4UB8Z

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 25
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4ub8Z00
5B66Z 5GTHZ 3KZIZ 5KAFZ 1S5LZ 5TISZ 3A0BZ 4PJ0Z 5GTIZ 3A0HZ 2AXTZ 4UB6Z 4UB8Z 4IL6Z 5B5EZ 5KAIZ 3WU2Z 3JCUZ 5E79Z 5H2FZ
chains in the Genus database with same CATH superfamily
1F4MA 1QVFU 3U10A 1VMGA 4DR5B 3K08A 2RNBA 3B09A 2WPDG 5BR8B 1IBKB 1LUVA 3HKDA 1IZ3A 2QWNB 4X1YA 1H2LA 1AR4A 2ZM6O 3ZRSA 1EN6A 3CYOA 5L3CA 2UXNA 1IBLO 3OTOB 4MVQA 3N2KB 4G2KA 1VQ4V 2JGDB 2LFRA 3RYHB 2N05A 2ITDC 4ZHQB 3T1YO 5EC2C 2ITCC 2QKSA 2YIAA 4UCVA 2DW4A 1H2GA 3OD4A 5DECA 2XOKG 3N2KA 3A2FA 4TOIA 2JGDA 2HHHB 3RYHA 1A32A 1IX9A 3G67A 2O57A 4JTAB 4YHHB 1ZTEA 4B3SO 1K5SA 4ZHQA 3BA8A 1MMMA 3RYCB 2B5UA 3K57A 5K1XA 1XMOB 3X2QC 2XHBA 2Y4UA 2IJKA 1G8MA 1ZWIC 3E8BA 4KHPO 2ZINA 1SQGA 3JAMN 4CH4A 4BIOA 5IE9A 3N27A 2LGQA 2Q68A 3AG1C 1VQLV 2RDCA 3LNNA 3IC7A 1SQBH 4TUYB 4K8ZA 3A0HZ 1GH6A 1QVGU 4U7OA 5K1PA 3L73H 3ETGA 3B2EE 1P84F 2Y0PA 1AP6A 3BFRA 3GVMA 3RVYA 2UXDO 4FK5C 5EBWC 3F7VC 3AG4B 4UVAA 4K0KB 4TUYA 1NH2D 2JRIA 4LH7A 1V9PA 1BSMA 4MTXA 5GTIZ 4G27B 3ZN1A 3OMIB 2B1IA 1VQKV 4ZKIA 3O65A 2E74B 3HKBB 1FJGO 4FZ1A 4WFHA 4P30A 3HB3B 3I5DA 2UUAO 3ZHTA 3LDCA 2QE7G 1O9GA 3PJSK 2XAQA 4JI1O 3QO5A 3CCMV 1JQ0A 4HZ3A 4DUZB 2IJIA 2AW9A 3VQVA 1JOYA 1EZJA 2AHZA 3HKBA 2YIDA 3I56V 1M5IA 1AVMA 3GWOA 1R3IC 2DWDC 2X0LA 4JYYA 1HNXB 4LF7O 3CCQV 2H8PC 1VQOV 1XMQO 2QJ1A 3KG2A 2OWOA 1KBHA 4UVCA 1ZL8B 2IH3C 2IBZH 3T4DA 3EFFK 4WFEA 3IFXA 1IURA 3K9AA 4AQYO 3TGUH 3NR7A 4JI6O 4LCUC 1ZUQA 2R72A 3OM3B 2P6JA 4DR3O 2PI5A 1MOFA 4JI0O 5IYDO 1VQ5V 4JZ2A 3B77A 4YY3O 4GZRB 4H0LB 4IL6Z 3M99B 2P67A 2L35A 2ZE5A 3AK1A 1KMIZ 5EC1C 1RP3B 1UFIA 1XOUA 5LMNO 3K5LA 2EIMB 4PHZA 1QHTA 1F7YA 1AI4A 1JJOA 1L1FA 2E5LO 1KC8W 1N33B 4FFKA 1IBMB 5JH7B 3FYEB 2ZDIA 1S5JA 4LR3A 3IC9A 1AI5A 4B3MO 4JI8O 2HR3A 1S77D 2P5OA 1WNSA 3SPCA 4J9ZB 1F23A 3NXSA 1SERA 1PKXA 3ABKC 2QSAA 2QTSA 4IYHA 4OPAA 1ORQC 4JTDB 2QM8A 2WLJA 1H8HG 1VQ9V 1S3JA 5JH7A 1Y6XA 1IBLB 5F2VO 1NJIW 1YXBA 4P9PA 1I94O 2EULA 4RO2A 4NTYA 1SZTA 4CH5A 4FZ0A 4ICGA 4JV5O 1MSWD 2CK3G 1FFXB 5DEDA 1RM1C 2F4VB 1FAFA 5B3SB 3CXHF 5D5QA 5LMUB 4ZI7B 2R9AA 2X6CA 3K5OA 4ZOLB 1KECA 3RW0A 4UV9A 4DV0O 1XUQA 1JMKC 2ZIMA 5LXTB 3RWRD 1J95A 2IM9A 2CE4A 2RMKB 4DO2A 4XDKA 5A9GA 2CAZC 2YC0A 2WLLB 2QR4A 4ZI7A 3ZHRA 3T1HO 1J5EB 4ZOLA 1WN7A 5EIBC 4KHPB 4DUYO 1US6A 4RWUA 2QM4A 5LXTA 1I7FA 1NR1A 1AI7A 3RT3C 3AEIA 1SQPH 3DC6A 1N0NA 4LF9B 4X88A 4CH3A 1SF9A 2F66C 2ZE7A 2CUGA 4Z2WA 2WLLA 2A06H 2GUZB 4QPJA 3S3WA 2JEUA 1AILA 4E2LA 2WSSG 2PY5A 1WB7A 2K1EA 3UQ8A 2CTQA 1G1XB 1BT8A 4DR5O 5BR8O 1IBKO 5ITZB 3F5TA 1P49A 4QGPA 4UB8Z 2ATKC 1UJWB 2GUZA 4LFBB 1OV9A 4D6TH 4MSWC 5KLVH 5J9PC 4FLXA 2JGUA 2V4DA 5KHJA 1WLEA 5ITZA 3CEIA 3IGAC 3VOUA 2ZR2A 1Q86W 3STZC 3CC4V 4I9WA 2HVKC 2R70A 3AG1B 5KAIZ 3K9SA 4LNUB 4N23A 4JI1B 5KX5B 3JD1A 2VRZA 5JJNB 2HG5C 5IY5B 1MNGA 1GN4A 1Q43A 2YDEA 4J80A 2EIJB 2Q67A 3H1HH 3L74H 4X89A 1JR9A 4LFCO 4LNUA 4QE9A 1ENVA 3SGIA 1XNQB 3AG4C 5B5EZ 5KX5A 1PL0A 5HFLA 1W0JG 4CC6A 4WFBV 2ZR3A 4WF9V 4UCSA 1HP8A 4IHJB 1E79G 2Y69C 4JYAB 3E8GA 4OPHA 1AR1B 4PJ0Z 4F4LA 3JYCA 3ML0A 3EHBB 1M90W 4J41A 4FVMA 4DR3B 4UXNA 1Q3EA 5C93A 3ZHSA 1Q8IA 4JI0B 4IHJA 5GTHZ 4EFEA 5IYBO 1FXHA 1PNLA 4MVMA 4TV9B 1K33A 5CA0A 1NQTA 5LP6B 4YY3B 1BL8A 3BAAA 3F5WC 3UT5B 1AJNA 2HKOA 1FYJA 1NR7A 5H9CA 1H2KA 2BCCH 3W7XA 3TETA 4HBNA 1WJZA 1VF6A 4Q6GA 4FLYA 3HR0A 2DQ3A 1BGYH 4TV9A 1U96A 5LP6A 2BSKB 1WP7A 3G6EV 3JAWB 3OTFA 3H1IH 2OCCB 1BHBA 2LGWA 3UKMA 1OCRB 3ASOB 4B3MB 4JI8B 1WA8B 2QGNA 2QWQB 1VQNV 1SQFA 1IDSA 5GW7A 3FB7C 2LP7A 3LSSA 3IAYA 2BSKA 2GV9A 2ODMA 3E83A 1FS0G 3JAWA 4J10A 3RN4A 3APOA 2CGOA 3S3XA 1V54B 2ZE6A 2XUMA 3ETDA 1R6NA 2IU3A 4RUEA 2ZDIC 1I94B 1WA8A 3R65A 4KL1A 1NU1H 4IT5A 5B1BB 1H2SB 3JCUZ 2PYLA 2EIMC 1K34A 4LWSB 2FYUH 4FIPC 4XDJA 1NZ6A 2H94A 5IJ9B 1S5LZ 2A3QA 2HP8A 3MHHC 1XI1A 1CPYA 1E1QG 5LGNA 2ZXWB 4IYIA 4JI3O 4K35A 3ZX6A 2FTKA 1KP2A 3FD9A 2UUBB 1CEZA 4O4IB 1G6UA 4LWSA 3FFQA 3ICXA 4E4EA 3ZJZA 5FLXN 1TGOA 3BVOA 1YVWA 5H6QA 3WFVA 4XBFA 5CA3A 5IJ9A 2G38A 1VQ8V 3U11A 3BA9A 4DUYB 4H37A 2KQXA 4O2BB 4YJ3B 4PDRA 5LL6Y 4O4IA 2QA4V 1OCOB 5IYZB 4LF5O 3JATB 1M93A 5B3SC 5BXZA 1N33O 1TA8A 3T4ZA 1IBMO 2YXLA 4MW3A 1XBLA 2IJJA 4BR6A 4RQFA 1GAXA 4TV8B 2R9IA 3FYIB 4O2BA 3JD0A 4YJ3A 4I9QA 1D5AA 3HKEB 5IYZA 2IU0A 3JATA 2QWRB 5FPOA 1YSCA 2KB1A 3WU2Z 3C3SA 1JFFB 2Z5UA 5B1NA 1EFRG 1H2MA 2UU9O 4U3FH 3D8CA 1P7BA 4IIJB 5CBGA 1NH2B 4WFGA 1K4DC 1X59A 4UCUA 2OYQA 4TV8A 5EYPB 3BRCA 2F4VO 3HKEA 1HR0B 2P4VA 2XAFA 1YHQV 3D36A 3CB2A 3W7SA 1JFFA 3MD0A 5LMUO 4PI0A 3BY6A 1Q81W 4IIJA 5CA1B 4X20B 2E76B 5EYPA 3KCYA 4O4HB 4BIZA 2X7RB 4Z1MG 5CMUA 4LFCB 2D2CB 4RAIA 3E86A 4R7CA 1J5EO 5FL7G 3TK1A 5CA1A 3UCSC 4X20A 5LOVB 2AHYA 2WA4A 2QTOA 4O4HA 2FKXA 3LSUA 3VQWA 3RYFB 4BW5A 2Q8VA 4LF9O 2UXCO 2LJ2A 1AP5A 2EZOA 3SR2C 4GX2A 2CTRA 1XL4A 1M9NA 5C8YB 4I50B 1VQ6V 1PP9H 4C7UA 2CDYA 2GBOA 5CBHA 1D5NA 4NVPA 5GONB 3SJCC 5IY5C 4R50A 2OIGA 5LOVA 1SQQH 2F1MA 1GTOA 3SYOA 4GCZA 4J11A 1NTZH 2YEVB 3ZCCA 3RYFA 2EIJC 3FB5C 3KZIZ 4LFBO 4DW0A 5C8YA 4EKWA 4I50A 1B06A 1AROP 2B1GA 2LFSA 2QKCA 3BHPA 3K59A 2A7WA 5GONA 1H2NA 1MZFA 1VQMV 2YEVA 5A2QN 3N2GB 3OW2U 3JCZA 2Y69B 3E89A 3TXSA 4I4TB 2DYSB 2EBOA 4MS2A 1AR5A 1PNKA 1QLEC 1Y67A 3E35A 2LQTA 2HEPA 4DR1O 4YIOA 2DJVA 1HNZB 1YJWV 1GK9A 4JI2B 2KG7B 1IVSA 3N2GA 1VF6C 3WG7B 2WWWA 4I4TA 1PM9A 1URFA 4CBCA 5LP6C 2EINB 4AI8A 2CTWA 4L8JA 5KA5A 5EBLC 1FXVA 4X66B 1XNQO 1XL6A 1Q6IA 3H1LH 3DTUB 1MSDA 1QBZA 2L6LA 4DR6B 2KG7A 2PGGA 3ASNB 4JYAO 4B7KA 1HW7A 3CSXA 4DRXB 5DM6V 1QLNA 3CWBH 2OCCC 4X1KB 3OMNB 1RFYA 4HAMA 1OCRC 3ASOC 5EZYB 2A0LA 3STLC 1KU9A 1UPGA 2P06A 4PA7A 2EX3A 4JI3B 2EILB 3OT7A 4LF8B 3OUSA 1XEQA 4DRXA 1H38A 4DV3B 3CPWU 1R3JC 3RGBA 2YI8A 4X1KA 5IYCO 4O2AB 5KHIA 5AG2A 1K5QA 1V54C 5H2FZ 5EZYA 2VQFO 3VQXA 4D7TA 1K4CC 1E1RG 2HFEC 4CS2A 4GX5A 4J42A 2V1DA 4AILC 5B1BC 4FM1A 1Y76B 3CE2A 4OX9B 3DSQA 4LF5B 4H33A 4JZGA 4O2AA 1KP3A 3ZN0A 4BWAA 1OCCB 1F4NA 4JI5B 2JDIG 3RYIA 2KSDA 2HJDA 4TQDA 1JA8A 2PYJA 2ZXWC 5LHIA 3J7AU 1I5YA 2YIBD 1Y76A 5KA6A 3CMEV 3ABMB 1VARA 1N36B 3AK2A 1JX9A 2F43G 1VEWA 1M1KW 2UU9B 1SESA 1WPXA 5IWAO 2K9PA 5H5NA 1N32O 2Q73A 1G4YB 5DN6G 3CS5A 4GKJO 1MZEA 3ZEDA 1KB9F 2XTAA 3ZHVA 3OR7C 1XHZA 2OTLV 1OCOC 3CRMA 3A0BZ 1BE3H 2Q5ZA 2QM7A 4LF6O 1EN4A 3TXQA 1PPJH 3QO8A 2Y4TA 4MVRA 3TJTA 2B9ZA 4K3AA 3CP1A 4DV5O 3OFNG 2Z3YA 5B1AB 4DV6B 1TVKB 2UUBO 3CX5F 4EFBA 4CH6A 4JAUA 3D36C 4J7ZA 4MVSA 4DK1A 2QWPB 4B3RO 2OTJV 1LR1A 5D5PA 3MAQA 2UXCB 4P9OA 5BY1A 1TVKA 1HNWB 4KFMA 1Y66A 4BW9A 1KKDA 2ZQMA 5L3EA 1ZSPA 2QDOA 1GO3F 4DYLA 4NXNO 2N74A 1DF4A 3RVZA 4KP4A 4I5SA 4DV2B 3E8HA 5IT9N 4GKKB 2DN9A 4ASUG 1SQVH 3ZMSA 4FJCC 1YJNV 1KYOF 2WLNA 3CCRV 1COWG 1CXZB 3PN1A 4UB6Z 1LNQA 1HR0O 2JIZG 3A8TA 4DR1B 3L9DA 5LGUA 4DK0A 1XDCA 5KHGA 3UO2A 2FMLA 2MW2B 1Q90D 2LW7A 1Q7YW 4DR2O 5B1OA 4BAYA 2Q69A 1EN5A 3K5NA 2AZ0A 3ZRWB 2UUCO 2YXYA 1GN3A 2ARHA 3FX7A 3K0DA 3FAVB 3P3PA 4YJ2B 3W7UA 1R3LC 2RJZA 4U7NA 4JYCA 4U3JB 1Q82W 3CC7V 3K79A 3OGCC 1XILA 3CMAV 5CA0B 5TISZ 3L72H 3ZRWA 1YEWA 1QLEB 1L0NH 1QQCA 2DYSC 2Q9LA 4YXWG 3FAVA 3MDSA 4YJ2A 3QO7A 5LYJB 3IJ4A 2ZCEA 3K58A 3SJQC 1TUEB 4U3JA 3SPJA 2QWOB 1W0KG 2LO1A 1OCZB 4PV1B 4GYCB 4PD4F 1RSOB 1K7DA 1AJPA 1QU7A 3WG7C 1VF5B 2EINC 2ZNJA 1OHHG 4X65B 1PD3A 3B8NA 5J2UB 1VQ7V 1M56B 2VQFB 5LYJA 4F6EA 2NR5A 3ZMZA 1GRJA 4JPRA 2GDSA 1T5EA 2CGNA 1BMFG 1RSOA 1QR8A 4LFAO 4UCOA 1NI8A 4FLVA 1W59A 1ROPA 4LF4B 2Q7EA 3ASNC 4F6RB 3SJAC 5CB4B 1GM9A 1Q5OA 5J2UA 4TWKA 5KUKA 4OGQB 3G6BA 2YS8A 3C3TA 1NVPD 1S76D 3HPLC 2QKAA 2KKWA 2P7TC 1HNZO 4DR7O 1R6TA 4JI2O 3ZMVA 2EILC 2IW5A 4F6RA 3ZBHA 5CB4A 5EBMC 5IWAB 4X66O 1Q6UA 3GB7C 1N32B 2Q0OC 3SYCA 4GKJB 2UXXA 5KHHA 1L8DA 1K8AW 4DR6O 4Z1VA 3GWKC 1JCHA 3E22B 3H9VA 1U97A 3F7YC 3CC2V 1RPOA 3K5MA 1VQPV 1RPRA 2AZ2A 4LF6B 1OCCC 5L3BA 1M57B 1VIBA 3AG3B 4O4JB 4DV5B 1JJ2U 4CS3A 3E22A 4EB6B 5FNVB 4LF8O 2BOCC 1XNRB 3EXAA 2VQEB 1WB8A 1YIJV 1IXBA 3ABMC 4DV3O 3ZHUA 4FPPA 3OR6C 1XREA 3BEHA 1L0LH 4NTWA 3LNMB 4B3RB 3FB8C 2JJ2G 3O9OA 2X6BA 1I0HA 3DC5A 4O4JA 1BQ0A 1O9HA 2BOBC 3SYPA 1S72V 2PZSA 4EB6A 2XNDG 4LC1A 5FNVA 1LUWA 2HJFC 4OX9O 3D3IA 5LHGA 4PDMA 3CHXA 4W4LA 2BTOA 2XAJA 1Z2GA 1SC5B 1I08A 4JI5O 4NXNB 2GTSA 3OGIB 1SS3A 2F95B 1DK1A 1BCCH 4FLUA 3E2EA 4WCEV 3AG7A 1FFTB 5B1AC 1KQSU 4JAVA 4JYBA 1N36O 4UCTA 4NTXA 3ABLB 3H01A 1K9MW 4JF3A 1Y74B 2XAGA 5BZBA 3G71V 2N04A 4EEQA 4RQEA 1WPBA 2E3CA 3CD6V 2AXTZ 4H13B 1EM1A 4UFZA 3ZIAG 1YTFD 2ETNA 1JPXA 2DYRB 3HKCB 4ZBMA 2F93B 5JJEB 1Y74A 4DR2B 2W6JG 1D2DA 3ABTA 1DF5A 1N4CA 4I55B 2ADPA 4PA9A 5KUMA 2UUCB 5JQGB 4DV6O 2Z0AA 1QR9A 3BABA 3VBBA 2ZE8A 2WLMA 3BPZA 3HKCA 4DR4B 4FMTA 4I55A 2CH7B 1N34O 5LGTA 2FB5A 3JARB 5JQGA 4H44B 1K97A 4J7KA 1HNWO 3RFRA 1H8EG 3JD2A 4JI7B 3JSNA 2XAHA 3SPIA 4PI2A 3DGEA 1AJQA 1DLBA 1B6QA 1Z5VA 4DV4B 2CH7A 1S0VA 4NB5A 3JARA 5JVDB 4DV2O 4O4LB 3THOA 2WLKA 4FLWA 3RYCA 4ABMA 3T2MA 4LH6A 2QEXV 4B7EA 1ZLZA 4GKKO 4W4KA 3A0RA 2MK3A 4R6ZA 2DOSA 1YZBA 4B3TO 3ETEA 4JI4B 3K03A 4JGSA 4HYOA 5HFMA 4LFAB 5JVDA 4O4LA 3QTCA 1KUQA 4JASA 5EIBD 3ZMTA 2ADQB 5B66Z 3OMAB 4GT1A 2ZKOA 4DV7B 2YSUB 2VWJA 3I55V 3WB0A 4DR7B 2HLDG 1OCZC 3R66A 5L3DA 4NKGB 4X64O 4DV1B 2YI9A 2GHYA 3AK3A 1MABG 1KD1W 1MG1A 3SPGA 3JALB 1IXMA 2P22C 1NTKH 1P7GA 3JD3A 1M56C 4MTFA 3OEEG 4X8AA 1SETA 4XDLA 1B3QA 4CS4A 3K0GA 4TSFG 4X1IB 2XASA 3SYAA 3JALA 2YIBA 2BTQB 4FFBB 5LA6B 1NKDA 3B40A 4X9QA 1YI2V 1BHAA 4PA4A 3RBZA 1PL4A 1OJHA 4KUMA 1YITV 1YDXA 4X1IA 4QIWF 4X62O 3W7WA 2BTQA 4FFBA 5LA6A 1N0JA 1ZX3A 3OAAG 4GX0A 4X65O 2E75B 3U0ZA 1SQXH 1GM7A 1S5HC 2V7QG 4G28B 4QPKA 1YCIA 3RYIB 3QVNA 1PNMA 4PA6A 1ZL8A 3P30A 4I0XB 3DXRB 3ZHQA 3WB1A 4LF4O 3TCUA 4OXSA 1YF2A 1HDJA 4LBEC 2OT5A 4MT8A 1R1BA 3LSQA 2W0XA 1Z5WA 3JSLA 1M57C 1NS1A 3AG3C 4I0XA 4B08A 4YIPA 3DXRA 3WB2A 4WFAV 3M8AA 3ZS8C 3B4SA 4A5UB 2P4KA 3QF7A 2DQ0A 5KHKA 3ABUA 3CJHB 1QNMA 4FLTA 3QNEA 3AG2B 3QG5A 5E1AC 1DGSA 1PV0A 1R6KA 3L75H 2EIKB 2H3OA 2IH1C 1FXKB 1AB3A 2ZT9B 2Q4PA 4J7JA 1V55B 3SPHA 2OIEA 3UO3A 4K8XA 1HWYA 2ZM6B 4QJFB 1GM8A 3CJHA 1OZ0A 3FB6C 3W7TA 1K73W 4NXMO 4I7ZB 2JS3A 3EVKA 5BMVB 1FXKA 1SKVA 4D7SA 2PTMA 3T1YB 3P32A 4FLZA 1XNRO 1B04A 2VQEO 4GLXA 1N8RW 3CRCA 1THZA 2HVJC 3P3NA 4CC5A 3ABLC 5JCOA 1BZKA 3J81N 5BMVA 1N34B 5JJJB 2W0FC 1FFXA 3VQYA 4B3SB 2C2AA 3FKSG 3SYQA 3LDEA 3CCSV 4WBNB 1JVMA 2X6AA 2ZNIA 4KXRA 2DYRC 2A9HA 3CRAA 5IJ0B 2D3OW 1DTOA 1NTMH 1CP9A 2CTPA 3B8MA 3CCJV 2UXBO 1YJ9V 4Q20A 4WBNA 3H1JH 3D3QA 2NN4A 2WLIB 2YUAA 2WLHA 3L70H 4B3TB 2DE0X 2FL4A 2EJ7A 5IJ0A 4MTOA 1VF7A 2WA3A 4CZZA 4QNHB 3J80N 1SRYA 3LDDA 4FM0A 1FD9A 1XQ8A 2UXDB 3OUFA 3H1KH 2PI4A 2IJHA 2GTAA 3CXCU 4TQFA 5FPRA 2P90A 1BQZA 3X2QB 2JS5A 2WLIA 2DWEC 1Q6HA 4UCRA 3C90A 2DMXA 3OTOO 4UUJC 2EJRA 1FJGB 4X64B 1NVPB 4R8CA 1W2BU 2UUAB 3MHSC 2F23A 2Q7HA 4RUFA 4MW8A 1K92A 5CBFA 2YXHA 3CRRA 2RCVA 2Y48A 4DR4O 3ZMUA 2Q7GA 4MVOA 3BCCH 5KAFZ 3SJBC 1R3KC 4NR1A 2HHHO 4DXWA 3KKYA 4YHHO 2Q6AA 2PF4E 2LW1A 3OEHG 2ZIOA 5LHHA 4UVBA 4JI7O 4J9YB 4LF7B 2W6IG 3JASB 1XMOO 4TT3G 2OCHA 3M7MX 4HNAB 4WFFA 1XMQB 4GX1A 4JAAA 4DV4O 1I5XA 1R73A 4X62B 5KMGB 3LUTB 4PA3A 3CRQA 2ZD9A 3CCUV 4AQYB 4JI6B 5L3FA 1TUBB 3JASA 1EBOA 3SDLA 2YICA 2VWKA 2JEXA 4HNAA 3KCXA 2Q0AA 1FKAO 4JI4O 2NLJC 4QE7A 5J2TB 4MTGA 3APQA 3JD4A 2EZPA 2GSMB 5KMGA 1BS3A 4ZIBA 2JJ1G 4LP8A 4K0KO 1WAZA 1AI6A 1TUBA 2RQ6A 4DV7O 5CN0A 4MVUA 2M7WA 4NYKA 1XHXA 5JWPA 3G4SV 5E79Z 5J2TA 1GMGA 1M4UA 5LMNB 1X4TA 4DV1O 1KKCA 3T1CA 3CCEV 3UT5A 2E5LB 3E8FA 3Q4HB 1SA0B 2WAMA 3L71H 1Y4MA 3ZRXA 4DUZO 3K3WA 5EK0A 1GN2A 2NNUA 4PDLA 2JK5C 5H6RA 2RN9A 3OE7G 3Q4HA 1SA0A 2ILMA 1HNXO 4GUNA 4JTCB 4PDVA 4NXMB 1P4RA 2PUSA 1YTFB 4P2ZA 1ZAUA 4JV5B 1NBMG 3CCVV 4N21A 4AHCA 2A79B 5LBQA 4L87A 1SZXA 1MA1A 2Y0IA 2VS0A 1QCEA 1FPOA 2XT9A 4DV0B 4UV8A 2JVDA 4DW1A 3ETQA 3AG2C 3K06A 4FM2A 2EIKC 3K04A 3ABKB 1FXKC 2BE3A 3G80A 3JAKB 1V55C 2AGAA 1WP8A 3ZRVA 1TAEA 2M6YA 3CCLV 1GKFA 1K3EA 3T1HB 4IGGA 1EZVH 5L3GA 1GN6A 2R9RB 3UM7A 4MVZA 4BIUA 1F51A 5JCOC 3HKDB 4PELA 1RM1B 1NT2B 2UXBB 3JAKA 4X1YB 1VP7A 5IDJA
chains in the Genus database with same CATH topology
5B66Z 5GTHZ 3KZIZ 5KAFZ 1S5LZ 5TISZ 3A0BZ 4PJ0Z 5GTIZ 3A0HZ 2AXTZ 4UB6Z 4UB8Z 4IL6Z 5B5EZ 5KAIZ 3WU2Z 3JCUZ 5E79Z 5H2FZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 Z;  5GTH Z;  3KZI Z;  5KAF Z;  1S5L Z;  5TIS Z;  3A0B Z;  4PJ0 Z;  5GTI Z;  3A0H Z;  2AXT Z;  4UB6 Z;  4UB8 Z;  4IL6 Z;  5B5E Z;  5KAI Z;  3WU2 Z;  3JCU Z;  5E79 Z;  5H2F Z; 
#chains in the Genus database with same CATH topology
 1F4M A;  1QVF U;  3U10 A;  1VMG A;  4DR5 B;  3K08 A;  2RNB A;  3B09 A;  2WPD G;  5BR8 B;  1IBK B;  1LUV A;  3HKD A;  1IZ3 A;  2QWN B;  4X1Y A;  1H2L A;  1AR4 A;  2ZM6 O;  3ZRS A;  1EN6 A;  3CYO A;  5L3C A;  2UXN A;  1IBL O;  3OTO B;  4MVQ A;  3N2K B;  4G2K A;  1VQ4 V;  2JGD B;  2LFR A;  3RYH B;  2N05 A;  2ITD C;  4ZHQ B;  3T1Y O;  5EC2 C;  2ITC C;  2QKS A;  2YIA A;  4UCV A;  2DW4 A;  1H2G A;  3OD4 A;  5DEC A;  2XOK G;  3N2K A;  3A2F A;  4TOI A;  2JGD A;  2HHH B;  3RYH A;  1A32 A;  1IX9 A;  3G67 A;  2O57 A;  4JTA B;  4YHH B;  1ZTE A;  4B3S O;  1K5S A;  4ZHQ A;  3BA8 A;  1MMM A;  3RYC B;  2B5U A;  3K57 A;  5K1X A;  1XMO B;  3X2Q C;  2XHB A;  2Y4U A;  2IJK A;  1G8M A;  1ZWI C;  3E8B A;  4KHP O;  2ZIN A;  1SQG A;  3JAM N;  4CH4 A;  4BIO A;  5IE9 A;  3N27 A;  2LGQ A;  2Q68 A;  3AG1 C;  1VQL V;  2RDC A;  3LNN A;  3IC7 A;  1SQB H;  4TUY B;  4K8Z A;  3A0H Z;  1GH6 A;  1QVG U;  4U7O A;  5K1P A;  3L73 H;  3ETG A;  3B2E E;  1P84 F;  2Y0P A;  1AP6 A;  3BFR A;  3GVM A;  3RVY A;  2UXD O;  4FK5 C;  5EBW C;  3F7V C;  3AG4 B;  4UVA A;  4K0K B;  4TUY A;  1NH2 D;  2JRI A;  4LH7 A;  1V9P A;  1BSM A;  4MTX A;  5GTI Z;  4G27 B;  3ZN1 A;  3OMI B;  2B1I A;  1VQK V;  4ZKI A;  3O65 A;  2E74 B;  3HKB B;  1FJG O;  4FZ1 A;  4WFH A;  4P30 A;  3HB3 B;  3I5D A;  2UUA O;  3ZHT A;  3LDC A;  2QE7 G;  1O9G A;  3PJS K;  2XAQ A;  4JI1 O;  3QO5 A;  3CCM V;  1JQ0 A;  4HZ3 A;  4DUZ B;  2IJI A;  2AW9 A;  3VQV A;  1JOY A;  1EZJ A;  2AHZ A;  3HKB A;  2YID A;  3I56 V;  1M5I A;  1AVM A;  3GWO A;  1R3I C;  2DWD C;  2X0L A;  4JYY A;  1HNX B;  4LF7 O;  3CCQ V;  2H8P C;  1VQO V;  1XMQ O;  2QJ1 A;  3KG2 A;  2OWO A;  1KBH A;  4UVC A;  1ZL8 B;  2IH3 C;  2IBZ H;  3T4D A;  3EFF K;  4WFE A;  3IFX A;  1IUR A;  3K9A A;  4AQY O;  3TGU H;  3NR7 A;  4JI6 O;  4LCU C;  1ZUQ A;  2R72 A;  3OM3 B;  2P6J A;  4DR3 O;  2PI5 A;  1MOF A;  4JI0 O;  5IYD O;  1VQ5 V;  4JZ2 A;  3B77 A;  4YY3 O;  4GZR B;  4H0L B;  4IL6 Z;  3M99 B;  2P67 A;  2L35 A;  2ZE5 A;  3AK1 A;  1KMI Z;  5EC1 C;  1RP3 B;  1UFI A;  1XOU A;  5LMN O;  3K5L A;  2EIM B;  4PHZ A;  1QHT A;  1F7Y A;  1AI4 A;  1JJO A;  1L1F A;  2E5L O;  1KC8 W;  1N33 B;  4FFK A;  1IBM B;  5JH7 B;  3FYE B;  2ZDI A;  1S5J A;  4LR3 A;  3IC9 A;  1AI5 A;  4B3M O;  4JI8 O;  2HR3 A;  1S77 D;  2P5O A;  1WNS A;  3SPC A;  4J9Z B;  1F23 A;  3NXS A;  1SER A;  1PKX A;  3ABK C;  2QSA A;  2QTS A;  4IYH A;  4OPA A;  1ORQ C;  4JTD B;  2QM8 A;  2WLJ A;  1H8H G;  1VQ9 V;  1S3J A;  5JH7 A;  1Y6X A;  1IBL B;  5F2V O;  1NJI W;  1YXB A;  4P9P A;  1I94 O;  2EUL A;  4RO2 A;  4NTY A;  1SZT A;  4CH5 A;  4FZ0 A;  4ICG A;  4JV5 O;  1MSW D;  2CK3 G;  1FFX B;  5DED A;  1RM1 C;  2F4V B;  1FAF A;  5B3S B;  3CXH F;  5D5Q A;  5LMU B;  4ZI7 B;  2R9A A;  2X6C A;  3K5O A;  4ZOL B;  1KEC A;  3RW0 A;  4UV9 A;  4DV0 O;  1XUQ A;  1JMK C;  2ZIM A;  5LXT B;  3RWR D;  1J95 A;  2IM9 A;  2CE4 A;  2RMK B;  4DO2 A;  4XDK A;  5A9G A;  2CAZ C;  2YC0 A;  2WLL B;  2QR4 A;  4ZI7 A;  3ZHR A;  3T1H O;  1J5E B;  4ZOL A;  1WN7 A;  5EIB C;  4KHP B;  4DUY O;  1US6 A;  4RWU A;  2QM4 A;  5LXT A;  1I7F A;  1NR1 A;  1AI7 A;  3RT3 C;  3AEI A;  1SQP H;  3DC6 A;  1N0N A;  4LF9 B;  4X88 A;  4CH3 A;  1SF9 A;  2F66 C;  2ZE7 A;  2CUG A;  4Z2W A;  2WLL A;  2A06 H;  2GUZ B;  4QPJ A;  3S3W A;  2JEU A;  1AIL A;  4E2L A;  2WSS G;  2PY5 A;  1WB7 A;  2K1E A;  3UQ8 A;  2CTQ A;  1G1X B;  1BT8 A;  4DR5 O;  5BR8 O;  1IBK O;  5ITZ B;  3F5T A;  1P49 A;  4QGP A;  4UB8 Z;  2ATK C;  1UJW B;  2GUZ A;  4LFB B;  1OV9 A;  4D6T H;  4MSW C;  5KLV H;  5J9P C;  4FLX A;  2JGU A;  2V4D A;  5KHJ A;  1WLE A;  5ITZ A;  3CEI A;  3IGA C;  3VOU A;  2ZR2 A;  1Q86 W;  3STZ C;  3CC4 V;  4I9W A;  2HVK C;  2R70 A;  3AG1 B;  5KAI Z;  3K9S A;  4LNU B;  4N23 A;  4JI1 B;  5KX5 B;  3JD1 A;  2VRZ A;  5JJN B;  2HG5 C;  5IY5 B;  1MNG A;  1GN4 A;  1Q43 A;  2YDE A;  4J80 A;  2EIJ B;  2Q67 A;  3H1H H;  3L74 H;  4X89 A;  1JR9 A;  4LFC O;  4LNU A;  4QE9 A;  1ENV A;  3SGI A;  1XNQ B;  3AG4 C;  5B5E Z;  5KX5 A;  1PL0 A;  5HFL A;  1W0J G;  4CC6 A;  4WFB V;  2ZR3 A;  4WF9 V;  4UCS A;  1HP8 A;  4IHJ B;  1E79 G;  2Y69 C;  4JYA B;  3E8G A;  4OPH A;  1AR1 B;  4PJ0 Z;  4F4L A;  3JYC A;  3ML0 A;  3EHB B;  1M90 W;  4J41 A;  4FVM A;  4DR3 B;  4UXN A;  1Q3E A;  5C93 A;  3ZHS A;  1Q8I A;  4JI0 B;  4IHJ A;  5GTH Z;  4EFE A;  5IYB O;  1FXH A;  1PNL A;  4MVM A;  4TV9 B;  1K33 A;  5CA0 A;  1NQT A;  5LP6 B;  4YY3 B;  1BL8 A;  3BAA A;  3F5W C;  3UT5 B;  1AJN A;  2HKO A;  1FYJ A;  1NR7 A;  5H9C A;  1H2K A;  2BCC H;  3W7X A;  3TET A;  4HBN A;  1WJZ A;  1VF6 A;  4Q6G A;  4FLY A;  3HR0 A;  2DQ3 A;  1BGY H;  4TV9 A;  1U96 A;  5LP6 A;  2BSK B;  1WP7 A;  3G6E V;  3JAW B;  3OTF A;  3H1I H;  2OCC B;  1BHB A;  2LGW A;  3UKM A;  1OCR B;  3ASO B;  4B3M B;  4JI8 B;  1WA8 B;  2QGN A;  2QWQ B;  1VQN V;  1SQF A;  1IDS A;  5GW7 A;  3FB7 C;  2LP7 A;  3LSS A;  3IAY A;  2BSK A;  2GV9 A;  2ODM A;  3E83 A;  1FS0 G;  3JAW A;  4J10 A;  3RN4 A;  3APO A;  2CGO A;  3S3X A;  1V54 B;  2ZE6 A;  2XUM A;  3ETD A;  1R6N A;  2IU3 A;  4RUE A;  2ZDI C;  1I94 B;  1WA8 A;  3R65 A;  4KL1 A;  1NU1 H;  4IT5 A;  5B1B B;  1H2S B;  3JCU Z;  2PYL A;  2EIM C;  1K34 A;  4LWS B;  2FYU H;  4FIP C;  4XDJ A;  1NZ6 A;  2H94 A;  5IJ9 B;  1S5L Z;  2A3Q A;  2HP8 A;  3MHH C;  1XI1 A;  1CPY A;  1E1Q G;  5LGN A;  2ZXW B;  4IYI A;  4JI3 O;  4K35 A;  3ZX6 A;  2FTK A;  1KP2 A;  3FD9 A;  2UUB B;  1CEZ A;  4O4I B;  1G6U A;  4LWS A;  3FFQ A;  3ICX A;  4E4E A;  3ZJZ A;  5FLX N;  1TGO A;  3BVO A;  1YVW A;  5H6Q A;  3WFV A;  4XBF A;  5CA3 A;  5IJ9 A;  2G38 A;  1VQ8 V;  3U11 A;  3BA9 A;  4DUY B;  4H37 A;  2KQX A;  4O2B B;  4YJ3 B;  4PDR A;  5LL6 Y;  4O4I A;  2QA4 V;  1OCO B;  5IYZ B;  4LF5 O;  3JAT B;  1M93 A;  5B3S C;  5BXZ A;  1N33 O;  1TA8 A;  3T4Z A;  1IBM O;  2YXL A;  4MW3 A;  1XBL A;  2IJJ A;  4BR6 A;  4RQF A;  1GAX A;  4TV8 B;  2R9I A;  3FYI B;  4O2B A;  3JD0 A;  4YJ3 A;  4I9Q A;  1D5A A;  3HKE B;  5IYZ A;  2IU0 A;  3JAT A;  2QWR B;  5FPO A;  1YSC A;  2KB1 A;  3WU2 Z;  3C3S A;  1JFF B;  2Z5U A;  5B1N A;  1EFR G;  1H2M A;  2UU9 O;  4U3F H;  3D8C A;  1P7B A;  4IIJ B;  5CBG A;  1NH2 B;  4WFG A;  1K4D C;  1X59 A;  4UCU A;  2OYQ A;  4TV8 A;  5EYP B;  3BRC A;  2F4V O;  3HKE A;  1HR0 B;  2P4V A;  2XAF A;  1YHQ V;  3D36 A;  3CB2 A;  3W7S A;  1JFF A;  3MD0 A;  5LMU O;  4PI0 A;  3BY6 A;  1Q81 W;  4IIJ A;  5CA1 B;  4X20 B;  2E76 B;  5EYP A;  3KCY A;  4O4H B;  4BIZ A;  2X7R B;  4Z1M G;  5CMU A;  4LFC B;  2D2C B;  4RAI A;  3E86 A;  4R7C A;  1J5E O;  5FL7 G;  3TK1 A;  5CA1 A;  3UCS C;  4X20 A;  5LOV B;  2AHY A;  2WA4 A;  2QTO A;  4O4H A;  2FKX A;  3LSU A;  3VQW A;  3RYF B;  4BW5 A;  2Q8V A;  4LF9 O;  2UXC O;  2LJ2 A;  1AP5 A;  2EZO A;  3SR2 C;  4GX2 A;  2CTR A;  1XL4 A;  1M9N A;  5C8Y B;  4I50 B;  1VQ6 V;  1PP9 H;  4C7U A;  2CDY A;  2GBO A;  5CBH A;  1D5N A;  4NVP A;  5GON B;  3SJC C;  5IY5 C;  4R50 A;  2OIG A;  5LOV A;  1SQQ H;  2F1M A;  1GTO A;  3SYO A;  4GCZ A;  4J11 A;  1NTZ H;  2YEV B;  3ZCC A;  3RYF A;  2EIJ C;  3FB5 C;  3KZI Z;  4LFB O;  4DW0 A;  5C8Y A;  4EKW A;  4I50 A;  1B06 A;  1ARO P;  2B1G A;  2LFS A;  2QKC A;  3BHP A;  3K59 A;  2A7W A;  5GON A;  1H2N A;  1MZF A;  1VQM V;  2YEV A;  5A2Q N;  3N2G B;  3OW2 U;  3JCZ A;  2Y69 B;  3E89 A;  3TXS A;  4I4T B;  2DYS B;  2EBO A;  4MS2 A;  1AR5 A;  1PNK A;  1QLE C;  1Y67 A;  3E35 A;  2LQT A;  2HEP A;  4DR1 O;  4YIO A;  2DJV A;  1HNZ B;  1YJW V;  1GK9 A;  4JI2 B;  2KG7 B;  1IVS A;  3N2G A;  1VF6 C;  3WG7 B;  2WWW A;  4I4T A;  1PM9 A;  1URF A;  4CBC A;  5LP6 C;  2EIN B;  4AI8 A;  2CTW A;  4L8J A;  5KA5 A;  5EBL C;  1FXV A;  4X66 B;  1XNQ O;  1XL6 A;  1Q6I A;  3H1L H;  3DTU B;  1MSD A;  1QBZ A;  2L6L A;  4DR6 B;  2KG7 A;  2PGG A;  3ASN B;  4JYA O;  4B7K A;  1HW7 A;  3CSX A;  4DRX B;  5DM6 V;  1QLN A;  3CWB H;  2OCC C;  4X1K B;  3OMN B;  1RFY A;  4HAM A;  1OCR C;  3ASO C;  5EZY B;  2A0L A;  3STL C;  1KU9 A;  1UPG A;  2P06 A;  4PA7 A;  2EX3 A;  4JI3 B;  2EIL B;  3OT7 A;  4LF8 B;  3OUS A;  1XEQ A;  4DRX A;  1H38 A;  4DV3 B;  3CPW U;  1R3J C;  3RGB A;  2YI8 A;  4X1K A;  5IYC O;  4O2A B;  5KHI A;  5AG2 A;  1K5Q A;  1V54 C;  5H2F Z;  5EZY A;  2VQF O;  3VQX A;  4D7T A;  1K4C C;  1E1R G;  2HFE C;  4CS2 A;  4GX5 A;  4J42 A;  2V1D A;  4AIL C;  5B1B C;  4FM1 A;  1Y76 B;  3CE2 A;  4OX9 B;  3DSQ A;  4LF5 B;  4H33 A;  4JZG A;  4O2A A;  1KP3 A;  3ZN0 A;  4BWA A;  1OCC B;  1F4N A;  4JI5 B;  2JDI G;  3RYI A;  2KSD A;  2HJD A;  4TQD A;  1JA8 A;  2PYJ A;  2ZXW C;  5LHI A;  3J7A U;  1I5Y A;  2YIB D;  1Y76 A;  5KA6 A;  3CME V;  3ABM B;  1VAR A;  1N36 B;  3AK2 A;  1JX9 A;  2F43 G;  1VEW A;  1M1K W;  2UU9 B;  1SES A;  1WPX A;  5IWA O;  2K9P A;  5H5N A;  1N32 O;  2Q73 A;  1G4Y B;  5DN6 G;  3CS5 A;  4GKJ O;  1MZE A;  3ZED A;  1KB9 F;  2XTA A;  3ZHV A;  3OR7 C;  1XHZ A;  2OTL V;  1OCO C;  3CRM A;  3A0B Z;  1BE3 H;  2Q5Z A;  2QM7 A;  4LF6 O;  1EN4 A;  3TXQ A;  1PPJ H;  3QO8 A;  2Y4T A;  4MVR A;  3TJT A;  2B9Z A;  4K3A A;  3CP1 A;  4DV5 O;  3OFN G;  2Z3Y A;  5B1A B;  4DV6 B;  1TVK B;  2UUB O;  3CX5 F;  4EFB A;  4CH6 A;  4JAU A;  3D36 C;  4J7Z A;  4MVS A;  4DK1 A;  2QWP B;  4B3R O;  2OTJ V;  1LR1 A;  5D5P A;  3MAQ A;  2UXC B;  4P9O A;  5BY1 A;  1TVK A;  1HNW B;  4KFM A;  1Y66 A;  4BW9 A;  1KKD A;  2ZQM A;  5L3E A;  1ZSP A;  2QDO A;  1GO3 F;  4DYL A;  4NXN O;  2N74 A;  1DF4 A;  3RVZ A;  4KP4 A;  4I5S A;  4DV2 B;  3E8H A;  5IT9 N;  4GKK B;  2DN9 A;  4ASU G;  1SQV H;  3ZMS A;  4FJC C;  1YJN V;  1KYO F;  2WLN A;  3CCR V;  1COW G;  1CXZ B;  3PN1 A;  4UB6 Z;  1LNQ A;  1HR0 O;  2JIZ G;  3A8T A;  4DR1 B;  3L9D A;  5LGU A;  4DK0 A;  1XDC A;  5KHG A;  3UO2 A;  2FML A;  2MW2 B;  1Q90 D;  2LW7 A;  1Q7Y W;  4DR2 O;  5B1O A;  4BAY A;  2Q69 A;  1EN5 A;  3K5N A;  2AZ0 A;  3ZRW B;  2UUC O;  2YXY A;  1GN3 A;  2ARH A;  3FX7 A;  3K0D A;  3FAV B;  3P3P A;  4YJ2 B;  3W7U A;  1R3L C;  2RJZ A;  4U7N A;  4JYC A;  4U3J B;  1Q82 W;  3CC7 V;  3K79 A;  3OGC C;  1XIL A;  3CMA V;  5CA0 B;  5TIS Z;  3L72 H;  3ZRW A;  1YEW A;  1QLE B;  1L0N H;  1QQC A;  2DYS C;  2Q9L A;  4YXW G;  3FAV A;  3MDS A;  4YJ2 A;  3QO7 A;  5LYJ B;  3IJ4 A;  2ZCE A;  3K58 A;  3SJQ C;  1TUE B;  4U3J A;  3SPJ A;  2QWO B;  1W0K G;  2LO1 A;  1OCZ B;  4PV1 B;  4GYC B;  4PD4 F;  1RSO B;  1K7D A;  1AJP A;  1QU7 A;  3WG7 C;  1VF5 B;  2EIN C;  2ZNJ A;  1OHH G;  4X65 B;  1PD3 A;  3B8N A;  5J2U B;  1VQ7 V;  1M56 B;  2VQF B;  5LYJ A;  4F6E A;  2NR5 A;  3ZMZ A;  1GRJ A;  4JPR A;  2GDS A;  1T5E A;  2CGN A;  1BMF G;  1RSO A;  1QR8 A;  4LFA O;  4UCO A;  1NI8 A;  4FLV A;  1W59 A;  1ROP A;  4LF4 B;  2Q7E A;  3ASN C;  4F6R B;  3SJA C;  5CB4 B;  1GM9 A;  1Q5O A;  5J2U A;  4TWK A;  5KUK A;  4OGQ B;  3G6B A;  2YS8 A;  3C3T A;  1NVP D;  1S76 D;  3HPL C;  2QKA A;  2KKW A;  2P7T C;  1HNZ O;  4DR7 O;  1R6T A;  4JI2 O;  3ZMV A;  2EIL C;  2IW5 A;  4F6R A;  3ZBH A;  5CB4 A;  5EBM C;  5IWA B;  4X66 O;  1Q6U A;  3GB7 C;  1N32 B;  2Q0O C;  3SYC A;  4GKJ B;  2UXX A;  5KHH A;  1L8D A;  1K8A W;  4DR6 O;  4Z1V A;  3GWK C;  1JCH A;  3E22 B;  3H9V A;  1U97 A;  3F7Y C;  3CC2 V;  1RPO A;  3K5M A;  1VQP V;  1RPR A;  2AZ2 A;  4LF6 B;  1OCC C;  5L3B A;  1M57 B;  1VIB A;  3AG3 B;  4O4J B;  4DV5 B;  1JJ2 U;  4CS3 A;  3E22 A;  4EB6 B;  5FNV B;  4LF8 O;  2BOC C;  1XNR B;  3EXA A;  2VQE B;  1WB8 A;  1YIJ V;  1IXB A;  3ABM C;  4DV3 O;  3ZHU A;  4FPP A;  3OR6 C;  1XRE A;  3BEH A;  1L0L H;  4NTW A;  3LNM B;  4B3R B;  3FB8 C;  2JJ2 G;  3O9O A;  2X6B A;  1I0H A;  3DC5 A;  4O4J A;  1BQ0 A;  1O9H A;  2BOB C;  3SYP A;  1S72 V;  2PZS A;  4EB6 A;  2XND G;  4LC1 A;  5FNV A;  1LUW A;  2HJF C;  4OX9 O;  3D3I A;  5LHG A;  4PDM A;  3CHX A;  4W4L A;  2BTO A;  2XAJ A;  1Z2G A;  1SC5 B;  1I08 A;  4JI5 O;  4NXN B;  2GTS A;  3OGI B;  1SS3 A;  2F95 B;  1DK1 A;  1BCC H;  4FLU A;  3E2E A;  4WCE V;  3AG7 A;  1FFT B;  5B1A C;  1KQS U;  4JAV A;  4JYB A;  1N36 O;  4UCT A;  4NTX A;  3ABL B;  3H01 A;  1K9M W;  4JF3 A;  1Y74 B;  2XAG A;  5BZB A;  3G71 V;  2N04 A;  4EEQ A;  4RQE A;  1WPB A;  2E3C A;  3CD6 V;  2AXT Z;  4H13 B;  1EM1 A;  4UFZ A;  3ZIA G;  1YTF D;  2ETN A;  1JPX A;  2DYR B;  3HKC B;  4ZBM A;  2F93 B;  5JJE B;  1Y74 A;  4DR2 B;  2W6J G;  1D2D A;  3ABT A;  1DF5 A;  1N4C A;  4I55 B;  2ADP A;  4PA9 A;  5KUM A;  2UUC B;  5JQG B;  4DV6 O;  2Z0A A;  1QR9 A;  3BAB A;  3VBB A;  2ZE8 A;  2WLM A;  3BPZ A;  3HKC A;  4DR4 B;  4FMT A;  4I55 A;  2CH7 B;  1N34 O;  5LGT A;  2FB5 A;  3JAR B;  5JQG A;  4H44 B;  1K97 A;  4J7K A;  1HNW O;  3RFR A;  1H8E G;  3JD2 A;  4JI7 B;  3JSN A;  2XAH A;  3SPI A;  4PI2 A;  3DGE A;  1AJQ A;  1DLB A;  1B6Q A;  1Z5V A;  4DV4 B;  2CH7 A;  1S0V A;  4NB5 A;  3JAR A;  5JVD B;  4DV2 O;  4O4L B;  3THO A;  2WLK A;  4FLW A;  3RYC A;  4ABM A;  3T2M A;  4LH6 A;  2QEX V;  4B7E A;  1ZLZ A;  4GKK O;  4W4K A;  3A0R A;  2MK3 A;  4R6Z A;  2DOS A;  1YZB A;  4B3T O;  3ETE A;  4JI4 B;  3K03 A;  4JGS A;  4HYO A;  5HFM A;  4LFA B;  5JVD A;  4O4L A;  3QTC A;  1KUQ A;  4JAS A;  5EIB D;  3ZMT A;  2ADQ B;  5B66 Z;  3OMA B;  4GT1 A;  2ZKO A;  4DV7 B;  2YSU B;  2VWJ A;  3I55 V;  3WB0 A;  4DR7 B;  2HLD G;  1OCZ C;  3R66 A;  5L3D A;  4NKG B;  4X64 O;  4DV1 B;  2YI9 A;  2GHY A;  3AK3 A;  1MAB G;  1KD1 W;  1MG1 A;  3SPG A;  3JAL B;  1IXM A;  2P22 C;  1NTK H;  1P7G A;  3JD3 A;  1M56 C;  4MTF A;  3OEE G;  4X8A A;  1SET A;  4XDL A;  1B3Q A;  4CS4 A;  3K0G A;  4TSF G;  4X1I B;  2XAS A;  3SYA A;  3JAL A;  2YIB A;  2BTQ B;  4FFB B;  5LA6 B;  1NKD A;  3B40 A;  4X9Q A;  1YI2 V;  1BHA A;  4PA4 A;  3RBZ A;  1PL4 A;  1OJH A;  4KUM A;  1YIT V;  1YDX A;  4X1I A;  4QIW F;  4X62 O;  3W7W A;  2BTQ A;  4FFB A;  5LA6 A;  1N0J A;  1ZX3 A;  3OAA G;  4GX0 A;  4X65 O;  2E75 B;  3U0Z A;  1SQX H;  1GM7 A;  1S5H C;  2V7Q G;  4G28 B;  4QPK A;  1YCI A;  3RYI B;  3QVN A;  1PNM A;  4PA6 A;  1ZL8 A;  3P30 A;  4I0X B;  3DXR B;  3ZHQ A;  3WB1 A;  4LF4 O;  3TCU A;  4OXS A;  1YF2 A;  1HDJ A;  4LBE C;  2OT5 A;  4MT8 A;  1R1B A;  3LSQ A;  2W0X A;  1Z5W A;  3JSL A;  1M57 C;  1NS1 A;  3AG3 C;  4I0X A;  4B08 A;  4YIP A;  3DXR A;  3WB2 A;  4WFA V;  3M8A A;  3ZS8 C;  3B4S A;  4A5U B;  2P4K A;  3QF7 A;  2DQ0 A;  5KHK A;  3ABU A;  3CJH B;  1QNM A;  4FLT A;  3QNE A;  3AG2 B;  3QG5 A;  5E1A C;  1DGS A;  1PV0 A;  1R6K A;  3L75 H;  2EIK B;  2H3O A;  2IH1 C;  1FXK B;  1AB3 A;  2ZT9 B;  2Q4P A;  4J7J A;  1V55 B;  3SPH A;  2OIE A;  3UO3 A;  4K8X A;  1HWY A;  2ZM6 B;  4QJF B;  1GM8 A;  3CJH A;  1OZ0 A;  3FB6 C;  3W7T A;  1K73 W;  4NXM O;  4I7Z B;  2JS3 A;  3EVK A;  5BMV B;  1FXK A;  1SKV A;  4D7S A;  2PTM A;  3T1Y B;  3P32 A;  4FLZ A;  1XNR O;  1B04 A;  2VQE O;  4GLX A;  1N8R W;  3CRC A;  1THZ A;  2HVJ C;  3P3N A;  4CC5 A;  3ABL C;  5JCO A;  1BZK A;  3J81 N;  5BMV A;  1N34 B;  5JJJ B;  2W0F C;  1FFX A;  3VQY A;  4B3S B;  2C2A A;  3FKS G;  3SYQ A;  3LDE A;  3CCS V;  4WBN B;  1JVM A;  2X6A A;  2ZNI A;  4KXR A;  2DYR C;  2A9H A;  3CRA A;  5IJ0 B;  2D3O W;  1DTO A;  1NTM H;  1CP9 A;  2CTP A;  3B8M A;  3CCJ V;  2UXB O;  1YJ9 V;  4Q20 A;  4WBN A;  3H1J H;  3D3Q A;  2NN4 A;  2WLI B;  2YUA A;  2WLH A;  3L70 H;  4B3T B;  2DE0 X;  2FL4 A;  2EJ7 A;  5IJ0 A;  4MTO A;  1VF7 A;  2WA3 A;  4CZZ A;  4QNH B;  3J80 N;  1SRY A;  3LDD A;  4FM0 A;  1FD9 A;  1XQ8 A;  2UXD B;  3OUF A;  3H1K H;  2PI4 A;  2IJH A;  2GTA A;  3CXC U;  4TQF A;  5FPR A;  2P90 A;  1BQZ A;  3X2Q B;  2JS5 A;  2WLI A;  2DWE C;  1Q6H A;  4UCR A;  3C90 A;  2DMX A;  3OTO O;  4UUJ C;  2EJR A;  1FJG B;  4X64 B;  1NVP B;  4R8C A;  1W2B U;  2UUA B;  3MHS C;  2F23 A;  2Q7H A;  4RUF A;  4MW8 A;  1K92 A;  5CBF A;  2YXH A;  3CRR A;  2RCV A;  2Y48 A;  4DR4 O;  3ZMU A;  2Q7G A;  4MVO A;  3BCC H;  5KAF Z;  3SJB C;  1R3K C;  4NR1 A;  2HHH O;  4DXW A;  3KKY A;  4YHH O;  2Q6A A;  2PF4 E;  2LW1 A;  3OEH G;  2ZIO A;  5LHH A;  4UVB A;  4JI7 O;  4J9Y B;  4LF7 B;  2W6I G;  3JAS B;  1XMO O;  4TT3 G;  2OCH A;  3M7M X;  4HNA B;  4WFF A;  1XMQ B;  4GX1 A;  4JAA A;  4DV4 O;  1I5X A;  1R73 A;  4X62 B;  5KMG B;  3LUT B;  4PA3 A;  3CRQ A;  2ZD9 A;  3CCU V;  4AQY B;  4JI6 B;  5L3F A;  1TUB B;  3JAS A;  1EBO A;  3SDL A;  2YIC A;  2VWK A;  2JEX A;  4HNA A;  3KCX A;  2Q0A A;  1FKA O;  4JI4 O;  2NLJ C;  4QE7 A;  5J2T B;  4MTG A;  3APQ A;  3JD4 A;  2EZP A;  2GSM B;  5KMG A;  1BS3 A;  4ZIB A;  2JJ1 G;  4LP8 A;  4K0K O;  1WAZ A;  1AI6 A;  1TUB A;  2RQ6 A;  4DV7 O;  5CN0 A;  4MVU A;  2M7W A;  4NYK A;  1XHX A;  5JWP A;  3G4S V;  5E79 Z;  5J2T A;  1GMG A;  1M4U A;  5LMN B;  1X4T A;  4DV1 O;  1KKC A;  3T1C A;  3CCE V;  3UT5 A;  2E5L B;  3E8F A;  3Q4H B;  1SA0 B;  2WAM A;  3L71 H;  1Y4M A;  3ZRX A;  4DUZ O;  3K3W A;  5EK0 A;  1GN2 A;  2NNU A;  4PDL A;  2JK5 C;  5H6R A;  2RN9 A;  3OE7 G;  3Q4H A;  1SA0 A;  2ILM A;  1HNX O;  4GUN A;  4JTC B;  4PDV A;  4NXM B;  1P4R A;  2PUS A;  1YTF B;  4P2Z A;  1ZAU A;  4JV5 B;  1NBM G;  3CCV V;  4N21 A;  4AHC A;  2A79 B;  5LBQ A;  4L87 A;  1SZX A;  1MA1 A;  2Y0I A;  2VS0 A;  1QCE A;  1FPO A;  2XT9 A;  4DV0 B;  4UV8 A;  2JVD A;  4DW1 A;  3ETQ A;  3AG2 C;  3K06 A;  4FM2 A;  2EIK C;  3K04 A;  3ABK B;  1FXK C;  2BE3 A;  3G80 A;  3JAK B;  1V55 C;  2AGA A;  1WP8 A;  3ZRV A;  1TAE A;  2M6Y A;  3CCL V;  1GKF A;  1K3E A;  3T1H B;  4IGG A;  1EZV H;  5L3G A;  1GN6 A;  2R9R B;  3UM7 A;  4MVZ A;  4BIU A;  1F51 A;  5JCO C;  3HKD B;  4PEL A;  1RM1 B;  1NT2 B;  2UXB B;  3JAK A;  4X1Y B;  1VP7 A;  5IDJ A; 
#chains in the Genus database with same CATH homology
 5B66 Z;  5GTH Z;  3KZI Z;  5KAF Z;  1S5L Z;  5TIS Z;  3A0B Z;  4PJ0 Z;  5GTI Z;  3A0H Z;  2AXT Z;  4UB6 Z;  4UB8 Z;  4IL6 Z;  5B5E Z;  5KAI Z;  3WU2 Z;  3JCU Z;  5E79 Z;  5H2F Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...