4JAAA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
328
Chain Sequence
ALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 102
structure length 328
sequence length 328
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4jaaA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jaaA01
2WA4A 1H2MA 2XUMA 3KCXA 1YCIA 2W0XA 1H2LA 4AI8A 2Y0IA 1H2NA 3P3NA 1IZ3A 4B7EA 1MZFA 2YDEA 2ILMA 4Z1VA 4Z2WA 4NR1A 4JAAA 1H2KA 2CGOA 2CGNA 3D8CA 3KCYA 4BIOA 1MZEA 4B7KA 3OD4A 3P3PA 4QU2A 2WA3A 5JWPA 2YC0A
chains in the Genus database with same CATH superfamily
4CDQC 4F6RB 1P84F 1ULCA 4BYYA 4LFBB 3HQXA 2PI5A 4UFMA 5I91A 2J1VA 5GZGA 1V0AA 5KXBA 1UPSA 4NHLA 3CLPA 4DB5A 1AI5A 4AHWA 3HQRA 1Y43B 3CP1A 2HJFC 5ACA1 2XVLA 4IESA 1XXNA 3UJOA 5FIXA 1COV1 2N74A 1WA8B 3OMAB 4XF9A 3ZFGB 1FOD3 1LHUA 3TK1A 3CS5A 2B4KA 3K51A 1A34A 2JB8A 3ME2A 2Y0OA 2LGWA 5FUIA 4B3TB 2UWAA 4DR3O 2GTAA 1ASJ2 1YRZA 1RHI2 3AG3C 2VQEB 1I3HA 1R082 2ZHLA 3ZYPA 4B08A 3ASIA 1RUC1 2ARXA 2HG5C 4DXWA 5IFPA 4FPKA 3N2KA 4JI3O 1VF6C 4OHWA 5JH7A 1XOUA 3PDQA 5LXTB 1OPOA 3DTUB 3J7LA 2EBOA 1N1YA 4N9IA 3JAMN 4XJWA 4BQ3A 5F32A 4UUJC 5JJNB 2XHNA 1IS4A 1F4MA 3T1HB 4B3MO 3NO8A 3RG0A 3S5QA 3LDDA 4P14A 5ITZB 2UXNA 4JGZA 5FYVA 4NAOA 1SDWA 2MEV3 2LW7A 2ZHMA 2NNUA 1FOD2 3WCRA 4NHXA 3UK9A 2YDEA 2XBO1 3ORJA 4GX1A 4WM8B 5EZYA 1H4GA 2JICA 4DV3B 2WZR3 4F7ZA 4B8EA 1H4HA 1BSMA 1J58A 1O8PA 4JI1B 4L11A 1N0NA 3VHRA 4R4ZA 4OI0A 3JSLA 4YM1A 1UYPA 1E1QG 5B2GB 1OFNA 3FE5A 3ALQA 4O9GA 3NNMA 1ORQC 4DW1A 4TWKA 2UXDB 3EYPA 5BNPB 1XL6A 2Q0AA 1MA1A 3JU9A 1I7FA 2VC9A 5FYMA 1XMOO 3W21A 4LE4A 4AQYO 4J1XA 2WLJA 4XDJA 4XC9A 5CZKA 5JMOA 1AX1A 2D2CB 4QKDA 4QX3A 5IWAO 3CCJV 4MVQA 1HRV1 4TUYA 2Z0AA 4QU1A 3ZXGA 3FFZA 1P49A 1EN5A 1ZTEA 4FMTA 1SBDA 4XDQA 4YZ1A 3K5MA 3VZNA 4LTAA 5JUVA 1GN6A 5HV4A 4OUEA 4WVMB 2MEV2 3TWIA 2W5FA 3OTOO 4IW3A 3KM5A 4UV9A 3THOA 4N43B 1YUDA 3DPRA 3W7SA 4JGYC 2ZE7A 5JI9A 2WZR2 5FJKA 2HVJC 1ZRFA 2RQ6A 1JYTA 4FOWA 5M0TA 2YIBA 4MO3M 1WCUA 4RN5A 3GF6A 2ARAA 5FP7A 3B3QE 1T5EA 4LKFA 1AYM3 1VQ7V 5C9AB 3O1TA 2F66C 2VW1A 1IBLO 1HNZB 2Q30A 3NAPC 2HWC3 2BEOA 1XI1A 3SCGA 3UGGA 4D6RA 5C8CC 3WLUA 4OHZA 3B02A 1XDCA 5IK8A 2XGXA 3E97A 4XIKA 3ACFA 3USSA 2ZGNA 4I50B 4GMP1 4LNVA 3VDDB 4BDVB 1F8VA 2EXJA 4XDOA 1YNAA 1L8DA 3DUIA 3VBHB 1S5LZ 2R30A 4O7XA 2ZEXA 2RS53 2NM1A 3IDBB 5BNOC 2DU0A 5IAXA 1GAXA 3WNLA 1C1LA 2WO1A 2RS11 5J2UA 1OA3A 1XUQA 4QPGA 5FZOB 3MD0A 1PGW2 1RTVA 3SDLA 4XFGA 2IVJA 4OI2A 3WHTA 2P1BA 4CEYC 4UFKA 3AL6A 3AMQA 1W6OB 5FZ4A 2VMCA 3ZX7A 2XB6C 4DV0O 3HNMA 3UO2A 2X8KA 1BK1A 2R041 3AM2A 4CP1A 5DXDA 1J95A 4IL6Z 2VBBA 3STLC 3DN7A 3HKDA 3H42B 4P2ZA 1J59A 1W6QB 1V6KA 1AYM2 3H1LH 5FMBA 2YI8A 5EFUA 2E63A 4GWNA 4XBFA 3F5TA 2HWC2 1TEIA 2Y64A 4LO8A 3JD2A 3ILFA 4LUMA 1S0GA 3ZXFA 2CYFA 5JCOA 4QX2A 3N9NA 4XBQA 2QSAA 2PF4E 3O1SA 3OSDA 3RYHB 4LEJA 2ERFA 4UCVA 2FDIA 4AQ6A 2ZGMA 2MW2B 4QE7A 2WRAA 4BQ4A 5A6QA 1VQNV 2CGNA 5IJ9B 4QPKA 1J3PA 2DYRC 4FP3A 1MABG 2ZMLA 3V0BA 3KZIZ 1BMV2 2QKDA 3X29B 4CXXA 4QAWA 1ZZCA 5DECA 5FTTC 5B4XA 4UCSA 3RQ0A 4FLVA 4KGQA 1MZ6A 4RGAA 5DAPA 3S3XA 3ZXLA 5B1BC 1N33B 3NKGA 2RJZA 3VN4A 1J5EB 5FL7G 2ZINA 1AUYA 4UCOA 5KHJA 1S0EA 1PV0A 1YJKA 3AC0A 4UF0B 2PTMA 1WMEA 5IVBA 1AL21 4DO0A 1HNWB 5DABA 1W9SA 3FWEA 1TNRA 5FO8B 2VJXA 2UY8A 4X66B 2XLFA 2ODMA 3OR7C 1NZ6A 1QLNA 5EYYA 3M3OA 2YROA 4HNAA 4JTCB 3U07A 2D5HA 1VBA3 1SQBH 1SS3A 4BHPA 4LF4O 1QY4A 2Q69A 4UI9L 1UOFA 1MQTA 2G1MA 5FMOS 4COWA 4YHHB 2M6YA 4X1YB 2YBKA 1ZBE3 3L74H 5FBJA 4HL0A 2VUJA 1PL4A 5K0UA 1IG3A 4J1WA 2L35A 1YFUA 1BHBA 3R4SA 1XNCA 4MVZA 2JGDB 5FYIA 3M70A 5LHIA 1GWMA 3THCA 3DSQA 1I6XA 4NWVA 4XJ9A 1HRI1 1NCRC 4HKLA 2VM9A 4QQHA 4TQFA 2ZMKA 4AVVA 1WW4A 4HOOA 1Z0HA 3NJXA 5KC6A 3LUTB 3ZN5A 4V2WA 2QQJA 1GNYA 3SCFA 4ZXKA 2JG8A 2CSGA 4GJZA 3DC5A 3VD3A 1QEXA 5C7GA 4K6BA 5JQGA 3GALA 3BIWE 2DF7A 4OCTA 4TQDA 1KS5A 1A8DA 4LF8O 1WKYA 2HLDG 3ZSKA 3ZKUA 2Q1MA 2GAUA 4M3CB 4CDXB 2XASA 1CPYA 1H8EG 4BIUA 3WF1A 4AXOA 1PP9H 4OHYA 1CAWB 3MZHA 1VBA2 5EXOA 1Y66A 3CSXA 1QNWA 1Z7S1 3VOUA 4QKFA 3JATB 4LUKA 1UN1A 3WG2A 1BVVA 4GZ9A 1K4DC 2YICA 4LE3A 4IETA 1RUH3 2Q1FA 1ULGA 2MEV1 1VRBA 1ZL8A 1WCQA 2DUPA 1LU1A 1LAJA 1Q86W 1UWWA 3S30A 2CY6A 3JYCA 3UJQA 1CONA 1GP4A 2WZR1 3GM8A 1HB3A 1X9PA 4JHTA 3ASNB 1IQAA 4AQ2A 2HEWF 1B35C 2EILC 1EY2A 3CQOA 1RUE3 4UB8Z 3BEHA 4Q4V1 2C24A 4O4IB 3RZZA 3K06A 4UWDA 1OCOC 4MW8A 1XQ8A 3K46A 5F2SA 3JD71 2GZWA 1W6MB 3I3DA 4ARYA 4LA3A 3FX7A 1LNQA 1KBHA 1RUG3 3NL1A 5B4NA 3ZRXA 3BTZA 4Q26A 2A6WA 1Q5OA 1IPJA 4R4XA 4JYAO 3IWZA 3LIGA 1F2NA 1DZTA 2ZMNA 3HKBB 3LDBA 1WLWA 1WPBA 1YI7A 2GDFA 3VBFB 5FYHA 3ML0A 4YVSC 3RYIA 1ST8A 1JOYA 1D2SA 5J7MA 3VKFC 3HT2A 3TYJA 4LXLA 2EINC 1UOBA 1KJLA 3PVEA 1PGW1 2DBNA 4FFHA 1O4YA 2HBUA 4JAAA 1VBB3 1RUH2 2VW2A 5JMCA 2P06A 4G2KA 2PHFA 2X53S 2DWEC 4D94A 4DV2O 3RWKX 4DW0A 2JDYA 1NI8A 3G80A 1BL8A 3WDYA 5E89A 2VL4A 3UT5B 2Q8OA 1NCQA 1MS5A 4JI6B 1W06A 1SLBA 1U5XA 1QHTA 1WP7A 1EUUA 3K79A 1RUE2 1W8HA 3W20A 4IEWA 1AYM1 2DVAA 1RUNA 2BFUS 1PNGA 1VB2A 3PU8A 5C8YB 2A1XA 4UXAA 2EIMB 4Y1YA 1LENA 1UYZA 1IKPA 2RMU1 3LPGA 1RUG2 1VQ4V 2VCAA 2PYTA 3D8CA 3ZBHA 3CD6V 3CRQA 3AZXA 4JGZC 1UX7A 2ZX2A 1OZ0A 1EZVH 4RS5B 5KA6A 3D3IA 2BBAA 5F3IA 4RGGA 5ANNA 1UJWB 1XRUA 4PI0A 2VOTA 1AILA 3T2MA 1JPXA 2AREA 1F9KA 1JH5A 3ZPYA 2RS51 4YFWA 4TYSA 4JQTA 3ZHRA 3G6BA 3USUB 4DUWA 4C91A 1VB4A 5LASA 4W4LA 4W6YA 1WBFA 2VMFA 5GLZA 4C1XA 1OQ1A 3FUQA 3BKZA 2Q6AA 5CISA 4GH4A 4K20A 1VBB2 1PHMA 1BMV1 3WQBA 1ZA4A 5TSWA 3V65A 2IJHA 2OIGA 4KI5M 2GU9A 1I0HA 2G4IA 2DTYA 4QXKA 2AC1A 1KRIA 5JPNB 2Y4UA 5A80A 1OKOA 5AVAA 3EVKA 1BK0A 1GKFA 3O1VA 4B3RO 4DS0A 2BOCC 1ZZ7A 2WLLB 5L19A 4TN7A 4NTWA 2WLIA 1GN4A 2RMKB 4MVOA 3SISA 4E9KA 1SZTA 2WSUA 3OJBA 1GZTA 3WP3A 5C3RA 2K0GA 5LW9A 5IVJA 3I2IA 5A7WB 3RZKA 3DECA 2CK3G 2WSVA 3DPRC 1WNSA 4X64B 3KF3A 1JZ6A 3R6SA 1ND3B 1LHNA 2DYSB 3GJAA 3E8FA 1PNKA 5CBHA 1GH6A 3ZFFB 3CPWU 2WLHA 1GM9A 3SH3A 4PDWA 4JI4B 3U4SA 1KITA 2B1GA 4JV5B 2EXKA 1UYYA 2EXHA 1AXZA 2WWWA 2GC3A 4FBFA 1M57C 3JBG3 2VMEA 2AH2A 1JZ4A 4FPFA 4CDQB 2VY0A 2UXCB 3FJSA 1NT0A 4OQ9A 1NKDA 3LFIA 2W1WA 3N9OA 2V5DA 1NS1A 4UT5A 4ATEA 1PK6A 1F35A 3MDPA 3IM0A 2OVUA 1VBC1 3HNYM 4XTMA 2WBKA 4ZS2A 1YHFA 1VP6A 1Y9GA 4XQDA 1P7GA 3K77A 1DK1A 4X8NA 4FFBB 1ZNPA 2EZPA 1KKCA 4Z07A 3QO5A 4QPGC 5GLWA 1I94B 2IH3C 1PVXA 1NBMG 1H8VA 3CNAA 1VBA1 4R50A 3RSJA 4AI3A 2Q68A 4LCUC 2CH7B 2UURA 4FPJA 1KYOF 3WB2A 4ZBMA 5C4WA 1ZBE1 3DEMA 3PNAA 1SG3A 1M93A 1GQGA 1IGOA 2AEYA 4AFCA 4HT1T 4YW7A 1RM1C 4IEUA 1NH2B 4AR2A 1HN1A 2CDOA 1HLCA 1X33A 1HWYA 1D2QA 4Y1VA 3AL5A 1FJGB 4ZKIA 3WSOA 4E2QA 1O9GA 5DG2A 4BMEA 4I01A 5KHKA 5IYDO 4WV8A 5B1AB 3IPVA 1SFNA 2VZ1A 1W2NA 4FM2A 3EB7A 1PMHX 2DMXA 3I3BA 1YQ5A 1IDSA 1QVGU 3BB6A 5C70A 2E7QA 4XEZA 1RJ7A 2JECA 3QH6A 1HV1A 3ETQA 3HWJA 3J26N 3ZS8C 4MGTA 4BA6A 5L7OB 4QJFB 2QVSB 4K0KO 3I54A 4D7SA 1R1ZA 2D3SA 5A3PA 3LCPA 5FR3A 5LZ6A 1AYN3 1R3JC 1FXVA 1W8ZA 1LGBA 5LMNB 2BOJA 3S57A 3VBUA 3W5MA 2R9RB 1QQCA 2HKOA 1XYNA 1RUJ3 1OPMA 4LKDA 2AGSA 3VZOA 2GC2A 3T1HO 4JI2O 2QWQB 1BHGA 1LODA 2L9LA 4LBQA 1GICA 1YIPA 4PF5A 3I2OA 4PDLA 1DQ0A 2ZQMA 4WFEA 2A75A 5A7NA 4AZZA 1GP6A 1WBLA 1QU0A 3O7OA 2DTWA 4Y20A 3HKEA 1MQTC 4DV3O 2AW9A 4H7MA 4P9LA 3SGIA 3OGRA 4LWSA 2Z5WA 4ABMA 1XSQA 2G19A 2IFRA 3I2KA 3F7VC 4CVUA 1FPN3 5CA3A 3WW3A 4BQWA 3JAKA 1UAIA 2V09A 3RYFA 4X62B 4D69A 2TNFA 3T2TA 2UXBO 2O8QA 5CB7A 2XJPA 1VP7A 2E7TA 5DQ0A 3JARA 1AYN2 2BSKA 3INAA 3R4UA 2Z5UA 1V9U2 3ZJZA 3BYWA 1UY0A 4CCEA 4Q6GA 1K5MA 3QCWA 5FDBA 4QXCA 1M56C 2JDHA 4DXRA 3H0OA 2JG8C 2V72A 3OD0A 2W3JA 4LIVA 5FZLA 2YFUA 2Y6JA 4AEJA 5C8CB 1G8MA 3ENRA 5LA0A 2LRPA 1CAXA 1AF9A 1TMF3 2VCCA 3GBGA 4XF0A 1DGSA 4C8DA 1W0KG 1K45A 2K9ZA 2FDJA 2YXLA 3GGLA 5A33B 1JX9A 4EFEA 3AJZA 2QM4A 1DF5A 3FB6C 4YVWA 2C5DA 1JYNA 3SPCA 3UESA 5IVYA 4W4KA 2OT5A 5K8SA 5FPAA 1X8EA 5GZEA 4QX7A 1GWLA 5H9RA 2W94A 1HDJA 4P5HA 2EX3A 1YI2V 1QJX3 1FPN2 4QQ2A 4MHUA 1H8TC 4CYDA 2VZVA 3H3UA 1TQ5A 3FLPA 4UOJA 1YC61 3H01A 2JIZG 4DEVA 5HV0A 5L3FA 2KQXA 4XDLA 4P9OA 3T3YA 4PQQA 4CH5A 4PA7A 4PBOA 2YIDA 1LOAA 4IV1C 1H8HG 5KX5A 4LNUA 2VGDA 4X1KA 3VDAA 1D5NA 4JRLA 4QNHB 3E89A 4BOWA 3MW4A 4J11A 2E6VA 2ZE6A 2XQRA 3D5OA 3OTFA 1TMF2 4BQXA 5A3TA 1DBNA 4GULA 2HWF2 1LB2A 1W2UA 3NNJA 2Z2SB 1IG0A 2KD7A 4KWUA 1LEDA 4NIGA 4DV7B 3L9JT 3KWVA 3QH7A 1W28A 3ZFGA 1S55A 5JZGC 3JASB 3M4FA 2JEMA 2QQUA 4HZ3A 4LR3A 3RYCA 1BMFG 1HR0B 3DV8A 4OMCA 5A3MA 2ZACA 3I56V 2XDVA 5J9PC 1POV3 4LITA 3ZN0A 3SPGA 3Q8CA 5EJ1B 3K57A 3PTRB 1J3RA 1QJX2 3WNOA 4CCKA 4B1LA 4DK0A 4JTNA 4HETA 2WN2A 2D97A 1SA0A 1QJEA 5F3EA 2OUJA 5IVCA 3OM3B 1NCQC 1PGL1 2RDRA 4HLTA 5JXHA 1U96A 4FPYA 2BGCA 1GFF2 4DUYO 3FYIB 1ZRIA 1B04A 2WNEA 1YTFB 3L2HA 2SBAA 4FPLA 2ZCEA 4XF4A 3JBG1 1XEQA 5JI7A 4URAA 4H13B 1OLME 4W4ZA 5AVPA 4RAIA 2A3XA 1SDDB 2YPJA 1JUHA 2VMIA 4LQRA 4OPAA 4AK3A 1FD9A 1D4VB 2R063 4P30A 5FO9B 2DFCA 1PO13 2W0FC 4ZPIA 1N33O 2UU9B 1YJWV 1Y74B 1RXGA 4Q0VA 1J5EO 2XR4A 4GH4C 3QD6A 4AQTA 4KMQA 3BVOA 3DL3A 1ULPA 2BWCA 5CA0A 4JI8B 3MIDA 1SBEA 3SXWA 1WB7A 3AZYA 1HNWO 1YF2A 1O6UA 5K1PA 2WQ8A 4AEDB 4QX8A 2WFF3 4P9GA 4X66O 4GCZA 2ZX3A 2JIJA 5IY5C 2VAUA 4RFRB 1ROPA 2YC2A 4LO6B 2BDRA 1NQJA 2UUAB 1NG0A 1Y76A 2OCCC 2GMPA 5FP9A 2DDUA 2ZGSA 2WUHA 1UOGA 1OF3A 3CC4V 5IVVA 1R093 3LF7A 4EKWA 4YHHO 3A8TA 4JKMA 2DU1A 3FLRA 4EN9B 4TLGA 2E51A 3ABMB 1XE0A 5CB4A 3NNGA 2K1EA 3HT1A 3QVNA 3K5NA 4JDNA 3VLBB 1BKZA 1S2EA 2VTFA 2R062 1RPOA 4WVMA 4EWAA 1PO12 4BR6A 4LR4A 2UUCB 3T1CA 4FFKA 3IIAA 5EJ3A 1O5LA 2PHUA 1S0FA 5BMVA 2Q8DA 4PDWC 2WFPA 5FRAA 2AZ5A 2C9KA 2HKXA 2XOKG 4Q8KA 1DFQA 4OI4A 3HKCA 1X82A 2ZOEB 4HANA 3AYAA 5T54A 1TUEB 5F2WA 1AYN1 4TZDA 2EILB 3MPBA 3IMMA 3WDUA 4LT5A 5LHHA 1G4YB 4FLYA 2CV6A 2QQPA 4EN7B 1OCOB 3DXUA 1PK6C 3ILRA 2E76B 5DZGA 1Y4WA 4AVCA 3T4ZA 3LD8A 1RUJ1 4GJYA 1KD7A 4DXZA 1FS0G 1V55C 1OC1A 4DV5O 1R092 4BQ2A 2Y60A 5EC2C 1L0LH 3L71H 3VBHA 1NQTA 5IT6A 2JEUA 4ORFA 1IQDC 4R7CA 4MT8A 3O1OA 3OMNB 3U0ZA 5C4WC 1REDA 3SYAA 2QTOA 4JRAA 1VQ6V 5EK0A 1LOCA 1GUIA 3ETGA 4UYBA 1H1MA 1W6OA 1G6UA 2YEVB 4XUTA 4MUVA 3HQUA 3SMHA 1ZZ9A 1POV0 1YTFD 2VNOA 1EUTA 3N2KB 4WM7C 3ZFEA 2WA4A 5LP6A 1WCDJ 4FQ4A 1PM9A 3OGVA 2D6NA 4RQPA 4RR3A 5JH7B 3L2YA 4YW2A 2X10A 1W0JG 1GWKA 2IXCA 3L9DA 4B4QA 3K9AA 3POEA 5CBFA 3ZN6A 1SQQH 2HHHO 4P9WA 4YW1A 4BXSV 2VW0A 1BCCH 4LLOA 3NVCA 4GB31 2JX9A 1R6NA 4AAPA 2DN9A 5BYNA 3W5NA 4CSWA 5IJ9A 3P3NA 5I0UA 3KMHA 2LS6A 3TRSB 4MGQA 3ABKC 1H2SB 2D6PA 1ENSA 4WVWA 1MVQA 4OX9B 3LKJA 3N9QA 2HWB2 1QJX1 2Y6KA 2XWJB 3FB8C 3J7NA 4CP9A 4P00B 5JXGA 2D44A 3BPZA 1SBFA 4ZHNA 3I59B 3TB0A 4TLFA 2HEVF 3WB1A 5LY1A 4TTGA 2IU0A 1NR1A 1OMIA 1JHJA 1Q56A 5H9SA 4I9QA 2QQNA 3C3VA 5FZ7A 5K9YA 2OTJV 1SLTA 1HXS3 2WABA 3ILNA 4TUYB 1JODA 1N47A 3KGZA 1MZ5A 3KV5A 3VHNA 2GNMA 2LW8A 2W1SA 4MXVA 4OZXA 1QWRA 2AR6A 4M4RA 3RI8A 3C7HA 4X1YA 3HR9A 1S5JA 3C3SA 1SCRA 5G05L 3BI3A 3DPRB 4CA9A 1Q6UA 2W52A 1FV2A 3VB9A 1DG6A 4R9DA 2XMLA 3LNNA 4CCDA 2D6MA 2Q7GA 2ID4A 1POV1 1K5MC 1R6KA 3K59A 4P9YA 4ASMB 2EICA 2XJUA 1ODMA 1BZWA 2XJVA 3NMBA 1M57B 4Y5TA 2PHLA 2ZEZA 4E8DA 3P5BA 3OF1A 4NXNB 1N3OA 4UW5A 3DYMA 1QLEB 4WBNA 2GN3A 1EN6A 3TEXA 4LA2A 1ZM1A 4NHMA 3WD5A 4J25A 1VR3A 3AMMA 5CFCA 1YQ8A 4IEOA 1V6IA 1HXS2 1G9AA 4X64O 1MR5A 3JALA 3B9CA 4K3UA 5J2UB 3DKQA 1VQLV 3GZAA 2VZRA 2ET7A 1EFRG 2YB7A 1JR9A 4JI4O 2VNVA 2XPJA 3AB0A 4JV5O 2GNTA 4HVRA 2ETEA 4IE7A 1NE4A 1MS9A 2R061 1Q8IA 3CB2A 2FBEA 1PO11 1JYWA 2OTLV 1NLRA 3ZYGA 4GWJA 2UXCO 4WVVA 3HKDB 2EXIA 1V6JA 4DR3B 2ZIMA 1JCHA 4A6SA 2NMNA 4YIOA 4YIPA 1QVFU 1XREA 4XF1A 3POIA 4AFBA 5JOYA 3FD9A 4JI0B 3VBSA 1OURA 2Y0PA 2ZZJA 2WFF1 4NPLA 2XWBB 2JS3A 3ITQA 1W6MA 5JPMB 4AI8A 1I94O 2W87A 2VH9A 1Y7BA 2PXJA 1B6QA 3KQ4B 4H44B 5FK8A 3HN1A 4JI3B 1D2DA 2BW8A 2JG9A 2Z3YA 3HR0A 1FV3A 3T08A 3ZFGC 4EROA 3ACIA 1GQPA 2WLKA 3KG2A 3HKBA 4FI9A 2R72A 1SFYA 3OUIA 2WSSG 1W9YA 3KS7A 4AQSA 1A6CA 2FTKA 1AR63 3V0BB 3SH5A 2C0ZA 4O4LB 1ULOA 1VBE1 3SLIA 1U12A 2V4DA 4BJ0A 2VXJA 2AHZA 2IFWA 1FJGO 5HI0A 3WX5A 4L92A 1RSOA 3W7TA 2AZ0A 3M99B 3ZRWB 5JSRA 4FZ0A 1RUF1 1BBT1 5H6RA 2A5ZA 4E4HA 1MS3A 3UT5A 4PV1B 1DQ4A 1ZZBA 1ZRDA 4AL9A 4I0WB 4AOCA 3NQHA 4MSWC 5B1OA 1W8UA 3NR7A 3ZN4A 2P3IA 5C8YA 1ZSPA 3ZDSA 1E79G 4V2VA 4YGEA 1NXMA 2ES3A 4YW4A 1XMOB 4HNAB 2NP0A 3B00A 4M00A 5F6LB 5FPZA 4FXKB 2CHHA 1D5AA 3TGUH 4RS5A 2EJ7A 1Q81W 2FDFA 3LSEA 2Y48A 1JVMA 3VL8A 3C2UA 1OQEA 2UU8A 5LMNO 3PMEA 2QGNA 5K0UB 2YIBD 1QOOA 3IBMA 3LQCA 2Q4PA 1SHWB 3FAVA 1AR62 2VVDA 2JDMA 4UFHA 1H1AA 4GT1A 1UQXA 4LBLA 4M01A 2VOXA 4GKJO 1W9TA 4IYIA 2C4XA 2XG3A 3H8RA 4Y4YA 3CCQV 5BNPC 3MHZA 2ZGPA 3AG2B 1FYJA 2VU9A 1P8JA 1N32B 2WYFA 2FMLA 2VQUA 4K40A 3ZPOA 3OMIB 1MEC3 3UKMA 1CAVB 2RE9A 5IDJA 1JYVA 4K1YA 2E33A 3Q8FA 1QH7A 3WV6A 2JVDA 3EQEA 4LHKA 1LJ7A 1LOEA 3JD3A 1I08A 3FBYA 5F7UA 2J1AA 1NJIW 4X62O 3IC7A 4XFHA 1J83A 4WFHA 2ZCWA 1OA2A 4MLOA 1RMU1 5A7WA 1AP6A 5FCCA 1AXYA 2O14A 4N43C 1ZL8B 5FREA 4EN8B 3CJIA 5EBMC 4YXWG 5F5AA 3IMNA 4AHCA 2Q7EA 3KVBA 5L3GA 5C5TA 3FC0A 4R6ZA 1DYKA 3VD7A 1KJRA 2JWPA 5C9AC 2YUAA 2ZKOA 4X6RB 5C3OA 2G9GA 5EBLC 5CG9A 3OBTA 1MG1A 4LF5B 3AK1A 4CCLA 4HK9A 1OH3A 3ZXAC 5DAQA 1Q8PA 4UB6Z 3EHKA 4KL1A 5J09A 2B46X 3E8HA 4PLNA 4QB1A 3B93A 1MEC2 4Q5OA 4RFT0 3VDDC 3SJQC 2W46A 1JOBA 3LA2A 4P5YA 5FZFA 3K3WA 1FXKB 2QA4V 3VBHC 4GALA 2TBVA 1UXXX 2HH9A 1SF9A 2DYCA 2AGAA 5T5OA 4FFBA 4FTBA 4XOGA 1OQDA 1HXS1 2OQ7A 5FFOC 1PZ7A 4NKGB 1ZBA3 2E26A 4XDPA 3RYIB 2DVGA 2VZPA 2QDOA 2LUWA 3PLQA 1R73A 1N0JA 4FLTA 2CTRA 2HJIA 1UMIA 2VXRA 2QWRB 3MIBA 4XJUA 4D6TH 1WLDA 3QACA 2LQTA 2BWAA 2WNUA 1OVSA 3ETPA 1DQ2A 1JFFB 4OQ8A 2Y34A 3H8OA 4I0XA 5HFMA 2J1SA 3KT4A 3P1IA 2KKWA 4QE9A 4D7TA 4RQPC 1EYBA 4N8MA 5CKNA 3ON7A 3MV11 5I0DA 1EBOA 2EIKB 4Q4W3 2RG4A 4QGPA 4ISQA 2C26A 2JDAA 4DV7O 2Y33A 5SV5A 5GALA 4CP2A 1JMUB 4MG2A 4LBEC 2EIJB 4NRPA 3BRCA 4FLZA 1CGPA 2ZR3A 4X9QA 1K34A 1IHMA 3HAGA 4GKKB 5BPXA 2R32A 2R16A 2D7FA 5KC5A 3Q9OA 1UU6A 5DN2A 5L7OA 1YLLA 5CNAA 1ZBA2 1LUVA 3CWBH 2PHTA 3RDIA 4DR1B 5ABJB 2PLV3 2VS0A 4LF4B 3FHAA 5FZCA 2PHWA 4A5UB 3P30A 1AVBA 2VE1A 4JZRA 4GKYA 4RSUA 1R1A1 4ASLA 1XE7A 4GA9A 1BCXA 1JYCA 2JIGA 3MLKA 1YO8A 4YJ2A 1W99A 3MV01 3M2MA 4QGMA 1CAUA 5IY5B 1KXGA 1RP3B 4A4AA 4A44A 2QKSA 5EWSA 2OCCB 1BE3H 3S5AA 1C1FA 1RUD1 4Q4W2 1NA1A 2R70A 2QTSA 1URXA 4QXBA 3QO7A 2WLIB 4XUNA 2B1IA 1VQMV 5BY5A 3POWA 3M8LA 3H8XA 2J1TA 2WT1A 1KB9F 2FZ1A 1OBNA 2XNDG 3BTYA 2WS91 4WVZA 2L6LA 4LF8B 4WFBV 3H7YA 2KG7B 4IV3B 4QHZA 2JDIG 4F3JA 1CZVA 2RV9A 2QEXV 3FB5C 3ACGA 4TV9A 3AMNA 2B42B 2PLV2 5AFEA 5FXVA 1IKQA 1VQ5V 3N2GA 5L3CA 3FL7A 4XXPA 4K35A 2UUAO 1W04A 4BQYA 1P7BA 1P4RA 1PPJH 2RM21 2RDQA 1Q6IA 4WFAV 2QE7G 3CCVV 2WZEA 2PAEA 5C33A 4AGRA 2Y6HA 2AHYA 5F39A 3H1MA 2CTPA 1OLRA 4MV2A 1O3TA 5CFCC 4Q0QA 3ST7A 3L72H 1HIXA 2IM9A 4OZOA 2Q0OC 4GQ7A 5CFDA 4CDXC 3FBMA 4INDA 1EZJA 2WAOA 1I5PA 2IZWA 1LGCA 2FQPA 2UUCO 1C8M1 2ZAAA 3F7YC 2D3PA 4J80A 3WU2Z 3BUCA 3LA3A 1W6NB 2B9VA 4AHYA 3Q8EA 1E5SA 4D6SA 5FOBB 1YCIA 5IFTA 4QD2A 2BOIA 3WNXA 2WLMA 2ZS6B 1NY72 5EBWC 2QQVA 4CUGA 4HKOA 3U10A 5C4WB 5J3UA 4BISA 4AWDA 4CZZA 1UOJA 4TSVA 2TUNA 1L3JA 2WKKA 5IE9A 3QO8A 1OOPA 3A23A 5BUVA 3OY8A 4K9SA 3VBSC 1UKRA 3NJZA 1HNXB 2VBPA 1JTZX 1B09A 1S72V 4A41A 5IHRA 2P3YA 3E2EA 3VV1A 1JJOA 4YY3O 4OUMA 3RBZA 1AR5A 3S0MA 4GX0A 3RWRD 2XKOA 4PELA 3LNMB 1VQ9V 5FK7A 4HPKA 4PD4F 2JDZA 1NUKA 3CCLV 5LRRA 1UIKA 3EHBB 4XBNA 1SQXH 2JG9C 3CJHB 5LGTA 3AYEA 1M4UA 1Q3EA 5C3PA 4D0QA 2WYSA 2J1EA 1FAYA 1BT8A 4LBNA 3CHXA 2K2SA 5FAXA 3VBFC 2JD4A 1PZ9A 1VALA 2HFEC 3MIFA 3WF3A 1FT9A 5EV7A 1UF2C 5FYUA 3SJCC 2YU2A 5I8YA 3SYOA 3A2FA 4TT3G 3WNPA 5IK4A 1IS6A 5GTHZ 4LFCB 2CGPA 4YW3A 1G9FA 3GDBA 1L0NH 3BFRA 3HEIA 1EM1A 3N7KA 4JPRA 5LEKA 4ZKTB 3VBUB 3UM7A 2DFBA 3BA8A 1W3XA 5AFBA 1LHWA 4MGIE 4HG6B 4PF1A 2ZIOA 4COVA 1SQ4A 1MOFA 4XJ8A 5L3BA 1EPWA 4DUZO 3B5LB 4KU8A 1PD3A 2UUBB 4ZOLA 4LBQB 3LEKA 3CX5F 1HX6A 1BEV3 2EIMC 2RS33 1ODNA 3VDBA 4PIYA 1W90A 4RD7A 2XUMA 1I5XA 1XNRO 5FQ0A 4RS5C 3HKEB 1QIQA 1GOGA 3VZJA 4BWAA 4LWSB 1G9CA 1D4M3 4LK6A 4B3RB 1YEWA 2B5HA 4QB2A 5KMGB 3UT0A 1R3LC 3QLQA 3JAKB 3AXEA 3K03A 3JARB 5IK5A 1ENVA 4N7IA 2BSKB 3ZVXA 3MF9A 4RA0A 1N4CA 1QQP3 5FY1A 1O59A 5A7SA 4KGGA 4CPBA 5KHIA 3ES4A 1JZ7A 1PX3A 3WG7B 3PVBB 1WAZA 4MTFA 3LAGA 1CAXB 4EE2A 5F5CA 1H2GA 4A7ZA 2W08A 4DZGA 4Q4Y2 4XILA 1BEV2 3S3WA 2RS32 2PQSA 4PHZA 1EAH1 3WW1A 3ZMOA 1W0NA 4WF9V 4IGPA 5I8TA 5DDJ3 1VRH3 2YU1A 4YVWB 4PDRA 2DCJA 2QBXA 1FAFA 4LF6B 3VHOA 1GKBA 1D4M2 3ICXA 3WDXA 1XNAA 3AP4A 4TXWA 4IEYA 2DJVA 5FYSA 2V4AA 4L9BA 2JDPA 1ASJ3 1YYNA 5H9QA 4C7UA 4KQ7A 3BCCH 2W39A 1LOFC 2P22C 5DUVA 5HBAA 4NXNO 3DYPA 4CCNA 3A22A 2Q4SA 3DC6A 1KU9A 5FZIA 1QQP2 2YXHA 1A3KA 3L70H 3KV4A 1W2AX 4ARXA 2I74A 5EYPB 4F6EA 5KX5B 4LNUB 4X1KB 3LDEA 1Q43A 1D0GA 2GUZA 4UVCA 4LBMA 1MZFA 5IYZB 4Y26A 3VKMA 2VOKA 2OYZA 3SH4A 1HB2A 2OIIA 3JCUZ 2R1DA 2I45A 2VRZA 1AR93 2ARCA 2E7AA 4UVBA 2X29A 2DCKA 3KZ4C 3URFA 4Y1XA 4MTOA 1DGRA 5K7PA 1Q90D 1F4NA 5FLIA 3OEHG 3KV6A 4NPMA 5DDJ2 1VRH2 2A0LA 3OBZA 2DW4A 3RYCB 1RL3A 3KF5A 1UX6A 4E8CA 1YDXA 3SITA 1IBKB 4NN0A 5BNNA 4G28B 3ZHUA 4IIJA 2IJIA 3WF4A 3VQXA 1EP0A 4KWLA 2EZOA 3ABLB 4P02B 3DGTA 2PN5A 1NY71 4FPPA 2MNGA 5T5LA 3ZOIA 4K0KB 4JI0O 4Q2FA 4K1ZA 4JZGA 5DPNA 2YEVA 1SA0B 4OPHA 2Q5ZA 4AW7A 3BOWA 4COYA 1YQ6A 3LB9A 1VMGA 1JYIA 4DPNA 1KDKA 4LBQD 3LE0A 4MADA 2FD8A 2YZ4A 1V6MA 2VWKA 2FZ2A 1VBD3 2Y26A 3R4DB 3E5XA 3BCWA 5B1AC 4W65A 1Y6XA 5LL6Y 2LALA 1XE8A 1QJFA 5CBGA 3T2PA 1M1KW 3S6PA 1RIRA 4WZFA 4D8MA 1AR92 4Z2WA 4JI2B 4UW4A 3PJYA 1UFIA 2ORXA 3MLLA 5F5QA 1R1BA 5L7OC 1W0PA 3CCMV 3A0RA 2HWD1 1XNTA 2QCSB 2EVXA 2P37A 3ZDVA 1Q82W 4I55A 4V1PA 4ZONA 2ZTNA 4HFSA 5EQUA 4W6XA 4QGLA 2JRIA 2F4PA 4KP4A 5CA0B 4BCUA 5CADA 2Y8KA 5FPXA 2CE4A 5DZFA 2UWBA 4IL7A 2BBVA 4FVMA 1KC8W 3T0BA 2HWE3 2UXBB 2IUWA 1SETA 3I59A 3OCPA 1Y76B 2PQQA 2Y69C 5CEHA 4Z1MG 3RT3C 2NLJC 2G9ZA 2YIAA 4CDUA 1VBD2 4K21A 5LY2A 5FMOL 2P6JA 2X6AA 2KB1A 1MZEA 3GXUA 4EV0A 3U75A 5CB4B 2GMMA 1PL0A 2JE9A 1PNLA 3VD9A 3VZLA 3E6CC 1AX2A 5C3QA 4KBZA 1XILA 5I0RA 2R071 2Y6LA 4YM0A 1GN3A 3NJYA 3KGLA 4WFGA 3WF2A 3B09A 2A70A 1GM7A 1MACA 1WJZA 3UGFA 5BMVB 1NLSA 3I2GA 4BZ4A 2Q67A 3RMXA 1C5HA 1N32O 4XHBA 4CU6A 2VD7A 2QQKA 4BPZA 3AK3A 3HKCB 1XNKA 2HYKA 4LO5B 3LSUA 1HKDA 1CZSA 3GJBA 5FLJA 2BGOA 3AFKA 2JDKA 2OA2A 3RS6A 2HWE2 4YWAA 2RJKA 4QDQA 3OGJA 4NR1A 1U5YA 1JN2P 1UU5A 3J8F1 1HQWA 1XBFA 5GZDA 1F51A 1O7FA 2ORZA 1TME3 4B3NA 1ND2A 4AFDA 1O3RA 3JZVA 1IVSA 1QMJA 1BZKA 2CL2A 3VKLA 5LOVA 3ZR5A 1TZOA 3GYDA 4LF7O 2BUKA 2JKXA 3PIGA 2VG9A 1GOHA 2PHDA 5D5QA 4Q29A 1AR81 2R1BA 2ZGKA 4DR5B 2I07B 4ET7A 3JB4C 1S1AA 5KWRA 3PTYA 5FZGA 3MUY1 3O1UA 1UY4A 3I3QA 4LF5O 1QJY3 2QM7A 4CC5A 4R8CA 2RDSA 3MW2A 1W3VA 2G9FA 1CR7A 3O9OA 2DQ3A 1SMVA 3ZFEB 4HSJA 5LP6B 3AG7A 3HBZA 1KMIZ 2B5UA 2ITDC 4RR3B 1QQP1 4RQPB 1WB8A 4KH9A 3NWKA 2FHRA 2DCYA 4L87A 1WCKA 3WCSA 3H8UA 3WNMA 3ZN6B 2OCHA 4DUYB 2FB5A 3ZSJA 4QDRA 2XT9A 4RHV3 2VECA 1T6GC 2VMHA 1TME2 5J37A 4HONA 4XZUG 2BP6A 1OF4A 2DVFA 2OZJA 3AVRA 3BALA 5BXXA 3N7MA 2NN8A 2J1RA 3CC7V 4GIQA 3BU7A 5LA9A 1CJPA 4RWUA 2CU5A 4META 4O4LA 4P9XA 1XHZA 3LDKA 2HVKC 5FY8A 2B8MA 2QQLA 4XUQA 5GW7A 2FDGA 1NT2B 1ASJ1 1RHI1 4CP9B 1QJY2 1OSGA 2BFUL 3ZRWA 3LPFA 4IEZA 2XHKA 1R081 4PQ9A 3AYCA 5LCWL 3UKTA 2I2SA 2WWSA 2W9XA 3EMRA 3GWOA 2E9QA 4H0LB 4FXGB 4GKKO 2F17A 1Q8QA 5HFLA 4BIZA 3EO6A 2ZKLA 3NV4A 1HQNA 2YGLA 4Y1UA 1BQ0A 3SKVA 4RHV2 2XAJA 4DR1O 1ZVFA 2RJ2A 2F93B 4XIOA 1AR91 2VZQA 1MVEA 5IW0A 3E35A 4Z82A 4CU7A 4YJ3A 1YIFA 2E75B 2GNDA 2YBSA 4DV1B 1S0JA 2WDBA 2WQZC 3AMHA 4XCAA 3IZOA 1FOD1 2ETNA 3VZKA 3EXUA 3BTXA 3BABA 3IN9A 4YNIA 2WT2A 1GZCA 4X1IA 4FFFA 2NR5A 3TN93 2VZOA 4AEDC 1GK9A 1REFA 4RUEA 1YHQV 1QCEA 2RHPA 2ZE8A 2QZ3A 1N1TA 4QX1A 2KM2A 2IC1A 5LK5A 5A1LA 4WBNB 2ZA9A 1OXCA 4ATFA 3RWNA 2JK5C 2VBDA 1A8MA 3OG2A 4YRDA 3WR0A 2H8PC 1PKXA 3NRUA 1DLBA 4OGQB 1ZYBA 1CAVA 5CFCB 1XU1A 1CIWA 3ABMC 3BIEA 1M06G 3LIHA 1VBD1 3WW4A 2PUSA 2YXSA 3SJAC 3K58A 3JALB 2XJQA 4PCRA 4A7YA 2P90A 1WLEA 4AG4A 1LUWA 3LEIA 3DYOA 2X6CA 4DV5B 1SCSA 1K12A 1LGNA 4LC1A 3J7MA 5L9BA 2J42A 3BAAA 1YITV 1DP0A 5FXXA 4CS4A 5JVVA 2Q5TA 2XAGA 1ZZ8A 5T5PA 1KS4A 3G6JB 5FZ3A 2WLPA 3TN92 1OH4A 2X05A 4AGGA 4AFAA 1J1TA 3MHSC 4U3JA 4DR4B 1STMA 4LLFA 2D6OX 2Y38A 3VBSB 4WCEV 1S0BA 1QOTA 3ZCCA 2XAQA 2DV9A 2UY9A 4QQOA 3J80N 1GSLA 5LEJA 4FTSA 5JIAA 3VBRA 1Q8VA 2UYBA 2OKXA 4LF9B 2JG9B 1FXKA 4XQ4A 2QJ1A 5D8AB 5FKBA 2A6YA 1XU2A 1COV3 5JJJB 2WO2A 2BNOA 4M3CE 1FI2A 4CE8A 3K2OA 5KXCA 4JKLA 3N9LA 3H1WA 2HHHB 3KKYA 5FYZA 2BQPA 4NE9A 3OPTA 2IJKA 4DR7B 5FO7B 1K42A 4IEXA 2XQXA 1ZA7A 4WFFA 1YQ2A 3WT3A 4AHXA 1WUVA 2CTVA 2XONA 2BTOA 3A0BZ 1HNXO 1S3JA 4UFZA 5CYYA 1NLQA 4YM2A 2YSUB 1JFFA 3CIHA 1RSOB 1AJQA 3WINE 4QQLA 2EALA 4AI0A 3MAQA 1G1XB 5EIBD 2IU3A 2JJ6A 2P7TC 2P5OA 2P4VA 3IDCB 3T4DA 3LSDA 1E1RG 3D0SA 4L0PA 2HWC1 2WJSA 4XABA 4NIAA 1AI4A 3NAPA 4QPIA 3UO3A 1R6TA 2JKBA 2LP7A 2DWDC 2LJ2A 4OMDA 3OGSA 5ACA2 4GXLA 2VQFO 4EB6A 3GHMA 1COV2 4LFCO 1T2XA 3T1LA 4CP0A 1ZX5A 4I3GA 5E6HA 1F4HA 2ADEA 4Q1PA 4UBHA 5ABJA 4HVQA 3FAVB 4UW3A 2GDSA 5DMYA 1V9PA 3K4DA 4JI5B 3CL1A 4HMZA 5CVRA 4O4HA 3O0XA 2UUBO 4I09A 2ZDIA 1HB4A 5GLTA 2UWCA 1SERA 1OJHA 3PIJA 2JE8A 5FZHA 4CEYA 1SLLA 4D3WA 1KP2A 1QJY1 3ELNA 1RUC2 1F23A 4J10A 1GNHA 4CDUC 2PGGA 2XLAA 4LO7A 1G8WA 1MS4A 4YZ4A 3PJQA 4FO9A 4IT5A 2ZAHA 2WNVA 3WF0A 4FIPC 2ZBJA 3TBDA 2GP3A 1GMGA 5KA5A 1HRV3 5FZBA 1LULA 1TGOA 2D43A 1OLMA 2EF6A 4PLMA 2VNGA 4EWDA 1W8WA 4QPYA 4UFLA 2BGPA 2YMZA 4MVSA 1AXKA 2VULA 3CEWA 2DWRA 4S2DA 2KG7A 1H2LA 4IV3A 2XL9A 3VBOA 3ZO0B 2XBO2 1X50A 2ZM6B 3TXSA 3TXQA 2SLIA 3CJIB 4O2AA 3H3ZA 2G38A 1NVPB 1S5HC 4FPHA 2DVDA 4OULA 4OVEA 3VKNA 3OUSA 4O65A 2ADPA 4XAEA 3D36A 5D21A 2ARBA 1K73W 2A7WA 2M7WA 3TNQA 1QLEC 4XURA 1L7QA 1US3A 3JAWA 2AEZA 5LMUB 4Z8BA 5C93A 4ZXEA 3W9AA 5JOXA 3K48A 3S7IA 2Y0IA 4LF6O 2D98A 3IB3A 2CDYA 4DEQA 4GMP3 1RFYA 1BGYH 5A32A 5JLVA 1ENQA 3MIHA 5EJZB 1HRV2 4D7YA 5JCTA 3GHNA 4IEVA 1NX9A 2IH1C 1YI9A 2ATKC 1W6NA 1E5IA 2OXBA 1R3KC 2YG0A 2BOBC 3ZXDA 1ZRCA 4MVUA 3D82A 2MK3A 4MXWA 1XYOA 2WNUB 3MEPA 2BRTA 4NHKA 4I0XB 3THDA 4U2AA 2R043 1WW6A 2HBTA 4EZHA 5JXIA 3FX3A 3AG1B 3ROUA 4CEWB 5BNQA 4A45A 5JAXA 4JX0A 4E27A 2V5YA 4DIQA 1NCRA 1JJ2U 2LW1A 5JCOC 2EAKA 4Y1ZA 1F5FA 3AK0A 3EJKA 1QNYA 3I2HA 3DKWA 5GZCA 1IBKO 4ZY9A 1SQPH 3ZLIA 1PVC3 3CJHA 3CCEV 1LKNA 1W0OA 2GP5A 4J42A 5DN6G 1W05A 4H7LA 4FCAA 4J7KA 1DGRN 3K0DA 3STZC 4AVBA 2RJLA 4N9HA 3JD0A 1Y9MA 3WVJA 1X59A 5FMDA 4OHVA 3ZMNA 5LBFA 1K5SA 3H9VA 2ZGLA 3QBQA 1XB9A 4JYBA 3SYQA 2O0OA 1JA8A 4RQEA 3N9PA 3ZYIB 3NV2A 1CPMA 2OZ6A 1V9U3 1RUH1 4HSLA 4XETA 3FYEB 4YJ2B 3Q4HA 2R042 2XAHA 3K9SA 1CAUB 2VUDA 5FKCA 3B2EE 2QQMA 4DY5A 1W8TA 3E6DA 1RUOA 2H94A 4GKJB 3IT8A 2IXIA 3O0WA 1AL23 4A7KA 4BE3A 2Y69B 3H1IH 1NA1B 3CCRV 1IPSA 2DCTA 4FSJA 1RUE1 5G04L 1B35A 3CYOA 4NROA 1FYUA 2V73A 4FM1A 3FB7C 1AI6A 4S2GA 1K3EA 2D5FA 1PVC2 1CVNA 1RUG1 4FAGA 3T2QA 5EIYB 3UQ8A 4KU7A 1VIWB 1E5RA 1VAVA 1XMQB 3B77A 3OW2U 1XQNA 4K8ZA 5KMGA 5K0UC 4P9PA 4LKSA 1NVPD 4TV9B 5IVFA 3O65A 3GVMA 4CH6A 3M8AA 2P34A 5BV6A 3CCUV 3N2GB 1KFXL 3B8NA 4IE4A 4FQZA 4CDWA 2OUHA 3FFQA 2VVEA 4O4JB 4W50A 4IE6A 4YVSA 2LGQA 1HRI3 5FY9A 3LOBA 2NZ9A 3AKTA 1VBB1 3ES1A 3C7EA 4Z2AA 3G7DA 2IXLA 2RN9A 3AG2C 1PIV3 3KQRA 1LEMA 4EQVA 2C6SA 1AROP 3JQWA 4MS2A 2N04A 1LNSA 3PUQA 1LR1A 5FYTA 3UNPA 4XBLA 2E32A 1AL22 3JSNA 1US2A 4S2HA 2HWF3 5CFDB 4CU8A 1XL4A 1H1IA 1JUIA 2GBOA 3C7OA 1O4TA 4PBPA 1VMJA 1JXNA 1UMHA 4GMP0 1YWKA 3SYPA 3ZR6A 1Z7S3 4O2BA 4M3CF 2ET1A 4C0BA 1DYPA 5LBCA 3FZ3A 2XVGA 3CKHA 5J96B 3OUHA 3OPZA 4NXMB 1MS0A 2BE3A 2H6CA 2WPDG 1OOPB 1CQ9A 3OY8B 3RPQA 2BNNA 2K46A 1HRI2 5J1XA 1W6PB 4NVPA 3WFVA 2C9AA 3WNKA 4G9SB 4E4ZA 4YARA 4Q4V3 1PIV2 4YW5A 5EYPA 4F4LA 2ZE5A 1F15A 3JD73 4N53B 5IYZA 3ZRSA 4HPKB 3RRDA 5IYCO 1JZ3A 3VBRC 4MGSA 1RGSA 1FXKC 5JIUA 3K04A 2QNKA 5A7QA 1CIYA 3C8XA 2IJJA 4TWTA 1RYYA 2AXTZ 1JI6A 1I5ZA 5E79Z 4U3FH 4DR5O 1IXBA 4UCTA 4QXHA 1CJDA 3IAYA 1CX4A 2CDPA 3U4XA 3RFRA 3GCXA 4Q0UA 2BU9A 1Z7S2 4FFGA 2PHRA 4BQ1A 2VCBA 1MPXA 2W6IG 1FFXA 5CN0A 4DRVA 2PHXA 1U5IA 2CTQA 5A6ZA 4JASA 3I2DA 4MH0E 4AHZA 1GM8A 1KEXA 3ZSEA 4DR6O 3W58A 2QQIA 4DUXA 3OGCC 4CS2A 1E57A 4JKKA 1H2KA 3NJVA 3BVCA 1L7LA 2Z4FA 5F6KA 2EIKC 1HJGA 2PI4A 3P6BA 2WT0A 4ZOLB 4I4TA 4XQWA 4Q4V2 1JOPA 5H9CA 1RJ8A 4IEQA 3N4MA 4PA9A 4Y3OA 2EIJC 3JD72 4QPIC 1S0DA 2TEPA 4LFAB 2RMU3 5F3CA 1FFTB 3OE7G 5FQ0B 5FY0A 5F37A 1SPPA 2QDNA 1DHKB 3QNEA 1BVP1 2V7QG 4XFIA 1XSRA 3ZMTA 3EFFK 1OD5A 2B9UA 5HCFA 5K4LA 3CRCA 5LA6B 5DZEA 1AJKA 2A79B 2OT7A 4JQRA 5ABJC 1KGYA 4PLOA 5LBBA 2YC0A 3SPIA 2F6BA 4WBBA 5LGNA 1IX9A 3TJTA 1D7PM 3GBWA 4LJHA 2ZDIC 4Q0PA 4Z1VA 5JVDA 3R05A 1LU2A 3S7EA 4QQPA 4ZI7B 1DZRA 2IBZH 2WINB 4Z92B 1DF0A 5T3NA 4H37A 2A6XA 1G86A 3J4UH 4OYUA 1GZWA 1FATA 2WNVC 3DF0A 5B1NA 3A0HZ 2ZX0A 5LHGA 3TNPB 2WA3A 2BTVC 4EFBA 4AVTA 3HBKA 4DV1O 3W7WA 5FBZA 2BTQA 2ZGRA 2RMU2 4AVAA 2ZT9B 3AKRA 2W91A 4CCCA 2GH2A 3H7JA 3WQ0A 1V54C 4URTA 1B06A 1W2BU 1DLCA 4Q0SA 3OPWA 1PVC1 1GO3F 3GWKC 4EWEA 3OYWA 4IV3C 4FLXA 4FOYA 3VBOC 2DOSA 5J2TB 2E53A 1AJNA 2RS52 1ZREA 1O3SA 1GU3A 3OEEG 4IDZA 3RYPA 1F7YA 4XFBA 1ZWIC 4OUSA 2BVBA 4EZ4A 4AGVA 1K8AW 4ZS3A 4DR2O 2Z79A 3D36C 5LB6A 4GZRB 1WMFA 4JDOA 4DV6O 2ZZQA 2QDRA 4XHXA 1V9U1 3IKWA 1J3QA 5FZ1A 5FPVA 4A6OA 2GUZB 3BPSA 4DK1A 1IBMB 4CTEA 3MUZ1 2D40A 1UZWA 2Q1ZB 5FY7A 1NXD1 3VBBA 5HCHA 3UGHA 3V0AA 1VBC3 1WCSA 1QU7A 3B4SA 4YY3B 3H1YA 1EV13 5JJEB 2YYOA 5L9RA 3E83A 2BNMA 5JSOA 3LEGA 3T4HB 5FNVB 5B66Z 5BNNB 1THZA 4IIJB 5JDBA 1J84A 2RDNA 2QZ2A 4PI2A 5K1XA 3ASOB 1K7DA 4YPJA 2WLQA 2WLNA 2EIGA 4DR4O 3Q8BA 4H33A 3RI9A 3AG4C 4PDMA 3WP5A 4KNCA 2HWB3 3OBRA 4KUMA 1FPN1 5KBFA 4Y5Z0 1W8NA 3N7JA 5IT9N 4X89A 3VQYA 3SR2C 2VUAA 1NKGA 2ZEWA 4UFIA 3JD1A 3B40A 3RZLA 4IGOA 5E8AA 5FY5A 4Q4X3 4IXLA 5HCBA 4LF9O 1FPOA 5L3EA 2J22A 1NR7A 1PIV1 2VTXA 1LECA 4YG6A 2OPWA 4MGKE 1ZX3A 3D3AA 4ICGA 5A7OA 1UZ0A 4DUZB 3GB7C 1TMF1 1VBC2 4DR7O 5SV8A 4AEMA 2RNBA 1JYXA 4NPRA 2X5IB 1JOJA 2HWF1 2R49A 1EV12 5KAFZ 1OCZC 1TVGA 4MYEA 2ADDA 4I55B 1XNRB 4XFCA 1UD1A 3HIFA 1A78A 3N9MA 1L7RA 1BLZA 4RUFA 3AKQA 2R0HA 4PIZA 3MHHC 4G3YC 4OXSA 2VO5A 3EXAA 4CPBD 2VQTA 2J7MA 2P6CA 3G71V 1DQ5A 3VBUC 3GZEA 4U36A 3VKOA 1ZBE2 3MW3A 5D1IA 1YFYA 2BERA 4GAZA 1Y4MA 4FPGA 3HOBA 4NWWA 4Y22B 4YGDA 3NW4A 2N05A 1H8TA 2O1QA 3MYXA 2GC0A 2JENA 4LP8A 4Q4X2 4CDUB 2AUYA 2YUEA 3MF6A 2KR2A 3UYJA 3A0KA 1H30A 1XHXA 2JS5A 4MTGA 2PYLA 2W6JG 3O1PA 4IV1A 3UKNA 4C0HA 1SESA 4KHPO 1V6OA 2Q73A 2KSDA 1APNA 1MSWD 2YBPA 4MGZE 3W7UA 3CE2A 4JI5O 1BQZA 4I7ZB 2IW5A 2V1DA 1VF5B 4X6QB 3LFMA 3H1KH 4Q1RA 3CEIA 1OD3A 1Z78A 1BS3A 5KHHA 4CDWC 4BWOA 5F2VO 1OHHG 5JZGA 4TV8A 4N21A 5A3WA 4P9IA 2CAVA 1GANA 2VNRA 1X7NA 3M1HA 5B3SC 4PJ0Z 3ABZA 5LRSA 5FP4A 2WQ4A 4IHJA 3WG7C 1F31A 2W0XA 3ACLA 4NYKA 3CZJA 2RDCA 3MO4A 2CWMA 1ULEA 2CAZC 4NMIA 4PT6A 3MIGA 3E22A 2VUCA 1K4CC 4Y33A 1N1VA 3BGAA 1O9HA 1WLTA 5H9PA 1ND2B 5TISZ 5JXJA 4ISRA 4YVWC 3ETEA 3KLSA 4BW9A 1N1SA 2ZM6O 3T0AA 5A6XA 4E4EA 5LOVB 5CA1B 4GKXA 3MIEA 2VOVA 3WP4A 2QTWB 1BHAA 1JBCA 1OCRB 4E2GA 5KUMA 1NTMH 3I8TA 3ZHVA 1UW8A 1MS8A 4S2FA 4LO4B 1PM7A 3VD5A 5GTIZ 2F43G 1QDOA 5DG1A 3P3PA 5LMUO 1KUQA 3C3TA 3BOPA 1XPWA 4JCKA 3A21A 4CCOA 1UO9A 3OUFA 5J98B 1TUBB 1VEWA 1AL0G 4GX2A 3AKPA 3ZM8A 3ZIAG 2E5LO 3H50A 3MBWA 1UMZA 1AHSA 4QB6A 4B7KA 3OD4A 2QWOB 1IS5A 1X9TA 4R52A 2MPFA 3E8BA 2P4KA 3LOIA 4OFGA 2RVAA 1DGLA 4DY3A 3OR6C 3BU0A 4JYYA 4JGSA 2W68A 1C3HA 2CUGA 5D8AA 1R091 3APOA 5KUKA 3NNFA 5IK7A 2NYYA 4JVAA 4YGBA 1NAEA 4B4PA 1WPXA 1ZUQA 4H2AA 1UKGA 4AI2A 3MFCA 2X6BA 3AFGA 5FYCA 1UY3A 3ABLC 4B29A 3U1XA 4D6QA 3ABUA 4I2OA 3O5SA 3BTAA 5AG2A 3BY6A 2D3OW 5F9TA 4YG0A 3O1RA 3THTA 2GH8A 1C28A 3I2JA 4J7ZA 1VQOV 4K7JA 2HYXA 4XE9A 4UCUA 5IAVA 3CDZB 3WUCA 1S0VA 4I9WA 1X4TA 1UU4A 5GM0A 3PVNA 3ZYJB 5FJHA 1WP8A 1GYKA 3KHCA 4H55A 3K4ZA 4X8PA 1NTKH 1XJAA 4HVOA 2ZX4A 3RN4A 1Y3TA 2PMWB 1SLCA 3SPHA 3ZMSA 2ADQB 2YHJA 3VDCA 1XNQB 5FZ9A 4YW6A 1COWG 5F5IA 3RZHA 3G6EV 1QGLA 4YJ3B 4QX0A 3POBA 1EV11 2YGMA 1AR4A 4G4FA 4X88A 1LRHA 3N35A 5D5PA 3POYA 4X1IB 4GX5A 2Y4TA 3PVOA 3CXCU 5IATA 2ZPXA 5IJ0A 5FZDA 5J36A 1SZBA 2A6ZA 3M7AA 4ZHQA 1CPNA 5C8WA 1IZ3A 2HWB1 5L36A 3ZXKA 3WQ7A 1PGL2 3AG3B 4MW3A 4LFBO 5FUPA 1QXPA 2ZEYA 2QWNB 1TVKA 4FLWA 3KVAA 5KR7A 3OAAG 4Q4X1 3JBG2 4WM7A 1PMJX 1YFWA 1WMDA 1OCCC 1XMQO 2RCVA 2XJSA 3IDAA 1UL9A 4Q27A 1DF4A 1S4CA 5IYYA 3KHBA 2XJTA 1OLQA 2YS8A 1V70A 3SYCA 1PM4A 2WN3A 1R3IC 4LK7A 1XOYA 1OA4A 4I3PA 5BR8B 4B3TO 3R65A 1TA8A 2DUQA 4XPVA 1WWYA 1GBGA 2H0BA 2VQEO 4Y24A 2A7AA 4QX5A 2A3WA 5L3DA 1CN1A 2WWUA 4LF7B 3RZJA 1SC5B 3OUJA 4DRXB 4DINB 3JUUA 2BCCH 1OT5A 4U3JB 2Q7HA 4LHNA 3CCSV 2JB4A 3WNNA 1LOGA 3E5QA 1C57A 3PL0A 5A6YA 1OHFA 3OOXA 4OLLA 1GNZA 2OWOA 4CBCA 1IURA 1DQ6A 2R9AA 3A0NA 3UV9A 2B39A 2Q8EA 5JR2A 3VBRB 5HCAA 3BHPA 3SPJA 1H9PA 3KT1A 3G4SV 2H6BA 5FLXN 4MTXA 4C90A 1O5UA 4XJZA 2XH6A 3OEAA 2OPKA 3WG3A 1SKVA 4LH6A 1OI6A 1YXWA 5F8PA 5DAXA 4CCMA 5I0SA 2EAAA 3LGRA 4IE5A 5T5JA 4SBVA 4NXMO 4DXTA 4BIOA 1W8FA 2VZSA 1Q8SA 2D6KA 2NQYA 3UL2A 4YG3A 5LBEA 1W8OA 2OQ6A 3K0GA 4AE2A 3BA9A 4JI1O 3G67A 4KWJA 3ATGA 5A1FA 1K9MW 4J9ZB 3MPPG 4MOAA 4HBNA 3ZN1A 3GBFA 4COUA 4YZ3A 3ZFEC 1W39A 5LP6C 4UFJA 4QKNA 2UXDO 3T30A 1J1LA 4CEWA 3PMSA 4JGYB 3VD4A 4RR3C 3K3OA 1N8RW 2VQ0A 3DXRB 3LSQA 2BZDA 3AP9A 4K3AA 3W7XA 4COZA 3FKSG 1A32A 4MGYE 1AR73 3I97A 1F4AA 2JGUA 1AB3A 3H9AA 4MVRA 3NAPB 4QPIB 1RUJ2 5CMUA 4ES9A 5DAVA 3RVHA 3KD4A 1LR5A 2GNBA 4EB6B 3AVSA 1YQCA 2BPA2 2ZXQA 4ZZ5A 3CMEV 4GB33 2Q9LA 2FDHA 5L73A 4FOVA 1N34B 5LYJA 2AYHA 4JI7B 1GTOA 5F1RA 2FCVA 5BNOB 4IE0A 3K5OA 1HW5A 2X0LA 4X20A 1CP9A 4O4HB 3CMGA 3APQA 3N3HA 2ARHA 2W1UA 3CF6E 1UY1A 1HV0A 1JS9A 4B7EA 3ETDA 2YC4A 4CEYB 4QPJA 3KT7A 1HNZO 4LOTA 4NIHA 5GONA 4XUPA 4LFAO 4LHSA 1NH2D 2VQAA 2FMDA 4BIFA 1AX0A 4JTDB 5EIBC 3PUHA 3U37A 2WNVB 3PN1A 3NKTA 1TAEA 3MICA 3BN6A 2J1UA 3ZKYA 1CXZB 1AR72 4WZCA 4F6RA 1YIJV 4NOTA 1HDKA 3AZWA 3POGA 1ONAA 5FPOA 1AI7A 3V56A 4P08A 1V54B 4NUBA 2R0FA 4L99A 2W47A 3ZIXA 4GWMA 3JD4A 4GB32 3TEYA 2H0VA 5C3SA 4QM8A 1CESA 1WA8A 2Z69A 3VBOB 4JC1A 3E6BA 2C2AA 5FOJB 3K3NA 4O2AB 3C7GA 3KSCA 1GQHA 4GLXA 3OT7A 4M0NA 4LHLA 1AR61 3SQOA 4NB5A 4NRQA 3GCWA 4O4JA 1RVF3 1CD3G 2DYRB 3RVZA 5KXDA 1C8NA 2QWPB 1AR1B 4BAYA 1YSCA 3SKJE 3IJ4A 5FLHA 1AVMA 3SCHA 4FLUA 3JAWB 5B1BB 3ZHQA 3I2FA 1NYWA 1OUSA 3VQVA 5CIRA 5ANQA 1PO23 1WGPA 3I3MA 3WDVA 2WWJA 4HXCA 4HAMA 4IYHA 1VAMA 3NXSA 3KCXA 5A32B 4JAVA 5CKMA 3O12A 5FXWA 5LXTA 2QQOA 5D2AA 5FUNA 1DCSA 1DQ1A 3IDEA 1K97A 4MVMA 2JJ2G 4FP2A 3ZYBA 2ZHKA 4KBBA 3KV9A 3ZMZA 2XXZA 3D6EA 5ITZA 4MXWB 3H1HH 4BH9A 2AZ2A 2HLEA 4UXNA 1PX4A 5FZ6A 4QHBA 5FXZA 3PUSA 5FZ8A 1UCXA 3AG4B 1DU3D 3AJYA 3WG1A 1IBMO 4WM8A 3UETA 1HP8A 2RR13 1RVF2 1W6PA 1EPZA 4O61A 5JOZA 1VLNA 4LKEA 3K08A 2VZUA 3E86A 5ISLA 4DUVA 5IYBO 5KLVH 1NCRB 3ZSLA 4CZSA 3UCSC 4JDMA 4N53A 1QXJA 4ZZ8A 5BNPA 1AZDA 4AAXA 1PO22 4FPOB 4Q20A 4YSFA 5KHGA 5LATA 4R9CA 4SLIA 5D8AC 3CC2V 1PMIA 1MEC1 4IEPA 1N36B 4FZ1A 4BQ5A 2JDUA 2KXLA 2ZXWC 2H3OA 2WAAA 1DGWA 3T2OA 1OCZB 2XHBA 1M90W 4NIDA 4IGGA 1GMMA 4NO4A 4DV4B 3RW0A 4JTOA 1VPHA 3D0JA 1ULDA 2VQFB 1VBE3 2NLRA 4CC6A 1H2MA 4X8AA 4A3XA 4Y4RA 3CU7A 3JQXA 4IUGA 3ZX6A 3CBNA 1ZLZA 1ULFA 3Q4HB 4N43A 4XCBA 1RUF3 1BBT3 1S0CA 3O1MA 2RR12 4FK5C 4CXWA 3BODA 2VZ3A 4Y5SA 1LHVA 1SQGA 3I49A 4Q4Y3 5C9AA 2WFF2 1B35B 4GD4A 1JU3A 3X2QC 1S76D 1VQKV 2Z42A 4HKWA 2EA7A 5FWJA 2JXAA 3PJSK 4B3SB 5BY1A 1X36A 4NTYA 2XL7A 2YXYA 2F4VB 1WA4A 2D93A 1W59A 1V6NA 4I50A 4R8HA 1O91A 3VDDA 5LA6A 3B8MA 4BB3A 4PIXA 1M4WA 4KG0A 1POQA 2NPIA 2LFSA 3R0RA 2FL4A 2PA7A 2EJRA 1S0IA 1UY2A 1QHDA 1PGSA 1ZBA1 5HXVA 4HN1A 2YY1A 5IWFA 2WC2A 4CDWB 3VZMA 1VBE2 5FZOA 4KG8A 4YVSB 4F83A 4F8AA 2LTNA 4JYCA 3FN9A 5FZEA 5DEDA 5A3NA 3K75B 2EINB 1IPKA 5CAZA 1UYXA 4O9EA 1WW5A 4ZI7A 1GP5A 3ZHTA 4NAMA 4QIWF 5B3SB 5E88A 3IAPA 4E2LA 2LM3A 1RUF2 1BBT2 1XYPA 3B94A 1RUI3 1WLCA 4DYLA 2DBIA 2HEPA 3F5WC 1Q7YW 1W6QA 2K9PA 1ENXA 2XUEA 3CZUA 3VL9A 4JZ2A 2GN7A 4Q4W1 2IXJA 1W9WA 2WAMA 4XFAA 2JJ1G 1SZXA 1N3QA 1AR71 1C5IA 2Y6FA 1Z5VA 1UZZA 2C1FA 2B9ZA 5A70A 1QBZA 3E8GA 4O2BB 1EN4A 2GTSA 3RYHA 1RMU3 4CUAA 3RGBA 1C4RA 2W1QA 4JGZB 5J2TA 1UXZA 1GV9A 1UZYA 1K92A 2P67A 2FDKA 3CJIC 3F95A 2NN4A 2XOMA 2ZNJA 2PY5A 2A71A 1TG7A 3M7MX 1QF3A 5EZYB 1K5QA 2HP8A 2PLV1 1U5ZA 3NV1A 1CWPA 1LTEA 4KXRA 2PELA 4JI6O 3AP7A 1MMMA 3MFAA 2AACA 1WA6X 5CKQA 2ZGOA 4FTEA 4MSVA 5A3UA 3T4VA 5C71A 3DGEA 1GR3A 1RUI2 4W6WA 4AVSA 3SNMA 5FZAA 3I55V 1VARA 2KA3A 5T55A 3F2ZA 4NIIA 1OFSA 1SLAA 4UF0A 2O57A 5FV3A 5JWPA 1FXZA 1DTOA 1YFXA 3SEPA 2Q8CA 1ZZ6A 4OHXA 1FMD3 1YXBA 4I0AA 4YM3A 3AK2A 4IGQA 4C1WA 1I9RA 5FNVA 3OGGA 3ZHSA 3K4AA 5CBLA 1JQ0A 3WEZA 1RMU2 2VWJA 1HQLA 1G9DA 2HJDA 2WNUC 2XVKA 4K8RB 2ZJCA 1FFXB 2WNOA 4DNYA 2ZGQA 4X65B 5LBQA 3WB0A 1K5JA 3KCYA 3Q8AA 3AG1C 1Y67A 4CEWC 2PZSA 5I0TA 1G9BA 4JTAB 4YZ2A 1H2NA 1BQPA 2VZTA 2JGDA 3FUOA 2A9HA 3J7AU 1RVF1 4GYCB 5DUXA 4I4TB 5GLVA 4RQFA 2YPDA 4AYUA 5CU1A 1HJFA 3ZSMA 3WG4A 3TEWA 4XJAA 4KWKA 1NU1H 2OYQA 3T1YB 1PNMA 5AC93 2FYUH 1O8SA 3AP5A 4XMAA 1SPPB 1PZ8A 4XXAA 1QOSA 1PO21 5EC1C 4UVAA 1WD3A 1MSDA 3ZXEA 2X5IA 4N7UA 1QKQA 1WD4A 2JDNA 3HPLC 2F23A 5A3OA 1FMD2 4YYOA 4QHOA 3I4IA 4M3CA 4CDXA 3THPA 5LA1A 4ZU5A 2P6HA 2BYVE 1GN2A 3TCUA 4HYOA 4I0BA 1CAWA 4QPGB 2WIIB 4UW6A 4FPCA 1W2TA 4XVHA 2QUOA 1LOBA 3ZYHA 5JOWA 3JATA 5JVDB 1R1A3 4ES8A 4UBGA 3QTCA 2FMYA 5DUWA 4XTPA 1RB8G 4Y22A 2P3KA 1WN7A 3RJRA 5FMCA 1SFPA 2CWSA 4RO2A 1JZ5A 4LMFA 2QJVA 2GC1A 1GZWB 3E1F1 1M5IA 4NRMA 3RJ2X 2NMOA 2RR11 1NA1C 1XNQO 3J9SA 3ZMVA 1QJU3 1JW6A 3I5DA 4TOIA 3GZTB 4OI1A 2JE7A 2PFWA 1FNZA 4PA6A 1RUD3 3RMYA 1RM1B 2XTAA 1QR9A 4DMIA 2VCMA 1QJZA 4RGKA 4O4IA 4IERA 2BTQB 2VPVA 4CRQA 4UAPA 5DAWA 4LH7A 3HD8B 4LIUA 2B7YA 4UV8A 4FAHA 2ZX1A 1OCCB 1KD1W 4MHRA 5AC92 2ZKNA 3IGAC 4DO2A 5T52A 2A3QA 2UYAA 2GMEA 3OBAA 3OYWB 4BW5A 2WS93 4XMIA 4R9BA 3R66A 4LPLA 2W92A 4M0HA 2DUOA 3M3EA 2ZABA 5LA2A 1REEA 1YJNV 1OV9A 2GHYA 3VBFA 4QMAA 4R9AA 3D4KA 4B3MB 3QF7A 5APAA 5FPRA 2RM23 1BYHA 1OKQA 5T50A 1R1A2 3OGIB 1S2KA 2W2IA 1JMKC 1UIJA 4QM9A 1X8MA 2QR4A 4J6GA 2P17A 3RZMA 3PUIA 4A2UA 5DM6V 4EN0A 3B01A 4L8JA 4QKBA 4FOQA 1QJU2 1Z5WA 5CFDC 3V0AB 1RUD2 4ASKA 3AKSA 5BR8O 2LROA 5C6CA 4LOSA 3OB8A 4NTXA 4Q4Y1 2QKCA 1BEV1 2RS31 2CAUA 1C8M3 1GLHA 5FYBA 4QU2A 1RPRA 3CRMA 5CA1A 4BXFA 4W8JA 3HNBM 4QGNA 4JV4A 2P4EA 3VQWA 4AQYB 2BV4A 2WS92 1D4M1 5A1AA 1MQTB 4YGCA 2VTXJ 4L8QA 2QM8A 2VMDA 4XAAA 3LWCA 5IWAB 4RYDA 3ZEDA 4MX3A 1VIBA 4WM8C 1JU4A 1WMXA 4EEQA 1OOPC 2V4VA 1SQVH 3USUA 4TSFG 2RM22 3B69A 3MLJA 4N90A 1SACA 1L1FA 3HVDA 5FP8A 3M3QA 1TUBA 4E4SA 3OTOB 5ERLA 1WW7A 1MNGA 4N53C 3J7HA 3WHUA 4DR6B 5GLUA 4LBJA 3ACHA 1M56B 3FLTA 4XZPA 3UKVA 2JG8B 4ZIBA 1GOFA 3HMYA 1QR8A 1RUI1 1VMHA 3JCZA 5JQGB 3AYDA 3RYRA 5EP9A 2EIBA 2GSYA 3AX4A 2QQWA 5LK7B 1IBLB 2QFEA 3PHMA 2WLLA 1C8M2 1VJ2A 3ZYFA 5EZWA 2PYJA 1SEFA 1E5HA 5KAIZ 5DDJ1 1VRH1 1FKAO 1W9FA 4YLZA 5JSPA 1LHOA 1B3QA 3IAQA 3POJA 4LULA 1US6A 5F3GA 1H38A 4XF3A 5FZKA 3QG5A 4Q8LA 1BJQA 4UCRA 2CGOA 4DOUA 3AZZA 3MGUA 3HN3A 4EYUA 1ND3A 1OUXA 3U11A 1DLLA 1H8TB 3U14A 3ZFFA 3FHQA 1LOFA 3ZYRA 2LFRA 2EIDA 4AI1A 2DCZA 1G6NA 3TEZA 1U0AA 3RNSA 1DDLA 2HR3A 4ITCA 1Z2GA 1ACCA 4DV0B 4E4DX 4LBOA 4CDQA 4IV1B 2FCUA 3A4UA 4PA4A 1N3PA 3WQ1A 1N34O 3GZUC 2XLGA 5E16A 2VVFA 4JI7O 5FP3A 1ZAUA 1I5YA 1RITA 2DQ0A 2A3YA 2EIEA 1UPIA 3WOGA 1ALYA 1FMD1 4EJRA 5JZGB 4TV8B 5LWBA 3N7LA 1RINA 5E1AC 2F1MA 4J41A 1R64A 1TNFA 4L2NA 1SQFA 2R9IA 4AI9A 2CH7A 1SRYA 1KQRA 4IHJB 3MI8A 1MS1A 5H5NA 1IOAA 3ABTA 2ZD9A 4DR2B 2ATFA 4FVVA 3E22B 1NCQB 1JZ8A 3POFA 1KKDA 2A06H 4DV6B 1VQ8V 4HK8A 1H0BA 4FT8A 3CMAV 3FMGA 1EAH3 2OIEA 2QKAA 1NQDA 1O3QA 4A42A 2Q8VA 2A73B 1VF6A 4BM8A 2VR4A 4YZ5A 3IC9A 5JR7B 5AC91 1LESA 2WL1A 3LEMA 1KQSU 2IXKA 4LORA 1HR0O 3NNLA 1UPGA 1NE6A 5I8SA 2DURA 5GZFA 1HW7A 1DZQA 2F4LA 5A7PA 3WZ1A 5FPBA 2LO1A 2DE0X 1XNBA 4HZFA 2QE3A 1F5JA 2BVVA 2FKXA 4H14A 5FZ0A 5C5UA 4K8FA 2IXHA 3HJRA 4DRXA 3ECQA 3TETA 3T1MA 4GH4B 2W95A 2OS2A 3L75H 2D6LX 4BU2A 1NZIA 4PA3A 5A3LA 3M3CA 3N36A 2Y6GA 3RYKA 1DIWA 2BJSA 3NV3A 1K3IA 2HWE1 2ITCC 4MVTA 4AEKA 1URFA 3B9IA 4CUBA 2ZHNA 5ACA3 1QJU1 5L9VA 3RZGA 1S77D 3TOJA 1VAKA 3SJBC 1EAH2 2R6QA 2VOWA 1I1EA 1HB1A 4JAUA 4NHYA 1HN0A 5BNNC 1DYOA 2VMGA 2ZXWB 2UU9O 3AXDA 4CH4A 4B4RA 1M9NA 1AP5A 3AZVA 1H6XA 3ASOC 1W03A 3WDTA 3PUAA 1CZTA 2DVBA 3I3EA 3JXSA 5FY4A 2MHFA 4JI8O 1UZVA 1IXMA 4FJCC 5FZMA 3H1JH 3JCIA 5KXEA 1T6BX 3WY6A 5FPUA 1RUC3 1SLIA 5IUQA 3U78A 4PDWB 2ZGTA 4JGYA 2CTWA 4E2SA 1NTZH 3K5LA 3DXRA 5H6QA 2JEXA 4BK5A 1YZBA 1N36O 2IWGB 3L73H 2ZGUA 3J81N 3CXHF 5BXZA 3VHPA 4PJYA 5C8CA 1VE0A 3X2QB 4DV4O 1ZRRA 3SEEA 1PK6B 2X5IC 1KFUL 5BZBA 1TME1 4J9YB 3ZRVA 4U7OA 4ZU7A 1GRJA 1V55B 3N27A 2HWD3 3WP6A 4CCJA 4ZU4A 3LDRA 5A33A 4I02A 2XBO3 5IJRA 4KHPB 3H3LA 3VUOA 4BMBA 3CRRA 4GUNA 2WR9A 5BNOA 1W2OA 2OW4A 4I5SA 4XW3A 4ASUG 4JYAB 4XACA 1YJLA 5IJ0B 5FPLA 2PAKA 2A6VA 4XYXA 4BLJA 5CG8A 1RXFA 1V00A 1XNDA 2E31A 2OX0A 4ZHQB 3T09A 4IQPA 2UXXA 2XKPA 1QH6A 3NSTA 4G27B 1WZXA 2YFZA 3HPNA 3ASNC 4B3SO 3PU3A 4J7JA 5EHDA 5IVEA 1TVKB 3VGIA 5EPAA 3POSA 5I93A 1FNYA 2F4VO 3AMPA 2B45X 4WM7B 4LBKA 3JB8A 5GKAC 4DV2B 4A3ZA 1YVWA 3OEBA 2AENA 2HEYF 4AILC 4HN0A 3SHRA 4CUCA 3IPVB 4RHV1 3MDSA 3LA7A 5EYXA 1JZ2A 4XDKA 2R073 1AJOA 5FYYA 1Q6HA 2HWD2 3A7QA 3LSSA 3IFXA 3AP6A 3V64A 1GZ9A 2YV8A 3CRAA 1KP3A 4DQAA 2R7EB 3JASA 2ENRA 2XAFA 1O4ZA 2XJRA 4M4PA 3E5UA 1H9WA 4DRRA 3ZXJA 1IS3A 4QDSA 5H2FZ 4U7NA 3ABKB 3FHIB 4MZUA 2N7GA 1V6LA 1TE1B 3IIIA 4EN6B 3SC7X 2WZ8A 3LZZA 4FM0A 1RC6A 3I7DA 5DUUA 3DXTA 1PNFA 4FFIA 4QPWA 3GNEA 1KDMA 4I30A 4AFMA 3WDWA 3J8F3 2F95B 3CJXA 1CEZA 1UNBA 1ND2C 3WUDA 2ZNIA 1YJ9V 1H6YA 1AJPA 4QWNA 1QNMA 5FWEA 5A2QN 1QDCA 2E5LB 3W59A 4YFZA 1Q8OA 4AF9A 3WXPA 4XUOA 4P9JA 2WZPP 3HB3B 1JHNA 5GJ6A 2E74B 5HPOA 2WO7A 2RS13 1OCRC 4FPEA 1NOVA 4Y20B 1XC6A 2X7RB 1VMFA 2R072 1CX1A 1ENRA 3EBRA 4B1MA 4CS3A 4JF3A 2PAMA 2P2KA 3D3QA 1AR83 3O0VA 2P3JA 4OX9O 4JHZA 2IVIB 3KB5A 3KCCA 1VF7A 1NZCA 1Y9QA 2GSMB 3M3IA 3RYFB 1Y74A 4NJ4A 2YI9A 3ZMUA 2WO3A 3QOPA 3ZIWA 1FX5A 5LGUA 3LDCA 3TN91 3TAYA 3P32A 3APBA 2GV9A 4PDVA 1K5MB 1XBLA 4N23A 5CA6A 3AEIA 4AEDA 1K33A 5E1RA 4CXYA 5B5EZ 1KECA 4K8XA 1D0HA 3J8F2 1DGWX 3O14A 4ONUA 5J48A 4KFMA 1OVPA 2D3RA 3OFNG 4BLIA 2ILMA 4CH3A 4DXSA 1G7YA 4QT6A 4X65O 5LYJB 4GWIA 4DFSA 2RS12 4XFFA 3C90A 1FXHA 2E3CA 2FCTA 2GALA 3T0DA 2ZR2A 4CU9A 3CO2A 4X20B 2P5BA 1S2BA 1LCLA 4RL7A 1VQPV 1AR82 1ND3C 5HXMA 1BXHA 2DYSC 1RHI3 5A9GA 3B7MA 3WW2A 5GONB 3ZFFC 2JD9A 2CNAA 3T1YO 1R083 3PURA 4H3WA 2X09A 1QXRA 2O8OA 4L97A 2EULA 3RVYA 4BK4A 3C7FA 1U97A 3DCQA
chains in the Genus database with same CATH topology
4YRDA 3WR0A 4CDQC 1ULCA 3P3NA 5I0UA 4AE2A 3KMHA 4BYYA 1DS0A 4KWJA 1ZYBA 3HQXA 3ATGA 3TRSB 1CAVA 3MPPG 5CFCB 5I91A 1XU1A 1CIWA 5GZGA 1M06G 5KXBA 1VBD1 4HBNA 3WW4A 1UPSA 3GBFA 4NHLA 4COUA 3CLPA 4YZ3A 4DB5A 2D6PA 1ENSA 4WVWA 1MVQA 3ZFEC 2YXSA 1W39A 4AHWA 3LKJA 1Y43B 5ACA1 2XVLA 2XJQA 4IESA 4PCRA 1XXNA 2HWB2 1J1LA 1QJX1 4A7YA 4CEWA 2XWJB 3PMSA 4JGYB 3UJOA 4RR3C 4AG4A 2D44A 1COV1 3N6WA 3BPZA 1SBFA 2VQ0A 3AP9A 4XF9A 3I59B 3ZFGB 1FOD3 1SCSA 3TB0A 1LHUA 4COZA 4TLFA 1LGNA 2HEVF 4MGYE 1AR73 3K51A 1OMIA 1Q56A 5H9SA 5JVVA 3H9AA 3ME2A 2Y0OA 2Q5TA 3NAPB 4QPIB 2UWAA 1RUJ2 3C3VA 1ZZ8A 4ES9A 5K9YA 5T5PA 3KD4A 1LR5A 1KS4A 1SLTA 2GNBA 1HXS3 3G6JB 1ASJ2 1YRZA 1RHI2 3ILNA 2WLPA 1N47A 2BPA2 1I3HA 3KGZA 3TN92 4GB33 1MZ5A 4AGGA 4AFAA 1J1TA 1R082 3VHNA 2GNMA 2ZHLA 5L73A 4LLFA 4FOVA 2D6OX 2Y38A 3ZYPA 3ASIA 4MXVA 3VBSB 1RUC1 2ARXA 4OZXA 1QWRA 2AR6A 3RI8A 4FPKA 2AYHA 1S0BA 1QOTA 3HR9A 5F1RA 5BNOB 1SCRA 1HW5A 2DV9A 2UY9A 4QQOA 4OHWA 3DPRB 2W52A 1GSLA 5LEJA 1FV2A 1OPOA 3N3HA 3CF6E 4FTSA 1DG6A 5JIAA 4R9DA 3VBRA 1HV0A 1Q8VA 2UYBA 1N1YA 2JG9B 4N9IA 4XJWA 4B7EA 4XQ4A 2D6MA 5D8AB 2A6YA 4CEYB 1IS4A 1XU2A 1COV3 3KT7A 1POV1 1K5MC 2BNOA 4M3CE 1FI2A 4P9YA 4ASMB 3NO8A 3RG0A 2XJUA 4P14A 5KXCA 2VQAA 2FMDA 1BZWA 3H1WA 2XJVA 4JGZA 2PHLA 4BIFA 2BQPA 1NX8A 1AX0A 1SDWA 2MEV3 2ZHMA 2WNVB 5FO7B 1FOD2 3NKTA 3OF1A 4IEXA 3WCRA 1N3OA 4UW5A 3UK9A 2YDEA 3MICA 2GN3A 2XBO1 3WT3A 4AHXA 1WUVA 1AR72 2CTVA 4WZCA 4WM8B 1H4GA 2JICA 4NOTA 4LA2A 1ZM1A 2WZR3 4NHMA 3WD5A 4F7ZA 4B8EA 1VR3A 1H4HA 4YM2A 1HDKA 3AMMA 1J58A 3AZWA 5CFCA 1ONAA 4IEOA 4L11A 1V6IA 3VHRA 3V56A 1HXS2 4R4ZA 4OI0A 1G9AA 4YM1A 3WINE 2R0FA 1MR5A 4L99A 3ZIXA 5B2GB 4QQLA 4GWMA 3B9CA 2EALA 1OFNA 4GB32 4K3UA 4AI0A 2H0VA 3FE5A 3ALQA 4O9GA 3GZAA 3EATX 4QM8A 1CESA 3VBOB 2ET7A 2Z69A 2JJ6A 5BNPB 4M27A 4JC1A 2Q0AA 3JU9A 3E6BA 3IDCB 2XPJA 5FOJB 3AB0A 2GNTA 3KSCA 3LSDA 3D0SA 4LE4A 4HVRA 1GQHA 2HWC1 2WJSA 2ETEA 4J1XA 1NE4A 1MS9A 2R061 4M0NA 4LHLA 1AR61 1PO11 2FBEA 3NAPA 4QPIA 1RVF3 2JKBA 1CD3G 5KXDA 1C8NA 1NLRA 3ZYGA 1AX1A 5ACA2 4GXLA 4WVVA 2EXIA 1V6JA 1HRV1 3GHMA 1COV2 5FLHA 3SCHA 3ZXGA 3T1LA 2NMNA 4CP0A 1ZX5A 3FFZA 4I3GA 4XF1A 1NYWA 1SBDA 4XDQA 4AFBA 4Q1PA 5CIRA 5JOYA 4YZ1A 3VZNA 3VBSA 2ZZJA 4LTAA 4UBHA 1PO23 2WFF1 2XWBB 5ABJA 4WVMB 2MEV2 4HVQA 1WGPA 4UW3A 3PVJA 2WBOA 3WDVA 3TWIA 1W6MA 1VAMA 3KM5A 3KCXA 5A32B 5JPMB 4AI8A 4N43B 2VH9A