4UB8Z

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 25
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4ub8Z00
3JCUZ 1S5LZ 3KZIZ 3A0BZ 5KAFZ 5TISZ 2AXTZ 4IL6Z 5GTIZ 4UB8Z 5E79Z 5GTHZ 5B66Z 3A0HZ 5KAIZ 4PJ0Z 5H2FZ 4UB6Z 3WU2Z 5B5EZ
chains in the Genus database with same CATH superfamily
5B3SB 1NTMH 1TA8A 3L72H 2RQ6A 1FS0G 4MTXA 4WFBV 3VQYA 4FM1A 4ZI7B 3JAWB 4ABMA 1SQBH 3K5MA 5B1BB 1PP9H 5EYPB 2PUSA 4H44B 4O4LA 4JV5B 2UXBB 3BPZA 3T4DA 1VARA 4LNUB 1PNLA 3SYAA 2ADPA 1SQVH 3E22A 5K1XA 2D2CB 3K5NA 2CUGA 3WG7C 5BZBA 2WA3A 3CSXA 4AILC 1KQSU 5FLXN 1WN7A 1Q86W 5LMUO 1IBKB 2ILMA 2ZXWC 3UQ8A 1WAZA 1OCRC 1QR8A 3DSQA 4I5SA 2DQ3A 2YUAA 3T1YO 1MG1A 2IJKA 4J10A 2W0FC 2KQXA 3I55V 4JI1O 1I5YA 1XMQO 1IX9A 3ICXA 5JVDA 2AZ0A 4BIUA 4GT1A 5BXZA 3JATB 4QNHB 5CMUA 5JJNB 1F23A 2ODMA 4CBCA 4YY3B 2OIEA 1BHBA 1SC5B 1ZL8A 2WLMA 2IJIA 1Q81W 5LA6B 3SYPA 1AVMA 1WP8A 3UM7A 4L8JA 3ZMSA 4U7NA 1DK1A 4QPKA 3D3QA 4KUMA 1H2KA 5H9CA 3KG2A 5D5QA 1J95A 1RSOB 4IGGA 3ETQA 3LNMB 2XHBA 2EJ7A 3AG1C 1AJNA 4DK1A 5H5NA 4MTOA 4GKJO 2QKAA 1K7DA 5JCOC 5J2UB 2Y0IA 4NVPA 4GYCB 2WLIB 3OR6C 4QJFB 3ZIAG 2L35A 3RYCA 4TV8B 4TWKA 3CHXA 3L70H 1MA1A 5DN6G 2QWQB 2WLJA 4B3TB 3DGEA 2RDCA 3K5LA 3BAAA 3HKDB 4O4JA 1WB8A 3OW2U 4NTYA 2YXLA 4D7SA 1H8EG 1PPJH 4P30A 3CMAV 3TETA 5L3DA 2QM8A 2F43G 4JI6B 2UXBO 2GTAA 3RVYA 4B7KA 3B4SA 3JYCA 4ASUG 4E4EA 2B1GA 4OPHA 3E83A 1KU9A 1D5AA 2H8PC 2HR3A 2JK5C 1H38A 4O4HB 5H2FZ 4R8CA 3BVOA 1T5EA 3M99B 1IURA 3CCJV 3ZJZA 3ETDA 1YITV 5BR8B 3QVNA 2DQ0A 3L74H 2F1MA 1JFFA 1ZAUA 3UO3A 2H3OA 3SPCA 5LHIA 1KP2A 4JAVA 4PA7A 3C3TA 1NBMG 4JZGA 2UXNA 1VF6C 1SQPH 3J80N 4FJCC 2YXYA 2IU3A 4I4TB 4RWUA 1XHZA 3T2MA 4RO2A 1TVKB 1YHQV 4DR2B 2QKCA 4YY3O 1HNXB 4FLTA 2F66C 1IZ3A 3QO5A 1BE3H 2BSKA 2A7WA 3SGIA 2YXHA 4FFKA 1R6TA 5KX5B 1XI1A 2HP8A 4EEQA 4HBNA 4OPAA 4MVSA 2HHHB 1BSMA 1K33A 1MSWD 3EFFK 3G6EV 4I50A 3UT5B 1JR9A 1ROPA 2IM9A 2E3CA 5CA3A 4IYIA 3W7UA 5B1NA 2JRIA 5IYCO 4GCZA 1SESA 4GX2A 2WLKA 4FFBA 4YHHO 4DW1A 2Q68A 4DRXB 4X66B 1URFA 1OCCB 3BY6A 3E8FA 3BABA 3WB2A 5IY5B 4IIJB 4WFGA 2E76B 4FPPA 4YJ3A 2ARHA 1M5IA 1S0VA 4X1KB 4X88A 1BGYH 3ZHQA 3I5DA 4U3JA 3FB5C 3LUTB 2DN9A 1FPOA 3B77A 4BW5A 2CTRA 5KHGA 3ABMB 2EIJC 1FAFA 1WB7A 4MW8A 5GTHZ 5JH7B 3Q4HB 3N27A 2G38A 3RT3C 3AK2A 4J9ZB 2PGGA 1AROP 4DV6B 2WA4A 3D3IA 2BOCC 3GVMA 4LCUC 4DR5B 1S77D 4O4IA 4BW9A 4F6RA 4JAUA 2EINC 2WLLA 4U7OA 5JWPA 5BR8O 3ZHSA 1GN6A 3JALB 1OV9A 1K73W 4DR6O 1HR0B 3RYHB 5H6RA 1MZFA 2IH1C 4ZOLB 1Q6IA 5JQGB 2XAGA 3LDCA 2ZNJA 4KP4A 1GN3A 4UUJC 1SQFA 2XAFA 4EKWA 4R50A 2Z5UA 1VQOV 3OTOB 4JAAA 3RW0A 4PDRA 4JI0O 2LQTA 4DR2O 4LF6B 1HNXO 2UUCB 3HPLC 3A0BZ 3C90A 3ZN0A 5TISZ 1S5JA 2RMKB 3TXSA 1AP6A 2ZQMA 2HHHO 2C2AA 1BT8A 1JPXA 5L3GA 3K04A 5KHKA 4LF5B 1K8AW 4DR3B 3FB6C 4CH5A 2Y69C 1FFXB 1LUVA 3P32A 5KHIA 2DW4A 1SQQH 4IHJA 4UCOA 4CS3A 2JEUA 3KCXA 4K3AA 4ZKIA 4PA3A 2ZCEA 2PZSA 3A2FA 4U3FH 3WFVA 2V7QG 2X6BA 3OD4A 5B1OA 1P7BA 3U11A 3QG5A 4B08A 4I55B 1LR1A 5J9PC 3ZHVA 2A79B 3SPHA 1FXKA 1AI5A 1HP8A 3CXCU 2FTKA 2ZR3A 5FNVB 1FYJA 2DJVA 5GTIZ 2EZPA 1XUQA 3D36A 4DV3O 5EIBD 2M6YA 3CRMA 2P90A 4P2ZA 4BAYA 3D8CA 4DV6O 4DR7B 2BTQA 4Q6GA 4G2KA 4CH4A 2Q7HA 1XQ8A 3RYIA 2PTMA 3TCUA 2W0XA 3RBZA 3HKCA 4TOIA 1U97A 1M9NA 3ZEDA 2B1IA 4PELA 4FLZA 4GKKB 1GM8A 2WLNA 5IT9N 3F5WC 4B3SB 5IYZA 3PN1A 4P9PA 2RJZA 5K1PA 1HR0O 2FMLA 4X8AA 1FJGB 1N0NA 1B04A 4OGQB 2ITDC 3LSQA 3A0RA 1KKDA 1NKDA 5CA1B 1R1BA 1SA0B 3WG7B 3ZN1A 2X7RB 2ZT9B 2GSMB 1JCHA 3ZMVA 5IJ9A 1YCIA 2XASA 2ZXWB 2LGQA 1PM9A 1OCRB 1BQZA 4LF6O 3HKBA 2UUCO 5IJ0A 1HNZO 1EBOA 1AJPA 1SETA 3EHBB 3SJBC 2ZDIC 1WA8A 1Y6XA 2LP7A 5BY1A 5JVDB 4LF5O 2YEVB 4MVZA 4DR3O 3K58A 1XBLA 5IWAB 1IBLB 1SZXA 5KHJA 4UCUA 2P5OA 4PDMA 5CN0A 3ZRVA 2IJJA 4JF3A 1AILA 3F7YC 4OX9O 1ZL8B 1Q43A 3K0GA 2P4VA 2CGOA 1CEZA 4X1IB 3ASOC 4NXNO 3APOA 2W6JG 4O2BB 1QQCA 1Y74A 4GUNA 4MTFA 2KG7A 4FZ0A 1Y76A 3SYOA 2JGDB 3R66A 1QU7A 2UXXA 4J7KA 5LXTA 2NR5A 3CP1A 3UO2A 4LFAB 3AG1B 4MS2A 1XMOB 4DUYO 2LGWA 5E79Z 1SZTA 1QCEA 1QNMA 1YXBA 3E89A 1N32B 3GWKC 3ETGA 3QNEA 1NT2B 2EILC 5EC2C 2YIDA 2A0LA 1X59A 4J80A 2BOBC 2ETNA 2P7TC 4X64O 2D3OW 5LOVB 3E8GA 1VQ5V 3FX7A 2YIBA 1EM1A 5BMVB 4O4JB 2QTSA 3HKEB 2JVDA 4ZHQB 4GKKO 3SYCA 4DR1B 1VF5B 5GONB 4EFBA 2P6JA 4AQYO 4JI3O 3O9OA 1V55C 4WFFA 1I5XA 1DLBA 1E1RG 5FL7G 2F93B 2UUBO 1RP3B 2DYSC 3JD1A 2EIKC 1FJGO 2EX3A 4ICGA 3QO7A 4FIPC 2NLJC 1YZBA 1KKCA 2DOSA 2HKOA 2MK3A 1ZUQA 4OXSA 2Q69A 1I0HA 3W7XA 3JASA 4H13B 1S5LZ 2YSUB 1JFFB 5J2TB 1Q8IA 3J81N 4FLWA 4X62B 1GN4A 3IC7A 4Z1MG 1WP7A 3IFXA 2RNBA 5DEDA 2OIGA 2ZINA 5IWAO 2PYJA 4DR4B 1FXVA 1AI7A 4TSFG 4LF8O 1ORQC 1M56C 3ZX6A 3F7VC 1NR1A 1MOFA 4TUYB 4QGPA 2BSKB 4MW3A 3CB2A 3LSSA 5F2VO 3DXRA 2H94A 1GK9A 3K57A 2ZE5A 2FKXA 4XBFA 1AR1B 2XTAA 4YIOA 1UJWB 4E2LA 3A8TA 4JI7B 1OCOC 5EC1C 4JTCB 4J7ZA 1SRYA 4LC1A 1CPYA 4LF7B 1N33B 5B1AC 3ABLC 1KMIZ 1PD3A 4LFAO 4NTXA 3X2QC 2AXTZ 2X6AA 1YIJV 2FYUH 1YSCA 2JGUA 1BMFG 4J7JA 3RWRD 4PA6A 1N32O 2OT5A 2ZM6O 4NYKA 3JAKB 2UXCO 1JJ2U 3AG2C 5ITZA 4RQFA 5C8YB 4CS4A 2EBOA 1PNMA 3I56V 3AG4C 1WLEA 3ZS8C 5CBHA 1Y67A 3OFNG 3H1JH 3CRAA 5EZYA 1KYOF 2EIJB 3AG7A 1G6UA 3N2GB 3VBBA 1S76D 4DR1O 1XREA 3B2EE 4JV5O 3K08A 1JOYA 2GTSA 2CK3G 4UV9A 3FYEB 4J9YB 1NH2B 4BIOA 1E1QG 3JAMN 4DV7B 1YJWV 1FKAO 1GTOA 2WPDG 4UVAA 1UPGA 3A0HZ 1YVWA 1R3IC 3P30A 1UFIA 4O4IB 5L3FA 1IBKO 2F4VB 4LNUA 1NZ6A 2EINB 4UV8A 1EZVH 4AI8A 3FFQA 4TV9B 1I7FA 4NKGB 1OZ0A 4X20B 5LGTA 4H0LB 3AG3C 5CB4B 2YC0A 4X62O 1R3JC 1W59A 3JARB 1VQ8V 1K34A 2XT9A 4PA4A 4K8ZA 1L8DA 2HG5C 2ZE6A 4JTDB 2IBZH 3SYQA 2CE4A 2B5UA 5B5EZ 1MSDA 4B7EA 3TJTA 5AG2A 1W0JG 2DYRC 1MABG 1TUEB 1VQKV 4UCVA 2CAZC 3P3NA 2Q0OC 1D5NA 2VWKA 2HJDA 1MMMA 2ZE7A 2CH7B 4JI7O 2YDEA 2Y69B 1Z2GA 5LA6A 5L3EA 4LF7O 4IHJB 1OCZC 2OCCC 1Q5OA 5CA0B 1N4CA 2O57A 2MW2B 2CTPA 3ZHRA 4X65B 3CMEV 4JI8B 4NR1A 1SQXH 1RSOA 3STZC 3FAVA 4O2AB 1QBZA 1I08A 1LUWA 2RCVA 2DWDC 3G67A 5J2UA 3VQVA 2VWJA 2HVJC 4B3TO 3SJQC 2N74A 1G8MA 3WB0A 5EK0A 4TV8A 4RUFA 3OGIB 1G1XB 1YEWA 4KL1A 3UKMA 5FPRA 2PF4E 2HVKC 2X0LA 4D7TA 1XNRB 1GN2A 2BTOA 4JI6O 1Q7YW 4EB6B 2QEXV 2XAQA 4DV7O 1NH2D 1BS3A 2JJ2G 2XOKG 2OWOA 2XUMA 4I0XB 4FZ1A 2WAMA 2BCCH 4Z1VA 2F4VO 1VQNV 3MD0A 1H2SB 2ZD9A 1QR9A 2GDSA 4Q20A 4TQDA 4CH3A 4DV1B 4MVUA 3CD6V 5C93A 1RPRA 5CBGA 2EJRA 5HFLA 4HNAA 1VQLV 1AI6A 4JI4B 1H2MA 4WBNB 1GO3F 4J41A 2QR4A 2PI4A 3E35A 4I7ZB 3ABUA 1N34B 1ZX3A 4X1YB 2RN9A 1QVFU 2P22C 1NS1A 4HYOA 5IJ0B 1KBHA 4JI5B 5JJJB 5LHHA 2ZKOA 4JYBA 1NVPD 3OMIB 4WCEV 4I4TA 1WA8B 4UVCA 3LDDA 3ASNC 3OAAG 2YI8A 4UB6Z 5JJEB 1BZKA 2A3QA 4HZ3A 5KX5A 3G6BA 4MVRA 3CCEV 4FLUA 4UB8Z 4RQEA 1LNQA 2W6IG 4X65O 4JI8O 4X66O 1EN6A 4PJ0Z 3ASOB 1S5HC 5KUKA 1JQ0A 1VEWA 3OMAB 1M1KW 4Z2WA 1VQPV 3UT5A 1F51A 4YXWG 1FXKC 3T4ZA 1Y76B 3BA8A 4DV2B 4LFBB 3OGCC 1ENVA 4DV5B 1XL4A 2Z0AA 2ZNIA 3THOA 1V9PA 3CJHB 5KUMA 4DRXA 2DE0X 4K8XA 4UXNA 4RUEA 3D36C 1M93A 4H37A 5KHHA 3W7SA 2VQEB 3CEIA 4DUZB 4LP8A 3EVKA 1PKXA 1HDJA 2FB5A 3U10A 4QIWF 1K3EA 3F5TA 1XNRO 2EILB 3W7TA 4DV0B 2YICA 1XNQB 4LF4B 2XNDG 3SJCC 2Y4TA 2ITCC 5JH7A 4TT3G 3Q4HA 4DR5O 5KAIZ 3WU2Z 1F4NA 3E8HA 4C7UA 4O4LB 4CZZA 1R6NA 1V55B 3OEHG 1N0JA 2K1EA 2QKSA 2ZIMA 2F23A 1HNWB 1RM1C 3DC6A 2DYSB 2NN4A 2EIKB 3E22B 2GBOA 3ZRXA 1GAXA 1K4CC 4JI4O 3K9AA 4I9WA 3JALA 2JJ1G 5LL6Y 2WWWA 3OTOO 3RYHA 1N34O 3H1HH 4ZOLA 5JQGA 2Q9LA 4JI5O 1K92A 5KMGA 1W0KG 4LR3A 3H1IH 4PV1B 4W4LA 3JSLA 5LMUB 3CC2V 1P4RA 4N21A 5L3BA 5DECA 2ZIOA 1VQMV 1HWYA 4WFEA 2QM7A 2QTOA 3B40A 1O9HA 2E5LB 4MVQA 3ZMTA 4IL6Z 4JI1B 4JGSA 1XILA 1M56B 1QLEC 1QLNA 2QA4V 2K9PA 5LYJA 2PI5A 1FFXA 1MZEA 2ADQB 4MT8A 5LP6C 5LHGA 5LP6A 3OM3B 2YI9A 2R70A 3BRCA 4DV2O 1NU1H 1OCOB 3KCYA 4X9QA 3K5OA 3R65A 5B1AB 2JEXA 1TUBA 3ABLB 3JD2A 1RPOA 5LGNA 3X2QB 3ZRSA 3ZBHA 1EN5A 4UCTA 3P3PA 1WPBA 3CRRA 3NR7A 3OEEG 4GZRB 4I55A 4PA9A 2VQEO 4YJ2A 2GUZA 5IYDO 3RYCB 1GM9A 2Q6AA 3AG2B 2LO1A 5FNVA 2Y4UA 1XNQO 4GX5A 4DR7O 4H33A 4GLXA 4LF4O 2YIAA 1CP9A 3CCSV 1N8RW 1S72V 3AG4B 1L0NH 1EN4A 3JD0A 3O65A 4UCRA 2QDOA 4G27B 1DGSA 1L1FA 4LF9B 1Y4MA 3RFRA 3FB7C 4B3SO 4KXRA 4DYLA 4KHPB 3ABKC 4BIZA 4CC6A 5IE9A 4K35A 2WLHA 4LBEC 5GW7A 1Q82W 1I94B 2Y0PA 3WB1A 4JYAB 4CS2A 1NTKH 4BWAA 1HNWO 5LGUA 2LFRA 5A2QN 3H01A 1XDCA 1H2LA 4DW0A 3VQXA 1QHTA 3APQA 2IU0A 1IBMB 2HLDG 3M7MX 3ZRWA 3W7WA 4EFEA 3ZHTA 4FLYA 3JD3A 3AG3B 4GX1A 5CA1A 4K0KB 1K5QA 1KD1W 3B8MA 1SA0A 4RAIA 2E75B 4UVBA 1Q90D 2YS8A 1H2NA 5H6QA 1VQ7V 1IBLO 2IJHA 1V54C 3HR0A 2E5LO 2DYRB 4FMTA 3AK1A 1VQ9V 2JS3A 2V1DA 2YEVA 5B66Z 4GX0A 2QGNA 4IYHA 1BQ0A 1YI2V 3OMNB 4B3RB 3PJSK 3RYFA 1IDSA 1P49A 1GMGA 1B6QA 4W4KA 3T1CA 2EIMC 2A9HA 4LWSA 4I50B 2Q4PA 1XMOO 2OYQA 4X1IA 4O2BA 1OCZB 1M57C 2OCCB 1G4YB 3ABTA 2Q5ZA 3MDSA 4FFBB 1AR5A 4MSWC 2JGDA 1B06A 3FAVB 4ZBMA 1Z5WA 3ZCCA 2NNUA 4YJ3B 5JCOA 3IC9A 1R73A 4U3JB 4YHHB 3SDLA 3N2KA 1VF7A 2P67A 2Z3YA 2UUAB 2OTJV 1KECA 3K79A 3LNNA 4LF9O 1NTZH 1E79G 1US6A 1COWG 5B3SC 4FLVA 4MVMA 4KHPO 1RFYA 5LOVA 5KA6A 3BA9A 1OHHG 1I94O 4JYAO 5BMVA 4ZI7A 4LH7A 3H9VA 3JAWA 3HKEA 4ZHQA 5B1BC 3RN4A 4YIPA 5EYPA 1XHXA 1U96A 5GONA 4HAMA 1WPXA 5LBQA 3M8AA 4PDLA 5EBMC 2QWNB 1AJQA 4F6RB 3SPIA 1JMKC 2WLLB 2BE3A 2WSSG 3H1KH 5FPOA 4F4LA 4ZIBA 1IBMO 3G80A 4NXMB 5KAFZ 4JI2B 2KKWA 3K3WA 1PL4A 1JX9A 1L0LH 1ZWIC 3ZHUA 4K0KO 1BHAA 2GV9A 2P4KA 3DC5A 4QE7A 4HNAB 1GKFA 4DK0A 4PI0A 1DF4A 1SF9A 2FL4A 3CS5A 1SS3A 3UCSC 5J2TA 4DR4O 4J42A 4DR6B 2OCHA 3MAQA 1A32A 4PDVA 1GM7A 1NVPB 3K0DA 2QWPB 3E8BA 5HFMA 1K9MW 2CTQA 1VF6A 3HB3B 4CC5A 4I9QA 3SPJA 3IAYA 1JA8A 1HW7A 1XEQA 1PNKA 1ZLZA 3JATA 4B3RO 1AI4A 1P7GA 3ASNB 4JI0B 2UXDB 1NR7A 4TUYA 1N33O 2VS0A 3KZIZ 5D5PA 1VP7A 3B09A 4FM2A 2IW5A 2LFSA 3K06A 1WNSA 3DTUB 3AK3A 3CXHF 5L3CA 3K59A 4DV4B 2CGNA 3NXSA 1OJHA 4JPRA 1YJNV 2XAHA 1FXKB 3U0ZA 1YF2A 1R3KC 4D6TH 2AHYA 2QWRB 2WLIA 2AZ2A 4QE9A 2EULA 3JAKA 1O9GA 1Z5VA 2QJ1A 2Y48A 3L73H 2UUAO 5C8YA 3TK1A 1PV0A 3BEHA 3OUSA 2QM4A 1F4MA 4UFZA 3L71H 3FD9A 1W2BU 2JS5A 4J11A 3SR2C 1VMGA 2PYLA 2F95B 4PD4F 3HKDA 1IVSA 2BTQB 2Q73A 3S3XA 4DV3B 2IH3C 3RYIB 3N2GA 3T1HB 3HKCB 4AHCA 3BCCH 1SKVA 3GWOA 2KB1A 2ZE8A 1THZA 2P06A 2CDYA 3LSUA 1EFRG 1R6KA 4R6ZA 4PHZA 3OE7G 5IYZB 3OT7A 4UCSA 3KKYA 3G4SV 4NXMO 5A9GA 2AGAA 4JI2O 2DWEC 3B8NA 1K5SA 1EZJA 1RM1B 3CCLV 4O4HA 3SJAC 1NQTA 3SPGA 4JYCA 4WFHA 5E1AC 4G28B 2B9ZA 2X6CA 3ZMZA 2UU9B 4TV9A 1N36B 1NI8A 3JCUZ 4X20A 5IJ9B 5CB4A 1BL8A 2VRZA 1K97A 3BHPA 3JARA 3HKBB 2N05A 3FKSG 3K9SA 4KFMA 1ZTEA 1PL0A 2Q7EA 3STLC 5KMGB 1YTFB 1TVKA 1JVMA 4XDLA 1Q6HA 2QWOB 2AHZA 1TAEA 5EBLC 2UXDO 3LDEA 1HNZB 5KA5A 2A06H 4LFCB 2Q7GA 1M90W 1IXBA 4P9OA 4A5UB 1J5EB 4CH6A 3OTFA 3IJ4A 1QLEB 2EZOA 2CH7A 2R9IA 5DM6V 4DV4O 1IXMA 1NJIW 3CRQA 5LYJB 1Y74B 1VIBA 4FLXA 2Q8VA 1F7YA 2VQFB 1ZSPA 4WF9V 2KG7B 5LMNB 5LP6B 4XDKA 5CA0A 4PI2A 4JASA 1S3JA 4OX9B 1AR4A 5LXTB 2LW7A 1OCCC 3TXQA 5CBFA 1TUBB 3BFRA 3CCRV 4NXNB 1SQGA 4WFAV 5IY5C 4O2AA 4IIJA 5EBWC 1Q6UA 1XOUA 3CYOA 4X1KA 4YJ2B 1YDXA 2GUZB 1H8HG 3CX5F 4B3MB 2CTWA 1FD9A 3E2EA 4FK5C 5IYBO 3ABMC 4DUYB 4BR6A 1KB9F 3FB8C 5EIBC 2ATKC 1MNGA 3JSNA 2AW9A 3CCMV 1GH6A 3RGBA 4N23A 2OTLV 3T1HO 2LW1A 3QF7A 4JZ2A 1SERA 2HFEC 3S3WA 3E86A 4EB6A 3AEIA 3QO8A 1FFTB 3MHHC 4X64B 3ABKB 1CXZB 2XAJA 4DV1O 4FVMA 2DMXA 4I0XA 4IT5A 2L6LA 2Q67A 1VQ4V 4L87A 1X4TA 2QE7G 3IGAC 4AQYB 4JI3B 3FYIB 3ETEA 2UU9O 2E74B 5IDJA 1N36O 2LJ2A 1XL6A 3CRCA 2UUBB 4XDJA 1P84F 3JASB 1TGOA 2M7WA 4NB5A 3K03A 3ZRWB 4DO2A 4F6EA 4WBNA 2N04A 2PY5A 3JD4A 3MHSC 3CCQV 2HJFC 1YTFD 4X1YA 3CC4V 2V4DA 3CCUV 2Q0AA 3T1YB 1KP3A 3OUFA 1H2GA 1QVGU 4LH6A 4DXWA 4MVOA 4LFCO 1YJ9V 3J7AU 1Y66A 1V54B 2ZDIA 2R9AA 3VQWA 1J5EO 1XMQB 4X89A 1Q3EA 1K4DC 5KLVH 3DXRB 4FM0A 2QSAA 1FXHA 2GHYA 3ML0A 3RYFB 2VQFO 4JYYA 5LMNO 3JCZA 1WJZA 3L75H 2R72A 4LF8B 4LFBO 4NTWA 1JJOA 2HEPA 2JIZG 4DV5O 2EIMB 1D2DA 3CWBH 4LWSB 1BCCH 3OR7C 4QPJA 1VQ6V 4TQFA 2JDIG 3GB7C 1M57B 1DF5A 3QTCA 4R7CA 4MTGA 4DUZO 2R9RB 1AP5A 1AB3A 4JTAB 3RVZA 3G71V 4B3MO 5ITZB 3VOUA 2ZR2A 4DV0O 4GKJB 1KC8W 3CJHA 3EXAA 3H1LH 2KSDA 3L9DA 3CC7V 1M4UA 3N2KB 1B3QA 3TGUH 2ZM6B 1DTOA 3C3SA 2UXCB 3ZMUA 5EZYB 3CPWU 1GRJA 3CE2A 3CCVV 2YIBD 1KUQA 1R3LC
chains in the Genus database with same CATH topology
3JCUZ 1S5LZ 3KZIZ 3A0BZ 5KAFZ 5TISZ 2AXTZ 4IL6Z 5GTIZ 4UB8Z 5E79Z 5GTHZ 5B66Z 3A0HZ 5KAIZ 4PJ0Z 5H2FZ 4UB6Z 3WU2Z 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Z;  1S5L Z;  3KZI Z;  3A0B Z;  5KAF Z;  5TIS Z;  2AXT Z;  4IL6 Z;  5GTI Z;  4UB8 Z;  5E79 Z;  5GTH Z;  5B66 Z;  3A0H Z;  5KAI Z;  4PJ0 Z;  5H2F Z;  4UB6 Z;  3WU2 Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 5B3S B;  1NTM H;  1TA8 A;  3L72 H;  2RQ6 A;  1FS0 G;  4MTX A;  4WFB V;  3VQY A;  4FM1 A;  4ZI7 B;  3JAW B;  4ABM A;  1SQB H;  3K5M A;  5B1B B;  1PP9 H;  5EYP B;  2PUS A;  4H44 B;  4O4L A;  4JV5 B;  2UXB B;  3BPZ A;  3T4D A;  1VAR A;  4LNU B;  1PNL A;  3SYA A;  2ADP A;  1SQV H;  3E22 A;  5K1X A;  2D2C B;  3K5N A;  2CUG A;  3WG7 C;  5BZB A;  2WA3 A;  3CSX A;  4AIL C;  1KQS U;  5FLX N;  1WN7 A;  1Q86 W;  5LMU O;  1IBK B;  2ILM A;  2ZXW C;  3UQ8 A;  1WAZ A;  1OCR C;  1QR8 A;  3DSQ A;  4I5S A;  2DQ3 A;  2YUA A;  3T1Y O;  1MG1 A;  2IJK A;  4J10 A;  2W0F C;  2KQX A;  3I55 V;  4JI1 O;  1I5Y A;  1XMQ O;  1IX9 A;  3ICX A;  5JVD A;  2AZ0 A;  4BIU A;  4GT1 A;  5BXZ A;  3JAT B;  4QNH B;  5CMU A;  5JJN B;  1F23 A;  2ODM A;  4CBC A;  4YY3 B;  2OIE A;  1BHB A;  1SC5 B;  1ZL8 A;  2WLM A;  2IJI A;  1Q81 W;  5LA6 B;  3SYP A;  1AVM A;  1WP8 A;  3UM7 A;  4L8J A;  3ZMS A;  4U7N A;  1DK1 A;  4QPK A;  3D3Q A;  4KUM A;  1H2K A;  5H9C A;  3KG2 A;  5D5Q A;  1J95 A;  1RSO B;  4IGG A;  3ETQ A;  3LNM B;  2XHB A;  2EJ7 A;  3AG1 C;  1AJN A;  4DK1 A;  5H5N A;  4MTO A;  4GKJ O;  2QKA A;  1K7D A;  5JCO C;  5J2U B;  2Y0I A;  4NVP A;  4GYC B;  2WLI B;  3OR6 C;  4QJF B;  3ZIA G;  2L35 A;  3RYC A;  4TV8 B;  4TWK A;  3CHX A;  3L70 H;  1MA1 A;  5DN6 G;  2QWQ B;  2WLJ A;  4B3T B;  3DGE A;  2RDC A;  3K5L A;  3BAA A;  3HKD B;  4O4J A;  1WB8 A;  3OW2 U;  4NTY A;  2YXL A;  4D7S A;  1H8E G;  1PPJ H;  4P30 A;  3CMA V;  3TET A;  5L3D A;  2QM8 A;  2F43 G;  4JI6 B;  2UXB O;  2GTA A;  3RVY A;  4B7K A;  3B4S A;  3JYC A;  4ASU G;  4E4E A;  2B1G A;  4OPH A;  3E83 A;  1KU9 A;  1D5A A;  2H8P C;  2HR3 A;  2JK5 C;  1H38 A;  4O4H B;  5H2F Z;  4R8C A;  3BVO A;  1T5E A;  3M99 B;  1IUR A;  3CCJ V;  3ZJZ A;  3ETD A;  1YIT V;  5BR8 B;  3QVN A;  2DQ0 A;  3L74 H;  2F1M A;  1JFF A;  1ZAU A;  3UO3 A;  2H3O A;  3SPC A;  5LHI A;  1KP2 A;  4JAV A;  4PA7 A;  3C3T A;  1NBM G;  4JZG A;  2UXN A;  1VF6 C;  1SQP H;  3J80 N;  4FJC C;  2YXY A;  2IU3 A;  4I4T B;  4RWU A;  1XHZ A;  3T2M A;  4RO2 A;  1TVK B;  1YHQ V;  4DR2 B;  2QKC A;  4YY3 O;  1HNX B;  4FLT A;  2F66 C;  1IZ3 A;  3QO5 A;  1BE3 H;  2BSK A;  2A7W A;  3SGI A;  2YXH A;  4FFK A;  1R6T A;  5KX5 B;  1XI1 A;  2HP8 A;  4EEQ A;  4HBN A;  4OPA A;  4MVS A;  2HHH B;  1BSM A;  1K33 A;  1MSW D;  3EFF K;  3G6E V;  4I50 A;  3UT5 B;  1JR9 A;  1ROP A;  2IM9 A;  2E3C A;  5CA3 A;  4IYI A;  3W7U A;  5B1N A;  2JRI A;  5IYC O;  4GCZ A;  1SES A;  4GX2 A;  2WLK A;  4FFB A;  4YHH O;  4DW1 A;  2Q68 A;  4DRX B;  4X66 B;  1URF A;  1OCC B;  3BY6 A;  3E8F A;  3BAB A;  3WB2 A;  5IY5 B;  4IIJ B;  4WFG A;  2E76 B;  4FPP A;  4YJ3 A;  2ARH A;  1M5I A;  1S0V A;  4X1K B;  4X88 A;  1BGY H;  3ZHQ A;  3I5D A;  4U3J A;  3FB5 C;  3LUT B;  2DN9 A;  1FPO A;  3B77 A;  4BW5 A;  2CTR A;  5KHG A;  3ABM B;  2EIJ C;  1FAF A;  1WB7 A;  4MW8 A;  5GTH Z;  5JH7 B;  3Q4H B;  3N27 A;  2G38 A;  3RT3 C;  3AK2 A;  4J9Z B;  2PGG A;  1ARO P;  4DV6 B;  2WA4 A;  3D3I A;  2BOC C;  3GVM A;  4LCU C;  4DR5 B;  1S77 D;  4O4I A;  4BW9 A;  4F6R A;  4JAU A;  2EIN C;  2WLL A;  4U7O A;  5JWP A;  5BR8 O;  3ZHS A;  1GN6 A;  3JAL B;  1OV9 A;  1K73 W;  4DR6 O;  1HR0 B;  3RYH B;  5H6R A;  1MZF A;  2IH1 C;  4ZOL B;  1Q6I A;  5JQG B;  2XAG A;  3LDC A;  2ZNJ A;  4KP4 A;  1GN3 A;  4UUJ C;  1SQF A;  2XAF A;  4EKW A;  4R50 A;  2Z5U A;  1VQO V;  3OTO B;  4JAA A;  3RW0 A;  4PDR A;  4JI0 O;  2LQT A;  4DR2 O;  4LF6 B;  1HNX O;  2UUC B;  3HPL C;  3A0B Z;  3C90 A;  3ZN0 A;  5TIS Z;  1S5J A;  2RMK B;  3TXS A;  1AP6 A;  2ZQM A;  2HHH O;  2C2A A;  1BT8 A;  1JPX A;  5L3G A;  3K04 A;  5KHK A;  4LF5 B;  1K8A W;  4DR3 B;  3FB6 C;  4CH5 A;  2Y69 C;  1FFX B;  1LUV A;  3P32 A;  5KHI A;  2DW4 A;  1SQQ H;  4IHJ A;  4UCO A;  4CS3 A;  2JEU A;  3KCX A;  4K3A A;  4ZKI A;  4PA3 A;  2ZCE A;  2PZS A;  3A2F A;  4U3F H;  3WFV A;  2V7Q G;  2X6B A;  3OD4 A;  5B1O A;  1P7B A;  3U11 A;  3QG5 A;  4B08 A;  4I55 B;  1LR1 A;  5J9P C;  3ZHV A;  2A79 B;  3SPH A;  1FXK A;  1AI5 A;  1HP8 A;  3CXC U;  2FTK A;  2ZR3 A;  5FNV B;  1FYJ A;  2DJV A;  5GTI Z;  2EZP A;  1XUQ A;  3D36 A;  4DV3 O;  5EIB D;  2M6Y A;  3CRM A;  2P90 A;  4P2Z A;  4BAY A;  3D8C A;  4DV6 O;  4DR7 B;  2BTQ A;  4Q6G A;  4G2K A;  4CH4 A;  2Q7H A;  1XQ8 A;  3RYI A;  2PTM A;  3TCU A;  2W0X A;  3RBZ A;  3HKC A;  4TOI A;  1U97 A;  1M9N A;  3ZED A;  2B1I A;  4PEL A;  4FLZ A;  4GKK B;  1GM8 A;  2WLN A;  5IT9 N;  3F5W C;  4B3S B;  5IYZ A;  3PN1 A;  4P9P A;  2RJZ A;  5K1P A;  1HR0 O;  2FML A;  4X8A A;  1FJG B;  1N0N A;  1B04 A;  4OGQ B;  2ITD C;  3LSQ A;  3A0R A;  1KKD A;  1NKD A;  5CA1 B;  1R1B A;  1SA0 B;  3WG7 B;  3ZN1 A;  2X7R B;  2ZT9 B;  2GSM B;  1JCH A;  3ZMV A;  5IJ9 A;  1YCI A;  2XAS A;  2ZXW B;  2LGQ A;  1PM9 A;  1OCR B;  1BQZ A;  4LF6 O;  3HKB A;  2UUC O;  5IJ0 A;  1HNZ O;  1EBO A;  1AJP A;  1SET A;  3EHB B;  3SJB C;  2ZDI C;  1WA8 A;  1Y6X A;  2LP7 A;  5BY1 A;  5JVD B;  4LF5 O;  2YEV B;  4MVZ A;  4DR3 O;  3K58 A;  1XBL A;  5IWA B;  1IBL B;  1SZX A;  5KHJ A;  4UCU A;  2P5O A;  4PDM A;  5CN0 A;  3ZRV A;  2IJJ A;  4JF3 A;  1AIL A;  3F7Y C;  4OX9 O;  1ZL8 B;  1Q43 A;  3K0G A;  2P4V A;  2CGO A;  1CEZ A;  4X1I B;  3ASO C;  4NXN O;  3APO A;  2W6J G;  4O2B B;  1QQC A;  1Y74 A;  4GUN A;  4MTF A;  2KG7 A;  4FZ0 A;  1Y76 A;  3SYO A;  2JGD B;  3R66 A;  1QU7 A;  2UXX A;  4J7K A;  5LXT A;  2NR5 A;  3CP1 A;  3UO2 A;  4LFA B;  3AG1 B;  4MS2 A;  1XMO B;  4DUY O;  2LGW A;  5E79 Z;  1SZT A;  1QCE A;  1QNM A;  1YXB A;  3E89 A;  1N32 B;  3GWK C;  3ETG A;  3QNE A;  1NT2 B;  2EIL C;  5EC2 C;  2YID A;  2A0L A;  1X59 A;  4J80 A;  2BOB C;  2ETN A;  2P7T C;  4X64 O;  2D3O W;  5LOV B;  3E8G A;  1VQ5 V;  3FX7 A;  2YIB A;  1EM1 A;  5BMV B;  4O4J B;  2QTS A;  3HKE B;  2JVD A;  4ZHQ B;  4GKK O;  3SYC A;  4DR1 B;  1VF5 B;  5GON B;  4EFB A;  2P6J A;  4AQY O;  4JI3 O;  3O9O A;  1V55 C;  4WFF A;  1I5X A;  1DLB A;  1E1R G;  5FL7 G;  2F93 B;  2UUB O;  1RP3 B;  2DYS C;  3JD1 A;  2EIK C;  1FJG O;  2EX3 A;  4ICG A;  3QO7 A;  4FIP C;  2NLJ C;  1YZB A;  1KKC A;  2DOS A;  2HKO A;  2MK3 A;  1ZUQ A;  4OXS A;  2Q69 A;  1I0H A;  3W7X A;  3JAS A;  4H13 B;  1S5L Z;  2YSU B;  1JFF B;  5J2T B;  1Q8I A;  3J81 N;  4FLW A;  4X62 B;  1GN4 A;  3IC7 A;  4Z1M G;  1WP7 A;  3IFX A;  2RNB A;  5DED A;  2OIG A;  2ZIN A;  5IWA O;  2PYJ A;  4DR4 B;  1FXV A;  1AI7 A;  4TSF G;  4LF8 O;  1ORQ C;  1M56 C;  3ZX6 A;  3F7V C;  1NR1 A;  1MOF A;  4TUY B;  4QGP A;  2BSK B;  4MW3 A;  3CB2 A;  3LSS A;  5F2V O;  3DXR A;  2H94 A;  1GK9 A;  3K57 A;  2ZE5 A;  2FKX A;  4XBF A;  1AR1 B;  2XTA A;  4YIO A;  1UJW B;  4E2L A;  3A8T A;  4JI7 B;  1OCO C;  5EC1 C;  4JTC B;  4J7Z A;  1SRY A;  4LC1 A;  1CPY A;  4LF7 B;  1N33 B;  5B1A C;  3ABL C;  1KMI Z;  1PD3 A;  4LFA O;  4NTX A;  3X2Q C;  2AXT Z;  2X6A A;  1YIJ V;  2FYU H;  1YSC A;  2JGU A;  1BMF G;  4J7J A;  3RWR D;  4PA6 A;  1N32 O;  2OT5 A;  2ZM6 O;  4NYK A;  3JAK B;  2UXC O;  1JJ2 U;  3AG2 C;  5ITZ A;  4RQF A;  5C8Y B;  4CS4 A;  2EBO A;  1PNM A;  3I56 V;  3AG4 C;  1WLE A;  3ZS8 C;  5CBH A;  1Y67 A;  3OFN G;  3H1J H;  3CRA A;  5EZY A;  1KYO F;  2EIJ B;  3AG7 A;  1G6U A;  3N2G B;  3VBB A;  1S76 D;  4DR1 O;  1XRE A;  3B2E E;  4JV5 O;  3K08 A;  1JOY A;  2GTS A;  2CK3 G;  4UV9 A;  3FYE B;  4J9Y B;  1NH2 B;  4BIO A;  1E1Q G;  3JAM N;  4DV7 B;  1YJW V;  1FKA O;  1GTO A;  2WPD G;  4UVA A;  1UPG A;  3A0H Z;  1YVW A;  1R3I C;  3P30 A;  1UFI A;  4O4I B;  5L3F A;  1IBK O;  2F4V B;  4LNU A;  1NZ6 A;  2EIN B;  4UV8 A;  1EZV H;  4AI8 A;  3FFQ A;  4TV9 B;  1I7F A;  4NKG B;  1OZ0 A;  4X20 B;  5LGT A;  4H0L B;  3AG3 C;  5CB4 B;  2YC0 A;  4X62 O;  1R3J C;  1W59 A;  3JAR B;  1VQ8 V;  1K34 A;  2XT9 A;  4PA4 A;  4K8Z A;  1L8D A;  2HG5 C;  2ZE6 A;  4JTD B;  2IBZ H;  3SYQ A;  2CE4 A;  2B5U A;  5B5E Z;  1MSD A;  4B7E A;  3TJT A;  5AG2 A;  1W0J G;  2DYR C;  1MAB G;  1TUE B;  1VQK V;  4UCV A;  2CAZ C;  3P3N A;  2Q0O C;  1D5N A;  2VWK A;  2HJD A;  1MMM A;  2ZE7 A;  2CH7 B;  4JI7 O;  2YDE A;  2Y69 B;  1Z2G A;  5LA6 A;  5L3E A;  4LF7 O;  4IHJ B;  1OCZ C;  2OCC C;  1Q5O A;  5CA0 B;  1N4C A;  2O57 A;  2MW2 B;  2CTP A;  3ZHR A;  4X65 B;  3CME V;  4JI8 B;  4NR1 A;  1SQX H;  1RSO A;  3STZ C;  3FAV A;  4O2A B;  1QBZ A;  1I08 A;  1LUW A;  2RCV A;  2DWD C;  3G67 A;  5J2U A;  3VQV A;  2VWJ A;  2HVJ C;  4B3T O;  3SJQ C;  2N74 A;  1G8M A;  3WB0 A;  5EK0 A;  4TV8 A;  4RUF A;  3OGI B;  1G1X B;  1YEW A;  4KL1 A;  3UKM A;  5FPR A;  2PF4 E;  2HVK C;  2X0L A;  4D7T A;  1XNR B;  1GN2 A;  2BTO A;  4JI6 O;  1Q7Y W;  4EB6 B;  2QEX V;  2XAQ A;  4DV7 O;  1NH2 D;  1BS3 A;  2JJ2 G;  2XOK G;  2OWO A;  2XUM A;  4I0X B;  4FZ1 A;  2WAM A;  2BCC H;  4Z1V A;  2F4V O;  1VQN V;  3MD0 A;  1H2S B;  2ZD9 A;  1QR9 A;  2GDS A;  4Q20 A;  4TQD A;  4CH3 A;  4DV1 B;  4MVU A;  3CD6 V;  5C93 A;  1RPR A;  5CBG A;  2EJR A;  5HFL A;  4HNA A;  1VQL V;  1AI6 A;  4JI4 B;  1H2M A;  4WBN B;  1GO3 F;  4J41 A;  2QR4 A;  2PI4 A;  3E35 A;  4I7Z B;  3ABU A;  1N34 B;  1ZX3 A;  4X1Y B;  2RN9 A;  1QVF U;  2P22 C;  1NS1 A;  4HYO A;  5IJ0 B;  1KBH A;  4JI5 B;  5JJJ B;  5LHH A;  2ZKO A;  4JYB A;  1NVP D;  3OMI B;  4WCE V;  4I4T A;  1WA8 B;  4UVC A;  3LDD A;  3ASN C;  3OAA G;  2YI8 A;  4UB6 Z;  5JJE B;  1BZK A;  2A3Q A;  4HZ3 A;  5KX5 A;  3G6B A;  4MVR A;  3CCE V;  4FLU A;  4UB8 Z;  4RQE A;  1LNQ A;  2W6I G;  4X65 O;  4JI8 O;  4X66 O;  1EN6 A;  4PJ0 Z;  3ASO B;  1S5H C;  5KUK A;  1JQ0 A;  1VEW A;  3OMA B;  1M1K W;  4Z2W A;  1VQP V;  3UT5 A;  1F51 A;  4YXW G;  1FXK C;  3T4Z A;  1Y76 B;  3BA8 A;  4DV2 B;  4LFB B;  3OGC C;  1ENV A;  4DV5 B;  1XL4 A;  2Z0A A;  2ZNI A;  3THO A;  1V9P A;  3CJH B;  5KUM A;  4DRX A;  2DE0 X;  4K8X A;  4UXN A;  4RUE A;  3D36 C;  1M93 A;  4H37 A;  5KHH A;  3W7S A;  2VQE B;  3CEI A;  4DUZ B;  4LP8 A;  3EVK A;  1PKX A;  1HDJ A;  2FB5 A;  3U10 A;  4QIW F;  1K3E A;  3F5T A;  1XNR O;  2EIL B;  3W7T A;  4DV0 B;  2YIC A;  1XNQ B;  4LF4 B;  2XND G;  3SJC C;  2Y4T A;  2ITC C;  5JH7 A;  4TT3 G;  3Q4H A;  4DR5 O;  5KAI Z;  3WU2 Z;  1F4N A;  3E8H A;  4C7U A;  4O4L B;  4CZZ A;  1R6N A;  1V55 B;  3OEH G;  1N0J A;  2K1E A;  2QKS A;  2ZIM A;  2F23 A;  1HNW B;  1RM1 C;  3DC6 A;  2DYS B;  2NN4 A;  2EIK B;  3E22 B;  2GBO A;  3ZRX A;  1GAX A;  1K4C C;  4JI4 O;  3K9A A;  4I9W A;  3JAL A;  2JJ1 G;  5LL6 Y;  2WWW A;  3OTO O;  3RYH A;  1N34 O;  3H1H H;  4ZOL A;  5JQG A;  2Q9L A;  4JI5 O;  1K92 A;  5KMG A;  1W0K G;  4LR3 A;  3H1I H;  4PV1 B;  4W4L A;  3JSL A;  5LMU B;  3CC2 V;  1P4R A;  4N21 A;  5L3B A;  5DEC A;  2ZIO A;  1VQM V;  1HWY A;  4WFE A;  2QM7 A;  2QTO A;  3B40 A;  1O9H A;  2E5L B;  4MVQ A;  3ZMT A;  4IL6 Z;  4JI1 B;  4JGS A;  1XIL A;  1M56 B;  1QLE C;  1QLN A;  2QA4 V;  2K9P A;  5LYJ A;  2PI5 A;  1FFX A;  1MZE A;  2ADQ B;  4MT8 A;  5LP6 C;  5LHG A;  5LP6 A;  3OM3 B;  2YI9 A;  2R70 A;  3BRC A;  4DV2 O;  1NU1 H;  1OCO B;  3KCY A;  4X9Q A;  3K5O A;  3R65 A;  5B1A B;  2JEX A;  1TUB A;  3ABL B;  3JD2 A;  1RPO A;  5LGN A;  3X2Q B;  3ZRS A;  3ZBH A;  1EN5 A;  4UCT A;  3P3P A;  1WPB A;  3CRR A;  3NR7 A;  3OEE G;  4GZR B;  4I55 A;  4PA9 A;  2VQE O;  4YJ2 A;  2GUZ A;  5IYD O;  3RYC B;  1GM9 A;  2Q6A A;  3AG2 B;  2LO1 A;  5FNV A;  2Y4U A;  1XNQ O;  4GX5 A;  4DR7 O;  4H33 A;  4GLX A;  4LF4 O;  2YIA A;  1CP9 A;  3CCS V;  1N8R W;  1S72 V;  3AG4 B;  1L0N H;  1EN4 A;  3JD0 A;  3O65 A;  4UCR A;  2QDO A;  4G27 B;  1DGS A;  1L1F A;  4LF9 B;  1Y4M A;  3RFR A;  3FB7 C;  4B3S O;  4KXR A;  4DYL A;  4KHP B;  3ABK C;  4BIZ A;  4CC6 A;  5IE9 A;  4K35 A;  2WLH A;  4LBE C;  5GW7 A;  1Q82 W;  1I94 B;  2Y0P A;  3WB1 A;  4JYA B;  4CS2 A;  1NTK H;  4BWA A;  1HNW O;  5LGU A;  2LFR A;  5A2Q N;  3H01 A;  1XDC A;  1H2L A;  4DW0 A;  3VQX A;  1QHT A;  3APQ A;  2IU0 A;  1IBM B;  2HLD G;  3M7M X;  3ZRW A;  3W7W A;  4EFE A;  3ZHT A;  4FLY A;  3JD3 A;  3AG3 B;  4GX1 A;  5CA1 A;  4K0K B;  1K5Q A;  1KD1 W;  3B8M A;  1SA0 A;  4RAI A;  2E75 B;  4UVB A;  1Q90 D;  2YS8 A;  1H2N A;  5H6Q A;  1VQ7 V;  1IBL O;  2IJH A;  1V54 C;  3HR0 A;  2E5L O;  2DYR B;  4FMT A;  3AK1 A;  1VQ9 V;  2JS3 A;  2V1D A;  2YEV A;  5B66 Z;  4GX0 A;  2QGN A;  4IYH A;  1BQ0 A;  1YI2 V;  3OMN B;  4B3R B;  3PJS K;  3RYF A;  1IDS A;  1P49 A;  1GMG A;  1B6Q A;  4W4K A;  3T1C A;  2EIM C;  2A9H A;  4LWS A;  4I50 B;  2Q4P A;  1XMO O;  2OYQ A;  4X1I A;  4O2B A;  1OCZ B;  1M57 C;  2OCC B;  1G4Y B;  3ABT A;  2Q5Z A;  3MDS A;  4FFB B;  1AR5 A;  4MSW C;  2JGD A;  1B06 A;  3FAV B;  4ZBM A;  1Z5W A;  3ZCC A;  2NNU A;  4YJ3 B;  5JCO A;  3IC9 A;  1R73 A;  4U3J B;  4YHH B;  3SDL A;  3N2K A;  1VF7 A;  2P67 A;  2Z3Y A;  2UUA B;  2OTJ V;  1KEC A;  3K79 A;  3LNN A;  4LF9 O;  1NTZ H;  1E79 G;  1US6 A;  1COW G;  5B3S C;  4FLV A;  4MVM A;  4KHP O;  1RFY A;  5LOV A;  5KA6 A;  3BA9 A;  1OHH G;  1I94 O;  4JYA O;  5BMV A;  4ZI7 A;  4LH7 A;  3H9V A;  3JAW A;  3HKE A;  4ZHQ A;  5B1B C;  3RN4 A;  4YIP A;  5EYP A;  1XHX A;  1U96 A;  5GON A;  4HAM A;  1WPX A;  5LBQ A;  3M8A A;  4PDL A;  5EBM C;  2QWN B;  1AJQ A;  4F6R B;  3SPI A;  1JMK C;  2WLL B;  2BE3 A;  2WSS G;  3H1K H;  5FPO A;  4F4L A;  4ZIB A;  1IBM O;  3G80 A;  4NXM B;  5KAF Z;  4JI2 B;  2KKW A;  3K3W A;  1PL4 A;  1JX9 A;  1L0L H;  1ZWI C;  3ZHU A;  4K0K O;  1BHA A;  2GV9 A;  2P4K A;  3DC5 A;  4QE7 A;  4HNA B;  1GKF A;  4DK0 A;  4PI0 A;  1DF4 A;  1SF9 A;  2FL4 A;  3CS5 A;  1SS3 A;  3UCS C;  5J2T A;  4DR4 O;  4J42 A;  4DR6 B;  2OCH A;  3MAQ A;  1A32 A;  4PDV A;  1GM7 A;  1NVP B;  3K0D A;  2QWP B;  3E8B A;  5HFM A;  1K9M W;  2CTQ A;  1VF6 A;  3HB3 B;  4CC5 A;  4I9Q A;  3SPJ A;  3IAY A;  1JA8 A;  1HW7 A;  1XEQ A;  1PNK A;  1ZLZ A;  3JAT A;  4B3R O;  1AI4 A;  1P7G A;  3ASN B;  4JI0 B;  2UXD B;  1NR7 A;  4TUY A;  1N33 O;  2VS0 A;  3KZI Z;  5D5P A;  1VP7 A;  3B09 A;  4FM2 A;  2IW5 A;  2LFS A;  3K06 A;  1WNS A;  3DTU B;  3AK3 A;  3CXH F;  5L3C A;  3K59 A;  4DV4 B;  2CGN A;  3NXS A;  1OJH A;  4JPR A;  1YJN V;  2XAH A;  1FXK B;  3U0Z A;  1YF2 A;  1R3K C;  4D6T H;  2AHY A;  2QWR B;  2WLI A;  2AZ2 A;  4QE9 A;  2EUL A;  3JAK A;  1O9G A;  1Z5V A;  2QJ1 A;  2Y48 A;  3L73 H;  2UUA O;  5C8Y A;  3TK1 A;  1PV0 A;  3BEH A;  3OUS A;  2QM4 A;  1F4M A;  4UFZ A;  3L71 H;  3FD9 A;  1W2B U;  2JS5 A;  4J11 A;  3SR2 C;  1VMG A;  2PYL A;  2F95 B;  4PD4 F;  3HKD A;  1IVS A;  2BTQ B;  2Q73 A;  3S3X A;  4DV3 B;  2IH3 C;  3RYI B;  3N2G A;  3T1H B;  3HKC B;  4AHC A;  3BCC H;  1SKV A;  3GWO A;  2KB1 A;  2ZE8 A;  1THZ A;  2P06 A;  2CDY A;  3LSU A;  1EFR G;  1R6K A;  4R6Z A;  4PHZ A;  3OE7 G;  5IYZ B;  3OT7 A;  4UCS A;  3KKY A;  3G4S V;  4NXM O;  5A9G A;  2AGA A;  4JI2 O;  2DWE C;  3B8N A;  1K5S A;  1EZJ A;  1RM1 B;  3CCL V;  4O4H A;  3SJA C;  1NQT A;  3SPG A;  4JYC A;  4WFH A;  5E1A C;  4G28 B;  2B9Z A;  2X6C A;  3ZMZ A;  2UU9 B;  4TV9 A;  1N36 B;  1NI8 A;  3JCU Z;  4X20 A;  5IJ9 B;  5CB4 A;  1BL8 A;  2VRZ A;  1K97 A;  3BHP A;  3JAR A;  3HKB B;  2N05 A;  3FKS G;  3K9S A;  4KFM A;  1ZTE A;  1PL0 A;  2Q7E A;  3STL C;  5KMG B;  1YTF B;  1TVK A;  1JVM A;  4XDL A;  1Q6H A;  2QWO B;  2AHZ A;  1TAE A;  5EBL C;  2UXD O;  3LDE A;  1HNZ B;  5KA5 A;  2A06 H;  4LFC B;  2Q7G A;  1M90 W;  1IXB A;  4P9O A;  4A5U B;  1J5E B;  4CH6 A;  3OTF A;  3IJ4 A;  1QLE B;  2EZO A;  2CH7 A;  2R9I A;  5DM6 V;  4DV4 O;  1IXM A;  1NJI W;  3CRQ A;  5LYJ B;  1Y74 B;  1VIB A;  4FLX A;  2Q8V A;  1F7Y A;  2VQF B;  1ZSP A;  4WF9 V;  2KG7 B;  5LMN B;  5LP6 B;  4XDK A;  5CA0 A;  4PI2 A;  4JAS A;  1S3J A;  4OX9 B;  1AR4 A;  5LXT B;  2LW7 A;  1OCC C;  3TXQ A;  5CBF A;  1TUB B;  3BFR A;  3CCR V;  4NXN B;  1SQG A;  4WFA V;  5IY5 C;  4O2A A;  4IIJ A;  5EBW C;  1Q6U A;  1XOU A;  3CYO A;  4X1K A;  4YJ2 B;  1YDX A;  2GUZ B;  1H8H G;  3CX5 F;  4B3M B;  2CTW A;  1FD9 A;  3E2E A;  4FK5 C;  5IYB O;  3ABM C;  4DUY B;  4BR6 A;  1KB9 F;  3FB8 C;  5EIB C;  2ATK C;  1MNG A;  3JSN A;  2AW9 A;  3CCM V;  1GH6 A;  3RGB A;  4N23 A;  2OTL V;  3T1H O;  2LW1 A;  3QF7 A;  4JZ2 A;  1SER A;  2HFE C;  3S3W A;  3E86 A;  4EB6 A;  3AEI A;  3QO8 A;  1FFT B;  3MHH C;  4X64 B;  3ABK B;  1CXZ B;  2XAJ A;  4DV1 O;  4FVM A;  2DMX A;  4I0X A;  4IT5 A;  2L6L A;  2Q67 A;  1VQ4 V;  4L87 A;  1X4T A;  2QE7 G;  3IGA C;  4AQY B;  4JI3 B;  3FYI B;  3ETE A;  2UU9 O;  2E74 B;  5IDJ A;  1N36 O;  2LJ2 A;  1XL6 A;  3CRC A;  2UUB B;  4XDJ A;  1P84 F;  3JAS B;  1TGO A;  2M7W A;  4NB5 A;  3K03 A;  3ZRW B;  4DO2 A;  4F6E A;  4WBN A;  2N04 A;  2PY5 A;  3JD4 A;  3MHS C;  3CCQ V;  2HJF C;  1YTF D;  4X1Y A;  3CC4 V;  2V4D A;  3CCU V;  2Q0A A;  3T1Y B;  1KP3 A;  3OUF A;  1H2G A;  1QVG U;  4LH6 A;  4DXW A;  4MVO A;  4LFC O;  1YJ9 V;  3J7A U;  1Y66 A;  1V54 B;  2ZDI A;  2R9A A;  3VQW A;  1J5E O;  1XMQ B;  4X89 A;  1Q3E A;  1K4D C;  5KLV H;  3DXR B;  4FM0 A;  2QSA A;  1FXH A;  2GHY A;  3ML0 A;  3RYF B;  2VQF O;  4JYY A;  5LMN O;  3JCZ A;  1WJZ A;  3L75 H;  2R72 A;  4LF8 B;  4LFB O;  4NTW A;  1JJO A;  2HEP A;  2JIZ G;  4DV5 O;  2EIM B;  1D2D A;  3CWB H;  4LWS B;  1BCC H;  3OR7 C;  4QPJ A;  1VQ6 V;  4TQF A;  2JDI G;  3GB7 C;  1M57 B;  1DF5 A;  3QTC A;  4R7C A;  4MTG A;  4DUZ O;  2R9R B;  1AP5 A;  1AB3 A;  4JTA B;  3RVZ A;  3G71 V;  4B3M O;  5ITZ B;  3VOU A;  2ZR2 A;  4DV0 O;  4GKJ B;  1KC8 W;  3CJH A;  3EXA A;  3H1L H;  2KSD A;  3L9D A;  3CC7 V;  1M4U A;  3N2K B;  1B3Q A;  3TGU H;  2ZM6 B;  1DTO A;  3C3S A;  2UXC B;  3ZMU A;  5EZY B;  3CPW U;  1GRJ A;  3CE2 A;  3CCV V;  2YIB D;  1KUQ A;  1R3L C; 
#chains in the Genus database with same CATH homology
 3JCU Z;  1S5L Z;  3KZI Z;  3A0B Z;  5KAF Z;  5TIS Z;  2AXT Z;  4IL6 Z;  5GTI Z;  4UB8 Z;  5E79 Z;  5GTH Z;  5B66 Z;  3A0H Z;  5KAI Z;  4PJ0 Z;  5H2F Z;  4UB6 Z;  3WU2 Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...