1GH6A

Retinoblastoma pocket complexed with sv40 large t antigen
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
SHMREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Large T antigen
publication title Structural basis for the inactivation of retinoblastoma tumor suppressor by SV40 large T antigen.
pubmed doi rcsb
source organism Simian virus 40
total genus 23
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.-:
pdb deposition date 2000-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1gh6A01
1FPOA 2CTWA 4IT5A 2OCHA 1IURA 2GUZA 2DMXA 2CTRA 2EJ7A 2L6LA 2Y4UA 2LO1A 3BVOA 1HDJA 2CTQA 1FAFA 2QWQB 2QWNB 2LGWA 1NZ6A 2M6YA 3UO3A 1BQ0A 4J7ZA 3AG7A 1WJZA 2N05A 2QSAA 1BQZA 2N04A 2DN9A 2QWRB 1GH6A 2QWPB 2CUGA 3UCSC 2PF4E 2KQXA 2Y4TA 2CTPA 4RWUA 3APQA 2QWOB 1XBLA 2GUZB 3APOA 3UO2A 4J80A 2YS8A 2YUAA 1N4CA
chains in the Genus database with same CATH superfamily
4YJ3B 2F4VO 3NR7A 4OXSA 1AVMA 2ZM6O 3T1HB 1WAZA 5IJ9A 5KHJA 1QLNA 2WWWA 2EJ7A 2Q0OC 4X1KA 3UO3A 1JFFB 3K08A 4TOIA 2DYRC 3D36A 5J2UB 1QQCA 2YIBA 1B04A 1HNZB 4NXNO 4IGGA 1PM9A 4PA6A 3CE2A 4FLWA 3E35A 1SRYA 1FYJA 3CXCU 3J81N 1EZJA 4JZ2A 3CCVV 2AHYA 3K59A 5J2TA 4TT3G 1HW7A 2ZIMA 3AK1A 4MTGA 3T1HO 1NTZH 3ASNC 5IJ0B 1FJGB 1R6KA 2DJVA 4AILC 2ZDIA 5LGTA 2PZSA 4PELA 1J5EO 4MS2A 3K9AA 1HDJA 4BIOA 2B5UA 1BQ0A 4O4IA 2Y0IA 3G4SV 1JR9A 3CCUV 1F4MA 2CUGA 1WPXA 5KLVH 3S3WA 3UO2A 3ZRVA 4GKKB 4GUNA 2H94A 3B09A 3SYAA 1ZX3A 3JASB 5J9PC 3B40A 5B1NA 2XOKG 1VQ5V 4UB6Z 1NT2B 1Y76B 5EYPA 5KHGA 2ATKC 3WG7C 4ZOLA 1FJGO 4RWUA 1VQ6V 1M1KW 5KHIA 2M7WA 3RYCB 2DYSC 4NTXA 2A7WA 3OGCC 4O2AB 2GSMB 2XHBA 2VQEB 2EIKC 2ZKOA 3VQXA 1BZKA 1FXKB 1K97A 2HJDA 1FFTB 2OTJV 2HG5C 4G27B 4X89A 3DTUB 2XT9A 2B1IA 3BA9A 3JAKA 1NR1A 2WLNA 2Q7HA 3CYOA 3HKCB 1WB7A 4I50A 1U97A 4J9YB 5CBHA 4Q6GA 4DV7O 1WB8A 4HZ3A 3ASOC 5EBWC 1KYOF 4PA9A 2BCCH 3RYFA 4KL1A 2NN4A 3Q4HA 4YIOA 1FFXA 3LUTB 3IJ4A 1KMIZ 2VQEO 3ZMUA 2WLLB 1VMGA 3OAAG 3D3IA 4X66B 1R3IC 2MK3A 1KQSU 3OEHG 3LNNA 4O2BA 1PNKA 1R3LC 2CAZC 1Q82W 3HKDA 3QNEA 3OR7C 1GN2A 5CBFA 3P30A 3JD1A 4QPKA 5GONB 4E2LA 3CCEV 4XDJA 3ZRWA 5B1AC 1NKDA 4MW8A 5LL6Y 1WLEA 2EILC 3J7AU 1YJNV 1AJQA 1GO3F 2Z3YA 2JJ1G 4DUZO 5KHHA 4X66O 2ITDC 2QEXV 3ABMB 1N0NA 4UVAA 4K0KB 2P22C 3OE7G 4U3FH 4O4LB 5AG2A 4DR4O 4DK0A 3N2GB 1G4YB 4LF4B 4J7ZA 2X6CA 2L35A 5H9CA 1OCCC 1AI6A 2IBZH 1KBHA 1QNMA 4UVCA 1HNXO 4IYIA 1URFA 3OT7A 1VARA 1S5JA 4H37A 4IT5A 3CCSV 4DV1O 3L71H 1S0VA 2Y4UA 2GTSA 3CD6V 5LHIA 4FM0A 1XHZA 1OHHG 4Z2WA 4P30A 1I7FA 5IYBO 4RUEA 1S72V 1ZWIC 3EVKA 2JS3A 4Q20A 1MA1A 4DV5B 2C2AA 5JH7A 1TUEB 4B3TB 5LHHA 3FB6C 2V7QG 1V55C 3A0HZ 4LF4O 3I56V 3K5MA 2CTRA 5KAFZ 2ZT9B 4ZOLB 3G67A 3RVYA 1GN6A 3CS5A 5B3SB 4PDVA 4YHHB 4FJCC 1YDXA 4WFAV 4X88A 4FLUA 3TGUH 5GTHZ 2ADPA 1N32O 2ILMA 4TV8A 3F5WC 2E75B 4UV8A 1Y4MA 2PUSA 1IXBA 1ZL8A 5JWPA 5LMUO 1NJIW 2Q69A 4JI2O 4BWAA 1UJWB 3JAKB 2HR3A 3CC7V 3JD3A 4OX9B 1JOYA 3D3QA 2F93B 3TXQA 1JVMA 3JAWA 2EIJC 3JYCA 1OCOC 4Z1MG 1R6TA 1RPOA 4GYCB 3U10A 1JCHA 2CK3G 3Q4HB 4JYBA 4YHHO 4F4LA 2YICA 3SPIA 4CH5A 3C3SA 4DYLA 3FYEB 2MW2B 3P3NA 4IL6Z 3L9DA 1G1XB 4B3RB 4QIWF 1Q6UA 2ZXWC 2DE0X 3EFFK 2IJKA 4B7KA 1DGSA 1JJOA 4GX0A 4X20A 1I94B 1DTOA 3HKDB 2OT5A 1VF6C 4J11A 4UB8Z 2GBOA 2R72A 4OX9O 3DSQA 3AG4B 2PGGA 5BR8B 4TWKA 3CRQA 1E1RG 2Q5ZA 3SYPA 3HKBA 3ZRWB 1XMQO 4X1IA 3HR0A 2A3QA 3DC5A 5EZYA 4YY3B 2AZ2A 1NTMH 3STLC 2IH3C 3CEIA 5TISZ 3K5LA 5HFLA 2YXYA 1Q6HA 1F23A 2CDYA 1WPBA 2GHYA 5A2QN 1S5LZ 1BHAA 2KB1A 1KECA 4FK5C 3SYOA 1D2DA 2Q67A 1SQFA 4I4TB 2ARHA 4JI4B 3H1IH 1Q86W 3D8CA 1EM1A 1OCZB 3B77A 2WLMA 1EFRG 3IAYA 3KKYA 2NR5A 1B3QA 1H2SB 1FXHA 5BR8O 3ABKB 2YEVB 2R9RB 1ZTEA 2A79B 2EX3A 1B6QA 1YTFD 3QTCA 4LF8B 3K06A 4ZKIA 3KCYA 1L0NH 2ZE6A 3K3WA 1BCCH 2DMXA 3MHSC 3NXSA 5IJ0A 5JH7B 2Z0AA 4H33A 3E8GA 4FLTA 4W4LA 4FMTA 4J41A 3JSNA 4PA3A 4JI4O 4CS3A 5IWAB 5KAIZ 4MW3A 4X65B 1NR7A 1EN5A 4NTYA 5DEDA 1RM1B 1Q6IA 1VQ9V 4NR1A 3A0RA 3SPGA 2Q68A 4JV5O 2Q7EA 2LFSA 1P7GA 2YIAA 3SPCA 3C90A 3K57A 1PV0A 4IHJB 1NZ6A 4LF8O 4LBEC 3DGEA 3CCJV 4TV8B 1NVPD 4CS2A 2A9HA 1Q8IA 1JA8A 1Y76A 5CN0A 3KG2A 3ZN1A 1YJ9V 1ZL8B 2XTAA 1TGOA 1XMOB 2Q6AA 1V9PA 3RYCA 3SJBC 4DV4B 2AW9A 5H6RA 2Q7GA 1DF4A 3GWOA 2P67A 4O2AA 2EZOA 2CGOA 3C3TA 4I0XA 4WFFA 4ABMA 3QO5A 1FXKA 3JAWB 4D7TA 2Y69B 1P84F 5K1XA 1X59A 2R9AA 4LF6B 1IZ3A 5E1AC 4OPHA 2YXLA 4MT8A 2DWEC 1QU7A 3BFRA 3SPHA 3L72H 4EFEA 5CA1A 4CH3A 1SZXA 3ABLB 2LGWA 5KHKA 1JJ2U 4J7KA 2IM9A 4XDLA 2DOSA 3A0BZ 1WN7A 4X64B 1V54B 3VOUA 4JI0B 4J80A 1XMOO 2Y0PA 4GX1A 3K5NA 4LWSB 4X20B 4DV4O 5L3CA 1YITV 4MVUA 1SQVH 2L6LA 2VQFB 4MTFA 5JJNB 1K73W 5LMNB 2WLLA 4YIPA 3ZMTA 1YVWA 1P7BA 3JCZA 5LXTA 3E2EA 3HKBB 1P49A 3WU2Z 4LF6O 3LDEA 2XNDG 3N2KB 1GN3A 2K9PA 1NTKH 5EZYB 1MG1A 1A32A 1FPOA 4CH6A 2FMLA 4LH6A 1M57B 1SQBH 4QJFB 4DR5O 2XAQA 1N33B 2LQTA 1BMFG 5JJEB 3UT5A 3W7SA 3ZIAG 2UUBB 1YI2V 5GONA 4AI8A 4MVOA 2QSAA 2BE3A 4J7JA 4NYKA 2RCVA 3OM3B 1L1FA 3G80A 4IYHA 4R7CA 1F7YA 2CH7A 2VQFO 5B1BB 2AHZA 2UXXA 4X62B 2WSSG 1KP2A 1XOUA 3ZCCA 4JTDB 1K5QA 2EIMC 3AEIA 4NTWA 3ZRXA 3OW2U 1KD1W 4O4LA 1RP3B 4JI5O 3UCSC 1HR0O 2UXBO 5FPOA 3N2GA 5CB4B 5D5QA 2QWOB 2D3OW 1NS1A 2OIGA 4UCOA 1BT8A 1MZFA 4P9OA 4FLZA 2UUBO 4MTXA 5FNVA 3SJAC 1H2LA 1BE3H 5IY5B 3ETDA 5LYJA 3QO7A 4HNAA 1QVGU 3E22B 3ZHUA 1HNZO 1YF2A 2PI5A 4AHCA 2DN9A 1QLEB 2GV9A 4E4EA 2QWPB 4KXRA 5LGUA 2QTOA 3O9OA 4QGPA 1YIJV 1PL0A 4L87A 2PY5A 3E8HA 2FKXA 1VP7A 3A2FA 1WA8A 1M4UA 1NI8A 1P4RA 5BZBA 3QO8A 4DRXA 5LP6C 3L74H 1XEQA 2P4VA 2HP8A 5H2FZ 1BS3A 1Y74A 4RUFA 1XL6A 2HLDG 2XUMA 3OEEG 1TAEA 2HHHB 1HWYA 1H8HG 4L8JA 1Z5WA 2LO1A 4I0XB 3STZC 5H5NA 2E76B 5D5PA 3AG2C 3SYQA 5EIBD 4JAUA 4GKKO 3R66A 2HEPA 1L0LH 1O9GA 2X6BA 3TK1A 3ICXA 5FL7G 2YS8A 2HVKC 5CA1B 1YZBA 1M56C 4WF9V 4LFCB 5CMUA 4LFAB 3SPJA 2WPDG 3FYIB 3HB3B 2OCCC 4TUYA 2HHHO 5C8YA 3M99B 2XAJA 3X2QC 1OCRB 2JJ2G 2JRIA 2IJIA 3FX7A 3H1KH 5LXTB 3JALB 4G28B 1W0KG 3K0DA 2CTQA 5CA3A 1AROP 3AG1C 4FM2A 1B06A 4GX2A 2BTQA 4FLVA 3AG3C 1HNWB 1VF5B 5L3FA 3CRCA 1S77D 4X1YA 1WNSA 5CBGA 3UT5B 3LSUA 3CXHF 1J95A 4BW9A 1K9MW 2JVDA 2A0LA 1XI1A 1RPRA 2CGNA 2N05A 2CH7B 3N27A 1BGYH 4B3SB 2JEUA 1AP6A 1M5IA 2ODMA 1JMKC 4PDMA 1K92A 3IC7A 1TVKB 1SS3A 3LSQA 3RT3C 3BVOA 4DR7B 4X8AA 1XL4A 4I4TA 2WLJA 1R1BA 1HNWO 4DW0A 4KUMA 4H13B 1M9NA 1LUVA 2BOCC 4GT1A 3THOA 3ZEDA 1ENVA 3U11A 5FNVB 4CBCA 1N34B 2IH1C 1AR4A 2RNBA 2YEVA 3BAAA 2QGNA 5LYJB 3OUSA 4HNAB 1NH2D 4DXWA 1SETA 1ROPA 1H2MA 2BSKA 5L3EA 1SQGA 3VQYA 4YXWG 1SQXH 4RAIA 4BAYA 2ZIOA 4K0KO 3HKEB 1WA8B 3TJTA 2GTAA 4DV6B 5L3GA 4LC1A 4DRXB 5DN6G 3MD0A 3ZHSA 3CSXA 4JI1B 4JTAB 2EINB 1Y74B 3ETGA 4NVPA 4JYYA 1RSOA 1Z5VA 3ZN0A 4JI3B 4KFMA 1GKFA 4PHZA 1CPYA 1COWG 4DV0B 5DECA 4IHJA 1Q7YW 4AQYB 5H6QA 1GM7A 3SGIA 4LFBB 4FFKA 5JCOC 1H2GA 2O57A 2ZNJA 5DM6V 2Z5UA 2E5LB 3JARA 1S5HC 3JATB 1YHQV 1FAFA 1FXKC 3IFXA 4DV5O 5K1PA 4K8ZA 4DV6O 3VQWA 2PF4E 4B3TO 1Q81W 5BXZA 2OYQA 2F43G 3L73H 4JYAB 4XBFA 4NB5A 2RN9A 4CC5A 2Q8VA 2OCHA 4DV2B 4LF7B 1IURA 4JI3O 4TUYB 5C8YB 3BPZA 1PNMA 4DV0O 1QR8A 1IBLB 1AI5A 4MTOA 1EBOA 4MVMA 4TQFA 2E5LO 3JCUZ 4C7UA 3B8NA 3BRCA 3FD9A 1VQOV 4GLXA 4PA7A 3CC2V 3K5OA 1OJHA 3ZX6A 4D6TH 3RYHB 1XNRB 1GRJA 4LWSA 2BTQB 3RFRA 4R8CA 4X1YB 3ETQA 2N04A 5IYZB 5BY1A 2E74B 2UUCB 2IU0A 4DV2O 2XAHA 1YTFB 3GVMA 4LF7O 1ZAUA 2QR4A 2F66C 4GKJB 2QM8A 4U3JB 1AI7A 3N2KA 3QG5A 5IYDO 3T1YB 2GUZA 1W59A 3D36C 2H3OA 5JVDB 4ZHQB 5HFMA 3FB7C 3RVZA 1XQ8A 2PI4A 3CRMA 4B3RO 3EXAA 4UCRA 5BMVA 3B4SA 3G6EV 1EN4A 3RYIA 4RQFA 3ABMC 2UXDB 2ITCC 3CPWU 1Q5OA 1I94O 4FLYA 1L8DA 3WB0A 1Q3EA 3OTFA 2N74A 3I5DA 1QCEA 5L3DA 4B7EA 4JI7B 1ZLZA 2UUCO 2DYRB 5EC2C 4JI6B 2IJJA 1NVPB 5GW7A 4DR3B 2ZDIC 2QA4V 3EHBB 2UXNA 4FVMA 4PDRA 4IIJA 3T1YO 3FB5C 4LF9B 4YY3O 3CC4V 2DQ3A 2JGDB 2BSKB 4FZ1A 3B2EE 3MHHC 5CB4A 1MMMA 5EBLC 4P9PA 5KUMA 2KG7B 3H1JH 2QWQB 1XNQB 1LUWA 3R65A 1AJNA 4EB6A 3CRRA 2QE7G 1KP3A 2VWJA 3E22A 2R70A 3BABA 3ASNB 4OGQB 1LNQA 1PP9H 1KU9A 5LBQA 3M7MX 3OMNB 1MSDA 3W7TA 1RFYA 1SERA 1RSOB 4U7NA 3ZHQA 4LF5B 1H38A 1BSMA 1AR5A 2M6YA 3FB8C 5B3SC 4LF9O 1Q43A 4QE7A 1THZA 1G8MA 3JARB 1JPXA 2YSUB 3LDCA 3GB7C 1XDCA 1KC8W 2QJ1A 2P7TC 3MDSA 1G6UA 1KKDA 4B3MB 1O9HA 3AK2A 3ZS8C 5C93A 4HAMA 5IWAO 4KHPB 3DXRA 3WG7B 1AI4A 4X65O 1R6NA 3H1HH 4ZI7B 2DYSB 2W0FC 4DO2A 1TA8A 1N4CA 2VWKA 3GWKC 1AILA 4K35A 4TV9A 1IBMB 5IT9N 2WLKA 3RN4A 3F7YC 1T5EA 2EIKB 2K1EA 4DV3B 1PD3A 1W2BU 1EZVH 2YI9A 2ZE7A 3RW0A 1VQ7V 4RO2A 1IVSA 4BIUA 2QKSA 3P32A 4K3AA 2ETNA 2FL4A 1U96A 3E8FA 4JF3A 2F4VB 3CMEV 4X9QA 4KHPO 2ZM6B 1SZTA 3ASOB 4BIZA 1QR9A 1OV9A 4K8XA 3SYCA 3JALA 3E8BA 2P90A 4DR6B 3AG4C 2BTOA 5E79Z 2GUZB 2F95B 2FYUH 4DV3O 4UCVA 1CXZB 4LH7A 3ZJZA 1PNLA 2V1DA 3PJSK 2AZ0A 2UXCB 5BMVB 3BCCH 4JASA 5CA0A 1E1QG 2X7RB 4QNHB 3RYIB 2XAFA 4EKWA 2OWOA 4X64O 1DK1A 4JI0O 1VF6A 2Y4TA 4D7SA 3T4DA 4JPRA 3WFVA 3ABUA 3QVNA 5LMNO 2JK5C 1OCZC 2LW7A 4LP8A 2ZD9A 5B66Z 2QM7A 2DQ0A 5B1AB 2Q73A 3L70H 2WAMA 4DR6O 1TVKA 2EILB 4IIJB 1J5EB 3ABKC 3WB2A 3APQA 1YJWV 1KB9F 4J10A 2UXCO 1N33O 4R50A 5F2VO 1UFIA 5FLXN 1VQNV 2VS0A 2W6IG 1MABG 1LR1A 1PKXA 4EB6B 4CS4A 3KCXA 1H2KA 4HYOA 1VQKV 4MVQA 4PD4F 1OCCB 3VBBA 4X62O 5ITZA 2UU9B 3BY6A 1JX9A 2AGAA 4UVBA 2F1MA 2OIEA 2HVJC 3CMAV 3FAVB 5LA6B 1RM1C 4DW1A 3HKEA 3ZHVA 1F4NA 2JGUA 1Y6XA 3ZMVA 3UM7A 4PDLA 3AG7A 5LGNA 1XUQA 1AP5A 2JS5A 1AJPA 1S76D 4XDKA 1W0JG 5JQGB 4KP4A 4N23A 3ZBHA 1V55B 3PN1A 4PI0A 3DXRB 4J9ZB 2JIZG 1GM8A 4N21A 1K33A 2KKWA 3O65A 2UU9O 4DV7B 4GZRB 4TSFG 4TV9B 3JATA 3K9SA 5LOVB 2Y69C 1VQPV 3G6BA 3K79A 5EBMC 3UQ8A 5EC1C 2RDCA 4UCUA 4LNUB 3ABLC 2GDSA 2HFEC 2NNUA 2LGQA 1XILA 4WFEA 1WJZA 2ZR2A 3AK3A 1N8RW 4F6EA 3ZMZA 4WBNA 1V54C 4I5SA 3K0GA 3T4ZA 2YUAA 4JAVA 3G71V 1XHXA 1SKVA 2G38A 4CC6A 2EIJB 1OCOB 3H1LH 1I5YA 1NBMG 1OZ0A 1SF9A 3F5TA 4I7ZB 3H9VA 2NLJC 1DF5A 1GN4A 2FB5A 1FD9A 1MSWD 4UCTA 2UUAB 3RYHA 4WFHA 4FZ0A 2JEXA 4DUZB 4LFCO 1GAXA 2ZXWB 2JDIG 1H8EG 5IYZA 4LFAO 5CA0B 3MAQA 4I55B 4JGSA 1M57C 5KX5B 3SR2C 2P4KA 1NH2B 3ABTA 4FLXA 1SESA 3A8TA 4U3JA 1VQ8V 4F6RB 2HKOA 3CCLV 4DR4B 2HJFC 2WLIA 1IX9A 1GK9A 3RBZA 5JVDA 2QDOA 3E89A 3TETA 4ZHQA 5IJ9B 3HPLC 3L75H 3VQVA 5EK0A 1FXVA 2ZR3A 4X1KB 5B1BC 1M90W 1HNXB 4J42A 1VIBA 3CJHA 4DK1A 3BHPA 4DV1B 2E3CA 2UUAO 3JD0A 3P3PA 4FFBA 2B1GA 1E79G 4EFBA 3JSLA 4A5UB 4P2ZA 4GCZA 1AB3A 4JYCA 2D2CB 2RJZA 4WFGA 3M8AA 1ORQC 4O4JA 2ZCEA 4YJ2A 3OD4A 2IJHA 2XASA 5J2TB 3KZIZ 5IY5C 3BEHA 2JGDA 4O4HA 1IBKB 5ITZB 4B3SO 2ZE8A 2YI8A 3T2MA 4DR1B 5EIBC 4G2KA 1QLEC 2KG7A 5L3BA 2V4DA 2W0XA 4FPPA 1K34A 2Q4PA 3TCUA 4PV1B 1YXBA 4O4IB 1VQLV 3CCMV 4DR7O 1ZUQA 3W7UA 1N32B 1SA0A 2YIBD 1R3JC 4PA4A 2IU3A 4Z1VA 4ZIBA 1PL4A 2H8PC 2CE4A 2X0LA 4NXMB 4H44B 1N34O 5LMUB 1WP7A 4JI2B 1TUBA 2P06A 3JAMN 1M93A 1I08A 1JQ0A 3ZHRA 2X6AA 5FPRA 4LR3A 2QTSA 2LJ2A 5EYPB 3S3XA 3BA8A 1IBKO 1FKAO 4DR1O 1QHTA 1WP8A 4ZBMA 2Q9LA 2A06H 5LP6A 3F7VC 2PYLA 2YDEA 4B08A 3DC6A 4DR2B 2KSDA 2QM4A 3LSSA 5KMGA 1XBLA 4JI1O 2B9ZA 2LFRA 4HBNA 1XREA 2ZINA 5LHGA 4ZI7A 4WCEV 4NXMO 4FIPC 1YSCA 3B8MA 2AXTZ 3JD2A 1K5SA 4WBNB 2EULA 5A9GA 2IW5A 1D5NA 2XAGA 4AQYO 1GM9A 2F23A 1I0HA 3IGAC 4I50B 4LFBO 4QPJA 1OCRC 5KA5A 1IDSA 4UXNA 3K04A 1XMQB 1HP8A 3RYFB 1K8AW 4I9QA 1FFXB 1SQPH 4DUYB 3OMIB 4DR2O 3ETEA 4JYAO 1N36B 2CTPA 4R6ZA 1PPJH 2P6JA 1I5XA 1K7DA 3OMAB 4JI8B 2CTWA 4O2BB 1K4DC 1R3KC 1GTOA 1YCIA 3W7WA 4U7OA 2WLIB 1IBLO 3SJQC 3OTOB 2RQ6A 3U0ZA 1R73A 1VEWA 4EEQA 2KQXA 1K3EA 1VF7A 3APOA 4LCUC 3CJHB 4MVSA 1F51A 4FFBB 2DWDC 1XNRO 4JZGA 4CH4A 4DUYO 1YEWA 3UKMA 4YJ3A 4UV9A 3WB1A 4ICGA 2P5OA 4GX5A 1X4TA 1N36O 1BL8A 1KUQA 3SJCC 2WA4A 1CP9A 4BR6A 4JI8O 4O4JB 2BOBC 4GKJO 4YJ2B 1JFFA 2YC0A 2QKCA 3OGIB 1SC5B 5J2UA 3SDLA 3ML0A 1NQTA 2EJRA 3OFNG 4CZZA 4O4HB 3OTOO 1CEZA 3T1CA 1VQ4V 2EIMB 4JV5B 1US6A 3CWBH 5JJJB 3ZMSA 4UFZA 4ASUG 2UXDO 1EN6A 1SA0B 2ZE5A 2PYJA 3K03A 5IYCO 3ZHTA 2EINC 4JI7O 4OPAA 4BW5A 4QE9A 4WFBV 4RQEA 2LW1A 2WLHA 4JI6O 3FAVA 5LA6A 4DR3O 1TUBB 3K58A 2ZNIA 2YIDA 1AR1B 1HR0B 1Y66A 1Z2GA 3CCRV 4NKGB 2VRZA 4JAAA 3RWRD 3W7XA 2OTLV 3CP1A 4W4KA 4PI2A 3FKSG 5LP6B 1XNQO 3CHXA 1IXMA 1H2NA 3JASA 5JQGA 3CRAA 2EZPA 1MZEA 1MOFA 5KMGB 1D5AA 4MVRA 1SQQH 3E86A 1KKCA 1BQZA 3LNMB 1BHBA 2RMKB 1VQMV 4LF5O 2W6JG 3OR6C 2ZQMA 4MSWC 5IE9A 4PJ0Z 5LOVA 5JCOA 1ZSPA 5B1OA 3RGBA 3AG2B 4JTCB 3CCQV 5GTIZ 1Q90D 1K4CC 4LNUA 5B5EZ 1N0JA 1M56B 5KUKA 3OUFA 5KA6A 2ADQB 1DLBA 4UUJC 3I55V 4MVZA 1NU1H 4B3MO 4I9WA 2Q0AA 3HKCA 4DR5B 1UPGA 2OCCB 4FM1A 1GMGA 1GH6A 3LDDA 3X2QB 1QVFU 4TQDA 3J80N 1IBMO 1S3JA 3IC9A 1Y67A 3FFQA 2FTKA 3ZRSA 4NXNB 2LP7A 3TXSA 1QBZA 2DW4A 2WA3A 2PTMA 2Y48A 4H0LB 2QWNB 2QKAA 3AG1B 4I55A 3CB2A 5KX5A 1FS0G 2YXHA 3E83A 2QWRB 4UCSA 4X1IB 3AG3B 3CX5F 2R9IA 5IDJA 2EBOA 3JD4A 3H01A 1MNGA 4F6RA 4JI5B 3QF7A 2UXBB
chains in the Genus database with same CATH topology
1FPOA 2CTWA 4IT5A 2OCHA 1IURA 2GUZA 2DMXA 2CTRA 2EJ7A 2L6LA 2Y4UA 2LO1A 3BVOA 1HDJA 2CTQA 1FAFA 2QWQB 2QWNB 2LGWA 1NZ6A 2M6YA 3UO3A 1BQ0A 4J7ZA 3AG7A 1WJZA 2N05A 2QSAA 1BQZA 2N04A 2DN9A 2QWRB 1GH6A 2QWPB 2CUGA 3UCSC 2PF4E 2KQXA 2Y4TA 2CTPA 4RWUA 3APQA 2QWOB 1XBLA 2GUZB 3APOA 3UO2A 4J80A 2YS8A 2YUAA 1N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPO A;  2CTW A;  4IT5 A;  2OCH A;  1IUR A;  2GUZ A;  2DMX A;  2CTR A;  2EJ7 A;  2L6L A;  2Y4U A;  2LO1 A;  3BVO A;  1HDJ A;  2CTQ A;  1FAF A;  2QWQ B;  2QWN B;  2LGW A;  1NZ6 A;  2M6Y A;  3UO3 A;  1BQ0 A;  4J7Z A;  3AG7 A;  1WJZ A;  2N05 A;  2QSA A;  1BQZ A;  2N04 A;  2DN9 A;  2QWR B;  1GH6 A;  2QWP B;  2CUG A;  3UCS C;  2PF4 E;  2KQX A;  2Y4T A;  2CTP A;  4RWU A;  3APQ A;  2QWO B;  1XBL A;  2GUZ B;  3APO A;  3UO2 A;  4J80 A;  2YS8 A;  2YUA A;  1N4C A; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  2F4V O;  3NR7 A;  4OXS A;  1AVM A;  2ZM6 O;  3T1H B;  1WAZ A;  5IJ9 A;  5KHJ A;  1QLN A;  2WWW A;  2EJ7 A;  2Q0O C;  4X1K A;  3UO3 A;  1JFF B;  3K08 A;  4TOI A;  2DYR C;  3D36 A;  5J2U B;  1QQC A;  2YIB A;  1B04 A;  1HNZ B;  4NXN O;  4IGG A;  1PM9 A;  4PA6 A;  3CE2 A;  4FLW A;  3E35 A;  1SRY A;  1FYJ A;  3CXC U;  3J81 N;  1EZJ A;  4JZ2 A;  3CCV V;  2AHY A;  3K59 A;  5J2T A;  4TT3 G;  1HW7 A;  2ZIM A;  3AK1 A;  4MTG A;  3T1H O;  1NTZ H;  3ASN C;  5IJ0 B;  1FJG B;  1R6K A;  2DJV A;  4AIL C;  2ZDI A;  5LGT A;  2PZS A;  4PEL A;  1J5E O;  4MS2 A;  3K9A A;  1HDJ A;  4BIO A;  2B5U A;  1BQ0 A;  4O4I A;  2Y0I A;  3G4S V;  1JR9 A;  3CCU V;  1F4M A;  2CUG A;  1WPX A;  5KLV H;  3S3W A;  3UO2 A;  3ZRV A;  4GKK B;  4GUN A;  2H94 A;  3B09 A;  3SYA A;  1ZX3 A;  3JAS B;  5J9P C;  3B40 A;  5B1N A;  2XOK G;  1VQ5 V;  4UB6 Z;  1NT2 B;  1Y76 B;  5EYP A;  5KHG A;  2ATK C;  3WG7 C;  4ZOL A;  1FJG O;  4RWU A;  1VQ6 V;  1M1K W;  5KHI A;  2M7W A;  3RYC B;  2DYS C;  4NTX A;  2A7W A;  3OGC C;  4O2A B;  2GSM B;  2XHB A;  2VQE B;  2EIK C;  2ZKO A;  3VQX A;  1BZK A;  1FXK B;  1K97 A;  2HJD A;  1FFT B;  2OTJ V;  2HG5 C;  4G27 B;  4X89 A;  3DTU B;  2XT9 A;  2B1I A;  3BA9 A;  3JAK A;  1NR1 A;  2WLN A;  2Q7H A;  3CYO A;  3HKC B;  1WB7 A;  4I50 A;  1U97 A;  4J9Y B;  5CBH A;  4Q6G A;  4DV7 O;  1WB8 A;  4HZ3 A;  3ASO C;  5EBW C;  1KYO F;  4PA9 A;  2BCC H;  3RYF A;  4KL1 A;  2NN4 A;  3Q4H A;  4YIO A;  1FFX A;  3LUT B;  3IJ4 A;  1KMI Z;  2VQE O;  3ZMU A;  2WLL B;  1VMG A;  3OAA G;  3D3I A;  4X66 B;  1R3I C;  2MK3 A;  1KQS U;  3OEH G;  3LNN A;  4O2B A;  1PNK A;  1R3L C;  2CAZ C;  1Q82 W;  3HKD A;  3QNE A;  3OR7 C;  1GN2 A;  5CBF A;  3P30 A;  3JD1 A;  4QPK A;  5GON B;  4E2L A;  3CCE V;  4XDJ A;  3ZRW A;  5B1A C;  1NKD A;  4MW8 A;  5LL6 Y;  1WLE A;  2EIL C;  3J7A U;  1YJN V;  1AJQ A;  1GO3 F;  2Z3Y A;  2JJ1 G;  4DUZ O;  5KHH A;  4X66 O;  2ITD C;  2QEX V;  3ABM B;  1N0N A;  4UVA A;  4K0K B;  2P22 C;  3OE7 G;  4U3F H;  4O4L B;  5AG2 A;  4DR4 O;  4DK0 A;  3N2G B;  1G4Y B;  4LF4 B;  4J7Z A;  2X6C A;  2L35 A;  5H9C A;  1OCC C;  1AI6 A;  2IBZ H;  1KBH A;  1QNM A;  4UVC A;  1HNX O;  4IYI A;  1URF A;  3OT7 A;  1VAR A;  1S5J A;  4H37 A;  4IT5 A;  3CCS V;  4DV1 O;  3L71 H;  1S0V A;  2Y4U A;  2GTS A;  3CD6 V;  5LHI A;  4FM0 A;  1XHZ A;  1OHH G;  4Z2W A;  4P30 A;  1I7F A;  5IYB O;  4RUE A;  1S72 V;  1ZWI C;  3EVK A;  2JS3 A;  4Q20 A;  1MA1 A;  4DV5 B;  2C2A A;  5JH7 A;  1TUE B;  4B3T B;  5LHH A;  3FB6 C;  2V7Q G;  1V55 C;  3A0H Z;  4LF4 O;  3I56 V;  3K5M A;  2CTR A;  5KAF Z;  2ZT9 B;  4ZOL B;  3G67 A;  3RVY A;  1GN6 A;  3CS5 A;  5B3S B;  4PDV A;  4YHH B;  4FJC C;  1YDX A;  4WFA V;  4X88 A;  4FLU A;  3TGU H;  5GTH Z;  2ADP A;  1N32 O;  2ILM A;  4TV8 A;  3F5W C;  2E75 B;  4UV8 A;  1Y4M A;  2PUS A;  1IXB A;  1ZL8 A;  5JWP A;  5LMU O;  1NJI W;  2Q69 A;  4JI2 O;  4BWA A;  1UJW B;  3JAK B;  2HR3 A;  3CC7 V;  3JD3 A;  4OX9 B;  1JOY A;  3D3Q A;  2F93 B;  3TXQ A;  1JVM A;  3JAW A;  2EIJ C;  3JYC A;  1OCO C;  4Z1M G;  1R6T A;  1RPO A;  4GYC B;  3U10 A;  1JCH A;  2CK3 G;  3Q4H B;  4JYB A;  4YHH O;  4F4L A;  2YIC A;  3SPI A;  4CH5 A;  3C3S A;  4DYL A;  3FYE B;  2MW2 B;  3P3N A;  4IL6 Z;  3L9D A;  1G1X B;  4B3R B;  4QIW F;  1Q6U A;  2ZXW C;  2DE0 X;  3EFF K;  2IJK A;  4B7K A;  1DGS A;  1JJO A;  4GX0 A;  4X20 A;  1I94 B;  1DTO A;  3HKD B;  2OT5 A;  1VF6 C;  4J11 A;  4UB8 Z;  2GBO A;  2R72 A;  4OX9 O;  3DSQ A;  3AG4 B;  2PGG A;  5BR8 B;  4TWK A;  3CRQ A;  1E1R G;  2Q5Z A;  3SYP A;  3HKB A;  3ZRW B;  1XMQ O;  4X1I A;  3HR0 A;  2A3Q A;  3DC5 A;  5EZY A;  4YY3 B;  2AZ2 A;  1NTM H;  3STL C;  2IH3 C;  3CEI A;  5TIS Z;  3K5L A;  5HFL A;  2YXY A;  1Q6H A;  1F23 A;  2CDY A;  1WPB A;  2GHY A;  5A2Q N;  1S5L Z;  1BHA A;  2KB1 A;  1KEC A;  4FK5 C;  3SYO A;  1D2D A;  2Q67 A;  1SQF A;  4I4T B;  2ARH A;  4JI4 B;  3H1I H;  1Q86 W;  3D8C A;  1EM1 A;  1OCZ B;  3B77 A;  2WLM A;  1EFR G;  3IAY A;  3KKY A;  2NR5 A;  1B3Q A;  1H2S B;  1FXH A;  5BR8 O;  3ABK B;  2YEV B;  2R9R B;  1ZTE A;  2A79 B;  2EX3 A;  1B6Q A;  1YTF D;  3QTC A;  4LF8 B;  3K06 A;  4ZKI A;  3KCY A;  1L0N H;  2ZE6 A;  3K3W A;  1BCC H;  2DMX A;  3MHS C;  3NXS A;  5IJ0 A;  5JH7 B;  2Z0A A;  4H33 A;  3E8G A;  4FLT A;  4W4L A;  4FMT A;  4J41 A;  3JSN A;  4PA3 A;  4JI4 O;  4CS3 A;  5IWA B;  5KAI Z;  4MW3 A;  4X65 B;  1NR7 A;  1EN5 A;  4NTY A;  5DED A;  1RM1 B;  1Q6I A;  1VQ9 V;  4NR1 A;  3A0R A;  3SPG A;  2Q68 A;  4JV5 O;  2Q7E A;  2LFS A;  1P7G A;  2YIA A;  3SPC A;  3C90 A;  3K57 A;  1PV0 A;  4IHJ B;  1NZ6 A;  4LF8 O;  4LBE C;  3DGE A;  3CCJ V;  4TV8 B;  1NVP D;  4CS2 A;  2A9H A;  1Q8I A;  1JA8 A;  1Y76 A;  5CN0 A;  3KG2 A;  3ZN1 A;  1YJ9 V;  1ZL8 B;  2XTA A;  1TGO A;  1XMO B;  2Q6A A;  1V9P A;  3RYC A;  3SJB C;  4DV4 B;  2AW9 A;  5H6R A;  2Q7G A;  1DF4 A;  3GWO A;  2P67 A;  4O2A A;  2EZO A;  2CGO A;  3C3T A;  4I0X A;  4WFF A;  4ABM A;  3QO5 A;  1FXK A;  3JAW B;  4D7T A;  2Y69 B;  1P84 F;  5K1X A;  1X59 A;  2R9A A;  4LF6 B;  1IZ3 A;  5E1A C;  4OPH A;  2YXL A;  4MT8 A;  2DWE C;  1QU7 A;  3BFR A;  3SPH A;  3L72 H;  4EFE A;  5CA1 A;  4CH3 A;  1SZX A;  3ABL B;  2LGW A;  5KHK A;  1JJ2 U;  4J7K A;  2IM9 A;  4XDL A;  2DOS A;  3A0B Z;  1WN7 A;  4X64 B;  1V54 B;  3VOU A;  4JI0 B;  4J80 A;  1XMO O;  2Y0P A;  4GX1 A;  3K5N A;  4LWS B;  4X20 B;  4DV4 O;  5L3C A;  1YIT V;  4MVU A;  1SQV H;  2L6L A;  2VQF B;  4MTF A;  5JJN B;  1K73 W;  5LMN B;  2WLL A;  4YIP A;  3ZMT A;  1YVW A;  1P7B A;  3JCZ A;  5LXT A;  3E2E A;  3HKB B;  1P49 A;  3WU2 Z;  4LF6 O;  3LDE A;  2XND G;  3N2K B;  1GN3 A;  2K9P A;  1NTK H;  5EZY B;  1MG1 A;  1A32 A;  1FPO A;  4CH6 A;  2FML A;  4LH6 A;  1M57 B;  1SQB H;  4QJF B;  4DR5 O;  2XAQ A;  1N33 B;  2LQT A;  1BMF G;  5JJE B;  3UT5 A;  3W7S A;  3ZIA G;  2UUB B;  1YI2 V;  5GON A;  4AI8 A;  4MVO A;  2QSA A;  2BE3 A;  4J7J A;  4NYK A;  2RCV A;  3OM3 B;  1L1F A;  3G80 A;  4IYH A;  4R7C A;  1F7Y A;  2CH7 A;  2VQF O;  5B1B B;  2AHZ A;  2UXX A;  4X62 B;  2WSS G;  1KP2 A;  1XOU A;  3ZCC A;  4JTD B;  1K5Q A;  2EIM C;  3AEI A;  4NTW A;  3ZRX A;  3OW2 U;  1KD1 W;  4O4L A;  1RP3 B;  4JI5 O;  3UCS C;  1HR0 O;  2UXB O;  5FPO A;  3N2G A;  5CB4 B;  5D5Q A;  2QWO B;  2D3O W;  1NS1 A;  2OIG A;  4UCO A;  1BT8 A;  1MZF A;  4P9O A;  4FLZ A;  2UUB O;  4MTX A;  5FNV A;  3SJA C;  1H2L A;  1BE3 H;  5IY5 B;  3ETD A;  5LYJ A;  3QO7 A;  4HNA A;  1QVG U;  3E22 B;  3ZHU A;  1HNZ O;  1YF2 A;  2PI5 A;  4AHC A;  2DN9 A;  1QLE B;  2GV9 A;  4E4E A;  2QWP B;  4KXR A;  5LGU A;  2QTO A;  3O9O A;  4QGP A;  1YIJ V;  1PL0 A;  4L87 A;  2PY5 A;  3E8H A;  2FKX A;  1VP7 A;  3A2F A;  1WA8 A;  1M4U A;  1NI8 A;  1P4R A;  5BZB A;  3QO8 A;  4DRX A;  5LP6 C;  3L74 H;  1XEQ A;  2P4V A;  2HP8 A;  5H2F Z;  1BS3 A;  1Y74 A;  4RUF A;  1XL6 A;  2HLD G;  2XUM A;  3OEE G;  1TAE A;  2HHH B;  1HWY A;  1H8H G;  4L8J A;  1Z5W A;  2LO1 A;  4I0X B;  3STZ C;  5H5N A;  2E76 B;  5D5P A;  3AG2 C;  3SYQ A;  5EIB D;  4JAU A;  4GKK O;  3R66 A;  2HEP A;  1L0L H;  1O9G A;  2X6B A;  3TK1 A;  3ICX A;  5FL7 G;  2YS8 A;  2HVK C;  5CA1 B;  1YZB A;  1M56 C;  4WF9 V;  4LFC B;  5CMU A;  4LFA B;  3SPJ A;  2WPD G;  3FYI B;  3HB3 B;  2OCC C;  4TUY A;  2HHH O;  5C8Y A;  3M99 B;  2XAJ A;  3X2Q C;  1OCR B;  2JJ2 G;  2JRI A;  2IJI A;  3FX7 A;  3H1K H;  5LXT B;  3JAL B;  4G28 B;  1W0K G;  3K0D A;  2CTQ A;  5CA3 A;  1ARO P;  3AG1 C;  4FM2 A;  1B06 A;  4GX2 A;  2BTQ A;  4FLV A;  3AG3 C;  1HNW B;  1VF5 B;  5L3F A;  3CRC A;  1S77 D;  4X1Y A;  1WNS A;  5CBG A;  3UT5 B;  3LSU A;  3CXH F;  1J95 A;  4BW9 A;  1K9M W;  2JVD A;  2A0L A;  1XI1 A;  1RPR A;  2CGN A;  2N05 A;  2CH7 B;  3N27 A;  1BGY H;  4B3S B;  2JEU A;  1AP6 A;  1M5I A;  2ODM A;  1JMK C;  4PDM A;  1K92 A;  3IC7 A;  1TVK B;  1SS3 A;  3LSQ A;  3RT3 C;  3BVO A;  4DR7 B;  4X8A A;  1XL4 A;  4I4T A;  2WLJ A;  1R1B A;  1HNW O;  4DW0 A;  4KUM A;  4H13 B;  1M9N A;  1LUV A;  2BOC C;  4GT1 A;  3THO A;  3ZED A;  1ENV A;  3U11 A;  5FNV B;  4CBC A;  1N34 B;  2IH1 C;  1AR4 A;  2RNB A;  2YEV A;  3BAA A;  2QGN A;  5LYJ B;  3OUS A;  4HNA B;  1NH2 D;  4DXW A;  1SET A;  1ROP A;  1H2M A;  2BSK A;  5L3E A;  1SQG A;  3VQY A;  4YXW G;  1SQX H;  4RAI A;  4BAY A;  2ZIO A;  4K0K O;  3HKE B;  1WA8 B;  3TJT A;  2GTA A;  4DV6 B;  5L3G A;  4LC1 A;  4DRX B;  5DN6 G;  3MD0 A;  3ZHS A;  3CSX A;  4JI1 B;  4JTA B;  2EIN B;  1Y74 B;  3ETG A;  4NVP A;  4JYY A;  1RSO A;  1Z5V A;  3ZN0 A;  4JI3 B;  4KFM A;  1GKF A;  4PHZ A;  1CPY A;  1COW G;  4DV0 B;  5DEC A;  4IHJ A;  1Q7Y W;  4AQY B;  5H6Q A;  1GM7 A;  3SGI A;  4LFB B;  4FFK A;  5JCO C;  1H2G A;  2O57 A;  2ZNJ A;  5DM6 V;  2Z5U A;  2E5L B;  3JAR A;  1S5H C;  3JAT B;  1YHQ V;  1FAF A;  1FXK C;  3IFX A;  4DV5 O;  5K1P A;  4K8Z A;  4DV6 O;  3VQW A;  2PF4 E;  4B3T O;  1Q81 W;  5BXZ A;  2OYQ A;  2F43 G;  3L73 H;  4JYA B;  4XBF A;  4NB5 A;  2RN9 A;  4CC5 A;  2Q8V A;  2OCH A;  4DV2 B;  4LF7 B;  1IUR A;  4JI3 O;  4TUY B;  5C8Y B;  3BPZ A;  1PNM A;  4DV0 O;  1QR8 A;  1IBL B;  1AI5 A;  4MTO A;  1EBO A;  4MVM A;  4TQF A;  2E5L O;  3JCU Z;  4C7U A;  3B8N A;  3BRC A;  3FD9 A;  1VQO V;  4GLX A;  4PA7 A;  3CC2 V;  3K5O A;  1OJH A;  3ZX6 A;  4D6T H;  3RYH B;  1XNR B;  1GRJ A;  4LWS A;  2BTQ B;  3RFR A;  4R8C A;  4X1Y B;  3ETQ A;  2N04 A;  5IYZ B;  5BY1 A;  2E74 B;  2UUC B;  2IU0 A;  4DV2 O;  2XAH A;  1YTF B;  3GVM A;  4LF7 O;  1ZAU A;  2QR4 A;  2F66 C;  4GKJ B;  2QM8 A;  4U3J B;  1AI7 A;  3N2K A;  3QG5 A;  5IYD O;  3T1Y B;  2GUZ A;  1W59 A;  3D36 C;  2H3O A;  5JVD B;  4ZHQ B;  5HFM A;  3FB7 C;  3RVZ A;  1XQ8 A;  2PI4 A;  3CRM A;  4B3R O;  3EXA A;  4UCR A;  5BMV A;  3B4S A;  3G6E V;  1EN4 A;  3RYI A;  4RQF A;  3ABM C;  2UXD B;  2ITC C;  3CPW U;  1Q5O A;  1I94 O;  4FLY A;  1L8D A;  3WB0 A;  1Q3E A;  3OTF A;  2N74 A;  3I5D A;  1QCE A;  5L3D A;  4B7E A;  4JI7 B;  1ZLZ A;  2UUC O;  2DYR B;  5EC2 C;  4JI6 B;  2IJJ A;  1NVP B;  5GW7 A;  4DR3 B;  2ZDI C;  2QA4 V;  3EHB B;  2UXN A;  4FVM A;  4PDR A;  4IIJ A;  3T1Y O;  3FB5 C;  4LF9 B;  4YY3 O;  3CC4 V;  2DQ3 A;  2JGD B;  2BSK B;  4FZ1 A;  3B2E E;  3MHH C;  5CB4 A;  1MMM A;  5EBL C;  4P9P A;  5KUM A;  2KG7 B;  3H1J H;  2QWQ B;  1XNQ B;  1LUW A;  3R65 A;  1AJN A;  4EB6 A;  3CRR A;  2QE7 G;  1KP3 A;  2VWJ A;  3E22 A;  2R70 A;  3BAB A;  3ASN B;  4OGQ B;  1LNQ A;  1PP9 H;  1KU9 A;  5LBQ A;  3M7M X;  3OMN B;  1MSD A;  3W7T A;  1RFY A;  1SER A;  1RSO B;  4U7N A;  3ZHQ A;  4LF5 B;  1H38 A;  1BSM A;  1AR5 A;  2M6Y A;  3FB8 C;  5B3S C;  4LF9 O;  1Q43 A;  4QE7 A;  1THZ A;  1G8M A;  3JAR B;  1JPX A;  2YSU B;  3LDC A;  3GB7 C;  1XDC A;  1KC8 W;  2QJ1 A;  2P7T C;  3MDS A;  1G6U A;  1KKD A;  4B3M B;  1O9H A;  3AK2 A;  3ZS8 C;  5C93 A;  4HAM A;  5IWA O;  4KHP B;  3DXR A;  3WG7 B;  1AI4 A;  4X65 O;  1R6N A;  3H1H H;  4ZI7 B;  2DYS B;  2W0F C;  4DO2 A;  1TA8 A;  1N4C A;  2VWK A;  3GWK C;  1AIL A;  4K35 A;  4TV9 A;  1IBM B;  5IT9 N;  2WLK A;  3RN4 A;  3F7Y C;  1T5E A;  2EIK B;  2K1E A;  4DV3 B;  1PD3 A;  1W2B U;  1EZV H;  2YI9 A;  2ZE7 A;  3RW0 A;  1VQ7 V;  4RO2 A;  1IVS A;  4BIU A;  2QKS A;  3P32 A;  4K3A A;  2ETN A;  2FL4 A;  1U96 A;  3E8F A;  4JF3 A;  2F4V B;  3CME V;  4X9Q A;  4KHP O;  2ZM6 B;  1SZT A;  3ASO B;  4BIZ A;  1QR9 A;  1OV9 A;  4K8X A;  3SYC A;  3JAL A;  3E8B A;  2P90 A;  4DR6 B;  3AG4 C;  2BTO A;  5E79 Z;  2GUZ B;  2F95 B;  2FYU H;  4DV3 O;  4UCV A;  1CXZ B;  4LH7 A;  3ZJZ A;  1PNL A;  2V1D A;  3PJS K;  2AZ0 A;  2UXC B;  5BMV B;  3BCC H;  4JAS A;  5CA0 A;  1E1Q G;  2X7R B;  4QNH B;  3RYI B;  2XAF A;  4EKW A;  2OWO A;  4X64 O;  1DK1 A;  4JI0 O;  1VF6 A;  2Y4T A;  4D7S A;  3T4D A;  4JPR A;  3WFV A;  3ABU A;  3QVN A;  5LMN O;  2JK5 C;  1OCZ C;  2LW7 A;  4LP8 A;  2ZD9 A;  5B66 Z;  2QM7 A;  2DQ0 A;  5B1A B;  2Q73 A;  3L70 H;  2WAM A;  4DR6 O;  1TVK A;  2EIL B;  4IIJ B;  1J5E B;  3ABK C;  3WB2 A;  3APQ A;  1YJW V;  1KB9 F;  4J10 A;  2UXC O;  1N33 O;  4R50 A;  5F2V O;  1UFI A;  5FLX N;  1VQN V;  2VS0 A;  2W6I G;  1MAB G;  1LR1 A;  1PKX A;  4EB6 B;  4CS4 A;  3KCX A;  1H2K A;  4HYO A;  1VQK V;  4MVQ A;  4PD4 F;  1OCC B;  3VBB A;  4X62 O;  5ITZ A;  2UU9 B;  3BY6 A;  1JX9 A;  2AGA A;  4UVB A;  2F1M A;  2OIE A;  2HVJ C;  3CMA V;  3FAV B;  5LA6 B;  1RM1 C;  4DW1 A;  3HKE A;  3ZHV A;  1F4N A;  2JGU A;  1Y6X A;  3ZMV A;  3UM7 A;  4PDL A;  3AG7 A;  5LGN A;  1XUQ A;  1AP5 A;  2JS5 A;  1AJP A;  1S76 D;  4XDK A;  1W0J G;  5JQG B;  4KP4 A;  4N23 A;  3ZBH A;  1V55 B;  3PN1 A;  4PI0 A;  3DXR B;  4J9Z B;  2JIZ G;  1GM8 A;  4N21 A;  1K33 A;  2KKW A;  3O65 A;  2UU9 O;  4DV7 B;  4GZR B;  4TSF G;  4TV9 B;  3JAT A;  3K9S A;  5LOV B;  2Y69 C;  1VQP V;  3G6B A;  3K79 A;  5EBM C;  3UQ8 A;  5EC1 C;  2RDC A;  4UCU A;  4LNU B;  3ABL C;  2GDS A;  2HFE C;  2NNU A;  2LGQ A;  1XIL A;  4WFE A;  1WJZ A;  2ZR2 A;  3AK3 A;  1N8R W;  4F6E A;  3ZMZ A;  4WBN A;  1V54 C;  4I5S A;  3K0G A;  3T4Z A;  2YUA A;  4JAV A;  3G71 V;  1XHX A;  1SKV A;  2G38 A;  4CC6 A;  2EIJ B;  1OCO B;  3H1L H;  1I5Y A;  1NBM G;  1OZ0 A;  1SF9 A;  3F5T A;  4I7Z B;  3H9V A;  2NLJ C;  1DF5 A;  1GN4 A;  2FB5 A;  1FD9 A;  1MSW D;  4UCT A;  2UUA B;  3RYH A;  4WFH A;  4FZ0 A;  2JEX A;  4DUZ B;  4LFC O;  1GAX A;  2ZXW B;  2JDI G;  1H8E G;  5IYZ A;  4LFA O;  5CA0 B;  3MAQ A;  4I55 B;  4JGS A;  1M57 C;  5KX5 B;  3SR2 C;  2P4K A;  1NH2 B;  3ABT A;  4FLX A;  1SES A;  3A8T A;  4U3J A;  1VQ8 V;  4F6R B;  2HKO A;  3CCL V;  4DR4 B;  2HJF C;  2WLI A;  1IX9 A;  1GK9 A;  3RBZ A;  5JVD A;  2QDO A;  3E89 A;  3TET A;  4ZHQ A;  5IJ9 B;  3HPL C;  3L75 H;  3VQV A;  5EK0 A;  1FXV A;  2ZR3 A;  4X1K B;  5B1B C;  1M90 W;  1HNX B;  4J42 A;  1VIB A;  3CJH A;  4DK1 A;  3BHP A;  4DV1 B;  2E3C A;  2UUA O;  3JD0 A;  3P3P A;  4FFB A;  2B1G A;  1E79 G;  4EFB A;  3JSL A;  4A5U B;  4P2Z A;  4GCZ A;  1AB3 A;  4JYC A;  2D2C B;  2RJZ A;  4WFG A;  3M8A A;  1ORQ C;  4O4J A;  2ZCE A;  4YJ2 A;  3OD4 A;  2IJH A;  2XAS A;  5J2T B;  3KZI Z;  5IY5 C;  3BEH A;  2JGD A;  4O4H A;  1IBK B;  5ITZ B;  4B3S O;  2ZE8 A;  2YI8 A;  3T2M A;  4DR1 B;  5EIB C;  4G2K A;  1QLE C;  2KG7 A;  5L3B A;  2V4D A;  2W0X A;  4FPP A;  1K34 A;  2Q4P A;  3TCU A;  4PV1 B;  1YXB A;  4O4I B;  1VQL V;  3CCM V;  4DR7 O;  1ZUQ A;  3W7U A;  1N32 B;  1SA0 A;  2YIB D;  1R3J C;  4PA4 A;  2IU3 A;  4Z1V A;  4ZIB A;  1PL4 A;  2H8P C;  2CE4 A;  2X0L A;  4NXM B;  4H44 B;  1N34 O;  5LMU B;  1WP7 A;  4JI2 B;  1TUB A;  2P06 A;  3JAM N;  1M93 A;  1I08 A;  1JQ0 A;  3ZHR A;  2X6A A;  5FPR A;  4LR3 A;  2QTS A;  2LJ2 A;  5EYP B;  3S3X A;  3BA8 A;  1IBK O;  1FKA O;  4DR1 O;  1QHT A;  1WP8 A;  4ZBM A;  2Q9L A;  2A06 H;  5LP6 A;  3F7V C;  2PYL A;  2YDE A;  4B08 A;  3DC6 A;  4DR2 B;  2KSD A;  2QM4 A;  3LSS A;  5KMG A;  1XBL A;  4JI1 O;  2B9Z A;  2LFR A;  4HBN A;  1XRE A;  2ZIN A;  5LHG A;  4ZI7 A;  4WCE V;  4NXM O;  4FIP C;  1YSC A;  3B8M A;  2AXT Z;  3JD2 A;  1K5S A;  4WBN B;  2EUL A;  5A9G A;  2IW5 A;  1D5N A;  2XAG A;  4AQY O;  1GM9 A;  2F23 A;  1I0H A;  3IGA C;  4I50 B;  4LFB O;  4QPJ A;  1OCR C;  5KA5 A;  1IDS A;  4UXN A;  3K04 A;  1XMQ B;  1HP8 A;  3RYF B;  1K8A W;  4I9Q A;  1FFX B;  1SQP H;  4DUY B;  3OMI B;  4DR2 O;  3ETE A;  4JYA O;  1N36 B;  2CTP A;  4R6Z A;  1PPJ H;  2P6J A;  1I5X A;  1K7D A;  3OMA B;  4JI8 B;  2CTW A;  4O2B B;  1K4D C;  1R3K C;  1GTO A;  1YCI A;  3W7W A;  4U7O A;  2WLI B;  1IBL O;  3SJQ C;  3OTO B;  2RQ6 A;  3U0Z A;  1R73 A;  1VEW A;  4EEQ A;  2KQX A;  1K3E A;  1VF7 A;  3APO A;  4LCU C;  3CJH B;  4MVS A;  1F51 A;  4FFB B;  2DWD C;  1XNR O;  4JZG A;  4CH4 A;  4DUY O;  1YEW A;  3UKM A;  4YJ3 A;  4UV9 A;  3WB1 A;  4ICG A;  2P5O A;  4GX5 A;  1X4T A;  1N36 O;  1BL8 A;  1KUQ A;  3SJC C;  2WA4 A;  1CP9 A;  4BR6 A;  4JI8 O;  4O4J B;  2BOB C;  4GKJ O;  4YJ2 B;  1JFF A;  2YC0 A;  2QKC A;  3OGI B;  1SC5 B;  5J2U A;  3SDL A;  3ML0 A;  1NQT A;  2EJR A;  3OFN G;  4CZZ A;  4O4H B;  3OTO O;  1CEZ A;  3T1C A;  1VQ4 V;  2EIM B;  4JV5 B;  1US6 A;  3CWB H;  5JJJ B;  3ZMS A;  4UFZ A;  4ASU G;  2UXD O;  1EN6 A;  1SA0 B;  2ZE5 A;  2PYJ A;  3K03 A;  5IYC O;  3ZHT A;  2EIN C;  4JI7 O;  4OPA A;  4BW5 A;  4QE9 A;  4WFB V;  4RQE A;  2LW1 A;  2WLH A;  4JI6 O;  3FAV A;  5LA6 A;  4DR3 O;  1TUB B;  3K58 A;  2ZNI A;  2YID A;  1AR1 B;  1HR0 B;  1Y66 A;  1Z2G A;  3CCR V;  4NKG B;  2VRZ A;  4JAA A;  3RWR D;  3W7X A;  2OTL V;  3CP1 A;  4W4K A;  4PI2 A;  3FKS G;  5LP6 B;  1XNQ O;  3CHX A;  1IXM A;  1H2N A;  3JAS A;  5JQG A;  3CRA A;  2EZP A;  1MZE A;  1MOF A;  5KMG B;  1D5A A;  4MVR A;  1SQQ H;  3E86 A;  1KKC A;  1BQZ A;  3LNM B;  1BHB A;  2RMK B;  1VQM V;  4LF5 O;  2W6J G;  3OR6 C;  2ZQM A;  4MSW C;  5IE9 A;  4PJ0 Z;  5LOV A;  5JCO A;  1ZSP A;  5B1O A;  3RGB A;  3AG2 B;  4JTC B;  3CCQ V;  5GTI Z;  1Q90 D;  1K4C C;  4LNU A;  5B5E Z;  1N0J A;  1M56 B;  5KUK A;  3OUF A;  5KA6 A;  2ADQ B;  1DLB A;  4UUJ C;  3I55 V;  4MVZ A;  1NU1 H;  4B3M O;  4I9W A;  2Q0A A;  3HKC A;  4DR5 B;  1UPG A;  2OCC B;  4FM1 A;  1GMG A;  1GH6 A;  3LDD A;  3X2Q B;  1QVF U;  4TQD A;  3J80 N;  1IBM O;  1S3J A;  3IC9 A;  1Y67 A;  3FFQ A;  2FTK A;  3ZRS A;  4NXN B;  2LP7 A;  3TXS A;  1QBZ A;  2DW4 A;  2WA3 A;  2PTM A;  2Y48 A;  4H0L B;  2QWN B;  2QKA A;  3AG1 B;  4I55 A;  3CB2 A;  5KX5 A;  1FS0 G;  2YXH A;  3E83 A;  2QWR B;  4UCS A;  4X1I B;  3AG3 B;  3CX5 F;  2R9I A;  5IDJ A;  2EBO A;  3JD4 A;  3H01 A;  1MNG A;  4F6R A;  4JI5 B;  3QF7 A;  2UXB B; 
#chains in the Genus database with same CATH homology
 1FPO A;  2CTW A;  4IT5 A;  2OCH A;  1IUR A;  2GUZ A;  2DMX A;  2CTR A;  2EJ7 A;  2L6L A;  2Y4U A;  2LO1 A;  3BVO A;  1HDJ A;  2CTQ A;  1FAF A;  2QWQ B;  2QWN B;  2LGW A;  1NZ6 A;  2M6Y A;  3UO3 A;  1BQ0 A;  4J7Z A;  3AG7 A;  1WJZ A;  2N05 A;  2QSA A;  1BQZ A;  2N04 A;  2DN9 A;  2QWR B;  1GH6 A;  2QWP B;  2CUG A;  3UCS C;  2PF4 E;  2KQX A;  2Y4T A;  2CTP A;  4RWU A;  3APQ A;  2QWO B;  1XBL A;  2GUZ B;  3APO A;  3UO2 A;  4J80 A;  2YS8 A;  2YUA A;  1N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...