2Q67A

Crystal structure of nak channel d66a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
b'MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q67A00
3ZRSA 1ZWIC 5EBMC 3AG1C 3IFXA 4RAIA 3LDDA 4HZ3A 4WFEA 4PA4A 3T4ZA 1S5HC 3E83A 4MTFA 5EBLC 2K1EA 4I9WA 4X88A 3E89A 3K08A 3F7VC 2Q68A 2WLKA 4MS2A 3SJQC 2Q6AA 2BOCC 3R65A 2BOBC 4WFGA 3SPHA 3SYQA 3FB6C 5KUKA 3OUSA 4XDLA 3RBZA 1KKDA 2DWEC 2R9RB 4QNHB 2Q67A 4G27B 3K0DA 5EC2C 5CBFA 2WLNA 2IH3C 3UM7A 2EIJC 2HJFC 4P9OA 1BL8A 2Y69C 4F4LA 3FB5C 4PA9A 4KFMA 3LNMB 1V55C 1JVMA 2HG5C 2HVKC 3KG2A 4WFFA 2HVJC 3SPJA 3STLC 3PJSK 1OCRC 3AG3C 5J9PC 2X6CA 2ITDC 2EIKC 3E8BA 3TCUA 4PA7A 3T1CA 2P7TC 4MTOA 4UUJC 5E1AC 3RW0A 5CBHA 3ABKC 2QTOA 1ORQC 2ZD9A 4MW3A 1R3KC 2EIMC 3E86A 3FB7C 3HPLC 4MVQA 4P30A 5EK0A 2H8PC 3SPIA 4ZBMA 2A9HA 2NLJC 2A0LA 4PDRA 4QE7A 1K4CC 1R3LC 4PA6A 3SPCA 3K03A 3VOUA 2Q69A 5EC1C 4DXWA 4PDMA 4H37A 3UKMA 2W0FC 4R8CA 3T4DA 2WLJA 2DWDC 3TETA 1OCCC 4P2ZA 4QE9A 4X89A 4RUEA 4R50A 4PDLA 1OCZC 2WLMA 4LP8A 4GX2A 4MSWC 2KB1A 5B3SC 4TWKA 2X6AA 4JTDB 4MVOA 3SYCA 5EBWC 1V54C 4EKWA 4RO2A 4HYOA 4JTCB 4XDKA 2WLHA 2WLLA 3K04A 3K0GA 1XL6A 1R3IC 2EILC 2JK5C 4PA3A 5IY5C 2DYRC 3X2QC 3T2MA 3SPGA 4MW8A 1LNQA 2QKSA 1P7BA 4XDJA 3LUTB 4GX5A 1R3JC 5B1AC 3JYCA 4GX1A 4R7CA 4LBEC 2ITCC 3OGCC 4PDVA 2AHYA 2X6BA 2ZXWC 3WG7C 5BZBA 4MTGA 3OR6C 4OXSA 3E8FA 2A79B 2IH1C 3K06A 1QLEC 5B1BC 4GX0A 1G4YB 4LCUC 3RVYA 3AG2C 4CBCA 2WLIA 3LDCA 1XL4A 3ASOC 4MVUA 4MVZA 2WLLB 2OCCC 3E8GA 2AHZA 3BEHA 3F7YC 4WFHA 2YEVA 2EINC 4BW5A 3ASNC 3IGAC 3F5WC 3OR7C 2HFEC 3LDEA 3ZJZA 1M57C 1J95A 1K4DC 3E8HA 4P9PA 4RUFA 4X8AA 3SYOA 4JTAB 4R6ZA 3SYPA 3AG4C 3EFFK 3ABLC 2ATKC 4MVSA 2DYSC 1OCOC 1M56C 3RVZA 3SYAA 3FB8C 2WLIB 3OUFA 4J9ZB 4J9YB 4MVRA 3ABMC 3GB7C 4MVMA 3STZC 4H33A 4G28B 5KUMA 5CBGA
chains in the Genus database with same CATH superfamily
3ZRSA 1H8EG 5K1PA 4X1KB 3ZHVA 2DOSA 1S5HC 1B04A 1Y4MA 5H6QA 4JI8O 1WLEA 4FM0A 3OUSA 1XHXA 2O57A 4FFBA 1VQLV 2RNBA 3JATB 2WLNA 2VS0A 3LNNA 2E74B 3BRCA 2EX3A 2YIBD 3LNMB 4IHJA 1FJGO 2CTRA 4WFFA 5HFMA 1VQ5V 2ZIMA 3EHBB 4DV0B 3DXRA 5IJ0B 4TV9A 3ZMTA 1FFXA 4TUYB 1AILA 3K59A 4DV3O 2ODMA 5JCOA 1GM8A 4I9QA 3SPIA 3A0RA 1FXHA 1NZ6A 2A9HA 5JCOC 4JI6B 1YZBA 1IXBA 3VOUA 2ZQMA 1VQ9V 2JJ1G 3ZS8C 3U10A 3M8AA 2LFRA 3AK3A 5KA6A 3JAWA 4DO2A 1XNQB 1IBMB 2LGQA 2KB1A 5EBWC 4JI1O 4IIJA 4Q20A 1CP9A 1QLEB 1RP3B 4O2AA 2Q7HA 5IY5C 4O4JA 1BCCH 4KUMA 3RGBA 1NH2B 4R7CA 1H2GA 3G67A 3KCXA 3OGIB 3VBBA 1PM9A 2WLLB 4J41A 1SQQH 3B2EE 1XMOO 2UUCO 4F6RA 4P9PA 4JTAB 3RT3C 4J11A 1N32O 3FYEB 4UCOA 2QA4V 4J9YB 5H2FZ 2Q0OC 1E1QG 3ZMUA 2PTMA 3CRCA 4PA4A 4MTFA 1MABG 2LJ2A 4NVPA 1Q86W 3IC7A 1RSOA 1OCRB 1SQBH 2P4KA 5GONB 3JASB 4O2BB 1U96A 2EIJC 2Q0AA 4B7KA 3CRMA 3J80N 4PA9A 1N34B 3ZX6A 1BGYH 1O9HA 1JR9A 4DV7O 4UB8Z 1XMQO 3RYHB 1YVWA 1V55B 4MTOA 2IJIA 3RW0A 4DK1A 1NTMH 2ZD9A 2EIMC 3AK2A 4DV5O 4X66B 4JI4O 5EC1C 3L75H 1TGOA 1W59A 4J10A 4P2ZA 3CCMV 3CPWU 2UUAO 2ETNA 3W7UA 4IT5A 4B3MO 4JF3A 5F2VO 3K58A 1UPGA 3ASOB 3OTOB 3X2QC 3L73H 2Q4PA 1XQ8A 3RYIA 1I7FA 4LH6A 5LL6Y 5BZBA 2P22C 1PNMA 4DR1B 1R73A 2VQEB 4JZ2A 3HKDB 2BSKB 1VMGA 2QTSA 1Z2GA 1PD3A 3OD4A 1P84F 1SQXH 2W0XA 4DV6B 3IGAC 1XREA 3E22B 2OTJV 1I94O 4I55B 3E8HA 4LF8B 5IYZA 1LR1A 4DV1O 1B3QA 4MVSA 3H1LH 1JQ0A 2Y48A 3T4DA 3ABUA 1H8HG 2P4VA 3AG1C 4DR4O 4FM2A 2ZKOA 3ABLB 1FS0G 1L0LH 2FKXA 3ZRWB 3F7VC 2WLKA 2OT5A 4HBNA 4I50B 4FVMA 4RQEA 1IX9A 2CE4A 5HFLA 4DUZB 5EC2C 3CXHF 4DR2B 1F23A 1VP7A 2L6LA 1YDXA 4IL6Z 1N36O 1NU1H 5A9GA 1N0JA 1H2NA 5J9PC 4ZHQB 4CH4A 5EIBD 1JCHA 4UUJC 1FYJA 5E1AC 4DR7B 3E86A 2IU3A 2H3OA 3IC9A 3SJBC 1ZUQA 3VQWA 5IYDO 2Q69A 4J7ZA 3ABKB 1K92A 3CJHA 4ZOLB 4MVOA 3HB3B 1RPRA 2F43G 3CCVV 1HNXB 2EILC 1R3IC 1DF5A 4MT8A 2DYRC 5KAIZ 2HP8A 4JYAB 5A2QN 1A32A 2AZ2A 1BMFG 1NVPB 1Y67A 2E76B 2ZXWC 4U3JA 4B08A 5B1BC 3AG4B 1ENVA 4OPAA 3Q4HA 3DC5A 3SR2C 1I5YA 4WFHA 3FKSG 5BMVA 1Q8IA 4NTWA 2C2AA 3QO5A 2JDIG 3A2FA 1ZSPA 2XAFA 3BHPA 5L3BA 5CA3A 2LP7A 2N05A 4B3TB 5IE9A 1WB8A 2QDOA 4MVRA 3ABMC 1PNLA 1ZL8A 1RFYA 2XAGA 1QU7A 2F23A 2YXLA 3OTFA 1JPXA 3MHHC 3JD0A 1WJZA 2QE7G 4UXNA 3A0HZ 1NR7A 3SYQA 2ZR2A 3OMNB 4B3RO 1K5QA 4JYBA 4DYLA 1SZTA 4YHHO 1B06A 3B8MA 2EIKB 1UFIA 1M93A 4DW1A 1HWYA 4GT1A 2Q7GA 3CHXA 4LFAO 5LXTA 4YXWG 1SERA 4PA7A 1PP9H 4RWUA 4K8ZA 3SJCC 2QKAA 4JV5B 2ZDIA 5B1NA 2R9AA 1ORQC 1N8RW 2R72A 2XT9A 2PUSA 2D3OW 1JFFA 4I0XA 1O9GA 3BABA 1SQGA 1OCZC 3K5OA 1W2BU 3HKBB 3HR0A 3M7MX 1Y76B 4YJ3A 2BTQA 1US6A 3N27A 1XL6A 3P32A 4FLWA 1AROP 3SPGA 2NR5A 1E79G 1Q43A 3TJTA 2PI4A 4X62B 3JARB 4GCZA 4CBCA 1CPYA 1K97A 4NXNO 2GDSA 3OW2U 2JEUA 3BEHA 2HHHB 1BQ0A 1J5EO 4BW5A 2VRZA 1VQKV 4JAUA 4WBNA 5H5NA 4DRXB 1TA8A 2B1IA 3K5MA 4DUYB 1F4NA 4UB6Z 2ATKC 1SA0A 4LF6B 1WN7A 3RVZA 1L8DA 3CYOA 2F4VB 1OHHG 4JI0B 4RAIA 3LDDA 1K8AW 4YIPA 1Y66A 1D5NA 2UXBO 1S0VA 1ZAUA 2Y0IA 4NB5A 5IDJA 4DV0O 3QG5A 1BT8A 5JH7A 4PV1B 2R9RB 2F95B 4G27B 4IHJB 3T1YB 3OT7A 4JYCA 1Y74A 2IJJA 1QLNA 3MD0A 2R9IA 4UCUA 4QJFB 1NQTA 3D36A 3P3PA 4O4HB 1PPJH 2V1DA 1YIJV 1BHBA 1NT2B 4DR6O 3D36C 2Y69B 1IBMO 2UU9B 2KQXA 4PA6A 1PL4A 4LF7B 3TXQA 3JAWB 4H37A 5IY5B 5JVDA 5KA5A 4Z1VA 5L3EA 4X89A 3CE2A 1PV0A 4YY3B 2JS5A 2Z5UA 4TWKA 2ILMA 2FB5A 4CH6A 2F1MA 4EB6A 2ARHA 2QM4A 2RMKB 3PN1A 1SRYA 1IBLB 2PYLA 4FM1A 4W4LA 4PDVA 2YDEA 5LP6C 1FAFA 4F6RB 2XAQA 1UJWB 4J7JA 3O9OA 5FNVB 3UO2A 3HKEB 3F5TA 4OPHA 4RUFA 4R6ZA 5C8YB 3SYPA 3N2GA 3CWBH 3CX5F 1FXKC 1NTKH 4NR1A 4J9ZB 1S5LZ 1QVFU 1RM1C 4X65B 2EIJB 3ICXA 3LSUA 2HLDG 1N34O 4K0KO 3K08A 5EYPA 1KD1W 1AI6A 2EZPA 1FFTB 1DGSA 3ZN1A 3QVNA 1N0NA 3G4SV 1IVSA 3D3IA 3D8CA 2WAMA 4N21A 4YJ2B 4JPRA 1L1FA 2D2CB 2QWQB 4LNUB 4L8JA 3FB5C 4KFMA 1DTOA 2EIMB 3W7SA 2HR3A 1KC8W 5FPOA 3FX7A 1HNZB 3AG3C 1XUQA 2BE3A 4JI3B 3D3QA 3B09A 3T1CA 1X4TA 4X1YB 5CA1B 5L3GA 1R1BA 4P30A 2OYQA 4FLVA 4QGPA 2NLJC 1K4CC 4YIOA 5KMGB 3OTOO 3CXCU 4PDMA 3X2QB 1TVKA 1VQ7V 3DGEA 2P90A 4GKKB 4DR1O 5KAFZ 5B3SC 2DMXA 3ZEDA 4RO2A 2VQEO 3P3NA 1AP6A 3HKCA 1PL0A 4DV6O 5CB4A 3JCZA 5LGNA 3O65A 3QO7A 2DW4A 1HP8A 3CC7V 1CXZB 4LCUC 1IDSA 1FPOA 2B5UA 3CS5A 5CA0A 3AG1B 1M57C 3IAYA 2GSMB 5L3CA 5IYCO 2B9ZA 4O4LA 5C93A 2DYSC 1W0KG 3OM3B 4H33A 4DUZO 1EN4A 4DR2O 4WFEA 4WFBV 4KP4A 2Q68A 5FPRA 3N2KA 2JGUA 3R65A 2BOBC 2MK3A 3G6EV 4JASA 4QNHB 4FPPA 5KX5B 1Q90D 4NYKA 4GKJO 2JGDB 4UVCA 2E75B 2E5LB 3FAVB 5LYJB 4DR7O 3ZMSA 3WFVA 3KG2A 1NJIW 4O4IA 1TUBB 2M7WA 2ZM6B 2XUMA 1AJQA 3K57A 1NH2D 3K5LA 5BY1A 4TT3G 5JQGA 5IYBO 2H8PC 3AK1A 1HNXO 1VQ6V 1AI7A 3K03A 3W7TA 4I5SA 1ZX3A 2EILB 2VQFB 4B7EA 2W0FC 2DYRB 4X20A 3VQXA 4JYAO 5LOVA 4GZRB 4CS4A 4BIUA 1H2KA 4MSWC 3JALA 1MSWD 3ZMVA 2X0LA 2YIBA 4EEQA 4Z1MG 4FLYA 5J2TA 2ZE7A 3T2MA 3BPZA 1LNQA 2NNUA 4NXMB 2Q5ZA 2Y0PA 2VWJA 2X6BA 3CCJV 3WG7C 5IWAB 2RCVA 3OR6C 1GK9A 1KBHA 4DR5O 3ETQA 2WLIA 3RN4A 2UXDO 4CH3A 1I0HA 2ZCEA 3ASNC 2WWWA 1PKXA 4X1KA 1G1XB 1YF2A 1WAZA 4X8AA 2XASA 1ZL8B 2YC0A 1JA8A 4FFKA 3H1KH 3IJ4A 2YEVB 3JATA 3IFXA 5LHHA 2ZINA 2PF4E 4PI0A 3K9AA 3WB0A 2KKWA 2Q6AA 1YEWA 3FB6C 3WU2Z 2DWEC 5IJ0A 3CCQV 4B3SB 1K5SA 4TUYA 3G6BA 2YUAA 1IBKB 1VQ4V 1FJGB 3BA9A 2IM9A 2IH3C 4JV5O 5E79Z 4F6EA 4HNAB 3H1JH 1BL8A 4FIPC 4DV3B 4LF9B 5GTIZ 1Q81W 1R6KA 1WPXA 2LO1A 2G38A 1NS1A 2YICA 1OCZB 1IURA 4QPKA 3OEHG 2ZT9B 4ZBMA 2A0LA 4JAAA 4JI5B 4E4EA 3SPCA 2JS3A 3JD2A 1R6NA 1YITV 4D6TH 1OCCC 4YJ3B 4R50A 1VF7A 1GAXA 4X62O 3ZBHA 4KHPB 1SF9A 4FLXA 3MDSA 2WLLA 2XNDG 2HHHO 3NR7A 5ITZB 1YJNV 1AB3A 4LF5O 3ZMZA 3BAAA 4TQFA 2V7QG 5KHGA 3W7XA 2AHYA 3A0BZ 4WCEV 1OV9A 2QWNB 5JJEB 4WBNB 4DUYO 1EN6A 4XBFA 4ZI7B 4LF6O 5KHIA 1XMOB 4MVUA 1SS3A 2OCCC 3E8GA 2CAZC 3UQ8A 5LA6B 1N4CA 4JI0O 1BHAA 4J42A 3QF7A 4ZKIA 4CS2A 3EFFK 1L0NH 1OCOC 3CSXA 1M56C 4HAMA 3STZC 1MOFA 5GONA 3JASA 4UCVA 2YI8A 4PJ0Z 4HZ3A 5JH7B 4PHZA 5EBLC 4IYHA 2OTLV 3E89A 4MS2A 4W4KA 3RYHA 1B6QA 5EZYB 5J2UB 1GH6A 2QSAA 1EM1A 3RYCA 4OX9B 2F66C 1KKCA 1V55C 1GMGA 2LW7A 2UU9O 2Y4TA 3SPJA 4LF7O 4DW0A 1YJWV 3A8TA 2Q8VA 3I56V 4X1IB 3CMEV 2L35A 3CEIA 4CZZA 2JRIA 1NBMG 4PD4F 1NVPD 5DEDA 5JVDB 3J7AU 4QE7A 4DV4B 2UUAB 4AQYB 4X64B 1BE3H 1E1RG 1NI8A 4C7UA 1Q82W 3RYFB 2YIAA 4LFBO 2N04A 1JMKC 2LW1A 4EB6B 1IXMA 2KG7A 2CUGA 5TISZ 5LP6B 1WA8B 4JTDB 2F93B 4LWSB 4QPJA 3SYCA 1VARA 3APQA 4HYOA 1FKAO 3HKDA 2BSKA 5D5QA 2CGNA 3H1IH 4JI7B 3ETEA 1QR9A 2QKSA 3E22A 1R3JC 2CH7B 5B1AC 2ZDIC 3JAKB 4I55A 4I4TB 4MTGA 2GUZB 1XEQA 3AEIA 1SC5B 2UUBO 4GX0A 3RVYA 5IJ9A 3UT5B 5EIBC 1FXKB 1I94B 1XILA 1S3JA 3OE7G 2ADPA 1K33A 4UV9A 1QCEA 1YTFB 4J7KA 5LBQA 3ZRWA 4K3AA 2QWOB 1U97A 3JAMN 2CTWA 3ABLC 4I50A 3FB8C 1KB9F 4H0LB 3VQYA 1HR0B 4P9OA 4G28B 5KUMA 2A06H 2IJHA 2JVDA 3H9VA 1BSMA 2FL4A 3LSQA 4KL1A 5KLVH 3NXSA 3ZN0A 1HNZO 1N33B 4JYYA 2AW9A 4ZHQA 4JI3O 5LMNB 3CC2V 4NTYA 5LHIA 4BIZA 4ABMA 2HVJC 1CEZA 5D5PA 3GWKC 2X6CA 4FFBB 4BAYA 4EFBA 2P7TC 4GKKO 4ZOLA 3ABKC 1WB7A 2N74A 5B3SB 3L74H 1MZEA 3M99B 1H2MA 3QO8A 2RQ6A 3DXRB 4TV9B 1MG1A 1FFXB 4JI6O 3JSNA 4FZ0A 1S72V 3T1HB 4GX2A 3K3WA 3I5DA 1FXVA 3RFRA 4EKWA 4LFCB 3U0ZA 2GHYA 1EZJA 1GN3A 5BXZA 3ZHRA 1MMMA 1XNQO 4DK0A 1THZA 1ZTEA 4K8XA 4FLTA 1NTZH 4LBEC 1M57B 3E8FA 3K06A 1H2SB 1Y6XA 4IIJB 1G4YB 5JWPA 4H44B 3ZRXA 2QWRB 2DYSB 3P30A 4MVZA 2GBOA 1VF6A 3TXSA 4O2AB 5DN6G 3B40A 1XHZA 3ETDA 5BR8B 4O4JB 4O4LB 1GO3F 3F5WC 1LUVA 4AHCA 1XOUA 3SYOA 3L71H 3C90A 1VQMV 3OUFA 1BS3A 3ZIAG 2ADQB 5CBGA 1XNRB 4UVAA 2E5LO 4TV8A 3N2KB 3SJAC 1S76D 2YIDA 4B3RB 4FMTA 3CRRA 1VQ8V 2FTKA 3SJQC 1YJ9V 5KUKA 1DF4A 3ZRVA 4EFEA 2ZM6O 1XBLA 1Q7YW 1JVMA 3EVKA 2HG5C 2HVKC 1GM7A 4RQFA 3KCYA 2VQFO 1DLBA 1RSOB 3U11A 2UXCB 1MNGA 5JQGB 3E8BA 2QR4A 1IZ3A 1M90W 2QKCA 1Y76A 2E3CA 1SETA 4JI2B 1DK1A 4R8CA 2QM7A 4NXMO 1SQFA 4J80A 2PZSA 4X9QA 1T5EA 5IWAO 2WLMA 4QIWF 4X66O 1SQPH 3JARA 5L3DA 2DQ0A 4JAVA 2CTPA 4UCTA 2EBOA 3QNEA 4DV2B 2PGGA 3LUTB 4XDJA 4DRXA 3ASNB 1KYOF 3OGCC 1J5EB 4U7OA 1M9NA 1AJNA 3W7WA 3CCSV 4MTXA 1YI2V 3RYIB 4UVBA 4GLXA 1MZFA 3CC4V 3OMAB 2OWOA 1WPBA 1KU9A 1NKDA 3OFNG 1HNWB 2UXBB 4LF8O 4B3SO 2JEXA 2RN9A 1IBKO 5EBMC 1KECA 2QGNA 2WA3A 4LF4B 4AILC 4I9WA 3OAAG 5IYZB 2M6YA 2MW2B 4O4HA 2GV9A 4LF9O 1GN6A 3H1HH 3CCLV 1HDJA 1Z5WA 2Q67A 4ZIBA 4FZ1A 4CS3A 2Y69C 3L70H 3B4SA 3K5NA 4DR6B 2PI5A 4JI5O 3K9SA 2ZE6A 2WPDG 2QEXV 3PJSK 2CGOA 2QJ1A 2H94A 3WB2A 4WF9V 2CK3G 1OCCB 2YI9A 3MAQA 2PY5A 4KHPO 4MVQA 2GTSA 2YXHA 1MSDA 4G2KA 4DXWA 5LGTA 3UKMA 3E35A 3TETA 1VQNV 2LFSA 4PDLA 1AJPA 1JJOA 2XAHA 2W6IG 1V54C 5LMUB 4JTCB 5JJNB 4K35A 2OCCB 5FNVA 5L3FA 2QWPB 3HKEA 1Q6HA 4U7NA 4GX1A 3CJHB 2DQ3A 5JJJB 4DR3B 5C8YA 2A79B 2IH1C 1M1KW 3AG2C 1PNKA 3R66A 1OCOB 4BIOA 1M56B 2NN4A 2EINC 2ZXWB 4A5UB 3BFRA 3S3XA 1P7GA 2P5OA 3OR7C 2Q9LA 1VIBA 5B1BB 3MHSC 1GKFA 4U3JB 1H38A 1WP7A 3Q4HB 4K0KB 4GYCB 5BMVB 3J81N 3DSQA 3UO3A 4OX9O 4NTXA 4YJ2A 4LNUA 3T4ZA 4B3TO 1AR1B 3RYCB 3QTCA 5DECA 3ABMB 2W6JG 3SPHA 1QNMA 3RBZA 2EZOA 5CBFA 5FLXN 3DC6A 4X1YA 5CA1A 1Q6IA 1Q3EA 4F4LA 1X59A 4CC6A 4JI8B 4DV4O 3STLC 4JZGA 5KMGA 4AQYO 5K1XA 1SZXA 4X64O 3TCUA 1S5JA 4IYIA 4I7ZB 3HPLC 5KHKA 2JJ2G 3TGUH 2P67A 4JI7O 2KG7B 5LXTB 1URFA 1WP8A 4BR6A 5B1AB 2X6AA 3L9DA 2XAJA 2BTOA 2OIGA 3CCEV 2UXNA 1AR5A 1SQVH 4LC1A 4MW8A 1QVGU 1JFFB 4I0XB 2YXYA 5IJ9B 3JYCA 2A7WA 4UV8A 4FLUA 4Q6GA 1QLEC 4JI1B 1EBOA 2BTQB 1HR0O 2AHZA 4N23A 1COWG 5B66Z 3AG7A 3ABTA 3LDEA 4AI8A 2Z3YA 1K4DC 4JGSA 2ZR3A 1BZKA 4FLZA 1N33O 2ZNIA 1K7DA 3CCUV 3GB7C 5LMNO 5FL7G 5KX5A 2FYUH 1XI1A 1ZWIC 2JGDA 3FAVA 5LYJA 2UUCB 3E83A 2F4VO 4CC5A 1AP5A 1RPOA 4GKJB 1TUBA 3ZHQA 1N32B 2DE0X 1SA0B 3EXAA 1KKDA 3RWRD 4NKGB 1K34A 3KZIZ 2IU0A 1VQPV 2LGWA 3TK1A 1GTOA 2B1GA 3B8NA 2HKOA 1BQZA 2Y4UA 2Q73A 3T1YO 3GVMA 3JD1A 4O2BA 3CRAA 1OCRC 1AI5A 1FD9A 4Z2WA 1GM9A 2AZ0A 1QQCA 2VWKA 3ZHUA 2EJRA 5GW7A 1G6UA 1Y74B 2UXXA 3T1HO 1R3KC 3FB7C 4LFCO 3WB1A 2PYJA 1F51A 1VEWA 4FK5C 1NR1A 4TOIA 4DV7B 1XMQB 2WLJA 4RUEA 4UFZA 1JX9A 3ETGA 4LP8A 1AVMA 4DV5B 1YHQV 1MA1A 1S77D 3CP1A 1SKVA 1YCIA 2X7RB 4D7SA 3K04A 4YY3O 2EULA 5BR8O 4JI4B 1GN2A 1JOYA 1EN5A 4DR5B 4GX5A 2DN9A 4H13B 2UXDB 4OXSA 4B3MB 3K79A 1IBLO 1ROPA 5AG2A 3ASOC 1EZVH 2R70A 5CMUA 3F7YC 4TQDA 1XNRO 2YEVA 1K9MW 2HEPA 3JD4A 3ZJZA 1J95A 2EJ7A 1K3EA 3VQVA 4TV8B 1WNSA 3FFQA 4GUNA 3S3WA 2Q7EA 4UCSA 4HNAA 1HW7A 2WSSG 1G8MA 4DV1B 3N2GB 4X65O 2AGAA 4WFGA 1LUWA 1JJ2U 4XDLA 1RM1B 2UXCO 1TAEA 3ZHSA 1P49A 5H9CA 4DR4B 1OZ0A 1D2DA 1SESA 1Z5VA 4FJCC 4CH5A 4OGQB 1F7YA 5EYPB 2KSDA 1ZLZA 4JI2O 1EFRG 2ITDC 1QR8A 5CN0A 4D7TA 1QHTA 3CMAV 5CBHA 1W0JG 2FMLA 4KXRA 4MW3A 2ZE5A 5DM6V 3BVOA 3AG3B 3I55V 2OIEA 2A3QA 4TSFG 4BW9A 2HJDA 5IT9N 1N36B 3H01A 3ML0A 5ITZA 4LR3A 4DV2O 4E2LA 4IGGA 2XOKG 4QE9A 1KP2A 1R6TA 1YTFD 3L72H 4ZI7A 4LF5B 3OEEG 3CD6V 3K0GA 3BA8A 2JK5C 2OCHA 2WA4A 5LA6A 3UCSC 2AXTZ 1TVKB 1P7BA 1Q5OA 3GWOA 4ASUG 5KHJA 1H2LA 3G71V 5LHGA 1AR4A 1KUQA 1HNWO 2XHBA 2YSUB 3HKCB 3DTUB 1GN4A 5CB4B 1M4UA 4LF4O 2CDYA 3C3TA 3APOA 4PELA 3BCCH 1D5AA 1I5XA 3AG4C 1KP3A 3JCUZ 1AI4A 3B77A 3LSSA 5EZYA 3C3SA 3SGIA 5J2UA 5H6RA 4MVMA 1VQOV 3JD3A 2ZIOA 5CA0B 3ZCCA 5KHHA 3FYIB 2CTQA 1P4RA 4ICGA 2ZE8A 3CRQA 2K1EA 4X88A 3THOA 5GTHZ 1XDCA 2IW5A 2BOCC 1VF6C 3G80A 2IBZH 4U3FH 4X1IA 1KQSU 3K0DA 4WFAV 2P06A 2BCCH 2RDCA 4BWAA 3UM7A 2HJFC 5B1OA 3CB2A 1KMIZ 3ZHTA 5B5EZ 3BY6A 3OMIB 2IJKA 1YSCA 1YXBA 2LQTA 3RYFA 2EIKC 4YHHB 3SDLA 2DJVA 3KKYA 1I08A 2QTOA 1VF5B 5LP6A 1WA8A 1QBZA 4LWSA 5EK0A 4LFBB 5LMUO 4PDRA 1V54B 1R3LC 4O4IB 1TUEB 1V9PA 4LFAB 4PI2A 1OJHA 2DWDC 2CH7A 1F4MA 3JAKA 2ZNJA 2K9PA 4I4TA 2GUZA 4DR3O 2YS8A 4XDKA 2WLHA 3UT5A 1FXKA 2RJZA 3AG2B 2V4DA 3JSLA 4PA3A 1GRJA 2GTAA 3HKBA 4X20B 2EINB 2UUBB 5LOVB 2ITCC 2XTAA 2QM8A 3JALB 1Q6UA 4L87A 4LH7A 3LDCA 1XL4A 5LGUA 3CCRV 4UCRA 5J2TB 3WG7B 1K73W 2HFEC 3E2EA 3FD9A 2JIZG 2P6JA 3SYAA 2WLIB 1M5IA 4NXNB 2Z0AA
chains in the Genus database with same CATH topology
3ZRSA 1H8EG 4RAIA 3LDDA 4HZ3A 1K8AW 3T4ZA 1S5HC 1Y66A 5EBLC 1S0VA 1AR1B 1Y4MA 5H6QA 3E89A 2OTLV 3ABMB 4MS2A 1WLEA 2W6JG 5IDJA 3SPHA 1B6QA 3OUSA 3RBZA 2EZOA 2R9RB 1VQLV 4G27B 5CBFA 2WLNA 4JYCA 1QLNA 2IJJA 3MD0A 2R9IA 4F4LA 4QJFB 3LNMB 1V55C 1GMGA 1NQTA 3D36A 4WFFA 3SPJA 3STLC 5HFMA 1VQ5V 2V1DA 1YJWV 3EHBB 1YIJV 1BHBA 3ZMTA 3I56V 3CMEV 2Y69B 3TCUA 1GM8A 4CZZA 1NBMG 3HPLC 3A0RA 2JJ2G 3SPIA 1NVPD 1FXHA 2A9HA 4QE7A 4PA6A 2P67A 3VOUA 1E1RG 2ZQMA 1Q82W 4H37A 2JJ1G 1VQ9V 5IY5B 5KA5A 5L3EA 2LFRA 4X89A 1IXMA 5B1AB 5KA6A 4DO2A 2KB1A 2Z5UA 4TWKA 2X6AA 4JTDB 4QPJA 3SYCA 5EBWC 2XAJA 4Q20A 4HYOA 1CP9A 1QLEB 5IY5C 3CCEV 2UXNA 3ETEA 4LC1A 1QR9A 4MW8A 2QKSA 1QVGU 4KUMA 1R3JC 1SRYA 3JYCA 5B1AC 4R7CA 1NH2B 2ZDIC 4UV8A 4PDVA 1H2GA 4MTGA 3AEIA 3VBBA 1QLEC 4GX0A 3RVYA 1EBOA 2XAQA 1FXKB 1UJWB 2WLLB 2AHZA 4N23A 1COWG 1S3JA 3OE7G 1K33A 4UV9A 1QCEA 3ABTA 1YTFB 3LDEA 2Z3YA 1K4DC 4JGSA 4P9PA 4RUFA 5LBQA 3ZRWA 4JTAB 4R6ZA 3SYPA 3ABLC 2ZR3A 3FYEB 1FXKC 3FB8C 4J9ZB 1K7DA 2QA4V 3CCUV 4J9YB 3GB7C 5FL7G 4P9OA 4G28B 5KUMA 1ZWIC 2IJHA 1E1QG 1QVFU 1RM1C 3ZMUA 4PA4A 2EIJB 3E83A 4MTFA 1MABG 3LSQA 2HLDG 1RPOA 3K08A 3NXSA 3ZN0A 1KD1W 1Q86W 1AI6A 2EZPA 1FFTB 1KKDA 3IC7A 1OCRB 3ZN1A 3G4SV 1K34A 3D3IA 3CC2V 2IU0A 2WAMA 1VQPV 5LHIA 4N21A 2EIJC 3TK1A 4JPRA 1L1FA 1GTOA 2B1GA 3B8NA 2HKOA 3FB5C 4PA9A 4KFMA 1DTOA 2EIMB 3W7SA 2HR3A 3JD1A 4BIZA 2HVJC 1KC8W 1CEZA 1OCRC 1AI5A 3AG3C 2X6CA 1GM9A 4BAYA 3T1CA 2EJRA 1V55B 2P7TC 4MTOA 2IJIA 5GW7A 3RW0A 3ABKC 2UXXA 5L3GA 2ZD9A 1R3KC 2EIMC 3FB7C 4P30A 5B3SB 2NLJC 1F51A 1K4CC 3M99B 1NR1A 4FK5C 3QO8A 5EC1C 3CXCU 4PDMA 3X2QB 1MG1A 2WLJA 1VQ7V 3DGEA 4P2ZA 4RUEA 3CPWU 3CCMV 2P90A 3W7UA 1JX9A 3ETGA 4LP8A 1S72V 4GX2A 3K3WA 5B3SC 4JF3A 1YHQV 1FXVA 4EKWA 3CP1A 1S77D 4RO2A 2GHYA 2X7RB 1EZJA 3K04A 3ASOB 3X2QC 1JOYA 1THZA 1PL0A 4GX5A 3JCZA 4LBEC 5LGNA 5BZBA 1M57B 4OXSA 3E8FA 1PNMA 3QO7A 2DW4A 1R73A 3K06A 3CC7V 1G4YB 3K79A 4LCUC 1ROPA 3ZRXA 2B5UA 2DYSB 3ASOC 3P30A 4MVZA 5CMUA 5DN6G 3ETDA 3F7YC 1PD3A 2YEVA 1GO3F 1K9MW 3IGAC 3F5WC 3AG1B 2OTJV 3JD4A 3ZJZA 1M57C 1J95A 3E8HA 3SYOA 2GSMB 5L3CA 5IYCO 1K3EA 4MVSA 2DYSC 1W0KG 5C93A 1JQ0A 1VQMV 3OM3B 3OUFA 2Y48A 3ZIAG 4H33A 3T4DA 3ABUA 5CBGA 4UVAA 1H8HG 3AG1C 4WFEA 1S76D 3ABLB 2WSSG 1FS0G 4WFBV 4FMTA 3ZRWB 1G8MA 4KP4A 3F7VC 2Q68A 1VQ8V 2WLKA 2OT5A 2FTKA 3SJQC 3R65A 1YJ9V 2BOBC 2MK3A 4WFGA 1JJ2U 5KUKA 4XDLA 1RM1B 1DF4A 3ZRVA 4RQEA 3G6EV 4JASA 4QNHB 5H9CA 4FPPA 5HFLA 5EC2C 1Q7YW 4UVCA 1OZ0A 1F23A 1SESA 4FJCC 3ZMSA 3WFVA 1JVMA 2HG5C 2HVKC 1GM7A 3KG2A 4RQFA 1NJIW 1DLBA 5J9PC 1EFRG 2ITDC 3E8BA 1QR8A 2M7WA 5CN0A 1JCHA 4UUJC 5E1AC 3CMAV 5CBHA 1W0JG 1AJQA 1M90W 4MW3A 1NH2D 3E86A 5DM6V 4TT3G 5IYBO 2H8PC 2IU3A 3AG3B 3I55V 4TSFG 1VQ6V 1AI7A 3K03A 5IYDO 1SETA 3H01A 3ML0A 3W7TA 4I5SA 2EILB 2Q69A 4E2LA 3ABKB 1K92A 2W0FC 2DYRB 4R8CA 2QM7A 2XOKG 4QE9A 1KP2A 4BIUA 2WLMA 4QIWF 4MSWC 5L3DA 1YTFD 2DQ0A 1MSWD 4JAVA 4MVOA 3ZMVA 3HB3B 1RPRA 2F43G 3CCVV 2X0LA 3OEEG 3CD6V 3K0GA 2EBOA 2EILC 1R3IC 1DF5A 2JK5C 3QNEA 4MT8A 4Z1MG 2DYRC 3T2MA 1LNQA 2NNUA 3GWOA 1P7BA 4XDJA 3LUTB 4ASUG 1BMFG 3ASNB 1NVPB 3G71V 3OGCC 3CCJV 2X6BA 5LHGA 2ZXWC 3WG7C 3OR6C 1GK9A 4U7OA 5B1BC 3AG4B 1ENVA 2WLIA 1M9NA 1AJNA 1I5YA 2YSUB 4WFHA 3W7WA 3FKSG 3CCSV 4MTXA 1YI2V 3ASNC 3DTUB 2WWWA 1PKXA 4UVBA 2C2AA 3QO5A 4X8AA 2JDIG 4PELA 2XASA 3CC4V 3OMAB 2XAFA 1I5XA 3AG4C 1KP3A 1AI4A 1NKDA 5L3BA 5CA3A 2LP7A 3B77A 3LSSA 3OFNG 5H6RA 4MVRA 2JEXA 3ABMC 4MVMA 1VQOV 1PNLA 3JD3A 3ZCCA 2YEVB 5EBMC 3FYIB 1KECA 2XAGA 3IFXA 5LHHA 1JPXA 3MHHC 3JD0A 1P4RA 2K1EA 4I9WA 4X88A 2QE7G 3OAAG 4UXNA 3K9AA 2IW5A 2Q6AA 2BOCC 1NR7A 3SYQA 3FB6C 2ZR2A 3OMNB 3CCLV 2DWEC 1K5QA 4JYBA 3CCQV 1SZTA 1K5SA 2Q67A 3B8MA 1KQSU 1VQ4V 2EIKB 3K0DA 4WFAV 2IH3C 3UM7A 2HJFC 5B1OA 1BL8A 2Y69C 4FIPC 2PI5A 2WPDG 2QEXV 3BY6A 3OMIB 3PJSK 1HWYA 4GT1A 2IJKA 1YSCA 1Q81W 2EIKC 4YXWG 1SERA 4PA7A 2H94A 1R6KA 4WF9V 1WPXA 2CK3G 1OCCB 2ZDIA 5B1NA 2QTOA 1ORQC 1OCZB 1N8RW 1QBZA 3OEHG 4QPKA 4MVQA 5EK0A 4ZBMA 2A0LA 4PDRA 1V54B 1R3LC 3SPCA 1TUEB 3JD2A 4G2KA 4DXWA 5LGTA 2D3OW 3UKMA 3E35A 1R6NA 1YITV 2DWDC 1F4MA 1OCCC 3TETA 1VQNV 4R50A 2LFSA 4PDLA 1AJPA 1OCZC 2XAHA 2W6IG 1W2BU 1V54C 4JTCB 4XDKA 2WLHA 1FXKA 2WLLA 3AG2B 2XNDG 1XL6A 3P32A 4PA3A 1YJNV 2OCCB 5L3FA 1AROP 3SPGA 4U7NA 2EINB 3ZMZA 1E79G 2V7QG 4GX1A 2ITCC 3W7XA 2AHYA 2DQ3A 4WCEV 2PI4A 2A79B 2QM8A 2IH1C 4XBFA 4GCZA 4L87A 1M1KW 4CBCA 3AG2C 1CPYA 1K97A 1PNKA 3LDCA 1OCOB 1XL4A 4MVUA 1M56B 2OCCC 3E8GA 3OW2U 5LGUA 2JEUA 3BEHA 3CCRV 2EINC 4BW5A 2ZXWB 3WG7B 4JAUA 1VQKV 1K73W 1BHAA 3OR7C 2HFEC 5B1BB 3MHSC 2B1IA 1GKFA 4ZKIA 3E2EA 1H38A 1F4NA 2JIZG 2ATKC 3EFFK 1OCOC 1M56C 2P6JA 3RVZA 3SYAA 4HAMA 2WLIB 3CYOA 3STZC 1MOFA 1OHHG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRS A;  1ZWI C;  5EBM C;  3AG1 C;  3IFX A;  4RAI A;  3LDD A;  4HZ3 A;  4WFE A;  4PA4 A;  3T4Z A;  1S5H C;  3E83 A;  4MTF A;  5EBL C;  2K1E A;  4I9W A;  4X88 A;  3E89 A;  3K08 A;  3F7V C;  2Q68 A;  2WLK A;  4MS2 A;  3SJQ C;  2Q6A A;  2BOC C;  3R65 A;  2BOB C;  4WFG A;  3SPH A;  3SYQ A;  3FB6 C;  5KUK A;  3OUS A;  4XDL A;  3RBZ A;  1KKD A;  2DWE C;  2R9R B;  4QNH B;  2Q67 A;  4G27 B;  3K0D A;  5EC2 C;  5CBF A;  2WLN A;  2IH3 C;  3UM7 A;  2EIJ C;  2HJF C;  4P9O A;  1BL8 A;  2Y69 C;  4F4L A;  3FB5 C;  4PA9 A;  4KFM A;  3LNM B;  1V55 C;  1JVM A;  2HG5 C;  2HVK C;  3KG2 A;  4WFF A;  2HVJ C;  3SPJ A;  3STL C;  3PJS K;  1OCR C;  3AG3 C;  5J9P C;  2X6C A;  2ITD C;  2EIK C;  3E8B A;  3TCU A;  4PA7 A;  3T1C A;  2P7T C;  4MTO A;  4UUJ C;  5E1A C;  3RW0 A;  5CBH A;  3ABK C;  2QTO A;  1ORQ C;  2ZD9 A;  4MW3 A;  1R3K C;  2EIM C;  3E86 A;  3FB7 C;  3HPL C;  4MVQ A;  4P30 A;  5EK0 A;  2H8P C;  3SPI A;  4ZBM A;  2A9H A;  2NLJ C;  2A0L A;  4PDR A;  4QE7 A;  1K4C C;  1R3L C;  4PA6 A;  3SPC A;  3K03 A;  3VOU A;  2Q69 A;  5EC1 C;  4DXW A;  4PDM A;  4H37 A;  3UKM A;  2W0F C;  4R8C A;  3T4D A;  2WLJ A;  2DWD C;  3TET A;  1OCC C;  4P2Z A;  4QE9 A;  4X89 A;  4RUE A;  4R50 A;  4PDL A;  1OCZ C;  2WLM A;  4LP8 A;  4GX2 A;  4MSW C;  2KB1 A;  5B3S C;  4TWK A;  2X6A A;  4JTD B;  4MVO A;  3SYC A;  5EBW C;  1V54 C;  4EKW A;  4RO2 A;  4HYO A;  4JTC B;  4XDK A;  2WLH A;  2WLL A;  3K04 A;  3K0G A;  1XL6 A;  1R3I C;  2EIL C;  2JK5 C;  4PA3 A;  5IY5 C;  2DYR C;  3X2Q C;  3T2M A;  3SPG A;  4MW8 A;  1LNQ A;  2QKS A;  1P7B A;  4XDJ A;  3LUT B;  4GX5 A;  1R3J C;  5B1A C;  3JYC A;  4GX1 A;  4R7C A;  4LBE C;  2ITC C;  3OGC C;  4PDV A;  2AHY A;  2X6B A;  2ZXW C;  3WG7 C;  5BZB A;  4MTG A;  3OR6 C;  4OXS A;  3E8F A;  2A79 B;  2IH1 C;  3K06 A;  1QLE C;  5B1B C;  4GX0 A;  1G4Y B;  4LCU C;  3RVY A;  3AG2 C;  4CBC A;  2WLI A;  3LDC A;  1XL4 A;  3ASO C;  4MVU A;  4MVZ A;  2WLL B;  2OCC C;  3E8G A;  2AHZ A;  3BEH A;  3F7Y C;  4WFH A;  2YEV A;  2EIN C;  4BW5 A;  3ASN C;  3IGA C;  3F5W C;  3OR7 C;  2HFE C;  3LDE A;  3ZJZ A;  1M57 C;  1J95 A;  1K4D C;  3E8H A;  4P9P A;  4RUF A;  4X8A A;  3SYO A;  4JTA B;  4R6Z A;  3SYP A;  3AG4 C;  3EFF K;  3ABL C;  2ATK C;  4MVS A;  2DYS C;  1OCO C;  1M56 C;  3RVZ A;  3SYA A;  3FB8 C;  2WLI B;  3OUF A;  4J9Z B;  4J9Y B;  4MVR A;  3ABM C;  3GB7 C;  4MVM A;  3STZ C;  4H33 A;  4G28 B;  5KUM A;  5CBG A; 
#chains in the Genus database with same CATH topology
 3ZRS A;  1H8E G;  5K1P A;  4X1K B;  3ZHV A;  2DOS A;  1S5H C;  1B04 A;  1Y4M A;  5H6Q A;  4JI8 O;  1WLE A;  4FM0 A;  3OUS A;  1XHX A;  2O57 A;  4FFB A;  1VQL V;  2RNB A;  3JAT B;  2WLN A;  2VS0 A;  3LNN A;  2E74 B;  3BRC A;  2EX3 A;  2YIB D;  3LNM B;  4IHJ A;  1FJG O;  2CTR A;  4WFF A;  5HFM A;  1VQ5 V;  2ZIM A;  3EHB B;  4DV0 B;  3DXR A;  5IJ0 B;  4TV9 A;  3ZMT A;  1FFX A;  4TUY B;  1AIL A;  3K59 A;  4DV3 O;  2ODM A;  5JCO A;  1GM8 A;  4I9Q A;  3SPI A;  3A0R A;  1FXH A;  1NZ6 A;  2A9H A;  5JCO C;  4JI6 B;  1YZB A;  1IXB A;  3VOU A;  2ZQM A;  1VQ9 V;  2JJ1 G;  3ZS8 C;  3U10 A;  3M8A A;  2LFR A;  3AK3 A;  5KA6 A;  3JAW A;  4DO2 A;  1XNQ B;  1IBM B;  2LGQ A;  2KB1 A;  5EBW C;  4JI1 O;  4IIJ A;  4Q20 A;  1CP9 A;  1QLE B;  1RP3 B;  4O2A A;  2Q7H A;  5IY5 C;  4O4J A;  1BCC H;  4KUM A;  3RGB A;  1NH2 B;  4R7C A;  1H2G A;  3G67 A;  3KCX A;  3OGI B;  3VBB A;  1PM9 A;  2WLL B;  4J41 A;  1SQQ H;  3B2E E;  1XMO O;  2UUC O;  4F6R A;  4P9P A;  4JTA B;  3RT3 C;  4J11 A;  1N32 O;  3FYE B;  4UCO A;  2QA4 V;  4J9Y B;  5H2F Z;  2Q0O C;  1E1Q G;  3ZMU A;  2PTM A;  3CRC A;  4PA4 A;  4MTF A;  1MAB G;  2LJ2 A;  4NVP A;  1Q86 W;  3IC7 A;  1RSO A;  1OCR B;  1SQB H;  2P4K A;  5GON B;  3JAS B;  4O2B B;  1U96 A;  2EIJ C;  2Q0A A;  4B7K A;  3CRM A;  3J80 N;  4PA9 A;  1N34 B;  3ZX6 A;  1BGY H;  1O9H A;  1JR9 A;  4DV7 O;  4UB8 Z;  1XMQ O;  3RYH B;  1YVW A;  1V55 B;  4MTO A;  2IJI A;  3RW0 A;  4DK1 A;  1NTM H;  2ZD9 A;  2EIM C;  3AK2 A;  4DV5 O;  4X66 B;  4JI4 O;  5EC1 C;  3L75 H;  1TGO A;  1W59 A;  4J10 A;  4P2Z A;  3CCM V;  3CPW U;  2UUA O;  2ETN A;  3W7U A;  4IT5 A;  4B3M O;  4JF3 A;  5F2V O;  3K58 A;  1UPG A;  3ASO B;  3OTO B;  3X2Q C;  3L73 H;  2Q4P A;  1XQ8 A;  3RYI A;  1I7F A;  4LH6 A;  5LL6 Y;  5BZB A;  2P22 C;  1PNM A;  4DR1 B;  1R73 A;  2VQE B;  4JZ2 A;  3HKD B;  2BSK B;  1VMG A;  2QTS A;  1Z2G A;  1PD3 A;  3OD4 A;  1P84 F;  1SQX H;  2W0X A;  4DV6 B;  3IGA C;  1XRE A;  3E22 B;  2OTJ V;  1I94 O;  4I55 B;  3E8H A;  4LF8 B;  5IYZ A;  1LR1 A;  4DV1 O;  1B3Q A;  4MVS A;  3H1L H;  1JQ0 A;  2Y48 A;  3T4D A;  3ABU A;  1H8H G;  2P4V A;  3AG1 C;  4DR4 O;  4FM2 A;  2ZKO A;  3ABL B;  1FS0 G;  1L0L H;  2FKX A;  3ZRW B;  3F7V C;  2WLK A;  2OT5 A;  4HBN A;  4I50 B;  4FVM A;  4RQE A;  1IX9 A;  2CE4 A;  5HFL A;  4DUZ B;  5EC2 C;  3CXH F;  4DR2 B;  1F23 A;  1VP7 A;  2L6L A;  1YDX A;  4IL6 Z;  1N36 O;  1NU1 H;  5A9G A;  1N0J A;  1H2N A;  5J9P C;  4ZHQ B;  4CH4 A;  5EIB D;  1JCH A;  4UUJ C;  1FYJ A;  5E1A C;  4DR7 B;  3E86 A;  2IU3 A;  2H3O A;  3IC9 A;  3SJB C;  1ZUQ A;  3VQW A;  5IYD O;  2Q69 A;  4J7Z A;  3ABK B;  1K92 A;  3CJH A;  4ZOL B;  4MVO A;  3HB3 B;  1RPR A;  2F43 G;  3CCV V;  1HNX B;  2EIL C;  1R3I C;  1DF5 A;  4MT8 A;  2DYR C;  5KAI Z;  2HP8 A;  4JYA B;  5A2Q N;  1A32 A;  2AZ2 A;  1BMF G;  1NVP B;  1Y67 A;  2E76 B;  2ZXW C;  4U3J A;  4B08 A;  5B1B C;  3AG4 B;  1ENV A;  4OPA A;  3Q4H A;  3DC5 A;  3SR2 C;  1I5Y A;  4WFH A;  3FKS G;  5BMV A;  1Q8I A;  4NTW A;  2C2A A;  3QO5 A;  2JDI G;  3A2F A;  1ZSP A;  2XAF A;  3BHP A;  5L3B A;  5CA3 A;  2LP7 A;  2N05 A;  4B3T B;  5IE9 A;  1WB8 A;  2QDO A;  4MVR A;  3ABM C;  1PNL A;  1ZL8 A;  1RFY A;  2XAG A;  1QU7 A;  2F23 A;  2YXL A;  3OTF A;  1JPX A;  3MHH C;  3JD0 A;  1WJZ A;  2QE7 G;  4UXN A;  3A0H Z;  1NR7 A;  3SYQ A;  2ZR2 A;  3OMN B;  4B3R O;  1K5Q A;  4JYB A;  4DYL A;  1SZT A;  4YHH O;  1B06 A;  3B8M A;  2EIK B;  1UFI A;  1M93 A;  4DW1 A;  1HWY A;  4GT1 A;  2Q7G A;  3CHX A;  4LFA O;  5LXT A;  4YXW G;  1SER A;  4PA7 A;  1PP9 H;  4RWU A;  4K8Z A;  3SJC C;  2QKA A;  4JV5 B;  2ZDI A;  5B1N A;  2R9A A;  1ORQ C;  1N8R W;  2R72 A;  2XT9 A;  2PUS A;  2D3O W;  1JFF A;  4I0X A;  1O9G A;  3BAB A;  1SQG A;  1OCZ C;  3K5O A;  1W2B U;  3HKB B;  3HR0 A;  3M7M X;  1Y76 B;  4YJ3 A;  2BTQ A;  1US6 A;  3N27 A;  1XL6 A;  3P32 A;  4FLW A;  1ARO P;  3SPG A;  2NR5 A;  1E79 G;  1Q43 A;  3TJT A;  2PI4 A;  4X62 B;  3JAR B;  4GCZ A;  4CBC A;  1CPY A;  1K97 A;  4NXN O;  2GDS A;  3OW2 U;  2JEU A;  3BEH A;  2HHH B;  1BQ0 A;  1J5E O;  4BW5 A;  2VRZ A;  1VQK V;  4JAU A;  4WBN A;  5H5N A;  4DRX B;  1TA8 A;  2B1I A;  3K5M A;  4DUY B;  1F4N A;  4UB6 Z;  2ATK C;  1SA0 A;  4LF6 B;  1WN7 A;  3RVZ A;  1L8D A;  3CYO A;  2F4V B;  1OHH G;  4JI0 B;  4RAI A;  3LDD A;  1K8A W;  4YIP A;  1Y66 A;  1D5N A;  2UXB O;  1S0V A;  1ZAU A;  2Y0I A;  4NB5 A;  5IDJ A;  4DV0 O;  3QG5 A;  1BT8 A;  5JH7 A;  4PV1 B;  2R9R B;  2F95 B;  4G27 B;  4IHJ B;  3T1Y B;  3OT7 A;  4JYC A;  1Y74 A;  2IJJ A;  1QLN A;  3MD0 A;  2R9I A;  4UCU A;  4QJF B;  1NQT A;  3D36 A;  3P3P A;  4O4H B;  1PPJ H;  2V1D A;  1YIJ V;  1BHB A;  1NT2 B;  4DR6 O;  3D36 C;  2Y69 B;  1IBM O;  2UU9 B;  2KQX A;  4PA6 A;  1PL4 A;  4LF7 B;  3TXQ A;  3JAW B;  4H37 A;  5IY5 B;  5JVD A;  5KA5 A;  4Z1V A;  5L3E A;  4X89 A;  3CE2 A;  1PV0 A;  4YY3 B;  2JS5 A;  2Z5U A;  4TWK A;  2ILM A;  2FB5 A;  4CH6 A;  2F1M A;  4EB6 A;  2ARH A;  2QM4 A;  2RMK B;  3PN1 A;  1SRY A;  1IBL B;  2PYL A;  4FM1 A;  4W4L A;  4PDV A;  2YDE A;  5LP6 C;  1FAF A;  4F6R B;  2XAQ A;  1UJW B;  4J7J A;  3O9O A;  5FNV B;  3UO2 A;  3HKE B;  3F5T A;  4OPH A;  4RUF A;  4R6Z A;  5C8Y B;  3SYP A;  3N2G A;  3CWB H;  3CX5 F;  1FXK C;  1NTK H;  4NR1 A;  4J9Z B;  1S5L Z;  1QVF U;  1RM1 C;  4X65 B;  2EIJ B;  3ICX A;  3LSU A;  2HLD G;  1N34 O;  4K0K O;  3K08 A;  5EYP A;  1KD1 W;  1AI6 A;  2EZP A;  1FFT B;  1DGS A;  3ZN1 A;  3QVN A;  1N0N A;  3G4S V;  1IVS A;  3D3I A;  3D8C A;  2WAM A;  4N21 A;  4YJ2 B;  4JPR A;  1L1F A;  2D2C B;  2QWQ B;  4LNU B;  4L8J A;  3FB5 C;  4KFM A;  1DTO A;  2EIM B;  3W7S A;  2HR3 A;  1KC8 W;  5FPO A;  3FX7 A;  1HNZ B;  3AG3 C;  1XUQ A;  2BE3 A;  4JI3 B;  3D3Q A;  3B09 A;  3T1C A;  1X4T A;  4X1Y B;  5CA1 B;  5L3G A;  1R1B A;  4P30 A;  2OYQ A;  4FLV A;  4QGP A;  2NLJ C;  1K4C C;  4YIO A;  5KMG B;  3OTO O;  3CXC U;  4PDM A;  3X2Q B;  1TVK A;  1VQ7 V;  3DGE A;  2P90 A;  4GKK B;  4DR1 O;  5KAF Z;  5B3S C;  2DMX A;  3ZED A;  4RO2 A;  2VQE O;  3P3N A;  1AP6 A;  3HKC A;  1PL0 A;  4DV6 O;  5CB4 A;  3JCZ A;  5LGN A;  3O65 A;  3QO7 A;  2DW4 A;  1HP8 A;  3CC7 V;  1CXZ B;  4LCU C;  1IDS A;  1FPO A;  2B5U A;  3CS5 A;  5CA0 A;  3AG1 B;  1M57 C;  3IAY A;  2GSM B;  5L3C A;  5IYC O;  2B9Z A;  4O4L A;  5C93 A;  2DYS C;  1W0K G;  3OM3 B;  4H33 A;  4DUZ O;  1EN4 A;  4DR2 O;  4WFE A;  4WFB V;  4KP4 A;  2Q68 A;  5FPR A;  3N2K A;  2JGU A;  3R65 A;  2BOB C;  2MK3 A;  3G6E V;  4JAS A;  4QNH B;  4FPP A;  5KX5 B;  1Q90 D;  4NYK A;  4GKJ O;  2JGD B;  4UVC A;  2E75 B;  2E5L B;  3FAV B;  5LYJ B;  4DR7 O;  3ZMS A;  3WFV A;  3KG2 A;  1NJI W;  4O4I A;  1TUB B;  2M7W A;  2ZM6 B;  2XUM A;  1AJQ A;  3K57 A;  1NH2 D;  3K5L A;  5BY1 A;  4TT3 G;  5JQG A;  5IYB O;  2H8P C;  3AK1 A;  1HNX O;  1VQ6 V;  1AI7 A;  3K03 A;  3W7T A;  4I5S A;  1ZX3 A;  2EIL B;  2VQF B;  4B7E A;  2W0F C;  2DYR B;  4X20 A;  3VQX A;  4JYA O;  5LOV A;  4GZR B;  4CS4 A;  4BIU A;  1H2K A;  4MSW C;  3JAL A;  1MSW D;  3ZMV A;  2X0L A;  2YIB A;  4EEQ A;  4Z1M G;  4FLY A;  5J2T A;  2ZE7 A;  3T2M A;  3BPZ A;  1LNQ A;  2NNU A;  4NXM B;  2Q5Z A;  2Y0P A;  2VWJ A;  2X6B A;  3CCJ V;  3WG7 C;  5IWA B;  2RCV A;  3OR6 C;  1GK9 A;  1KBH A;  4DR5 O;  3ETQ A;  2WLI A;  3RN4 A;  2UXD O;  4CH3 A;  1I0H A;  2ZCE A;  3ASN C;  2WWW A;  1PKX A;  4X1K A;  1G1X B;  1YF2 A;  1WAZ A;  4X8A A;  2XAS A;  1ZL8 B;  2YC0 A;  1JA8 A;  4FFK A;  3H1K H;  3IJ4 A;  2YEV B;  3JAT A;  3IFX A;  5LHH A;  2ZIN A;  2PF4 E;  4PI0 A;  3K9A A;  3WB0 A;  2KKW A;  2Q6A A;  1YEW A;  3FB6 C;  3WU2 Z;  2DWE C;  5IJ0 A;  3CCQ V;  4B3S B;  1K5S A;  4TUY A;  3G6B A;  2YUA A;  1IBK B;  1VQ4 V;  1FJG B;  3BA9 A;  2IM9 A;  2IH3 C;  4JV5 O;  5E79 Z;  4F6E A;  4HNA B;  3H1J H;  1BL8 A;  4FIP C;  4DV3 B;  4LF9 B;  5GTI Z;  1Q81 W;  1R6K A;  1WPX A;  2LO1 A;  2G38 A;  1NS1 A;  2YIC A;  1OCZ B;  1IUR A;  4QPK A;  3OEH G;  2ZT9 B;  4ZBM A;  2A0L A;  4JAA A;  4JI5 B;  4E4E A;  3SPC A;  2JS3 A;  3JD2 A;  1R6N A;  1YIT V;  4D6T H;  1OCC C;  4YJ3 B;  4R50 A;  1VF7 A;  1GAX A;  4X62 O;  3ZBH A;  4KHP B;  1SF9 A;  4FLX A;  3MDS A;  2WLL A;  2XND G;  2HHH O;  3NR7 A;  5ITZ B;  1YJN V;  1AB3 A;  4LF5 O;  3ZMZ A;  3BAA A;  4TQF A;  2V7Q G;  5KHG A;  3W7X A;  2AHY A;  3A0B Z;  4WCE V;  1OV9 A;  2QWN B;  5JJE B;  4WBN B;  4DUY O;  1EN6 A;  4XBF A;  4ZI7 B;  4LF6 O;  5KHI A;  1XMO B;  4MVU A;  1SS3 A;  2OCC C;  3E8G A;  2CAZ C;  3UQ8 A;  5LA6 B;  1N4C A;  4JI0 O;  1BHA A;  4J42 A;  3QF7 A;  4ZKI A;  4CS2 A;  3EFF K;  1L0N H;  1OCO C;  3CSX A;  1M56 C;  4HAM A;  3STZ C;  1MOF A;  5GON A;  3JAS A;  4UCV A;  2YI8 A;  4PJ0 Z;  4HZ3 A;  5JH7 B;  4PHZ A;  5EBL C;  4IYH A;  2OTL V;  3E89 A;  4MS2 A;  4W4K A;  3RYH A;  1B6Q A;  5EZY B;  5J2U B;  1GH6 A;  2QSA A;  1EM1 A;  3RYC A;  4OX9 B;  2F66 C;  1KKC A;  1V55 C;  1GMG A;  2LW7 A;  2UU9 O;  2Y4T A;  3SPJ A;  4LF7 O;  4DW0 A;  1YJW V;  3A8T A;  2Q8V A;  3I56 V;  4X1I B;  3CME V;  2L35 A;  3CEI A;  4CZZ A;  2JRI A;  1NBM G;  4PD4 F;  1NVP D;  5DED A;  5JVD B;  3J7A U;  4QE7 A;  4DV4 B;  2UUA B;  4AQY B;  4X64 B;  1BE3 H;  1E1R G;  1NI8 A;  4C7U A;  1Q82 W;  3RYF B;  2YIA A;  4LFB O;  2N04 A;  1JMK C;  2LW1 A;  4EB6 B;  1IXM A;  2KG7 A;  2CUG A;  5TIS Z;  5LP6 B;  1WA8 B;  4JTD B;  2F93 B;  4LWS B;  4QPJ A;  3SYC A;  1VAR A;  3APQ A;  4HYO A;  1FKA O;  3HKD A;  2BSK A;  5D5Q A;  2CGN A;  3H1I H;  4JI7 B;  3ETE A;  1QR9 A;  2QKS A;  3E22 A;  1R3J C;  2CH7 B;  5B1A C;  2ZDI C;  3JAK B;  4I55 A;  4I4T B;  4MTG A;  2GUZ B;  1XEQ A;  3AEI A;  1SC5 B;  2UUB O;  4GX0 A;  3RVY A;  5IJ9 A;  3UT5 B;  5EIB C;  1FXK B;  1I94 B;  1XIL A;  1S3J A;  3OE7 G;  2ADP A;  1K33 A;  4UV9 A;  1QCE A;  1YTF B;  4J7K A;  5LBQ A;  3ZRW A;  4K3A A;  2QWO B;  1U97 A;  3JAM N;  2CTW A;  3ABL C;  4I50 A;  3FB8 C;  1KB9 F;  4H0L B;  3VQY A;  1HR0 B;  4P9O A;  4G28 B;  5KUM A;  2A06 H;  2IJH A;  2JVD A;  3H9V A;  1BSM A;  2FL4 A;  3LSQ A;  4KL1 A;  5KLV H;  3NXS A;  3ZN0 A;  1HNZ O;  1N33 B;  4JYY A;  2AW9 A;  4ZHQ A;  4JI3 O;  5LMN B;  3CC2 V;  4NTY A;  5LHI A;  4BIZ A;  4ABM A;  2HVJ C;  1CEZ A;  5D5P A;  3GWK C;  2X6C A;  4FFB B;  4BAY A;  4EFB A;  2P7T C;  4GKK O;  4ZOL A;  3ABK C;  1WB7 A;  2N74 A;  5B3S B;  3L74 H;  1MZE A;  3M99 B;  1H2M A;  3QO8 A;  2RQ6 A;  3DXR B;  4TV9 B;  1MG1 A;  1FFX B;  4JI6 O;  3JSN A;  4FZ0 A;  1S72 V;  3T1H B;  4GX2 A;  3K3W A;  3I5D A;  1FXV A;  3RFR A;  4EKW A;  4LFC B;  3U0Z A;  2GHY A;  1EZJ A;  1GN3 A;  5BXZ A;  3ZHR A;  1MMM A;  1XNQ O;  4DK0 A;  1THZ A;  1ZTE A;  4K8X A;  4FLT A;  1NTZ H;  4LBE C;  1M57 B;  3E8F A;  3K06 A;  1H2S B;  1Y6X A;  4IIJ B;  1G4Y B;  5JWP A;  4H44 B;  3ZRX A;  2QWR B;  2DYS B;  3P30 A;  4MVZ A;  2GBO A;  1VF6 A;  3TXS A;  4O2A B;  5DN6 G;  3B40 A;  1XHZ A;  3ETD A;  5BR8 B;  4O4J B;  4O4L B;  1GO3 F;  3F5W C;  1LUV A;  4AHC A;  1XOU A;  3SYO A;  3L71 H;  3C90 A;  1VQM V;  3OUF A;  1BS3 A;  3ZIA G;  2ADQ B;  5CBG A;  1XNR B;  4UVA A;  2E5L O;  4TV8 A;  3N2K B;  3SJA C;  1S76 D;  2YID A;  4B3R B;  4FMT A;  3CRR A;  1VQ8 V;  2FTK A;  3SJQ C;  1YJ9 V;  5KUK A;  1DF4 A;  3ZRV A;  4EFE A;  2ZM6 O;  1XBL A;  1Q7Y W;  1JVM A;  3EVK A;  2HG5 C;  2HVK C;  1GM7 A;  4RQF A;  3KCY A;  2VQF O;  1DLB A;  1RSO B;  3U11 A;  2UXC B;  1MNG A;  5JQG B;  3E8B A;  2QR4 A;  1IZ3 A;  1M90 W;  2QKC A;  1Y76 A;  2E3C A;  1SET A;  4JI2 B;  1DK1 A;  4R8C A;  2QM7 A;  4NXM O;  1SQF A;  4J80 A;  2PZS A;  4X9Q A;  1T5E A;  5IWA O;  2WLM A;  4QIW F;  4X66 O;  1SQP H;  3JAR A;  5L3D A;  2DQ0 A;  4JAV A;  2CTP A;  4UCT A;  2EBO A;  3QNE A;  4DV2 B;  2PGG A;  3LUT B;  4XDJ A;  4DRX A;  3ASN B;  1KYO F;  3OGC C;  1J5E B;  4U7O A;  1M9N A;  1AJN A;  3W7W A;  3CCS V;  4MTX A;  1YI2 V;  3RYI B;  4UVB A;  4GLX A;  1MZF A;  3CC4 V;  3OMA B;  2OWO A;  1WPB A;  1KU9 A;  1NKD A;  3OFN G;  1HNW B;  2UXB B;  4LF8 O;  4B3S O;  2JEX A;  2RN9 A;  1IBK O;  5EBM C;  1KEC A;  2QGN A;  2WA3 A;  4LF4 B;  4AIL C;  4I9W A;  3OAA G;  5IYZ B;  2M6Y A;  2MW2 B;  4O4H A;  2GV9 A;  4LF9 O;  1GN6 A;  3H1H H;  3CCL V;  1HDJ A;  1Z5W A;  2Q67 A;  4ZIB A;  4FZ1 A;  4CS3 A;  2Y69 C;  3L70 H;  3B4S A;  3K5N A;  4DR6 B;  2PI5 A;  4JI5 O;  3K9S A;  2ZE6 A;  2WPD G;  2QEX V;  3PJS K;  2CGO A;  2QJ1 A;  2H94 A;  3WB2 A;  4WF9 V;  2CK3 G;  1OCC B;  2YI9 A;  3MAQ A;  2PY5 A;  4KHP O;  4MVQ A;  2GTS A;  2YXH A;  1MSD A;  4G2K A;  4DXW A;  5LGT A;  3UKM A;  3E35 A;  3TET A;  1VQN V;  2LFS A;  4PDL A;  1AJP A;  1JJO A;  2XAH A;  2W6I G;  1V54 C;  5LMU B;  4JTC B;  5JJN B;  4K35 A;  2OCC B;  5FNV A;  5L3F A;  2QWP B;  3HKE A;  1Q6H A;  4U7N A;  4GX1 A;  3CJH B;  2DQ3 A;  5JJJ B;  4DR3 B;  5C8Y A;  2A79 B;  2IH1 C;  1M1K W;  3AG2 C;  1PNK A;  3R66 A;  1OCO B;  4BIO A;  1M56 B;  2NN4 A;  2EIN C;  2ZXW B;  4A5U B;  3BFR A;  3S3X A;  1P7G A;  2P5O A;  3OR7 C;  2Q9L A;  1VIB A;  5B1B B;  3MHS C;  1GKF A;  4U3J B;  1H38 A;  1WP7 A;  3Q4H B;  4K0K B;  4GYC B;  5BMV B;  3J81 N;  3DSQ A;  3UO3 A;  4OX9 O;  4NTX A;  4YJ2 A;  4LNU A;  3T4Z A;  4B3T O;  1AR1 B;  3RYC B;  3QTC A;  5DEC A;  3ABM B;  2W6J G;  3SPH A;  1QNM A;  3RBZ A;  2EZO A;  5CBF A;  5FLX N;  3DC6 A;  4X1Y A;  5CA1 A;  1Q6I A;  1Q3E A;  4F4L A;  1X59 A;  4CC6 A;  4JI8 B;  4DV4 O;  3STL C;  4JZG A;  5KMG A;  4AQY O;  5K1X A;  1SZX A;  4X64 O;  3TCU A;  1S5J A;  4IYI A;  4I7Z B;  3HPL C;  5KHK A;  2JJ2 G;  3TGU H;  2P67 A;  4JI7 O;  2KG7 B;  5LXT B;  1URF A;  1WP8 A;  4BR6 A;  5B1A B;  2X6A A;  3L9D A;  2XAJ A;  2BTO A;  2OIG A;  3CCE V;  2UXN A;  1AR5 A;  1SQV H;  4LC1 A;  4MW8 A;  1QVG U;  1JFF B;  4I0X B;  2YXY A;  5IJ9 B;  3JYC A;  2A7W A;  4UV8 A;  4FLU A;  4Q6G A;  1QLE C;  4JI1 B;  1EBO A;  2BTQ B;  1HR0 O;  2AHZ A;  4N23 A;  1COW G;  5B66 Z;  3AG7 A;  3ABT A;  3LDE A;  4AI8 A;  2Z3Y A;  1K4D C;  4JGS A;  2ZR3 A;  1BZK A;  4FLZ A;  1N33 O;  2ZNI A;  1K7D A;  3CCU V;  3GB7 C;  5LMN O;  5FL7 G;  5KX5 A;  2FYU H;  1XI1 A;  1ZWI C;  2JGD A;  3FAV A;  5LYJ A;  2UUC B;  3E83 A;  2F4V O;  4CC5 A;  1AP5 A;  1RPO A;  4GKJ B;  1TUB A;  3ZHQ A;  1N32 B;  2DE0 X;  1SA0 B;  3EXA A;  1KKD A;  3RWR D;  4NKG B;  1K34 A;  3KZI Z;  2IU0 A;  1VQP V;  2LGW A;  3TK1 A;  1GTO A;  2B1G A;  3B8N A;  2HKO A;  1BQZ A;  2Y4U A;  2Q73 A;  3T1Y O;  3GVM A;  3JD1 A;  4O2B A;  3CRA A;  1OCR C;  1AI5 A;  1FD9 A;  4Z2W A;  1GM9 A;  2AZ0 A;  1QQC A;  2VWK A;  3ZHU A;  2EJR A;  5GW7 A;  1G6U A;  1Y74 B;  2UXX A;  3T1H O;  1R3K C;  3FB7 C;  4LFC O;  3WB1 A;  2PYJ A;  1F51 A;  1VEW A;  4FK5 C;  1NR1 A;  4TOI A;  4DV7 B;  1XMQ B;  2WLJ A;  4RUE A;  4UFZ A;  1JX9 A;  3ETG A;  4LP8 A;  1AVM A;  4DV5 B;  1YHQ V;  1MA1 A;  1S77 D;  3CP1 A;  1SKV A;  1YCI A;  2X7R B;  4D7S A;  3K04 A;  4YY3 O;  2EUL A;  5BR8 O;  4JI4 B;  1GN2 A;  1JOY A;  1EN5 A;  4DR5 B;  4GX5 A;  2DN9 A;  4H13 B;  2UXD B;  4OXS A;  4B3M B;  3K79 A;  1IBL O;  1ROP A;  5AG2 A;  3ASO C;  1EZV H;  2R70 A;  5CMU A;  3F7Y C;  4TQD A;  1XNR O;  2YEV A;  1K9M W;  2HEP A;  3JD4 A;  3ZJZ A;  1J95 A;  2EJ7 A;  1K3E A;  3VQV A;  4TV8 B;  1WNS A;  3FFQ A;  4GUN A;  3S3W A;  2Q7E A;  4UCS A;  4HNA A;  1HW7 A;  2WSS G;  1G8M A;  4DV1 B;  3N2G B;  4X65 O;  2AGA A;  4WFG A;  1LUW A;  1JJ2 U;  4XDL A;  1RM1 B;  2UXC O;  1TAE A;  3ZHS A;  1P49 A;  5H9C A;  4DR4 B;  1OZ0 A;  1D2D A;  1SES A;  1Z5V A;  4FJC C;  4CH5 A;  4OGQ B;  1F7Y A;  5EYP B;  2KSD A;  1ZLZ A;  4JI2 O;  1EFR G;  2ITD C;  1QR8 A;  5CN0 A;  4D7T A;  1QHT A;  3CMA V;  5CBH A;  1W0J G;  2FML A;  4KXR A;  4MW3 A;  2ZE5 A;  5DM6 V;  3BVO A;  3AG3 B;  3I55 V;  2OIE A;  2A3Q A;  4TSF G;  4BW9 A;  2HJD A;  5IT9 N;  1N36 B;  3H01 A;  3ML0 A;  5ITZ A;  4LR3 A;  4DV2 O;  4E2L A;  4IGG A;  2XOK G;  4QE9 A;  1KP2 A;  1R6T A;  1YTF D;  3L72 H;  4ZI7 A;  4LF5 B;  3OEE G;  3CD6 V;  3K0G A;  3BA8 A;  2JK5 C;  2OCH A;  2WA4 A;  5LA6 A;  3UCS C;  2AXT Z;  1TVK B;  1P7B A;  1Q5O A;  3GWO A;  4ASU G;  5KHJ A;  1H2L A;  3G71 V;  5LHG A;  1AR4 A;  1KUQ A;  1HNW O;  2XHB A;  2YSU B;  3HKC B;  3DTU B;  1GN4 A;  5CB4 B;  1M4U A;  4LF4 O;  2CDY A;  3C3T A;  3APO A;  4PEL A;  3BCC H;  1D5A A;  1I5X A;  3AG4 C;  1KP3 A;  3JCU Z;  1AI4 A;  3B77 A;  3LSS A;  5EZY A;  3C3S A;  3SGI A;  5J2U A;  5H6R A;  4MVM A;  1VQO V;  3JD3 A;  2ZIO A;  5CA0 B;  3ZCC A;  5KHH A;  3FYI B;  2CTQ A;  1P4R A;  4ICG A;  2ZE8 A;  3CRQ A;  2K1E A;  4X88 A;  3THO A;  5GTH Z;  1XDC A;  2IW5 A;  2BOC C;  1VF6 C;  3G80 A;  2IBZ H;  4U3F H;  4X1I A;  1KQS U;  3K0D A;  4WFA V;  2P06 A;  2BCC H;  2RDC A;  4BWA A;  3UM7 A;  2HJF C;  5B1O A;  3CB2 A;  1KMI Z;  3ZHT A;  5B5E Z;  3BY6 A;  3OMI B;  2IJK A;  1YSC A;  1YXB A;  2LQT A;  3RYF A;  2EIK C;  4YHH B;  3SDL A;  2DJV A;  3KKY A;  1I08 A;  2QTO A;  1VF5 B;  5LP6 A;  1WA8 A;  1QBZ A;  4LWS A;  5EK0 A;  4LFB B;  5LMU O;  4PDR A;  1V54 B;  1R3L C;  4O4I B;  1TUE B;  1V9P A;  4LFA B;  4PI2 A;  1OJH A;  2DWD C;  2CH7 A;  1F4M A;  3JAK A;  2ZNJ A;  2K9P A;  4I4T A;  2GUZ A;  4DR3 O;  2YS8 A;  4XDK A;  2WLH A;  3UT5 A;  1FXK A;  2RJZ A;  3AG2 B;  2V4D A;  3JSL A;  4PA3 A;  1GRJ A;  2GTA A;  3HKB A;  4X20 B;  2EIN B;  2UUB B;  5LOV B;  2ITC C;  2XTA A;  2QM8 A;  3JAL B;  1Q6U A;  4L87 A;  4LH7 A;  3LDC A;  1XL4 A;  5LGU A;  3CCR V;  4UCR A;  5J2T B;  3WG7 B;  1K73 W;  2HFE C;  3E2E A;  3FD9 A;  2JIZ G;  2P6J A;  3SYA A;  2WLI B;  1M5I A;  4NXN B;  2Z0A A; 
#chains in the Genus database with same CATH homology
 3ZRS A;  1H8E G;  4RAI A;  3LDD A;  4HZ3 A;  1K8A W;  3T4Z A;  1S5H C;  1Y66 A;  5EBL C;  1S0V A;  1AR1 B;  1Y4M A;  5H6Q A;  3E89 A;  2OTL V;  3ABM B;  4MS2 A;  1WLE A;  2W6J G;  5IDJ A;  3SPH A;  1B6Q A;  3OUS A;  3RBZ A;  2EZO A;  2R9R B;  1VQL V;  4G27 B;  5CBF A;  2WLN A;  4JYC A;  1QLN A;  2IJJ A;  3MD0 A;  2R9I A;  4F4L A;  4QJF B;  3LNM B;  1V55 C;  1GMG A;  1NQT A;  3D36 A;  4WFF A;  3SPJ A;  3STL C;  5HFM A;  1VQ5 V;  2V1D A;  1YJW V;  3EHB B;  1YIJ V;  1BHB A;  3ZMT A;  3I56 V;  3CME V;  2Y69 B;  3TCU A;  1GM8 A;  4CZZ A;  1NBM G;  3HPL C;  3A0R A;  2JJ2 G;  3SPI A;  1NVP D;  1FXH A;  2A9H A;  4QE7 A;  4PA6 A;  2P67 A;  3VOU A;  1E1R G;  2ZQM A;  1Q82 W;  4H37 A;  2JJ1 G;  1VQ9 V;  5IY5 B;  5KA5 A;  5L3E A;  2LFR A;  4X89 A;  1IXM A;  5B1A B;  5KA6 A;  4DO2 A;  2KB1 A;  2Z5U A;  4TWK A;  2X6A A;  4JTD B;  4QPJ A;  3SYC A;  5EBW C;  2XAJ A;  4Q20 A;  4HYO A;  1CP9 A;  1QLE B;  5IY5 C;  3CCE V;  2UXN A;  3ETE A;  4LC1 A;  1QR9 A;  4MW8 A;  2QKS A;  1QVG U;  4KUM A;  1R3J C;  1SRY A;  3JYC A;  5B1A C;  4R7C A;  1NH2 B;  2ZDI C;  4UV8 A;  4PDV A;  1H2G A;  4MTG A;  3AEI A;  3VBB A;  1QLE C;  4GX0 A;  3RVY A;  1EBO A;  2XAQ A;  1FXK B;  1UJW B;  2WLL B;  2AHZ A;  4N23 A;  1COW G;  1S3J A;  3OE7 G;  1K33 A;  4UV9 A;  1QCE A;  3ABT A;  1YTF B;  3LDE A;  2Z3Y A;  1K4D C;  4JGS A;  4P9P A;  4RUF A;  5LBQ A;  3ZRW A;  4JTA B;  4R6Z A;  3SYP A;  3ABL C;  2ZR3 A;  3FYE B;  1FXK C;  3FB8 C;  4J9Z B;  1K7D A;  2QA4 V;  3CCU V;  4J9Y B;  3GB7 C;  5FL7 G;  4P9O A;  4G28 B;  5KUM A;  1ZWI C;  2IJH A;  1E1Q G;  1QVF U;  1RM1 C;  3ZMU A;  4PA4 A;  2EIJ B;  3E83 A;  4MTF A;  1MAB G;  3LSQ A;  2HLD G;  1RPO A;  3K08 A;  3NXS A;  3ZN0 A;  1KD1 W;  1Q86 W;  1AI6 A;  2EZP A;  1FFT B;  1KKD A;  3IC7 A;  1OCR B;  3ZN1 A;  3G4S V;  1K34 A;  3D3I A;  3CC2 V;  2IU0 A;  2WAM A;  1VQP V;  5LHI A;  4N21 A;  2EIJ C;  3TK1 A;  4JPR A;  1L1F A;  1GTO A;  2B1G A;  3B8N A;  2HKO A;  3FB5 C;  4PA9 A;  4KFM A;  1DTO A;  2EIM B;  3W7S A;  2HR3 A;  3JD1 A;  4BIZ A;  2HVJ C;  1KC8 W;  1CEZ A;  1OCR C;  1AI5 A;  3AG3 C;  2X6C A;  1GM9 A;  4BAY A;  3T1C A;  2EJR A;  1V55 B;  2P7T C;  4MTO A;  2IJI A;  5GW7 A;  3RW0 A;  3ABK C;  2UXX A;  5L3G A;  2ZD9 A;  1R3K C;  2EIM C;  3FB7 C;  4P30 A;  5B3S B;  2NLJ C;  1F51 A;  1K4C C;  3M99 B;  1NR1 A;  4FK5 C;  3QO8 A;  5EC1 C;  3CXC U;  4PDM A;  3X2Q B;  1MG1 A;  2WLJ A;  1VQ7 V;  3DGE A;  4P2Z A;  4RUE A;  3CPW U;  3CCM V;  2P90 A;  3W7U A;  1JX9 A;  3ETG A;  4LP8 A;  1S72 V;  4GX2 A;  3K3W A;  5B3S C;  4JF3 A;  1YHQ V;  1FXV A;  4EKW A;  3CP1 A;  1S77 D;  4RO2 A;  2GHY A;  2X7R B;  1EZJ A;  3K04 A;  3ASO B;  3X2Q C;  1JOY A;  1THZ A;  1PL0 A;  4GX5 A;  3JCZ A;  4LBE C;  5LGN A;  5BZB A;  1M57 B;  4OXS A;  3E8F A;  1PNM A;  3QO7 A;  2DW4 A;  1R73 A;  3K06 A;  3CC7 V;  1G4Y B;  3K79 A;  4LCU C;  1ROP A;  3ZRX A;  2B5U A;  2DYS B;  3ASO C;  3P30 A;  4MVZ A;  5CMU A;  5DN6 G;  3ETD A;  3F7Y C;  1PD3 A;  2YEV A;  1GO3 F;  1K9M W;  3IGA C;  3F5W C;  3AG1 B;  2OTJ V;  3JD4 A;  3ZJZ A;  1M57 C;  1J95 A;  3E8H A;  3SYO A;  2GSM B;  5L3C A;  5IYC O;  1K3E A;  4MVS A;  2DYS C;  1W0K G;  5C93 A;  1JQ0 A;  1VQM V;  3OM3 B;  3OUF A;  2Y48 A;  3ZIA G;  4H33 A;  3T4D A;  3ABU A;  5CBG A;  4UVA A;  1H8H G;  3AG1 C;  4WFE A;  1S76 D;  3ABL B;  2WSS G;  1FS0 G;  4WFB V;  4FMT A;  3ZRW B;  1G8M A;  4KP4 A;  3F7V C;  2Q68 A;  1VQ8 V;  2WLK A;  2OT5 A;  2FTK A;  3SJQ C;  3R65 A;  1YJ9 V;  2BOB C;  2MK3 A;  4WFG A;  1JJ2 U;  5KUK A;  4XDL A;  1RM1 B;  1DF4 A;  3ZRV A;  4RQE A;  3G6E V;  4JAS A;  4QNH B;  5H9C A;  4FPP A;  5HFL A;  5EC2 C;  1Q7Y W;  4UVC A;  1OZ0 A;  1F23 A;  1SES A;  4FJC C;  3ZMS A;  3WFV A;  1JVM A;  2HG5 C;  2HVK C;  1GM7 A;  3KG2 A;  4RQF A;  1NJI W;  1DLB A;  5J9P C;  1EFR G;  2ITD C;  3E8B A;  1QR8 A;  2M7W A;  5CN0 A;  1JCH A;  4UUJ C;  5E1A C;  3CMA V;  5CBH A;  1W0J G;  1AJQ A;  1M90 W;  4MW3 A;  1NH2 D;  3E86 A;  5DM6 V;  4TT3 G;  5IYB O;  2H8P C;  2IU3 A;  3AG3 B;  3I55 V;  4TSF G;  1VQ6 V;  1AI7 A;  3K03 A;  5IYD O;  1SET A;  3H01 A;  3ML0 A;  3W7T A;  4I5S A;  2EIL B;  2Q69 A;  4E2L A;  3ABK B;  1K92 A;  2W0F C;  2DYR B;  4R8C A;  2QM7 A;  2XOK G;  4QE9 A;  1KP2 A;  4BIU A;  2WLM A;  4QIW F;  4MSW C;  5L3D A;  1YTF D;  2DQ0 A;  1MSW D;  4JAV A;  4MVO A;  3ZMV A;  3HB3 B;  1RPR A;  2F43 G;  3CCV V;  2X0L A;  3OEE G;  3CD6 V;  3K0G A;  2EBO A;  2EIL C;  1R3I C;  1DF5 A;  2JK5 C;  3QNE A;  4MT8 A;  4Z1M G;  2DYR C;  3T2M A;  1LNQ A;  2NNU A;  3GWO A;  1P7B A;  4XDJ A;  3LUT B;  4ASU G;  1BMF G;  3ASN B;  1NVP B;  3G71 V;  3OGC C;  3CCJ V;  2X6B A;  5LHG A;  2ZXW C;  3WG7 C;  3OR6 C;  1GK9 A;  4U7O A;  5B1B C;  3AG4 B;  1ENV A;  2WLI A;  1M9N A;  1AJN A;  1I5Y A;  2YSU B;  4WFH A;  3W7W A;  3FKS G;  3CCS V;  4MTX A;  1YI2 V;  3ASN C;  3DTU B;  2WWW A;  1PKX A;  4UVB A;  2C2A A;  3QO5 A;  4X8A A;  2JDI G;  4PEL A;  2XAS A;  3CC4 V;  3OMA B;  2XAF A;  1I5X A;  3AG4 C;  1KP3 A;  1AI4 A;  1NKD A;  5L3B A;  5CA3 A;  2LP7 A;  3B77 A;  3LSS A;  3OFN G;  5H6R A;  4MVR A;  2JEX A;  3ABM C;  4MVM A;  1VQO V;  1PNL A;  3JD3 A;  3ZCC A;  2YEV B;  5EBM C;  3FYI B;  1KEC A;  2XAG A;  3IFX A;  5LHH A;  1JPX A;  3MHH C;  3JD0 A;  1P4R A;  2K1E A;  4I9W A;  4X88 A;  2QE7 G;  3OAA G;  4UXN A;  3K9A A;  2IW5 A;  2Q6A A;  2BOC C;  1NR7 A;  3SYQ A;  3FB6 C;  2ZR2 A;  3OMN B;  3CCL V;  2DWE C;  1K5Q A;  4JYB A;  3CCQ V;  1SZT A;  1K5S A;  2Q67 A;  3B8M A;  1KQS U;  1VQ4 V;  2EIK B;  3K0D A;  4WFA V;  2IH3 C;  3UM7 A;  2HJF C;  5B1O A;  1BL8 A;  2Y69 C;  4FIP C;  2PI5 A;  2WPD G;  2QEX V;  3BY6 A;  3OMI B;  3PJS K;  1HWY A;  4GT1 A;  2IJK A;  1YSC A;  1Q81 W;  2EIK C;  4YXW G;  1SER A;  4PA7 A;  2H94 A;  1R6K A;  4WF9 V;  1WPX A;  2CK3 G;  1OCC B;  2ZDI A;  5B1N A;  2QTO A;  1ORQ C;  1OCZ B;  1N8R W;  1QBZ A;  3OEH G;  4QPK A;  4MVQ A;  5EK0 A;  4ZBM A;  2A0L A;  4PDR A;  1V54 B;  1R3L C;  3SPC A;  1TUE B;  3JD2 A;  4G2K A;  4DXW A;  5LGT A;  2D3O W;  3UKM A;  3E35 A;  1R6N A;  1YIT V;  2DWD C;  1F4M A;  1OCC C;  3TET A;  1VQN V;  4R50 A;  2LFS A;  4PDL A;  1AJP A;  1OCZ C;  2XAH A;  2W6I G;  1W2B U;  1V54 C;  4JTC B;  4XDK A;  2WLH A;  1FXK A;  2WLL A;  3AG2 B;  2XND G;  1XL6 A;  3P32 A;  4PA3 A;  1YJN V;  2OCC B;  5L3F A;  1ARO P;  3SPG A;  4U7N A;  2EIN B;  3ZMZ A;  1E79 G;  2V7Q G;  4GX1 A;  2ITC C;  3W7X A;  2AHY A;  2DQ3 A;  4WCE V;  2PI4 A;  2A79 B;  2QM8 A;  2IH1 C;  4XBF A;  4GCZ A;  4L87 A;  1M1K W;  4CBC A;  3AG2 C;  1CPY A;  1K97 A;  1PNK A;  3LDC A;  1OCO B;  1XL4 A;  4MVU A;  1M56 B;  2OCC C;  3E8G A;  3OW2 U;  5LGU A;  2JEU A;  3BEH A;  3CCR V;  2EIN C;  4BW5 A;  2ZXW B;  3WG7 B;  4JAU A;  1VQK V;  1K73 W;  1BHA A;  3OR7 C;  2HFE C;  5B1B B;  3MHS C;  2B1I A;  1GKF A;  4ZKI A;  3E2E A;  1H38 A;  1F4N A;  2JIZ G;  2ATK C;  3EFF K;  1OCO C;  1M56 C;  2P6J A;  3RVZ A;  3SYA A;  4HAM A;  2WLI B;  3CYO A;  3STZ C;  1MOF A;  1OHH G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...