1N4CA

Nmr structure of the j-domain and clathrin substrate binding domain of bovine auxilin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
182
structure length
182
Chain Sequence
b'GPLGSPEFSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxilin
publication title Structure of the functional fragment of auxilin required for catalytic uncoating of clathrin-coated vesicles.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 27
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1n4cA01
2N05A 2QSAA 3UO3A 2CTPA 3APQA 2M6YA 1N4CA 2DN9A 2QWPB 2QWNB 1XBLA 2KQXA 2N04A 2YUAA 1BQ0A 2Y4TA 2LO1A 2GUZB 2GUZA 4J80A 2Y4UA 3UCSC 1FAFA 2L6LA 2CUGA 1FPOA 3BVOA 1HDJA 1WJZA 3APOA 2CTRA 1GH6A 1IURA 2OCHA 2QWOB 4IT5A 2PF4E 2YS8A 2EJ7A 2QWQB 2QWRB 2LGWA 1BQZA 2CTQA 4J7ZA 2CTWA 2DMXA 3UO2A 1NZ6A 3AG7A 4RWUA
chains in the Genus database with same CATH superfamily
2N05A 2Q67A 3QTCA 3R65A 4YJ2A 2IJIA 3VQYA 4JPRA 5IJ9A 4PI0A 1M56C 3ZX6A 1KUQA 3PJSK 2ZDIA 4PD4F 5EIBC 2ZE7A 1AI6A 4NB5A 4BIUA 4MTOA 3L75H 4X62O 2WA3A 4P30A 4CH6A 3F7VC 3EFFK 1SESA 4DR7O 3T1YO 1R6NA 2E5LO 4WBNA 1GN4A 2BCCH 1TUBA 1IBLO 5KHJA 5B3SC 4NXMO 4E4EA 5BR8B 1RM1B 3ZMSA 1XEQA 2XASA 3G71V 3IC7A 2UXBO 3FX7A 4H13B 1J95A 2PYJA 2ZQMA 1FXVA 1P4RA 4MVUA 3GVMA 1XREA 3MHSC 4FLZA 4CS2A 4O4HB 4TUYB 3IFXA 4NVPA 1COWG 3DXRA 1MG1A 3G6EV 1JOYA 4G27B 3OAAG 1PPJH 2X7RB 1I08A 4DW1A 4DUZB 3CJHB 1XMQB 1FJGB 3OMIB 3UT5B 1PNKA 3P32A 4K8XA 3H9VA 1TAEA 1SA0B 3QO5A 2JS3A 1XNQB 2ODMA 1N0NA 2P4KA 2JGDA 1D5NA 2YUAA 2P4VA 1Y67A 3PN1A 5LGUA 2BOCC 2EULA 1K4CC 4RUFA 3A8TA 1Q81W 3ZRVA 3CXCU 5KA6A 4LCUC 5EC1C 4OX9O 2WWWA 3SDLA 2W0FC 2ADQB 3CWBH 4AQYB 5A2QN 3ETGA 4PDMA 5B1BC 4FLYA 4DR2O 1OCZB 3ZMVA 4LF6O 5IY5B 4UB8Z 2CTQA 2PI5A 4BIZA 4FZ0A 3L71H 3I55V 3K03A 3HB3B 3K59A 1S5HC 3SR2C 1BSMA 4B3RB 3E8HA 5C8YB 1YCIA 3RWRD 3NR7A 4HAMA 4UVAA 4FVMA 2XAGA 3VQXA 1MSWD 1NU1H 4J11A 1O9GA 4CC5A 3CRAA 1H8EG 5LGNA 3ABLB 3EHBB 3OR7C 2CH7A 2D2CB 1LUVA 5JVDA 4LF4O 3FB7C 4MVRA 3ETDA 4X88A 1VQMV 2FL4A 1VIBA 4LBEC 4NKGB 3P3PA 5CA0B 3TJTA 4I7ZB 4YHHO 2VQEO 4GZRB 5IWAB 4FLWA 1VF6C 2EINC 2ZNJA 1TGOA 1ZUQA 2UXCO 1R3KC 4FIPC 2LO1A 3JARB 1JPXA 1YJWV 3RYHB 2WLIA 1GKFA 5CA3A 3JD4A 1WLEA 1CXZB 2A9HA 1QVFU 2EZPA 4YJ2B 4JYCA 5J2TA 2QR4A 2HG5C 3ABKC 3CCRV 4JI2O 4TT3G 1P7BA 4HNAA 2F95B 1VQOV 2XUMA 1FFTB 3EXAA 5CMUA 4K0KO 4U3JA 4UB6Z 3KZIZ 2AGAA 4UFZA 1V55C 4MVQA 4PELA 3B77A 2X6AA 3SPJA 4O4IB 5GW7A 3D8CA 3E83A 1TUBB 5FPOA 3SGIA 2OCCB 1KQSU 3STLC 4I9WA 4OPAA 2L35A 2WLMA 4IYIA 3ZRSA 1HP8A 4EB6A 1E1QG 2NN4A 2YS8A 2D3OW 3X2QB 4PHZA 4GX2A 5FNVA 2QSAA 3ZHUA 4K35A 4FM0A 2DYRB 1GTOA 1H2SB 1N0JA 3QG5A 5CBGA 5BMVB 3AK3A 3B40A 4YJ3A 1I5XA 1AP6A 2Q69A 2HHHO 2EJRA 4PA3A 1L1FA 2UUBB 3E35A 4Q20A 1W0KG 3OTOB 4LF5B 3N27A 3K04A 1JX9A 1QBZA 1BHAA 1ZL8A 1OCOB 4L87A 3VOUA 3OUSA 5LHIA 2P7TC 2Q5ZA 3FB6C 4B3TO 3RYCB 1SS3A 1YITV 1QLEB 5DN6G 2NR5A 1HNXO 2EIKC 3I56V 2ADPA 3K58A 1J5EB 2OIGA 2P67A 3ASNB 4Q6GA 1VQ9V 2EILB 1XI1A 3BFRA 4PI2A 1K92A 2LGWA 1H2NA 1K73W 3K5MA 4ZI7A 4DK0A 5EBMC 3Q4HA 1SZXA 1I0HA 3OUFA 4R50A 2ETNA 3BAAA 4LH7A 1I7FA 1YEWA 2ARHA 1IX9A 4GX5A 3ZCCA 4JZ2A 2LGQA 5LMNB 1V54C 2F23A 2V1DA 3CCJV 1NH2D 1S3JA 3AG4C 5BZBA 2Z3YA 1MNGA 1LNQA 1KP3A 1NBMG 1KBHA 1YTFB 1DF4A 5B1NA 4DR1B 1FYJA 1GN3A 1VQ6V 1QHTA 1RFYA 1HR0B 4UV9A 4AILC 1E1RG 5DECA 3ZJZA 1BMFG 4PA7A 2ZT9B 3RBZA 4LP8A 3AG1C 1VARA 4MVMA 3H1HH 1YXBA 1OHHG 1XNRB 1KC8W 1BE3H 3TK1A 3N2KA 4GYCB 5KHGA 3T1HB 4ASUG 5BR8O 4K8ZA 4DV0B 4JZGA 1I94B 1OJHA 3WB0A 2UUAB 4LF8B 4NXNO 1NVPB 4BAYA 4G2KA 4X20B 5IYZA 2PY5A 2UXDB 4B7KA 1FXKC 4ZOLB 2GBOA 3SJBC 4JASA 4PV1B 1N8RW 4IGGA 4R6ZA 1M4UA 2M6YA 2Q0AA 2QWNB 3M8AA 3SJAC 4DR6B 3B09A 3ML0A 1R73A 1GN6A 2WLIB 1GM7A 1PL4A 2Q6AA 1AR4A 2QE7G 3SYPA 5L3GA 1XMQO 1FJGO 4LFCB 4AHCA 5B1OA 5LL6Y 2LFSA 3OGIB 5J2TB 2Y69B 2W6IG 5LP6C 2HLDG 1JCHA 1XNQO 4I50B 3KG2A 1EN6A 4HNAB 4YIOA 4JI4O 2P5OA 1FFXB 3OEEG 1N36B 3H01A 4U3JB 1IBMB 1VQ8V 4X65B 3E22A 1NH2B 2B5UA 2R9AA 1SQGA 3BA9A 4WFEA 1H2MA 1O9HA 5LMUB 1ZWIC 2W0XA 4FMTA 1K3EA 4EB6B 4AQYO 2YIAA 2LFRA 1ORQC 1Y6XA 1OCCB 5J2UA 4FM2A 2BE3A 1Q82W 2DWDC 4KHPO 1FXHA 1DTOA 4FPPA 4WFBV 5LA6A 1V9PA 4CC6A 1IXBA 2DOSA 4UCSA 3BABA 2VWJA 2Q4PA 1K33A 4JTCB 1G8MA 4YJ3B 5KUMA 3U10A 4MVZA 3BVOA 3O65A 1BZKA 4NTYA 1VF6A 1R6KA 3K57A 1VQPV 1JJOA 2QKAA 1G4YB 2QKSA 1ZL8B 2Z5UA 2XAHA 4MVSA 3ZRWB 2AXTZ 3SYOA 1HNWB 2E74B 4F6EA 3MAQA 4GKJO 5EK0A 2YIBA 4P2ZA 3CRQA 2CUGA 2H3OA 3BRCA 4OXSA 2DQ0A 5K1XA 1AP5A 5CB4A 5ITZA 1FKAO 1M56B 1JFFA 4ZI7B 5IWAO 4DUYB 4MTGA 3W7XA 2QA4V 5LBQA 1DF5A 3CRCA 2KQXA 1GRJA 2RJZA 1AR5A 1PV0A 3J81N 1EN5A 1KB9F 4ZIBA 2RMKB 4U7OA 1GH6A 2QEXV 1K97A 5B3SB 3CCEV 1Q43A 3TGUH 4FJCC 2CTWA 2A79B 1AR1B 2PUSA 2LP7A 1PL0A 3JAWB 5E1AC 1Z5WA 1LUWA 2XHBA 1VF5B 1R3JC 1T5EA 2GUZA 1NTZH 1SC5B 1SQQH 1N32B 4UCOA 4GKKB 4P9OA 1AILA 2IJHA 4H0LB 4YY3B 2UUCB 1S76D 1DLBA 2FKXA 2QM4A 3N2KB 2KB1A 4PA6A 3SYCA 3G6BA 2XT9A 4JI7O 3AEIA 1WB7A 1SKVA 4NR1A 4BR6A 3FYEB 5CN0A 5IYZB 3A0RA 2VQFB 2YI9A 3QNEA 1N33B 2A06H 1YIJV 4QGPA 1PD3A 5BY1A 2JJ2G 1JQ0A 2ZXWB 4B3MB 1K9MW 1K34A 4O4JA 3A0HZ 4KP4A 5EBWC 3C3TA 1F51A 2PYLA 2KKWA 2JEUA 5H5NA 4FLUA 3SJQC 2JIZG 3HKCA 2QTSA 5HFLA 1L8DA 2WLKA 3JATA 2B1GA 2V4DA 4LF9B 3R66A 2RQ6A 3HKEA 4LF5O 4B3SB 2BSKA 5L3CA 4MT8A 4JI1B 4LNUB 4X64O 1NTMH 2E76B 4DV6B 3MDSA 1ZSPA 5EZYA 1BHBA 2ZINA 4JI5B 1D2DA 3RVYA 4OPHA 3SYQA 1S72V 3M99B 1J5EO 3W7TA 2Q7HA 5A9GA 1QR8A 1FPOA 1MMMA 2IU0A 3AG2B 5KAFZ 3OM3B 2ZCEA 3E22B 3J80N 1Q86W 5C93A 5KLVH 3F5WC 4UVBA 4LFBB 3CB2A 3SPIA 1SQXH 1H8HG 5H6RA 4CS4A 3EVKA 3VBBA 3TCUA 5J2UB 1PNMA 2Q7GA 5LMNO 3OT7A 2HEPA 3JD2A 5LHHA 2QWRB 3K3WA 3IJ4A 3LSQA 3JCUZ 1MZEA 3G80A 4DR1O 4RWUA 2PI4A 3LSSA 5JQGA 4NTXA 1N4CA 1KKDA 1OCRB 1ZLZA 1XBLA 1ZAUA 2YI8A 1FXKA 4TSFG 5IT9N 3CEIA 4YXWG 1N34B 2JRIA 1B6QA 5LXTA 4YIPA 1A32A 1VQLV 1XNRO 3CRMA 3U0ZA 3JAMN 3T1HO 1WA8A 1KP2A 1I94O 4EEQA 2ZNIA 2UUAO 4PJ0Z 1AJNA 4DV5O 1AI4A 5KHKA 5LP6A 1R6TA 5CB4B 5EYPB 4X1KA 2KSDA 4GX1A 1JFFB 1NTKH 2DMXA 4QPJA 2CGOA 3H1LH 4CH4A 2WAMA 4TV8B 4JAAA 4F6RA 3GB7C 2DJVA 2QWPB 4BWAA 1V55B 4PDRA 3D3QA 3RYFA 5IY5C 1BCCH 2F4VB 1YI2V 1U96A 3AG3B 3S3XA 1CPYA 2M7WA 2QWQB 4QE7A 3A2FA 3P3NA 3WB1A 3RYIA 4W4KA 2XAJA 2AZ0A 3CHXA 3H1JH 2CK3G 2GTSA 1AI7A 4FLTA 3JAKA 4R8CA 2JVDA 2R70A 5IJ9B 1KD1W 4ZKIA 3ICXA 1XDCA 5GTHZ 4LWSA 2HKOA 3RW0A 3FD9A 3ABLC 2PF4E 1IBMO 1GAXA 1GO3F 1NT2B 1YTFD 3SYAA 1OZ0A 4BW5A 4FLXA 3JD3A 4O4LA 3DC6A 4WBNB 3VQVA 5JH7A 4TOIA 4UV8A 4NYKA 3ZMTA 1RPOA 3ETQA 1QLNA 3FFQA 1NR7A 1IURA 1RPRA 1P49A 2A7WA 1NS1A 4X62B 2EIKB 5L3EA 3K5NA 3OTFA 4D7SA 3AK2A 3JD0A 2Q7EA 1IBLB 2ZKOA 4JTAB 4AI8A 3DXRB 2F93B 4J7KA 1NVPD 3IAYA 3K9SA 3HKEB 5JCOC 2EZOA 2HP8A 2BSKB 4O2AA 1US6A 3ASOB 4DR4O 2XOKG 3MHHC 4JI8B 3AG4B 5EZYB 3L9DA 1HNWO 2JGDB 2W6JG 2N74A 3SPCA 2OTJV 3HKBA 4G28B 2AZ2A 1K4DC 3ABMC 1CEZA 4JV5O 4JAVA 2YICA 3OEHG 3HKDA 3FAVA 1XMOO 3S3WA 3CMAV 3AK1A 1H2KA 4DUYO 2Y48A 4UVCA 2CTPA 1IXMA 1F7YA 3N2GA 2WLLA 4X66B 5KAIZ 1S0VA 4B08A 3X2QC 5IDJA 1IBKB 4LFAB 4DV4B 2OWOA 2Y0IA 1SQFA 1EBOA 2LW1A 2BTQA 2DYRC 5LGTA 4NTWA 2KG7A 2DW4A 2YC0A 4UCUA 1IDSA 4RO2A 4IIJA 5JQGB 3CPWU 1SQVH 3IGAC 4TWKA 3K06A 3CS5A 5IYBO 3UQ8A 1N32O 3E8GA 2QKCA 4X1YA 2Z0AA 1OCOC 1M9NA 2CGNA 1B04A 5LXTB 4DR2B 2UUCO 1XILA 2Q68A 4PA9A 5JJNB 1EN4A 1QLEC 2JGUA 3OW2U 4I4TA 3BEHA 4P9PA 5EBLC 1K8AW 3JALA 3ASNC 1WA8B 2PZSA 3OR6C 2EILC 4LC1A 2CH7B 1UJWB 2EIMC 4KXRA 5JVDB 2H94A 2DYSB 3B4SA 4L8JA 2AHYA 1K5SA 3K5OA 3ZMZA 5LP6B 3K0DA 3QVNA 3WG7B 3OMNB 4IT5A 5D5QA 4X1KB 4DR3B 1M5IA 3HPLC 3E86A 4H44B 1WNSA 3UO2A 4X8AA 4JYAB 3D3IA 1S5JA 2QDOA 4J41A 3WFVA 3RGBA 1Q3EA 3RYFB 4FLVA 2PGGA 2PTMA 1Q6HA 1ENVA 4LF9O 1AJPA 2HVJC 3L70H 4CH5A 4DUZO 1MABG 2VQEB 1MOFA 5EIBD 1VMGA 1SQBH 3JAKB 3ZS8C 2ZIMA 3ZMUA 4DV6O 4I55A 1NR1A 2UXCB 4JI5O 4IL6Z 4QIWF 2FB5A 4TUYA 1THZA 4IYHA 5HFMA 2QTOA 3E8BA 1Y66A 1B06A 1XHXA 1X59A 1M90W 2FTKA 1WAZA 3UT5A 4HYOA 4XBFA 5IYCO 3CYOA 4O4LB 3UO3A 1KU9A 5JH7B 3CE2A 4WFGA 1M57C 3ZN1A 1HW7A 3L73H 4FFBA 1QQCA 2ZM6B 4QJFB 2R9RB 1RP3B 2VRZA 1BT8A 2EX3A 5H9CA 1HNZB 5FNVB 2GTAA 4JI0B 2X0LA 4WF9V 2OT5A 2GSMB 2DE0X 4B3RO 1F4NA 4MS2A 2P22C 2LQTA 3BHPA 3JD1A 4BW9A 4UUJC 2ZE6A 1K7DA 4XDKA 3J7AU 2HVKC 3TXSA 4JTDB 1QVGU 2H8PC 1S5LZ 3LDDA 1B3QA 2A0LA 1YHQV 4TQDA 3U11A 1PKXA 1EZJA 2P90A 3ZHVA 3ZHTA 4HZ3A 1R1BA 5B1AC 3HKDB 1QR9A 2OTLV 2ITDC 3CCQV 1AB3A 4MVOA 3CCMV 5L3DA 4PDLA 4CZZA 3N2GB 3DGEA 1OCCC 3KCXA 1NQTA 3Q4HB 1XHZA 4B3TB 2F43G 2WLLB 4GLXA 2YDEA 1KKCA 4WCEV 3CRRA 1DK1A 4HBNA 1HNXB 3ZHRA 3BCCH 2F4VO 4QPKA 4LF7B 3JSNA 2BTQB 4D7TA 2KG7B 4J9YB 2XAFA 1GK9A 5CBFA 2A3QA 1QCEA 3LDCA 3KCYA 4IIJB 5DM6V 3B8NA 1M93A 1JA8A 2R72A 1GM9A 5GONA 1XL4A 5CBHA 4JYBA 4DV7B 1QNMA 3P30A 1BQ0A 4X1YB 1KECA 2EIJC 4JI3B 2CTRA 1PM9A 3K79A 2ZR3A 5B5EZ 3ZN0A 1F23A 3H1IH 4I4TB 3OD4A 1XOUA 3CCUV 3OFNG 1W59A 2UU9B 3JALB 1SERA 4JI6B 4U7NA 5JCOA 2HFEC 3JASA 1S77D 4ICGA 4UCTA 3M7MX 4J42A 3IC9A 4FFKA 1SETA 4R7CA 1QU7A 3RVZA 3CCVV 1F4MA 1NZ6A 2V7QG 2WLNA 5LHGA 2K1EA 4LH6A 4O4IA 3APQA 3RT3C 2YIBD 3HR0A 2FYUH 5K1PA 2RCVA 4NXNB 1Q90D 4MW8A 1XQ8A 5LOVA 1PP9H 1TUEB 2XAQA 3SPGA 1W2BU 2UUBO 4DV1B 3DTUB 1AJQA 3OTOO 4J7ZA 2ATKC 2ITCC 5B1BB 1Y76A 4JI8O 4I55B 3ZHQA 5KX5A 3CC4V 5L3BA 2Y0PA 5BMVA 2UXXA 3UCSC 1GMGA 4BIOA 1SRYA 4GT1A 1P84F 1HWYA 5F2VO 5H6QA 3T4ZA 3CX5F 5BXZA 1RM1C 3LDEA 4RQFA 3RYCA 4X66O 5TISZ 1VQ4V 1IBKO 4JI4B 4LFAO 4DK1A 4DV4O 5KHIA 4FFBB 2WPDG 3E89A 3D36C 1WJZA 2ZXWC 4Z1MG 4MSWC 1VQNV 1JMKC 4ZBMA 1BL8A 3DSQA 2Q0OC 4JYYA 2QGNA 3RFRA 5LA6B 3T4DA 1YVWA 1R3LC 2HJDA 4N21A 1VQ5V 2C2AA 1SZTA 2ILMA 1Q7YW 1HR0O 1JJ2U 3CCLV 2VWKA 3OGCC 2IU3A 3OE7G 3APOA 3MD0A 1UPGA 2EINB 1YDXA 4U3FH 2WA4A 4KHPB 2DWEC 4MTFA 3O9OA 1Q8IA 3T1CA 1PNLA 1NKDA 2OIEA 1EFRG 1WPBA 2ZR2A 1TVKA 3LNNA 3NXSA 5KUKA 3JCZA 3OMAB 5KA5A 1VP7A 3AG2C 2GHYA 2FMLA 2IJKA 4RAIA 4DV0O 4KL1A 5L3FA 2L6LA 2O57A 4LF8O 4FM1A 2BTOA 2OCHA 4DR3O 3RN4A 3ABKB 3STZC 5GTIZ 4QNHB 2UXDO 5ITZB 4JYAO 2F1MA 3ETEA 4JAUA 4DR5B 4TV9A 4ZHQA 1KYOF 4GCZA 4FZ1A 1IVSA 1WP8A 3I5DA 1CP9A 2ZE8A 4UXNA 2GV9A 4DR6O 4GKJB 1OCZC 2ZE5A 1NI8A 1Y4MA 2HR3A 1D5AA 1AROP 4MTXA 1HDJA 2YIDA 4DV2B 1TA8A 4X20A 1MSDA 2JS5A 1OCRC 1MA1A 2Q8VA 4GX0A 2VS0A 4LFCO 2YEVA 4J7JA 3CCSV 4DRXA 4ZOLA 2P6JA 5GONB 4DW0A 4EFEA 3THOA 2GUZB 4DV3B 3FKSG 2QM8A 2WSSG 3QO8A 1N36O 2CDYA 5JJEB 4X65O 1YJNV 5IJ0A 1Q6IA 3GWOA 3K9AA 4CS3A 4IHJA 2X6BA 3JASB 4H37A 2E75B 4W4LA 5CA1A 2DN9A 5LMUO 4I50A 1SQPH 2IH3C 2ZM6O 1FFXA 4I0XA 3E8FA 4ABMA 4H33A 1Z2GA 4QE9A 1EZVH 3W7SA 1RSOA 1HNZO 4JI0O 4OGQB 3ABMB 4DR7B 3T1YB 2JJ1G 2E5LB 4JI7B 4O4JB 3W7UA 3AG3C 4MW3A 2RNBA 3T2MA 3H1KH 4NXMB 3HKCB 2P06A 5LOVB 1G6UA 3JYCA 4J10A 3JATB 2E3CA 4JF3A 1XL6A 2B1IA 5KMGA 2IM9A 2UXBB 2XNDG 3BY6A 4A5UB 2AW9A 1R3IC 3LNMB 1Y76B 1H2GA 2ZDIC 1AVMA 5KX5B 1V54B 3C90A 3ZRXA 1ZX3A 2JEXA 3CMEV 4XDLA 1DGSA 2QWOB 1VQKV 4RUEA 4Z2WA 4UCVA 3FB8C 3F7YC 1BQZA 2OCCC 3QF7A 4X64B 3ZRWA 3FYIB 4GUNA 3AG1B 4N23A 4LF7O 5LYJA 1URFA 2IJJA 2F66C 3G4SV 1LR1A 4O2BA 2EIMB 4EFBA 3L72H 2EJ7A 3VQWA 3ZEDA 3CXHF 4X1IA 3F5TA 1ZTEA 3BPZA 4DV7O 4OX9B 3SPHA 4FK5C 1Y74A 2IW5A 5IE9A 1FXKB 4J80A 3G67A 4GKKO 4JI3O 3ASOC 4Z1VA 4YY3O 1VEWA 1FD9A 4LF6B 3B8MA 1TVKB 3ZBHA 4CBCA 1IZ3A 3A0BZ 3K5LA 4DYLA 2UU9O 4JI6O 3JAWA 1YZBA 4LR3A 1L0NH 2YXYA 3K08A 1K5QA 2Y4TA 1UFIA 4JGSA 5J9PC 4XDJA 4PDVA 1E79G 3CC7V 4KFMA 2VQFO 3CSXA 4WFFA 2Q73A 5AG2A 1N33O 4TV9B 4ZHQB 3GWKC 3ABUA 5EC2C 3TXQA 4F6RB 4B3MO 2GDSA 4D6TH 1YSCA 3L74H 3ZIAG 1Q6UA 1H38A 1Q5OA 4LF4B 2BOBC 5KHHA 4WFAV 4DV5B 2UXNA 2ZIOA 2WLHA 3CP1A 4DV1O 1M57B 2NNUA 2YEVB 4B3SO 3RYIB 3AG7A 4DRXB 4YHHB 4JI1O 3D36A 1YF2A 1JVMA 3JSLA 1Z5VA 4EKWA 2N04A 5DEDA 5E79Z 1NJIW 4O4HA 3UKMA 2Y4UA 1YJ9V 5JWPA 5IYDO 2X6CA 5B66Z 4LWSB 1KMIZ 1G1XB 4B7EA 5FL7G 2MK3A 5IJ0B 2Q9LA 3CJHA 2DYSC 1GM8A 4IHJB 4LNUA 3WB2A 1L0LH 5CA1B 1SA0A 4TQFA 3WG7C 4LFBO 4C7UA 5FLXN 2YXLA 4JI2B 2CAZC 1SF9A 1VF7A 4I0XB 3TETA 4CH3A 4UCRA 5H2FZ 2JK5C 2CE4A 3QO7A 4K0KB 5D5PA 1RSOB 3DC5A 4K3AA 5B1AB 2HJFC 3LSUA 1WP7A 1BS3A 4DXWA 3ABTA 3LUTB 5KMGB 1ROPA 2XTAA 1N34O 2Y69C 2WLJA 2LJ2A 1W0JG 4O2AB 2B9ZA 2RN9A 2IBZH 1VQ7V 3FB5C 3CC2V 1XUQA 2RDCA 1H2LA 2MW2B 1X4TA 2AHZA 3WU2Z 4X89A 2DQ3A 5JJJB 5FPRA 5C8YA 3HKBB 2HHHB 1AI5A 3E2EA 2YSUB 3FAVB 4F4LA 4I5SA 4DO2A 4DR5O 2G38A 2EIJB 2K9PA 3KKYA 4X9QA 1JR9A 4DR4B 1EM1A 2OYQA 1FS0G 2YXHA 4E2LA 3ZHSA 2EBOA 2LW7A 5LYJB 1OV9A 1FAFA 3K0GA 3C3SA 4DV2O 1I5YA 2NLJC 2IH1C 2QM7A 1MZFA 4JV5B 4O2BB 5EYPA 3SJCC 3W7WA 1WN7A 1WPXA 1M1KW 3CD6V 4X1IB 1XMOB 5CA0A 4I9QA 4TV8A 4RQEA 1P7GA 1Y74B 3BA8A 2R9IA 2QJ1A 1BGYH 4DV3O 4J9ZB 1GN2A 3B2EE 4PA4A 3UM7A 3JARA 1WB8A 3RYHA 4WFHA 2ZD9A 1U97A 4KUMA 2JDIG
chains in the Genus database with same CATH topology
2N05A 2QSAA 3UO3A 2CTPA 3APQA 2M6YA 1N4CA 2DN9A 2QWPB 2QWNB 1XBLA 2KQXA 2N04A 2YUAA 1BQ0A 2Y4TA 2LO1A 2GUZB 2GUZA 4J80A 2Y4UA 3UCSC 1FAFA 2L6LA 2CUGA 1FPOA 3BVOA 1HDJA 1WJZA 3APOA 2CTRA 1GH6A 1IURA 2OCHA 2QWOB 4IT5A 2PF4E 2YS8A 2EJ7A 2QWQB 2QWRB 2LGWA 1BQZA 2CTQA 4J7ZA 2CTWA 2DMXA 3UO2A 1NZ6A 3AG7A 4RWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N05 A;  2QSA A;  3UO3 A;  2CTP A;  3APQ A;  2M6Y A;  1N4C A;  2DN9 A;  2QWP B;  2QWN B;  1XBL A;  2KQX A;  2N04 A;  2YUA A;  1BQ0 A;  2Y4T A;  2LO1 A;  2GUZ B;  2GUZ A;  4J80 A;  2Y4U A;  3UCS C;  1FAF A;  2L6L A;  2CUG A;  1FPO A;  3BVO A;  1HDJ A;  1WJZ A;  3APO A;  2CTR A;  1GH6 A;  1IUR A;  2OCH A;  2QWO B;  4IT5 A;  2PF4 E;  2YS8 A;  2EJ7 A;  2QWQ B;  2QWR B;  2LGW A;  1BQZ A;  2CTQ A;  4J7Z A;  2CTW A;  2DMX A;  3UO2 A;  1NZ6 A;  3AG7 A;  4RWU A; 
#chains in the Genus database with same CATH topology
 2N05 A;  2Q67 A;  3QTC A;  3R65 A;  4YJ2 A;  2IJI A;  3VQY A;  4JPR A;  5IJ9 A;  4PI0 A;  1M56 C;  3ZX6 A;  1KUQ A;  3PJS K;  2ZDI A;  4PD4 F;  5EIB C;  2ZE7 A;  1AI6 A;  4NB5 A;  4BIU A;  4MTO A;  3L75 H;  4X62 O;  2WA3 A;  4P30 A;  4CH6 A;  3F7V C;  3EFF K;  1SES A;  4DR7 O;  3T1Y O;  1R6N A;  2E5L O;  4WBN A;  1GN4 A;  2BCC H;  1TUB A;  1IBL O;  5KHJ A;  5B3S C;  4NXM O;  4E4E A;  5BR8 B;  1RM1 B;  3ZMS A;  1XEQ A;  2XAS A;  3G71 V;  3IC7 A;  2UXB O;  3FX7 A;  4H13 B;  1J95 A;  2PYJ A;  2ZQM A;  1FXV A;  1P4R A;  4MVU A;  3GVM A;  1XRE A;  3MHS C;  4FLZ A;  4CS2 A;  4O4H B;  4TUY B;  3IFX A;  4NVP A;  1COW G;  3DXR A;  1MG1 A;  3G6E V;  1JOY A;  4G27 B;  3OAA G;  1PPJ H;  2X7R B;  1I08 A;  4DW1 A;  4DUZ B;  3CJH B;  1XMQ B;  1FJG B;  3OMI B;  3UT5 B;  1PNK A;  3P32 A;  4K8X A;  3H9V A;  1TAE A;  1SA0 B;  3QO5 A;  2JS3 A;  1XNQ B;  2ODM A;  1N0N A;  2P4K A;  2JGD A;  1D5N A;  2YUA A;  2P4V A;  1Y67 A;  3PN1 A;  5LGU A;  2BOC C;  2EUL A;  1K4C C;  4RUF A;  3A8T A;  1Q81 W;  3ZRV A;  3CXC U;  5KA6 A;  4LCU C;  5EC1 C;  4OX9 O;  2WWW A;  3SDL A;  2W0F C;  2ADQ B;  3CWB H;  4AQY B;  5A2Q N;  3ETG A;  4PDM A;  5B1B C;  4FLY A;  4DR2 O;  1OCZ B;  3ZMV A;  4LF6 O;  5IY5 B;  4UB8 Z;  2CTQ A;  2PI5 A;  4BIZ A;  4FZ0 A;  3L71 H;  3I55 V;  3K03 A;  3HB3 B;  3K59 A;  1S5H C;  3SR2 C;  1BSM A;  4B3R B;  3E8H A;  5C8Y B;  1YCI A;  3RWR D;  3NR7 A;  4HAM A;  4UVA A;  4FVM A;  2XAG A;  3VQX A;  1MSW D;  1NU1 H;  4J11 A;  1O9G A;  4CC5 A;  3CRA A;  1H8E G;  5LGN A;  3ABL B;  3EHB B;  3OR7 C;  2CH7 A;  2D2C B;  1LUV A;  5JVD A;  4LF4 O;  3FB7 C;  4MVR A;  3ETD A;  4X88 A;  1VQM V;  2FL4 A;  1VIB A;  4LBE C;  4NKG B;  3P3P A;  5CA0 B;  3TJT A;  4I7Z B;  4YHH O;  2VQE O;  4GZR B;  5IWA B;  4FLW A;  1VF6 C;  2EIN C;  2ZNJ A;  1TGO A;  1ZUQ A;  2UXC O;  1R3K C;  4FIP C;  2LO1 A;  3JAR B;  1JPX A;  1YJW V;  3RYH B;  2WLI A;  1GKF A;  5CA3 A;  3JD4 A;  1WLE A;  1CXZ B;  2A9H A;  1QVF U;  2EZP A;  4YJ2 B;  4JYC A;  5J2T A;  2QR4 A;  2HG5 C;  3ABK C;  3CCR V;  4JI2 O;  4TT3 G;  1P7B A;  4HNA A;  2F95 B;  1VQO V;  2XUM A;  1FFT B;  3EXA A;  5CMU A;  4K0K O;  4U3J A;  4UB6 Z;  3KZI Z;  2AGA A;  4UFZ A;  1V55 C;  4MVQ A;  4PEL A;  3B77 A;  2X6A A;  3SPJ A;  4O4I B;  5GW7 A;  3D8C A;  3E83 A;  1TUB B;  5FPO A;  3SGI A;  2OCC B;  1KQS U;  3STL C;  4I9W A;  4OPA A;  2L35 A;  2WLM A;  4IYI A;  3ZRS A;  1HP8 A;  4EB6 A;  1E1Q G;  2NN4 A;  2YS8 A;  2D3O W;  3X2Q B;  4PHZ A;  4GX2 A;  5FNV A;  2QSA A;  3ZHU A;  4K35 A;  4FM0 A;  2DYR B;  1GTO A;  1H2S B;  1N0J A;  3QG5 A;  5CBG A;  5BMV B;  3AK3 A;  3B40 A;  4YJ3 A;  1I5X A;  1AP6 A;  2Q69 A;  2HHH O;  2EJR A;  4PA3 A;  1L1F A;  2UUB B;  3E35 A;  4Q20 A;  1W0K G;  3OTO B;  4LF5 B;  3N27 A;  3K04 A;  1JX9 A;  1QBZ A;  1BHA A;  1ZL8 A;  1OCO B;  4L87 A;  3VOU A;  3OUS A;  5LHI A;  2P7T C;  2Q5Z A;  3FB6 C;  4B3T O;  3RYC B;  1SS3 A;  1YIT V;  1QLE B;  5DN6 G;  2NR5 A;  1HNX O;  2EIK C;  3I56 V;  2ADP A;  3K58 A;  1J5E B;  2OIG A;  2P67 A;  3ASN B;  4Q6G A;  1VQ9 V;  2EIL B;  1XI1 A;  3BFR A;  4PI2 A;  1K92 A;  2LGW A;  1H2N A;  1K73 W;  3K5M A;  4ZI7 A;  4DK0 A;  5EBM C;  3Q4H A;  1SZX A;  1I0H A;  3OUF A;  4R50 A;  2ETN A;  3BAA A;  4LH7 A;  1I7F A;  1YEW A;  2ARH A;  1IX9 A;  4GX5 A;  3ZCC A;  4JZ2 A;  2LGQ A;  5LMN B;  1V54 C;  2F23 A;  2V1D A;  3CCJ V;  1NH2 D;  1S3J A;  3AG4 C;  5BZB A;  2Z3Y A;  1MNG A;  1LNQ A;  1KP3 A;  1NBM G;  1KBH A;  1YTF B;  1DF4 A;  5B1N A;  4DR1 B;  1FYJ A;  1GN3 A;  1VQ6 V;  1QHT A;  1RFY A;  1HR0 B;  4UV9 A;  4AIL C;  1E1R G;  5DEC A;  3ZJZ A;  1BMF G;  4PA7 A;  2ZT9 B;  3RBZ A;  4LP8 A;  3AG1 C;  1VAR A;  4MVM A;  3H1H H;  1YXB A;  1OHH G;  1XNR B;  1KC8 W;  1BE3 H;  3TK1 A;  3N2K A;  4GYC B;  5KHG A;  3T1H B;  4ASU G;  5BR8 O;  4K8Z A;  4DV0 B;  4JZG A;  1I94 B;  1OJH A;  3WB0 A;  2UUA B;  4LF8 B;  4NXN O;  1NVP B;  4BAY A;  4G2K A;  4X20 B;  5IYZ A;  2PY5 A;  2UXD B;  4B7K A;  1FXK C;  4ZOL B;  2GBO A;  3SJB C;  4JAS A;  4PV1 B;  1N8R W;  4IGG A;  4R6Z A;  1M4U A;  2M6Y A;  2Q0A A;  2QWN B;  3M8A A;  3SJA C;  4DR6 B;  3B09 A;  3ML0 A;  1R73 A;  1GN6 A;  2WLI B;  1GM7 A;  1PL4 A;  2Q6A A;  1AR4 A;  2QE7 G;  3SYP A;  5L3G A;  1XMQ O;  1FJG O;  4LFC B;  4AHC A;  5B1O A;  5LL6 Y;  2LFS A;  3OGI B;  5J2T B;  2Y69 B;  2W6I G;  5LP6 C;  2HLD G;  1JCH A;  1XNQ O;  4I50 B;  3KG2 A;  1EN6 A;  4HNA B;  4YIO A;  4JI4 O;  2P5O A;  1FFX B;  3OEE G;  1N36 B;  3H01 A;  4U3J B;  1IBM B;  1VQ8 V;  4X65 B;  3E22 A;  1NH2 B;  2B5U A;  2R9A A;  1SQG A;  3BA9 A;  4WFE A;  1H2M A;  1O9H A;  5LMU B;  1ZWI C;  2W0X A;  4FMT A;  1K3E A;  4EB6 B;  4AQY O;  2YIA A;  2LFR A;  1ORQ C;  1Y6X A;  1OCC B;  5J2U A;  4FM2 A;  2BE3 A;  1Q82 W;  2DWD C;  4KHP O;  1FXH A;  1DTO A;  4FPP A;  4WFB V;  5LA6 A;  1V9P A;  4CC6 A;  1IXB A;  2DOS A;  4UCS A;  3BAB A;  2VWJ A;  2Q4P A;  1K33 A;  4JTC B;  1G8M A;  4YJ3 B;  5KUM A;  3U10 A;  4MVZ A;  3BVO A;  3O65 A;  1BZK A;  4NTY A;  1VF6 A;  1R6K A;  3K57 A;  1VQP V;  1JJO A;  2QKA A;  1G4Y B;  2QKS A;  1ZL8 B;  2Z5U A;  2XAH A;  4MVS A;  3ZRW B;  2AXT Z;  3SYO A;  1HNW B;  2E74 B;  4F6E A;  3MAQ A;  4GKJ O;  5EK0 A;  2YIB A;  4P2Z A;  3CRQ A;  2CUG A;  2H3O A;  3BRC A;  4OXS A;  2DQ0 A;  5K1X A;  1AP5 A;  5CB4 A;  5ITZ A;  1FKA O;  1M56 B;  1JFF A;  4ZI7 B;  5IWA O;  4DUY B;  4MTG A;  3W7X A;  2QA4 V;  5LBQ A;  1DF5 A;  3CRC A;  2KQX A;  1GRJ A;  2RJZ A;  1AR5 A;  1PV0 A;  3J81 N;  1EN5 A;  1KB9 F;  4ZIB A;  2RMK B;  4U7O A;  1GH6 A;  2QEX V;  1K97 A;  5B3S B;  3CCE V;  1Q43 A;  3TGU H;  4FJC C;  2CTW A;  2A79 B;  1AR1 B;  2PUS A;  2LP7 A;  1PL0 A;  3JAW B;  5E1A C;  1Z5W A;  1LUW A;  2XHB A;  1VF5 B;  1R3J C;  1T5E A;  2GUZ A;  1NTZ H;  1SC5 B;  1SQQ H;  1N32 B;  4UCO A;  4GKK B;  4P9O A;  1AIL A;  2IJH A;  4H0L B;  4YY3 B;  2UUC B;  1S76 D;  1DLB A;  2FKX A;  2QM4 A;  3N2K B;  2KB1 A;  4PA6 A;  3SYC A;  3G6B A;  2XT9 A;  4JI7 O;  3AEI A;  1WB7 A;  1SKV A;  4NR1 A;  4BR6 A;  3FYE B;  5CN0 A;  5IYZ B;  3A0R A;  2VQF B;  2YI9 A;  3QNE A;  1N33 B;  2A06 H;  1YIJ V;  4QGP A;  1PD3 A;  5BY1 A;  2JJ2 G;  1JQ0 A;  2ZXW B;  4B3M B;  1K9M W;  1K34 A;  4O4J A;  3A0H Z;  4KP4 A;  5EBW C;  3C3T A;  1F51 A;  2PYL A;  2KKW A;  2JEU A;  5H5N A;  4FLU A;  3SJQ C;  2JIZ G;  3HKC A;  2QTS A;  5HFL A;  1L8D A;  2WLK A;  3JAT A;  2B1G A;  2V4D A;  4LF9 B;  3R66 A;  2RQ6 A;  3HKE A;  4LF5 O;  4B3S B;  2BSK A;  5L3C A;  4MT8 A;  4JI1 B;  4LNU B;  4X64 O;  1NTM H;  2E76 B;  4DV6 B;  3MDS A;  1ZSP A;  5EZY A;  1BHB A;  2ZIN A;  4JI5 B;  1D2D A;  3RVY A;  4OPH A;  3SYQ A;  1S72 V;  3M99 B;  1J5E O;  3W7T A;  2Q7H A;  5A9G A;  1QR8 A;  1FPO A;  1MMM A;  2IU0 A;  3AG2 B;  5KAF Z;  3OM3 B;  2ZCE A;  3E22 B;  3J80 N;  1Q86 W;  5C93 A;  5KLV H;  3F5W C;  4UVB A;  4LFB B;  3CB2 A;  3SPI A;  1SQX H;  1H8H G;  5H6R A;  4CS4 A;  3EVK A;  3VBB A;  3TCU A;  5J2U B;  1PNM A;  2Q7G A;  5LMN O;  3OT7 A;  2HEP A;  3JD2 A;  5LHH A;  2QWR B;  3K3W A;  3IJ4 A;  3LSQ A;  3JCU Z;  1MZE A;  3G80 A;  4DR1 O;  4RWU A;  2PI4 A;  3LSS A;  5JQG A;  4NTX A;  1N4C A;  1KKD A;  1OCR B;  1ZLZ A;  1XBL A;  1ZAU A;  2YI8 A;  1FXK A;  4TSF G;  5IT9 N;  3CEI A;  4YXW G;  1N34 B;  2JRI A;  1B6Q A;  5LXT A;  4YIP A;  1A32 A;  1VQL V;  1XNR O;  3CRM A;  3U0Z A;  3JAM N;  3T1H O;  1WA8 A;  1KP2 A;  1I94 O;  4EEQ A;  2ZNI A;  2UUA O;  4PJ0 Z;  1AJN A;  4DV5 O;  1AI4 A;  5KHK A;  5LP6 A;  1R6T A;  5CB4 B;  5EYP B;  4X1K A;  2KSD A;  4GX1 A;  1JFF B;  1NTK H;  2DMX A;  4QPJ A;  2CGO A;  3H1L H;  4CH4 A;  2WAM A;  4TV8 B;  4JAA A;  4F6R A;  3GB7 C;  2DJV A;  2QWP B;  4BWA A;  1V55 B;  4PDR A;  3D3Q A;  3RYF A;  5IY5 C;  1BCC H;  2F4V B;  1YI2 V;  1U96 A;  3AG3 B;  3S3X A;  1CPY A;  2M7W A;  2QWQ B;  4QE7 A;  3A2F A;  3P3N A;  3WB1 A;  3RYI A;  4W4K A;  2XAJ A;  2AZ0 A;  3CHX A;  3H1J H;  2CK3 G;  2GTS A;  1AI7 A;  4FLT A;  3JAK A;  4R8C A;  2JVD A;  2R70 A;  5IJ9 B;  1KD1 W;  4ZKI A;  3ICX A;  1XDC A;  5GTH Z;  4LWS A;  2HKO A;  3RW0 A;  3FD9 A;  3ABL C;  2PF4 E;  1IBM O;  1GAX A;  1GO3 F;  1NT2 B;  1YTF D;  3SYA A;  1OZ0 A;  4BW5 A;  4FLX A;  3JD3 A;  4O4L A;  3DC6 A;  4WBN B;  3VQV A;  5JH7 A;  4TOI A;  4UV8 A;  4NYK A;  3ZMT A;  1RPO A;  3ETQ A;  1QLN A;  3FFQ A;  1NR7 A;  1IUR A;  1RPR A;  1P49 A;  2A7W A;  1NS1 A;  4X62 B;  2EIK B;  5L3E A;  3K5N A;  3OTF A;  4D7S A;  3AK2 A;  3JD0 A;  2Q7E A;  1IBL B;  2ZKO A;  4JTA B;  4AI8 A;  3DXR B;  2F93 B;  4J7K A;  1NVP D;  3IAY A;  3K9S A;  3HKE B;  5JCO C;  2EZO A;  2HP8 A;  2BSK B;  4O2A A;  1US6 A;  3ASO B;  4DR4 O;  2XOK G;  3MHH C;  4JI8 B;  3AG4 B;  5EZY B;  3L9D A;  1HNW O;  2JGD B;  2W6J G;  2N74 A;  3SPC A;  2OTJ V;  3HKB A;  4G28 B;  2AZ2 A;  1K4D C;  3ABM C;  1CEZ A;  4JV5 O;  4JAV A;  2YIC A;  3OEH G;  3HKD A;  3FAV A;  1XMO O;  3S3W A;  3CMA V;  3AK1 A;  1H2K A;  4DUY O;  2Y48 A;  4UVC A;  2CTP A;  1IXM A;  1F7Y A;  3N2G A;  2WLL A;  4X66 B;  5KAI Z;  1S0V A;  4B08 A;  3X2Q C;  5IDJ A;  1IBK B;  4LFA B;  4DV4 B;  2OWO A;  2Y0I A;  1SQF A;  1EBO A;  2LW1 A;  2BTQ A;  2DYR C;  5LGT A;  4NTW A;  2KG7 A;  2DW4 A;  2YC0 A;  4UCU A;  1IDS A;  4RO2 A;  4IIJ A;  5JQG B;  3CPW U;  1SQV H;  3IGA C;  4TWK A;  3K06 A;  3CS5 A;  5IYB O;  3UQ8 A;  1N32 O;  3E8G A;  2QKC A;  4X1Y A;  2Z0A A;  1OCO C;  1M9N A;  2CGN A;  1B04 A;  5LXT B;  4DR2 B;  2UUC O;  1XIL A;  2Q68 A;  4PA9 A;  5JJN B;  1EN4 A;  1QLE C;  2JGU A;  3OW2 U;  4I4T A;  3BEH A;  4P9P A;  5EBL C;  1K8A W;  3JAL A;  3ASN C;  1WA8 B;  2PZS A;  3OR6 C;  2EIL C;  4LC1 A;  2CH7 B;  1UJW B;  2EIM C;  4KXR A;  5JVD B;  2H94 A;  2DYS B;  3B4S A;  4L8J A;  2AHY A;  1K5S A;  3K5O A;  3ZMZ A;  5LP6 B;  3K0D A;  3QVN A;  3WG7 B;  3OMN B;  4IT5 A;  5D5Q A;  4X1K B;  4DR3 B;  1M5I A;  3HPL C;  3E86 A;  4H44 B;  1WNS A;  3UO2 A;  4X8A A;  4JYA B;  3D3I A;  1S5J A;  2QDO A;  4J41 A;  3WFV A;  3RGB A;  1Q3E A;  3RYF B;  4FLV A;  2PGG A;  2PTM A;  1Q6H A;  1ENV A;  4LF9 O;  1AJP A;  2HVJ C;  3L70 H;  4CH5 A;  4DUZ O;  1MAB G;  2VQE B;  1MOF A;  5EIB D;  1VMG A;  1SQB H;  3JAK B;  3ZS8 C;  2ZIM A;  3ZMU A;  4DV6 O;  4I55 A;  1NR1 A;  2UXC B;  4JI5 O;  4IL6 Z;  4QIW F;  2FB5 A;  4TUY A;  1THZ A;  4IYH A;  5HFM A;  2QTO A;  3E8B A;  1Y66 A;  1B06 A;  1XHX A;  1X59 A;  1M90 W;  2FTK A;  1WAZ A;  3UT5 A;  4HYO A;  4XBF A;  5IYC O;  3CYO A;  4O4L B;  3UO3 A;  1KU9 A;  5JH7 B;  3CE2 A;  4WFG A;  1M57 C;  3ZN1 A;  1HW7 A;  3L73 H;  4FFB A;  1QQC A;  2ZM6 B;  4QJF B;  2R9R B;  1RP3 B;  2VRZ A;  1BT8 A;  2EX3 A;  5H9C A;  1HNZ B;  5FNV B;  2GTA A;  4JI0 B;  2X0L A;  4WF9 V;  2OT5 A;  2GSM B;  2DE0 X;  4B3R O;  1F4N A;  4MS2 A;  2P22 C;  2LQT A;  3BHP A;  3JD1 A;  4BW9 A;  4UUJ C;  2ZE6 A;  1K7D A;  4XDK A;  3J7A U;  2HVK C;  3TXS A;  4JTD B;  1QVG U;  2H8P C;  1S5L Z;  3LDD A;  1B3Q A;  2A0L A;  1YHQ V;  4TQD A;  3U11 A;  1PKX A;  1EZJ A;  2P90 A;  3ZHV A;  3ZHT A;  4HZ3 A;  1R1B A;  5B1A C;  3HKD B;  1QR9 A;  2OTL V;  2ITD C;  3CCQ V;  1AB3 A;  4MVO A;  3CCM V;  5L3D A;  4PDL A;  4CZZ A;  3N2G B;  3DGE A;  1OCC C;  3KCX A;  1NQT A;  3Q4H B;  1XHZ A;  4B3T B;  2F43 G;  2WLL B;  4GLX A;  2YDE A;  1KKC A;  4WCE V;  3CRR A;  1DK1 A;  4HBN A;  1HNX B;  3ZHR A;  3BCC H;  2F4V O;  4QPK A;  4LF7 B;  3JSN A;  2BTQ B;  4D7T A;  2KG7 B;  4J9Y B;  2XAF A;  1GK9 A;  5CBF A;  2A3Q A;  1QCE A;  3LDC A;  3KCY A;  4IIJ B;  5DM6 V;  3B8N A;  1M93 A;  1JA8 A;  2R72 A;  1GM9 A;  5GON A;  1XL4 A;  5CBH A;  4JYB A;  4DV7 B;  1QNM A;  3P30 A;  1BQ0 A;  4X1Y B;  1KEC A;  2EIJ C;  4JI3 B;  2CTR A;  1PM9 A;  3K79 A;  2ZR3 A;  5B5E Z;  3ZN0 A;  1F23 A;  3H1I H;  4I4T B;  3OD4 A;  1XOU A;  3CCU V;  3OFN G;  1W59 A;  2UU9 B;  3JAL B;  1SER A;  4JI6 B;  4U7N A;  5JCO A;  2HFE C;  3JAS A;  1S77 D;  4ICG A;  4UCT A;  3M7M X;  4J42 A;  3IC9 A;  4FFK A;  1SET A;  4R7C A;  1QU7 A;  3RVZ A;  3CCV V;  1F4M A;  1NZ6 A;  2V7Q G;  2WLN A;  5LHG A;  2K1E A;  4LH6 A;  4O4I A;  3APQ A;  3RT3 C;  2YIB D;  3HR0 A;  2FYU H;  5K1P A;  2RCV A;  4NXN B;  1Q90 D;  4MW8 A;  1XQ8 A;  5LOV A;  1PP9 H;  1TUE B;  2XAQ A;  3SPG A;  1W2B U;  2UUB O;  4DV1 B;  3DTU B;  1AJQ A;  3OTO O;  4J7Z A;  2ATK C;  2ITC C;  5B1B B;  1Y76 A;  4JI8 O;  4I55 B;  3ZHQ A;  5KX5 A;  3CC4 V;  5L3B A;  2Y0P A;  5BMV A;  2UXX A;  3UCS C;  1GMG A;  4BIO A;  1SRY A;  4GT1 A;  1P84 F;  1HWY A;  5F2V O;  5H6Q A;  3T4Z A;  3CX5 F;  5BXZ A;  1RM1 C;  3LDE A;  4RQF A;  3RYC A;  4X66 O;  5TIS Z;  1VQ4 V;  1IBK O;  4JI4 B;  4LFA O;  4DK1 A;  4DV4 O;  5KHI A;  4FFB B;  2WPD G;  3E89 A;  3D36 C;  1WJZ A;  2ZXW C;  4Z1M G;  4MSW C;  1VQN V;  1JMK C;  4ZBM A;  1BL8 A;  3DSQ A;  2Q0O C;  4JYY A;  2QGN A;  3RFR A;  5LA6 B;  3T4D A;  1YVW A;  1R3L C;  2HJD A;  4N21 A;  1VQ5 V;  2C2A A;  1SZT A;  2ILM A;  1Q7Y W;  1HR0 O;  1JJ2 U;  3CCL V;  2VWK A;  3OGC C;  2IU3 A;  3OE7 G;  3APO A;  3MD0 A;  1UPG A;  2EIN B;  1YDX A;  4U3F H;  2WA4 A;  4KHP B;  2DWE C;  4MTF A;  3O9O A;  1Q8I A;  3T1C A;  1PNL A;  1NKD A;  2OIE A;  1EFR G;  1WPB A;  2ZR2 A;  1TVK A;  3LNN A;  3NXS A;  5KUK A;  3JCZ A;  3OMA B;  5KA5 A;  1VP7 A;  3AG2 C;  2GHY A;  2FML A;  2IJK A;  4RAI A;  4DV0 O;  4KL1 A;  5L3F A;  2L6L A;  2O57 A;  4LF8 O;  4FM1 A;  2BTO A;  2OCH A;  4DR3 O;  3RN4 A;  3ABK B;  3STZ C;  5GTI Z;  4QNH B;  2UXD O;  5ITZ B;  4JYA O;  2F1M A;  3ETE A;  4JAU A;  4DR5 B;  4TV9 A;  4ZHQ A;  1KYO F;  4GCZ A;  4FZ1 A;  1IVS A;  1WP8 A;  3I5D A;  1CP9 A;  2ZE8 A;  4UXN A;  2GV9 A;  4DR6 O;  4GKJ B;  1OCZ C;  2ZE5 A;  1NI8 A;  1Y4M A;  2HR3 A;  1D5A A;  1ARO P;  4MTX A;  1HDJ A;  2YID A;  4DV2 B;  1TA8 A;  4X20 A;  1MSD A;  2JS5 A;  1OCR C;  1MA1 A;  2Q8V A;  4GX0 A;  2VS0 A;  4LFC O;  2YEV A;  4J7J A;  3CCS V;  4DRX A;  4ZOL A;  2P6J A;  5GON B;  4DW0 A;  4EFE A;  3THO A;  2GUZ B;  4DV3 B;  3FKS G;  2QM8 A;  2WSS G;  3QO8 A;  1N36 O;  2CDY A;  5JJE B;  4X65 O;  1YJN V;  5IJ0 A;  1Q6I A;  3GWO A;  3K9A A;  4CS3 A;  4IHJ A;  2X6B A;  3JAS B;  4H37 A;  2E75 B;  4W4L A;  5CA1 A;  2DN9 A;  5LMU O;  4I50 A;  1SQP H;  2IH3 C;  2ZM6 O;  1FFX A;  4I0X A;  3E8F A;  4ABM A;  4H33 A;  1Z2G A;  4QE9 A;  1EZV H;  3W7S A;  1RSO A;  1HNZ O;  4JI0 O;  4OGQ B;  3ABM B;  4DR7 B;  3T1Y B;  2JJ1 G;  2E5L B;  4JI7 B;  4O4J B;  3W7U A;  3AG3 C;  4MW3 A;  2RNB A;  3T2M A;  3H1K H;  4NXM B;  3HKC B;  2P06 A;  5LOV B;  1G6U A;  3JYC A;  4J10 A;  3JAT B;  2E3C A;  4JF3 A;  1XL6 A;  2B1I A;  5KMG A;  2IM9 A;  2UXB B;  2XND G;  3BY6 A;  4A5U B;  2AW9 A;  1R3I C;  3LNM B;  1Y76 B;  1H2G A;  2ZDI C;  1AVM A;  5KX5 B;  1V54 B;  3C90 A;  3ZRX A;  1ZX3 A;  2JEX A;  3CME V;  4XDL A;  1DGS A;  2QWO B;  1VQK V;  4RUE A;  4Z2W A;  4UCV A;  3FB8 C;  3F7Y C;  1BQZ A;  2OCC C;  3QF7 A;  4X64 B;  3ZRW A;  3FYI B;  4GUN A;  3AG1 B;  4N23 A;  4LF7 O;  5LYJ A;  1URF A;  2IJJ A;  2F66 C;  3G4S V;  1LR1 A;  4O2B A;  2EIM B;  4EFB A;  3L72 H;  2EJ7 A;  3VQW A;  3ZED A;  3CXH F;  4X1I A;  3F5T A;  1ZTE A;  3BPZ A;  4DV7 O;  4OX9 B;  3SPH A;  4FK5 C;  1Y74 A;  2IW5 A;  5IE9 A;  1FXK B;  4J80 A;  3G67 A;  4GKK O;  4JI3 O;  3ASO C;  4Z1V A;  4YY3 O;  1VEW A;  1FD9 A;  4LF6 B;  3B8M A;  1TVK B;  3ZBH A;  4CBC A;  1IZ3 A;  3A0B Z;  3K5L A;  4DYL A;  2UU9 O;  4JI6 O;  3JAW A;  1YZB A;  4LR3 A;  1L0N H;  2YXY A;  3K08 A;  1K5Q A;  2Y4T A;  1UFI A;  4JGS A;  5J9P C;  4XDJ A;  4PDV A;  1E79 G;  3CC7 V;  4KFM A;  2VQF O;  3CSX A;  4WFF A;  2Q73 A;  5AG2 A;  1N33 O;  4TV9 B;  4ZHQ B;  3GWK C;  3ABU A;  5EC2 C;  3TXQ A;  4F6R B;  4B3M O;  2GDS A;  4D6T H;  1YSC A;  3L74 H;  3ZIA G;  1Q6U A;  1H38 A;  1Q5O A;  4LF4 B;  2BOB C;  5KHH A;  4WFA V;  4DV5 B;  2UXN A;  2ZIO A;  2WLH A;  3CP1 A;  4DV1 O;  1M57 B;  2NNU A;  2YEV B;  4B3S O;  3RYI B;  3AG7 A;  4DRX B;  4YHH B;  4JI1 O;  3D36 A;  1YF2 A;  1JVM A;  3JSL A;  1Z5V A;  4EKW A;  2N04 A;  5DED A;  5E79 Z;  1NJI W;  4O4H A;  3UKM A;  2Y4U A;  1YJ9 V;  5JWP A;  5IYD O;  2X6C A;  5B66 Z;  4LWS B;  1KMI Z;  1G1X B;  4B7E A;  5FL7 G;  2MK3 A;  5IJ0 B;  2Q9L A;  3CJH A;  2DYS C;  1GM8 A;  4IHJ B;  4LNU A;  3WB2 A;  1L0L H;  5CA1 B;  1SA0 A;  4TQF A;  3WG7 C;  4LFB O;  4C7U A;  5FLX N;  2YXL A;  4JI2 B;  2CAZ C;  1SF9 A;  1VF7 A;  4I0X B;  3TET A;  4CH3 A;  4UCR A;  5H2F Z;  2JK5 C;  2CE4 A;  3QO7 A;  4K0K B;  5D5P A;  1RSO B;  3DC5 A;  4K3A A;  5B1A B;  2HJF C;  3LSU A;  1WP7 A;  1BS3 A;  4DXW A;  3ABT A;  3LUT B;  5KMG B;  1ROP A;  2XTA A;  1N34 O;  2Y69 C;  2WLJ A;  2LJ2 A;  1W0J G;  4O2A B;  2B9Z A;  2RN9 A;  2IBZ H;  1VQ7 V;  3FB5 C;  3CC2 V;  1XUQ A;  2RDC A;  1H2L A;  2MW2 B;  1X4T A;  2AHZ A;  3WU2 Z;  4X89 A;  2DQ3 A;  5JJJ B;  5FPR A;  5C8Y A;  3HKB B;  2HHH B;  1AI5 A;  3E2E A;  2YSU B;  3FAV B;  4F4L A;  4I5S A;  4DO2 A;  4DR5 O;  2G38 A;  2EIJ B;  2K9P A;  3KKY A;  4X9Q A;  1JR9 A;  4DR4 B;  1EM1 A;  2OYQ A;  1FS0 G;  2YXH A;  4E2L A;  3ZHS A;  2EBO A;  2LW7 A;  5LYJ B;  1OV9 A;  1FAF A;  3K0G A;  3C3S A;  4DV2 O;  1I5Y A;  2NLJ C;  2IH1 C;  2QM7 A;  1MZF A;  4JV5 B;  4O2B B;  5EYP A;  3SJC C;  3W7W A;  1WN7 A;  1WPX A;  1M1K W;  3CD6 V;  4X1I B;  1XMO B;  5CA0 A;  4I9Q A;  4TV8 A;  4RQE A;  1P7G A;  1Y74 B;  3BA8 A;  2R9I A;  2QJ1 A;  1BGY H;  4DV3 O;  4J9Z B;  1GN2 A;  3B2E E;  4PA4 A;  3UM7 A;  3JAR A;  1WB8 A;  3RYH A;  4WFH A;  2ZD9 A;  1U97 A;  4KUM A;  2JDI G; 
#chains in the Genus database with same CATH homology
 2N05 A;  2QSA A;  3UO3 A;  2CTP A;  3APQ A;  2M6Y A;  1N4C A;  2DN9 A;  2QWP B;  2QWN B;  1XBL A;  2KQX A;  2N04 A;  2YUA A;  1BQ0 A;  2Y4T A;  2LO1 A;  2GUZ B;  2GUZ A;  4J80 A;  2Y4U A;  3UCS C;  1FAF A;  2L6L A;  2CUG A;  1FPO A;  3BVO A;  1HDJ A;  1WJZ A;  3APO A;  2CTR A;  1GH6 A;  1IUR A;  2OCH A;  2QWO B;  4IT5 A;  2PF4 E;  2YS8 A;  2EJ7 A;  2QWQ B;  2QWR B;  2LGW A;  1BQZ A;  2CTQ A;  4J7Z A;  2CTW A;  2DMX A;  3UO2 A;  1NZ6 A;  3AG7 A;  4RWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...