2Q67A

Crystal structure of nak channel d66a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q67A00
1V54C 3RVZA 4EKWA 2WLIB 3ZRSA 3SPGA 3K06A 3OR7C 4MVQA 3VOUA 3LDCA 2EILC 4H33A 3RW0A 4PA6A 1JVMA 2Q6AA 4PA9A 4BW5A 3T2MA 4DXWA 3HPLC 2ITCC 2WLIA 3ABLC 2QKSA 3BEHA 2A79B 3F7YC 4MSWC 4PA4A 4R50A 2WLKA 4LCUC 5J9PC 2AHZA 5EBWC 3SPIA 2W0FC 2YEVA 4MVOA 2IH1C 2WLJA 4MVRA 1OCRC 2WLLA 4JTCB 4TWKA 3K03A 4WFEA 4P2ZA 3E8BA 3K0DA 3OGCC 4RUFA 4PDMA 1J95A 2HVJC 3E8HA 4QNHB 4RUEA 2EIMC 1XL6A 4MW8A 4CBCA 5CBFA 5CBGA 2QTOA 3SYQA 2BOBC 4WFFA 3AG3C 2AHYA 3LUTB 3ASNC 1K4CC 5EC2C 5IY5C 3IGAC 4H37A 3RVYA 4HYOA 4GX2A 2Q69A 2WLMA 2H8PC 3PJSK 4P30A 3GB7C 2R9RB 3ZJZA 5KUKA 1R3IC 3ASOC 2WLLB 4MTGA 4X89A 2NLJC 4XDKA 2EIKC 3K0GA 3LDDA 4MVSA 3RBZA 1QLEC 1OCCC 3ABKC 1BL8A 4G27B 3WG7C 2HJFC 4ZBMA 2HFEC 3SPHA 4MTFA 3OUFA 3ABMC 3KG2A 1KKDA 4GX5A 2DYSC 3TCUA 2ZD9A 3T4DA 2JK5C 4JTDB 3SYOA 3IFXA 5EBLC 1S5HC 2DYRC 4PA7A 1OCZC 4X8AA 4GX0A 2WLNA 4JTAB 3FB6C 3FB8C 4WFHA 5E1AC 1ORQC 4MVUA 2K1EA 3OR6C 4P9PA 2DWDC 4PDVA 2IH3C 3LDEA 2WLHA 1M57C 4G28B 2A0LA 3SPJA 2DWEC 2EIJC 1R3LC 3SYAA 4J9ZB 2Q68A 4PA3A 3JYCA 3LNMB 4R6ZA 4PDRA 4MVZA 3E8GA 4GX1A 1M56C 4PDLA 5BZBA 2Q67A 3T1CA 5CBHA 4RO2A 3TETA 5B3SC 3STZC 5KUMA 4XDJA 1G4YB 2X6AA 2HG5C 2Y69C 3X2QC 4MVMA 4X88A 3E86A 4MTOA 4OXSA 3E89A 3EFFK 4QE7A 2HVKC 2BOCC 2ITDC 2P7TC 4I9WA 4F4LA 3T4ZA 4HZ3A 4UUJC 4WFGA 5EC1C 4KFMA 1OCOC 4LBEC 3AG1C 5EK0A 1LNQA 2OCCC 3E83A 3FB7C 3E8FA 4R8CA 1ZWIC 3OUSA 3SYPA 3UM7A 2X6BA 2A9HA 2X6CA 3SPCA 3UKMA 1XL4A 2KB1A 4MS2A 1R3KC 2ATKC 4MW3A 4RAIA 5B1AC 5EBMC 2ZXWC 5B1BC 3AG2C 3F7VC 3K04A 3STLC 1V55C 1R3JC 3AG4C 3R65A 3K08A 4QE9A 4XDLA 3SJQC 2EINC 4P9OA 3FB5C 1K4DC 4J9YB 4R7CA 1P7BA 3SYCA 4LP8A 3F5WC
chains in the Genus database with same CATH superfamily
1QCEA 3CRRA 3ZHRA 3UO2A 4PA6A 3UT5A 4PD4F 3ABLC 2JS3A 1JFFA 2W0FC 3J81N 5IWAO 5L3BA 2HVJC 1MZFA 2Z5UA 3ZHSA 3MHSC 2BOBC 4B3TB 1Q82W 3GWKC 4UCRA 4H37A 3H1LH 4NXMO 3U11A 5IE9A 1N8RW 2FMLA 2XTAA 3ABKC 4ZBMA 3BVOA 1K33A 3OFNG 5CA1B 1AJNA 4JGSA 2QTSA 1SKVA 5DM6V 3J7AU 2F66C 5L3DA 4EFBA 5BR8O 3CCQV 3FB6C 1GN2A 2CGNA 1SQFA 2FKXA 3K59A 3RYCA 2ZE7A 1VF5B 4X1KA 3AK3A 4U3FH 3CEIA 2ZCEA 5B3SC 2ZR3A 2OT5A 3G71V 4BIZA 3L74H 4F6RA 3HKBB 4KFMA 4UXNA 2YDEA 3JASA 3OW2U 2JRIA 3OUSA 3W7UA 2ZIOA 1YHQV 3M7MX 5GTHZ 1K9MW 4JAAA 1FD9A 1R3KC 2R70A 4UB6Z 4EFEA 1G1XB 4XDLA 1K4DC 4F6RB 1XMOB 4EKWA 1AI7A 2ADPA 3ZN1A 4HBNA 1XUQA 1GH6A 2VQEO 4UCSA 3HPLC 2QE7G 1AR4A 2EBOA 3CCVV 3A2FA 4PI0A 1N0JA 1OCRC 1S72V 1XILA 4X1YB 1NR1A 1XI1A 3S3WA 4PDMA 1ZLZA 3ABMB 2AZ0A 5KHIA 4Q6GA 1SS3A 1SA0A 3WFVA 1SQPH 1KP2A 5DN6G 4YJ2B 3CB2A 2FB5A 1FJGB 4B3TO 4LF4B 2XASA 3PJSK 4P30A 4DO2A 4CZZA 3ZRVA 3AG1B 4H44B 2NLJC 3UO3A 4BIUA 4FLVA 3IAYA 1BL8A 1P49A 2EIJB 4TT3G 3B09A 2IBZH 1NTKH 1AJPA 2Q7EA 2ILMA 1SA0B 2P6JA 4BIOA 5LMUB 3OM3B 2Y4UA 4ZOLA 2QGNA 2PF4E 3C90A 3A0HZ 3OTOO 2EZOA 5LHHA 4PDVA 1ROPA 3L70H 2OCHA 2Y4TA 2ZE5A 4TUYB 5JJJB 4PA3A 2VS0A 3DSQA 4ZI7A 2CH7A 3CYOA 3L72H 1M56C 2Q67A 3K3WA 1BGYH 2PI4A 1MA1A 3CRAA 4ZOLB 2X6AA 2DJVA 1P84F 3OGIB 2WA3A 4DR3B 4NXNB 1HNXB 2P5OA 2CTWA 3ETDA 3CXCU 3RGBA 2EULA 1OCOC 2UXBB 4ZI7B 3JAKB 1JJOA 1FFTB 3D36A 4R8CA 1KC8W 1S5JA 4JAUA 1KKCA 1R6NA 3UKMA 1AROP 1MOFA 5KAFZ 3OT7A 2ZXWC 1WLEA 1BCCH 1Y67A 2JDIG 2GSMB 1NJIW 4PV1B 1V54C 3FAVA 4JZ2A 2BCCH 3JCUZ 3SPGA 1XMOO 3DGEA 3UCSC 2FTKA 5IY5B 4U7NA 2ZDIC 3JAMN 2YEVA 2V4DA 1RM1B 1DF4A 5JCOA 1M93A 1H2LA 3BRCA 1XL6A 3QO5A 1YJWV 1YXBA 3AG3C 2GBOA 2UXCB 4JI8B 4CH6A 1GTOA 1GO3F 1FJGO 4U7OA 2H8PC 4LF4O 1AI6A 3ZMSA 1VF6A 4X89A 2LJ2A 1FS0G 3LDDA 2QKAA 3WG7C 4Z1VA 3HKEB 1K97A 4FZ1A 2UU9B 1DLBA 4X65B 4X20B 3IFXA 5LMUO 1WJZA 4B7KA 4GX0A 4JTAB 4LWSA 1XREA 5CN0A 3K9AA 1K34A 3CCSV 2IH3C 2KG7B 2GUZB 1AILA 4FIPC 5GTIZ 1QBZA 2OCCB 3LNMB 3P32A 4PDRA 3JSNA 4CH4A 1JCHA 5GW7A 5B1BB 3LNNA 2IU3A 4NXNO 4DR3O 4ZHQA 5KA6A 5LGTA 2JJ2G 1HNXO 4OPHA 4B08A 3ASNB 3TJTA 2CE4A 2ZR2A 4HAMA 1N34O 2Y48A 4TQFA 4GKKB 2UXBO 1F51A 1P4RA 3APQA 4J80A 1ZTEA 1V9PA 4DW1A 1H2GA 2UXDB 1WP7A 4ZHQB 2RN9A 3JAWA 1Z5VA 1H2KA 3JSLA 4QGPA 3E2EA 5K1PA 1VIBA 3D3QA 5J2UA 1SZXA 3LDCA 4H33A 2Q6AA 1JOYA 4O2AA 5CA0A 1VQ6V 3HKCA 1YTFD 1KBHA 4J7ZA 2OTLV 4MVRA 5J2TA 1PNMA 3OGCC 1NH2D 4FZ0A 2LW1A 2EIMC 3A0RA 1Q43A 3UQ8A 2IJKA 1IBKB 2CDYA 1BMFG 4XBFA 3LUTB 4J7JA 2Q73A 1AP6A 4N23A 3K5OA 3CMAV 5CA0B 2UXCO 3AEIA 5EIBC 1E79G 2Q69A 5JCOC 5CB4A 1AP5A 4JI8O 1CEZA 4NKGB 4PELA 4UV9A 3VQXA 1QLEC 4NTYA 2JVDA 1OV9A 2ZNIA 1LR1A 4X62O 4J10A 3NXSA 2Q0OC 3ABTA 2UU9O 2YXLA 4X65O 3ZHQA 4DR4B 5JJEB 1VF6C 4JYCA 2YXHA 4JI0B 3ZHVA 2G38A 3BA8A 5LMNB 1NTZH 3JALA 4FM0A 4OGQB 4MT8A 1ZL8B 3RYFB 1I5YA 2E76B 4R6ZA 4MVZA 3QO8A 1PNKA 5BXZA 3BAAA 2QKCA 1IDSA 1KP3A 3B77A 1PL0A 3CCRV 4F4LA 3IC9A 4IL6Z 3L73H 1AR1B 1LNQA 3QTCA 4F6EA 4GKKO 4NR1A 1K92A 3GWOA 3AG4C 1Y74B 2UXDO 1F4NA 4TSFG 1M9NA 1RSOA 1BHBA 2AW9A 1RPOA 2UXNA 1Y66A 3K06A 1L0LH 1AR5A 4MSWC 3QO7A 5LA6B 2GV9A 1LUVA 4K3AA 4MVOA 2EIKB 2XHBA 5C8YA 1Q6HA 1GK9A 3K0DA 1H2NA 2C2AA 3G80A 4DR5B 3O65A 1TAEA 1IBKO 5KHKA 1IX9A 1OCZB 2Q4PA 3P30A 5LGNA 5C8YB 2JEXA 1R6KA 4K0KO 3U0ZA 3LSUA 3SPHA 1XNQB 1S3JA 1ENVA 3B8MA 2XAFA 1WB7A 2HEPA 4JTDB 1MSDA 1VARA 4FJCC 4DR4O 3FYEB 1MZEA 2K1EA 2YICA 3E35A 4JI0O 4DR2B 4I4TA 2WLHA 2DWEC 4OPAA 4BW9A 3L9DA 4GX1A 4RO2A 1VQLV 1AB3A 1G4YB 5B1AB 2Y69C 2X7RB 3SDLA 1FPOA 4OXSA 4TV9A 4QE7A 1V55B 2ZQMA 2EINB 4UCTA 5EC1C 1TA8A 4KUMA 4LBEC 2WWWA 1I5XA 3JD2A 1NI8A 3QF7A 1KUQA 1LUWA 4FLXA 4MW3A 1IURA 5FLXN 2Q5ZA 1N32B 4EB6A 3CC7V 3VQWA 4BWAA 4YIOA 5LHIA 3CD6V 1S5LZ 2ETNA 1GN3A 5LGUA 3DC6A 2QR4A 4LP8A 1QR9A 3RVZA 1FAFA 1Y76A 4O4HA 4JI5O 4LF5B 2ZIMA 3T2MA 4B3MB 1H2SB 1BQ0A 4R50A 2AHZA 1SF9A 5LXTB 2WLLA 4JTCB 4Q20A 1OCCB 3E8BA 5H6RA 2OYQA 4RUEA 2WSSG 4IYHA 2QTOA 3SYQA 4O4HB 2AHYA 3ZHUA 3BHPA 4DR5O 4FFKA 3IGAC 1XBLA 2VQEB 5B1NA 2E5LB 2R9RB 3ASOC 1Q3EA 2WLLB 4XDKA 3OMNB 2WA4A 5IYCO 2D3OW 2UUBB 2XAGA 4FLYA 3OE7G 2QA4V 1Y6XA 1F7YA 3DTUB 1XNQO 5B5EZ 2QWQB 4AILC 3SYOA 5CA1A 2LQTA 1NKDA 4I5SA 4WFHA 2R72A 1MG1A 3K57A 1M4UA 2P90A 4I55A 2YI9A 3ZIAG 3SPJA 3ZN0A 2A0LA 4ASUG 4DR2O 3JD3A 1AJQA 4L87A 3THOA 3CS5A 4DK0A 1S76D 2PY5A 2GHYA 3CPWU 2HG5C 1ZAUA 3AG2B 3E86A 4H0LB 3CRCA 3EFFK 3B40A 4I55B 2HKOA 3QNEA 3OTOB 4HZ3A 4O4IB 1K73W 2N05A 3AK1A 1FYJA 2QJ1A 1JQ0A 5L3FA 2ZINA 3HKBA 1Q7YW 2PI5A 3QG5A 4GYCB 4FFBA 3CWBH 2ZT9B 3K04A 3R65A 1N32O 3SYCA 4CS4A 1RPRA 4PA9A 1Q81W 1QVGU 1GN6A 2ITCC 4LF5O 4QPJA 3CCEV 4OX9B 4UVAA 4B3MO 4FFBB 2WLJA 5JQGA 2YC0A 3K5LA 4QPKA 3E8HA 4CH5A 5LP6B 1I7FA 1YJNV 4X1YA 2VQFB 3OTFA 4HYOA 2NN4A 2IJHA 4YJ2A 1BS3A 4DV3O 3LSSA 1R3IC 1XEQA 2E5LO 1K3EA 4LF6B 5JQGB 1HWYA 1N4CA 1E1QG 4MTFA 3MDSA 2UUBO 1EN4A 2IW5A 1BSMA 1JJ2U 1MABG 1YSCA 4O2BB 2NR5A 4ABMA 4HNAA 2O57A 3S3XA 1IXBA 1QQCA 2P4KA 2WPDG 4TUYA 4BR6A 1BE3H 1XNRB 3X2QC 4E2LA 4MVMA 4IIJB 4X9QA 2K9PA 2X0LA 4HNAB 5B1OA 4ZKIA 4UCVA 2JS5A 1K7DA 2AZ2A 1JMKC 3ZHTA 2AXTZ 1VP7A 1L8DA 3EHBB 2X6BA 2RMKB 2CTPA 2UUAB 3JAKA 1ZUQA 3STLC 3D3IA 3AK2A 3F5WC 3OR7C 1N34B 1JVMA 1M1KW 4LF9B 1XDCA 2MK3A 2WLKA 3JARB 4OX9O 5LBQA 1BT8A 5KHGA 1W59A 4CBCA 1D2DA 3K5MA 1EN6A 5BY1A 2QM8A 4DV0B 4FLZA 4GX2A 2VQFO 1NVPB 4LFAB 3RYIA 4W4LA 1VQPV 2F95B 3K0GA 4MVSA 4LF6O 4FMTA 3ABMC 3KG2A 1IVSA 5KLVH 3EVKA 5ITZA 1NBMG 3JATA 3PN1A 1YCIA 3G67A 3HKEA 2JK5C 2RQ6A 1AI4A 4X20A 4DUYB 3RYIB 3Q4HA 4JV5O 5L3EA 1PP9H 4NYKA 1CXZB 1P7GA 4UB8Z 2Q7GA 2EIJC 1QNMA 2IJJA 1H2MA 2ZKOA 3JYCA 2KG7A 5ITZB 2GUZA 3JATB 1J5EO 4X62B 4JASA 2ODMA 3TETA 4PI2A 2AGAA 4XDJA 2DMXA 1EFRG 3Q4HB 1XNRO 1S0VA 1HW7A 3SGIA 2BOCC 4C7UA 2ITDC 2P7TC 1IZ3A 4WFGA 1N33B 3I56V 3FKSG 5IYZB 3ZBHA 3G6BA 3MAQA 3H9VA 3E8FA 4FLWA 3IC7A 4K35A 5KAIZ 3SYPA 2F43G 3BA9A 5L3CA 2V7QG 3FD9A 5HFLA 2UUAO 5E79Z 3ZRWA 3OAAG 1R1BA 1R3JC 1NZ6A 1P7BA 2CAZC 2ADQB 2V1DA 3ZRSA 3VOUA 3K58A 3H1IH 2PTMA 4I50A 4LF9O 4JZGA 3ZRWB 2GDSA 5D5PA 1QU7A 2HHHB 4RUFA 3RWRD 3N2KA 1SETA 5KX5A 5A2QN 5IJ9B 1FXVA 5FPRA 2DYSB 3D36C 4D7TA 2M7WA 5IY5C 3A8TA 4O4JA 4I50B 4DV0O 2P22C 3QVNA 1FXKB 4LFAO 4RQFA 4D7SA 1RFYA 1RM1C 3SR2C 3N2KB 5KX5B 2HFEC 4FM2A 3OUFA 4UFZA 4I0XB 5LYJA 3HB3B 1KKDA 3GVMA 2JEUA 2W6IG 5A9GA 2F4VB 1YVWA 4O4JB 1ORQC 2F1MA 4DUYO 1VQ4V 3CE2A 2DWDC 2PYLA 4Z2WA 1O9GA 1W2BU 4K0KB 1DGSA 5LYJB 3WB0A 2RNBA 3DXRB 5L3GA 3E8GA 1ZL8A 5H6QA 3RYFA 3OMAB 3KZIZ 2DW4A 4DV5B 3CC4V 3CCLV 2MW2B 2BSKA 4QIWF 2LGWA 3W7WA 3T1YB 1VQOV 2CK3G 1G6UA 3N2GB 5IJ0B 3JD0A 1WA8A 2CTQA 2B1IA 5D5QA 1N33O 4DV1B 1URFA 2OCCC 3E83A 2EILB 3G6EV 4JI4B 3ZS8C 2A9HA 1VQ7V 5B1BC 2BSKB 3ML0A 3CJHB 3W7TA 5FL7G 2E3CA 3SJQC 2B1GA 4R7CA 3IJ4A 1WA8B 1HR0B 1Y74A 4MVQA 1SC5B 1DF5A 5LOVA 1B06A 4GKJB 4PA4A 3BEHA 1PV0A 1H38A 2ARHA 5CA3A 4B3RB 4ZIBA 4WCEV 1CPYA 5LA6A 4P2ZA 1AVMA 2HHHO 4QNHB 3TXQA 1PNLA 5JVDA 1N0NA 5CBGA 3P3NA 1K4CC 2DYRB 5LOVB 1YI2V 1YIJV 4JI5B 3ABUA 2E75B 3HR0A 4MTGA 1QR8A 4FLTA 4W4KA 3BABA 1D5NA 2Q7HA 2BTQB 2IU0A 1SQQH 1JX9A 4DW0A 2Q9LA 5JVDB 2JGDB 4X1IA 4WBNA 5IDJA 3TCUA 4DR7B 1ZX3A 4JYAB 4CC6A 4O4LB 4PA7A 1SQVH 2F4VO 1XMQB 4MVUA 2JGUA 4DR6B 2N74A 3CC2V 1M57C 4X66B 3ZEDA 4FLUA 4X1IB 4WBNB 2LO1A 2RDCA 3RYHA 4LF8B 1YZBA 4PJ0Z 4D6TH 1H8HG 1HNZB 4IHJB 4DV5O 4JAVA 4RQEA 3O9OA 4JF3A 3T1YO 3H1HH 5EK0A 3RYHB 1AI5A 4LNUA 4DV1O 1VQNV 4JI4O 3ABLB 4DV4B 2KB1A 1KMIZ 5EBMC 1RP3B 1FXHA 3B8NA 3ETGA 3FB5C 1JR9A 2Q0AA 1HR0O 2WLIB 1KECA 1PPJH 2HR3A 4LNUB 3RW0A 2QM4A 3TGUH 3T1HB 4J41A 5B66Z 4JPRA 3ZMZA 5TISZ 4GKJO 3CP1A 2IH1C 3BPZA 3ABKB 1WN7A 4B3RO 1N36B 5LXTA 1A32A 1XHXA 4MW8A 1EBOA 2OWOA 3OMIB 4NVPA 5LL6Y 2QDOA 1GM7A 3APOA 3GB7C 3ZJZA 2EIKC 4H13B 4J42A 2DQ0A 2HJFC 1QVFU 4GCZA 1Q6UA 2L35A 1MSWD 1TGOA 4DUZB 4Z1MG 1FFXB 3H01A 2ZD9A 5B3SB 4DV6B 4DR7O 3JD1A 1OCZC 4JYAO 3FB8C 2EZPA 1QHTA 5DEDA 1I94B 3TXSA 4WF9V 1XMQO 1Q6IA 4DV3B 2CGOA 2LFRA 3SJBC 4DR6O 4RWUA 2KKWA 1VQMV 4LFBB 1YF2A 4I7ZB 4X66O 4JI6B 1YEWA 4LF8O 1SQXH 4AQYB 1EZVH 2QWOB 2KQXA 1WNSA 2BTOA 2A7WA 1VEWA 1HNZO 4YJ3B 1WP8A 1X4TA 1SQBH 2HVKC 1Z2GA 2PUSA 4I9WA 1SRYA 1D5AA 1OJHA 1YJ9V 2BE3A 1Q8IA 4O4IA 1ZWIC 2H3OA 1ZSPA 3NR7A 4RAIA 5B1AC 4DRXA 4DV4O 1OCRB 4FPPA 1Z5WA 1V55C 4LF7B 4UCOA 2NNUA 2EINC 4YY3B 3C3SA 3UT5B 1Y4MA 2UXXA 2QM7A 5H2FZ 1JFFB 2FL4A 4BW5A 4DXWA 1NVPD 3F5TA 3K9SA 3T1HO 3F7YC 4DRXB 3SPIA 4DYLA 4U3JA 1VQ5V 4JI1O 1TUEB 3RN4A 2ZM6O 4UV8A 1N36O 3X2QB 4JYYA 4WFFA 3WB1A 5HFMA 3B2EE 5EC2C 5LP6A 1VQ9V 2QSAA 1NS1A 1O9HA 1DTOA 4U3JB 4B3SB 1OCCC 3EXAA 1TUBA 4I9QA 4NTWA 1TVKB 4DUZO 1M56B 1SESA 2EJRA 4X64B 2LGQA 1NTMH 4DV6O 1DK1A 1OHHG 3RYCB 4GUNA 4X1KB 4O2BA 2Q8VA 2YIAA 4JI7B 2HJDA 4N21A 1I94O 4JI3B 1TUBB 1OCOB 2N04A 5EIBD 1JPXA 4LFBO 2H94A 3T1CA 1VQKV 4UVCA 3STZC 4JI6O 2ZDIA 5KHJA 5IYDO 2ZXWB 1QLNA 5LHGA 4AQYO 1U96A 3E89A 1HDJA 3L75H 2HP8A 4JV5B 2UUCB 3LSQA 2D2CB 3D8CA 3JASB 4IIJA 1Q86W 1K8AW 1V54B 5BMVA 3CX5F 1PD3A 3KCXA 5K1XA 1GM8A 3OEHG 1J5EB 2P06A 3SPCA 4MS2A 4NB5A 3AG2C 3F7VC 1I0HA 2LFSA 2XAHA 4AHCA 4QE9A 4P9OA 4J9YB 2LW7A 4LF7O 5BMVB 4YY3O 3P3PA 4BAYA 3AG3B 4PHZA 2QWNB 2OIEA 3JD4A 4K8ZA 1HNWB 2VWJA 4TWKA 1F23A 3K03A 4KL1A 4UCUA 3WG7B 3K5NA 4YIPA 3JARA 2QWRB 2Z0AA 2YI8A 4GLXA 4GZRB 4GT1A 1GRJA 3U10A 1MNGA 2ZE6A 2YIBD 5F2VO 2OIGA 4E4EA 2W0XA 3OD4A 1PM9A 4B3SO 5LP6C 5JWPA 4IT5A 3ZX6A 4JI2B 1GM9A 1NT2B 4K8XA 1S5HC 1EZJA 4X8AA 2L6LA 3HKDA 4X64O 1VQ8V 2CH7B 2PZSA 5EZYA 3LDEA 4G28B 1XQ8A 1R3LC 4JI7O 4J9ZB 4JI3O 3CXHF 3ICXA 1SQGA 1BQZA 2OTJV 2XUMA 2FYUH 3BY6A 4CC5A 1COWG 1KYOF 4KP4A 2RJZA 3G4SV 3ZMVA 2ZE8A 4MTOA 1KQSU 1B6QA 3ETQA 3HKDB 3I5DA 3CHXA 5EZYB 4UUJC 1KU9A 2UUCO 1H8EG 5AG2A 3AG1C 2JIZG 2QWPB 3UM7A 5IYZA 1VF7A 4DR1B 2X6CA 2XAQA 1FKAO 3CCUV 4WFBV 2R9IA 4LH6A 2PGGA 3FAVB 1KD1W 2EIMB 4LFCB 3KKYA 2JJ1G 1T5EA 4DV2B 2EX3A 2YEVB 1BZKA 1K5QA 3RBZA 1OZ0A 2QKSA 4ICGA 2A79B 5J9PC 4LC1A 4CS3A 5IT9N 1HNWO 3KCYA 4WFEA 1QLEB 3RT3C 3ZCCA 3I55V 4QJFB 2RCVA 3CCMV 2HLDG 5IJ9A 3WU2Z 4YXWG 3VBBA 3WB2A 2WLMA 5JH7A 3ZMUA 1JA8A 2WAMA 3TK1A 1FXKA 5KMGA 4IGGA 5FPOA 4GX5A 1EM1A 4LWSB 2F93B 4I0XA 1PKXA 4FK5C 4JI2O 1G8MA 2WLNA 2B9ZA 1NQTA 5JH7B 2Y0PA 2M6YA 3OR6C 5IYBO 3CSXA 2YIBA 1S77D 2DQ3A 3A0BZ 4EEQA 5KMGB 1KB9F 1W0KG 2DN9A 4NTXA 5KUMA 3W7XA 3DXRA 4X88A 3CMEV 1WPXA 4IYIA 3AG4B 5H5NA 1NR7A 2A06H 1L0NH 1YITV 1PL4A 3MD0A 3FB7C 3N2GA 5IJ0A 1XHZA 1F4MA 4DR1O 3JAWB 1E1RG 2ATKC 2GTAA 3RFRA 3B4SA 2Z3YA 4TOIA 3W7SA 3K08A 5J2UB 4G2KA 2B5UA 3SJCC 1WPBA 3CJHA 4O2AB 2YIDA 4WFAV 3HKCB 4LFCO 3CRMA 4FVMA 1WAZA 4DV2O 5J2TB 1M57B 4JYBA 2YSUB 1GKFA 1J95A 4YHHB 1VMGA 3M99B 3FYIB 4B7EA 5CB4B 3ASNC 3FFQA 3H1KH 1L1FA 5KUKA 5FNVA 4KHPB 3J80N 2KSDA 4G27B 1UJWB 1THZA 3ZMTA 3R66A 2BTQA 2DYSC 4LH7A 3T4DA 3BCCH 5EBLC 2Y69B 2JGDA 2CTRA 2YXYA 1IBMB 3JALB 1IBLB 1HP8A 5FNVB 1FXKC 4P9PA 4DK1A 1X59A 4O4LA 1BHAA 1M90W 5EYPA 3VQVA 2P67A 3OEEG 4PDLA 4DV7B 5CBHA 5DECA 3AG7A 1YDXA 4J11A 1EN5A 2W6JG 3T4ZA 3CCJV 4IHJA 2VRZA 5EYPB 1R6TA 1W0JG 1GAXA 4CH3A 5H9CA 1Q90D 3H1JH 2F23A 2ZNJA 1XL4A 1Q5OA 2GTSA 4TQDA 1XOUA 2XOKG 1RSOB 3ZRXA 1SERA 1GMGA 2R9AA 2XAJA 3VQYA 2XNDG 3JCZA 5JJNB 3ETEA 2XT9A 3CRQA 3K79A 2EILC 1UPGA 2IM9A 1UFIA 2WLIA 2DOSA 2Y0IA 4LCUC 5EBWC 1WB8A 3ASOB 5GONA 3M8AA 5IWAB 5C93A 1M5IA 2IJIA 1IXMA 4UVBA 4YHHO 5CBFA 1NU1H 2EJ7A 1CP9A 4NXMB 3L71H 1I08A 3RVYA 2LP7A 3N27A 1YTFB 4MTXA 4TV8A 5GONB 5LMNO 2PYJA 3SJAC 4L8JA 4KHPO 5KHHA 4CS2A 4JI1B 1NH2B 1GN4A 3C3TA 2ZM6B 2P4VA 3DC5A 5BR8B 2DYRC 1FFXA 4I4TB 5E1AC 4TV8B 1IBMO 2VWKA 1U97A 1IBLO 1SZTA 1R73A 5KA5A 3E22A 3SYAA 2Q68A 1B3QA 5CMUA 4LR3A 1K5SA 5BZBA 4TV9B 1US6A 2CUGA 4DV7O 2A3QA 2E74B 4A5UB 3MHHC 1TVKA 4FM1A 3E22B 4YJ3A 4AI8A 2YUAA 1B04A 3BFRA 4EB6B 4KXRA 2YS8A 4J7KA 1MMMA 2QEXV 2DE0X 1Y76B 3FX7A
chains in the Genus database with same CATH topology
1BHBA 4BAYA 1RPOA 1QCEA 2V1DA 2UXNA 3AG3B 1Y66A 3K06A 3ZRSA 3VOUA 4PA6A 3ABLC 4MSWC 3QO7A 3JD4A 2W0FC 4MVOA 4TWKA 2EIKB 3ZRWB 1F23A 3K03A 1GK9A 3WG7B 3K0DA 4RUFA 1SETA 5L3BA 2HVJC 2Z5UA 2C2AA 1FXVA 3MHSC 2BOBC 4GT1A 2DYSB 1Q82W 2M7WA 5IY5C 4H37A 1OCZB 3P30A 5LGNA 1FXKB 1N8RW 4RQFA 2JEXA 1R6KA 1RM1C 3ABKC 4ZBMA 1K33A 2HFEC 3OFNG 3SPHA 3OUFA 1S3JA 1ENVA 1AJNA 3HB3B 4JGSA 1KKDA 3B8MA 2XAFA 2JEUA 2W6IG 1GM9A 4JTDB 5DM6V 1S5HC 5L3DA 4FJCC 1EZJA 4X8AA 3FYEB 3CCQV 3FB6C 1ORQC 2K1EA 1VQ4V 1VQ8V 3E35A 2DWDC 3LDEA 2WLHA 4G28B 2DWEC 1W2BU 1R3LC 4J9ZB 2OTJV 5L3GA 3E8GA 3BY6A 4GX1A 5H6QA 1COWG 3OMAB 4RO2A 1VQLV 5B3SC 2DW4A 1G4YB 2Y69C 4KP4A 2X7RB 2ZR3A 5B1AB 2OT5A 3ZMVA 4MTOA 3G4SV 1B6QA 3CCLV 4OXSA 1KQSU 3G71V 4QIWF 4QE7A 1V55B 4BIZA 3W7WA 2ZQMA 1VQOV 2CK3G 2EINB 4UUJC 5EC1C 3JD0A 4KFMA 4UXNA 1H8EG 2B1IA 4KUMA 4LBEC 2WWWA 3AG1C 2JIZG 1I5XA 3JD2A 2OCCC 3E83A 2EILB 3OW2U 3G6EV 3OUSA 3W7UA 3UM7A 1YHQV 2A9HA 2X6CA 2XAQA 1VQ7V 1K9MW 4MW3A 1R3KC 3CCUV 4WFBV 5B1BC 3ML0A 3CC7V 2R9IA 5LHIA 3W7TA 3CD6V 5FL7G 4XDLA 3SJQC 5LGUA 2B1GA 4R7CA 1K4DC 4LP8A 1KD1W 2EIMB 1QR9A 3RVZA 4EKWA 2JJ1G 1AI7A 3ZN1A 4MVQA 1DF5A 2YEVB 3T2MA 3HPLC 1K5QA 3RBZA 1OZ0A 4PA4A 2QKSA 3BEHA 2A79B 2QE7G 4R50A 5J9PC 2EBOA 3CCVV 2AHZA 1H38A 4LC1A 5CA3A 1OCRC 2WLLA 4JTCB 4Q20A 1QLEB 4WFEA 1OCCB 4WCEV 1CPYA 1S72V 4P2ZA 1NR1A 3E8BA 3ZCCA 4PDMA 5H6RA 3ABMB 4QNHB 4RUEA 2WSSG 3I55V 1PNLA 4QJFB 5CBGA 2QTOA 3SYQA 3WFVA 1KP2A 2AHYA 5DN6G 3CCMV 1K4CC 2HLDG 3CC4V 2DYRB 3IGAC 4YXWG 3VBBA 1YI2V 1YIJV 5B1NA 3ABUA 2WLMA 2XASA 3PJSK 4P30A 4DO2A 4CZZA 2R9RB 3ZRVA 3ASOC 3AG1B 2WLLB 4MTGA 2NLJC 4XDKA 3ZMUA 1QR8A 3OMNB 4BIUA 5IYCO 2WAMA 2D3OW 3TK1A 1BL8A 2EIJB 4TT3G 2IU0A 1FXKA 2XAGA 1JX9A 3OE7G 2QA4V 1AJPA 4GX5A 3DTUB 2P6JA 5IDJA 3TCUA 3OM3B 3SYOA 1PKXA 4FK5C 1NKDA 4PA7A 4I5SA 1G8MA 2WLNA 4WFHA 1NQTA 4MVUA 3OR6C 5IYBO 1MG1A 1S77D 2EZOA 5LHHA 2DQ3A 2P90A 4PDVA 1ROPA 3ZIAG 3CC2V 3SPJA 1M57C 3ZN0A 2A0LA 4ASUG 3JD3A 4PA3A 3CYOA 1AJQA 4L87A 1W0KG 1M56C 2Q67A 1S76D 3K3WA 2PI4A 5KUMA 2GHYA 1H8HG 3CPWU 3W7XA 2X6AA 2HG5C 4X88A 3AG2B 3E86A 3CMEV 1WPXA 3EFFK 3AG4B 1NR7A 4JAVA 3ETDA 4RQEA 3CXCU 2HKOA 3QNEA 4HZ3A 4JF3A 1K73W 1OCOC 5EK0A 1YITV 3MD0A 1JQ0A 3FB7C 3D36A 1FFTB 4R8CA 5L3FA 1AI5A 1Q7YW 2PI5A 1KC8W 1VQNV 4JAUA 1R6NA 3ABLB 1F4MA 3UKMA 1AROP 2KB1A 1E1RG 2ATKC 1MOFA 5EBMC 2ZXWC 1WLEA 2JDIG 3K04A 1FXHA 3B8NA 2GSMB 2Z3YA 3R65A 3W7SA 3K08A 3ETGA 1NJIW 4G2KA 2B5UA 3FB5C 3SYCA 1V54C 2WLIB 4WFAV 1RPRA 3SPGA 3DGEA 1KECA 2HR3A 2FTKA 3RW0A 5IY5B 4PA9A 1Q81W 1QVGU 4U7NA 4JPRA 2ITCC 2ZDIC 4QPJA 3ZMZA 3CCEV 1M57B 4UVAA 3CP1A 2YEVA 4JYBA 2IH1C 2WLJA 1RM1B 1DF4A 3ABKB 2YSUB 1GKFA 1J95A 4QPKA 3E8HA 3M99B 4MW8A 1EBOA 1XL6A 3FYIB 3QO5A 1YJNV 1YJWV 3AG3C 3OMIB 3ASNC 4HYOA 1GTOA 1GO3F 2IJHA 1GM7A 4U7OA 2H8PC 1L1FA 3GB7C 3ZJZA 1AI6A 3LSSA 1R3IC 3ZMSA 5KUKA 1K3EA 4X89A 1FS0G 1HWYA 2EIKC 3LDDA 4G27B 3WG7C 2DQ0A 2HJFC 1E1QG 4GCZA 1UJWB 1QVFU 1THZA 4MTFA 3ZMTA 1K97A 1MSWD 4Z1MG 1DLBA 3H01A 2IW5A 2DYSC 1JJ2U 3T4DA 1MABG 1YSCA 2ZD9A 5B3SB 3IFXA 2Y69B 5EBLC 3JD1A 1OCZC 4GX0A 4JTAB 3FB8C 2EZPA 5CN0A 1FXKC 4P9PA 4WF9V 3K9AA 1K34A 3CCSV 1BHAA 2IH3C 2LFRA 1M90W 4FIPC 1VQMV 2WPDG 1QBZA 2OCCB 3LNMB 3P32A 4PDRA 2P67A 3OEEG 4PDLA 5CBHA 1JCHA 5GW7A 3X2QC 4E2LA 4MVMA 5B1BB 2IU3A 2X0LA 2HVKC 2W6JG 4I9WA 5B1OA 4ZKIA 5KA6A 3T4ZA 1SRYA 5LGTA 3CCJV 2JJ2G 3ASNB 1K7DA 2ZR2A 4HAMA 1W0JG 1YJ9V 5H9CA 2Y48A 1ZWIC 1F51A 3EHBB 2X6BA 1P4RA 1XL4A 4RAIA 5B1AC 2XOKG 3ZRXA 1SERA 1OCRB 1H2GA 4FPPA 3STLC 1GMGA 1V55C 2XAJA 3D3IA 2NNUA 2EINC 2XNDG 3JCZA 3E2EA 3F5WC 1Y4MA 3ETEA 2UXXA 2QM7A 3OR7C 3K79A 2EILC 3LDCA 4TSFG 4H33A 1JVMA 2Q6AA 1M1KW 1JOYA 4BW5A 4DXWA 1NVPD 2WLIA 1VQ6V 1YTFD 3F7YC 2MK3A 2WLKA 4LCUC 5EBWC 3ASOB 3SPIA 2OTLV 4MVRA 1VQ5V 5C93A 1PNMA 3OGCC 1NH2D 1TUEB 5LBQA 2IJIA 1IXMA 4UV8A 2EIMC 3A0RA 4UVBA 4CBCA 3X2QB 5CBFA 2IJKA 1CP9A 4WFFA 1BMFG 4XBFA 5HFMA 3LUTB 5EC2C 2QM8A 4N23A 3CMAV 1VQ9V 3RVYA 2LP7A 4GX2A 1NVPB 3AEIA 1E79G 2Q69A 1YTFB 4MTXA 1CEZA 1DTOA 4PELA 1VQPV 4UV9A 3K0GA 4MVSA 1QLEC 1OCCC 1NH2B 4FMTA 3ABMC 3KG2A 3NXSA 1M56B 1NBMG 1SESA 3ABTA 2JK5C 2EJRA 4JYCA 1AI4A 2DYRC 5E1AC 1OHHG 5L3EA 4N21A 1SZTA 4MT8A 1R73A 5KA5A 2EIJC 1OCOB 3SYAA 1I5YA 2IJJA 2Q68A 1JPXA 3JYCA 4R6ZA 4MVZA 5CMUA 3QO8A 1K5SA 2H94A 5BZBA 3T1CA 1VQKV 4JASA 4UVCA 3TETA 1PNKA 3STZC 2ZDIA 4XDJA 5IYDO 2ZXWB 1EFRG 1QLNA 1KP3A 5LHGA 3B77A 3E89A 1S0VA 1PL0A 2BOCC 3CCRV 2ITDC 2P7TC 4F4LA 3LSQA 4WFGA 3MHHC 3I56V 1Q86W 1K8AW 3FKSG 1V54B 1AR1B 1LNQA 1PD3A 3E8FA 3IC7A 3SYPA 2F43G 5L3CA 1GM8A 3OEHG 3SPCA 4MS2A 2V7QG 5HFLA 3AG2C 3F7VC 2LFSA 1K92A 3ZRWA 3GWOA 3OAAG 3AG4C 1R3JC 2XAHA 2QEXV 4QE9A 4P9OA 4J9YB 1F4NA 1P7BA 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 C;  3RVZ A;  4EKW A;  2WLI B;  3ZRS A;  3SPG A;  3K06 A;  3OR7 C;  4MVQ A;  3VOU A;  3LDC A;  2EIL C;  4H33 A;  3RW0 A;  4PA6 A;  1JVM A;  2Q6A A;  4PA9 A;  4BW5 A;  3T2M A;  4DXW A;  3HPL C;  2ITC C;  2WLI A;  3ABL C;  2QKS A;  3BEH A;  2A79 B;  3F7Y C;  4MSW C;  4PA4 A;  4R50 A;  2WLK A;  4LCU C;  5J9P C;  2AHZ A;  5EBW C;  3SPI A;  2W0F C;  2YEV A;  4MVO A;  2IH1 C;  2WLJ A;  4MVR A;  1OCR C;  2WLL A;  4JTC B;  4TWK A;  3K03 A;  4WFE A;  4P2Z A;  3E8B A;  3K0D A;  3OGC C;  4RUF A;  4PDM A;  1J95 A;  2HVJ C;  3E8H A;  4QNH B;  4RUE A;  2EIM C;  1XL6 A;  4MW8 A;  4CBC A;  5CBF A;  5CBG A;  2QTO A;  3SYQ A;  2BOB C;  4WFF A;  3AG3 C;  2AHY A;  3LUT B;  3ASN C;  1K4C C;  5EC2 C;  5IY5 C;  3IGA C;  4H37 A;  3RVY A;  4HYO A;  4GX2 A;  2Q69 A;  2WLM A;  2H8P C;  3PJS K;  4P30 A;  3GB7 C;  2R9R B;  3ZJZ A;  5KUK A;  1R3I C;  3ASO C;  2WLL B;  4MTG A;  4X89 A;  2NLJ C;  4XDK A;  2EIK C;  3K0G A;  3LDD A;  4MVS A;  3RBZ A;  1QLE C;  1OCC C;  3ABK C;  1BL8 A;  4G27 B;  3WG7 C;  2HJF C;  4ZBM A;  2HFE C;  3SPH A;  4MTF A;  3OUF A;  3ABM C;  3KG2 A;  1KKD A;  4GX5 A;  2DYS C;  3TCU A;  2ZD9 A;  3T4D A;  2JK5 C;  4JTD B;  3SYO A;  3IFX A;  5EBL C;  1S5H C;  2DYR C;  4PA7 A;  1OCZ C;  4X8A A;  4GX0 A;  2WLN A;  4JTA B;  3FB6 C;  3FB8 C;  4WFH A;  5E1A C;  1ORQ C;  4MVU A;  2K1E A;  3OR6 C;  4P9P A;  2DWD C;  4PDV A;  2IH3 C;  3LDE A;  2WLH A;  1M57 C;  4G28 B;  2A0L A;  3SPJ A;  2DWE C;  2EIJ C;  1R3L C;  3SYA A;  4J9Z B;  2Q68 A;  4PA3 A;  3JYC A;  3LNM B;  4R6Z A;  4PDR A;  4MVZ A;  3E8G A;  4GX1 A;  1M56 C;  4PDL A;  5BZB A;  2Q67 A;  3T1C A;  5CBH A;  4RO2 A;  3TET A;  5B3S C;  3STZ C;  5KUM A;  4XDJ A;  1G4Y B;  2X6A A;  2HG5 C;  2Y69 C;  3X2Q C;  4MVM A;  4X88 A;  3E86 A;  4MTO A;  4OXS A;  3E89 A;  3EFF K;  4QE7 A;  2HVK C;  2BOC C;  2ITD C;  2P7T C;  4I9W A;  4F4L A;  3T4Z A;  4HZ3 A;  4UUJ C;  4WFG A;  5EC1 C;  4KFM A;  1OCO C;  4LBE C;  3AG1 C;  5EK0 A;  1LNQ A;  2OCC C;  3E83 A;  3FB7 C;  3E8F A;  4R8C A;  1ZWI C;  3OUS A;  3SYP A;  3UM7 A;  2X6B A;  2A9H A;  2X6C A;  3SPC A;  3UKM A;  1XL4 A;  2KB1 A;  4MS2 A;  1R3K C;  2ATK C;  4MW3 A;  4RAI A;  5B1A C;  5EBM C;  2ZXW C;  5B1B C;  3AG2 C;  3F7V C;  3K04 A;  3STL C;  1V55 C;  1R3J C;  3AG4 C;  3R65 A;  3K08 A;  4QE9 A;  4XDL A;  3SJQ C;  2EIN C;  4P9O A;  3FB5 C;  1K4D C;  4J9Y B;  4R7C A;  1P7B A;  3SYC A;  4LP8 A;  3F5W C; 
#chains in the Genus database with same CATH topology
 1QCE A;  3CRR A;  3ZHR A;  3UO2 A;  4PA6 A;  3UT5 A;  4PD4 F;  3ABL C;  2JS3 A;  1JFF A;  2W0F C;  3J81 N;  5IWA O;  5L3B A;  2HVJ C;  1MZF A;  2Z5U A;  3ZHS A;  3MHS C;  2BOB C;  4B3T B;  1Q82 W;  3GWK C;  4UCR A;  4H37 A;  3H1L H;  4NXM O;  3U11 A;  5IE9 A;  1N8R W;  2FML A;  2XTA A;  3ABK C;  4ZBM A;  3BVO A;  1K33 A;  3OFN G;  5CA1 B;  1AJN A;  4JGS A;  2QTS A;  1SKV A;  5DM6 V;  3J7A U;  2F66 C;  5L3D A;  4EFB A;  5BR8 O;  3CCQ V;  3FB6 C;  1GN2 A;  2CGN A;  1SQF A;  2FKX A;  3K59 A;  3RYC A;  2ZE7 A;  1VF5 B;  4X1K A;  3AK3 A;  4U3F H;  3CEI A;  2ZCE A;  5B3S C;  2ZR3 A;  2OT5 A;  3G71 V;  4BIZ A;  3L74 H;  4F6R A;  3HKB B;  4KFM A;  4UXN A;  2YDE A;  3JAS A;  3OW2 U;  2JRI A;  3OUS A;  3W7U A;  2ZIO A;  1YHQ V;  3M7M X;  5GTH Z;  1K9M W;  4JAA A;  1FD9 A;  1R3K C;  2R70 A;  4UB6 Z;  4EFE A;  1G1X B;  4XDL A;  1K4D C;  4F6R B;  1XMO B;  4EKW A;  1AI7 A;  2ADP A;  3ZN1 A;  4HBN A;  1XUQ A;  1GH6 A;  2VQE O;  4UCS A;  3HPL C;  2QE7 G;  1AR4 A;  2EBO A;  3CCV V;  3A2F A;  4PI0 A;  1N0J A;  1OCR C;  1S72 V;  1XIL A;  4X1Y B;  1NR1 A;  1XI1 A;  3S3W A;  4PDM A;  1ZLZ A;  3ABM B;  2AZ0 A;  5KHI A;  4Q6G A;  1SS3 A;  1SA0 A;  3WFV A;  1SQP H;  1KP2 A;  5DN6 G;  4YJ2 B;  3CB2 A;  2FB5 A;  1FJG B;  4B3T O;  4LF4 B;  2XAS A;  3PJS K;  4P30 A;  4DO2 A;  4CZZ A;  3ZRV A;  3AG1 B;  4H44 B;  2NLJ C;  3UO3 A;  4BIU A;  4FLV A;  3IAY A;  1BL8 A;  1P49 A;  2EIJ B;  4TT3 G;  3B09 A;  2IBZ H;  1NTK H;  1AJP A;  2Q7E A;  2ILM A;  1SA0 B;  2P6J A;  4BIO A;  5LMU B;  3OM3 B;  2Y4U A;  4ZOL A;  2QGN A;  2PF4 E;  3C90 A;  3A0H Z;  3OTO O;  2EZO A;  5LHH A;  4PDV A;  1ROP A;  3L70 H;  2OCH A;  2Y4T A;  2ZE5 A;  4TUY B;  5JJJ B;  4PA3 A;  2VS0 A;  3DSQ A;  4ZI7 A;  2CH7 A;  3CYO A;  3L72 H;  1M56 C;  2Q67 A;  3K3W A;  1BGY H;  2PI4 A;  1MA1 A;  3CRA A;  4ZOL B;  2X6A A;  2DJV A;  1P84 F;  3OGI B;  2WA3 A;  4DR3 B;  4NXN B;  1HNX B;  2P5O A;  2CTW A;  3ETD A;  3CXC U;  3RGB A;  2EUL A;  1OCO C;  2UXB B;  4ZI7 B;  3JAK B;  1JJO A;  1FFT B;  3D36 A;  4R8C A;  1KC8 W;  1S5J A;  4JAU A;  1KKC A;  1R6N A;  3UKM A;  1ARO P;  1MOF A;  5KAF Z;  3OT7 A;  2ZXW C;  1WLE A;  1BCC H;  1Y67 A;  2JDI G;  2GSM B;  1NJI W;  4PV1 B;  1V54 C;  3FAV A;  4JZ2 A;  2BCC H;  3JCU Z;  3SPG A;  1XMO O;  3DGE A;  3UCS C;  2FTK A;  5IY5 B;  4U7N A;  2ZDI C;  3JAM N;  2YEV A;  2V4D A;  1RM1 B;  1DF4 A;  5JCO A;  1M93 A;  1H2L A;  3BRC A;  1XL6 A;  3QO5 A;  1YJW V;  1YXB A;  3AG3 C;  2GBO A;  2UXC B;  4JI8 B;  4CH6 A;  1GTO A;  1GO3 F;  1FJG O;  4U7O A;  2H8P C;  4LF4 O;  1AI6 A;  3ZMS A;  1VF6 A;  4X89 A;  2LJ2 A;  1FS0 G;  3LDD A;  2QKA A;  3WG7 C;  4Z1V A;  3HKE B;  1K97 A;  4FZ1 A;  2UU9 B;  1DLB A;  4X65 B;  4X20 B;  3IFX A;  5LMU O;  1WJZ A;  4B7K A;  4GX0 A;  4JTA B;  4LWS A;  1XRE A;  5CN0 A;  3K9A A;  1K34 A;  3CCS V;  2IH3 C;  2KG7 B;  2GUZ B;  1AIL A;  4FIP C;  5GTI Z;  1QBZ A;  2OCC B;  3LNM B;  3P32 A;  4PDR A;  3JSN A;  4CH4 A;  1JCH A;  5GW7 A;  5B1B B;  3LNN A;  2IU3 A;  4NXN O;  4DR3 O;  4ZHQ A;  5KA6 A;  5LGT A;  2JJ2 G;  1HNX O;  4OPH A;  4B08 A;  3ASN B;  3TJT A;  2CE4 A;  2ZR2 A;  4HAM A;  1N34 O;  2Y48 A;  4TQF A;  4GKK B;  2UXB O;  1F51 A;  1P4R A;  3APQ A;  4J80 A;  1ZTE A;  1V9P A;  4DW1 A;  1H2G A;  2UXD B;  1WP7 A;  4ZHQ B;  2RN9 A;  3JAW A;  1Z5V A;  1H2K A;  3JSL A;  4QGP A;  3E2E A;  5K1P A;  1VIB A;  3D3Q A;  5J2U A;  1SZX A;  3LDC A;  4H33 A;  2Q6A A;  1JOY A;  4O2A A;  5CA0 A;  1VQ6 V;  3HKC A;  1YTF D;  1KBH A;  4J7Z A;  2OTL V;  4MVR A;  5J2T A;  1PNM A;  3OGC C;  1NH2 D;  4FZ0 A;  2LW1 A;  2EIM C;  3A0R A;  1Q43 A;  3UQ8 A;  2IJK A;  1IBK B;  2CDY A;  1BMF G;  4XBF A;  3LUT B;  4J7J A;  2Q73 A;  1AP6 A;  4N23 A;  3K5O A;  3CMA V;  5CA0 B;  2UXC O;  3AEI A;  5EIB C;  1E79 G;  2Q69 A;  5JCO C;  5CB4 A;  1AP5 A;  4JI8 O;  1CEZ A;  4NKG B;  4PEL A;  4UV9 A;  3VQX A;  1QLE C;  4NTY A;  2JVD A;  1OV9 A;  2ZNI A;  1LR1 A;  4X62 O;  4J10 A;  3NXS A;  2Q0O C;  3ABT A;  2UU9 O;  2YXL A;  4X65 O;  3ZHQ A;  4DR4 B;  5JJE B;  1VF6 C;  4JYC A;  2YXH A;  4JI0 B;  3ZHV A;  2G38 A;  3BA8 A;  5LMN B;  1NTZ H;  3JAL A;  4FM0 A;  4OGQ B;  4MT8 A;  1ZL8 B;  3RYF B;  1I5Y A;  2E76 B;  4R6Z A;  4MVZ A;  3QO8 A;  1PNK A;  5BXZ A;  3BAA A;  2QKC A;  1IDS A;  1KP3 A;  3B77 A;  1PL0 A;  3CCR V;  4F4L A;  3IC9 A;  4IL6 Z;  3L73 H;  1AR1 B;  1LNQ A;  3QTC A;  4F6E A;  4GKK O;  4NR1 A;  1K92 A;  3GWO A;  3AG4 C;  1Y74 B;  2UXD O;  1F4N A;  4TSF G;  1M9N A;  1RSO A;  1BHB A;  2AW9 A;  1RPO A;  2UXN A;  1Y66 A;  3K06 A;  1L0L H;  1AR5 A;  4MSW C;  3QO7 A;  5LA6 B;  2GV9 A;  1LUV A;  4K3A A;  4MVO A;  2EIK B;  2XHB A;  5C8Y A;  1Q6H A;  1GK9 A;  3K0D A;  1H2N A;  2C2A A;  3G80 A;  4DR5 B;  3O65 A;  1TAE A;  1IBK O;  5KHK A;  1IX9 A;  1OCZ B;  2Q4P A;  3P30 A;  5LGN A;  5C8Y B;  2JEX A;  1R6K A;  4K0K O;  3U0Z A;  3LSU A;  3SPH A;  1XNQ B;  1S3J A;  1ENV A;  3B8M A;  2XAF A;  1WB7 A;  2HEP A;  4JTD B;  1MSD A;  1VAR A;  4FJC C;  4DR4 O;  3FYE B;  1MZE A;  2K1E A;  2YIC A;  3E35 A;  4JI0 O;  4DR2 B;  4I4T A;  2WLH A;  2DWE C;  4OPA A;  4BW9 A;  3L9D A;  4GX1 A;  4RO2 A;  1VQL V;  1AB3 A;  1G4Y B;  5B1A B;  2Y69 C;  2X7R B;  3SDL A;  1FPO A;  4OXS A;  4TV9 A;  4QE7 A;  1V55 B;  2ZQM A;  2EIN B;  4UCT A;  5EC1 C;  1TA8 A;  4KUM A;  4LBE C;  2WWW A;  1I5X A;  3JD2 A;  1NI8 A;  3QF7 A;  1KUQ A;  1LUW A;  4FLX A;  4MW3 A;  1IUR A;  5FLX N;  2Q5Z A;  1N32 B;  4EB6 A;  3CC7 V;  3VQW A;  4BWA A;  4YIO A;  5LHI A;  3CD6 V;  1S5L Z;  2ETN A;  1GN3 A;  5LGU A;  3DC6 A;  2QR4 A;  4LP8 A;  1QR9 A;  3RVZ A;  1FAF A;  1Y76 A;  4O4H A;  4JI5 O;  4LF5 B;  2ZIM A;  3T2M A;  4B3M B;  1H2S B;  1BQ0 A;  4R50 A;  2AHZ A;  1SF9 A;  5LXT B;  2WLL A;  4JTC B;  4Q20 A;  1OCC B;  3E8B A;  5H6R A;  2OYQ A;  4RUE A;  2WSS G;  4IYH A;  2QTO A;  3SYQ A;  4O4H B;  2AHY A;  3ZHU A;  3BHP A;  4DR5 O;  4FFK A;  3IGA C;  1XBL A;  2VQE B;  5B1N A;  2E5L B;  2R9R B;  3ASO C;  1Q3E A;  2WLL B;  4XDK A;  3OMN B;  2WA4 A;  5IYC O;  2D3O W;  2UUB B;  2XAG A;  4FLY A;  3OE7 G;  2QA4 V;  1Y6X A;  1F7Y A;  3DTU B;  1XNQ O;  5B5E Z;  2QWQ B;  4AIL C;  3SYO A;  5CA1 A;  2LQT A;  1NKD A;  4I5S A;  4WFH A;  2R72 A;  1MG1 A;  3K57 A;  1M4U A;  2P90 A;  4I55 A;  2YI9 A;  3ZIA G;  3SPJ A;  3ZN0 A;  2A0L A;  4ASU G;  4DR2 O;  3JD3 A;  1AJQ A;  4L87 A;  3THO A;  3CS5 A;  4DK0 A;  1S76 D;  2PY5 A;  2GHY A;  3CPW U;  2HG5 C;  1ZAU A;  3AG2 B;  3E86 A;  4H0L B;  3CRC A;  3EFF K;  3B40 A;  4I55 B;  2HKO A;  3QNE A;  3OTO B;  4HZ3 A;  4O4I B;  1K73 W;  2N05 A;  3AK1 A;  1FYJ A;  2QJ1 A;  1JQ0 A;  5L3F A;  2ZIN A;  3HKB A;  1Q7Y W;  2PI5 A;  3QG5 A;  4GYC B;  4FFB A;  3CWB H;  2ZT9 B;  3K04 A;  3R65 A;  1N32 O;  3SYC A;  4CS4 A;  1RPR A;  4PA9 A;  1Q81 W;  1QVG U;  1GN6 A;  2ITC C;  4LF5 O;  4QPJ A;  3CCE V;  4OX9 B;  4UVA A;  4B3M O;  4FFB B;  2WLJ A;  5JQG A;  2YC0 A;  3K5L A;  4QPK A;  3E8H A;  4CH5 A;  5LP6 B;  1I7F A;  1YJN V;  4X1Y A;  2VQF B;  3OTF A;  4HYO A;  2NN4 A;  2IJH A;  4YJ2 A;  1BS3 A;  4DV3 O;  3LSS A;  1R3I C;  1XEQ A;  2E5L O;  1K3E A;  4LF6 B;  5JQG B;  1HWY A;  1N4C A;  1E1Q G;  4MTF A;  3MDS A;  2UUB O;  1EN4 A;  2IW5 A;  1BSM A;  1JJ2 U;  1MAB G;  1YSC A;  4O2B B;  2NR5 A;  4ABM A;  4HNA A;  2O57 A;  3S3X A;  1IXB A;  1QQC A;  2P4K A;  2WPD G;  4TUY A;  4BR6 A;  1BE3 H;  1XNR B;  3X2Q C;  4E2L A;  4MVM A;  4IIJ B;  4X9Q A;  2K9P A;  2X0L A;  4HNA B;  5B1O A;  4ZKI A;  4UCV A;  2JS5 A;  1K7D A;  2AZ2 A;  1JMK C;  3ZHT A;  2AXT Z;  1VP7 A;  1L8D A;  3EHB B;  2X6B A;  2RMK B;  2CTP A;  2UUA B;  3JAK A;  1ZUQ A;  3STL C;  3D3I A;  3AK2 A;  3F5W C;  3OR7 C;  1N34 B;  1JVM A;  1M1K W;  4LF9 B;  1XDC A;  2MK3 A;  2WLK A;  3JAR B;  4OX9 O;  5LBQ A;  1BT8 A;  5KHG A;  1W59 A;  4CBC A;  1D2D A;  3K5M A;  1EN6 A;  5BY1 A;  2QM8 A;  4DV0 B;  4FLZ A;  4GX2 A;  2VQF O;  1NVP B;  4LFA B;  3RYI A;  4W4L A;  1VQP V;  2F95 B;  3K0G A;  4MVS A;  4LF6 O;  4FMT A;  3ABM C;  3KG2 A;  1IVS A;  5KLV H;  3EVK A;  5ITZ A;  1NBM G;  3JAT A;  3PN1 A;  1YCI A;  3G67 A;  3HKE A;  2JK5 C;  2RQ6 A;  1AI4 A;  4X20 A;  4DUY B;  3RYI B;  3Q4H A;  4JV5 O;  5L3E A;  1PP9 H;  4NYK A;  1CXZ B;  1P7G A;  4UB8 Z;  2Q7G A;  2EIJ C;  1QNM A;  2IJJ A;  1H2M A;  2ZKO A;  3JYC A;  2KG7 A;  5ITZ B;  2GUZ A;  3JAT B;  1J5E O;  4X62 B;  4JAS A;  2ODM A;  3TET A;  4PI2 A;  2AGA A;  4XDJ A;  2DMX A;  1EFR G;  3Q4H B;  1XNR O;  1S0V A;  1HW7 A;  3SGI A;  2BOC C;  4C7U A;  2ITD C;  2P7T C;  1IZ3 A;  4WFG A;  1N33 B;  3I56 V;  3FKS G;  5IYZ B;  3ZBH A;  3G6B A;  3MAQ A;  3H9V A;  3E8F A;  4FLW A;  3IC7 A;  4K35 A;  5KAI Z;  3SYP A;  2F43 G;  3BA9 A;  5L3C A;  2V7Q G;  3FD9 A;  5HFL A;  2UUA O;  5E79 Z;  3ZRW A;  3OAA G;  1R1B A;  1R3J C;  1NZ6 A;  1P7B A;  2CAZ C;  2ADQ B;  2V1D A;  3ZRS A;  3VOU A;  3K58 A;  3H1I H;  2PTM A;  4I50 A;  4LF9 O;  4JZG A;  3ZRW B;  2GDS A;  5D5P A;  1QU7 A;  2HHH B;  4RUF A;  3RWR D;  3N2K A;  1SET A;  5KX5 A;  5A2Q N;  5IJ9 B;  1FXV A;  5FPR A;  2DYS B;  3D36 C;  4D7T A;  2M7W A;  5IY5 C;  3A8T A;  4O4J A;  4I50 B;  4DV0 O;  2P22 C;  3QVN A;  1FXK B;  4LFA O;  4RQF A;  4D7S A;  1RFY A;  1RM1 C;  3SR2 C;  3N2K B;  5KX5 B;  2HFE C;  4FM2 A;  3OUF A;  4UFZ A;  4I0X B;  5LYJ A;  3HB3 B;  1KKD A;  3GVM A;  2JEU A;  2W6I G;  5A9G A;  2F4V B;  1YVW A;  4O4J B;  1ORQ C;  2F1M A;  4DUY O;  1VQ4 V;  3CE2 A;  2DWD C;  2PYL A;  4Z2W A;  1O9G A;  1W2B U;  4K0K B;  1DGS A;  5LYJ B;  3WB0 A;  2RNB A;  3DXR B;  5L3G A;  3E8G A;  1ZL8 A;  5H6Q A;  3RYF A;  3OMA B;  3KZI Z;  2DW4 A;  4DV5 B;  3CC4 V;  3CCL V;  2MW2 B;  2BSK A;  4QIW F;  2LGW A;  3W7W A;  3T1Y B;  1VQO V;  2CK3 G;  1G6U A;  3N2G B;  5IJ0 B;  3JD0 A;  1WA8 A;  2CTQ A;  2B1I A;  5D5Q A;  1N33 O;  4DV1 B;  1URF A;  2OCC C;  3E83 A;  2EIL B;  3G6E V;  4JI4 B;  3ZS8 C;  2A9H A;  1VQ7 V;  5B1B C;  2BSK B;  3ML0 A;  3CJH B;  3W7T A;  5FL7 G;  2E3C A;  3SJQ C;  2B1G A;  4R7C A;  3IJ4 A;  1WA8 B;  1HR0 B;  1Y74 A;  4MVQ A;  1SC5 B;  1DF5 A;  5LOV A;  1B06 A;  4GKJ B;  4PA4 A;  3BEH A;  1PV0 A;  1H38 A;  2ARH A;  5CA3 A;  4B3R B;  4ZIB A;  4WCE V;  1CPY A;  5LA6 A;  4P2Z A;  1AVM A;  2HHH O;  4QNH B;  3TXQ A;  1PNL A;  5JVD A;  1N0N A;  5CBG A;  3P3N A;  1K4C C;  2DYR B;  5LOV B;  1YI2 V;  1YIJ V;  4JI5 B;  3ABU A;  2E75 B;  3HR0 A;  4MTG A;  1QR8 A;  4FLT A;  4W4K A;  3BAB A;  1D5N A;  2Q7H A;  2BTQ B;  2IU0 A;  1SQQ H;  1JX9 A;  4DW0 A;  2Q9L A;  5JVD B;  2JGD B;  4X1I A;  4WBN A;  5IDJ A;  3TCU A;  4DR7 B;  1ZX3 A;  4JYA B;  4CC6 A;  4O4L B;  4PA7 A;  1SQV H;  2F4V O;  1XMQ B;  4MVU A;  2JGU A;  4DR6 B;  2N74 A;  3CC2 V;  1M57 C;  4X66 B;  3ZED A;  4FLU A;  4X1I B;  4WBN B;  2LO1 A;  2RDC A;  3RYH A;  4LF8 B;  1YZB A;  4PJ0 Z;  4D6T H;  1H8H G;  1HNZ B;  4IHJ B;  4DV5 O;  4JAV A;  4RQE A;  3O9O A;  4JF3 A;  3T1Y O;  3H1H H;  5EK0 A;  3RYH B;  1AI5 A;  4LNU A;  4DV1 O;  1VQN V;  4JI4 O;  3ABL B;  4DV4 B;  2KB1 A;  1KMI Z;  5EBM C;  1RP3 B;  1FXH A;  3B8N A;  3ETG A;  3FB5 C;  1JR9 A;  2Q0A A;  1HR0 O;  2WLI B;  1KEC A;  1PPJ H;  2HR3 A;  4LNU B;  3RW0 A;  2QM4 A;  3TGU H;  3T1H B;  4J41 A;  5B66 Z;  4JPR A;  3ZMZ A;  5TIS Z;  4GKJ O;  3CP1 A;  2IH1 C;  3BPZ A;  3ABK B;  1WN7 A;  4B3R O;  1N36 B;  5LXT A;  1A32 A;  1XHX A;  4MW8 A;  1EBO A;  2OWO A;  3OMI B;  4NVP A;  5LL6 Y;  2QDO A;  1GM7 A;  3APO A;  3GB7 C;  3ZJZ A;  2EIK C;  4H13 B;  4J42 A;  2DQ0 A;  2HJF C;  1QVF U;  4GCZ A;  1Q6U A;  2L35 A;  1MSW D;  1TGO A;  4DUZ B;  4Z1M G;  1FFX B;  3H01 A;  2ZD9 A;  5B3S B;  4DV6 B;  4DR7 O;  3JD1 A;  1OCZ C;  4JYA O;  3FB8 C;  2EZP A;  1QHT A;  5DED A;  1I94 B;  3TXS A;  4WF9 V;  1XMQ O;  1Q6I A;  4DV3 B;  2CGO A;  2LFR A;  3SJB C;  4DR6 O;  4RWU A;  2KKW A;  1VQM V;  4LFB B;  1YF2 A;  4I7Z B;  4X66 O;  4JI6 B;  1YEW A;  4LF8 O;  1SQX H;  4AQY B;  1EZV H;  2QWO B;  2KQX A;  1WNS A;  2BTO A;  2A7W A;  1VEW A;  1HNZ O;  4YJ3 B;  1WP8 A;  1X4T A;  1SQB H;  2HVK C;  1Z2G A;  2PUS A;  4I9W A;  1SRY A;  1D5A A;  1OJH A;  1YJ9 V;  2BE3 A;  1Q8I A;  4O4I A;  1ZWI C;  2H3O A;  1ZSP A;  3NR7 A;  4RAI A;  5B1A C;  4DRX A;  4DV4 O;  1OCR B;  4FPP A;  1Z5W A;  1V55 C;  4LF7 B;  4UCO A;  2NNU A;  2EIN C;  4YY3 B;  3C3S A;  3UT5 B;  1Y4M A;  2UXX A;  2QM7 A;  5H2F Z;  1JFF B;  2FL4 A;  4BW5 A;  4DXW A;  1NVP D;  3F5T A;  3K9S A;  3T1H O;  3F7Y C;  4DRX B;  3SPI A;  4DYL A;  4U3J A;  1VQ5 V;  4JI1 O;  1TUE B;  3RN4 A;  2ZM6 O;  4UV8 A;  1N36 O;  3X2Q B;  4JYY A;  4WFF A;  3WB1 A;  5HFM A;  3B2E E;  5EC2 C;  5LP6 A;  1VQ9 V;  2QSA A;  1NS1 A;  1O9H A;  1DTO A;  4U3J B;  4B3S B;  1OCC C;  3EXA A;  1TUB A;  4I9Q A;  4NTW A;  1TVK B;  4DUZ O;  1M56 B;  1SES A;  2EJR A;  4X64 B;  2LGQ A;  1NTM H;  4DV6 O;  1DK1 A;  1OHH G;  3RYC B;  4GUN A;  4X1K B;  4O2B A;  2Q8V A;  2YIA A;  4JI7 B;  2HJD A;  4N21 A;  1I94 O;  4JI3 B;  1TUB B;  1OCO B;  2N04 A;  5EIB D;  1JPX A;  4LFB O;  2H94 A;  3T1C A;  1VQK V;  4UVC A;  3STZ C;  4JI6 O;  2ZDI A;  5KHJ A;  5IYD O;  2ZXW B;  1QLN A;  5LHG A;  4AQY O;  1U96 A;  3E89 A;  1HDJ A;  3L75 H;  2HP8 A;  4JV5 B;  2UUC B;  3LSQ A;  2D2C B;  3D8C A;  3JAS B;  4IIJ A;  1Q86 W;  1K8A W;  1V54 B;  5BMV A;  3CX5 F;  1PD3 A;  3KCX A;  5K1X A;  1GM8 A;  3OEH G;  1J5E B;  2P06 A;  3SPC A;  4MS2 A;  4NB5 A;  3AG2 C;  3F7V C;  1I0H A;  2LFS A;  2XAH A;  4AHC A;  4QE9 A;  4P9O A;  4J9Y B;  2LW7 A;  4LF7 O;  5BMV B;  4YY3 O;  3P3P A;  4BAY A;  3AG3 B;  4PHZ A;  2QWN B;  2OIE A;  3JD4 A;  4K8Z A;  1HNW B;  2VWJ A;  4TWK A;  1F23 A;  3K03 A;  4KL1 A;  4UCU A;  3WG7 B;  3K5N A;  4YIP A;  3JAR A;  2QWR B;  2Z0A A;  2YI8 A;  4GLX A;  4GZR B;  4GT1 A;  1GRJ A;  3U10 A;  1MNG A;  2ZE6 A;  2YIB D;  5F2V O;  2OIG A;  4E4E A;  2W0X A;  3OD4 A;  1PM9 A;  4B3S O;  5LP6 C;  5JWP A;  4IT5 A;  3ZX6 A;  4JI2 B;  1GM9 A;  1NT2 B;  4K8X A;  1S5H C;  1EZJ A;  4X8A A;  2L6L A;  3HKD A;  4X64 O;  1VQ8 V;  2CH7 B;  2PZS A;  5EZY A;  3LDE A;  4G28 B;  1XQ8 A;  1R3L C;  4JI7 O;  4J9Z B;  4JI3 O;  3CXH F;  3ICX A;  1SQG A;  1BQZ A;  2OTJ V;  2XUM A;  2FYU H;  3BY6 A;  4CC5 A;  1COW G;  1KYO F;  4KP4 A;  2RJZ A;  3G4S V;  3ZMV A;  2ZE8 A;  4MTO A;  1KQS U;  1B6Q A;  3ETQ A;  3HKD B;  3I5D A;  3CHX A;  5EZY B;  4UUJ C;  1KU9 A;  2UUC O;  1H8E G;  5AG2 A;  3AG1 C;  2JIZ G;  2QWP B;  3UM7 A;  5IYZ A;  1VF7 A;  4DR1 B;  2X6C A;  2XAQ A;  1FKA O;  3CCU V;  4WFB V;  2R9I A;  4LH6 A;  2PGG A;  3FAV B;  1KD1 W;  2EIM B;  4LFC B;  3KKY A;  2JJ1 G;  1T5E A;  4DV2 B;  2EX3 A;  2YEV B;  1BZK A;  1K5Q A;  3RBZ A;  1OZ0 A;  2QKS A;  4ICG A;  2A79 B;  5J9P C;  4LC1 A;  4CS3 A;  5IT9 N;  1HNW O;  3KCY A;  4WFE A;  1QLE B;  3RT3 C;  3ZCC A;  3I55 V;  4QJF B;  2RCV A;  3CCM V;  2HLD G;  5IJ9 A;  3WU2 Z;  4YXW G;  3VBB A;  3WB2 A;  2WLM A;  5JH7 A;  3ZMU A;  1JA8 A;  2WAM A;  3TK1 A;  1FXK A;  5KMG A;  4IGG A;  5FPO A;  4GX5 A;  1EM1 A;  4LWS B;  2F93 B;  4I0X A;  1PKX A;  4FK5 C;  4JI2 O;  1G8M A;  2WLN A;  2B9Z A;  1NQT A;  5JH7 B;  2Y0P A;  2M6Y A;  3OR6 C;  5IYB O;  3CSX A;  2YIB A;  1S77 D;  2DQ3 A;  3A0B Z;  4EEQ A;  5KMG B;  1KB9 F;  1W0K G;  2DN9 A;  4NTX A;  5KUM A;  3W7X A;  3DXR A;  4X88 A;  3CME V;  1WPX A;  4IYI A;  3AG4 B;  5H5N A;  1NR7 A;  2A06 H;  1L0N H;  1YIT V;  1PL4 A;  3MD0 A;  3FB7 C;  3N2G A;  5IJ0 A;  1XHZ A;  1F4M A;  4DR1 O;  3JAW B;  1E1R G;  2ATK C;  2GTA A;  3RFR A;  3B4S A;  2Z3Y A;  4TOI A;  3W7S A;  3K08 A;  5J2U B;  4G2K A;  2B5U A;  3SJC C;  1WPB A;  3CJH A;  4O2A B;  2YID A;  4WFA V;  3HKC B;  4LFC O;  3CRM A;  4FVM A;  1WAZ A;  4DV2 O;  5J2T B;  1M57 B;  4JYB A;  2YSU B;  1GKF A;  1J95 A;  4YHH B;  1VMG A;  3M99 B;  3FYI B;  4B7E A;  5CB4 B;  3ASN C;  3FFQ A;  3H1K H;  1L1F A;  5KUK A;  5FNV A;  4KHP B;  3J80 N;  2KSD A;  4G27 B;  1UJW B;  1THZ A;  3ZMT A;  3R66 A;  2BTQ A;  2DYS C;  4LH7 A;  3T4D A;  3BCC H;  5EBL C;  2Y69 B;  2JGD A;  2CTR A;  2YXY A;  1IBM B;  3JAL B;  1IBL B;  1HP8 A;  5FNV B;  1FXK C;  4P9P A;  4DK1 A;  1X59 A;  4O4L A;  1BHA A;  1M90 W;  5EYP A;  3VQV A;  2P67 A;  3OEE G;  4PDL A;  4DV7 B;  5CBH A;  5DEC A;  3AG7 A;  1YDX A;  4J11 A;  1EN5 A;  2W6J G;  3T4Z A;  3CCJ V;  4IHJ A;  2VRZ A;  5EYP B;  1R6T A;  1W0J G;  1GAX A;  4CH3 A;  5H9C A;  1Q90 D;  3H1J H;  2F23 A;  2ZNJ A;  1XL4 A;  1Q5O A;  2GTS A;  4TQD A;  1XOU A;  2XOK G;  1RSO B;  3ZRX A;  1SER A;  1GMG A;  2R9A A;  2XAJ A;  3VQY A;  2XND G;  3JCZ A;  5JJN B;  3ETE A;  2XT9 A;  3CRQ A;  3K79 A;  2EIL C;  1UPG A;  2IM9 A;  1UFI A;  2WLI A;  2DOS A;  2Y0I A;  4LCU C;  5EBW C;  1WB8 A;  3ASO B;  5GON A;  3M8A A;  5IWA B;  5C93 A;  1M5I A;  2IJI A;  1IXM A;  4UVB A;  4YHH O;  5CBF A;  1NU1 H;  2EJ7 A;  1CP9 A;  4NXM B;  3L71 H;  1I08 A;  3RVY A;  2LP7 A;  3N27 A;  1YTF B;  4MTX A;  4TV8 A;  5GON B;  5LMN O;  2PYJ A;  3SJA C;  4L8J A;  4KHP O;  5KHH A;  4CS2 A;  4JI1 B;  1NH2 B;  1GN4 A;  3C3T A;  2ZM6 B;  2P4V A;  3DC5 A;  5BR8 B;  2DYR C;  1FFX A;  4I4T B;  5E1A C;  4TV8 B;  1IBM O;  2VWK A;  1U97 A;  1IBL O;  1SZT A;  1R73 A;  5KA5 A;  3E22 A;  3SYA A;  2Q68 A;  1B3Q A;  5CMU A;  4LR3 A;  1K5S A;  5BZB A;  4TV9 B;  1US6 A;  2CUG A;  4DV7 O;  2A3Q A;  2E74 B;  4A5U B;  3MHH C;  1TVK A;  4FM1 A;  3E22 B;  4YJ3 A;  4AI8 A;  2YUA A;  1B04 A;  3BFR A;  4EB6 B;  4KXR A;  2YS8 A;  4J7K A;  1MMM A;  2QEX V;  2DE0 X;  1Y76 B;  3FX7 A; 
#chains in the Genus database with same CATH homology
 1BHB A;  4BAY A;  1RPO A;  1QCE A;  2V1D A;  2UXN A;  3AG3 B;  1Y66 A;  3K06 A;  3ZRS A;  3VOU A;  4PA6 A;  3ABL C;  4MSW C;  3QO7 A;  3JD4 A;  2W0F C;  4MVO A;  4TWK A;  2EIK B;  3ZRW B;  1F23 A;  3K03 A;  1GK9 A;  3WG7 B;  3K0D A;  4RUF A;  1SET A;  5L3B A;  2HVJ C;  2Z5U A;  2C2A A;  1FXV A;  3MHS C;  2BOB C;  4GT1 A;  2DYS B;  1Q82 W;  2M7W A;  5IY5 C;  4H37 A;  1OCZ B;  3P30 A;  5LGN A;  1FXK B;  1N8R W;  4RQF A;  2JEX A;  1R6K A;  1RM1 C;  3ABK C;  4ZBM A;  1K33 A;  2HFE C;  3OFN G;  3SPH A;  3OUF A;  1S3J A;  1ENV A;  1AJN A;  3HB3 B;  4JGS A;  1KKD A;  3B8M A;  2XAF A;  2JEU A;  2W6I G;  1GM9 A;  4JTD B;  5DM6 V;  1S5H C;  5L3D A;  4FJC C;  1EZJ A;  4X8A A;  3FYE B;  3CCQ V;  3FB6 C;  1ORQ C;  2K1E A;  1VQ4 V;  1VQ8 V;  3E35 A;  2DWD C;  3LDE A;  2WLH A;  4G28 B;  2DWE C;  1W2B U;  1R3L C;  4J9Z B;  2OTJ V;  5L3G A;  3E8G A;  3BY6 A;  4GX1 A;  5H6Q A;  1COW G;  3OMA B;  4RO2 A;  1VQL V;  5B3S C;  2DW4 A;  1G4Y B;  2Y69 C;  4KP4 A;  2X7R B;  2ZR3 A;  5B1A B;  2OT5 A;  3ZMV A;  4MTO A;  3G4S V;  1B6Q A;  3CCL V;  4OXS A;  1KQS U;  3G71 V;  4QIW F;  4QE7 A;  1V55 B;  4BIZ A;  3W7W A;  2ZQM A;  1VQO V;  2CK3 G;  2EIN B;  4UUJ C;  5EC1 C;  3JD0 A;  4KFM A;  4UXN A;  1H8E G;  2B1I A;  4KUM A;  4LBE C;  2WWW A;  3AG1 C;  2JIZ G;  1I5X A;  3JD2 A;  2OCC C;  3E83 A;  2EIL B;  3OW2 U;  3G6E V;  3OUS A;  3W7U A;  3UM7 A;  1YHQ V;  2A9H A;  2X6C A;  2XAQ A;  1VQ7 V;  1K9M W;  4MW3 A;  1R3K C;  3CCU V;  4WFB V;  5B1B C;  3ML0 A;  3CC7 V;  2R9I A;  5LHI A;  3W7T A;  3CD6 V;  5FL7 G;  4XDL A;  3SJQ C;  5LGU A;  2B1G A;  4R7C A;  1K4D C;  4LP8 A;  1KD1 W;  2EIM B;  1QR9 A;  3RVZ A;  4EKW A;  2JJ1 G;  1AI7 A;  3ZN1 A;  4MVQ A;  1DF5 A;  2YEV B;  3T2M A;  3HPL C;  1K5Q A;  3RBZ A;  1OZ0 A;  4PA4 A;  2QKS A;  3BEH A;  2A79 B;  2QE7 G;  4R50 A;  5J9P C;  2EBO A;  3CCV V;  2AHZ A;  1H38 A;  4LC1 A;  5CA3 A;  1OCR C;  2WLL A;  4JTC B;  4Q20 A;  1QLE B;  4WFE A;  1OCC B;  4WCE V;  1CPY A;  1S72 V;  4P2Z A;  1NR1 A;  3E8B A;  3ZCC A;  4PDM A;  5H6R A;  3ABM B;  4QNH B;  4RUE A;  2WSS G;  3I55 V;  1PNL A;  4QJF B;  5CBG A;  2QTO A;  3SYQ A;  3WFV A;  1KP2 A;  2AHY A;  5DN6 G;  3CCM V;  1K4C C;  2HLD G;  3CC4 V;  2DYR B;  3IGA C;  4YXW G;  3VBB A;  1YI2 V;  1YIJ V;  5B1N A;  3ABU A;  2WLM A;  2XAS A;  3PJS K;  4P30 A;  4DO2 A;  4CZZ A;  2R9R B;  3ZRV A;  3ASO C;  3AG1 B;  2WLL B;  4MTG A;  2NLJ C;  4XDK A;  3ZMU A;  1QR8 A;  3OMN B;  4BIU A;  5IYC O;  2WAM A;  2D3O W;  3TK1 A;  1BL8 A;  2EIJ B;  4TT3 G;  2IU0 A;  1FXK A;  2XAG A;  1JX9 A;  3OE7 G;  2QA4 V;  1AJP A;  4GX5 A;  3DTU B;  2P6J A;  5IDJ A;  3TCU A;  3OM3 B;  3SYO A;  1PKX A;  4FK5 C;  1NKD A;  4PA7 A;  4I5S A;  1G8M A;  2WLN A;  4WFH A;  1NQT A;  4MVU A;  3OR6 C;  5IYB O;  1MG1 A;  1S77 D;  2EZO A;  5LHH A;  2DQ3 A;  2P90 A;  4PDV A;  1ROP A;  3ZIA G;  3CC2 V;  3SPJ A;  1M57 C;  3ZN0 A;  2A0L A;  4ASU G;  3JD3 A;  4PA3 A;  3CYO A;  1AJQ A;  4L87 A;  1W0K G;  1M56 C;  2Q67 A;  1S76 D;  3K3W A;  2PI4 A;  5KUM A;  2GHY A;  1H8H G;  3CPW U;  3W7X A;  2X6A A;  2HG5 C;  4X88 A;  3AG2 B;  3E86 A;  3CME V;  1WPX A;  3EFF K;  3AG4 B;  1NR7 A;  4JAV A;  3ETD A;  4RQE A;  3CXC U;  2HKO A;  3QNE A;  4HZ3 A;  4JF3 A;  1K73 W;  1OCO C;  5EK0 A;  1YIT V;  3MD0 A;  1JQ0 A;  3FB7 C;  3D36 A;  1FFT B;  4R8C A;  5L3F A;  1AI5 A;  1Q7Y W;  2PI5 A;  1KC8 W;  1VQN V;  4JAU A;  1R6N A;  3ABL B;  1F4M A;  3UKM A;  1ARO P;  2KB1 A;  1E1R G;  2ATK C;  1MOF A;  5EBM C;  2ZXW C;  1WLE A;  2JDI G;  3K04 A;  1FXH A;  3B8N A;  2GSM B;  2Z3Y A;  3R65 A;  3W7S A;  3K08 A;  3ETG A;  1NJI W;  4G2K A;  2B5U A;  3FB5 C;  3SYC A;  1V54 C;  2WLI B;  4WFA V;  1RPR A;  3SPG A;  3DGE A;  1KEC A;  2HR3 A;  2FTK A;  3RW0 A;  5IY5 B;  4PA9 A;  1Q81 W;  1QVG U;  4U7N A;  4JPR A;  2ITC C;  2ZDI C;  4QPJ A;  3ZMZ A;  3CCE V;  1M57 B;  4UVA A;  3CP1 A;  2YEV A;  4JYB A;  2IH1 C;  2WLJ A;  1RM1 B;  1DF4 A;  3ABK B;  2YSU B;  1GKF A;  1J95 A;  4QPK A;  3E8H A;  3M99 B;  4MW8 A;  1EBO A;  1XL6 A;  3FYI B;  3QO5 A;  1YJN V;  1YJW V;  3AG3 C;  3OMI B;  3ASN C;  4HYO A;  1GTO A;  1GO3 F;  2IJH A;  1GM7 A;  4U7O A;  2H8P C;  1L1F A;  3GB7 C;  3ZJZ A;  1AI6 A;  3LSS A;  1R3I C;  3ZMS A;  5KUK A;  1K3E A;  4X89 A;  1FS0 G;  1HWY A;  2EIK C;  3LDD A;  4G27 B;  3WG7 C;  2DQ0 A;  2HJF C;  1E1Q G;  4GCZ A;  1UJW B;  1QVF U;  1THZ A;  4MTF A;  3ZMT A;  1K97 A;  1MSW D;  4Z1M G;  1DLB A;  3H01 A;  2IW5 A;  2DYS C;  1JJ2 U;  3T4D A;  1MAB G;  1YSC A;  2ZD9 A;  5B3S B;  3IFX A;  2Y69 B;  5EBL C;  3JD1 A;  1OCZ C;  4GX0 A;  4JTA B;  3FB8 C;  2EZP A;  5CN0 A;  1FXK C;  4P9P A;  4WF9 V;  3K9A A;  1K34 A;  3CCS V;  1BHA A;  2IH3 C;  2LFR A;  1M90 W;  4FIP C;  1VQM V;  2WPD G;  1QBZ A;  2OCC B;  3LNM B;  3P32 A;  4PDR A;  2P67 A;  3OEE G;  4PDL A;  5CBH A;  1JCH A;  5GW7 A;  3X2Q C;  4E2L A;  4MVM A;  5B1B B;  2IU3 A;  2X0L A;  2HVK C;  2W6J G;  4I9W A;  5B1O A;  4ZKI A;  5KA6 A;  3T4Z A;  1SRY A;  5LGT A;  3CCJ V;  2JJ2 G;  3ASN B;  1K7D A;  2ZR2 A;  4HAM A;  1W0J G;  1YJ9 V;  5H9C A;  2Y48 A;  1ZWI C;  1F51 A;  3EHB B;  2X6B A;  1P4R A;  1XL4 A;  4RAI A;  5B1A C;  2XOK G;  3ZRX A;  1SER A;  1OCR B;  1H2G A;  4FPP A;  3STL C;  1GMG A;  1V55 C;  2XAJ A;  3D3I A;  2NNU A;  2EIN C;  2XND G;  3JCZ A;  3E2E A;  3F5W C;  1Y4M A;  3ETE A;  2UXX A;  2QM7 A;  3OR7 C;  3K79 A;  2EIL C;  3LDC A;  4TSF G;  4H33 A;  1JVM A;  2Q6A A;  1M1K W;  1JOY A;  4BW5 A;  4DXW A;  1NVP D;  2WLI A;  1VQ6 V;  1YTF D;  3F7Y C;  2MK3 A;  2WLK A;  4LCU C;  5EBW C;  3ASO B;  3SPI A;  2OTL V;  4MVR A;  1VQ5 V;  5C93 A;  1PNM A;  3OGC C;  1NH2 D;  1TUE B;  5LBQ A;  2IJI A;  1IXM A;  4UV8 A;  2EIM C;  3A0R A;  4UVB A;  4CBC A;  3X2Q B;  5CBF A;  2IJK A;  1CP9 A;  4WFF A;  1BMF G;  4XBF A;  5HFM A;  3LUT B;  5EC2 C;  2QM8 A;  4N23 A;  3CMA V;  1VQ9 V;  3RVY A;  2LP7 A;  4GX2 A;  1NVP B;  3AEI A;  1E79 G;  2Q69 A;  1YTF B;  4MTX A;  1CEZ A;  1DTO A;  4PEL A;  1VQP V;  4UV9 A;  3K0G A;  4MVS A;  1QLE C;  1OCC C;  1NH2 B;  4FMT A;  3ABM C;  3KG2 A;  3NXS A;  1M56 B;  1NBM G;  1SES A;  3ABT A;  2JK5 C;  2EJR A;  4JYC A;  1AI4 A;  2DYR C;  5E1A C;  1OHH G;  5L3E A;  4N21 A;  1SZT A;  4MT8 A;  1R73 A;  5KA5 A;  2EIJ C;  1OCO B;  3SYA A;  1I5Y A;  2IJJ A;  2Q68 A;  1JPX A;  3JYC A;  4R6Z A;  4MVZ A;  5CMU A;  3QO8 A;  1K5S A;  2H94 A;  5BZB A;  3T1C A;  1VQK V;  4JAS A;  4UVC A;  3TET A;  1PNK A;  3STZ C;  2ZDI A;  4XDJ A;  5IYD O;  2ZXW B;  1EFR G;  1QLN A;  1KP3 A;  5LHG A;  3B77 A;  3E89 A;  1S0V A;  1PL0 A;  2BOC C;  3CCR V;  2ITD C;  2P7T C;  4F4L A;  3LSQ A;  4WFG A;  3MHH C;  3I56 V;  1Q86 W;  1K8A W;  3FKS G;  1V54 B;  1AR1 B;  1LNQ A;  1PD3 A;  3E8F A;  3IC7 A;  3SYP A;  2F43 G;  5L3C A;  1GM8 A;  3OEH G;  3SPC A;  4MS2 A;  2V7Q G;  5HFL A;  3AG2 C;  3F7V C;  2LFS A;  1K92 A;  3ZRW A;  3GWO A;  3OAA G;  3AG4 C;  1R3J C;  2XAH A;  2QEX V;  4QE9 A;  4P9O A;  4J9Y B;  1F4N A;  1P7B A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...