1GH6A

Retinoblastoma pocket complexed with sv40 large t antigen
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
SHMREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large T antigen
publication title Structural basis for the inactivation of retinoblastoma tumor suppressor by SV40 large T antigen.
pubmed doi rcsb
source organism Simian virus 40
molecule tags Antitumor protein
total genus 23
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.-:
pdb deposition date 2000-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1gh6A01
2CTQA 3UO2A 2LGWA 4J7ZA 2CUGA 2CTWA 2QWQB 2QWOB 2L6LA 2KQXA 2YS8A 1IURA 2M6YA 2QWPB 1XBLA 2DN9A 2LO1A 2Y4UA 2QSAA 1FPOA 2QWNB 1NZ6A 2CTRA 1BQ0A 3BVOA 4IT5A 2CTPA 2DMXA 3UO3A 2GUZA 2N04A 2YUAA 2QWRB 3APQA 2GUZB 1GH6A 1FAFA 3UCSC 2EJ7A 1WJZA 1HDJA 1N4CA 3APOA 4J80A 4RWUA 1BQZA 2OCHA 3AG7A 2Y4TA 2N05A 2PF4E
chains in the Genus database with same CATH superfamily
1VQ6V 1QR8A 4YJ3A 1M57C 3U0ZA 1R1BA 3I55V 2M6YA 1XBLA 2ZIOA 3HB3B 2FTKA 1MZEA 3RYHB 2OWOA 1NKDA 1EN4A 3MDSA 2WLNA 2GHYA 3CRMA 3X2QB 3ZMUA 2LFSA 1SQVH 2VRZA 4IHJA 2UXNA 4X89A 4RQEA 1MA1A 1QVFU 2BTQB 2ADPA 1EFRG 4N23A 2UU9B 3LDCA 5HFMA 4K35A 4MS2A 5FL7G 1K73W 5CA0A 4W4LA 4PV1B 4FM0A 3KG2A 1IXMA 4YIPA 5BR8O 2P6JA 3R65A 4X62B 1XNQO 4JI1B 1VF6A 4GX1A 4DV0O 4PI0A 3ZRSA 1K33A 5FLXN 3ZEDA 3ZMVA 3B8MA 4U3JB 2P4VA 4X1YB 4IHJB 1BE3H 1QLEC 3ZS8C 5LGTA 2CUGA 2LJ2A 2XUMA 1XOUA 1PPJH 4JPRA 4P30A 1LNQA 1YF2A 3IC9A 2QDOA 2QWRB 1XHXA 3CEIA 3N2GB 4UVAA 1R3JC 2CE4A 2OT5A 3ZMZA 2UXCB 2G38A 3W7TA 5JWPA 2WLHA 2C2AA 2OIEA 3ASNB 4AQYO 4FIPC 5L3DA 1JPXA 2XAJA 5DEDA 2VQFB 3ETGA 1AJQA 4B3TB 5J2TA 1GM8A 1H8EG 2QTSA 1HNWB 1Q86W 5LHGA 1OCZB 5L3EA 2WLIA 3ZIAG 4DV1O 4LF9B 4WFEA 3NR7A 1F7YA 1IBLB 3CJHA 4FLWA 3AG4B 1L8DA 1F4NA 3Q4HA 4FZ1A 4ABMA 3RVYA 1H38A 1EN5A 5LXTA 1R6TA 1RSOA 4BAYA 5J2TB 4MVZA 1Y6XA 1BL8A 3E22A 1HR0B 2WLIB 3CRQA 3VBBA 3M99B 3AK1A 3CJHB 3TXSA 4DV4O 1FXKA 4DR2O 4QJFB 1FFXA 3Q4HB 3ABKB 3ASOC 1EN6A 4MVQA 2ODMA 1SA0A 1PNMA 3D36C 5LXTB 4D7SA 3CX5F 1RSOB 3OR6C 1HDJA 1EM1A 5LP6A 1F23A 3X2QC 1XI1A 5BR8B 4DUZB 1N33O 1XNQB 4BW9A 1QU7A 5C93A 3CHXA 1FXKB 1NH2D 1FFXB 2L35A 4PA4A 3W7UA 2P5OA 4CH3A 2JDIG 1Q82W 1SA0B 4I50A 5KMGA 4B3SO 2N04A 3RW0A 5FNVA 2HJDA 4P9PA 3AG7A 5LP6B 1SZTA 3JYCA 1YEWA 2AZ2A 4CH5A 1A32A 1SQBH 3EFFK 2ARHA 2UXDO 4R6ZA 2FYUH 3E83A 3T1CA 3J80N 3P30A 1WN7A 2GUZA 2NNUA 1GM9A 4I50B 1B04A 1XUQA 4H37A 2IBZH 5FNVB 2JS3A 4MVRA 2PF4E 5IJ9B 3VQXA 1PKXA 3K03A 2P90A 3JD1A 2HJFC 4DV1B 1VF6C 3K06A 2XT9A 4LF7O 4LH6A 3QO7A 1Z5WA 3AG1B 4DK0A 2FL4A 1YI2V 1M4UA 2H8PC 4X88A 4QIWF 1US6A 2ZINA 3SYQA 4DR5O 2GUZB 3MHHC 2Y0IA 5CN0A 4RWUA 1GRJA 4JI7O 2ZE8A 1LUVA 2QR4A 1Y66A 1JJOA 1T5EA 4NKGB 1OCRC 4TUYA 3JCUZ 1R3LC 1N36O 4CH6A 4OPAA 3R66A 3W7WA 2Y69B 5CA1A 2QSAA 3CWBH 2EBOA 4GX5A 2WLMA 2D2CB 4GKKB 4DUYO 5LYJA 1QNMA 2QE7G 5J9PC 5H6QA 3LSQA 4DV3O 1ZAUA 2HR3A 4DR7B 3K5MA 5IYBO 3KCYA 1BCCH 3EHBB 3OD4A 3CSXA 3VQVA 3D8CA 3ZJZA 1HNZB 1N33B 5CA1B 4FM1A 3WG7C 3CXHF 1KQSU 1GN4A 4OX9O 5AG2A 5L3GA 3L73H 3APOA 1SQQH 2PI4A 5LYJB 1JX9A 1J5EO 2R72A 4GZRB 5K1XA 3UKMA 4H0LB 2QM7A 4J10A 3JARB 3MHSC 1LUWA 4IT5A 1FXKC 4H33A 2JVDA 3ZHVA 1WA8A 3L71H 4ICGA 2RJZA 1TA8A 2WAMA 1VQPV 3J7AU 1V54B 2E76B 4YJ2A 1FJGO 5H5NA 1RPOA 5LP6C 2CTWA 4LNUB 1XHZA 3ETEA 4ZI7A 4LF8O 4AI8A 1DTOA 4O4JA 4UCVA 2WA4A 2Z3YA 2X7RB 1I5YA 3OMAB 4ZOLB 2PY5A 4LF7B 1NBMG 4O4HA 2EILB 2UUBO 1WA8B 3ICXA 1DLBA 4LFAO 1S0VA 3MD0A 2DW4A 3FB6C 1Q6UA 3DXRA 3UO2A 1Y67A 2JJ2G 4AILC 1N34O 1OJHA 3E86A 1OV9A 2JEXA 3HPLC 2LW7A 3CCQV 1N36B 4O4JB 2BTOA 2P4KA 3P3PA 1DK1A 3AG1C 4I4TA 3A0BZ 2A0LA 1NT2B 3PJSK 4TV8B 4O4HB 1VF7A 3SPGA 4DUYB 1VQ9V 3HKEB 1XILA 3FB5C 3DXRB 2ZQMA 4NVPA 1HWYA 1N32O 5GTIZ 1H8HG 2Y69C 2YUAA 1WP8A 2BOCC 2JEUA 2ZE5A 1NU1H 3ABTA 2ETNA 4I4TB 3JD0A 1G8MA 4MVSA 1N0JA 3AG2B 1SC5B 2AHYA 3QF7A 5EBWC 2VQEB 3OW2U 2IM9A 5JQGA 4JI5O 1WP7A 1M9NA 2WPDG 1IBMO 2UUCB 4D7TA 4UCRA 2Q7EA 3CCEV 4KFMA 1BHAA 5KA5A 1KBHA 2HP8A 3CCLV 1GMGA 4XDJA 1AILA 4ZHQA 3LNMB 3TXQA 3SPIA 5B1BB 2YXHA 4Q6GA 1H2KA 3ABLC 3CXCU 3VQWA 4JI3B 1UPGA 5JQGB 3SGIA 3DTUB 4UVBA 4X1IB 3LNNA 1IBKB 4LF8B 2AGAA 2P67A 5LMNO 4DR4B 3JSLA 4DR6O 1SQGA 3K58A 1BGYH 4BR6A 2IW5A 2X0LA 4ZHQB 5D5QA 1YITV 2FB5A 1GO3F 4O2BA 4WCEV 1EZJA 3T4ZA 5LOVA 1ZX3A 2Z5UA 5KUKA 1QLEB 2H94A 3ZMTA 4J9ZB 4UB8Z 1R73A 1P7BA 4PA9A 1P4RA 3K3WA 3STZC 3VQYA 2AW9A 3FB8C 4O2BB 3W7SA 4TQFA 1VQ7V 4F6RA 1G4YB 3RN4A 3O9OA 1N32B 3BAAA 3EXAA 4WBNA 3P32A 1SQFA 3OGCC 4I7ZB 3ZRWA 4K3AA 2OTLV 5BZBA 1GTOA 1PL0A 1NZ6A 2ZR3A 3F7YC 5LGNA 4CH4A 4JYAO 4NXMB 3CC7V 4JI5B 4NXNO 2X6AA 1NR7A 3E35A 3UM7A 3A0RA 2A06H 2F4VB 4QE7A 3UQ8A 3L9DA 1MSWD 4WBNB 2UXXA 1S5JA 4CC5A 3ZN1A 5IWAB 3AG2C 1NTKH 4MTGA 4DV2O 5F2VO 4PJ0Z 1AROP 2GTAA 3RBZA 3H9VA 2R70A 2BE3A 4UCOA 3ZRVA 1XNRO 1I08A 1R3IC 2A7WA 3QTCA 2B5UA 3RYCA 1IXBA 2HEPA 3F5TA 3SDLA 1VIBA 3JAWA 2R9IA 5GW7A 2ZXWB 3SYCA 1K8AW 5JJNB 2XAQA 4DR6B 2DE0X 3OMIB 4XDKA 5B1BC 4XDLA 3T1YO 4EEQA 1YXBA 4K0KO 4JI2O 5B5EZ 2R9RB 2Q8VA 2QM8A 1MG1A 3RYCB 1SS3A 5LA6A 1NH2B 1GKFA 3WFVA 2F66C 4RQFA 4BWAA 2X6CA 4YJ3B 4ZIBA 5DN6G 4TV9A 5JCOA 1K5SA 2HKOA 1SRYA 2EZOA 4DYLA 1L0LH 3ZHSA 3BHPA 3BFRA 3B09A 4GUNA 1VQ8V 5H2FZ 2EINC 4G27B 2EZPA 2EIMC 4DW0A 1PNLA 1SKVA 3QO5A 2W0FC 4DO2A 3IGAC 5D5PA 3A8TA 4TV9B 1F51A 3GVMA 1V9PA 4UV9A 4JI4O 5CA0B 3APQA 1VQNV 1JA8A 3JAMN 1I94O 2EIJC 1FXHA 2ZD9A 5HFLA 1F4MA 3PN1A 4FLTA 4J42A 1H2NA 3CRRA 2A9HA 1Q7YW 1KKDA 1UJWB 1BS3A 4YHHB 1KU9A 3SJQC 2XAGA 4X65B 2Y4UA 1WNSA 5IYCO 1YJWV 1GN3A 1SETA 3C3TA 2YC0A 3CS5A 5H6RA 1VEWA 2FMLA 3K9SA 1KP2A 1JVMA 1OCRB 4KHPO 4DV2B 4MVMA 1XNRB 1VQ5V 1VQLV 2N74A 3K9AA 4DV6O 5E1AC 1K4CC 3H1IH 2JS5A 5KHHA 5LL6Y 1D5NA 3ML0A 1TGOA 4LH7A 5GONA 3MAQA 4MW8A 4IGGA 1O9HA 4WFHA 2XAHA 4N21A 4DV7O 5IYZA 1TAEA 4K0KB 4JI2B 1JQ0A 3WG7B 3RYIA 5B3SC 5KX5A 2ZXWC 5IDJA 3SJBC 4X64O 3G80A 2JGDA 5GONB 1URFA 4O4IA 1SZXA 3BCCH 3E22B 1XMQO 1YZBA 5CBFA 1Q90D 1VF5B 4DV0B 1QVGU 3L70H 5IYZB 2QWPB 4UXNA 2PZSA 4EKWA 2V7QG 4C7UA 3RYIB 1GN6A 1B06A 2GDSA 1SESA 1Q81W 1B6QA 4TQDA 4HAMA 1K4DC 1JCHA 1OZ0A 1YJ9V 2JGDB 3D3QA 5IJ0A 3SJCC 4I5SA 5CA3A 3N27A 1GK9A 1MABG 1I94B 3RWRD 2E5LO 3S3WA 5LBQA 5CB4A 5CBHA 4HBNA 4AQYB 3THOA 2ITCC 1M90W 4U3FH 2F95B 2DQ3A 2GTSA 2DOSA 5KMGB 3B8NA 4XBFA 3CMEV 5JCOC 5KHJA 1MMMA 4R8CA 1Q3EA 2QJ1A 2KG7A 2CTQA 4B7KA 4K8XA 1MOFA 1EBOA 1OCOC 3RGBA 4FJCC 4GKJO 5LMUO 2HLDG 2QWNB 3ZHRA 3STLC 3OTOO 2DWDC 5CB4B 2W6IG 2WLJA 2PGGA 2AXTZ 1PNKA 3T1HO 2ZIMA 4Z1MG 2VS0A 2IH1C 1Q8IA 2KG7B 4B3RO 4TOIA 3SPJA 5DECA 4EB6A 3EVKA 4LF5O 3CCMV 4TSFG 2JJ1G 4DV4B 4DR2B 2Z0AA 1BT8A 2YEVA 4FFBA 3JATA 3FX7A 4JV5O 4FZ0A 1JR9A 4WFGA 4X64B 3NXSA 4LCUC 4TT3G 3KKYA 4TUYB 1FKAO 4DR1O 1NJIW 2DN9A 1XMQB 1KUQA 3IAYA 2ZNIA 4EB6B 5JVDA 1M93A 2K9PA 1CPYA 3K0GA 2YEVB 2V1DA 4B3SB 4FFBB 4DV5O 3ABLB 1DF4A 1N0NA 1THZA 4F6EA 3OAAG 1Z2GA 4J9YB 4Q20A 3F5WC 5JVDB 2UXDB 1P84F 2E5LB 3RYFA 3ZRXA 5JJEB 3BEHA 2RMKB 4H13B 3SPHA 3CCJV 3UT5A 4QPKA 1ZL8A 2LGWA 4I55A 5KA6A 3OUFA 2P7TC 2E74B 3B40A 1Y4MA 2ZNJA 1XMOO 4LP8A 1OCCB 4X20A 3A2FA 4X9QA 3H01A 2H3OA 2X6BA 2GV9A 5B1AB 2E75B 4PELA 5TISZ 3B2EE 1S76D 1NVPD 1W2BU 1BSMA 2OTJV 4L8JA 3JD2A 1W59A 3RYFB 3CYOA 4GT1A 4DR5B 3H1HH 1RFYA 3QVNA 2YIDA 4YJ2B 3UT5B 4JI7B 1R6NA 1ZL8B 4QNHB 1M5IA 4UUJC 4KL1A 4ZI7B 2RNBA 1NQTA 1S5LZ 1QLNA 4B3RB 2ZM6O 4RUFA 4LF5B 5B66Z 2YXYA 2ZCEA 4LR3A 5EC2C 3TK1A 4JZGA 4J41A 2YSUB 4JASA 1TVKA 1S72V 2ZT9B 1YJNV 4JZ2A 1AVMA 1E1QG 4JI6O 1AP6A 2EJRA 4PA3A 1D2DA 4DV3B 1CXZB 2MW2B 2BOBC 4DR1B 1ZWIC 3AEIA 4Z1VA 4PI2A 3JALA 2HVKC 3G6BA 3HKCA 2B1IA 3G6EV 4LF4O 1NTZH 4OX9B 1NTMH 1I0HA 3KZIZ 1TVKB 5BY1A 1I7FA 1J5EB 2JRIA 2WA3A 1K7DA 2HHHO 3LSUA 2ZE6A 3W7XA 2HVJC 1WB7A 1FAFA 3UCSC 1KYOF 3ETDA 4MTOA 3K59A 1AB3A 3BA8A 4WFBV 3JALB 3AK2A 3HKCB 4UCUA 5KAFZ 4NTXA 4NYKA 2NR5A 4LF6O 1K92A 2ILMA 2JK5C 5L3CA 4X66O 2Q4PA 1FJGB 4X8AA 5C8YA 3TJTA 2UXBO 3T4DA 1XMOB 3GWOA 3J81N 3TGUH 5CBGA 4LFCO 2UUBB 2IJKA 1OHHG 4PHZA 4LFAB 1FS0G 2DYSB 4JF3A 4LC1A 2EINB 3K0DA 2KB1A 2CH7A 2OCCC 3CP1A 1OCCC 5C8YB 1N34B 2EIMB 4LWSA 3OEHG 4UFZA 3ZX6A 5B1AC 4O4LA 3LUTB 1IDSA 2B1GA 2EX3A 3GWKC 5KHKA 1DGSA 3BPZA 2Q73A 3HR0A 3QNEA 2CTRA 5KAIZ 3I5DA 5KUMA 4I9WA 1MZFA 2EIJB 4B08A 4OPHA 3OT7A 4JI6B 2AHZA 2UU9O 2CH7B 4JI8O 5A2QN 1AJPA 4LWSB 5LOVB 2LW1A 1PM9A 2CGOA 2XAFA 4O4LB 1AR5A 2JIZG 1H2LA 2L6LA 2ZE7A 4GX2A 4UCTA 5FPRA 4X62O 2RQ6A 3CRAA 4JI1O 2QA4V 4G2KA 1L1FA 4PD4F 1YTFB 2Q9LA 4JYYA 4I9QA 2QKAA 4QE9A 2DJVA 4LFBO 1N4CA 4WF9V 1H2GA 3ZHUA 4B7EA 2Y4TA 5EYPA 2CGNA 4F6RB 1IBMB 3N2KA 4ZBMA 3SJAC 4EFEA 1VARA 5B1NA 1TUBA 2Y0PA 4PDLA 3ZN0A 1S77D 2UXCO 4DR3O 1NI8A 3QO8A 4JGSA 3ZRWB 1VQMV 2P22C 3UO3A 4LF6B 2HG5C 4J80A 2VQFO 2Q67A 2Q7HA 2QKSA 4X66B 1WB8A 4B3TO 5EYPB 3FFQA 3IFXA 1K97A 1HNWO 2F93B 2QWQB 4G28B 4WFAV 5LMNB 5B3SB 3OUSA 3N2KB 4LF9O 1FPOA 4BW5A 1TUBB 4FLVA 1IBLO 3B4SA 4LFCB 5L3FA 2XOKG 2IU3A 1RM1C 4PDRA 3CCSV 3P3NA 2BTQA 4PA7A 4JTAB 2KKWA 1I5XA 4GYCB 4J7JA 4U7NA 4A5UB 1NS1A 4J7ZA 1K9MW 4JTDB 3JAWB 1AR1B 1RP3B 4CS4A 3SYOA 1HR0O 2IH3C 3ZHTA 3OTFA 1SQPH 3SYPA 3AG3C 4JYBA 1YDXA 1WJZA 2PUSA 4U3JA 4X1YA 3O65A 2DYSC 4CZZA 1COWG 2GBOA 2N05A 2IJJA 1H2MA 2YI9A 2A3QA 2QM4A 1CEZA 2Q6AA 2YI8A 5EC1C 2QWOB 5EBMC 4MT8A 4JI8B 5LA6B 4KP4A 2RCVA 2F43G 2DYRB 3N2GA 5KHGA 4BIOA 4DUZO 1N8RW 3FAVA 2NN4A 4WFFA 4X1KA 3WB0A 2Q0OC 2A79B 3FYIB 4JYAB 1OCOB 4LFBB 4Z2WA 4NXNB 4R7CA 2HFEC 1QHTA 2LFRA 4DK1A 4NB5A 4E4EA 2PI5A 1YTFD 1DF5A 4OXSA 1W0KG 4JYCA 3FAVB 4DR3B 5LHIA 2OCHA 2MK3A 1H2SB 4X1KB 4QGPA 2GSMB 3IJ4A 4F4LA 4IYIA 1P49A 3A0HZ 5DM6V 1MSDA 3E8FA 4UVCA 1U96A 2BCCH 1X4TA 1S5HC 4PDMA 3SYAA 3DC6A 4ZKIA 1E1RG 4PDVA 5A9GA 1G1XB 4DW1A 4HNAA 5EBLC 3B77A 4EFBA 5IE9A 1YVWA 2PYJA 3T1YB 2ZDIA 1JJ2U 1R3KC 2EIKC 1WAZA 4U7OA 3HKDA 1BQ0A 1UFIA 3FYEB 1Q6HA 1Q5OA 3FKSG 3OM3B 2VWJA 1WLEA 3C90A 1V55B 1J95A 1BZKA 2Q5ZA 3LDEA 3SPCA 3L72H 1QR9A 4HNAB 4CS3A 2LQTA 2OIGA 4FVMA 2M7WA 1ZUQA 1XDCA 2ADQB 3OEEG 4GKKO 4JTCB 1IX9A 4QPJA 1GN2A 1PP9H 3BRCA 2XASA 3FB7C 3L75H 4MW3A 3HKDB 1ENVA 3JSNA 5EIBD 4DR7O 5KX5B 4CC6A 5H9CA 3OE7G 5EIBC 3CPWU 1IZ3A 1K5QA 3CB2A 5IT9N 3BABA 4MVUA 3LSSA 1HNZO 4JI4B 1R6KA 4O4IB 2R9AA 4YIOA 2F23A 2F1MA 3U11A 1Z5VA 5BMVA 3M8AA 4DRXA 4RUEA 4JAUA 4FLXA 1XEQA 4JAVA 1FXVA 3RT3C 2E3CA 1NVPB 4NR1A 2DYRC 2EJ7A 5IY5B 2V4DA 5IJ9A 3FD9A 2CAZC 1CP9A 2BSKA 1AI5A 5IJ0B 1YCIA 4KHPB 4HZ3A 2KSDA 3CCUV 3LDDA 5BMVB 4AHCA 3CE2A 4KXRA 4RO2A 4DRXB 1QQCA 2RN9A 4NTYA 1TUEB 1Y74A 2IU0A 1GH6A 2QEXV 4B3MO 1WPXA 3K57A 4DV6B 1JFFA 3ZBHA 5EZYA 1XQ8A 2BSKB 2YIBA 3ASNC 3I56V 1HNXO 4FLUA 2IJIA 4DV7B 5KLVH 3TCUA 3K08A 1GM7A 3E8BA 1D5AA 1Y74B 3HKBA 1PV0A 1OCZC 1AI4A 2YDEA 5GTHZ 4J7KA 3GB7C 1JOYA 2VWKA 1JFFB 1KMIZ 3AG4C 3K5OA 5EZYB 1Q6IA 2LGQA 3OGIB 1KC8W 3E2EA 2AZ0A 4PA6A 1KKCA 3S3XA 2Q0AA 1RPRA 3VOUA 1NR1A 1VQ4V 3K5NA 3HKBB 1V55C 1GAXA 1PL4A 2K1EA 4E2LA 4FM2A 3JATB 3K5LA 3JARA 3M7MX 1QBZA 1P7GA 3ABKC 1E79G 4LBEC 3BVOA 1Y76A 4GCZA 1YIJV 3ABUA 2ZDIC 4NTWA 3CCRV 1K34A 5KHIA 2VQEO 3E8GA 2O57A 2WLLA 4LNUA 1ZTEA 3ABMB 2QTOA 4DXWA 2ITDC 2UUCO 1KB9F 4O2AA 4ZOLA 2OCCB 1M56B 1Y76B 4GKJB 5LMUB 3K79A 4D6TH 3OTOB 2Q68A 4K8ZA 1B3QA 4JI3O 5IY5C 2WLLB 1SQXH 4BIZA 4B3MB 1ORQC 1IBKO 4DR4O 1KP3A 2DQ0A 4I55B 2LO1A 3T1HB 2UUAO 2XNDG 4O2AB 3OR7C 3ZMSA 3WB2A 1M1KW 3E8HA 3C3SA 1VP7A 3QG5A 4TV8A 4X20B 1HNXB 4UB6Z 1JMKC 3HKEA 3D3IA 3CD6V 1WPBA 5FPOA 5L3BA 3DGEA 2KQXA 4IIJA 5IYDO 1ROPA 3H1LH 4JV5B 1U97A 2CTPA 3BA9A 1IVSA 1AP5A 1YHQV 3RVZA 1BQZA 1FYJA 2JGUA 1AI6A 2YICA 2CDYA 2DWEC 3JD3A 2ATKC 5EK0A 2LP7A 3T2MA 4JI0O 2W0XA 1IURA 4FMTA 4IIJB 4FK5C 4MSWC 4DV5B 4P2ZA 1PD3A 2YIBD 4GX0A 1ZLZA 4FPPA 1BHBA 2XHBA 3AK3A 3JAKA 2NLJC 3KCXA 1Q43A 1YSCA 2IJHA 3CRCA 1K3EA 3OFNG 4NXMO 5JJJB 4UCSA 4X1IA 3JD4A 4MVOA 1AR4A 2XTAA 2F4VO 3H1JH 2CK3G 4P9OA 1FD9A 1RM1B 4YY3O 2ZR2A 4L87A 1M57B 3K04A 1VQOV 5IWAO 5K1PA 3JAKB 3WU2Z 1X59A 1G6UA 5LGUA 4JAAA 3ABMC 2EULA 3AG3B 5E79Z 1BMFG 3RFRA 3ZHQA 3CC2V 2YXLA 5JH7A 4FFKA 3DSQA 2Q69A 3JASA 4TWKA 2UUAB 1O9GA 1VMGA 3SR2C 1M56C 5B1OA 3E89A 3ETQA 5ITZA 2ZM6B 4H44B 5BXZA 1V54C 3G4SV 2OYQA 2YS8A 4CS2A 1KD1W 2DMXA 5LHHA 3BY6A 2D3OW 5JH7B 1W0JG 4ASUG 3G71V 4IL6Z 3G67A 2WLKA 1L0NH 3JASB 1MNGA 2WWWA 4I0XA 3OMNB 2EILC 2QKCA 2PTMA 5ITZB 4FLZA 2W6JG 5J2UA 4UV8A 2Y48A 4IYHA 4J11A 3ZCCA 4LF4B 4YXWG 4KUMA 3CC4V 1FFTB 4JI0B 1LR1A 1SF9A 3U10A 1HP8A 5CMUA 1XL6A 2QGNA 4FLYA 4HYOA 1HW7A 2HHHB 4MTXA 4GLXA 3DC5A 1XREA 4I0XB 1SERA 1XL4A 4RAIA 5J2UB 3L74H 1AI7A 3TETA 4YHHO 3IC7A 2P06A 4X65O 3H1KH 2Q7GA 4OGQB 4W4KA 2FKXA 3CMAV 4BIUA 2ZKOA 1QCEA 4YY3B 2UXBB 2EIKB 2YIAA 3D36A 4CBCA 3RYHA 4R50A 3JCZA 3WB1A 2RDCA 1AJNA 1EZVH 3CCVV 1VQKV 2B9ZA 1S3JA 4MTFA 2PYLA 3ASOB 3F7VC 1KECA 1ZSPA 2WSSG
chains in the Genus database with same CATH topology
2CTQA 3UO2A 2LGWA 4J7ZA 2CUGA 2CTWA 2QWQB 2QWOB 2L6LA 2KQXA 2YS8A 1IURA 2M6YA 2QWPB 1XBLA 2DN9A 2LO1A 2Y4UA 2QSAA 1FPOA 2QWNB 1NZ6A 2CTRA 1BQ0A 3BVOA 4IT5A 2CTPA 2DMXA 3UO3A 2GUZA 2N04A 2YUAA 2QWRB 3APQA 2GUZB 1GH6A 1FAFA 3UCSC 2EJ7A 1WJZA 1HDJA 1N4CA 3APOA 4J80A 4RWUA 1BQZA 2OCHA 3AG7A 2Y4TA 2N05A 2PF4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  3UO2 A;  2LGW A;  4J7Z A;  2CUG A;  2CTW A;  2QWQ B;  2QWO B;  2L6L A;  2KQX A;  2YS8 A;  1IUR A;  2M6Y A;  2QWP B;  1XBL A;  2DN9 A;  2LO1 A;  2Y4U A;  2QSA A;  1FPO A;  2QWN B;  1NZ6 A;  2CTR A;  1BQ0 A;  3BVO A;  4IT5 A;  2CTP A;  2DMX A;  3UO3 A;  2GUZ A;  2N04 A;  2YUA A;  2QWR B;  3APQ A;  2GUZ B;  1GH6 A;  1FAF A;  3UCS C;  2EJ7 A;  1WJZ A;  1HDJ A;  1N4C A;  3APO A;  4J80 A;  4RWU A;  1BQZ A;  2OCH A;  3AG7 A;  2Y4T A;  2N05 A;  2PF4 E; 
#chains in the Genus database with same CATH topology
 1VQ6 V;  1QR8 A;  4YJ3 A;  1M57 C;  3U0Z A;  1R1B A;  3I55 V;  2M6Y A;  1XBL A;  2ZIO A;  3HB3 B;  2FTK A;  1MZE A;  3RYH B;  2OWO A;  1NKD A;  1EN4 A;  3MDS A;  2WLN A;  2GHY A;  3CRM A;  3X2Q B;  3ZMU A;  2LFS A;  1SQV H;  2VRZ A;  4IHJ A;  2UXN A;  4X89 A;  4RQE A;  1MA1 A;  1QVF U;  2BTQ B;  2ADP A;  1EFR G;  4N23 A;  2UU9 B;  3LDC A;  5HFM A;  4K35 A;  4MS2 A;  5FL7 G;  1K73 W;  5CA0 A;  4W4L A;  4PV1 B;  4FM0 A;  3KG2 A;  1IXM A;  4YIP A;  5BR8 O;  2P6J A;  3R65 A;  4X62 B;  1XNQ O;  4JI1 B;  1VF6 A;  4GX1 A;  4DV0 O;  4PI0 A;  3ZRS A;  1K33 A;  5FLX N;  3ZED A;  3ZMV A;  3B8M A;  4U3J B;  2P4V A;  4X1Y B;  4IHJ B;  1BE3 H;  1QLE C;  3ZS8 C;  5LGT A;  2CUG A;  2LJ2 A;  2XUM A;  1XOU A;  1PPJ H;  4JPR A;  4P30 A;  1LNQ A;  1YF2 A;  3IC9 A;  2QDO A;  2QWR B;  1XHX A;  3CEI A;  3N2G B;  4UVA A;  1R3J C;  2CE4 A;  2OT5 A;  3ZMZ A;  2UXC B;  2G38 A;  3W7T A;  5JWP A;  2WLH A;  2C2A A;  2OIE A;  3ASN B;  4AQY O;  4FIP C;  5L3D A;  1JPX A;  2XAJ A;  5DED A;  2VQF B;  3ETG A;  1AJQ A;  4B3T B;  5J2T A;  1GM8 A;  1H8E G;  2QTS A;  1HNW B;  1Q86 W;  5LHG A;  1OCZ B;  5L3E A;  2WLI A;  3ZIA G;  4DV1 O;  4LF9 B;  4WFE A;  3NR7 A;  1F7Y A;  1IBL B;  3CJH A;  4FLW A;  3AG4 B;  1L8D A;  1F4N A;  3Q4H A;  4FZ1 A;  4ABM A;  3RVY A;  1H38 A;  1EN5 A;  5LXT A;  1R6T A;  1RSO A;  4BAY A;  5J2T B;  4MVZ A;  1Y6X A;  1BL8 A;  3E22 A;  1HR0 B;  2WLI B;  3CRQ A;  3VBB A;  3M99 B;  3AK1 A;  3CJH B;  3TXS A;  4DV4 O;  1FXK A;  4DR2 O;  4QJF B;  1FFX A;  3Q4H B;  3ABK B;  3ASO C;  1EN6 A;  4MVQ A;  2ODM A;  1SA0 A;  1PNM A;  3D36 C;  5LXT B;  4D7S A;  3CX5 F;  1RSO B;  3OR6 C;  1HDJ A;  1EM1 A;  5LP6 A;  1F23 A;  3X2Q C;  1XI1 A;  5BR8 B;  4DUZ B;  1N33 O;  1XNQ B;  4BW9 A;  1QU7 A;  5C93 A;  3CHX A;  1FXK B;  1NH2 D;  1FFX B;  2L35 A;  4PA4 A;  3W7U A;  2P5O A;  4CH3 A;  2JDI G;  1Q82 W;  1SA0 B;  4I50 A;  5KMG A;  4B3S O;  2N04 A;  3RW0 A;  5FNV A;  2HJD A;  4P9P A;  3AG7 A;  5LP6 B;  1SZT A;  3JYC A;  1YEW A;  2AZ2 A;  4CH5 A;  1A32 A;  1SQB H;  3EFF K;  2ARH A;  2UXD O;  4R6Z A;  2FYU H;  3E83 A;  3T1C A;  3J80 N;  3P30 A;  1WN7 A;  2GUZ A;  2NNU A;  1GM9 A;  4I50 B;  1B04 A;  1XUQ A;  4H37 A;  2IBZ H;  5FNV B;  2JS3 A;  4MVR A;  2PF4 E;  5IJ9 B;  3VQX A;  1PKX A;  3K03 A;  2P90 A;  3JD1 A;  2HJF C;  4DV1 B;  1VF6 C;  3K06 A;  2XT9 A;  4LF7 O;  4LH6 A;  3QO7 A;  1Z5W A;  3AG1 B;  4DK0 A;  2FL4 A;  1YI2 V;  1M4U A;  2H8P C;  4X88 A;  4QIW F;  1US6 A;  2ZIN A;  3SYQ A;  4DR5 O;  2GUZ B;  3MHH C;  2Y0I A;  5CN0 A;  4RWU A;  1GRJ A;  4JI7 O;  2ZE8 A;  1LUV A;  2QR4 A;  1Y66 A;  1JJO A;  1T5E A;  4NKG B;  1OCR C;  4TUY A;  3JCU Z;  1R3L C;  1N36 O;  4CH6 A;  4OPA A;  3R66 A;  3W7W A;  2Y69 B;  5CA1 A;  2QSA A;  3CWB H;  2EBO A;  4GX5 A;  2WLM A;  2D2C B;  4GKK B;  4DUY O;  5LYJ A;  1QNM A;  2QE7 G;  5J9P C;  5H6Q A;  3LSQ A;  4DV3 O;  1ZAU A;  2HR3 A;  4DR7 B;  3K5M A;  5IYB O;  3KCY A;  1BCC H;  3EHB B;  3OD4 A;  3CSX A;  3VQV A;  3D8C A;  3ZJZ A;  1HNZ B;  1N33 B;  5CA1 B;  4FM1 A;  3WG7 C;  3CXH F;  1KQS U;  1GN4 A;  4OX9 O;  5AG2 A;  5L3G A;  3L73 H;  3APO A;  1SQQ H;  2PI4 A;  5LYJ B;  1JX9 A;  1J5E O;  2R72 A;  4GZR B;  5K1X A;  3UKM A;  4H0L B;  2QM7 A;  4J10 A;  3JAR B;  3MHS C;  1LUW A;  4IT5 A;  1FXK C;  4H33 A;  2JVD A;  3ZHV A;  1WA8 A;  3L71 H;  4ICG A;  2RJZ A;  1TA8 A;  2WAM A;  1VQP V;  3J7A U;  1V54 B;  2E76 B;  4YJ2 A;  1FJG O;  5H5N A;  1RPO A;  5LP6 C;  2CTW A;  4LNU B;  1XHZ A;  3ETE A;  4ZI7 A;  4LF8 O;  4AI8 A;  1DTO A;  4O4J A;  4UCV A;  2WA4 A;  2Z3Y A;  2X7R B;  1I5Y A;  3OMA B;  4ZOL B;  2PY5 A;  4LF7 B;  1NBM G;  4O4H A;  2EIL B;  2UUB O;  1WA8 B;  3ICX A;  1DLB A;  4LFA O;  1S0V A;  3MD0 A;  2DW4 A;  3FB6 C;  1Q6U A;  3DXR A;  3UO2 A;  1Y67 A;  2JJ2 G;  4AIL C;  1N34 O;  1OJH A;  3E86 A;  1OV9 A;  2JEX A;  3HPL C;  2LW7 A;  3CCQ V;  1N36 B;  4O4J B;  2BTO A;  2P4K A;  3P3P A;  1DK1 A;  3AG1 C;  4I4T A;  3A0B Z;  2A0L A;  1NT2 B;  3PJS K;  4TV8 B;  4O4H B;  1VF7 A;  3SPG A;  4DUY B;  1VQ9 V;  3HKE B;  1XIL A;  3FB5 C;  3DXR B;  2ZQM A;  4NVP A;  1HWY A;  1N32 O;  5GTI Z;  1H8H G;  2Y69 C;  2YUA A;  1WP8 A;  2BOC C;  2JEU A;  2ZE5 A;  1NU1 H;  3ABT A;  2ETN A;  4I4T B;  3JD0 A;  1G8M A;  4MVS A;  1N0J A;  3AG2 B;  1SC5 B;  2AHY A;  3QF7 A;  5EBW C;  2VQE B;  3OW2 U;  2IM9 A;  5JQG A;  4JI5 O;  1WP7 A;  1M9N A;  2WPD G;  1IBM O;  2UUC B;  4D7T A;  4UCR A;  2Q7E A;  3CCE V;  4KFM A;  1BHA A;  5KA5 A;  1KBH A;  2HP8 A;  3CCL V;  1GMG A;  4XDJ A;  1AIL A;  4ZHQ A;  3LNM B;  3TXQ A;  3SPI A;  5B1B B;  2YXH A;  4Q6G A;  1H2K A;  3ABL C;  3CXC U;  3VQW A;  4JI3 B;  1UPG A;  5JQG B;  3SGI A;  3DTU B;  4UVB A;  4X1I B;  3LNN A;  1IBK B;  4LF8 B;  2AGA A;  2P67 A;  5LMN O;  4DR4 B;  3JSL A;  4DR6 O;  1SQG A;  3K58 A;  1BGY H;  4BR6 A;  2IW5 A;  2X0L A;  4ZHQ B;  5D5Q A;  1YIT V;  2FB5 A;  1GO3 F;  4O2B A;  4WCE V;  1EZJ A;  3T4Z A;  5LOV A;  1ZX3 A;  2Z5U A;  5KUK A;  1QLE B;  2H94 A;  3ZMT A;  4J9Z B;  4UB8 Z;  1R73 A;  1P7B A;  4PA9 A;  1P4R A;  3K3W A;  3STZ C;  3VQY A;  2AW9 A;  3FB8 C;  4O2B B;  3W7S A;  4TQF A;  1VQ7 V;  4F6R A;  1G4Y B;  3RN4 A;  3O9O A;  1N32 B;  3BAA A;  3EXA A;  4WBN A;  3P32 A;  1SQF A;  3OGC C;  4I7Z B;  3ZRW A;  4K3A A;  2OTL V;  5BZB A;  1GTO A;  1PL0 A;  1NZ6 A;  2ZR3 A;  3F7Y C;  5LGN A;  4CH4 A;  4JYA O;  4NXM B;  3CC7 V;  4JI5 B;  4NXN O;  2X6A A;  1NR7 A;  3E35 A;  3UM7 A;  3A0R A;  2A06 H;  2F4V B;  4QE7 A;  3UQ8 A;  3L9D A;  1MSW D;  4WBN B;  2UXX A;  1S5J A;  4CC5 A;  3ZN1 A;  5IWA B;  3AG2 C;  1NTK H;  4MTG A;  4DV2 O;  5F2V O;  4PJ0 Z;  1ARO P;  2GTA A;  3RBZ A;  3H9V A;  2R70 A;  2BE3 A;  4UCO A;  3ZRV A;  1XNR O;  1I08 A;  1R3I C;  2A7W A;  3QTC A;  2B5U A;  3RYC A;  1IXB A;  2HEP A;  3F5T A;  3SDL A;  1VIB A;  3JAW A;  2R9I A;  5GW7 A;  2ZXW B;  3SYC A;  1K8A W;  5JJN B;  2XAQ A;  4DR6 B;  2DE0 X;  3OMI B;  4XDK A;  5B1B C;  4XDL A;  3T1Y O;  4EEQ A;  1YXB A;  4K0K O;  4JI2 O;  5B5E Z;  2R9R B;  2Q8V A;  2QM8 A;  1MG1 A;  3RYC B;  1SS3 A;  5LA6 A;  1NH2 B;  1GKF A;  3WFV A;  2F66 C;  4RQF A;  4BWA A;  2X6C A;  4YJ3 B;  4ZIB A;  5DN6 G;  4TV9 A;  5JCO A;  1K5S A;  2HKO A;  1SRY A;  2EZO A;  4DYL A;  1L0L H;  3ZHS A;  3BHP A;  3BFR A;  3B09 A;  4GUN A;  1VQ8 V;  5H2F Z;  2EIN C;  4G27 B;  2EZP A;  2EIM C;  4DW0 A;  1PNL A;  1SKV A;  3QO5 A;  2W0F C;  4DO2 A;  3IGA C;  5D5P A;  3A8T A;  4TV9 B;  1F51 A;  3GVM A;  1V9P A;  4UV9 A;  4JI4 O;  5CA0 B;  3APQ A;  1VQN V;  1JA8 A;  3JAM N;  1I94 O;  2EIJ C;  1FXH A;  2ZD9 A;  5HFL A;  1F4M A;  3PN1 A;  4FLT A;  4J42 A;  1H2N A;  3CRR A;  2A9H A;  1Q7Y W;  1KKD A;  1UJW B;  1BS3 A;  4YHH B;  1KU9 A;  3SJQ C;  2XAG A;  4X65 B;  2Y4U A;  1WNS A;  5IYC O;  1YJW V;  1GN3 A;  1SET A;  3C3T A;  2YC0 A;  3CS5 A;  5H6R A;  1VEW A;  2FML A;  3K9S A;  1KP2 A;  1JVM A;  1OCR B;  4KHP O;  4DV2 B;  4MVM A;  1XNR B;  1VQ5 V;  1VQL V;  2N74 A;  3K9A A;  4DV6 O;  5E1A C;  1K4C C;  3H1I H;  2JS5 A;  5KHH A;  5LL6 Y;  1D5N A;  3ML0 A;  1TGO A;  4LH7 A;  5GON A;  3MAQ A;  4MW8 A;  4IGG A;  1O9H A;  4WFH A;  2XAH A;  4N21 A;  4DV7 O;  5IYZ A;  1TAE A;  4K0K B;  4JI2 B;  1JQ0 A;  3WG7 B;  3RYI A;  5B3S C;  5KX5 A;  2ZXW C;  5IDJ A;  3SJB C;  4X64 O;  3G80 A;  2JGD A;  5GON B;  1URF A;  4O4I A;  1SZX A;  3BCC H;  3E22 B;  1XMQ O;  1YZB A;  5CBF A;  1Q90 D;  1VF5 B;  4DV0 B;  1QVG U;  3L70 H;  5IYZ B;  2QWP B;  4UXN A;  2PZS A;  4EKW A;  2V7Q G;  4C7U A;  3RYI B;  1GN6 A;  1B06 A;  2GDS A;  1SES A;  1Q81 W;  1B6Q A;  4TQD A;  4HAM A;  1K4D C;  1JCH A;  1OZ0 A;  1YJ9 V;  2JGD B;  3D3Q A;  5IJ0 A;  3SJC C;  4I5S A;  5CA3 A;  3N27 A;  1GK9 A;  1MAB G;  1I94 B;  3RWR D;  2E5L O;  3S3W A;  5LBQ A;  5CB4 A;  5CBH A;  4HBN A;  4AQY B;  3THO A;  2ITC C;  1M90 W;  4U3F H;  2F95 B;  2DQ3 A;  2GTS A;  2DOS A;  5KMG B;  3B8N A;  4XBF A;  3CME V;  5JCO C;  5KHJ A;  1MMM A;  4R8C A;  1Q3E A;  2QJ1 A;  2KG7 A;  2CTQ A;  4B7K A;  4K8X A;  1MOF A;  1EBO A;  1OCO C;  3RGB A;  4FJC C;  4GKJ O;  5LMU O;  2HLD G;  2QWN B;  3ZHR A;  3STL C;  3OTO O;  2DWD C;  5CB4 B;  2W6I G;  2WLJ A;  2PGG A;  2AXT Z;  1PNK A;  3T1H O;  2ZIM A;  4Z1M G;  2VS0 A;  2IH1 C;  1Q8I A;  2KG7 B;  4B3R O;  4TOI A;  3SPJ A;  5DEC A;  4EB6 A;  3EVK A;  4LF5 O;  3CCM V;  4TSF G;  2JJ1 G;  4DV4 B;  4DR2 B;  2Z0A A;  1BT8 A;  2YEV A;  4FFB A;  3JAT A;  3FX7 A;  4JV5 O;  4FZ0 A;  1JR9 A;  4WFG A;  4X64 B;  3NXS A;  4LCU C;  4TT3 G;  3KKY A;  4TUY B;  1FKA O;  4DR1 O;  1NJI W;  2DN9 A;  1XMQ B;  1KUQ A;  3IAY A;  2ZNI A;  4EB6 B;  5JVD A;  1M93 A;  2K9P A;  1CPY A;  3K0G A;  2YEV B;  2V1D A;  4B3S B;  4FFB B;  4DV5 O;  3ABL B;  1DF4 A;  1N0N A;  1THZ A;  4F6E A;  3OAA G;  1Z2G A;  4J9Y B;  4Q20 A;  3F5W C;  5JVD B;  2UXD B;  1P84 F;  2E5L B;  3RYF A;  3ZRX A;  5JJE B;  3BEH A;  2RMK B;  4H13 B;  3SPH A;  3CCJ V;  3UT5 A;  4QPK A;  1ZL8 A;  2LGW A;  4I55 A;  5KA6 A;  3OUF A;  2P7T C;  2E74 B;  3B40 A;  1Y4M A;  2ZNJ A;  1XMO O;  4LP8 A;  1OCC B;  4X20 A;  3A2F A;  4X9Q A;  3H01 A;  2H3O A;  2X6B A;  2GV9 A;  5B1A B;  2E75 B;  4PEL A;  5TIS Z;  3B2E E;  1S76 D;  1NVP D;  1W2B U;  1BSM A;  2OTJ V;  4L8J A;  3JD2 A;  1W59 A;  3RYF B;  3CYO A;  4GT1 A;  4DR5 B;  3H1H H;  1RFY A;  3QVN A;  2YID A;  4YJ2 B;  3UT5 B;  4JI7 B;  1R6N A;  1ZL8 B;  4QNH B;  1M5I A;  4UUJ C;  4KL1 A;  4ZI7 B;  2RNB A;  1NQT A;  1S5L Z;  1QLN A;  4B3R B;  2ZM6 O;  4RUF A;  4LF5 B;  5B66 Z;  2YXY A;  2ZCE A;  4LR3 A;  5EC2 C;  3TK1 A;  4JZG A;  4J41 A;  2YSU B;  4JAS A;  1TVK A;  1S72 V;  2ZT9 B;  1YJN V;  4JZ2 A;  1AVM A;  1E1Q G;  4JI6 O;  1AP6 A;  2EJR A;  4PA3 A;  1D2D A;  4DV3 B;  1CXZ B;  2MW2 B;  2BOB C;  4DR1 B;  1ZWI C;  3AEI A;  4Z1V A;  4PI2 A;  3JAL A;  2HVK C;  3G6B A;  3HKC A;  2B1I A;  3G6E V;  4LF4 O;  1NTZ H;  4OX9 B;  1NTM H;  1I0H A;  3KZI Z;  1TVK B;  5BY1 A;  1I7F A;  1J5E B;  2JRI A;  2WA3 A;  1K7D A;  2HHH O;  3LSU A;  2ZE6 A;  3W7X A;  2HVJ C;  1WB7 A;  1FAF A;  3UCS C;  1KYO F;  3ETD A;  4MTO A;  3K59 A;  1AB3 A;  3BA8 A;  4WFB V;  3JAL B;  3AK2 A;  3HKC B;  4UCU A;  5KAF Z;  4NTX A;  4NYK A;  2NR5 A;  4LF6 O;  1K92 A;  2ILM A;  2JK5 C;  5L3C A;  4X66 O;  2Q4P A;  1FJG B;  4X8A A;  5C8Y A;  3TJT A;  2UXB O;  3T4D A;  1XMO B;  3GWO A;  3J81 N;  3TGU H;  5CBG A;  4LFC O;  2UUB B;  2IJK A;  1OHH G;  4PHZ A;  4LFA B;  1FS0 G;  2DYS B;  4JF3 A;  4LC1 A;  2EIN B;  3K0D A;  2KB1 A;  2CH7 A;  2OCC C;  3CP1 A;  1OCC C;  5C8Y B;  1N34 B;  2EIM B;  4LWS A;  3OEH G;  4UFZ A;  3ZX6 A;  5B1A C;  4O4L A;  3LUT B;  1IDS A;  2B1G A;  2EX3 A;  3GWK C;  5KHK A;  1DGS A;  3BPZ A;  2Q73 A;  3HR0 A;  3QNE A;  2CTR A;  5KAI Z;  3I5D A;  5KUM A;  4I9W A;  1MZF A;  2EIJ B;  4B08 A;  4OPH A;  3OT7 A;  4JI6 B;  2AHZ A;  2UU9 O;  2CH7 B;  4JI8 O;  5A2Q N;  1AJP A;  4LWS B;  5LOV B;  2LW1 A;  1PM9 A;  2CGO A;  2XAF A;  4O4L B;  1AR5 A;  2JIZ G;  1H2L A;  2L6L A;  2ZE7 A;  4GX2 A;  4UCT A;  5FPR A;  4X62 O;  2RQ6 A;  3CRA A;  4JI1 O;  2QA4 V;  4G2K A;  1L1F A;  4PD4 F;  1YTF B;  2Q9L A;  4JYY A;  4I9Q A;  2QKA A;  4QE9 A;  2DJV A;  4LFB O;  1N4C A;  4WF9 V;  1H2G A;  3ZHU A;  4B7E A;  2Y4T A;  5EYP A;  2CGN A;  4F6R B;  1IBM B;  3N2K A;  4ZBM A;  3SJA C;  4EFE A;  1VAR A;  5B1N A;  1TUB A;  2Y0P A;  4PDL A;  3ZN0 A;  1S77 D;  2UXC O;  4DR3 O;  1NI8 A;  3QO8 A;  4JGS A;  3ZRW B;  1VQM V;  2P22 C;  3UO3 A;  4LF6 B;  2HG5 C;  4J80 A;  2VQF O;  2Q67 A;  2Q7H A;  2QKS A;  4X66 B;  1WB8 A;  4B3T O;  5EYP B;  3FFQ A;  3IFX A;  1K97 A;  1HNW O;  2F93 B;  2QWQ B;  4G28 B;  4WFA V;  5LMN B;  5B3S B;  3OUS A;  3N2K B;  4LF9 O;  1FPO A;  4BW5 A;  1TUB B;  4FLV A;  1IBL O;  3B4S A;  4LFC B;  5L3F A;  2XOK G;  2IU3 A;  1RM1 C;  4PDR A;  3CCS V;  3P3N A;  2BTQ A;  4PA7 A;  4JTA B;  2KKW A;  1I5X A;  4GYC B;  4J7J A;  4U7N A;  4A5U B;  1NS1 A;  4J7Z A;  1K9M W;  4JTD B;  3JAW B;  1AR1 B;  1RP3 B;  4CS4 A;  3SYO A;  1HR0 O;  2IH3 C;  3ZHT A;  3OTF A;  1SQP H;  3SYP A;  3AG3 C;  4JYB A;  1YDX A;  1WJZ A;  2PUS A;  4U3J A;  4X1Y A;  3O65 A;  2DYS C;  4CZZ A;  1COW G;  2GBO A;  2N05 A;  2IJJ A;  1H2M A;  2YI9 A;  2A3Q A;  2QM4 A;  1CEZ A;  2Q6A A;  2YI8 A;  5EC1 C;  2QWO B;  5EBM C;  4MT8 A;  4JI8 B;  5LA6 B;  4KP4 A;  2RCV A;  2F43 G;  2DYR B;  3N2G A;  5KHG A;  4BIO A;  4DUZ O;  1N8R W;  3FAV A;  2NN4 A;  4WFF A;  4X1K A;  3WB0 A;  2Q0O C;  2A79 B;  3FYI B;  4JYA B;  1OCO B;  4LFB B;  4Z2W A;  4NXN B;  4R7C A;  2HFE C;  1QHT A;  2LFR A;  4DK1 A;  4NB5 A;  4E4E A;  2PI5 A;  1YTF D;  1DF5 A;  4OXS A;  1W0K G;  4JYC A;  3FAV B;  4DR3 B;  5LHI A;  2OCH A;  2MK3 A;  1H2S B;  4X1K B;  4QGP A;  2GSM B;  3IJ4 A;  4F4L A;  4IYI A;  1P49 A;  3A0H Z;  5DM6 V;  1MSD A;  3E8F A;  4UVC A;  1U96 A;  2BCC H;  1X4T A;  1S5H C;  4PDM A;  3SYA A;  3DC6 A;  4ZKI A;  1E1R G;  4PDV A;  5A9G A;  1G1X B;  4DW1 A;  4HNA A;  5EBL C;  3B77 A;  4EFB A;  5IE9 A;  1YVW A;  2PYJ A;  3T1Y B;  2ZDI A;  1JJ2 U;  1R3K C;  2EIK C;  1WAZ A;  4U7O A;  3HKD A;  1BQ0 A;  1UFI A;  3FYE B;  1Q6H A;  1Q5O A;  3FKS G;  3OM3 B;  2VWJ A;  1WLE A;  3C90 A;  1V55 B;  1J95 A;  1BZK A;  2Q5Z A;  3LDE A;  3SPC A;  3L72 H;  1QR9 A;  4HNA B;  4CS3 A;  2LQT A;  2OIG A;  4FVM A;  2M7W A;  1ZUQ A;  1XDC A;  2ADQ B;  3OEE G;  4GKK O;  4JTC B;  1IX9 A;  4QPJ A;  1GN2 A;  1PP9 H;  3BRC A;  2XAS A;  3FB7 C;  3L75 H;  4MW3 A;  3HKD B;  1ENV A;  3JSN A;  5EIB D;  4DR7 O;  5KX5 B;  4CC6 A;  5H9C A;  3OE7 G;  5EIB C;  3CPW U;  1IZ3 A;  1K5Q A;  3CB2 A;  5IT9 N;  3BAB A;  4MVU A;  3LSS A;  1HNZ O;  4JI4 B;  1R6K A;  4O4I B;  2R9A A;  4YIO A;  2F23 A;  2F1M A;  3U11 A;  1Z5V A;  5BMV A;  3M8A A;  4DRX A;  4RUE A;  4JAU A;  4FLX A;  1XEQ A;  4JAV A;  1FXV A;  3RT3 C;  2E3C A;  1NVP B;  4NR1 A;  2DYR C;  2EJ7 A;  5IY5 B;  2V4D A;  5IJ9 A;  3FD9 A;  2CAZ C;  1CP9 A;  2BSK A;  1AI5 A;  5IJ0 B;  1YCI A;  4KHP B;  4HZ3 A;  2KSD A;  3CCU V;  3LDD A;  5BMV B;  4AHC A;  3CE2 A;  4KXR A;  4RO2 A;  4DRX B;  1QQC A;  2RN9 A;  4NTY A;  1TUE B;  1Y74 A;  2IU0 A;  1GH6 A;  2QEX V;  4B3M O;  1WPX A;  3K57 A;  4DV6 B;  1JFF A;  3ZBH A;  5EZY A;  1XQ8 A;  2BSK B;  2YIB A;  3ASN C;  3I56 V;  1HNX O;  4FLU A;  2IJI A;  4DV7 B;  5KLV H;  3TCU A;  3K08 A;  1GM7 A;  3E8B A;  1D5A A;  1Y74 B;  3HKB A;  1PV0 A;  1OCZ C;  1AI4 A;  2YDE A;  5GTH Z;  4J7K A;  3GB7 C;  1JOY A;  2VWK A;  1JFF B;  1KMI Z;  3AG4 C;  3K5O A;  5EZY B;  1Q6I A;  2LGQ A;  3OGI B;  1KC8 W;  3E2E A;  2AZ0 A;  4PA6 A;  1KKC A;  3S3X A;  2Q0A A;  1RPR A;  3VOU A;  1NR1 A;  1VQ4 V;  3K5N A;  3HKB B;  1V55 C;  1GAX A;  1PL4 A;  2K1E A;  4E2L A;  4FM2 A;  3JAT B;  3K5L A;  3JAR A;  3M7M X;  1QBZ A;  1P7G A;  3ABK C;  1E79 G;  4LBE C;  3BVO A;  1Y76 A;  4GCZ A;  1YIJ V;  3ABU A;  2ZDI C;  4NTW A;  3CCR V;  1K34 A;  5KHI A;  2VQE O;  3E8G A;  2O57 A;  2WLL A;  4LNU A;  1ZTE A;  3ABM B;  2QTO A;  4DXW A;  2ITD C;  2UUC O;  1KB9 F;  4O2A A;  4ZOL A;  2OCC B;  1M56 B;  1Y76 B;  4GKJ B;  5LMU B;  3K79 A;  4D6T H;  3OTO B;  2Q68 A;  4K8Z A;  1B3Q A;  4JI3 O;  5IY5 C;  2WLL B;  1SQX H;  4BIZ A;  4B3M B;  1ORQ C;  1IBK O;  4DR4 O;  1KP3 A;  2DQ0 A;  4I55 B;  2LO1 A;  3T1H B;  2UUA O;  2XND G;  4O2A B;  3OR7 C;  3ZMS A;  3WB2 A;  1M1K W;  3E8H A;  3C3S A;  1VP7 A;  3QG5 A;  4TV8 A;  4X20 B;  1HNX B;  4UB6 Z;  1JMK C;  3HKE A;  3D3I A;  3CD6 V;  1WPB A;  5FPO A;  5L3B A;  3DGE A;  2KQX A;  4IIJ A;  5IYD O;  1ROP A;  3H1L H;  4JV5 B;  1U97 A;  2CTP A;  3BA9 A;  1IVS A;  1AP5 A;  1YHQ V;  3RVZ A;  1BQZ A;  1FYJ A;  2JGU A;  1AI6 A;  2YIC A;  2CDY A;  2DWE C;  3JD3 A;  2ATK C;  5EK0 A;  2LP7 A;  3T2M A;  4JI0 O;  2W0X A;  1IUR A;  4FMT A;  4IIJ B;  4FK5 C;  4MSW C;  4DV5 B;  4P2Z A;  1PD3 A;  2YIB D;  4GX0 A;  1ZLZ A;  4FPP A;  1BHB A;  2XHB A;  3AK3 A;  3JAK A;  2NLJ C;  3KCX A;  1Q43 A;  1YSC A;  2IJH A;  3CRC A;  1K3E A;  3OFN G;  4NXM O;  5JJJ B;  4UCS A;  4X1I A;  3JD4 A;  4MVO A;  1AR4 A;  2XTA A;  2F4V O;  3H1J H;  2CK3 G;  4P9O A;  1FD9 A;  1RM1 B;  4YY3 O;  2ZR2 A;  4L87 A;  1M57 B;  3K04 A;  1VQO V;  5IWA O;  5K1P A;  3JAK B;  3WU2 Z;  1X59 A;  1G6U A;  5LGU A;  4JAA A;  3ABM C;  2EUL A;  3AG3 B;  5E79 Z;  1BMF G;  3RFR A;  3ZHQ A;  3CC2 V;  2YXL A;  5JH7 A;  4FFK A;  3DSQ A;  2Q69 A;  3JAS A;  4TWK A;  2UUA B;  1O9G A;  1VMG A;  3SR2 C;  1M56 C;  5B1O A;  3E89 A;  3ETQ A;  5ITZ A;  2ZM6 B;  4H44 B;  5BXZ A;  1V54 C;  3G4S V;  2OYQ A;  2YS8 A;  4CS2 A;  1KD1 W;  2DMX A;  5LHH A;  3BY6 A;  2D3O W;  5JH7 B;  1W0J G;  4ASU G;  3G71 V;  4IL6 Z;  3G67 A;  2WLK A;  1L0N H;  3JAS B;  1MNG A;  2WWW A;  4I0X A;  3OMN B;  2EIL C;  2QKC A;  2PTM A;  5ITZ B;  4FLZ A;  2W6J G;  5J2U A;  4UV8 A;  2Y48 A;  4IYH A;  4J11 A;  3ZCC A;  4LF4 B;  4YXW G;  4KUM A;  3CC4 V;  1FFT B;  4JI0 B;  1LR1 A;  1SF9 A;  3U10 A;  1HP8 A;  5CMU A;  1XL6 A;  2QGN A;  4FLY A;  4HYO A;  1HW7 A;  2HHH B;  4MTX A;  4GLX A;  3DC5 A;  1XRE A;  4I0X B;  1SER A;  1XL4 A;  4RAI A;  5J2U B;  3L74 H;  1AI7 A;  3TET A;  4YHH O;  3IC7 A;  2P06 A;  4X65 O;  3H1K H;  2Q7G A;  4OGQ B;  4W4K A;  2FKX A;  3CMA V;  4BIU A;  2ZKO A;  1QCE A;  4YY3 B;  2UXB B;  2EIK B;  2YIA A;  3D36 A;  4CBC A;  3RYH A;  4R50 A;  3JCZ A;  3WB1 A;  2RDC A;  1AJN A;  1EZV H;  3CCV V;  1VQK V;  2B9Z A;  1S3J A;  4MTF A;  2PYL A;  3ASO B;  3F7V C;  1KEC A;  1ZSP A;  2WSS G; 
#chains in the Genus database with same CATH homology
 2CTQ A;  3UO2 A;  2LGW A;  4J7Z A;  2CUG A;  2CTW A;  2QWQ B;  2QWO B;  2L6L A;  2KQX A;  2YS8 A;  1IUR A;  2M6Y A;  2QWP B;  1XBL A;  2DN9 A;  2LO1 A;  2Y4U A;  2QSA A;  1FPO A;  2QWN B;  1NZ6 A;  2CTR A;  1BQ0 A;  3BVO A;  4IT5 A;  2CTP A;  2DMX A;  3UO3 A;  2GUZ A;  2N04 A;  2YUA A;  2QWR B;  3APQ A;  2GUZ B;  1GH6 A;  1FAF A;  3UCS C;  2EJ7 A;  1WJZ A;  1HDJ A;  1N4C A;  3APO A;  4J80 A;  4RWU A;  1BQZ A;  2OCH A;  3AG7 A;  2Y4T A;  2N05 A;  2PF4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...