2Q67A

Crystal structure of nak channel d66a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q67A00
4JTCB 1S5HC 3OR6C 3SPJA 3UM7A 1QLEC 2ITCC 4MTOA 4TWKA 5IY5C 3AG4C 2K1EA 3SYOA 4GX1A 3F7YC 3AG2C 4WFFA 4F4LA 5E1AC 1JVMA 2DYRC 1XL4A 4G28B 5B1BC 3T1CA 4P9PA 2KB1A 4I9WA 2Q6AA 3SJQC 4MVQA 3SYCA 2JK5C 2HVKC 3ZJZA 3AG1C 3JYCA 2ZXWC 3E86A 3K0GA 4PDRA 4X89A 4XDJA 3TETA 3OUFA 5EC2C 1LNQA 3IGAC 2Y69C 3SPHA 3GB7C 5B3SC 4QE9A 5KUKA 2QKSA 4MVUA 5EK0A 2WLLB 4MSWC 5CBHA 2QTOA 1V55C 3HPLC 4PDLA 4XDLA 3T2MA 5CBFA 3LDDA 4X88A 4P2ZA 2A9HA 2WLHA 3E8BA 2AHZA 4J9YB 4RAIA 3LNMB 4UUJC 2A0LA 1J95A 2BOCC 2DWEC 1R3JC 2EIJC 2AHYA 2EIMC 3E8HA 3FB8C 4MTFA 4PA9A 4X8AA 3RVYA 4R6ZA 1R3IC 4P30A 3FB5C 4DXWA 1XL6A 3OR7C 3ABMC 3SPCA 2IH3C 2WLIB 4PDMA 3K06A 2WLNA 3E8FA 3IFXA 3SYQA 3UKMA 3RVZA 4WFGA 1ORQC 3E89A 4RO2A 4J9ZB 2Q69A 4MVSA 3SPIA 4PA7A 4JTAB 1BL8A 2P7TC 3K03A 4LP8A 1OCOC 3E8GA 3T4DA 4G27B 3ABKC 2EILC 3STLC 4WFEA 4BW5A 4H33A 5EC1C 2BOBC 4MW3A 1M57C 2DWDC 1K4CC 2X6AA 4MTGA 3SYAA 4EKWA 3K0DA 2DYSC 3ASNC 3LDCA 4KFMA 4LBEC 3LDEA 4MW8A 4GX5A 3BEHA 1K4DC 2W0FC 4MVMA 2ATKC 5EBLC 2HVJC 4CBCA 4H37A 2Q68A 3SPGA 2X6BA 3EFFK 3R65A 5EBMC 3FB6C 1M56C 3T4ZA 3F5WC 1P7BA 3F7VC 4WFHA 3KG2A 4ZBMA 3SYPA 2WLIA 5CBGA 1OCRC 4JTDB 4LCUC 4GX0A 4HYOA 4XDKA 3ZRSA 4R7CA 5BZBA 4MVZA 1ZWIC 2EINC 2WLKA 3RW0A 4R8CA 3K04A 1OCCC 2X6CA 2HG5C 3OGCC 4PA4A 2YEVA 3ASOC 1KKDA 3LUTB 2A79B 4P9OA 2R9RB 2H8PC 4RUEA 3K08A 3PJSK 3AG3C 2WLLA 4RUFA 1R3LC 4MS2A 3OUSA 3RBZA 1G4YB 3VOUA 3STZC 3ABLC 4PDVA 5J9PC 3TCUA 4QE7A 2EIKC 2ZD9A 4QNHB 4OXSA 2OCCC 2Q67A 5B1AC 2HFEC 2WLJA 4PA6A 3X2QC 1V54C 3WG7C 5KUMA 4GX2A 3FB7C 4MVRA 4R50A 2HJFC 4HZ3A 4PA3A 2NLJC 1OCZC 5EBWC 4MVOA 3E83A 2WLMA 2ITDC 1R3KC 2IH1C
chains in the Genus database with same CATH superfamily
3OR6C 3L72H 4NXMB 3K9AA 2F23A 3SYOA 2ZM6B 4DV2B 4JV5B 4OPHA 3D3IA 2Q73A 2KQXA 2FL4A 3SYCA 3L9DA 4J10A 1S77D 1R73A 2YSUB 1OCCB 2ZXWC 1SERA 1K7DA 3MD0A 3ABUA 3GB7C 2F1MA 4QE9A 2E5LB 3CCQV 2ZDIA 1NQTA 4I9QA 3ZHTA 3JAWA 1JA8A 3H01A 4X88A 1S72V 3CCLV 4DUYO 2YXHA 1VQKV 4N23A 2IJKA 3MHHC 3O65A 4TV8A 1VQ8V 5FPOA 3OFNG 5IYDO 2Z3YA 5EZYB 4J7JA 3S3WA 4PA7A 1IVSA 1TA8A 5CA0B 4MW3A 1I7FA 3CP1A 1E79G 5IE9A 4C7UA 3H9VA 4GX5A 4FFBA 1K5SA 2W0FC 3OGIB 3M7MX 2PYLA 5LOVA 4DRXA 2ADQB 1VMGA 3I56V 1MG1A 2V1DA 1WPBA 4UV9A 3AEIA 3QF7A 2PZSA 2B9ZA 4LFAO 2A79B 1NI8A 1N36O 1K92A 1SZTA 4NKGB 1I5YA 2GBOA 4L8JA 4X9QA 5J2UA 4LFAB 3W7XA 1JJOA 3E22A 1Y74B 3JCUZ 2WLJA 2EULA 3CC4V 1DLBA 4DV5O 2DYSB 1VF6C 4I5SA 4ABMA 3JATA 5AG2A 1N0NA 1MSWD 2OTJV 2CK3G 1OJHA 5LA6A 2YIDA 3MAQA 2GSMB 5IYCO 4DV5B 5DEDA 4JAAA 5EYPA 1FPOA 5JQGA 4LFBO 3SJQC 2HVKC 2HJDA 1K9MW 4X89A 4FFKA 4OGQB 3RFRA 3IGAC 5KUKA 1QLNA 4LFBB 3ABLB 5FNVA 2EIKB 3J80N 3I5DA 3JASB 2YUAA 1W0JG 4J7KA 1EFRG 2DWEC 4UVAA 2OWOA 3FB8C 5L3DA 5GONB 1B6QA 2Q7HA 2Y4TA 3SJAC 5HFLA 4DR6O 3AG4B 2F93B 1K8AW 1NZ6A 2DYRB 1GMGA 3M99B 3W7SA 4UCTA 3FFQA 3SYAA 4LBEC 5IJ9B 5KA6A 1L1FA 2QA4V 1NVPB 4B3RO 3ZRXA 5EBLC 4DO2A 1YJWV 1Q8IA 2CTPA 4FLYA 1AR4A 5BR8O 1XNRB 4JTDB 2W6IG 1GKFA 2LFRA 4MVZA 1RSOA 1W59A 4LF8O 4R8CA 1QR9A 4DYLA 4TV9A 4YY3O 5L3EA 3K5LA 3L75H 4HNAA 1U96A 5BR8B 5IYZB 1G4YB 1GM7A 2UXCO 1B3QA 4LF8B 4JYCA 2ZQMA 1R6KA 1LR1A 2EILB 4YY3B 1DGSA 4ICGA 3ZX6A 1YJNV 3H1LH 4PA6A 1V54C 3WG7C 5LBQA 5C8YA 1NR7A 4K8ZA 1R3KC 3UM7A 3G6BA 1QLEC 1CP9A 4TWKA 2XASA 5BXZA 4JYBA 4JYYA 1H8EG 3BHPA 4BWAA 3NR7A 5LYJB 4LF6O 1YZBA 2Q6AA 4O4HA 1S0VA 3N27A 5FL7G 3FX7A 1QVGU 3K5NA 1W0KG 4AI8A 1H8HG 1NTMH 4YJ3A 1ZL8A 4UCRA 1H2LA 1PV0A 4TUYB 3RYHA 3BA9A 3TGUH 4X1KA 3UT5B 4RAIA 3LNMB 2CGNA 1IXMA 1J95A 2EIJC 1N8RW 2EIMC 4NTYA 2BSKA 1VQNV 4UVCA 3JALA 3AK2A 2ZR2A 3HKDB 3CMAV 5TISZ 4PI0A 3UQ8A 3E89A 1QVFU 1AI7A 1KBHA 4LH6A 1BZKA 3C90A 2DJVA 5B5EZ 4TSFG 5EC1C 2DWDC 5LMUO 2ZDIC 3ASNC 4B3MO 5B66Z 1K4DC 1FD9A 4X1IB 2L6LA 4O2AA 1R1BA 3TJTA 5LMUB 2QEXV 3F7VC 3ASNB 2CAZC 1WNSA 1XDCA 1PKXA 5JJJB 1AI5A 2WWWA 2JJ1G 3MHSC 1JOYA 4GT1A 4E2LA 2X6CA 3CMEV 3C3SA 3FYIB 3SJBC 1O9GA 4RUEA 3KCXA 3W7TA 3ZMVA 2R9AA 4DV4O 2OIGA 5CB4B 1NR1A 4B08A 4R50A 2HJFC 4MVOA 4DV4B 3E83A 2PGGA 5KA5A 4CS3A 2K1EA 4WFFA 3K57A 1VF7A 4LFCO 3RYIB 1G6UA 3Q4HA 4P9PA 4IHJA 4DRXB 1P7GA 2H3OA 4XBFA 3U0ZA 4I55A 1VQ7V 4I4TB 1JQ0A 2OYQA 2YI9A 2HHHO 3S3XA 4YJ2A 4FLVA 4ZI7B 4LFCB 1ZAUA 5L3CA 3T1YO 1SF9A 1ENVA 1M93A 2M6YA 1KP2A 2ZE7A 4RQEA 2YS8A 5J2UB 3GVMA 4LF9B 5BY1A 3T1YB 1WB7A 2OT5A 2V4DA 3SPCA 2IH3C 3RYCA 3UKMA 1AVMA 1CXZB 1Z2GA 2LQTA 1ORQC 4BR6A 4RO2A 2K9PA 1G8MA 3AG2B 4K8XA 2YEVB 1U97A 2CH7A 1PL0A 3ABKC 3G4SV 3IJ4A 3AG1B 5JQGB 4JI8B 3TXQA 3CCSV 1FXKB 4UB6Z 1WP7A 1SQXH 4OX9O 3CX5F 3ETQA 4FM2A 2ZT9B 1MOFA 4F6RA 1M56C 1B06A 3CB2A 4IGGA 2FYUH 4OX9B 4YIPA 1TVKA 3ZRSA 3IAYA 3NXSA 5CN0A 3APOA 3KZIZ 1LUWA 2UUBO 5F2VO 4UCSA 3OGCC 2QJ1A 1M56B 2WLLA 4ZOLA 4GUNA 1AR5A 3VOUA 1PL4A 1Z5VA 1ZUQA 2UUBB 1OCOB 1JFFA 1AI6A 1VEWA 1K3EA 1NT2B 2XAGA 1BS3A 3OEEG 2AW9A 4HZ3A 4PA3A 4ZHQA 1QU7A 2E75B 4BIOA 3SR2C 2ITCC 1NH2D 3OE7G 3BABA 2KKWA 1OCRB 1KB9F 1IBLO 5IDJA 2VRZA 1YF2A 3CRQA 1SKVA 4FVMA 3VQWA 4EEQA 1IBLB 2ZE6A 1K5QA 2ARHA 2ZIMA 5JVDA 1N4CA 2IU0A 2QE7G 4JI2O 3P3NA 4LWSA 2PTMA 1N34O 2JRIA 3LDDA 3UCSC 2AHZA 2JIZG 2UXDO 3F5TA 4PV1B 4B3TB 3JSLA 1D2DA 4JI2B 1QHTA 2Q8VA 1AR1B 1K34A 1MSDA 2GUZB 3D36A 1EN6A 2UXDB 1URFA 3T4DA 3C3TA 5KX5B 3OW2U 4H33A 4DK1A 1SQPH 5JWPA 4TQDA 3CS5A 3CCUV 4I7ZB 3CXCU 3LNNA 1ZLZA 4TT3G 1QCEA 4WFAV 2OIEA 2Z0AA 3BPZA 2F66C 1V55B 3QG5A 3U11A 1Y6XA 1BGYH 2A06H 1GH6A 4WF9V 2QWQB 1SQQH 4JI6B 1SA0B 2BSKB 3WFVA 2DQ0A 3JALB 4X64O 1BQ0A 4HBNA 1R3LC 4EB6B 1VF5B 4U3JB 1Y76A 3N2KA 2Y0PA 5JJEB 5J9PC 4QE7A 3QO8A 5B1AC 1N0JA 3L74H 4HAMA 4Z1VA 2H94A 1OV9A 3K5OA 1OCZC 5KMGB 1L0NH 2EBOA 2AGAA 5IY5C 3JAKA 4LF4O 3RYFB 1XL4A 3A2FA 3ZHQA 1FFXB 2MK3A 4MVQA 3ZEDA 5LMNO 4FLXA 5J2TA 5CA1A 3E86A 3CD6V 2DN9A 2HEPA 1QBZA 4TQFA 4DV2O 4JV5O 5CMUA 4WFBV 1G1XB 2UXXA 5LMNB 4UB8Z 3DXRA 3T2MA 1IZ3A 1TUEB 1PNLA 3QO5A 1X59A 4O4JB 2P6JA 2Q7EA 3SDLA 2E5LO 1XL6A 2Y0IA 3ZMTA 4O4IA 4J9ZB 4I0XA 5D5QA 2P7TC 4G27B 2Q0OC 4LR3A 5EIBD 4N21A 5BMVA 2ZXWB 1K97A 2PI5A 1GN3A 3LSQA 3B8NA 1JCHA 4MW8A 4DV6O 3ZRWA 4O2BB 3B8MA 2VS0A 3DC5A 4XDKA 1WA8A 4DV6B 3WU2Z 1L8DA 2HG5C 1RFYA 1GN4A 3AK3A 1US6A 1YSCA 2PY5A 3TXSA 1N32O 3HKEB 2PF4E 1FAFA 5IJ0A 1YJ9V 1R6NA 5K1PA 5KUMA 4CH4A 1XQ8A 1NVPD 1BMFG 1N32B 2GTAA 5EBWC 4LNUA 4AQYO 2ITDC 4JTCB 2OCHA 1T5EA 5JH7B 4YXWG 1VIBA 3IC9A 4F6RB 1XUQA 4G28B 5B1BC 2BCCH 4AQYB 1XHZA 1PNKA 2GTSA 3JARB 3HKBB 4K3AA 2B1GA 4XDJA 3TETA 1E1RG 5GW7A 2F95B 2Y69C 2PUSA 4OPAA 2XUMA 1XHXA 2WLLB 1IDSA 3OTFA 5CA3A 2QTOA 1VQ9V 1JX9A 1FKAO 4DR5O 2UXBO 1GRJA 3OMNB 1H2SB 1M1KW 4D6TH 2QM4A 3RVYA 4MTFA 4PA9A 4X8AA 3CC7V 3ABMC 5LL6Y 4DR5B 2Q5ZA 5IYBO 2UXBB 1EZVH 1O9HA 3FAVB 3ZHVA 2DE0X 2QGNA 3CC2V 1YIJV 3ABMB 4E4EA 2LJ2A 4X1YB 4MTGA 1EM1A 1MA1A 1COWG 1S3JA 4KFMA 3G6EV 4MVMA 2ATKC 4DR2O 2XAHA 1VQMV 1TGOA 5DECA 4JI0B 1FFTB 2ZKOA 5JVDB 1QR8A 1MNGA 2NN4A 4JI4O 4IL6Z 2WLKA 4DR2B 3O9OA 3RW0A 4LC1A 3K04A 1Q86W 3D36C 4LF7O 4NR1A 5B1OA 2GHYA 4JI4B 2XTAA 2E3CA 1XNRO 1XI1A 1GK9A 3CCRV 1HWYA 4LF7B 4CH5A 1HR0O 4X20B 2RJZA 4UCOA 3OM3B 4FZ0A 2E76B 3F5WC 2QWRB 3ZRVA 3LSUA 1S5HC 1HR0B 3CRAA 3K79A 2XT9A 3B40A 3CCEV 3L73H 1TUBA 3JYCA 1MABG 5LXTB 3OUFA 5ITZB 4DUZB 4Q20A 3MDSA 2XNDG 2ZIOA 4DV1O 3HPLC 2R9IA 4IYHA 1P49A 2CGOA 1I94B 1V54B 3WG7B 2R70A 2CDYA 2BOCC 4BW9A 2AHYA 1NTKH 3HKCA 5A2QN 1AJQA 4CH3A 4R6ZA 3FB5C 4DV1B 2EJ7A 3AK1A 2WLIB 3JD1A 1THZA 1QLEB 3L70H 1A32A 2WSSG 1Y4MA 4JI1O 1XNQO 4H0LB 4QJFB 2FKXA 1D5NA 1P84F 2QM7A 3ZN1A 4BW5A 2JGDA 1YXBA 1M57C 1Z5WA 3N2GB 1K33A 4EKWA 3PN1A 4JI1B 1XNQB 3CE2A 2KG7A 4W4LA 1DF4A 3H1JH 1IBKB 2BTQA 2JS3A 2DQ3A 5DN6G 1M57B 4J41A 3ETGA 3FB6C 3LSSA 3KG2A 2N05A 3ZS8C 3FYEB 1PP9H 1ZWIC 2EINC 2EIJB 2EIMB 3W7WA 4QGPA 1JR9A 3M8AA 1KQSU 2R9RB 1KYOF 1AP6A 1Q43A 5LP6A 2EX3A 1NKDA 3STZC 5LGNA 1MZFA 4KP4A 1UJWB 2Q67A 3CJHA 4DV0O 3X2QC 1Q90D 5BMVB 5KHIA 3JAWB 1IX9A 4JYAO 2RQ6A 1LNQA 4O4LA 3SPJA 2JS5A 1KUQA 4DV0B 3K9SA 4TV8B 1EN5A 4JYAB 1R6TA 2F4VO 4IIJA 2DOSA 1N33O 1WPXA 5L3BA 4DR1O 1WA8B 3BA8A 4H44B 5KAFZ 4JF3A 4JAUA 2IM9A 2F4VB 4X65B 1N33B 4DR1B 1AB3A 3U10A 5FLXN 1VQ4V 4FLWA 4G2KA 4JI5O 4FFBB 3K5MA 2RCVA 5IJ0B 1SQBH 4UUJC 2EJRA 5LOVB 3OR7C 2GV9A 5A9GA 4JI5B 1BHAA 3E8FA 1YTFB 2Q69A 4FPPA 4LF9O 2YIBD 1H2KA 4DR7B 4LH7A 4IT5A 5KAIZ 4U7OA 3E22B 3CEIA 5GTHZ 4AILC 1Y67A 2AXTZ 2RDCA 4DW1A 1Q6HA 3T4ZA 3JATB 4JI8O 4BAYA 4ZBMA 3K58A 3B4SA 4GX0A 5BZBA 1BCCH 1F7YA 2YICA 5EZYA 4IYIA 5LA6B 4ZIBA 1RP3B 5EYPB 1KKDA 1YI2V 4U3FH 2H8PC 2HLDG 3BFRA 3PJSK 5HFMA 4RUFA 2VWKA 1IURA 4MS2A 3R66A 1IBMO 3BRCA 1XOUA 3ABKB 2ETNA 3TCUA 5E79Z 3ZN0A 2QWNB 4J11A 2OCCC 1VQOV 3K59A 2HFEC 1VARA 2LO1A 4GX2A 1IBMB 1FYJA 5FNVB 1VQPV 4PD4F 1ZTEA 2WLMA 2YI8A 4MTOA 2BTOA 4JI7O 3JSNA 4L87A 2VQEO 3DTUB 3CCMV 4QPJA 1HNWO 4A5UB 4NXNO 1AI4A 4GKKO 3G67A 2UUCB 5LHHA 4JI7B 4PDRA 3RWRD 3EXAA 3VBBA 2VQEB 3ZHRA 1HNWB 1Y74A 4NXNB 3EHBB 3AG7A 4MSWC 4GKKB 4KL1A 1BT8A 3ZHUA 4PDLA 1WN7A 4XDLA 4NVPA 5KHGA 2CTWA 2A0LA 2OTLV 2EZPA 4J7ZA 3K06A 1GAXA 2QM8A 4WFGA 1RSOB 1HNXB 4MVSA 4U7NA 1AJNA 2UUAB 4TV9B 1BL8A 2CE4A 3K03A 4HNAB 4FLZA 4GYCB 2E74B 4B3TO 2X6AA 4JPRA 1TUBB 2JEUA 4MTXA 3JASA 2HVJC 3JD0A 1ROPA 4CBCA 2QKAA 2QDOA 5C8YB 1YCIA 1J5EB 2QTSA 5GONA 1DF5A 4HYOA 2NR5A 1AJPA 4O4HB 2EZOA 1KD1W 2IJJA 4PDVA 4FIPC 5IJ9A 1DK1A 4JI6O 5KHKA 4YJ3B 3OT7A 1DTOA 1ZL8B 1Y66A 1ZSPA 3JD3A 4I50A 3EVKA 2IU3A 4PHZA 3RYHB 3QNEA 4X1KB 3AG3C 2LW1A 2P4VA 2FTKA 1NJIW 1PNMA 4DV3O 2CUGA 3T1CA 2KB1A 4I9WA 5IYZA 5LP6C 4Q6GA 5B1NA 1WB8A 5KHJA 1FXVA 2X7RB 4QIWF 3THOA 1CPYA 4DV3B 5B3SC 4JGSA 4JI3O 4B7KA 4B7EA 3OAAG 5CBHA 4DR3O 2LGQA 5B1AB 2A3QA 2A9HA 2JEXA 1XREA 4FZ1A 1XBLA 4O2AB 4JI3B 1RPOA 2CTQA 1OCZB 1R3IC 2LP7A 4F6EA 1OHHG 4DR3B 5H6RA 5LYJA 3DC6A 5IY5B 1NU1H 1RM1C 4DW0A 1QNMA 4NTXA 2FB5A 1KU9A 2QSAA 1WLEA 3E8GA 4QPKA 3STLC 1YHQV 3GWKC 5JCOA 1RM1B 5KLVH 4BIUA 3WB1A 2DMXA 1YDXA 3ETEA 4TUYA 3UT5A 1KMIZ 2W0XA 3R65A 3EFFK 3SPGA 1HW7A 2JVDA 2RNBA 4JZGA 2P22C 1ZX3A 3HKDA 4R7CA 2LW7A 3SGIA 4CC6A 2XHBA 1VQ6V 4GKJO 2JGUA 1OCCC 4PA4A 3Q4HB 4IHJB 2NNUA 4I55B 1SQFA 3FKSG 1AILA 3W7UA 1VQ5V 4GKJB 4YJ2B 3CSXA 2AZ0A 4X1IA 1AP5A 3T1HO 2P90A 5D5PA 3H1KH 3CCVV 2IBZH 3F7YC 2LGWA 3RYCB 3T1HB 5E1AC 1B04A 2JK5C 4DK0A 1NS1A 1Q5OA 4DUYB 2CH7B 1S5JA 2JDIG 2XAJA 3SPHA 5CB4A 3ML0A 2KSDA 2C2AA 2QKSA 2QR4A 3DGEA 2FMLA 4X62O 3JAMN 4PJ0Z 4WBNA 3HB3B 1H2GA 4FJCC 4P2ZA 3JD4A 2IJIA 2WLHA 5H9CA 1R3JC 5KHHA 4AHCA 4X62B 2XAFA 1L0LH 2A7WA 1TVKB 5L3FA 3RYIA 1P4RA 4I4TA 4FK5C 3I55V 4PELA 4LP8A 5B1BB 4ZI7A 4X66O 1WAZA 4ZOLB 2YC0A 2CTRA 4FM0A 3K3WA 1EBOA 1JFFB 2DYSC 3LDCA 2WA3A 2Y69B 4X66B 3UO2A 1F4MA 1N36B 4ZHQB 2G38A 1PD3A 3CHXA 4CC5A 4WFHA 1IXBA 2ZE8A 1M90W 1TAEA 5EIBC 2YEVA 1WJZA 4JI0O 1JPXA 3RBZA 2ILMA 1GO3F 2QKCA 1FXKA 3ABLC 2D3OW 2EIKC 2ZD9A 2Y48A 3RN4A 4FMTA 3ZMZA 3JCZA 3ABTA 3WB0A 1GN2A 4CS2A 4LWSB 3FD9A 1KKCA 3ICXA 1MMMA 1H38A 3AG4C 4GX1A 2Z5UA 1JVMA 1KECA 2DYRC 1KP3A 3ETDA 4FLTA 3P3PA 4H13B 5EK0A 3BAAA 4DR6B 1Q82W 3A0RA 4UVBA 3E8BA 2HKOA 3J7AU 4DUZO 3E8HA 3E35A 2X0LA 1Q6UA 3B2EE 4P30A 4I50B 3SYQA 4DR4O 1Q6IA 2B1IA 1I94O 2YIBA 3HR0A 4B3RB 4FLUA 3OEHG 2EILC 2VQFO 4DR4B 2VWJA 1Y76B 3N2KB 4KXRA 1K73W 3BEHA 4Z1MG 1Q7YW 3ZHSA 2VQFB 3D8CA 3CYOA 4H37A 3ZMSA 4ASUG 5EBMC 1GTOA 2JJ2G 4MT8A 1SQVH 3JD2A 2UXCB 4LCUC 1EN4A 5JJNB 2HP8A 1IBKO 3JAKB 2GUZA 1YTFD 3ASOC 4DV7O 5KX5A 5J2TB 5CA1B 4CZZA 3VQVA 5JCOC 4NTWA 4FM1A 2D2CB 4CH6A 3ASOB 1FJGO 4DV7B 3OTOO 4LF6B 3B77A 3P30A 1S5LZ 3DXRB 2NLJC 1F23A 2UU9O 1LUVA 3P32A 1FJGB 1KC8W 3OTOB 2W6JG 1FXHA 1SA0A 3APQA 4O4IB 2EINB 4CS4A 4W4KA 2UU9B 3QVNA 4I0XB 4EB6A 4U3JA 2RMKB 5EC2C 3G80A 1M5IA 4MVUA 3CWBH 1SS3A 5KMGA 3X2QB 5C93A 4J42A 1I08A 2XAQA 3ZRWB 2IJHA 1JJ2U 3L71H 1BHBA 4X65O 2P67A 3RYFA 2V7QG 3IFXA 1FFXA 4JZ2A 1GM9A 4B3MB 4JTAB 1SESA 1XEQA 2O57A 4RWUA 2BOBC 4KUMA 3BCCH 4GLXA 2UXNA 4WCEV 2PI4A 2X6BA 4NB5A 1RPRA 4O4JA 4DR7O 4LNUB 3A0HZ 4EFBA 1F51A 4YHHO 3SYPA 4WBNB 5CBGA 2HR3A 2LFSA 1JMKC 2Q4PA 4JASA 2R72A 3D3QA 4K0KO 2Q9LA 4YHHB 2GDSA 3OUSA 1NTZH 3ZBHA 4QNHB 3GWOA 1CEZA 2N04A 2N74A 4K0KB 1M9NA 4UCVA 2RN9A 2ZR3A 3OMAB 1YEWA 3A0BZ 4O2BA 1XMQO 4GCZA 2AZ2A 2IW5A 3QTCA 2HHHB 3B09A 1SC5B 4Z2WA 3TK1A 3AG2C 5CA0A 1XMQB 1UPGA 1E1QG 5IWAO 3AG1C 1M4UA 3K0GA 2F43G 2DW4A 1FXKC 3HKEA 3KCYA 4EFEA 1YVWA 5IWAB 3CRRA 2PYJA 3KKYA 2OCCB 2UUCO 3IC7A 5JH7A 2WA4A 3UO3A 2B5UA 4PDMA 2WLNA 3RVZA 1XILA 3SPIA 5LHIA 5H6QA 3SJCC 3JARA 3HKBA 2ZNIA 1OCOC 1V9PA 4NYKA 5FPRA 4D7TA 3OMIB 1SETA 4WFEA 1YITV 2YXLA 5L3GA 1HNXO 4UFZA 2UUAO 3BY6A 2YXYA 5K1XA 2ZCEA 2Q68A 4PI2A 1VF6A 1SZXA 3H1HH 1D5AA 1OCRC 2M7WA 2L35A 4LF5O 3FAVA 4B3SO 2ODMA 4J80A 1QQCA 1HNZO 3LUTB 2QWOB 3QO7A 4KHPO 4UCUA 3K08A 1J5EO 2Y4UA 4X1YA 1W2BU 4LF5B 1XMOO 4B3SB 4BIZA 3CPWU 2WAMA 1HNZB 4KHPB 1H2NA 1EZJA 1F4NA 1BE3H 1GM8A 3FB7C 2XOKG 1XMOB 1Q81W 1Q3EA 3VQXA 2P5OA 5LGUA 3H1IH 1VP7A 1H2MA 5GTIZ 3CCJV 3HKCB 5LHGA 2WPDG 4TOIA 3G71V 2P4KA 4F4LA 1VQLV 3ZIAG 3ZJZA 1N34B 2ZINA 5DM6V 1NBMG 2QWPB 1I5XA 3RGBA 2JGDB 3CRMA 4X20A 1SQGA 1V55C 2KG7B 4UXNA 5CBFA 2BTQB 1S76D 1AROP 3RT3C 1MZEA 4J9YB 2ZNJA 3OD4A 5H5NA 4GZRB 4JAVA 1UFIA 4DXWA 3AG3B 5H2FZ 1PM9A 3J81N 3DSQA 3E2EA 5LXTA 5ITZA 1HDJA 5LP6B 1K4CC 1HP8A 4UV8A 3K0DA 1FS0G 3LDEA 4RQFA 3CXHF 3VQYA 5B3SB 2YIAA 2YDEA 3CJHB 3ZMUA 2Q7GA 2ZE5A 4X64B 1P7BA 1NH2B 1GN6A 4ZKIA 2BE3A 4O4LB 2WLIA 1OZ0A 3A8TA 3BVOA 3ZCCA 1X4TA 4P9OA 3CRCA 4IIJB 2P06A 3WB2A 5LGTA 2Q0AA 4K35A 3N2GA 1PPJH 4YIOA 1SRYA 2MW2B 1I0HA 4OXSA 4NXMO 5IT9N 2ZM6O 1BSMA 4LF4B 2ADPA 4MVRA 1BQZA 1WP8A 4D7SA 2IH1C
chains in the Genus database with same CATH topology
3OR6C 3SPJA 2ITCC 1NH2D 3K9AA 3AG4C 3SYOA 4GX1A 3OE7G 2Z5UA 1JVMA 1OCRB 1KECA 2DYRC 3D3IA 5IDJA 1KP3A 3SYCA 1WPXA 5L3BA 1S77D 1R73A 2YSUB 1OCCB 2ZXWC 1SERA 1K7DA 3MD0A 3ETDA 3ABUA 4JF3A 4JAUA 3GB7C 4QE9A 3CCQV 5EK0A 1K5QA 2ZDIA 1NQTA 2IU0A 1VQ4V 2QE7G 3H01A 4G2KA 1Q82W 3LDDA 3A0RA 4X88A 1S72V 4UVBA 3CCLV 3E8BA 2HKOA 2AHZA 4UUJC 2JIZG 1VQKV 2EJRA 3E35A 3E8HA 2X0LA 4N23A 4P30A 2IJKA 3MHHC 3OR7C 1VQ8V 3SYQA 1BHAA 3E8FA 3OFNG 1YTFB 5IYDO 2Z3YA 1AR1B 2Q69A 1K34A 2B1IA 4PA7A 3D36A 4FPPA 3T4DA 3OEHG 2EILC 3OW2U 4H33A 4MW3A 3CP1A 3CCUV 1E79G 3CXCU 4TT3G 4GX5A 4U7OA 1K73W 3BEHA 4Z1MG 1QCEA 1K5SA 2W0FC 4WFAV 1Q7YW 3CYOA 1V55B 4H37A 3ZMSA 4ASUG 5EBMC 1GTOA 2JJ2G 3T4ZA 4MT8A 3JD2A 4BAYA 4ZBMA 4WF9V 1MG1A 3I56V 4LCUC 4GX0A 5BZBA 2V1DA 4UV9A 3AEIA 1YTFD 1KKDA 3ASOC 1YI2V 2A79B 3WFVA 2DQ0A 2H8PC 2HLDG 3PJSK 1K92A 5HFMA 4RUFA 1R3LC 1SZTA 4MS2A 4CZZA 1I5YA 5J9PC 3ABKB 3TCUA 4QE7A 3QO8A 3ZN0A 3ASOB 3W7XA 2OCCC 5B1AC 1VQOV 4HAMA 2HFEC 2WLJA 3CC4V 1DLBA 2DYSB 4GX2A 3B77A 3P30A 2H94A 4I5SA 1VQPV 2NLJC 1OCZC 2WLMA 1F23A 1MSWD 2OTJV 2EBOA 3P32A 1KC8W 4MTOA 2CK3G 5IY5C 2W6JG 2GSMB 5IYCO 1FXHA 4L87A 3DTUB 1XL4A 3CCMV 4QPJA 2EINB 1AI4A 3SJQC 2MK3A 4MVQA 2HVKC 3E86A 5LHHA 1K9MW 3CD6V 4PDRA 4X89A 3VBBA 1QBZA 5EC2C 3IGAC 5KUKA 5CMUA 1QLNA 3EHBB 4MVUA 4WFBV 4MSWC 2UXXA 3ABLB 2EIKB 4PDLA 4XDLA 3T2MA 3X2QB 5C93A 2XAQA 3ZRWB 1TUEB 1W0JG 2IJHA 2A0LA 1EFRG 2DWEC 1JJ2U 2OTLV 4UVAA 1PNLA 3FB8C 3QO5A 5L3DA 2EZPA 2P6JA 1BHBA 1B6QA 1XL6A 2P67A 3K06A 2V7QG 3IFXA 2QM8A 5HFLA 4WFGA 3ZMTA 1GM9A 4J9ZB 3AG4B 4MVSA 4U7NA 1AJNA 4JTAB 1BL8A 1SESA 2P7TC 1K8AW 3K03A 2DYRB 4G27B 1GMGA 3M99B 4N21A 2BOBC 3W7SA 4KUMA 2X6AA 4JPRA 2ZXWB 1K97A 3SYAA 2PI5A 4LBEC 3LSQA 3B8NA 1JCHA 2JEUA 4MW8A 4MTXA 5KA6A 1L1FA 2QA4V 2UXNA 1NVPB 3ZRXA 5EBLC 4DO2A 4WCEV 2HVJC 3JD0A 3ZRWA 1ROPA 4CBCA 1YJWV 2PI4A 2X6BA 1RPRA 3B8MA 1F51A 1DF5A 3SYPA 5CBGA 4JTDB 2W6IG 2HR3A 4HYOA 1GKFA 4XDKA 2LFRA 4MVZA 2LFSA 4R8CA 1QR9A 5L3EA 4JASA 1AJPA 2HG5C 2EZOA 3OUSA 1G4YB 1YSCA 1GM7A 2IJJA 1KD1W 4JYCA 2ZQMA 1R6KA 4PDVA 2EILB 4FIPC 4QNHB 1YJ9V 1YJNV 1R6NA 3GWOA 1CEZA 4PA6A 1M9NA 1V54C 3WG7C 5LBQA 1DTOA 5KUMA 2ZR3A 3OMAB 1Y66A 1NVPD 3JD3A 1NR7A 1BMFG 5EBWC 2IU3A 4GCZA 2ITDC 1R3KC 3QNEA 2IW5A 3AG3C 4JTCB 3UM7A 1QLEC 1CP9A 4TWKA 2XASA 3TK1A 4YXWG 2FTKA 3AG2C 1NJIW 4JYBA 1H8EG 1PNMA 1E1QG 4G28B 5B1BC 3T1CA 2KB1A 4I9WA 2Q6AA 1PNKA 3AG1C 1S0VA 5FL7G 3K0GA 2B1GA 2DW4A 2F43G 1FXKC 1QVGU 4XDJA 5B1NA 3TETA 1E1RG 5GW7A 1FXVA 1W0KG 2X7RB 2Y69C 4QIWF 1CPYA 5B3SC 1H8HG 4JGSA 2WLLB 3OAAG 5CBHA 2QTOA 5CA3A 1VQ9V 1JX9A 2OCCB 5B1AB 3OMNB 2A9HA 2JEXA 1M1KW 4RAIA 3LNMB 3IC7A 1IXMA 1J95A 2EIJC 1N8RW 2EIMC 3RVYA 1RPOA 4MTFA 1OCZB 4PA9A 4UVCA 4X8AA 3CC7V 1VQNV 1R3IC 2LP7A 1OHHG 3ABMC 2ZR2A 5H6RA 2B5UA 4PDMA 3CMAV 2WLNA 5IYBO 3RVZA 3E89A 3SPIA 5IY5B 1RM1C 5LHIA 5H6QA 1QVFU 1AI7A 3CC2V 1WLEA 1YIJV 1OCOC 3E8GA 4QPKA 3OMIB 1SETA 4WFEA 3STLC 3ABMB 1YHQV 4TSFG 5EC1C 2DWDC 4MTGA 1YITV 1RM1B 1COWG 5L3GA 2ZDIC 1S3JA 4BIUA 3ASNC 4KFMA 3BY6A 1K4DC 3ETEA 3G6EV 4MVMA 2ATKC 2XAHA 2Q68A 3SPGA 3R65A 3EFFK 1VQMV 2QEXV 3F7VC 1FFTB 3ASNB 1QR8A 1OCRC 1PKXA 2M7WA 4R7CA 2WLKA 1AI5A 2WWWA 3RW0A 2JJ1G 3MHSC 1VQ6V 4GT1A 4LC1A 1JOYA 3K04A 1Q86W 4E2LA 1OCCC 2X6CA 4PA4A 3CMEV 3FYIB 3LUTB 3QO7A 4RUEA 5B1OA 2GHYA 3K08A 2NNUA 3W7TA 1H38A 3ZMVA 3FKSG 3W7UA 1W2BU 1VQ5V 4BIZA 3CPWU 1GK9A 3CCRV 2WAMA 1HWYA 1EZJA 1F4NA 3OM3B 1NR1A 1GM8A 3FB7C 2XOKG 4R50A 2HJFC 1Q81W 2P90A 4MVOA 3E83A 3CCVV 3F5WC 5KA5A 5LGUA 3ZRVA 1S5HC 3K79A 3CCJV 2K1EA 3F7YC 5LHGA 4WFFA 3CCEV 2WPDG 3G71V 4F4LA 5E1AC 1VQLV 3ZIAG 4P9PA 4XBFA 2JK5C 3ZJZA 1VQ7V 3JYCA 1JQ0A 1MABG 5DM6V 2JDIG 1NBMG 2XAJA 3OUFA 1I5XA 3SPHA 3ML0A 5L3CA 4Q20A 2C2AA 2XNDG 2QKSA 1ENVA 3DGEA 1V55C 3HPLC 2R9IA 3HB3B 4UXNA 1KP2A 5CBFA 1H2GA 1S76D 4FJCC 4P2ZA 3JD4A 2IJIA 1V54B 2WLHA 1AROP 3WG7B 4RQEA 5H9CA 4J9YB 2BOCC 1R3JC 2AHYA 1AJQA 4R6ZA 4JAVA 4DXWA 2XAFA 3FB5C 2OT5A 3SPCA 2IH3C 2WLIB 3AG3B 3JD1A 5L3FA 1THZA 1QLEB 3UKMA 1ORQC 4RO2A 1P4RA 1G8MA 3AG2B 2WSSG 1Y4MA 4FK5C 2YEVB 4PELA 3I55V 4LP8A 4QJFB 5B1BB 1PL0A 3E2EA 3ABKC 2QM7A 3ZN1A 4BW5A 3G4SV 1M57C 1K4CC 3AG1B 4UV8A 3CCSV 1K33A 3K3WA 1EBOA 1FXKB 2DYSC 3K0DA 1FS0G 3LDCA 4EKWA 3LDEA 4RQFA 2Y69B 5B3SB 1DF4A 3ZMUA 2DQ3A 5DN6G 1MOFA 1M57B 1F4MA 3ETGA 3FB6C 1M56C 3LSSA 1P7BA 1PD3A 4WFHA 1NH2B 3KG2A 4ZKIA 2WLIA 1OZ0A 3ZRSA 3NXSA 5CN0A 3FYEB 1ZWIC 2EINC 2EIJB 2EIMB 3W7WA 1M90W 3ZCCA 1KQSU 3OGCC 2YEVA 1M56B 4P9OA 2R9RB 2WLLA 1JPXA 3RBZA 1NKDA 5LGTA 3VOUA 3STZC 5LGNA 1GO3F 1FXKA 1OCOB 1SRYA 3ABLC 2D3OW 4KP4A 1AI6A 2EIKC 2ZD9A 4OXSA 1UJWB 2Q67A 1K3EA 3X2QC 2Y48A 2XAGA 4FMTA 3OEEG 3ZMZA 3JCZA 4MVRA 3ABTA 4HZ3A 4PA3A 1LNQA 2IH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTC B;  1S5H C;  3OR6 C;  3SPJ A;  3UM7 A;  1QLE C;  2ITC C;  4MTO A;  4TWK A;  5IY5 C;  3AG4 C;  2K1E A;  3SYO A;  4GX1 A;  3F7Y C;  3AG2 C;  4WFF A;  4F4L A;  5E1A C;  1JVM A;  2DYR C;  1XL4 A;  4G28 B;  5B1B C;  3T1C A;  4P9P A;  2KB1 A;  4I9W A;  2Q6A A;  3SJQ C;  4MVQ A;  3SYC A;  2JK5 C;  2HVK C;  3ZJZ A;  3AG1 C;  3JYC A;  2ZXW C;  3E86 A;  3K0G A;  4PDR A;  4X89 A;  4XDJ A;  3TET A;  3OUF A;  5EC2 C;  1LNQ A;  3IGA C;  2Y69 C;  3SPH A;  3GB7 C;  5B3S C;  4QE9 A;  5KUK A;  2QKS A;  4MVU A;  5EK0 A;  2WLL B;  4MSW C;  5CBH A;  2QTO A;  1V55 C;  3HPL C;  4PDL A;  4XDL A;  3T2M A;  5CBF A;  3LDD A;  4X88 A;  4P2Z A;  2A9H A;  2WLH A;  3E8B A;  2AHZ A;  4J9Y B;  4RAI A;  3LNM B;  4UUJ C;  2A0L A;  1J95 A;  2BOC C;  2DWE C;  1R3J C;  2EIJ C;  2AHY A;  2EIM C;  3E8H A;  3FB8 C;  4MTF A;  4PA9 A;  4X8A A;  3RVY A;  4R6Z A;  1R3I C;  4P30 A;  3FB5 C;  4DXW A;  1XL6 A;  3OR7 C;  3ABM C;  3SPC A;  2IH3 C;  2WLI B;  4PDM A;  3K06 A;  2WLN A;  3E8F A;  3IFX A;  3SYQ A;  3UKM A;  3RVZ A;  4WFG A;  1ORQ C;  3E89 A;  4RO2 A;  4J9Z B;  2Q69 A;  4MVS A;  3SPI A;  4PA7 A;  4JTA B;  1BL8 A;  2P7T C;  3K03 A;  4LP8 A;  1OCO C;  3E8G A;  3T4D A;  4G27 B;  3ABK C;  2EIL C;  3STL C;  4WFE A;  4BW5 A;  4H33 A;  5EC1 C;  2BOB C;  4MW3 A;  1M57 C;  2DWD C;  1K4C C;  2X6A A;  4MTG A;  3SYA A;  4EKW A;  3K0D A;  2DYS C;  3ASN C;  3LDC A;  4KFM A;  4LBE C;  3LDE A;  4MW8 A;  4GX5 A;  3BEH A;  1K4D C;  2W0F C;  4MVM A;  2ATK C;  5EBL C;  2HVJ C;  4CBC A;  4H37 A;  2Q68 A;  3SPG A;  2X6B A;  3EFF K;  3R65 A;  5EBM C;  3FB6 C;  1M56 C;  3T4Z A;  3F5W C;  1P7B A;  3F7V C;  4WFH A;  3KG2 A;  4ZBM A;  3SYP A;  2WLI A;  5CBG A;  1OCR C;  4JTD B;  4LCU C;  4GX0 A;  4HYO A;  4XDK A;  3ZRS A;  4R7C A;  5BZB A;  4MVZ A;  1ZWI C;  2EIN C;  2WLK A;  3RW0 A;  4R8C A;  3K04 A;  1OCC C;  2X6C A;  2HG5 C;  3OGC C;  4PA4 A;  2YEV A;  3ASO C;  1KKD A;  3LUT B;  2A79 B;  4P9O A;  2R9R B;  2H8P C;  4RUE A;  3K08 A;  3PJS K;  3AG3 C;  2WLL A;  4RUF A;  1R3L C;  4MS2 A;  3OUS A;  3RBZ A;  1G4Y B;  3VOU A;  3STZ C;  3ABL C;  4PDV A;  5J9P C;  3TCU A;  4QE7 A;  2EIK C;  2ZD9 A;  4QNH B;  4OXS A;  2OCC C;  2Q67 A;  5B1A C;  2HFE C;  2WLJ A;  4PA6 A;  3X2Q C;  1V54 C;  3WG7 C;  5KUM A;  4GX2 A;  3FB7 C;  4MVR A;  4R50 A;  2HJF C;  4HZ3 A;  4PA3 A;  2NLJ C;  1OCZ C;  5EBW C;  4MVO A;  3E83 A;  2WLM A;  2ITD C;  1R3K C;  2IH1 C; 
#chains in the Genus database with same CATH topology
 3OR6 C;  3L72 H;  4NXM B;  3K9A A;  2F23 A;  3SYO A;  2ZM6 B;  4DV2 B;  4JV5 B;  4OPH A;  3D3I A;  2Q73 A;  2KQX A;  2FL4 A;  3SYC A;  3L9D A;  4J10 A;  1S77 D;  1R73 A;  2YSU B;  1OCC B;  2ZXW C;  1SER A;  1K7D A;  3MD0 A;  3ABU A;  3GB7 C;  2F1M A;  4QE9 A;  2E5L B;  3CCQ V;  2ZDI A;  1NQT A;  4I9Q A;  3ZHT A;  3JAW A;  1JA8 A;  3H01 A;  4X88 A;  1S72 V;  3CCL V;  4DUY O;  2YXH A;  1VQK V;  4N23 A;  2IJK A;  3MHH C;  3O65 A;  4TV8 A;  1VQ8 V;  5FPO A;  3OFN G;  5IYD O;  2Z3Y A;  5EZY B;  4J7J A;  3S3W A;  4PA7 A;  1IVS A;  1TA8 A;  5CA0 B;  4MW3 A;  1I7F A;  3CP1 A;  1E79 G;  5IE9 A;  4C7U A;  3H9V A;  4GX5 A;  4FFB A;  1K5S A;  2W0F C;  3OGI B;  3M7M X;  2PYL A;  5LOV A;  4DRX A;  2ADQ B;  1VMG A;  3I56 V;  1MG1 A;  2V1D A;  1WPB A;  4UV9 A;  3AEI A;  3QF7 A;  2PZS A;  2B9Z A;  4LFA O;  2A79 B;  1NI8 A;  1N36 O;  1K92 A;  1SZT A;  4NKG B;  1I5Y A;  2GBO A;  4L8J A;  4X9Q A;  5J2U A;  4LFA B;  3W7X A;  1JJO A;  3E22 A;  1Y74 B;  3JCU Z;  2WLJ A;  2EUL A;  3CC4 V;  1DLB A;  4DV5 O;  2DYS B;  1VF6 C;  4I5S A;  4ABM A;  3JAT A;  5AG2 A;  1N0N A;  1MSW D;  2OTJ V;  2CK3 G;  1OJH A;  5LA6 A;  2YID A;  3MAQ A;  2GSM B;  5IYC O;  4DV5 B;  5DED A;  4JAA A;  5EYP A;  1FPO A;  5JQG A;  4LFB O;  3SJQ C;  2HVK C;  2HJD A;  1K9M W;  4X89 A;  4FFK A;  4OGQ B;  3RFR A;  3IGA C;  5KUK A;  1QLN A;  4LFB B;  3ABL B;  5FNV A;  2EIK B;  3J80 N;  3I5D A;  3JAS B;  2YUA A;  1W0J G;  4J7K A;  1EFR G;  2DWE C;  4UVA A;  2OWO A;  3FB8 C;  5L3D A;  5GON B;  1B6Q A;  2Q7H A;  2Y4T A;  3SJA C;  5HFL A;  4DR6 O;  3AG4 B;  2F93 B;  1K8A W;  1NZ6 A;  2DYR B;  1GMG A;  3M99 B;  3W7S A;  4UCT A;  3FFQ A;  3SYA A;  4LBE C;  5IJ9 B;  5KA6 A;  1L1F A;  2QA4 V;  1NVP B;  4B3R O;  3ZRX A;  5EBL C;  4DO2 A;  1YJW V;  1Q8I A;  2CTP A;  4FLY A;  1AR4 A;  5BR8 O;  1XNR B;  4JTD B;  2W6I G;  1GKF A;  2LFR A;  4MVZ A;  1RSO A;  1W59 A;  4LF8 O;  4R8C A;  1QR9 A;  4DYL A;  4TV9 A;  4YY3 O;  5L3E A;  3K5L A;  3L75 H;  4HNA A;  1U96 A;  5BR8 B;  5IYZ B;  1G4Y B;  1GM7 A;  2UXC O;  1B3Q A;  4LF8 B;  4JYC A;  2ZQM A;  1R6K A;  1LR1 A;  2EIL B;  4YY3 B;  1DGS A;  4ICG A;  3ZX6 A;  1YJN V;  3H1L H;  4PA6 A;  1V54 C;  3WG7 C;  5LBQ A;  5C8Y A;  1NR7 A;  4K8Z A;  1R3K C;  3UM7 A;  3G6B A;  1QLE C;  1CP9 A;  4TWK A;  2XAS A;  5BXZ A;  4JYB A;  4JYY A;  1H8E G;  3BHP A;  4BWA A;  3NR7 A;  5LYJ B;  4LF6 O;  1YZB A;  2Q6A A;  4O4H A;  1S0V A;  3N27 A;  5FL7 G;  3FX7 A;  1QVG U;  3K5N A;  1W0K G;  4AI8 A;  1H8H G;  1NTM H;  4YJ3 A;  1ZL8 A;  4UCR A;  1H2L A;  1PV0 A;  4TUY B;  3RYH A;  3BA9 A;  3TGU H;  4X1K A;  3UT5 B;  4RAI A;  3LNM B;  2CGN A;  1IXM A;  1J95 A;  2EIJ C;  1N8R W;  2EIM C;  4NTY A;  2BSK A;  1VQN V;  4UVC A;  3JAL A;  3AK2 A;  2ZR2 A;  3HKD B;  3CMA V;  5TIS Z;  4PI0 A;  3UQ8 A;  3E89 A;  1QVF U;  1AI7 A;  1KBH A;  4LH6 A;  1BZK A;  3C90 A;  2DJV A;  5B5E Z;  4TSF G;  5EC1 C;  2DWD C;  5LMU O;  2ZDI C;  3ASN C;  4B3M O;  5B66 Z;  1K4D C;  1FD9 A;  4X1I B;  2L6L A;  4O2A A;  1R1B A;  3TJT A;  5LMU B;  2QEX V;  3F7V C;  3ASN B;  2CAZ C;  1WNS A;  1XDC A;  1PKX A;  5JJJ B;  1AI5 A;  2WWW A;  2JJ1 G;  3MHS C;  1JOY A;  4GT1 A;  4E2L A;  2X6C A;  3CME V;  3C3S A;  3FYI B;  3SJB C;  1O9G A;  4RUE A;  3KCX A;  3W7T A;  3ZMV A;  2R9A A;  4DV4 O;  2OIG A;  5CB4 B;  1NR1 A;  4B08 A;  4R50 A;  2HJF C;  4MVO A;  4DV4 B;  3E83 A;  2PGG A;  5KA5 A;  4CS3 A;  2K1E A;  4WFF A;  3K57 A;  1VF7 A;  4LFC O;  3RYI B;  1G6U A;  3Q4H A;  4P9P A;  4IHJ A;  4DRX B;  1P7G A;  2H3O A;  4XBF A;  3U0Z A;  4I55 A;  1VQ7 V;  4I4T B;  1JQ0 A;  2OYQ A;  2YI9 A;  2HHH O;  3S3X A;  4YJ2 A;  4FLV A;  4ZI7 B;  4LFC B;  1ZAU A;  5L3C A;  3T1Y O;  1SF9 A;  1ENV A;  1M93 A;  2M6Y A;  1KP2 A;  2ZE7 A;  4RQE A;  2YS8 A;  5J2U B;  3GVM A;  4LF9 B;  5BY1 A;  3T1Y B;  1WB7 A;  2OT5 A;  2V4D A;  3SPC A;  2IH3 C;  3RYC A;  3UKM A;  1AVM A;  1CXZ B;  1Z2G A;  2LQT A;  1ORQ C;  4BR6 A;  4RO2 A;  2K9P A;  1G8M A;  3AG2 B;  4K8X A;  2YEV B;  1U97 A;  2CH7 A;  1PL0 A;  3ABK C;  3G4S V;  3IJ4 A;  3AG1 B;  5JQG B;  4JI8 B;  3TXQ A;  3CCS V;  1FXK B;  4UB6 Z;  1WP7 A;  1SQX H;  4OX9 O;  3CX5 F;  3ETQ A;  4FM2 A;  2ZT9 B;  1MOF A;  4F6R A;  1M56 C;  1B06 A;  3CB2 A;  4IGG A;  2FYU H;  4OX9 B;  4YIP A;  1TVK A;  3ZRS A;  3IAY A;  3NXS A;  5CN0 A;  3APO A;  3KZI Z;  1LUW A;  2UUB O;  5F2V O;  4UCS A;  3OGC C;  2QJ1 A;  1M56 B;  2WLL A;  4ZOL A;  4GUN A;  1AR5 A;  3VOU A;  1PL4 A;  1Z5V A;  1ZUQ A;  2UUB B;  1OCO B;  1JFF A;  1AI6 A;  1VEW A;  1K3E A;  1NT2 B;  2XAG A;  1BS3 A;  3OEE G;  2AW9 A;  4HZ3 A;  4PA3 A;  4ZHQ A;  1QU7 A;  2E75 B;  4BIO A;  3SR2 C;  2ITC C;  1NH2 D;  3OE7 G;  3BAB A;  2KKW A;  1OCR B;  1KB9 F;  1IBL O;  5IDJ A;  2VRZ A;  1YF2 A;  3CRQ A;  1SKV A;  4FVM A;  3VQW A;  4EEQ A;  1IBL B;  2ZE6 A;  1K5Q A;  2ARH A;  2ZIM A;  5JVD A;  1N4C A;  2IU0 A;  2QE7 G;  4JI2 O;  3P3N A;  4LWS A;  2PTM A;  1N34 O;  2JRI A;  3LDD A;  3UCS C;  2AHZ A;  2JIZ G;  2UXD O;  3F5T A;  4PV1 B;  4B3T B;  3JSL A;  1D2D A;  4JI2 B;  1QHT A;  2Q8V A;  1AR1 B;  1K34 A;  1MSD A;  2GUZ B;  3D36 A;  1EN6 A;  2UXD B;  1URF A;  3T4D A;  3C3T A;  5KX5 B;  3OW2 U;  4H33 A;  4DK1 A;  1SQP H;  5JWP A;  4TQD A;  3CS5 A;  3CCU V;  4I7Z B;  3CXC U;  3LNN A;  1ZLZ A;  4TT3 G;  1QCE A;  4WFA V;  2OIE A;  2Z0A A;  3BPZ A;  2F66 C;  1V55 B;  3QG5 A;  3U11 A;  1Y6X A;  1BGY H;  2A06 H;  1GH6 A;  4WF9 V;  2QWQ B;  1SQQ H;  4JI6 B;  1SA0 B;  2BSK B;  3WFV A;  2DQ0 A;  3JAL B;  4X64 O;  1BQ0 A;  4HBN A;  1R3L C;  4EB6 B;  1VF5 B;  4U3J B;  1Y76 A;  3N2K A;  2Y0P A;  5JJE B;  5J9P C;  4QE7 A;  3QO8 A;  5B1A C;  1N0J A;  3L74 H;  4HAM A;  4Z1V A;  2H94 A;  1OV9 A;  3K5O A;  1OCZ C;  5KMG B;  1L0N H;  2EBO A;  2AGA A;  5IY5 C;  3JAK A;  4LF4 O;  3RYF B;  1XL4 A;  3A2F A;  3ZHQ A;  1FFX B;  2MK3 A;  4MVQ A;  3ZED A;  5LMN O;  4FLX A;  5J2T A;  5CA1 A;  3E86 A;  3CD6 V;  2DN9 A;  2HEP A;  1QBZ A;  4TQF A;  4DV2 O;  4JV5 O;  5CMU A;  4WFB V;  1G1X B;  2UXX A;  5LMN B;  4UB8 Z;  3DXR A;  3T2M A;  1IZ3 A;  1TUE B;  1PNL A;  3QO5 A;  1X59 A;  4O4J B;  2P6J A;  2Q7E A;  3SDL A;  2E5L O;  1XL6 A;  2Y0I A;  3ZMT A;  4O4I A;  4J9Z B;  4I0X A;  5D5Q A;  2P7T C;  4G27 B;  2Q0O C;  4LR3 A;  5EIB D;  4N21 A;  5BMV A;  2ZXW B;  1K97 A;  2PI5 A;  1GN3 A;  3LSQ A;  3B8N A;  1JCH A;  4MW8 A;  4DV6 O;  3ZRW A;  4O2B B;  3B8M A;  2VS0 A;  3DC5 A;  4XDK A;  1WA8 A;  4DV6 B;  3WU2 Z;  1L8D A;  2HG5 C;  1RFY A;  1GN4 A;  3AK3 A;  1US6 A;  1YSC A;  2PY5 A;  3TXS A;  1N32 O;  3HKE B;  2PF4 E;  1FAF A;  5IJ0 A;  1YJ9 V;  1R6N A;  5K1P A;  5KUM A;  4CH4 A;  1XQ8 A;  1NVP D;  1BMF G;  1N32 B;  2GTA A;  5EBW C;  4LNU A;  4AQY O;  2ITD C;  4JTC B;  2OCH A;  1T5E A;  5JH7 B;  4YXW G;  1VIB A;  3IC9 A;  4F6R B;  1XUQ A;  4G28 B;  5B1B C;  2BCC H;  4AQY B;  1XHZ A;  1PNK A;  2GTS A;  3JAR B;  3HKB B;  4K3A A;  2B1G A;  4XDJ A;  3TET A;  1E1R G;  5GW7 A;  2F95 B;  2Y69 C;  2PUS A;  4OPA A;  2XUM A;  1XHX A;  2WLL B;  1IDS A;  3OTF A;  5CA3 A;  2QTO A;  1VQ9 V;  1JX9 A;  1FKA O;  4DR5 O;  2UXB O;  1GRJ A;  3OMN B;  1H2S B;  1M1K W;  4D6T H;  2QM4 A;  3RVY A;  4MTF A;  4PA9 A;  4X8A A;  3CC7 V;  3ABM C;  5LL6 Y;  4DR5 B;  2Q5Z A;  5IYB O;  2UXB B;  1EZV H;  1O9H A;  3FAV B;  3ZHV A;  2DE0 X;  2QGN A;  3CC2 V;  1YIJ V;  3ABM B;  4E4E A;  2LJ2 A;  4X1Y B;  4MTG A;  1EM1 A;  1MA1 A;  1COW G;  1S3J A;  4KFM A;  3G6E V;  4MVM A;  2ATK C;  4DR2 O;  2XAH A;  1VQM V;  1TGO A;  5DEC A;  4JI0 B;  1FFT B;  2ZKO A;  5JVD B;  1QR8 A;  1MNG A;  2NN4 A;  4JI4 O;  4IL6 Z;  2WLK A;  4DR2 B;  3O9O A;  3RW0 A;  4LC1 A;  3K04 A;  1Q86 W;  3D36 C;  4LF7 O;  4NR1 A;  5B1O A;  2GHY A;  4JI4 B;  2XTA A;  2E3C A;  1XNR O;  1XI1 A;  1GK9 A;  3CCR V;  1HWY A;  4LF7 B;  4CH5 A;  1HR0 O;  4X20 B;  2RJZ A;  4UCO A;  3OM3 B;  4FZ0 A;  2E76 B;  3F5W C;  2QWR B;  3ZRV A;  3LSU A;  1S5H C;  1HR0 B;  3CRA A;  3K79 A;  2XT9 A;  3B40 A;  3CCE V;  3L73 H;  1TUB A;  3JYC A;  1MAB G;  5LXT B;  3OUF A;  5ITZ B;  4DUZ B;  4Q20 A;  3MDS A;  2XND G;  2ZIO A;  4DV1 O;  3HPL C;  2R9I A;  4IYH A;  1P49 A;  2CGO A;  1I94 B;  1V54 B;  3WG7 B;  2R70 A;  2CDY A;  2BOC C;  4BW9 A;  2AHY A;  1NTK H;  3HKC A;  5A2Q N;  1AJQ A;  4CH3 A;  4R6Z A;  3FB5 C;  4DV1 B;  2EJ7 A;  3AK1 A;  2WLI B;  3JD1 A;  1THZ A;  1QLE B;  3L70 H;  1A32 A;  2WSS G;  1Y4M A;  4JI1 O;  1XNQ O;  4H0L B;  4QJF B;  2FKX A;  1D5N A;  1P84 F;  2QM7 A;  3ZN1 A;  4BW5 A;  2JGD A;  1YXB A;  1M57 C;  1Z5W A;  3N2G B;  1K33 A;  4EKW A;  3PN1 A;  4JI1 B;  1XNQ B;  3CE2 A;  2KG7 A;  4W4L A;  1DF4 A;  3H1J H;  1IBK B;  2BTQ A;  2JS3 A;  2DQ3 A;  5DN6 G;  1M57 B;  4J41 A;  3ETG A;  3FB6 C;  3LSS A;  3KG2 A;  2N05 A;  3ZS8 C;  3FYE B;  1PP9 H;  1ZWI C;  2EIN C;  2EIJ B;  2EIM B;  3W7W A;  4QGP A;  1JR9 A;  3M8A A;  1KQS U;  2R9R B;  1KYO F;  1AP6 A;  1Q43 A;  5LP6 A;  2EX3 A;  1NKD A;  3STZ C;  5LGN A;  1MZF A;  4KP4 A;  1UJW B;  2Q67 A;  3CJH A;  4DV0 O;  3X2Q C;  1Q90 D;  5BMV B;  5KHI A;  3JAW B;  1IX9 A;  4JYA O;  2RQ6 A;  1LNQ A;  4O4L A;  3SPJ A;  2JS5 A;  1KUQ A;  4DV0 B;  3K9S A;  4TV8 B;  1EN5 A;  4JYA B;  1R6T A;  2F4V O;  4IIJ A;  2DOS A;  1N33 O;  1WPX A;  5L3B A;  4DR1 O;  1WA8 B;  3BA8 A;  4H44 B;  5KAF Z;  4JF3 A;  4JAU A;  2IM9 A;  2F4V B;  4X65 B;  1N33 B;  4DR1 B;  1AB3 A;  3U10 A;  5FLX N;  1VQ4 V;  4FLW A;  4G2K A;  4JI5 O;  4FFB B;  3K5M A;  2RCV A;  5IJ0 B;  1SQB H;  4UUJ C;  2EJR A;  5LOV B;  3OR7 C;  2GV9 A;  5A9G A;  4JI5 B;  1BHA A;  3E8F A;  1YTF B;  2Q69 A;  4FPP A;  4LF9 O;  2YIB D;  1H2K A;  4DR7 B;  4LH7 A;  4IT5 A;  5KAI Z;  4U7O A;  3E22 B;  3CEI A;  5GTH Z;  4AIL C;  1Y67 A;  2AXT Z;  2RDC A;  4DW1 A;  1Q6H A;  3T4Z A;  3JAT B;  4JI8 O;  4BAY A;  4ZBM A;  3K58 A;  3B4S A;  4GX0 A;  5BZB A;  1BCC H;  1F7Y A;  2YIC A;  5EZY A;  4IYI A;  5LA6 B;  4ZIB A;  1RP3 B;  5EYP B;  1KKD A;  1YI2 V;  4U3F H;  2H8P C;  2HLD G;  3BFR A;  3PJS K;  5HFM A;  4RUF A;  2VWK A;  1IUR A;  4MS2 A;  3R66 A;  1IBM O;  3BRC A;  1XOU A;  3ABK B;  2ETN A;  3TCU A;  5E79 Z;  3ZN0 A;  2QWN B;  4J11 A;  2OCC C;  1VQO V;  3K59 A;  2HFE C;  1VAR A;  2LO1 A;  4GX2 A;  1IBM B;  1FYJ A;  5FNV B;  1VQP V;  4PD4 F;  1ZTE A;  2WLM A;  2YI8 A;  4MTO A;  2BTO A;  4JI7 O;  3JSN A;  4L87 A;  2VQE O;  3DTU B;  3CCM V;  4QPJ A;  1HNW O;  4A5U B;  4NXN O;  1AI4 A;  4GKK O;  3G67 A;  2UUC B;  5LHH A;  4JI7 B;  4PDR A;  3RWR D;  3EXA A;  3VBB A;  2VQE B;  3ZHR A;  1HNW B;  1Y74 A;  4NXN B;  3EHB B;  3AG7 A;  4MSW C;  4GKK B;  4KL1 A;  1BT8 A;  3ZHU A;  4PDL A;  1WN7 A;  4XDL A;  4NVP A;  5KHG A;  2CTW A;  2A0L A;  2OTL V;  2EZP A;  4J7Z A;  3K06 A;  1GAX A;  2QM8 A;  4WFG A;  1RSO B;  1HNX B;  4MVS A;  4U7N A;  1AJN A;  2UUA B;  4TV9 B;  1BL8 A;  2CE4 A;  3K03 A;  4HNA B;  4FLZ A;  4GYC B;  2E74 B;  4B3T O;  2X6A A;  4JPR A;  1TUB B;  2JEU A;  4MTX A;  3JAS A;  2HVJ C;  3JD0 A;  1ROP A;  4CBC A;  2QKA A;  2QDO A;  5C8Y B;  1YCI A;  1J5E B;  2QTS A;  5GON A;  1DF5 A;  4HYO A;  2NR5 A;  1AJP A;  4O4H B;  2EZO A;  1KD1 W;  2IJJ A;  4PDV A;  4FIP C;  5IJ9 A;  1DK1 A;  4JI6 O;  5KHK A;  4YJ3 B;  3OT7 A;  1DTO A;  1ZL8 B;  1Y66 A;  1ZSP A;  3JD3 A;  4I50 A;  3EVK A;  2IU3 A;  4PHZ A;  3RYH B;  3QNE A;  4X1K B;  3AG3 C;  2LW1 A;  2P4V A;  2FTK A;  1NJI W;  1PNM A;  4DV3 O;  2CUG A;  3T1C A;  2KB1 A;  4I9W A;  5IYZ A;  5LP6 C;  4Q6G A;  5B1N A;  1WB8 A;  5KHJ A;  1FXV A;  2X7R B;  4QIW F;  3THO A;  1CPY A;  4DV3 B;  5B3S C;  4JGS A;  4JI3 O;  4B7K A;  4B7E A;  3OAA G;  5CBH A;  4DR3 O;  2LGQ A;  5B1A B;  2A3Q A;  2A9H A;  2JEX A;  1XRE A;  4FZ1 A;  1XBL A;  4O2A B;  4JI3 B;  1RPO A;  2CTQ A;  1OCZ B;  1R3I C;  2LP7 A;  4F6E A;  1OHH G;  4DR3 B;  5H6R A;  5LYJ A;  3DC6 A;  5IY5 B;  1NU1 H;  1RM1 C;  4DW0 A;  1QNM A;  4NTX A;  2FB5 A;  1KU9 A;  2QSA A;  1WLE A;  3E8G A;  4QPK A;  3STL C;  1YHQ V;  3GWK C;  5JCO A;  1RM1 B;  5KLV H;  4BIU A;  3WB1 A;  2DMX A;  1YDX A;  3ETE A;  4TUY A;  3UT5 A;  1KMI Z;  2W0X A;  3R65 A;  3EFF K;  3SPG A;  1HW7 A;  2JVD A;  2RNB A;  4JZG A;  2P22 C;  1ZX3 A;  3HKD A;  4R7C A;  2LW7 A;  3SGI A;  4CC6 A;  2XHB A;  1VQ6 V;  4GKJ O;  2JGU A;  1OCC C;  4PA4 A;  3Q4H B;  4IHJ B;  2NNU A;  4I55 B;  1SQF A;  3FKS G;  1AIL A;  3W7U A;  1VQ5 V;  4GKJ B;  4YJ2 B;  3CSX A;  2AZ0 A;  4X1I A;  1AP5 A;  3T1H O;  2P90 A;  5D5P A;  3H1K H;  3CCV V;  2IBZ H;  3F7Y C;  2LGW A;  3RYC B;  3T1H B;  5E1A C;  1B04 A;  2JK5 C;  4DK0 A;  1NS1 A;  1Q5O A;  4DUY B;  2CH7 B;  1S5J A;  2JDI G;  2XAJ A;  3SPH A;  5CB4 A;  3ML0 A;  2KSD A;  2C2A A;  2QKS A;  2QR4 A;  3DGE A;  2FML A;  4X62 O;  3JAM N;  4PJ0 Z;  4WBN A;  3HB3 B;  1H2G A;  4FJC C;  4P2Z A;  3JD4 A;  2IJI A;  2WLH A;  5H9C A;  1R3J C;  5KHH A;  4AHC A;  4X62 B;  2XAF A;  1L0L H;  2A7W A;  1TVK B;  5L3F A;  3RYI A;  1P4R A;  4I4T A;  4FK5 C;  3I55 V;  4PEL A;  4LP8 A;  5B1B B;  4ZI7 A;  4X66 O;  1WAZ A;  4ZOL B;  2YC0 A;  2CTR A;  4FM0 A;  3K3W A;  1EBO A;  1JFF B;  2DYS C;  3LDC A;  2WA3 A;  2Y69 B;  4X66 B;  3UO2 A;  1F4M A;  1N36 B;  4ZHQ B;  2G38 A;  1PD3 A;  3CHX A;  4CC5 A;  4WFH A;  1IXB A;  2ZE8 A;  1M90 W;  1TAE A;  5EIB C;  2YEV A;  1WJZ A;  4JI0 O;  1JPX A;  3RBZ A;  2ILM A;  1GO3 F;  2QKC A;  1FXK A;  3ABL C;  2D3O W;  2EIK C;  2ZD9 A;  2Y48 A;  3RN4 A;  4FMT A;  3ZMZ A;  3JCZ A;  3ABT A;  3WB0 A;  1GN2 A;  4CS2 A;  4LWS B;  3FD9 A;  1KKC A;  3ICX A;  1MMM A;  1H38 A;  3AG4 C;  4GX1 A;  2Z5U A;  1JVM A;  1KEC A;  2DYR C;  1KP3 A;  3ETD A;  4FLT A;  3P3P A;  4H13 B;  5EK0 A;  3BAA A;  4DR6 B;  1Q82 W;  3A0R A;  4UVB A;  3E8B A;  2HKO A;  3J7A U;  4DUZ O;  3E8H A;  3E35 A;  2X0L A;  1Q6U A;  3B2E E;  4P30 A;  4I50 B;  3SYQ A;  4DR4 O;  1Q6I A;  2B1I A;  1I94 O;  2YIB A;  3HR0 A;  4B3R B;  4FLU A;  3OEH G;  2EIL C;  2VQF O;  4DR4 B;  2VWJ A;  1Y76 B;  3N2K B;  4KXR A;  1K73 W;  3BEH A;  4Z1M G;  1Q7Y W;  3ZHS A;  2VQF B;  3D8C A;  3CYO A;  4H37 A;  3ZMS A;  4ASU G;  5EBM C;  1GTO A;  2JJ2 G;  4MT8 A;  1SQV H;  3JD2 A;  2UXC B;  4LCU C;  1EN4 A;  5JJN B;  2HP8 A;  1IBK O;  3JAK B;  2GUZ A;  1YTF D;  3ASO C;  4DV7 O;  5KX5 A;  5J2T B;  5CA1 B;  4CZZ A;  3VQV A;  5JCO C;  4NTW A;  4FM1 A;  2D2C B;  4CH6 A;  3ASO B;  1FJG O;  4DV7 B;  3OTO O;  4LF6 B;  3B77 A;  3P30 A;  1S5L Z;  3DXR B;  2NLJ C;  1F23 A;  2UU9 O;  1LUV A;  3P32 A;  1FJG B;  1KC8 W;  3OTO B;  2W6J G;  1FXH A;  1SA0 A;  3APQ A;  4O4I B;  2EIN B;  4CS4 A;  4W4K A;  2UU9 B;  3QVN A;  4I0X B;  4EB6 A;  4U3J A;  2RMK B;  5EC2 C;  3G80 A;  1M5I A;  4MVU A;  3CWB H;  1SS3 A;  5KMG A;  3X2Q B;  5C93 A;  4J42 A;  1I08 A;  2XAQ A;  3ZRW B;  2IJH A;  1JJ2 U;  3L71 H;  1BHB A;  4X65 O;  2P67 A;  3RYF A;  2V7Q G;  3IFX A;  1FFX A;  4JZ2 A;  1GM9 A;  4B3M B;  4JTA B;  1SES A;  1XEQ A;  2O57 A;  4RWU A;  2BOB C;  4KUM A;  3BCC H;  4GLX A;  2UXN A;  4WCE V;  2PI4 A;  2X6B A;  4NB5 A;  1RPR A;  4O4J A;  4DR7 O;  4LNU B;  3A0H Z;  4EFB A;  1F51 A;  4YHH O;  3SYP A;  4WBN B;  5CBG A;  2HR3 A;  2LFS A;  1JMK C;  2Q4P A;  4JAS A;  2R72 A;  3D3Q A;  4K0K O;  2Q9L A;  4YHH B;  2GDS A;  3OUS A;  1NTZ H;  3ZBH A;  4QNH B;  3GWO A;  1CEZ A;  2N04 A;  2N74 A;  4K0K B;  1M9N A;  4UCV A;  2RN9 A;  2ZR3 A;  3OMA B;  1YEW A;  3A0B Z;  4O2B A;  1XMQ O;  4GCZ A;  2AZ2 A;  2IW5 A;  3QTC A;  2HHH B;  3B09 A;  1SC5 B;  4Z2W A;  3TK1 A;  3AG2 C;  5CA0 A;  1XMQ B;  1UPG A;  1E1Q G;  5IWA O;  3AG1 C;  1M4U A;  3K0G A;  2F43 G;  2DW4 A;  1FXK C;  3HKE A;  3KCY A;  4EFE A;  1YVW A;  5IWA B;  3CRR A;  2PYJ A;  3KKY A;  2OCC B;  2UUC O;  3IC7 A;  5JH7 A;  2WA4 A;  3UO3 A;  2B5U A;  4PDM A;  2WLN A;  3RVZ A;  1XIL A;  3SPI A;  5LHI A;  5H6Q A;  3SJC C;  3JAR A;  3HKB A;  2ZNI A;  1OCO C;  1V9P A;  4NYK A;  5FPR A;  4D7T A;  3OMI B;  1SET A;  4WFE A;  1YIT V;  2YXL A;  5L3G A;  1HNX O;  4UFZ A;  2UUA O;  3BY6 A;  2YXY A;  5K1X A;  2ZCE A;  2Q68 A;  4PI2 A;  1VF6 A;  1SZX A;  3H1H H;  1D5A A;  1OCR C;  2M7W A;  2L35 A;  4LF5 O;  3FAV A;  4B3S O;  2ODM A;  4J80 A;  1QQC A;  1HNZ O;  3LUT B;  2QWO B;  3QO7 A;  4KHP O;  4UCU A;  3K08 A;  1J5E O;  2Y4U A;  4X1Y A;  1W2B U;  4LF5 B;  1XMO O;  4B3S B;  4BIZ A;  3CPW U;  2WAM A;  1HNZ B;  4KHP B;  1H2N A;  1EZJ A;  1F4N A;  1BE3 H;  1GM8 A;  3FB7 C;  2XOK G;  1XMO B;  1Q81 W;  1Q3E A;  3VQX A;  2P5O A;  5LGU A;  3H1I H;  1VP7 A;  1H2M A;  5GTI Z;  3CCJ V;  3HKC B;  5LHG A;  2WPD G;  4TOI A;  3G71 V;  2P4K A;  4F4L A;  1VQL V;  3ZIA G;  3ZJZ A;  1N34 B;  2ZIN A;  5DM6 V;  1NBM G;  2QWP B;  1I5X A;  3RGB A;  2JGD B;  3CRM A;  4X20 A;  1SQG A;  1V55 C;  2KG7 B;  4UXN A;  5CBF A;  2BTQ B;  1S76 D;  1ARO P;  3RT3 C;  1MZE A;  4J9Y B;  2ZNJ A;  3OD4 A;  5H5N A;  4GZR B;  4JAV A;  1UFI A;  4DXW A;  3AG3 B;  5H2F Z;  1PM9 A;  3J81 N;  3DSQ A;  3E2E A;  5LXT A;  5ITZ A;  1HDJ A;  5LP6 B;  1K4C C;  1HP8 A;  4UV8 A;  3K0D A;  1FS0 G;  3LDE A;  4RQF A;  3CXH F;  3VQY A;  5B3S B;  2YIA A;  2YDE A;  3CJH B;  3ZMU A;  2Q7G A;  2ZE5 A;  4X64 B;  1P7B A;  1NH2 B;  1GN6 A;  4ZKI A;  2BE3 A;  4O4L B;  2WLI A;  1OZ0 A;  3A8T A;  3BVO A;  3ZCC A;  1X4T A;  4P9O A;  3CRC A;  4IIJ B;  2P06 A;  3WB2 A;  5LGT A;  2Q0A A;  4K35 A;  3N2G A;  1PPJ H;  4YIO A;  1SRY A;  2MW2 B;  1I0H A;  4OXS A;  4NXM O;  5IT9 N;  2ZM6 O;  1BSM A;  4LF4 B;  2ADP A;  4MVR A;  1BQZ A;  1WP8 A;  4D7S A;  2IH1 C; 
#chains in the Genus database with same CATH homology
 3OR6 C;  3SPJ A;  2ITC C;  1NH2 D;  3K9A A;  3AG4 C;  3SYO A;  4GX1 A;  3OE7 G;  2Z5U A;  1JVM A;  1OCR B;  1KEC A;  2DYR C;  3D3I A;  5IDJ A;  1KP3 A;  3SYC A;  1WPX A;  5L3B A;  1S77 D;  1R73 A;  2YSU B;  1OCC B;  2ZXW C;  1SER A;  1K7D A;  3MD0 A;  3ETD A;  3ABU A;  4JF3 A;  4JAU A;  3GB7 C;  4QE9 A;  3CCQ V;  5EK0 A;  1K5Q A;  2ZDI A;  1NQT A;  2IU0 A;  1VQ4 V;  2QE7 G;  3H01 A;  4G2K A;  1Q82 W;  3LDD A;  3A0R A;  4X88 A;  1S72 V;  4UVB A;  3CCL V;  3E8B A;  2HKO A;  2AHZ A;  4UUJ C;  2JIZ G;  1VQK V;  2EJR A;  3E35 A;  3E8H A;  2X0L A;  4N23 A;  4P30 A;  2IJK A;  3MHH C;  3OR7 C;  1VQ8 V;  3SYQ A;  1BHA A;  3E8F A;  3OFN G;  1YTF B;  5IYD O;  2Z3Y A;  1AR1 B;  2Q69 A;  1K34 A;  2B1I A;  4PA7 A;  3D36 A;  4FPP A;  3T4D A;  3OEH G;  2EIL C;  3OW2 U;  4H33 A;  4MW3 A;  3CP1 A;  3CCU V;  1E79 G;  3CXC U;  4TT3 G;  4GX5 A;  4U7O A;  1K73 W;  3BEH A;  4Z1M G;  1QCE A;  1K5S A;  2W0F C;  4WFA V;  1Q7Y W;  3CYO A;  1V55 B;  4H37 A;  3ZMS A;  4ASU G;  5EBM C;  1GTO A;  2JJ2 G;  3T4Z A;  4MT8 A;  3JD2 A;  4BAY A;  4ZBM A;  4WF9 V;  1MG1 A;  3I56 V;  4LCU C;  4GX0 A;  5BZB A;  2V1D A;  4UV9 A;  3AEI A;  1YTF D;  1KKD A;  3ASO C;  1YI2 V;  2A79 B;  3WFV A;  2DQ0 A;  2H8P C;  2HLD G;  3PJS K;  1K92 A;  5HFM A;  4RUF A;  1R3L C;  1SZT A;  4MS2 A;  4CZZ A;  1I5Y A;  5J9P C;  3ABK B;  3TCU A;  4QE7 A;  3QO8 A;  3ZN0 A;  3ASO B;  3W7X A;  2OCC C;  5B1A C;  1VQO V;  4HAM A;  2HFE C;  2WLJ A;  3CC4 V;  1DLB A;  2DYS B;  4GX2 A;  3B77 A;  3P30 A;  2H94 A;  4I5S A;  1VQP V;  2NLJ C;  1OCZ C;  2WLM A;  1F23 A;  1MSW D;  2OTJ V;  2EBO A;  3P32 A;  1KC8 W;  4MTO A;  2CK3 G;  5IY5 C;  2W6J G;  2GSM B;  5IYC O;  1FXH A;  4L87 A;  3DTU B;  1XL4 A;  3CCM V;  4QPJ A;  2EIN B;  1AI4 A;  3SJQ C;  2MK3 A;  4MVQ A;  2HVK C;  3E86 A;  5LHH A;  1K9M W;  3CD6 V;  4PDR A;  4X89 A;  3VBB A;  1QBZ A;  5EC2 C;  3IGA C;  5KUK A;  5CMU A;  1QLN A;  3EHB B;  4MVU A;  4WFB V;  4MSW C;  2UXX A;  3ABL B;  2EIK B;  4PDL A;  4XDL A;  3T2M A;  3X2Q B;  5C93 A;  2XAQ A;  3ZRW B;  1TUE B;  1W0J G;  2IJH A;  2A0L A;  1EFR G;  2DWE C;  1JJ2 U;  2OTL V;  4UVA A;  1PNL A;  3FB8 C;  3QO5 A;  5L3D A;  2EZP A;  2P6J A;  1BHB A;  1B6Q A;  1XL6 A;  2P67 A;  3K06 A;  2V7Q G;  3IFX A;  2QM8 A;  5HFL A;  4WFG A;  3ZMT A;  1GM9 A;  4J9Z B;  3AG4 B;  4MVS A;  4U7N A;  1AJN A;  4JTA B;  1BL8 A;  1SES A;  2P7T C;  1K8A W;  3K03 A;  2DYR B;  4G27 B;  1GMG A;  3M99 B;  4N21 A;  2BOB C;  3W7S A;  4KUM A;  2X6A A;  4JPR A;  2ZXW B;  1K97 A;  3SYA A;  2PI5 A;  4LBE C;  3LSQ A;  3B8N A;  1JCH A;  2JEU A;  4MW8 A;  4MTX A;  5KA6 A;  1L1F A;  2QA4 V;  2UXN A;  1NVP B;  3ZRX A;  5EBL C;  4DO2 A;  4WCE V;  2HVJ C;  3JD0 A;  3ZRW A;  1ROP A;  4CBC A;  1YJW V;  2PI4 A;  2X6B A;  1RPR A;  3B8M A;  1F51 A;  1DF5 A;  3SYP A;  5CBG A;  4JTD B;  2W6I G;  2HR3 A;  4HYO A;  1GKF A;  4XDK A;  2LFR A;  4MVZ A;  2LFS A;  4R8C A;  1QR9 A;  5L3E A;  4JAS A;  1AJP A;  2HG5 C;  2EZO A;  3OUS A;  1G4Y B;  1YSC A;  1GM7 A;  2IJJ A;  1KD1 W;  4JYC A;  2ZQM A;  1R6K A;  4PDV A;  2EIL B;  4FIP C;  4QNH B;  1YJ9 V;  1YJN V;  1R6N A;  3GWO A;  1CEZ A;  4PA6 A;  1M9N A;  1V54 C;  3WG7 C;  5LBQ A;  1DTO A;  5KUM A;  2ZR3 A;  3OMA B;  1Y66 A;  1NVP D;  3JD3 A;  1NR7 A;  1BMF G;  5EBW C;  2IU3 A;  4GCZ A;  2ITD C;  1R3K C;  3QNE A;  2IW5 A;  3AG3 C;  4JTC B;  3UM7 A;  1QLE C;  1CP9 A;  4TWK A;  2XAS A;  3TK1 A;  4YXW G;  2FTK A;  3AG2 C;  1NJI W;  4JYB A;  1H8E G;  1PNM A;  1E1Q G;  4G28 B;  5B1B C;  3T1C A;  2KB1 A;  4I9W A;  2Q6A A;  1PNK A;  3AG1 C;  1S0V A;  5FL7 G;  3K0G A;  2B1G A;  2DW4 A;  2F43 G;  1FXK C;  1QVG U;  4XDJ A;  5B1N A;  3TET A;  1E1R G;  5GW7 A;  1FXV A;  1W0K G;  2X7R B;  2Y69 C;  4QIW F;  1CPY A;  5B3S C;  1H8H G;  4JGS A;  2WLL B;  3OAA G;  5CBH A;  2QTO A;  5CA3 A;  1VQ9 V;  1JX9 A;  2OCC B;  5B1A B;  3OMN B;  2A9H A;  2JEX A;  1M1K W;  4RAI A;  3LNM B;  3IC7 A;  1IXM A;  1J95 A;  2EIJ C;  1N8R W;  2EIM C;  3RVY A;  1RPO A;  4MTF A;  1OCZ B;  4PA9 A;  4UVC A;  4X8A A;  3CC7 V;  1VQN V;  1R3I C;  2LP7 A;  1OHH G;  3ABM C;  2ZR2 A;  5H6R A;  2B5U A;  4PDM A;  3CMA V;  2WLN A;  5IYB O;  3RVZ A;  3E89 A;  3SPI A;  5IY5 B;  1RM1 C;  5LHI A;  5H6Q A;  1QVF U;  1AI7 A;  3CC2 V;  1WLE A;  1YIJ V;  1OCO C;  3E8G A;  4QPK A;  3OMI B;  1SET A;  4WFE A;  3STL C;  3ABM B;  1YHQ V;  4TSF G;  5EC1 C;  2DWD C;  4MTG A;  1YIT V;  1RM1 B;  1COW G;  5L3G A;  2ZDI C;  1S3J A;  4BIU A;  3ASN C;  4KFM A;  3BY6 A;  1K4D C;  3ETE A;  3G6E V;  4MVM A;  2ATK C;  2XAH A;  2Q68 A;  3SPG A;  3R65 A;  3EFF K;  1VQM V;  2QEX V;  3F7V C;  1FFT B;  3ASN B;  1QR8 A;  1OCR C;  1PKX A;  2M7W A;  4R7C A;  2WLK A;  1AI5 A;  2WWW A;  3RW0 A;  2JJ1 G;  3MHS C;  1VQ6 V;  4GT1 A;  4LC1 A;  1JOY A;  3K04 A;  1Q86 W;  4E2L A;  1OCC C;  2X6C A;  4PA4 A;  3CME V;  3FYI B;  3LUT B;  3QO7 A;  4RUE A;  5B1O A;  2GHY A;  3K08 A;  2NNU A;  3W7T A;  1H38 A;  3ZMV A;  3FKS G;  3W7U A;  1W2B U;  1VQ5 V;  4BIZ A;  3CPW U;  1GK9 A;  3CCR V;  2WAM A;  1HWY A;  1EZJ A;  1F4N A;  3OM3 B;  1NR1 A;  1GM8 A;  3FB7 C;  2XOK G;  4R50 A;  2HJF C;  1Q81 W;  2P90 A;  4MVO A;  3E83 A;  3CCV V;  3F5W C;  5KA5 A;  5LGU A;  3ZRV A;  1S5H C;  3K79 A;  3CCJ V;  2K1E A;  3F7Y C;  5LHG A;  4WFF A;  3CCE V;  2WPD G;  3G71 V;  4F4L A;  5E1A C;  1VQL V;  3ZIA G;  4P9P A;  4XBF A;  2JK5 C;  3ZJZ A;  1VQ7 V;  3JYC A;  1JQ0 A;  1MAB G;  5DM6 V;  2JDI G;  1NBM G;  2XAJ A;  3OUF A;  1I5X A;  3SPH A;  3ML0 A;  5L3C A;  4Q20 A;  2C2A A;  2XND G;  2QKS A;  1ENV A;  3DGE A;  1V55 C;  3HPL C;  2R9I A;  3HB3 B;  4UXN A;  1KP2 A;  5CBF A;  1H2G A;  1S76 D;  4FJC C;  4P2Z A;  3JD4 A;  2IJI A;  1V54 B;  2WLH A;  1ARO P;  3WG7 B;  4RQE A;  5H9C A;  4J9Y B;  2BOC C;  1R3J C;  2AHY A;  1AJQ A;  4R6Z A;  4JAV A;  4DXW A;  2XAF A;  3FB5 C;  2OT5 A;  3SPC A;  2IH3 C;  2WLI B;  3AG3 B;  3JD1 A;  5L3F A;  1THZ A;  1QLE B;  3UKM A;  1ORQ C;  4RO2 A;  1P4R A;  1G8M A;  3AG2 B;  2WSS G;  1Y4M A;  4FK5 C;  2YEV B;  4PEL A;  3I55 V;  4LP8 A;  4QJF B;  5B1B B;  1PL0 A;  3E2E A;  3ABK C;  2QM7 A;  3ZN1 A;  4BW5 A;  3G4S V;  1M57 C;  1K4C C;  3AG1 B;  4UV8 A;  3CCS V;  1K33 A;  3K3W A;  1EBO A;  1FXK B;  2DYS C;  3K0D A;  1FS0 G;  3LDC A;  4EKW A;  3LDE A;  4RQF A;  2Y69 B;  5B3S B;  1DF4 A;  3ZMU A;  2DQ3 A;  5DN6 G;  1MOF A;  1M57 B;  1F4M A;  3ETG A;  3FB6 C;  1M56 C;  3LSS A;  1P7B A;  1PD3 A;  4WFH A;  1NH2 B;  3KG2 A;  4ZKI A;  2WLI A;  1OZ0 A;  3ZRS A;  3NXS A;  5CN0 A;  3FYE B;  1ZWI C;  2EIN C;  2EIJ B;  2EIM B;  3W7W A;  1M90 W;  3ZCC A;  1KQS U;  3OGC C;  2YEV A;  1M56 B;  4P9O A;  2R9R B;  2WLL A;  1JPX A;  3RBZ A;  1NKD A;  5LGT A;  3VOU A;  3STZ C;  5LGN A;  1GO3 F;  1FXK A;  1OCO B;  1SRY A;  3ABL C;  2D3O W;  4KP4 A;  1AI6 A;  2EIK C;  2ZD9 A;  4OXS A;  1UJW B;  2Q67 A;  1K3E A;  3X2Q C;  2Y48 A;  2XAG A;  4FMT A;  3OEE G;  3ZMZ A;  3JCZ A;  4MVR A;  3ABT A;  4HZ3 A;  4PA3 A;  1LNQ A;  2IH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...