2Q67A

Crystal structure of nak channel d66a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q67A00
3ASOC 4MSWC 4J9YB 1XL6A 3AG3C 3K0GA 3T4ZA 2HVKC 3LNMB 3E8HA 2X6BA 1V55C 2WLLA 2WLMA 2WLLB 5CBHA 4PDRA 1M56C 4MTGA 3SPJA 2DYSC 2A79B 3IGAC 4GX5A 4J9ZB 4G27B 3T2MA 2Q6AA 3K04A 1KKDA 4WFEA 3T1CA 3OUFA 4MTFA 3ZJZA 2K1EA 4PDVA 3RVZA 4X8AA 2HG5C 2Y69C 3ABLC 1ORQC 3FB7C 2ITCC 5B1BC 3OGCC 3SPGA 2QTOA 3SPIA 1M57C 5EBWC 4JTCB 1OCZC 2ZXWC 4WFHA 1OCCC 2X6CA 3JYCA 2P7TC 3TETA 4R8CA 4WFFA 4KFMA 3ASNC 4MVMA 2A0LA 3AG4C 2BOBC 4MVQA 5BZBA 4HZ3A 4MW3A 4P9OA 3SYOA 4XDKA 3OUSA 2YEVA 3EFFK 2IH3C 3FB6C 1BL8A 5EBMC 3OR6C 3E86A 3R65A 4RO2A 3LUTB 5E1AC 1XL4A 2DWEC 2NLJC 2HVJC 4MVSA 3FB5C 2AHYA 2BOCC 4R7CA 1K4DC 3F7YC 3SYQA 4X88A 5B3SC 4P2ZA 2WLIB 2WLIA 3K03A 3SPHA 4RAIA 1QLEC 2Q69A 1R3IC 4XDLA 1R3LC 3ZRSA 3WG7C 4CBCA 4DXWA 4EKWA 1OCOC 2WLKA 1ZWIC 1G4YB 4MS2A 2R9RB 2KB1A 4HYOA 3E8FA 1R3JC 2ATKC 4TWKA 4RUEA 2AHZA 2ZD9A 3RBZA 3SYPA 3TCUA 1LNQA 2HFEC 2DWDC 4R6ZA 1JVMA 3SPCA 4PDLA 3UM7A 5KUMA 4X89A 2EIMC 4MVOA 2HJFC 4MW8A 4LP8A 3K0DA 4UUJC 2OCCC 5EK0A 1OCRC 2EIKC 3SJQC 3T4DA 3PJSK 3ABMC 5CBFA 3LDCA 3LDDA 3ABKC 4H37A 4JTDB 4MVUA 5B1AC 3STZC 5J9PC 4PA4A 3X2QC 2X6AA 4P30A 3K08A 4WFGA 2EINC 2WLNA 2WLJA 3E8BA 3SYAA 3UKMA 3BEHA 1S5HC 4XDJA 4R50A 1K4CC 3E89A 2DYRC 5CBGA 4QE7A 2IH1C 4PA3A 3HPLC 3VOUA 4GX0A 1P7BA 4LCUC 1J95A 4ZBMA 4QE9A 1V54C 2Q67A 3GB7C 3F5WC 2H8PC 4H33A 4I9WA 1R3KC 4PA9A 3RVYA 2JK5C 2ITDC 4GX1A 4PA6A 4RUFA 3E83A 3STLC 3FB8C 5EC2C 4GX2A 3AG2C 5EC1C 3KG2A 3LDEA 5KUKA 4OXSA 4BW5A 2A9HA 3E8GA 4MVZA 3SYCA 2Q68A 4G28B 4MVRA 3F7VC 2QKSA 5EBLC 3IFXA 4JTAB 3RW0A 3AG1C 2W0FC 3K06A 4LBEC 2EILC 4MTOA 2WLHA 2EIJC 4P9PA 5IY5C 3OR7C 4QNHB 4PDMA 4PA7A 4F4LA
chains in the Genus database with same CATH superfamily
2F1MA 3BPZA 4J9YB 2OTJV 1M56C 4IL6Z 1HDJA 1T5EA 4F6RA 1QCEA 4DR7B 4NXNO 3JD2A 2HG5C 3FKSG 1IBMO 4DV7B 3K5NA 3SDLA 1Q3EA 4O4HB 1Y67A 3ZRVA 3JARA 1NTZH 1HNWB 2UXDB 1KD1W 4BIOA 3HKEA 4PELA 1Z5VA 1XILA 1KP3A 5IYZB 2Z3YA 5J2UB 4JAUA 1OHHG 3ZHRA 4U3JB 2ETNA 1R6TA 2HVJC 4EB6A 1F7YA 3G4SV 2YXYA 4JI1O 4W4KA 4GT1A 1OCOC 2LQTA 4F6RB 1R3JC 3AEIA 1TAEA 3QF7A 4X20A 4IIJA 5EK0A 5CBFA 3LDCA 1QU7A 5LYJB 1NR1A 2HHHB 1HP8A 4ZOLB 3HKDB 2WLNA 3SYAA 4JV5O 5EYPB 2CTRA 1ZLZA 1MSDA 2DYRC 4NVPA 1NS1A 2GUZB 3DGEA 3I5DA 4DYLA 1BHAA 3B8NA 3DXRA 4BW9A 2UXDO 2LFSA 2QWNB 1H8EG 3JATB 2N04A 2IJKA 3LSQA 1NBMG 1N33B 2ITDC 4B3SO 4WBNA 1XNRB 1N0JA 5FPOA 3THOA 3APQA 1VF7A 4FLUA 3D3QA 2W0FC 3ZHQA 2NR5A 4IIJB 5L3CA 2KG7A 1JJ2U 2PGGA 4JPRA 3ZHTA 4JI8O 2UXCB 1GN3A 2UXXA 3KCXA 4FFKA 2YIBA 1TGOA 5CA0A 4G27B 4ASUG 3OUFA 4WF9V 2RDCA 3ASNB 4FZ1A 5B1NA 4LF7O 4TQDA 4PI2A 3L73H 1ORQC 3CHXA 2YI8A 1KQSU 4WFHA 3ZHUA 3H1LH 2VQFB 1GM7A 5IWAB 4P9OA 5JWPA 1AROP 4X1IB 4O2AA 1HWYA 3R65A 2HJDA 5KAFZ 3N2GA 2PUSA 4Z1MG 5E1AC 3I56V 4PHZA 2ZE8A 3FB5C 1AP5A 2BOCC 3SYQA 1I94B 3SPHA 2E75B 1H2NA 1R3IC 3LNNA 2ZCEA 1R6KA 1JR9A 4JGSA 4JI7B 5IJ0B 4MS2A 1KB9F 4HNAA 3G71V 1KKCA 4HYOA 3TK1A 5LHGA 2ARHA 1XHZA 2E74B 2DWDC 1JVMA 1NH2D 4PDLA 3APOA 2HJFC 1AJPA 2XAGA 3ZIAG 2BE3A 1OCRC 3QO8A 5HFLA 3X2QC 4FZ0A 1PPJH 4JZ2A 3JD1A 4LFAO 4LC1A 2NN4A 4LF6O 4EB6B 3RT3C 1XMQB 2AW9A 2H3OA 4GLXA 5CA0B 1IBMB 1SS3A 3FB8C 1THZA 3SYCA 2CAZC 2VQFO 1GH6A 4AILC 4QJFB 4JYAB 3D8CA 2UU9B 5F2VO 2WLMA 5LP6B 1RFYA 3K57A 1W0KG 2P06A 1OCOB 4DR5O 3OT7A 3K04A 3WG7B 1SA0B 1YEWA 3WU2Z 1WP7A 3JSNA 3B2EE 2ZE6A 3H1KH 4LNUA 4J7JA 1JFFA 2FB5A 3JYCA 2CGNA 4KFMA 3N2KB 3ZMZA 3KZIZ 1L1FA 3ABKB 1RM1C 3EFFK 2ZDIA 2IW5A 4TUYB 2VQEO 4I55B 3RN4A 2BSKB 3FFQA 2UXBO 2LW1A 2M7WA 1P49A 4BR6A 4XDLA 3U10A 3ZRSA 2XT9A 2V1DA 2O57A 1HNZB 1V9PA 1NVPB 1SKVA 2FKXA 1OCCB 3RYIA 5GTIZ 4MVOA 1JFFB 2WWWA 4DR5B 3K0DA 2JJ1G 1HR0B 4JI3B 3LDDA 4MVUA 4FLXA 5LBQA 1K8AW 2KQXA 3CWBH 1I0HA 2GHYA 4R50A 4DR4B 4QE7A 1N34B 2LO1A 1K7DA 4NXMO 5IYBO 2EIKB 5JVDA 1X59A 1VQMV 2Q7EA 3CCMV 2N74A 3E22B 1ZUQA 3D36A 1H2SB 2QM7A 2YS8A 1QVFU 2VQEB 2G38A 3BFRA 4BW5A 5JJEB 2A9HA 3E8GA 3CCJV 1IBLO 2YICA 3QTCA 3F7VC 2QWPB 4QIWF 5LXTB 2CTQA 3CCLV 2B5UA 1QNMA 3OD4A 2IM9A 3ZS8C 1Y74B 1H2KA 3OEEG 1PL0A 4I50A 1EN5A 1VEWA 3I55V 3T2MA 3ETEA 3L9DA 2Q0AA 3ZN1A 2K1EA 1SQVH 2HKOA 2Y69C 3OGCC 4UB6Z 4B3MO 4UV9A 1XHXA 1W2BU 4WFFA 2B9ZA 4BIUA 4X1YA 4MVMA 4DV3B 1DF5A 4FIPC 5LGNA 1IZ3A 4LFCB 2YEVA 2IH3C 1XBLA 1I5YA 2A06H 1XOUA 2L35A 2PZSA 3F7YC 4JI2O 4YHHO 4B08A 2Q69A 2XAJA 4MT8A 1XMQO 5B5EZ 1MZEA 3FYIB 1FXHA 4FFBA 3C90A 2AZ0A 4CH4A 5C8YB 2KB1A 4FPPA 1H2GA 2PI5A 2OIGA 2ZD9A 1DTOA 4UB8Z 3SPCA 4O4HA 1D2DA 1I94O 1JPXA 3LSUA 3K08A 1LR1A 2WLJA 3E8BA 3IC7A 3SJBC 5IYZA 1EZVH 4DV0B 1MMMA 2EIMB 1K3EA 1R1BA 3X2QB 2QEXV 4FLWA 2EZPA 4O2BB 2JS3A 4H33A 4EFBA 1FXKC 5H2FZ 5C93A 4B3SB 5KA5A 2DQ3A 4X20B 1K5QA 4GCZA 1EBOA 2ZM6B 5EC1C 3OMNB 3HKEB 1SERA 2DYSB 5IJ9B 3RGBA 4YHHB 4JTAB 3IC9A 1UFIA 4LF6B 2EILC 2B1IA 4UXNA 3T1HB 2CE4A 5CB4B 4O4IA 4UCSA 4X65B 2F43G 1BMFG 1WLEA 1BQZA 4H0LB 1K33A 2YXHA 1BCCH 3RFRA 2DMXA 2JEXA 4FM2A 3L70H 1YI2V 2Q4PA 2YIDA 2ZXWC 3LSSA 2IJIA 3UCSC 4CH5A 3WB2A 2R9IA 2N05A 1OJHA 4LFBB 5LYJA 4B7KA 3ABMB 3OUSA 2VRZA 3OFNG 2EIJB 2PTMA 3CD6V 3C3SA 4DRXB 1E79G 1RPRA 3K9AA 3LUTB 3F5TA 1YHQV 5BR8B 4QPJA 3JAWA 3NR7A 4I0XB 4A5UB 2WLIA 4JF3A 3AK1A 4KXRA 4LF4B 1N34O 5D5PA 3OE7G 4NXNB 2KKWA 4B3RB 3JCUZ 4JI3O 2LGQA 2EILB 2DJVA 1XUQA 4DR2B 2OCCC 4DR1B 1H8HG 4JI0B 2Y0IA 2YEVB 4P30A 5CA1A 3BEHA 3U11A 1HNZO 4ABMA 1YXBA 5DM6V 2F95B 1GN6A 1SZTA 4FM0A 5BY1A 3MAQA 1COWG 3F5WC 3W7UA 2JGDB 2QSAA 2JK5C 1WPBA 2A3QA 4WBNB 4DV2O 1UJWB 4CC5A 3G6EV 5GTHZ 4G28B 4Q6GA 3T1YO 3K5LA 3PN1A 4U3FH 4OGQB 1V55B 1GRJA 5HFMA 5A9GA 4J42A 2QTSA 1QLNA 1XDCA 1V55C 2QDOA 4JI7O 1E1QG 4J9ZB 3RYHA 1KKDA 3ML0A 1L0LH 3ZMSA 1XREA 2WAMA 1SQGA 3DXRB 1EFRG 2QWOB 5IDJA 1GN2A 1VARA 4O2BA 4YJ2A 1Q6UA 1VQ4V 1ENVA 3C3TA 2JJ2G 3TXQA 4LWSA 1IBKB 1OCCC 4LWSB 3ASNC 2BOBC 1P4RA 4J10A 4O4JA 1NU1H 4NYKA 5KX5A 2RMKB 2EINB 1WB8A 4H13B 2DQ0A 4GYCB 2DYRB 2NLJC 5JCOA 3JAKB 2AHYA 4FLTA 5B3SC 2WLIB 4DUZB 5H6QA 4JAAA 2JVDA 2AZ2A 4NXMB 2F4VO 1K97A 4B3TB 5A2QN 4CH3A 2DE0X 4GKKO 5KAIZ 4X89A 3J81N 3T1YB 4FMTA 5EIBD 5B1AC 2BTOA 3UO3A 4PA4A 1PKXA 2CH7B 5LP6A 3E89A 2VWKA 3T1HO 3HPLC 1K9MW 4YXWG 4ZI7A 3FX7A 4GX1A 1WB7A 4E2LA 4YJ3B 3ASOB 4O4JB 1EM1A 1NZ6A 3A2FA 3HKCB 4MTOA 3OR7C 3D3IA 5KHHA 3ASOC 1AB3A 2XUMA 3K9SA 4LF5O 3QO5A 4GKKB 5IWAO 3ETDA 4DK0A 1M57B 4DV3O 5LGTA 2RCVA 2Z5UA 3M8AA 3Q4HB 1VQLV 4LH6A 4MTFA 3WB1A 3ZJZA 4QPKA 4X66O 4FM1A 2CK3G 1IVSA 2X6CA 1HNXB 1JX9A 4DR1O 2ZR2A 5BZBA 4LFCO 1U96A 2UUBO 1RSOA 3MD0A 2Y69B 4LF9O 1BL8A 4B3MB 2BSKA 2KSDA 1EN4A 4X66B 4JI0O 1K4DC 3A0RA 3OM3B 3O9OA 2PI4A 1TVKA 2P67A 1E1RG 2PYLA 5L3BA 1WJZA 3TJTA 3CYOA 5LHIA 3TCUA 1NH2B 3SJAC 3BCCH 4R6ZA 1MG1A 3UM7A 2QGNA 5K1PA 1N0NA 1VQ7V 4J7KA 5LA6A 1L8DA 1AVMA 1IX9A 2HR3A 3CB2A 4JAVA 3JCZA 3HKCA 1K4CC 4PA3A 1ROPA 3VOUA 5FLXN 4I55A 2UUAB 4JYBA 2RN9A 3OEHG 1OCRB 3JD4A 5L3GA 4I9WA 2UU9O 2WA4A 2LFRA 2E5LO 4GX2A 4OXSA 4K0KB 4DUYB 4TV8A 3BY6A 1TUEB 3CC2V 3CPWU 1Q8IA 1Y4MA 4P9PA 1SQXH 5DEDA 4PDMA 3ZMTA 4PA7A 4MSWC 3AG3C 3T4ZA 4I5SA 1VQ6V 4PDRA 5LMUB 2DYSC 3RWRD 4DR7O 2ODMA 2Q7HA 3CX5F 3ABLC 3FB7C 3RYCB 2OIEA 1X4TA 2JS5A 2OT5A 4PV1B 1OCZC 1Y6XA 1JMKC 3E35A 1AI7A 3CRAA 3JD0A 3BAAA 2EX3A 4HZ3A 3ZEDA 5CN0A 1K73W 3FB6C 1JA8A 3VBBA 3WFVA 1DGSA 2CGOA 1AILA 3CXCU 5KHIA 1M1KW 1QLEC 5KA6A 3M99B 4U7OA 5KHJA 4EKWA 3OTFA 1H2LA 5C8YA 3JARB 3B40A 4JI5O 3JD3A 2IJHA 4NKGB 3SYPA 1LNQA 2JGUA 1I7FA 2F23A 4X64O 1FXVA 2QM4A 3T4DA 4I4TA 3AK2A 2P6JA 1EZJA 3UKMA 1Q6IA 1NJIW 3ABLB 1TVKB 4GX0A 2YDEA 4I50B 1VQ9V 2ZDIC 2Q67A 1YTFB 1YJWV 4UCOA 4G2KA 1NKDA 3ZMUA 1CPYA 2UUCO 2EZOA 1MSWD 3ZBHA 4O2AB 3IFXA 3CRRA 4QNHB 2JRIA 4KHPO 3SGIA 4DV5B 3JALA 4ZOLA 3TGUH 4D7SA 1GKFA 1KMIZ 2GDSA 5ITZA 4NR1A 5L3DA 3HR0A 5IYDO 4OPAA 1D5NA 4HBNA 3K5OA 3SPGA 1XNQO 4JTCB 5LMNB 2DN9A 3B09A 3KCYA 4R8CA 4F6EA 4Q20A 4DV4B 2GV9A 1CEZA 5LOVB 3CSXA 4RO2A 3N2GB 3JASB 4U3JA 4R7CA 1M90W 5IY5B 1GTOA 2Y0PA 4J7ZA 3JALB 4CBCA 4UVBA 1S5JA 1PP9H 2Y4UA 4J11A 2WLKA 1ZWIC 1Y66A 1WPXA 2XAQA 2ZQMA 1KUQA 3AG2B 4AQYB 1GM9A 3A0BZ 5IJ9A 1R73A 2VS0A 2R72A 1ZSPA 3AG1B 4JI6B 3CC7V 4IHJA 5CB4A 1M4UA 3EHBB 3JAWB 1PNKA 2F4VB 5LOVA 1N32B 4BIZA 4RQEA 5KX5B 2ZE5A 1Z2GA 3K79A 1H2MA 1AI6A 3P3PA 1PNLA 3GWOA 4OPHA 2D3OW 1P7GA 1Y76B 3TXSA 3JAKA 4QE9A 4JYCA 2Y4TA 2JGDA 1YIJV 4K0KO 4DV6O 1RP3B 1W59A 5H5NA 1QR8A 5ITZB 3OTOO 1Q82W 4Z1VA 4FK5C 4LF4O 1FFXB 2FYUH 2RJZA 3L74H 4MVZA 4JI4O 4JI1B 1VF5B 4RQFA 1RPOA 5JQGB 5JQGA 3ZX6A 1FXKA 2HVKC 4J80A 4DO2A 3L71H 2GUZA 1J5EO 1KC8W 3L72H 1YVWA 3CJHB 1Q5OA 1VF6A 3U0ZA 1LUVA 2P90A 2P7TC 2KG7B 5LHHA 1KU9A 1FFXA 3H1HH 4AHCA 2LJ2A 3CCQV 2Q7GA 2DW4A 4LF7B 4D6TH 4X88A 1JOYA 4DR3B 5H9CA 5EZYA 1KP2A 3VQYA 1MZFA 3MHHC 4Z2WA 4HNAB 5B66Z 3IJ4A 2XTAA 2R9RB 5L3EA 2H94A 4AQYO 1G1XB 2AHZA 2UXCO 2HFEC 2XASA 4TV8B 1UPGA 1JCHA 5KMGB 1SQFA 1B04A 1NTKH 2R9AA 2JIZG 1J5EB 3ABKC 1FFTB 1FJGB 2AGAA 4X1IA 4JV5B 4X1KB 1CXZB 4XBFA 3B8MA 5CBGA 2E76B 1GMGA 3Q4HA 4CS4A 4WFAV 1I08A 4JI2B 4YJ2B 2OCCB 1H38A 1QR9A 3GB7C 3ZN0A 3JATA 1DK1A 2Q9LA 2ZXWB 3CCUV 4DV6B 5LMNO 3RYHB 3OTOB 5EC2C 4X62O 2ZIMA 1NR7A 4IGGA 5KUKA 4GKJB 4N21A 1SF9A 2CUGA 1AR1B 3AK3A 2L6LA 2QKAA 3CCEV 5GW7A 3LNMB 3E8HA 4D7TA 5B3SB 2WLLB 5L3FA 2HP8A 3H1IH 1B6QA 5IJ0A 4OX9B 5H6RA 1OV9A 5K1XA 1GAXA 2GBOA 3DC6A 1GK9A 2RQ6A 5B1OA 1WN7A 1WNSA 4KP4A 4X8AA 4AI8A 5B1BC 4PJ0Z 2BTQA 4HAMA 3BRCA 3B77A 3B4SA 3ETQA 1S3JA 1YITV 4I7ZB 2YIAA 3N2KA 5EIBC 4MVQA 4MW3A 3SYOA 1HNXO 3E86A 2GTAA 2GSMB 2HLDG 5DECA 1JJOA 2DWEC 3FYEB 1NQTA 4UV8A 3CXHF 5FNVB 1R3LC 4LF5B 1B06A 2FMLA 2ZNJA 1NVPD 5KHGA 1K92A 4RUEA 1ZL8A 1AI5A 3MDSA 4LP8A 1AI4A 1Q90D 4UCUA 4UUJC 3SJQC 4NTWA 5J9PC 4H37A 5CMUA 2X7RB 4DV1B 5CA3A 4TV9B 3G67A 3SJCC 3ETGA 4FLZA 1O9HA 1FD9A 4CC6A 4TUYA 3CRCA 2FL4A 3A0HZ 5B1BB 2UUCB 2PY5A 4ZBMA 2YI9A 3RYCA 3E2EA 2CTPA 4FVMA 3L75H 1W0JG 1OZ0A 4RUFA 3WB0A 3ZRXA 3W7WA 1US6A 1YCIA 4MVRA 3OGIB 3UO2A 1G6UA 3RYFB 2ADPA 2WLHA 2EIJC 4ZHQB 5J2TA 3UT5A 1KECA 1XL6A 3CE2A 2Y48A 4DR6B 5LL6Y 3SR2C 1S5LZ 1SETA 1TUBA 1IBLB 2JDIG 4IT5A 3JSLA 3FD9A 1ZL8B 5LMUO 1XNQB 2ZM6O 2ITCC 1BS3A 3E22A 5LXTA 1QQCA 3CRMA 3W7XA 2UXNA 1SQPH 1VMGA 2V4DA 2HEPA 4LFBO 1FPOA 1Q81W 1SZXA 1MA1A 2VWJA 4DRXA 5J2UA 3HB3B 1ZAUA 1XL4A 1YF2A 1XMOB 1Q86W 5BMVA 3OMAB 3JAMN 5JH7A 2UUBB 4P2ZA 1GM8A 1Z5WA 4UCRA 3CCRV 4GZRB 1U97A 3QO7A 1N32O 4JI6O 1DLBA 5KUMA 4ZKIA 5DN6G 4LR3A 2LP7A 2ILMA 3W7SA 3ICXA 4LFAB 3CCVV 3BABA 1G8MA 4O4IB 1RSOB 1AJNA 4PI0A 5B1AB 1Y74A 1AJQA 3S3WA 1N8RW 2XNDG 4LCUC 1YTFD 1WA8A 3CJHA 2ZNIA 1OCZB 2B1GA 4JASA 2Q8VA 4PD4F 4B3RO 1VF6C 1Q6HA 1IDSA 2YSUB 3HKBB 1QBZA 5AG2A 3KG2A 2D2CB 4FLYA 2QKSA 3RW0A 1GN4A 1F23A 1BE3H 3K5MA 1M56B 4O4LB 4KL1A 3DC5A 5BMVB 4F4LA 3K0GA 1FJGO 2WSSG 2X6BA 2A79B 4YY3B 1LUWA 2PYJA 2Q6AA 3P3NA 3S3XA 5IYCO 2MW2B 2PF4E 3O65A 4PDVA 3SPIA 1AR4A 4FLVA 4UFZA 1M57C 1RM1B 2OYQA 4TQFA 3TETA 5FPRA 4UCTA 2A0LA 1HR0O 3A8TA 1N36B 4DR3O 2CH7A 1TA8A 3ZHSA 4O4LA 1KYOF 4JZGA 2Q5ZA 3N27A 4MVSA 1VQOV 4IYIA 3K03A 4RAIA 1YSCA 1PM9A 2K9PA 2NNUA 1O9GA 2E5LB 1XNRO 1EN6A 5JJNB 4B7EA 3MHSC 2EIMC 4DV1O 1IURA 1DF4A 4TOIA 1VQ5V 4NB5A 5BR8O 4JI5B 1FXKB 3DTUB 2X0LA 2EINC 1BT8A 1VP7A 5LGUA 1N4CA 2IH1C 3BHPA 2IJJA 1M5IA 2C2AA 1M9NA 1Y76A 1S72V 5BXZA 4I0XA 5KLVH 4YY3O 2H8PC 2UUAO 1PV0A 4JI4B 1YJ9V 2ZINA 4TT3G 4GKJO 4JYAO 3VQWA 2Q0OC 2AXTZ 4IHJB 4C7UA 1AR5A 2LW7A 1NI8A 1P84F 2JEUA 2QM8A 3ABTA 1FYJA 2FTKA 2ZR3A 3CEIA 4DR4O 3VQXA 2IU0A 3CCSV 3K06A 3W7TA 5TISZ 5IY5C 3GVMA 5IE9A 2Z0AA 4KHPB 1QLEB 3R66A 5CBHA 4JYYA 4W4LA 1IXMA 3EVKA 4OX9O 5IT9N 2GTSA 1VQ8V 4WFEA 2M6YA 1V54B 3CS5A 4H44B 3RVZA 3CRQA 2ZIOA 3BVOA 3H9VA 1FS0G 3J7AU 5EZYB 1N33O 4ICGA 4L8JA 2QA4V 1BHBA 1SESA 4DUYO 1N36O 4GUNA 1HNWO 1GO3F 1NT2B 2W6JG 1IXBA 4K8ZA 3ZCCA 1YJNV 3QVNA 4DV2B 3AG7A 5KHKA 4CS2A 2W6IG 2YC0A 2RNBA 4X9QA 2WA3A 2QWRB 3WG7C 1BZKA 4DXWA 5EYPA 4DV0O 3OW2U 1XI1A 4YIPA 1PL4A 4X62B 2EJRA 3OAAG 4TWKA 3BA8A 3RBZA 2BTQB 4I9QA 4LF8B 4MW8A 4DV4O 2XAFA 1ZX3A 2EIKC 3ABMC 4JTDB 3STZC 2X6AA 3AG4B 4NTYA 4DW1A 2P4VA 1SRYA 3EXAA 4U7NA 3K59A 4MTXA 2OTLV 5D5QA 4CH6A 4X65O 1D5AA 3P32A 5KMGA 1R3KC 4PA9A 4ZI7B 1FAFA 3ZRWB 2CTWA 2LGWA 4PA6A 3KKYA 4J41A 4LH7A 1JQ0A 1ZTEA 1MOFA 3ABUA 5LP6C 3RYFA 2V7QG 2HHHO 2ADQB 2EJ7A 1S77D 1YZBA 4JI8B 1PD3A 2YUAA 4X1KA 4DR2O 5JJJB 4GX5A 1VQPV 4DUZO 1TUBB 4YJ3A 1PNMA 4X64B 2YIBD 3FAVB 2QTOA 5EBWC 4NTXA 4B3TO 3UT5B 3AG4C 5JCOC 4LF8O 1URFA 3OR6C 2E3CA 1MABG 1XMOO 4TSFG 3AG3B 1F4MA 1XEQA 2ZE7A 5JVDB 2F66C 1K34A 3K58A 3ZMVA 4DV7O 1YDXA 1M93A 4CS3A 3E8FA 5E79Z 1QHTA 4LF9B 3CMEV 2W0XA 1SQBH 3G80A 2CDYA 3IAYA 3CMAV 1K5SA 2XOKG 4UVCA 4QGPA 1S5HC 4XDJA 1BSMA 1QVGU 2XAHA 1S76D 3G6BA 3H01A 1P7BA 1J95A 2UXBB 1BGYH 3P30A 3D36C 5FNVA 3ZRWA 4EFEA 4FFBB 1WAZA 1SA0A 3E83A 2BCCH 3FAVA 2Q68A 1Q7YW 2ZKOA 1VQNV 1VIBA 4LBEC 2OWOA 5FL7G 5GONB 5GONA 2IBZH 5JH7B 4TV9A 1L0NH 2WLLA 4RWUA 2ZT9B 3SPJA 4MTGA 2QWQB 3IGAC 3UQ8A 1BQ0A 4WFBV 3QNEA 3HKBA 4FJCC 3T1CA 3M7MX 4DR6O 2WPDG 1IBKO 1XQ8A 2QE7G 3RYIB 4LNUB 4X1YB 5LA6B 2P5OA 4XDKA 1SC5B 1CP9A 1A32A 4CZZA 5CA1B 5EBMC 4DV5O 4DK1A 1R6NA 2XHBA 3H1JH 2EBOA 4EEQA 3ZHVA 4K3AA 1G4YB 2QKCA 4UVAA 2EULA 2ATKC 2OCHA 1MNGA 1AP6A 1NTMH 2Q73A 2P22C 4N23A 1FKAO 3CP1A 1SQQH 1WP8A 4I4TB 4UCVA 3PJSK 3NXSA 1F51A 1B3QA 1HW7A 3BA9A 4WFGA 2R70A 2F93B 3GWKC 4ZIBA 4YIOA 2IU3A 4BWAA 2MK3A 4DW0A 1WA8B 3CC4V 1V54C 4K8XA 3RVYA 1Q43A 1KBHA 4WCEV 3STLC 3VQVA 3AG2C 2P4KA 3LDEA 4KUMA 3K3WA 1VQKV 3J80N 4BAYA 3HKDA 2QJ1A 4L87A 5EBLC 2A7WA 2QR4A 3AG1C 4IYHA 3QG5A 1F4NA 2YXLA 3JASA 4ZHQA 1I5XA 3OMIB 4E4EA 4K35A 5J2TB 2DOSA 3DSQA 1S0VA
chains in the Genus database with same CATH topology
4J9YB 2OTJV 3K0GA 2WSSG 2X6BA 2F43G 1BMFG 1M56C 1WLEA 2A79B 2Q6AA 1GKFA 1K33A 1QCEA 5L3DA 5IYCO 5IYDO 4PDVA 3JD2A 2HG5C 2JEXA 3FKSG 3SPGA 3SPIA 1YI2V 1M57C 1RM1B 4JTCB 2ZXWC 3TETA 3LSSA 4R8CA 2IJIA 2A0LA 3ZRVA 2R9IA 4Q20A 1KD1W 3ABMB 3OUSA 4PELA 1CEZA 1KP3A 3OFNG 2EIJB 3CD6V 2Z3YA 1E79G 1RPRA 3K9AA 3LUTB 4JAUA 4RO2A 1OHHG 2HVJC 4MVSA 4R7CA 3G4SV 1VQOV 1YHQV 1M90W 5IY5B 4QPJA 1GTOA 2WLIA 3K03A 4RAIA 4JF3A 1YSCA 4CBCA 4UVBA 2NNUA 1OCOC 4GT1A 2WLKA 1ZWIC 1Y66A 1WPXA 2XAQA 1R3JC 2ZQMA 3AEIA 3OE7G 3AG2B 1GM9A 1R73A 2EILB 3MHSC 2EIMC 1DF4A 3AG1B 1VQ5V 2OCCC 5EK0A 5CBFA 1H8HG 3LDCA 3CC7V 3EHBB 1PNKA 1FXKB 2YEVB 1NR1A 3DTUB 4P30A 2X0LA 2EINC 2WLNA 3SYAA 4BIZA 3BEHA 4RQEA 3K79A 1AI6A 5DM6V 1PNLA 2DYRC 3GWOA 5LGUA 2IH1C 2IJJA 3DGEA 1BHAA 3B8NA 2D3OW 2C2AA 1M9NA 1SZTA 1S72V 4QE9A 2LFSA 1COWG 1H8EG 3F5WC 2H8PC 4JYCA 3W7UA 2IJKA 3LSQA 1NBMG 2JK5C 1YIJV 1YJ9V 2ITDC 4TT3G 1UJWB 1QR8A 1Q82W 4FK5C 3G6EV 4MVZA 4G28B 2JEUA 2QM8A 3ABTA 2FTKA 2ZR3A 1V55B 2W0FC 2IU0A 4RQFA 3CCSV 3K06A 3W7TA 5HFMA 5L3CA 1JJ2U 1RPOA 5IY5C 4JPRA 2UXXA 1FXKA 1QLEB 2HVKC 1QLNA 1V55C 5CBHA 4DO2A 1IXMA 1VQ8V 1E1QG 4G27B 4J9ZB 1KKDA 3ML0A 3ZMSA 4WFEA 2WAMA 4ASUG 1KC8W 3OUFA 1V54B 1EFRG 4WF9V 3ASNB 5IDJA 5B1NA 3RVZA 1VQ4V 1ORQC 1ENVA 2JJ2G 1FS0G 1KQSU 4WFHA 1OCCC 2P90A 2P7TC 1GM7A 2QA4V 3ASNC 5LHHA 1BHBA 2BOBC 1SESA 4P9OA 1P4RA 1GO3F 1AROP 1HWYA 2W6JG 3CCQV 2EINB 3R65A 3ZCCA 2DQ0A 1YJNV 4Z1MG 2DW4A 5E1AC 2DYRB 3I56V 2NLJC 3FB5C 2AHYA 2BOCC 3SYQA 4X88A 5B3SC 2W6IG 2WLIB 3SPHA 1JOYA 5H9CA 1R3IC 3WG7C 1KP2A 5H6QA 1R6KA 4JGSA 4DXWA 3OW2U 3MHHC 4MS2A 2R9RB 5L3EA 3G71V 2EJRA 4HYOA 3OAAG 1K97A 3TK1A 5LHGA 2H94A 4TWKA 2AHZA 3RBZA 2HFEC 2XASA 2DWDC 1JVMA 1JCHA 1NH2D 4PDLA 4X89A 2HJFC 4MW8A 1AJPA 2JIZG 2XAGA 3ZIAG 2XAFA 1OCRC 2EIKC 3ABMC 4FMTA 3ABKC 1FFTB 4JTDB 3STZC 5B1AC 3QO8A 4PA4A 5HFLA 3X2QC 2X6AA 1PKXA 3AG4B 4XBFA 1SRYA 3B8MA 3JD1A 3E89A 5CBGA 4LC1A 4U7NA 3HPLC 1GMGA 4MTXA 4WFAV 2OCCB 2OTLV 1H38A 1QR9A 3GB7C 3ZN0A 1K9MW 4YXWG 3P32A 2ZXWB 3CCUV 1R3KC 4PA9A 3ZRWB 4GX1A 4PA6A 3FB8C 5EC2C 5KUKA 1NR7A 4E2LA 4N21A 1THZA 1JQ0A 3SYCA 3ASOB 1AR1B 1MOFA 3ABUA 2V7QG 4MTOA 4QJFB 3OR7C 3D3IA 3ASOC 3CCEV 1S77D 5GW7A 3LNMB 3E8HA 1PD3A 2WLMA 5B3SB 2WLLB 5L3FA 1W0KG 1OCOB 4GX5A 1VQPV 3QO5A 1B6QA 3K04A 3WG7B 5H6RA 3ETDA 1M57B 5LGTA 2Z5UA 1VQLV 4MTFA 1PNMA 3ZJZA 1GK9A 4QPKA 5B1OA 4KP4A 4X8AA 5B1BC 2CK3G 2QTOA 4HAMA 5EBWC 2X6CA 3B77A 3JYCA 1YITV 1S3JA 1JX9A 4KFMA 3ZMZA 2ZR2A 3AG4C 4MVQA 5BZBA 4MW3A 3SYOA 1L1FA 3ABKB 1RM1C 3MD0A 2Y69B 3EFFK 2ZDIA 1BL8A 3OR6C 3E86A 2GSMB 2IW5A 2HLDG 1MABG 4TSFG 2DWEC 3FYEB 3AG3B 1F4MA 1NQTA 1K4DC 3A0RA 2M7WA 3OM3B 4UV8A 1K34A 2PI4A 4XDLA 1R3LC 2P67A 1E1RG 3ZRSA 3ZMVA 2V1DA 5L3BA 1NVPD 3CYOA 3E8FA 1NVPB 5LHIA 1K92A 4RUEA 3TCUA 3CMEV 1OCCB 1AI5A 1NH2B 4R6ZA 1MG1A 3UM7A 4MVOA 2WWWA 4LP8A 1AI4A 3K0DA 4UUJC 2JJ1G 3SJQC 1VQ7V 3LDDA 4H37A 4MVUA 5CMUA 5J9PC 2X7RB 5LBQA 2HR3A 5CA3A 1K8AW 4JAVA 3CMAV 3JCZA 3ETGA 1K5SA 2XOKG 4UVCA 2GHYA 1S5HC 4XDJA 4R50A 1K4CC 1QVGU 4QE7A 2XAHA 4PA3A 1ROPA 3VOUA 4JYBA 5B1BB 1S76D 3H01A 1P7BA 1K7DA 3OEHG 1J95A 4ZBMA 5IYBO 3P30A 1OCRB 2EIKB 1VQMV 3E2EA 3CCMV 3JD4A 5L3GA 4I9WA 3ZRWA 1W0JG 3D36A 1OZ0A 2QM7A 4RUFA 3E83A 2LFRA 1QVFU 4GX2A 3ZRXA 4OXSA 4BW5A 2A9HA 3E8GA 3CCJV 3W7WA 2Q68A 4MVRA 3F7VC 3BY6A 1Q7YW 4QIWF 1VQNV 1TUEB 3CC2V 3CCLV 2B5UA 4LBEC 5FL7G 3CPWU 1Y4MA 4P9PA 2WLHA 2EIJC 4PDMA 3OEEG 4PA7A 3ZMTA 1KECA 4MSWC 1PL0A 1XL6A 3AG3C 3T4ZA 2Y48A 4I5SA 2WLLA 1VQ6V 3I55V 4PDRA 4MTGA 3SPJA 2DYSC 3IGAC 3T2MA 3ETEA 4WFBV 3QNEA 1SETA 4FJCC 3T1CA 3ZN1A 2WPDG 2K1EA 2JDIG 2HKOA 2QE7G 2Y69C 3ABLC 3FB7C 2ITCC 3OGCC 2OT5A 4UV9A 1OCZC 1W2BU 4WFFA 3W7XA 2UXNA 3E35A 4BIUA 4MVMA 1AI7A 3JD0A 4HZ3A 1DF5A 4FIPC 5CN0A 5LGNA 4XDKA 2YEVA 1Q81W 1CP9A 1K73W 2IH3C 3FB6C 4CZZA 5EBMC 1R6NA 3VBBA 1I5YA 3HB3B 3WFVA 1XL4A 1Q86W 3OMAB 3F7YC 3CXCU 4P2ZA 1M1KW 2EBOA 1QLEC 2Q69A 2XAJA 4MT8A 1GM8A 5KA6A 3M99B 3FYIB 4U7OA 1FXHA 4EKWA 3CCRV 1G4YB 4UVAA 2KB1A 4FPPA 2ATKC 3QO7A 3JD3A 1H2GA 2PI5A 2IJHA 2ZD9A 1DTOA 3SYPA 1LNQA 3SPCA 4N23A 1DLBA 5KUMA 4ZKIA 5DN6G 3CP1A 2LP7A 1FXVA 3T4DA 3PJSK 3W7SA 3NXSA 1F51A 3CCVV 2P6JA 1JPXA 1G8MA 1EZJA 1AJNA 3K08A 4WFGA 2WLJA 3E8BA 3IC7A 3UKMA 2IU3A 2EIMB 5B1AB 1K3EA 3X2QB 2MK3A 1NJIW 1AJQA 3ABLB 4GX0A 1N8RW 2QEXV 2XNDG 2EZPA 4LCUC 1YTFD 1VQ9V 2ZDIC 3CC4V 1OCZB 1V54C 2Q67A 1YTFB 2B1GA 4JASA 4H33A 1FXKC 5C93A 3RVYA 5KA5A 2DQ3A 1YJWV 1K5QA 4GCZA 4WCEV 2YSUB 1EBOA 3STLC 4G2KA 1QBZA 3AG2C 5EC1C 1NKDA 3KG2A 3LDEA 1CPYA 3OMNB 3ZMUA 4KUMA 3K3WA 1VQKV 1SERA 2EZOA 4BAYA 1MSWD 2DYSB 4L87A 2QKSA 5EBLC 3IFXA 4JTAB 1F23A 3RW0A 3AG1C 1M56B 1F4NA 2EILC 2B1IA 1I5XA 3OMIB 4UXNA 4QNHB 1S0VA 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  4MSW C;  4J9Y B;  1XL6 A;  3AG3 C;  3K0G A;  3T4Z A;  2HVK C;  3LNM B;  3E8H A;  2X6B A;  1V55 C;  2WLL A;  2WLM A;  2WLL B;  5CBH A;  4PDR A;  1M56 C;  4MTG A;  3SPJ A;  2DYS C;  2A79 B;  3IGA C;  4GX5 A;  4J9Z B;  4G27 B;  3T2M A;  2Q6A A;  3K04 A;  1KKD A;  4WFE A;  3T1C A;  3OUF A;  4MTF A;  3ZJZ A;  2K1E A;  4PDV A;  3RVZ A;  4X8A A;  2HG5 C;  2Y69 C;  3ABL C;  1ORQ C;  3FB7 C;  2ITC C;  5B1B C;  3OGC C;  3SPG A;  2QTO A;  3SPI A;  1M57 C;  5EBW C;  4JTC B;  1OCZ C;  2ZXW C;  4WFH A;  1OCC C;  2X6C A;  3JYC A;  2P7T C;  3TET A;  4R8C A;  4WFF A;  4KFM A;  3ASN C;  4MVM A;  2A0L A;  3AG4 C;  2BOB C;  4MVQ A;  5BZB A;  4HZ3 A;  4MW3 A;  4P9O A;  3SYO A;  4XDK A;  3OUS A;  2YEV A;  3EFF K;  2IH3 C;  3FB6 C;  1BL8 A;  5EBM C;  3OR6 C;  3E86 A;  3R65 A;  4RO2 A;  3LUT B;  5E1A C;  1XL4 A;  2DWE C;  2NLJ C;  2HVJ C;  4MVS A;  3FB5 C;  2AHY A;  2BOC C;  4R7C A;  1K4D C;  3F7Y C;  3SYQ A;  4X88 A;  5B3S C;  4P2Z A;  2WLI B;  2WLI A;  3K03 A;  3SPH A;  4RAI A;  1QLE C;  2Q69 A;  1R3I C;  4XDL A;  1R3L C;  3ZRS A;  3WG7 C;  4CBC A;  4DXW A;  4EKW A;  1OCO C;  2WLK A;  1ZWI C;  1G4Y B;  4MS2 A;  2R9R B;  2KB1 A;  4HYO A;  3E8F A;  1R3J C;  2ATK C;  4TWK A;  4RUE A;  2AHZ A;  2ZD9 A;  3RBZ A;  3SYP A;  3TCU A;  1LNQ A;  2HFE C;  2DWD C;  4R6Z A;  1JVM A;  3SPC A;  4PDL A;  3UM7 A;  5KUM A;  4X89 A;  2EIM C;  4MVO A;  2HJF C;  4MW8 A;  4LP8 A;  3K0D A;  4UUJ C;  2OCC C;  5EK0 A;  1OCR C;  2EIK C;  3SJQ C;  3T4D A;  3PJS K;  3ABM C;  5CBF A;  3LDC A;  3LDD A;  3ABK C;  4H37 A;  4JTD B;  4MVU A;  5B1A C;  3STZ C;  5J9P C;  4PA4 A;  3X2Q C;  2X6A A;  4P30 A;  3K08 A;  4WFG A;  2EIN C;  2WLN A;  2WLJ A;  3E8B A;  3SYA A;  3UKM A;  3BEH A;  1S5H C;  4XDJ A;  4R50 A;  1K4C C;  3E89 A;  2DYR C;  5CBG A;  4QE7 A;  2IH1 C;  4PA3 A;  3HPL C;  3VOU A;  4GX0 A;  1P7B A;  4LCU C;  1J95 A;  4ZBM A;  4QE9 A;  1V54 C;  2Q67 A;  3GB7 C;  3F5W C;  2H8P C;  4H33 A;  4I9W A;  1R3K C;  4PA9 A;  3RVY A;  2JK5 C;  2ITD C;  4GX1 A;  4PA6 A;  4RUF A;  3E83 A;  3STL C;  3FB8 C;  5EC2 C;  4GX2 A;  3AG2 C;  5EC1 C;  3KG2 A;  3LDE A;  5KUK A;  4OXS A;  4BW5 A;  2A9H A;  3E8G A;  4MVZ A;  3SYC A;  2Q68 A;  4G28 B;  4MVR A;  3F7V C;  2QKS A;  5EBL C;  3IFX A;  4JTA B;  3RW0 A;  3AG1 C;  2W0F C;  3K06 A;  4LBE C;  2EIL C;  4MTO A;  2WLH A;  2EIJ C;  4P9P A;  5IY5 C;  3OR7 C;  4QNH B;  4PDM A;  4PA7 A;  4F4L A; 
#chains in the Genus database with same CATH topology
 2F1M A;  3BPZ A;  4J9Y B;  2OTJ V;  1M56 C;  4IL6 Z;  1HDJ A;  1T5E A;  4F6R A;  1QCE A;  4DR7 B;  4NXN O;  3JD2 A;  2HG5 C;  3FKS G;  1IBM O;  4DV7 B;  3K5N A;  3SDL A;  1Q3E A;  4O4H B;  1Y67 A;  3ZRV A;  3JAR A;  1NTZ H;  1HNW B;  2UXD B;  1KD1 W;  4BIO A;  3HKE A;  4PEL A;  1Z5V A;  1XIL A;  1KP3 A;  5IYZ B;  2Z3Y A;  5J2U B;  4JAU A;  1OHH G;  3ZHR A;  4U3J B;  2ETN A;  1R6T A;  2HVJ C;  4EB6 A;  1F7Y A;  3G4S V;  2YXY A;  4JI1 O;  4W4K A;  4GT1 A;  1OCO C;  2LQT A;  4F6R B;  1R3J C;  3AEI A;  1TAE A;  3QF7 A;  4X20 A;  4IIJ A;  5EK0 A;  5CBF A;  3LDC A;  1QU7 A;  5LYJ B;  1NR1 A;  2HHH B;  1HP8 A;  4ZOL B;  3HKD B;  2WLN A;  3SYA A;  4JV5 O;  5EYP B;  2CTR A;  1ZLZ A;  1MSD A;  2DYR C;  4NVP A;  1NS1 A;  2GUZ B;  3DGE A;  3I5D A;  4DYL A;  1BHA A;  3B8N A;  3DXR A;  4BW9 A;  2UXD O;  2LFS A;  2QWN B;  1H8E G;  3JAT B;  2N04 A;  2IJK A;  3LSQ A;  1NBM G;  1N33 B;  2ITD C;  4B3S O;  4WBN A;  1XNR B;  1N0J A;  5FPO A;  3THO A;  3APQ A;  1VF7 A;  4FLU A;  3D3Q A;  2W0F C;  3ZHQ A;  2NR5 A;  4IIJ B;  5L3C A;  2KG7 A;  1JJ2 U;  2PGG A;  4JPR A;  3ZHT A;  4JI8 O;  2UXC B;  1GN3 A;  2UXX A;  3KCX A;  4FFK A;  2YIB A;  1TGO A;  5CA0 A;  4G27 B;  4ASU G;  3OUF A;  4WF9 V;  2RDC A;  3ASN B;  4FZ1 A;  5B1N A;  4LF7 O;  4TQD A;  4PI2 A;  3L73 H;  1ORQ C;  3CHX A;  2YI8 A;  1KQS U;  4WFH A;  3ZHU A;  3H1L H;  2VQF B;  1GM7 A;  5IWA B;  4P9O A;  5JWP A;  1ARO P;  4X1I B;  4O2A A;  1HWY A;  3R65 A;  2HJD A;  5KAF Z;  3N2G A;  2PUS A;  4Z1M G;  5E1A C;  3I56 V;  4PHZ A;  2ZE8 A;  3FB5 C;  1AP5 A;  2BOC C;  3SYQ A;  1I94 B;  3SPH A;  2E75 B;  1H2N A;  1R3I C;  3LNN A;  2ZCE A;  1R6K A;  1JR9 A;  4JGS A;  4JI7 B;  5IJ0 B;  4MS2 A;  1KB9 F;  4HNA A;  3G71 V;  1KKC A;  4HYO A;  3TK1 A;  5LHG A;  2ARH A;  1XHZ A;  2E74 B;  2DWD C;  1JVM A;  1NH2 D;  4PDL A;  3APO A;  2HJF C;  1AJP A;  2XAG A;  3ZIA G;  2BE3 A;  1OCR C;  3QO8 A;  5HFL A;  3X2Q C;  4FZ0 A;  1PPJ H;  4JZ2 A;  3JD1 A;  4LFA O;  4LC1 A;  2NN4 A;  4LF6 O;  4EB6 B;  3RT3 C;  1XMQ B;  2AW9 A;  2H3O A;  4GLX A;  5CA0 B;  1IBM B;  1SS3 A;  3FB8 C;  1THZ A;  3SYC A;  2CAZ C;  2VQF O;  1GH6 A;  4AIL C;  4QJF B;  4JYA B;  3D8C A;  2UU9 B;  5F2V O;  2WLM A;  5LP6 B;  1RFY A;  3K57 A;  1W0K G;  2P06 A;  1OCO B;  4DR5 O;  3OT7 A;  3K04 A;  3WG7 B;  1SA0 B;  1YEW A;  3WU2 Z;  1WP7 A;  3JSN A;  3B2E E;  2ZE6 A;  3H1K H;  4LNU A;  4J7J A;  1JFF A;  2FB5 A;  3JYC A;  2CGN A;  4KFM A;  3N2K B;  3ZMZ A;  3KZI Z;  1L1F A;  3ABK B;  1RM1 C;  3EFF K;  2ZDI A;  2IW5 A;  4TUY B;  2VQE O;  4I55 B;  3RN4 A;  2BSK B;  3FFQ A;  2UXB O;  2LW1 A;  2M7W A;  1P49 A;  4BR6 A;  4XDL A;  3U10 A;  3ZRS A;  2XT9 A;  2V1D A;  2O57 A;  1HNZ B;  1V9P A;  1NVP B;  1SKV A;  2FKX A;  1OCC B;  3RYI A;  5GTI Z;  4MVO A;  1JFF B;  2WWW A;  4DR5 B;  3K0D A;  2JJ1 G;  1HR0 B;  4JI3 B;  3LDD A;  4MVU A;  4FLX A;  5LBQ A;  1K8A W;  2KQX A;  3CWB H;  1I0H A;  2GHY A;  4R50 A;  4DR4 B;  4QE7 A;  1N34 B;  2LO1 A;  1K7D A;  4NXM O;  5IYB O;  2EIK B;  5JVD A;  1X59 A;  1VQM V;  2Q7E A;  3CCM V;  2N74 A;  3E22 B;  1ZUQ A;  3D36 A;  1H2S B;  2QM7 A;  2YS8 A;  1QVF U;  2VQE B;  2G38 A;  3BFR A;  4BW5 A;  5JJE B;  2A9H A;  3E8G A;  3CCJ V;  1IBL O;  2YIC A;  3QTC A;  3F7V C;  2QWP B;  4QIW F;  5LXT B;  2CTQ A;  3CCL V;  2B5U A;  1QNM A;  3OD4 A;  2IM9 A;  3ZS8 C;  1Y74 B;  1H2K A;  3OEE G;  1PL0 A;  4I50 A;  1EN5 A;  1VEW A;  3I55 V;  3T2M A;  3ETE A;  3L9D A;  2Q0A A;  3ZN1 A;  2K1E A;  1SQV H;  2HKO A;  2Y69 C;  3OGC C;  4UB6 Z;  4B3M O;  4UV9 A;  1XHX A;  1W2B U;  4WFF A;  2B9Z A;  4BIU A;  4X1Y A;  4MVM A;  4DV3 B;  1DF5 A;  4FIP C;  5LGN A;  1IZ3 A;  4LFC B;  2YEV A;  2IH3 C;  1XBL A;  1I5Y A;  2A06 H;  1XOU A;  2L35 A;  2PZS A;  3F7Y C;  4JI2 O;  4YHH O;  4B08 A;  2Q69 A;  2XAJ A;  4MT8 A;  1XMQ O;  5B5E Z;  1MZE A;  3FYI B;  1FXH A;  4FFB A;  3C90 A;  2AZ0 A;  4CH4 A;  5C8Y B;  2KB1 A;  4FPP A;  1H2G A;  2PI5 A;  2OIG A;  2ZD9 A;  1DTO A;  4UB8 Z;  3SPC A;  4O4H A;  1D2D A;  1I94 O;  1JPX A;  3LSU A;  3K08 A;  1LR1 A;  2WLJ A;  3E8B A;  3IC7 A;  3SJB C;  5IYZ A;  1EZV H;  4DV0 B;  1MMM A;  2EIM B;  1K3E A;  1R1B A;  3X2Q B;  2QEX V;  4FLW A;  2EZP A;  4O2B B;  2JS3 A;  4H33 A;  4EFB A;  1FXK C;  5H2F Z;  5C93 A;  4B3S B;  5KA5 A;  2DQ3 A;  4X20 B;  1K5Q A;  4GCZ A;  1EBO A;  2ZM6 B;  5EC1 C;  3OMN B;  3HKE B;  1SER A;  2DYS B;  5IJ9 B;  3RGB A;  4YHH B;  4JTA B;  3IC9 A;  1UFI A;  4LF6 B;  2EIL C;  2B1I A;  4UXN A;  3T1H B;  2CE4 A;  5CB4 B;  4O4I A;  4UCS A;  4X65 B;  2F43 G;  1BMF G;  1WLE A;  1BQZ A;  4H0L B;  1K33 A;  2YXH A;  1BCC H;  3RFR A;  2DMX A;  2JEX A;  4FM2 A;  3L70 H;  1YI2 V;  2Q4P A;  2YID A;  2ZXW C;  3LSS A;  2IJI A;  3UCS C;  4CH5 A;  3WB2 A;  2R9I A;  2N05 A;  1OJH A;  4LFB B;  5LYJ A;  4B7K A;  3ABM B;  3OUS A;  2VRZ A;  3OFN G;  2EIJ B;  2PTM A;  3CD6 V;  3C3S A;  4DRX B;  1E79 G;  1RPR A;  3K9A A;  3LUT B;  3F5T A;  1YHQ V;  5BR8 B;  4QPJ A;  3JAW A;  3NR7 A;  4I0X B;  4A5U B;  2WLI A;  4JF3 A;  3AK1 A;  4KXR A;  4LF4 B;  1N34 O;  5D5P A;  3OE7 G;  4NXN B;  2KKW A;  4B3R B;  3JCU Z;  4JI3 O;  2LGQ A;  2EIL B;  2DJV A;  1XUQ A;  4DR2 B;  2OCC C;  4DR1 B;  1H8H G;  4JI0 B;  2Y0I A;  2YEV B;  4P30 A;  5CA1 A;  3BEH A;  3U11 A;  1HNZ O;  4ABM A;  1YXB A;  5DM6 V;  2F95 B;  1GN6 A;  1SZT A;  4FM0 A;  5BY1 A;  3MAQ A;  1COW G;  3F5W C;  3W7U A;  2JGD B;  2QSA A;  2JK5 C;  1WPB A;  2A3Q A;  4WBN B;  4DV2 O;  1UJW B;  4CC5 A;  3G6E V;  5GTH Z;  4G28 B;  4Q6G A;  3T1Y O;  3K5L A;  3PN1 A;  4U3F H;  4OGQ B;  1V55 B;  1GRJ A;  5HFM A;  5A9G A;  4J42 A;  2QTS A;  1QLN A;  1XDC A;  1V55 C;  2QDO A;  4JI7 O;  1E1Q G;  4J9Z B;  3RYH A;  1KKD A;  3ML0 A;  1L0L H;  3ZMS A;  1XRE A;  2WAM A;  1SQG A;  3DXR B;  1EFR G;  2QWO B;  5IDJ A;  1GN2 A;  1VAR A;  4O2B A;  4YJ2 A;  1Q6U A;  1VQ4 V;  1ENV A;  3C3T A;  2JJ2 G;  3TXQ A;  4LWS A;  1IBK B;  1OCC C;  4LWS B;  3ASN C;  2BOB C;  1P4R A;  4J10 A;  4O4J A;  1NU1 H;  4NYK A;  5KX5 A;  2RMK B;  2EIN B;  1WB8 A;  4H13 B;  2DQ0 A;  4GYC B;  2DYR B;  2NLJ C;  5JCO A;  3JAK B;  2AHY A;  4FLT A;  5B3S C;  2WLI B;  4DUZ B;  5H6Q A;  4JAA A;  2JVD A;  2AZ2 A;  4NXM B;  2F4V O;  1K97 A;  4B3T B;  5A2Q N;  4CH3 A;  2DE0 X;  4GKK O;  5KAI Z;  4X89 A;  3J81 N;  3T1Y B;  4FMT A;  5EIB D;  5B1A C;  2BTO A;  3UO3 A;  4PA4 A;  1PKX A;  2CH7 B;  5LP6 A;  3E89 A;  2VWK A;  3T1H O;  3HPL C;  1K9M W;  4YXW G;  4ZI7 A;  3FX7 A;  4GX1 A;  1WB7 A;  4E2L A;  4YJ3 B;  3ASO B;  4O4J B;  1EM1 A;  1NZ6 A;  3A2F A;  3HKC B;  4MTO A;  3OR7 C;  3D3I A;  5KHH A;  3ASO C;  1AB3 A;  2XUM A;  3K9S A;  4LF5 O;  3QO5 A;  4GKK B;  5IWA O;  3ETD A;  4DK0 A;  1M57 B;  4DV3 O;  5LGT A;  2RCV A;  2Z5U A;  3M8A A;  3Q4H B;  1VQL V;  4LH6 A;  4MTF A;  3WB1 A;  3ZJZ A;  4QPK A;  4X66 O;  4FM1 A;  2CK3 G;  1IVS A;  2X6C A;  1HNX B;  1JX9 A;  4DR1 O;  2ZR2 A;  5BZB A;  4LFC O;  1U96 A;  2UUB O;  1RSO A;  3MD0 A;  2Y69 B;  4LF9 O;  1BL8 A;  4B3M B;  2BSK A;  2KSD A;  1EN4 A;  4X66 B;  4JI0 O;  1K4D C;  3A0R A;  3OM3 B;  3O9O A;  2PI4 A;  1TVK A;  2P67 A;  1E1R G;  2PYL A;  5L3B A;  1WJZ A;  3TJT A;  3CYO A;  5LHI A;  3TCU A;  1NH2 B;  3SJA C;  3BCC H;  4R6Z A;  1MG1 A;  3UM7 A;  2QGN A;  5K1P A;  1N0N A;  1VQ7 V;  4J7K A;  5LA6 A;  1L8D A;  1AVM A;  1IX9 A;  2HR3 A;  3CB2 A;  4JAV A;  3JCZ A;  3HKC A;  1K4C C;  4PA3 A;  1ROP A;  3VOU A;  5FLX N;  4I55 A;  2UUA B;  4JYB A;  2RN9 A;  3OEH G;  1OCR B;  3JD4 A;  5L3G A;  4I9W A;  2UU9 O;  2WA4 A;  2LFR A;  2E5L O;  4GX2 A;  4OXS A;  4K0K B;  4DUY B;  4TV8 A;  3BY6 A;  1TUE B;  3CC2 V;  3CPW U;  1Q8I A;  1Y4M A;  4P9P A;  1SQX H;  5DED A;  4PDM A;  3ZMT A;  4PA7 A;  4MSW C;  3AG3 C;  3T4Z A;  4I5S A;  1VQ6 V;  4PDR A;  5LMU B;  2DYS C;  3RWR D;  4DR7 O;  2ODM A;  2Q7H A;  3CX5 F;  3ABL C;  3FB7 C;  3RYC B;  2OIE A;  1X4T A;  2JS5 A;  2OT5 A;  4PV1 B;  1OCZ C;  1Y6X A;  1JMK C;  3E35 A;  1AI7 A;  3CRA A;  3JD0 A;  3BAA A;  2EX3 A;  4HZ3 A;  3ZED A;  5CN0 A;  1K73 W;  3FB6 C;  1JA8 A;  3VBB A;  3WFV A;  1DGS A;  2CGO A;  1AIL A;  3CXC U;  5KHI A;  1M1K W;  1QLE C;  5KA6 A;  3M99 B;  4U7O A;  5KHJ A;  4EKW A;  3OTF A;  1H2L A;  5C8Y A;  3JAR B;  3B40 A;  4JI5 O;  3JD3 A;  2IJH A;  4NKG B;  3SYP A;  1LNQ A;  2JGU A;  1I7F A;  2F23 A;  4X64 O;  1FXV A;  2QM4 A;  3T4D A;  4I4T A;  3AK2 A;  2P6J A;  1EZJ A;  3UKM A;  1Q6I A;  1NJI W;  3ABL B;  1TVK B;  4GX0 A;  2YDE A;  4I50 B;  1VQ9 V;  2ZDI C;  2Q67 A;  1YTF B;  1YJW V;  4UCO A;  4G2K A;  1NKD A;  3ZMU A;  1CPY A;  2UUC O;  2EZO A;  1MSW D;  3ZBH A;  4O2A B;  3IFX A;  3CRR A;  4QNH B;  2JRI A;  4KHP O;  3SGI A;  4DV5 B;  3JAL A;  4ZOL A;  3TGU H;  4D7S A;  1GKF A;  1KMI Z;  2GDS A;  5ITZ A;  4NR1 A;  5L3D A;  3HR0 A;  5IYD O;  4OPA A;  1D5N A;  4HBN A;  3K5O A;  3SPG A;  1XNQ O;  4JTC B;  5LMN B;  2DN9 A;  3B09 A;  3KCY A;  4R8C A;  4F6E A;  4Q20 A;  4DV4 B;  2GV9 A;  1CEZ A;  5LOV B;  3CSX A;  4RO2 A;  3N2G B;  3JAS B;  4U3J A;  4R7C A;  1M90 W;  5IY5 B;  1GTO A;  2Y0P A;  4J7Z A;  3JAL B;  4CBC A;  4UVB A;  1S5J A;  1PP9 H;  2Y4U A;  4J11 A;  2WLK A;  1ZWI C;  1Y66 A;  1WPX A;  2XAQ A;  2ZQM A;  1KUQ A;  3AG2 B;  4AQY B;  1GM9 A;  3A0B Z;  5IJ9 A;  1R73 A;  2VS0 A;  2R72 A;  1ZSP A;  3AG1 B;  4JI6 B;  3CC7 V;  4IHJ A;  5CB4 A;  1M4U A;  3EHB B;  3JAW B;  1PNK A;  2F4V B;  5LOV A;  1N32 B;  4BIZ A;  4RQE A;  5KX5 B;  2ZE5 A;  1Z2G A;  3K79 A;  1H2M A;  1AI6 A;  3P3P A;  1PNL A;  3GWO A;  4OPH A;  2D3O W;  1P7G A;  1Y76 B;  3TXS A;  3JAK A;  4QE9 A;  4JYC A;  2Y4T A;  2JGD A;  1YIJ V;  4K0K O;  4DV6 O;  1RP3 B;  1W59 A;  5H5N A;  1QR8 A;  5ITZ B;  3OTO O;  1Q82 W;  4Z1V A;  4FK5 C;  4LF4 O;  1FFX B;  2FYU H;  2RJZ A;  3L74 H;  4MVZ A;  4JI4 O;  4JI1 B;  1VF5 B;  4RQF A;  1RPO A;  5JQG B;  5JQG A;  3ZX6 A;  1FXK A;  2HVK C;  4J80 A;  4DO2 A;  3L71 H;  2GUZ A;  1J5E O;  1KC8 W;  3L72 H;  1YVW A;  3CJH B;  1Q5O A;  1VF6 A;  3U0Z A;  1LUV A;  2P90 A;  2P7T C;  2KG7 B;  5LHH A;  1KU9 A;  1FFX A;  3H1H H;  4AHC A;  2LJ2 A;  3CCQ V;  2Q7G A;  2DW4 A;  4LF7 B;  4D6T H;  4X88 A;  1JOY A;  4DR3 B;  5H9C A;  5EZY A;  1KP2 A;  3VQY A;  1MZF A;  3MHH C;  4Z2W A;  4HNA B;  5B66 Z;  3IJ4 A;  2XTA A;  2R9R B;  5L3E A;  2H94 A;  4AQY O;  1G1X B;  2AHZ A;  2UXC O;  2HFE C;  2XAS A;  4TV8 B;  1UPG A;  1JCH A;  5KMG B;  1SQF A;  1B04 A;  1NTK H;  2R9A A;  2JIZ G;  1J5E B;  3ABK C;  1FFT B;  1FJG B;  2AGA A;  4X1I A;  4JV5 B;  4X1K B;  1CXZ B;  4XBF A;  3B8M A;  5CBG A;  2E76 B;  1GMG A;  3Q4H A;  4CS4 A;  4WFA V;  1I08 A;  4JI2 B;  4YJ2 B;  2OCC B;  1H38 A;  1QR9 A;  3GB7 C;  3ZN0 A;  3JAT A;  1DK1 A;  2Q9L A;  2ZXW B;  3CCU V;  4DV6 B;  5LMN O;  3RYH B;  3OTO B;  5EC2 C;  4X62 O;  2ZIM A;  1NR7 A;  4IGG A;  5KUK A;  4GKJ B;  4N21 A;  1SF9 A;  2CUG A;  1AR1 B;  3AK3 A;  2L6L A;  2QKA A;  3CCE V;  5GW7 A;  3LNM B;  3E8H A;  4D7T A;  5B3S B;  2WLL B;  5L3F A;  2HP8 A;  3H1I H;  1B6Q A;  5IJ0 A;  4OX9 B;  5H6R A;  1OV9 A;  5K1X A;  1GAX A;  2GBO A;  3DC6 A;  1GK9 A;  2RQ6 A;  5B1O A;  1WN7 A;  1WNS A;  4KP4 A;  4X8A A;  4AI8 A;  5B1B C;  4PJ0 Z;  2BTQ A;  4HAM A;  3BRC A;  3B77 A;  3B4S A;  3ETQ A;  1S3J A;  1YIT V;  4I7Z B;  2YIA A;  3N2K A;  5EIB C;  4MVQ A;  4MW3 A;  3SYO A;  1HNX O;  3E86 A;  2GTA A;  2GSM B;  2HLD G;  5DEC A;  1JJO A;  2DWE C;  3FYE B;  1NQT A;  4UV8 A;  3CXH F;  5FNV B;  1R3L C;  4LF5 B;  1B06 A;  2FML A;  2ZNJ A;  1NVP D;  5KHG A;  1K92 A;  4RUE A;  1ZL8 A;  1AI5 A;  3MDS A;  4LP8 A;  1AI4 A;  1Q90 D;  4UCU A;  4UUJ C;  3SJQ C;  4NTW A;  5J9P C;  4H37 A;  5CMU A;  2X7R B;  4DV1 B;  5CA3 A;  4TV9 B;  3G67 A;  3SJC C;  3ETG A;  4FLZ A;  1O9H A;  1FD9 A;  4CC6 A;  4TUY A;  3CRC A;  2FL4 A;  3A0H Z;  5B1B B;  2UUC B;  2PY5 A;  4ZBM A;  2YI9 A;  3RYC A;  3E2E A;  2CTP A;  4FVM A;  3L75 H;  1W0J G;  1OZ0 A;  4RUF A;  3WB0 A;  3ZRX A;  3W7W A;  1US6 A;  1YCI A;  4MVR A;  3OGI B;  3UO2 A;  1G6U A;  3RYF B;  2ADP A;  2WLH A;  2EIJ C;  4ZHQ B;  5J2T A;  3UT5 A;  1KEC A;  1XL6 A;  3CE2 A;  2Y48 A;  4DR6 B;  5LL6 Y;  3SR2 C;  1S5L Z;  1SET A;  1TUB A;  1IBL B;  2JDI G;  4IT5 A;  3JSL A;  3FD9 A;  1ZL8 B;  5LMU O;  1XNQ B;  2ZM6 O;  2ITC C;  1BS3 A;  3E22 A;  5LXT A;  1QQC A;  3CRM A;  3W7X A;  2UXN A;  1SQP H;  1VMG A;  2V4D A;  2HEP A;  4LFB O;  1FPO A;  1Q81 W;  1SZX A;  1MA1 A;  2VWJ A;  4DRX A;  5J2U A;  3HB3 B;  1ZAU A;  1XL4 A;  1YF2 A;  1XMO B;  1Q86 W;  5BMV A;  3OMA B;  3JAM N;  5JH7 A;  2UUB B;  4P2Z A;  1GM8 A;  1Z5W A;  4UCR A;  3CCR V;  4GZR B;  1U97 A;  3QO7 A;  1N32 O;  4JI6 O;  1DLB A;  5KUM A;  4ZKI A;  5DN6 G;  4LR3 A;  2LP7 A;  2ILM A;  3W7S A;  3ICX A;  4LFA B;  3CCV V;  3BAB A;  1G8M A;  4O4I B;  1RSO B;  1AJN A;  4PI0 A;  5B1A B;  1Y74 A;  1AJQ A;  3S3W A;  1N8R W;  2XND G;  4LCU C;  1YTF D;  1WA8 A;  3CJH A;  2ZNI A;  1OCZ B;  2B1G A;  4JAS A;  2Q8V A;  4PD4 F;  4B3R O;  1VF6 C;  1Q6H A;  1IDS A;  2YSU B;  3HKB B;  1QBZ A;  5AG2 A;  3KG2 A;  2D2C B;  4FLY A;  2QKS A;  3RW0 A;  1GN4 A;  1F23 A;  1BE3 H;  3K5M A;  1M56 B;  4O4L B;  4KL1 A;  3DC5 A;  5BMV B;  4F4L A;  3K0G A;  1FJG O;  2WSS G;  2X6B A;  2A79 B;  4YY3 B;  1LUW A;  2PYJ A;  2Q6A A;  3P3N A;  3S3X A;  5IYC O;  2MW2 B;  2PF4 E;  3O65 A;  4PDV A;  3SPI A;  1AR4 A;  4FLV A;  4UFZ A;  1M57 C;  1RM1 B;  2OYQ A;  4TQF A;  3TET A;  5FPR A;  4UCT A;  2A0L A;  1HR0 O;  3A8T A;  1N36 B;  4DR3 O;  2CH7 A;  1TA8 A;  3ZHS A;  4O4L A;  1KYO F;  4JZG A;  2Q5Z A;  3N27 A;  4MVS A;  1VQO V;  4IYI A;  3K03 A;  4RAI A;  1YSC A;  1PM9 A;  2K9P A;  2NNU A;  1O9G A;  2E5L B;  1XNR O;  1EN6 A;  5JJN B;  4B7E A;  3MHS C;  2EIM C;  4DV1 O;  1IUR A;  1DF4 A;  4TOI A;  1VQ5 V;  4NB5 A;  5BR8 O;  4JI5 B;  1FXK B;  3DTU B;  2X0L A;  2EIN C;  1BT8 A;  1VP7 A;  5LGU A;  1N4C A;  2IH1 C;  3BHP A;  2IJJ A;  1M5I A;  2C2A A;  1M9N A;  1Y76 A;  1S72 V;  5BXZ A;  4I0X A;  5KLV H;  4YY3 O;  2H8P C;  2UUA O;  1PV0 A;  4JI4 B;  1YJ9 V;  2ZIN A;  4TT3 G;  4GKJ O;  4JYA O;  3VQW A;  2Q0O C;  2AXT Z;  4IHJ B;  4C7U A;  1AR5 A;  2LW7 A;  1NI8 A;  1P84 F;  2JEU A;  2QM8 A;  3ABT A;  1FYJ A;  2FTK A;  2ZR3 A;  3CEI A;  4DR4 O;  3VQX A;  2IU0 A;  3CCS V;  3K06 A;  3W7T A;  5TIS Z;  5IY5 C;  3GVM A;  5IE9 A;  2Z0A A;  4KHP B;  1QLE B;  3R66 A;  5CBH A;  4JYY A;  4W4L A;  1IXM A;  3EVK A;  4OX9 O;  5IT9 N;  2GTS A;  1VQ8 V;  4WFE A;  2M6Y A;  1V54 B;  3CS5 A;  4H44 B;  3RVZ A;  3CRQ A;  2ZIO A;  3BVO A;  3H9V A;  1FS0 G;  3J7A U;  5EZY B;  1N33 O;  4ICG A;  4L8J A;  2QA4 V;  1BHB A;  1SES A;  4DUY O;  1N36 O;  4GUN A;  1HNW O;  1GO3 F;  1NT2 B;  2W6J G;  1IXB A;  4K8Z A;  3ZCC A;  1YJN V;  3QVN A;  4DV2 B;  3AG7 A;  5KHK A;  4CS2 A;  2W6I G;  2YC0 A;  2RNB A;  4X9Q A;  2WA3 A;  2QWR B;  3WG7 C;  1BZK A;  4DXW A;  5EYP A;  4DV0 O;  3OW2 U;  1XI1 A;  4YIP A;  1PL4 A;  4X62 B;  2EJR A;  3OAA G;  4TWK A;  3BA8 A;  3RBZ A;  2BTQ B;  4I9Q A;  4LF8 B;  4MW8 A;  4DV4 O;  2XAF A;  1ZX3 A;  2EIK C;  3ABM C;  4JTD B;  3STZ C;  2X6A A;  3AG4 B;  4NTY A;  4DW1 A;  2P4V A;  1SRY A;  3EXA A;  4U7N A;  3K59 A;  4MTX A;  2OTL V;  5D5Q A;  4CH6 A;  4X65 O;  1D5A A;  3P32 A;  5KMG A;  1R3K C;  4PA9 A;  4ZI7 B;  1FAF A;  3ZRW B;  2CTW A;  2LGW A;  4PA6 A;  3KKY A;  4J41 A;  4LH7 A;  1JQ0 A;  1ZTE A;  1MOF A;  3ABU A;  5LP6 C;  3RYF A;  2V7Q G;  2HHH O;  2ADQ B;  2EJ7 A;  1S77 D;  1YZB A;  4JI8 B;  1PD3 A;  2YUA A;  4X1K A;  4DR2 O;  5JJJ B;  4GX5 A;  1VQP V;  4DUZ O;  1TUB B;  4YJ3 A;  1PNM A;  4X64 B;  2YIB D;  3FAV B;  2QTO A;  5EBW C;  4NTX A;  4B3T O;  3UT5 B;  3AG4 C;  5JCO C;  4LF8 O;  1URF A;  3OR6 C;  2E3C A;  1MAB G;  1XMO O;  4TSF G;  3AG3 B;  1F4M A;  1XEQ A;  2ZE7 A;  5JVD B;  2F66 C;  1K34 A;  3K58 A;  3ZMV A;  4DV7 O;  1YDX A;  1M93 A;  4CS3 A;  3E8F A;  5E79 Z;  1QHT A;  4LF9 B;  3CME V;  2W0X A;  1SQB H;  3G80 A;  2CDY A;  3IAY A;  3CMA V;  1K5S A;  2XOK G;  4UVC A;  4QGP A;  1S5H C;  4XDJ A;  1BSM A;  1QVG U;  2XAH A;  1S76 D;  3G6B A;  3H01 A;  1P7B A;  1J95 A;  2UXB B;  1BGY H;  3P30 A;  3D36 C;  5FNV A;  3ZRW A;  4EFE A;  4FFB B;  1WAZ A;  1SA0 A;  3E83 A;  2BCC H;  3FAV A;  2Q68 A;  1Q7Y W;  2ZKO A;  1VQN V;  1VIB A;  4LBE C;  2OWO A;  5FL7 G;  5GON B;  5GON A;  2IBZ H;  5JH7 B;  4TV9 A;  1L0N H;  2WLL A;  4RWU A;  2ZT9 B;  3SPJ A;  4MTG A;  2QWQ B;  3IGA C;  3UQ8 A;  1BQ0 A;  4WFB V;  3QNE A;  3HKB A;  4FJC C;  3T1C A;  3M7M X;  4DR6 O;  2WPD G;  1IBK O;  1XQ8 A;  2QE7 G;  3RYI B;  4LNU B;  4X1Y B;  5LA6 B;  2P5O A;  4XDK A;  1SC5 B;  1CP9 A;  1A32 A;  4CZZ A;  5CA1 B;  5EBM C;  4DV5 O;  4DK1 A;  1R6N A;  2XHB A;  3H1J H;  2EBO A;  4EEQ A;  3ZHV A;  4K3A A;  1G4Y B;  2QKC A;  4UVA A;  2EUL A;  2ATK C;  2OCH A;  1MNG A;  1AP6 A;  1NTM H;  2Q73 A;  2P22 C;  4N23 A;  1FKA O;  3CP1 A;  1SQQ H;  1WP8 A;  4I4T B;  4UCV A;  3PJS K;  3NXS A;  1F51 A;  1B3Q A;  1HW7 A;  3BA9 A;  4WFG A;  2R70 A;  2F93 B;  3GWK C;  4ZIB A;  4YIO A;  2IU3 A;  4BWA A;  2MK3 A;  4DW0 A;  1WA8 B;  3CC4 V;  1V54 C;  4K8X A;  3RVY A;  1Q43 A;  1KBH A;  4WCE V;  3STL C;  3VQV A;  3AG2 C;  2P4K A;  3LDE A;  4KUM A;  3K3W A;  1VQK V;  3J80 N;  4BAY A;  3HKD A;  2QJ1 A;  4L87 A;  5EBL C;  2A7W A;  2QR4 A;  3AG1 C;  4IYH A;  3QG5 A;  1F4N A;  2YXL A;  3JAS A;  4ZHQ A;  1I5X A;  3OMI B;  4E4E A;  4K35 A;  5J2T B;  2DOS A;  3DSQ A;  1S0V A; 
#chains in the Genus database with same CATH homology
 4J9Y B;  2OTJ V;  3K0G A;  2WSS G;  2X6B A;  2F43 G;  1BMF G;  1M56 C;  1WLE A;  2A79 B;  2Q6A A;  1GKF A;  1K33 A;  1QCE A;  5L3D A;  5IYC O;  5IYD O;  4PDV A;  3JD2 A;  2HG5 C;  2JEX A;  3FKS G;  3SPG A;  3SPI A;  1YI2 V;  1M57 C;  1RM1 B;  4JTC B;  2ZXW C;  3TET A;  3LSS A;  4R8C A;  2IJI A;  2A0L A;  3ZRV A;  2R9I A;  4Q20 A;  1KD1 W;  3ABM B;  3OUS A;  4PEL A;  1CEZ A;  1KP3 A;  3OFN G;  2EIJ B;  3CD6 V;  2Z3Y A;  1E79 G;  1RPR A;  3K9A A;  3LUT B;  4JAU A;  4RO2 A;  1OHH G;  2HVJ C;  4MVS A;  4R7C A;  3G4S V;  1VQO V;  1YHQ V;  1M90 W;  5IY5 B;  4QPJ A;  1GTO A;  2WLI A;  3K03 A;  4RAI A;  4JF3 A;  1YSC A;  4CBC A;  4UVB A;  2NNU A;  1OCO C;  4GT1 A;  2WLK A;  1ZWI C;  1Y66 A;  1WPX A;  2XAQ A;  1R3J C;  2ZQM A;  3AEI A;  3OE7 G;  3AG2 B;  1GM9 A;  1R73 A;  2EIL B;  3MHS C;  2EIM C;  1DF4 A;  3AG1 B;  1VQ5 V;  2OCC C;  5EK0 A;  5CBF A;  1H8H G;  3LDC A;  3CC7 V;  3EHB B;  1PNK A;  1FXK B;  2YEV B;  1NR1 A;  3DTU B;  4P30 A;  2X0L A;  2EIN C;  2WLN A;  3SYA A;  4BIZ A;  3BEH A;  4RQE A;  3K79 A;  1AI6 A;  5DM6 V;  1PNL A;  2DYR C;  3GWO A;  5LGU A;  2IH1 C;  2IJJ A;  3DGE A;  1BHA A;  3B8N A;  2D3O W;  2C2A A;  1M9N A;  1SZT A;  1S72 V;  4QE9 A;  2LFS A;  1COW G;  1H8E G;  3F5W C;  2H8P C;  4JYC A;  3W7U A;  2IJK A;  3LSQ A;  1NBM G;  2JK5 C;  1YIJ V;  1YJ9 V;  2ITD C;  4TT3 G;  1UJW B;  1QR8 A;  1Q82 W;  4FK5 C;  3G6E V;  4MVZ A;  4G28 B;  2JEU A;  2QM8 A;  3ABT A;  2FTK A;  2ZR3 A;  1V55 B;  2W0F C;  2IU0 A;  4RQF A;  3CCS V;  3K06 A;  3W7T A;  5HFM A;  5L3C A;  1JJ2 U;  1RPO A;  5IY5 C;  4JPR A;  2UXX A;  1FXK A;  1QLE B;  2HVK C;  1QLN A;  1V55 C;  5CBH A;  4DO2 A;  1IXM A;  1VQ8 V;  1E1Q G;  4G27 B;  4J9Z B;  1KKD A;  3ML0 A;  3ZMS A;  4WFE A;  2WAM A;  4ASU G;  1KC8 W;  3OUF A;  1V54 B;  1EFR G;  4WF9 V;  3ASN B;  5IDJ A;  5B1N A;  3RVZ A;  1VQ4 V;  1ORQ C;  1ENV A;  2JJ2 G;  1FS0 G;  1KQS U;  4WFH A;  1OCC C;  2P90 A;  2P7T C;  1GM7 A;  2QA4 V;  3ASN C;  5LHH A;  1BHB A;  2BOB C;  1SES A;  4P9O A;  1P4R A;  1GO3 F;  1ARO P;  1HWY A;  2W6J G;  3CCQ V;  2EIN B;  3R65 A;  3ZCC A;  2DQ0 A;  1YJN V;  4Z1M G;  2DW4 A;  5E1A C;  2DYR B;  3I56 V;  2NLJ C;  3FB5 C;  2AHY A;  2BOC C;  3SYQ A;  4X88 A;  5B3S C;  2W6I G;  2WLI B;  3SPH A;  1JOY A;  5H9C A;  1R3I C;  3WG7 C;  1KP2 A;  5H6Q A;  1R6K A;  4JGS A;  4DXW A;  3OW2 U;  3MHH C;  4MS2 A;  2R9R B;  5L3E A;  3G71 V;  2EJR A;  4HYO A;  3OAA G;  1K97 A;  3TK1 A;  5LHG A;  2H94 A;  4TWK A;  2AHZ A;  3RBZ A;  2HFE C;  2XAS A;  2DWD C;  1JVM A;  1JCH A;  1NH2 D;  4PDL A;  4X89 A;  2HJF C;  4MW8 A;  1AJP A;  2JIZ G;  2XAG A;  3ZIA G;  2XAF A;  1OCR C;  2EIK C;  3ABM C;  4FMT A;  3ABK C;  1FFT B;  4JTD B;  3STZ C;  5B1A C;  3QO8 A;  4PA4 A;  5HFL A;  3X2Q C;  2X6A A;  1PKX A;  3AG4 B;  4XBF A;  1SRY A;  3B8M A;  3JD1 A;  3E89 A;  5CBG A;  4LC1 A;  4U7N A;  3HPL C;  1GMG A;  4MTX A;  4WFA V;  2OCC B;  2OTL V;  1H38 A;  1QR9 A;  3GB7 C;  3ZN0 A;  1K9M W;  4YXW G;  3P32 A;  2ZXW B;  3CCU V;  1R3K C;  4PA9 A;  3ZRW B;  4GX1 A;  4PA6 A;  3FB8 C;  5EC2 C;  5KUK A;  1NR7 A;  4E2L A;  4N21 A;  1THZ A;  1JQ0 A;  3SYC A;  3ASO B;  1AR1 B;  1MOF A;  3ABU A;  2V7Q G;  4MTO A;  4QJF B;  3OR7 C;  3D3I A;  3ASO C;  3CCE V;  1S77 D;  5GW7 A;  3LNM B;  3E8H A;  1PD3 A;  2WLM A;  5B3S B;  2WLL B;  5L3F A;  1W0K G;  1OCO B;  4GX5 A;  1VQP V;  3QO5 A;  1B6Q A;  3K04 A;  3WG7 B;  5H6R A;  3ETD A;  1M57 B;  5LGT A;  2Z5U A;  1VQL V;  4MTF A;  1PNM A;  3ZJZ A;  1GK9 A;  4QPK A;  5B1O A;  4KP4 A;  4X8A A;  5B1B C;  2CK3 G;  2QTO A;  4HAM A;  5EBW C;  2X6C A;  3B77 A;  3JYC A;  1YIT V;  1S3J A;  1JX9 A;  4KFM A;  3ZMZ A;  2ZR2 A;  3AG4 C;  4MVQ A;  5BZB A;  4MW3 A;  3SYO A;  1L1F A;  3ABK B;  1RM1 C;  3MD0 A;  2Y69 B;  3EFF K;  2ZDI A;  1BL8 A;  3OR6 C;  3E86 A;  2GSM B;  2IW5 A;  2HLD G;  1MAB G;  4TSF G;  2DWE C;  3FYE B;  3AG3 B;  1F4M A;  1NQT A;  1K4D C;  3A0R A;  2M7W A;  3OM3 B;  4UV8 A;  1K34 A;  2PI4 A;  4XDL A;  1R3L C;  2P67 A;  1E1R G;  3ZRS A;  3ZMV A;  2V1D A;  5L3B A;  1NVP D;  3CYO A;  3E8F A;  1NVP B;  5LHI A;  1K92 A;  4RUE A;  3TCU A;  3CME V;  1OCC B;  1AI5 A;  1NH2 B;  4R6Z A;  1MG1 A;  3UM7 A;  4MVO A;  2WWW A;  4LP8 A;  1AI4 A;  3K0D A;  4UUJ C;  2JJ1 G;  3SJQ C;  1VQ7 V;  3LDD A;  4H37 A;  4MVU A;  5CMU A;  5J9P C;  2X7R B;  5LBQ A;  2HR3 A;  5CA3 A;  1K8A W;  4JAV A;  3CMA V;  3JCZ A;  3ETG A;  1K5S A;  2XOK G;  4UVC A;  2GHY A;  1S5H C;  4XDJ A;  4R50 A;  1K4C C;  1QVG U;  4QE7 A;  2XAH A;  4PA3 A;  1ROP A;  3VOU A;  4JYB A;  5B1B B;  1S76 D;  3H01 A;  1P7B A;  1K7D A;  3OEH G;  1J95 A;  4ZBM A;  5IYB O;  3P30 A;  1OCR B;  2EIK B;  1VQM V;  3E2E A;  3CCM V;  3JD4 A;  5L3G A;  4I9W A;  3ZRW A;  1W0J G;  3D36 A;  1OZ0 A;  2QM7 A;  4RUF A;  3E83 A;  2LFR A;  1QVF U;  4GX2 A;  3ZRX A;  4OXS A;  4BW5 A;  2A9H A;  3E8G A;  3CCJ V;  3W7W A;  2Q68 A;  4MVR A;  3F7V C;  3BY6 A;  1Q7Y W;  4QIW F;  1VQN V;  1TUE B;  3CC2 V;  3CCL V;  2B5U A;  4LBE C;  5FL7 G;  3CPW U;  1Y4M A;  4P9P A;  2WLH A;  2EIJ C;  4PDM A;  3OEE G;  4PA7 A;  3ZMT A;  1KEC A;  4MSW C;  1PL0 A;  1XL6 A;  3AG3 C;  3T4Z A;  2Y48 A;  4I5S A;  2WLL A;  1VQ6 V;  3I55 V;  4PDR A;  4MTG A;  3SPJ A;  2DYS C;  3IGA C;  3T2M A;  3ETE A;  4WFB V;  3QNE A;  1SET A;  4FJC C;  3T1C A;  3ZN1 A;  2WPD G;  2K1E A;  2JDI G;  2HKO A;  2QE7 G;  2Y69 C;  3ABL C;  3FB7 C;  2ITC C;  3OGC C;  2OT5 A;  4UV9 A;  1OCZ C;  1W2B U;  4WFF A;  3W7X A;  2UXN A;  3E35 A;  4BIU A;  4MVM A;  1AI7 A;  3JD0 A;  4HZ3 A;  1DF5 A;  4FIP C;  5CN0 A;  5LGN A;  4XDK A;  2YEV A;  1Q81 W;  1CP9 A;  1K73 W;  2IH3 C;  3FB6 C;  4CZZ A;  5EBM C;  1R6N A;  3VBB A;  1I5Y A;  3HB3 B;  3WFV A;  1XL4 A;  1Q86 W;  3OMA B;  3F7Y C;  3CXC U;  4P2Z A;  1M1K W;  2EBO A;  1QLE C;  2Q69 A;  2XAJ A;  4MT8 A;  1GM8 A;  5KA6 A;  3M99 B;  3FYI B;  4U7O A;  1FXH A;  4EKW A;  3CCR V;  1G4Y B;  4UVA A;  2KB1 A;  4FPP A;  2ATK C;  3QO7 A;  3JD3 A;  1H2G A;  2PI5 A;  2IJH A;  2ZD9 A;  1DTO A;  3SYP A;  1LNQ A;  3SPC A;  4N23 A;  1DLB A;  5KUM A;  4ZKI A;  5DN6 G;  3CP1 A;  2LP7 A;  1FXV A;  3T4D A;  3PJS K;  3W7S A;  3NXS A;  1F51 A;  3CCV V;  2P6J A;  1JPX A;  1G8M A;  1EZJ A;  1AJN A;  3K08 A;  4WFG A;  2WLJ A;  3E8B A;  3IC7 A;  3UKM A;  2IU3 A;  2EIM B;  5B1A B;  1K3E A;  3X2Q B;  2MK3 A;  1NJI W;  1AJQ A;  3ABL B;  4GX0 A;  1N8R W;  2QEX V;  2XND G;  2EZP A;  4LCU C;  1YTF D;  1VQ9 V;  2ZDI C;  3CC4 V;  1OCZ B;  1V54 C;  2Q67 A;  1YTF B;  2B1G A;  4JAS A;  4H33 A;  1FXK C;  5C93 A;  3RVY A;  5KA5 A;  2DQ3 A;  1YJW V;  1K5Q A;  4GCZ A;  4WCE V;  2YSU B;  1EBO A;  3STL C;  4G2K A;  1QBZ A;  3AG2 C;  5EC1 C;  1NKD A;  3KG2 A;  3LDE A;  1CPY A;  3OMN B;  3ZMU A;  4KUM A;  3K3W A;  1VQK V;  1SER A;  2EZO A;  4BAY A;  1MSW D;  2DYS B;  4L87 A;  2QKS A;  5EBL C;  3IFX A;  4JTA B;  1F23 A;  3RW0 A;  3AG1 C;  1M56 B;  1F4N A;  2EIL C;  2B1I A;  1I5X A;  3OMI B;  4UXN A;  4QNH B;  1S0V A;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...