;  1AJP A;  4QIW F;  3T1H B;  4U3J B;  4LC1 A;  5LYJ A;  2GHY A;  1V54 C;  4DO2 A;  2P6J A;  5B1N A;  5LYJ B;  3T2M A;  3K9A A;  5EC2 C;  1YHQ V;  4JI4 O;  3WB2 A;  2A79 B;  1RP3 B;  5JJE B;  3OAA G;  1OJH A;  2YSU B;  1O9G A;  4Z2W A;  2IW5 A;  4FMT A;  2QKA A;  4UCR A;  3D36 C;  2ZM6 B;  3EHB B;  3OUS A;  4H37 A;  2ZE8 A;  2OYQ A;  2ODM A;  3KCX A;  4B3R B;  4DR7 O;  5EIB D;  1V55 B;  1YJ9 V;  1L8D A;  3BRC A;  4MVZ A;  5IJ9 B;  1UJW B;  4PA3 A;  2KQX A;  4FVM A;  2DWD C;  1J95 A;  3CCQ V;  2A06 H;  2JRI A;  2ZDI C;  4K0K O;  5IWA B;  3R66 A;  1XMO B;  3JAM N;  2Y48 A;  5BXZ A;  4NVP A;  3QO8 A;  3B4S A;  1S5L Z;  3J80 N;  1H2L A;  4PDL A;  5JVD B;  2OIG A;  2XAS A;  5DN6 G;  1VF5 B;  1Y76 B;  1VQO V;  3AK1 A;  5JWP A;  1N4C A;  1EZV H;  2P06 A;  3JD0 A;  1M57 C;  2GTA A;  2WLJ A;  5JCO C;  4X66 O;  1P7B A;  3HKD A;  1YZB A;  1HP8 A;  1NQT A;  3SJB C;  1HNZ O;  1I7F A;  1N36 O;  4J41 A;  3AG2 C;  2EIJ B;  1R3I C;  4GX1 A;  3G4S V;  3LDE A;  5KAF Z;  4MSW C;  1QLE B;  2QKC A;  1MZF A;  2GUZ B;  3K5O A;  1Z5W A;  5C8Y A;  1L0N H;  4UB8 Z;  5BY1 A;  2MK3 A;  2M7W A;  1B06 A;  1US6 A;  3FKS G;  4PDV A;  1XNQ O;  4DR3 O;  2AZ0 A;  1KC8 W;  1WA8 B;  2LGQ A;  3K06 A;  3FB5 C;  4JI8 B;  2OWO A;  1VQ5 V;  3B2E E;  4LBE C;  1GN3 A;  4DV0 B;  1MZE A;  3ABL B;  3RW0 A;  2PY5 A;  4B3T B;  1NT2 B;  5GW7 A;  5DEC A;  1F51 A;  4O2B A;  3LDC A;  3TJT A;  4DRX B;  2Y4U A;  3DXR B;  3JSN A;  4FZ1 A;  3BAA A;  1Q90 D;  3MAQ A;  1NTZ H;  2QR4 A;  5EZY B;  1XDC A;  1VF7 A;  4NYK A;  4DR4 O;  1K5S A;  2AHZ A;  1HDJ A;  3CCU V;  4UCT A;  3LSQ A;  4LP8 A;  3CHX A;  2KSD A;  3ETG A;  1K33 A;  3O9O A;  1OCC C;  4JZG A;  3W7S A;  2F4V B;  5LP6 B;  1BE3 H;  1GRJ A;  1AJQ A;  3BA8 A;  3WB0 A;  1PNL A;  1BT8 A;  1WPB A;  3STZ C;  4UV8 A;  4AQY O;  2JJ2 G;  4RQF A;  1H8H G;  2UXN A;  4ZIB A;  3OE7 G;  3S3W A;  3OFN G;  1JCH A;  2IJJ A;  2ZQM A;  1FJG O;  1GO3 F;  4CH5 A;  2Z3Y A;  2A3Q A;  5B3S C;  3E8G A;  4CH3 A;  4ZKI A;  4MTF A;  5DM6 V;  1S0V A;  1Q6H A;  3CCR V;  2NN4 A;  2ILM A;  1WP8 A;  1Y67 A;  4MTO A;  3VBB A;  4BAY A;  3CCS V;  4G28 B;  5A9G A;  2IJK A;  2EUL A;  2FL4 A;  3CX5 F;  3CCM V;  3B77 A;  1XI1 A;  1FS0 G;  4TUY B;  1U96 A;  2FTK A;  2QDO A;  3AG7 A;  3IAY A;  4O2A A;  4I50 A;  1XBL A;  4E4E A;  4O2A B;  4I50 B;  4UB6 Z;  1GM8 A;  1YSC A;  1ORQ C;  1IBK O;  1QU7 A;  4RUF A;  2UUB B;  4R7C A;  2Q0A A;  3TET A;  3VQV A;  2E75 B;  5L3E A;  2RQ6 A;  3OMI B;  1TGO A;  2RNB A;  2WLM A;  5LGT A;  4OX9 B;  3KG2 A;  4MVS A;  3A8T A;  2CTQ A;  4ABM A;  3K08 A;  4RUE A;  4DYL A;  3IJ4 A;  1D2D A;  2LFR A;  2YID A;  4X1Y A;  2Y69 B;  1HNX B;  4UVB A;  2RDC A;  2F1M A;  4KUM A;  3A0H Z;  2P7T C;  5KA5 A;  3L9D A;  4CS3 A;  4Q20 A;  1SRY A;  2QWP B;  1SA0 A;  4DR2 B;  4GT1 A;  2JIZ G;  2ZM6 O;  4GLX A;  2BOC C;  1OCZ B;  2DOS A;  4I0X A;  5J2T A;  1XNR B;  4BIZ A;  3ABK C;  3JAL B;  1YDX A;  2LGW A;  4I4T B;  4YHH O;  2Q69 A;  4O4L A;  3RYH A;  2QTO A;  2QWN B;  4JI3 B;  4FFK A;  1BHA A;  1RM1 C;  2UXD O;  2CGO A;  2ZIO A;  4BW9 A;  5TIS Z;  1G8M A;  5IWA O;  3KZI Z;  1XMO O;  2UU9 O;  2ZKO A;  2XHB A;  3Q4H A;  5KMG B;  4K3A A;  4NTY A;  1X59 A;  4CH4 A;  3QG5 A;  2ATK C;  3SPC A;  2WLK A;  1BQ0 A;  2P22 C;  5EBM C;  3RYF B;  3ZMV A;  4JPR A;  4GKK O;  1NBM G;  4WFA V;  5LMU O;  5FNV B;  5FPO A;  4X1K A;  5H2F Z;  5L3C A;  4DR1 O;  4BIU A;  4EB6 A;  4HZ3 A;  1F4N A;  3L71 H;  4QNH B;  5IYD O;  2YI9 A;  4IGG A;  4JTC B;  4JI4 B;  2F66 C;  1OHH G;  1NR7 A;  3A0R A;  4FK5 C;  4IT5 A;  4DV6 B;  2WLI B;  1JVM A;  2QM8 A;  5LGN A;  5C93 A;  1E1R G;  1V55 C;  1XL6 A;  1IXB A;  1SQQ H;  2YIC A;  4JAA A;  1GM9 A;  3H1J H;  4MVU A;  3RWR D;  3E89 A;  5L3G A;  2EZO A;  1YJW V;  1FKA O;  5LXT A;  3RVZ A;  3ZRS A;  4JI8 O;  3P32 A;  1AR4 A;  5BZB A;  1WB8 A;  1N34 B;  2E76 B;  2P5O A;  4FLX A;  4N23 A;  1S3J A;  4FLV A;  4JTA B;  1NVP D;  1SQF A;  2W6I G;  5EIB C;  4LF4 O;  3UM7 A;  3JAW B;  3ML0 A;  3K04 A;  1AP6 A;  3JAK A;  3G6B A;  3U11 A;  5KX5 A;  2JS5 A;  1KKD A;  4PJ0 Z;  2Q68 A;  4DV5 B;  5L3B A;  2EIJ C;  1GKF A;  4F6E A;  1SZX A;  4DUZ B;  2WLN A;  1R73 A;  4X66 B;  1QLE C;  4TV9 B;  1URF A;  4DV4 O;  1N36 B;  2XUM A;  3RYC B;  1FXH A;  3A2F A;  4ZHQ B;  4LF7 O;  1CPY A;  1B6Q A;  2JJ1 G;  1TUB A;  4IIJ A;  3WG7 B;  3J81 N;  5CN0 A;  3OM3 B;  3M7M X;  1S76 D;  1R6K A;  1AI5 A;  4PDM A;  3K0G A;  4O4H A;  4P9P A;  2ADP A;  3ABL C;  4OPH A;  1MAB G;  1PPJ H;  2DE0 X;  4DR3 B;  1VF6 C;  3GVM A;  2ZE5 A;  3N2K A;  3OT7 A;  2A7W A;  5FLX N;  1HR0 B;  1XRE A;  3TXQ A;  2Y4T A;  3OEH G;  4JF3 A;  2HG5 C;  2F93 B;  3VQW A;  4X89 A;  4O4I B;  1VQ6 V;  2ZT9 B;  1XHX A;  4ZOL B;  3ZHR A;  1GH6 A;  2XT9 A;  1MNG A;  1WNS A;  1NTK H;  1YCI A;  2UUB O;  1JX9 A;  1N33 O;  2XND G;  5DED A;  3T4D A;  3ASO B;  4KXR A;  3HKB B;  1MMM A;  4DR4 B;  3JCZ A;  4FLW A;  4YJ2 A;  4PHZ A;  2KG7 B;  1DGS A;  1CP9 A;  2NR5 A;  3ZED A;  1Q7Y W;  4HAM A;  4NR1 A;  4QE9 A;  4OX9 O;  3AG3 B;  4XDJ A;  4I55 B;  3CYO A;  2GV9 A;  3AG1 B;  4GX0 A;  1JFF B;  1GN6 A;  2C2A A;  4LR3 A;  3E83 A;  1NR1 A;  3DTU B;  2PZS A;  2L6L A;  4AQY B;  1ZL8 A;  3U10 A;  2QM7 A;  2D2C B;  3AK3 A;  1VQP V;  3CCV V;  4LFC B;  1SES A;  4FZ0 A;  5IYB O;  2WLL A;  1V9P A;  3T1Y B;  1FJG B;  1G6U A;  3UT5 B;  5K1P A;  3MD0 A;  3CMA V;  2IH3 C;  1OV9 A;  3K9S A;  4NTX A;  4DR5 B;  1FFX A;  3CXH F;  1S5J A;  5B5E Z;  3RN4 A;  3JAR A;  5KAI Z;  3CE2 A;  2PYL A;  2UUC B;  4FFB B;  4CC5 A;  3D3Q A;  3F7V C;  1IBK B;  2XOK G;  2YXL A;  1H2M A;  3RGB A;  5IT9 N;  4I5S A;  3E8H A;  4EFE A;  1M93 A;  4X9Q A;  2E74 B;  2Y69 C;  2O57 A;  1R3L C;  3L75 H;  3W7U A;  1EZJ A;  4LCU C;  1ZUQ A;  1QBZ A;  2OIE A;  2WWW A;  4OPA A;  1K9M W;  3F7Y C;  4R8C A;  1L1F A;  1F7Y A;  1Q6I A;  3RFR A;  1KBH A;  2VRZ A;  4U3F H;  4DV6 O;  1EFR G;  1OCZ C;  4J42 A;  1Q86 W;  4DV3 B;  4PA7 A;  1YTF D;  5E1A C;  1G4Y B;  2YUA A;  3QO7 A;  3FYI B;  2OT5 A;  2HFE C;  4UFZ A;  3HB3 B;  1TAE A;  2GTS A;  5H9C A;  1BL8 A;  4KHP O;  4PD4 F;  4X64 O;  1BHB A;  2G38 A;  4YHH B;  4K8Z A;  1ENV A;  3O65 A;  3UO3 A;  3L73 H;  1N34 O;  1H2N A;  3ABT A;  1KP2 A;  4GX5 A;  4FIP C;  2DJV A;  3CJH A;  2UXD B;  5IJ0 A;  4NKG B;  1FXV A;  2Z0A A;  1VQ4 V;  4LH7 A;  2UU9 B;  1LUW A;  2Q67 A;  3RYI A;  4MW3 A;  1JA8 A;  1ZSP A;  3JD3 A;  3B09 A;  5B1A C;  4CH6 A;  1PV0 A;  2WPD G;  1EN6 A;  2B5U A;  4AI8 A;  2P4V A;  1BGY H;  2UXX A;  1WAZ A;  3TK1 A;  4DV5 O;  1QR8 A;  3F5W C;  5KA6 A;  4GKK B;  1FXK A;  5LMU B;  1MOF A;  4DUZ O;  1GK9 A;  1K73 W;  1M4U A;  3JAS A;  4DR1 B;  2GDS A;  2XAQ A;  2CE4 A;  2ZE7 A;  3SDL A;  1F23 A;  2E5L B;  3JAS B;  3I56 V;  3SPI A;  3HKD B;  3TCU A;  3J7A U;  2A9H A;  4ZI7 A;  2AW9 A;  3FB7 C;  3M8A A;  1Y4M A;  1WJZ A;  5C8Y B;  2DMX A;  2HVJ C;  3E86 A;  2QKS A;  2W0F C;  4D7S A;  1I5X A;  2LFS A;  1SS3 A;  3LNN A;  1IX9 A;  3VQX A;  1G1X B;  1R1B A;  3JCU Z;  2JS3 A;  4JAS A;  3WB1 A;  4DV7 O;  1K5Q A;  1XL4 A;  3ZMZ A;  4DV1 O;  3GWK C;  1HR0 O;  4LF5 B;  4P2Z A;  4RAI A;  4GZR B;  3H1L H;  2BE3 A;  3IC9 A;  1EN4 A;  3MHS C;  4O2B B;  3OD4 A;  5LHG A;  1R6T A;  3H1H H;  1VQ9 V;  1TUE B;  5HFL A;  2FKX A;  2XAG A;  2UXC O;  4XDK A;  4LF4 B;  4P30 A;  2F95 B;  3CC2 V;  2HP8 A;  1Q43 A;  2OCH A;  2ZXW B;  1K92 A;  4B7K A;  2EIN B;  2V7Q G;  1AI7 A;  3LSU A;  2PF4 E;  3BA9 A;  3BVO A;  1JMK C;  2VQE O;  4UCO A;  3UO2 A;  3WG7 C;  4DV4 B;  1BSM A;  2WA4 A;  3VQY A;  5ITZ A;  4PDR A;  4RQE A;  3BAB A;  2B1G A;  4LF7 B;  4WFE A;  1IVS A;  4FM2 A;  2BCC H;  2XAH A;  1N32 O;  2EIM B;  4LFC O;  3ZHU A;  5CB4 A;  3C3S A;  3QNE A;  5KHH A;  4DK1 A;  3T1Y O;  3BHP A;  4QJF B;  2FML A;  2W6J G;  4QPJ A;  5BMV A;  3AG4 B;  1TVK A;  3N2G A;  3ZHT A;  4CS4 A;  4DR5 O;  4I9Q A;  4EFB A;  4R50 A;  2VQF O;  2CUG A;  2OCC B;  3N27 A;  2DN9 A;  3ASO C;  5GTI Z;  4LF8 O;  5CA3 A;  2UUC O;  3CRR A;  4WFB V;  1HW7 A;  1FPO A;  4JV5 B;  3I5D A;  3IFX A;  4BW5 A;  3DGE A;  4LWS A;  5IY5 B;  4NB5 A;  4H13 B;  3AK2 A;  1NJI W;  3AG3 C;  4LWS B;  1XOU A;  1ZLZ A;  3G6E V;  1SF9 A;  1H2G A;  1N33 B;  2F43 G;  1EM1 A;  2LW7 A;  2DQ3 A;  3JYC A;  2XAF A;  2BSK A;  3QO5 A;  1R6N A;  4YJ3 A;  4YIO A;  2IJI A;  2BSK B;  2ADQ B;  3QF7 A;  3U0Z A;  2JEU A; 
#chains in the Genus database with same CATH homology
 2CTQ A;  2PF4 E;  1NZ6 A;  1XBL A;  1GH6 A;  3BVO A;  4J7Z A;  1FPO A;  3UO2 A;  2LO1 A;  2LGW A;  4J80 A;  1BQZ A;  2QWR B;  2N05 A;  2QWN B;  2CTW A;  3APQ A;  1HDJ A;  2GUZ A;  3UO3 A;  2QWQ B;  1FAF A;  2KQX A;  2OCH A;  2YS8 A;  2QWO B;  1BQ0 A;  2Y4T A;  4IT5 A;  2GUZ B;  2M6Y A;  2CUG A;  2L6L A;  4RWU A;  1WJZ A;  2QSA A;  1N4C A;  2CTR A;  2DMX A;  2QWP B;  2YUA A;  3APO A;  2Y4U A;  2N04 A;  2DN9 A;  1IUR A;  2EJ7 A;  2CTP A;  3UCS C;  3AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...