4JAAA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
328
Chain Sequence
ALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
total genus 102
structure length 328
sequence length 328
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4jaaA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jaaA01
4JAAA 2CGNA 3OD4A 1H2LA 2CGOA 2YDEA 3KCYA 3P3NA 3P3PA 4B7KA 2YC0A 4BIOA 5JWPA 4Z2WA 1MZFA 2Y0IA 1YCIA 2WA3A 4Z1VA 1H2NA 1MZEA 2XUMA 2ILMA 2W0XA 4NR1A 4B7EA 1H2MA 3KCXA 1H2KA 4AI8A 4QU2A 2WA4A 1IZ3A 3D8CA
chains in the Genus database with same CATH superfamily
2RJZA 4J80A 5JSOA 1W6NB 2VBBA 5IJ9B 4A6OA 5J7MA 3ZEDA 1YFUA 3MO4A 4UVAA 2QKDA 4R4ZA 1WKYA 1W9SA 4I02A 5A33B 1B04A 1UU6A 5AC93 2RQ6A 1OPMA 2WQ4A 4QQPA 5JI7A 3AMQA 3RMYA 2XH6A 5JQGA 1J3PA 5C4WC 3AMPA 4GWMA 1ZSPA 3TNPB 2ADDA 4E8CA 3VBHA 2YBSA 4XJAA 1AR91 3W9AA 3GHMA 3ZHQA 1R1BA 1QJX3 2PYLA 2CAZC 4FO9A 1I5YA 2EILC 1M1KW 4X1IA 1J1LA 1F4NA 2K9PA 2Q8VA 5AG2A 1OI6A 5K4LA 1MSWD 3QH6A 1S4CA 3I4IA 4KI5M 5FL7G 5FLXN 2C4XA 3WF2A 3NO8A 2B4KA 3ZOIA 1FMD3 3CC4V 3P6BA 2XJUA 2F4LA 4H0LB 4DUXA 1RUJ2 4GB33 4B7KA 1EUTA 3FB7C 5DAWA 2IBZH 1QOTA 3MW4A 5GLTA 1SETA 2PHLA 3GZUC 2EJRA 4IIJA 2ZZQA 4PJYA 4BJ0A 4G3YC 4A41A 5B4XA 3U11A 2GMPA 4IGPA 1V0AA 5FOJB 4CEWA 1EUUA 1J95A 4A3XA 2BNNA 4UBGA 3JALA 3FMGA 5EJ3A 5IVBA 4UCVA 2VNRA 3I3BA 1SPPA 3OYWA 2Q8DA 4XQWA 3BN6A 3CJHA 3TWIA 1RM1C 4FBFA 3N4MA 1QBZA 1MR5A 3SYQA 4WM8C 1LENA 1LEDA 3LWCA 4YZ3A 2ZAHA 3TEYA 4FZ0A 4OX9B 5LRSA 1RYYA 4H55A 2DVGA 4CP9B 4Z92B 5L9VA 4Y5SA 5IK5A 2RS32 1HN1A 4FPHA 1LCLA 5EBWC 4K8RB 2BNOA 1PO21 4NIAA 3ZFEB 5KXCA 2JWPA 3VBSA 1WGPA 1XB9A 4CDUA 5IJ0A 3DC6A 3BA8A 3CLPA 2QUOA 2X5IC 5M0TA 3VDAA 3ZN0A 2QKCA 3N2GB 3ZVXA 1NI8A 4F6RA 3NJYA 1AYM2 3KKYA 1CPYA 1RSOA 1QVGU 1BYHA 4CBCA 3MFAA 1D4M2 2OXBA 3R6SA 1OCRB 3QOPA 2XQXA 5L3EA 4P5HA 1X9TA 4CCJA 2ZBJA 4OCTA 3M2MA 5KHJA 4BA6A 1M57C 2QFEA 5LHIA 1UU5A 3DEMA 1IQAA 5A7NA 4LF8O 4DNYA 3I7DA 4FPPA 1W6QB 4X1KB 2R073 2H6CA 4C90A 3G6JB 4LE4A 1FXVA 4FLTA 2DFCA 1OLQA 2CUGA 4H37A 3NJZA 1K5MB 1TMF1 1GUIA 4HPKA 3FZ3A 3ZCCA 1VQ6V 3MGUA 4QKDA 2P4EA 3DPRC 4TQDA 3MZHA 4TV8B 1GFF2 1EZVH 3TN91 3B8MA 2VMCA 4DRRA 1W2AX 4JI2B 2IJJA 1BJQA 2XAQA 1APNA 4OUSA 5KHIA 2I45A 2W2IA 3VQYA 1MABG 5HCHA 5GONB 5C9AB 4CUGA 1ND3C 2DV9A 2UXBO 1IG0A 3W5MA 2YB7A 2K46A 1OOPA 1XPWA 4LWSB 1IZ3A 1HV0A 4QB2A 2QDOA 3ZDVA 2ZEWA 1POV0 1CJPA 1HX6A 4WFBV 4DR7B 3ABUA 2P4VA 4C0BA 2F1MA 4DW1A 2RV9A 2WLKA 5D5QA 1EAH1 5FO8B 1KB9F 2QTOA 1K5QA 3X2QC 3O12A 1N0NA 1VQMV 4OMCA 4HKWA 1RUD1 2V09A 1ENRA 5C71A 1SRYA 4UFIA 4HNAB 3UGFA 5LATA 1R092 3URFA 3WNNA 3AKQA 4QE7A 1KS4A 4JV4A 2XHNA 2Z2SB 4Q4Y1 5CEHA 3ZN4A 2ES3A 4FZ1A 2ZPXA 1TQ5A 3VL8A 1WW7A 4NHYA 3OUSA 2B45X 1AR4A 3U0ZA 4AEKA 3RYRA 4CCNA 5K0UB 3CC7V 2GNTA 2ZHLA 2YIDA 2WRAA 4LBKA 3SCGA 3LEIA 2WLNA 1AR71 5E88A 2NR5A 1BVP1 3PU3A 3POEA 2WWJA 4LO6B 1Y74A 4GQ7A 5A9GA 4JYBA 1P7GA 2YEVA 3VBFB 5KWRA 5F6LB 4YVSB 5BPXA 4NIGA 2VXJA 4AFDA 3VKMA 2UU9O 3THOA 1EFRG 4ICGA 2YHJA 2VNVA 1F31A 4GKJO 5C3PA 1PNFA 3HMYA 4RQEA 3H9VA 2ZS6B 1RJ7A 5LXTB 2CK3G 2OA2A 4JVAA 3ZIXA 4D0QA 1NG0A 1RUG3 4PI0A 4BU2A 5KAIZ 4XUTA 3JAKA 4LJHA 3JUUA 5FQ0A 1GAXA 1VRH3 5FPBA 3WDYA 2F4VO 1ZRDA 2W1UA 2P3KA 1VR3A 3OY8B 3TBDA 4P9PA 4CS4A 5DEDA 5L73A 3AMMA 1S5LZ 4FP2A 2XGXA 4WM7C 1I94O 3D3IA 3MIEA 1YC61 2JS5A 4KQ7A 5LL6Y 3ZS8C 2YY1A 4Q4V3 1S77D 1ZL8A 4I55A 2JG8C 2E7AA 2ARXA 2UXCB 4P00B 2IFRA 1XYOA 4LPLA 1W8OA 5KHGA 1FFXB 5FK7A 2Q7GA 3ZYPA 5EIBC 3RZLA 2NP0A 2DTWA 3VB9A 1Q56A 3CRRA 1HN0A 2VU9A 3DGTA 1ZWIC 4ISQA 4BK5A 3WW4A 4NRPA 5CKNA 4X65B 3CBNA 2AGAA 1S0EA 2QQOA 4IEPA 4HN0A 1R3JC 1R73A 4GKYA 4J10A 1XBFA 2ZD9A 5DQ0A 1ZYBA 4SBVA 4GAZA 1P4RA 1W2NA 4XDJA 3D4KA 1K97A 2DYSC 2LJ2A 1H2NA 4NPMA 1D2DA 3MV01 4ARXA 5BNOA 3WQ7A 3DYOA 2C0ZA 1SBDA 3IZOA 3CRQA 4DW0A 2OTJV 2JD9A 4HYOA 5DN2A 1TVGA 1XQNA 1GBGA 5L3BA 3O0WA 2V7QG 3GBFA 4CDQB 2DUQA 4BQ1A 3Q8CA 4DIQA 4IETA 4P5YA 3M3QA 4W4LA 2J1VA 4KWKA 1O3RA 1Q5OA 2PAMA 4UW6A 1O4TA 5F2VO 2DU1A 2M7WA 2W87A 3QG5A 1C8M3 3VV1A 1KDMA 4DXRA 3BKZA 2D5FA 3KQRA 3T1MA 4AI2A 1IXMA 4QPGB 3A8TA 4KWUA 4MW8A 2XJSA 3K5OA 5KXEA 4TV9A 1WMXA 2Q8OA 4R9CA 1CIWA 4FPOB 1WLDA 1PVXA 3B5LB 4J9YB 2QTWB 2PHTA 2GDSA 2IJIA 4UWDA 1S76D 1YIFA 3MPBA 2RS11 1EYBA 2DUPA 3ECQA 4I50B 2VWKA 1HQNA 4LA3A 3U07A 5LA1A 1JZ8A 2EULA 5CFDC 4AQYB 4N43B 3HKCA 4LHLA 5C33A 2ORXA 3JQXA 3FLPA 1G8WA 4QHZA 2CTWA 3ZXLA 4CUBA 2UYBA 1RVF1 2ADQB 1LHOA 4CPBA 2Q67A 2ZE8A 5DUWA 2CTVA 2DVAA 1E5IA 4UW5A 3WNXA 1RUE3 2QQMA 3M8AA 2NLRA 4UVCA 3UNPA 4HONA 3DXUA 3H9AA 1V6IA 2VPVA 3OG2A 4WZCA 1I5XA 4QX3A 4O4LB 3JASA 3LAGA 5FUNA 4JZRA 4BQYA 2WNUC 2EF6A 2ZKNA 3VBRA 2FHRA 3AK3A 4N8MA 1B35A 3LOIA 4GT1A 1GM7A 2D98A 2RMU1 5B3SB 4MXWA 1BT8A 5JJJB 1K5SA 2CU5A 5FZ1A 5FKBA 4XBNA 3POBA 5A7WA 3E5UA 4OX9O 1R6TA 2WT0A 4DV6B 5FCCA 3IWZA 1COWG 1DIWA 1SZBA 3O0VA 2BOBC 1YIJV 3J80N 1KFUL 1E1QG 1ZBE1 1LHWA 2VZ3A 4AVBA 3ABKC 2X05A 3CCVV 2WZR3 4RR3B 1DF4A 4Q4W3 4QWNA 5A6QA 4YFZA 1JX9A 2HJFC 4XFAA 2V4DA 1ZM1A 3U10A 4J7ZA 3WLUA 1HB3A 2A6WA 2LS6A 4JGYA 5FRAA 1VBC3 5F5CA 4UOJA 2PXJA 4PQ9A 3W21A 1JYWA 4HT1T 1EV13 1GZWB 1LULA 3I49A 1CQ9A 4KHPB 4KNCA 1XU2A 2IW5A 5SV8A 4OGQB 2JKXA 2YXYA 4JGZA 4XFHA 1HLCA 2EZOA 2FBEA 4XF3A 3J26N 4C8DA 2PHRA 2E31A 4KFMA 4W50A 1WPBA 1DU3D 4UUJC 4DR6O 3N9MA 2Y0OA 3IPVB 2FMDA 4NIIA 5EZYB 4I3PA 2R062 4YXWG 2YU1A 1OKQA 1FPN2 5FJKA 1YJWV 1TAEA 1Q90D 4QX2A 3AMNA 4JI0B 2RM22 1S0FA 1Q8OA 4L97A 1PO11 2B1IA 1XEQA 4JI2O 5CU1A 4O4IB 5JH7B 4OHZA 3ZSLA 2K2SA 3D0SA 3NKTA 1SDDB 2A7WA 3QTCA 2EINB 3UKMA 5C8CA 1S2KA 3SR2C 1UZVA 1R6KA 4FLYA 5A80A 3E5QA 3M4FA 1N1YA 1OQEA 4I9WA 5F2WA 4A7YA 4LBQA 3C90A 1Q8VA 3VKOA 4M3CF 4DR7O 4CS2A 3ZFGB 4RS5C 2VNOA 1NTZH 4EEQA 5F1RA 2ZXWB 3CB2A 1AR81 3VQXA 4XCAA 4HKLA 3ABMB 1QQP3 5JWPA 2MPFA 1DG6A 1WA8B 2ZGMA 2VULA 1VBA3 4JV5B 3OJBA 1X50A 1Z0HA 4Q4Y2 2WNOA 2V5DA 2HWD2 3BU0A 1CAVB 3AZZA 4OQ9A 1DGWX 2GP5A 3ST7A 3O7OA 1BMV1 3LB9A 5EYPB 2XVLA 3RYFB 4KUMA 2R72A 2Q73A 2XVGA 3HR0A 1AR72 3NMBA 1RUOA 1Q6IA 3S7IA 2NMNA 4JGSA 4QGPA 1UCXA 3S5QA 4GMP1 4ZS3A 2Y6HA 2XT9A 2JE9A 4Q8LA 4IYIA 1L7RA 2J42A 5LGUA 4OQ8A 1RUI2 4X6RB 1SA0B 2ADPA 1PIV3 5FZBA 1H4GA 4UCUA 4QKNA 5JZGC 2Q69A 1JH5A 1WCUA 4CCMA 1KD1W 2EBOA 1PVC1 2FZ2A 1A6CA 2UY9A 3K5MA 2BERA 1BHGA 3LZZA 1W2TA 4P9IA 3CCMV 2PAEA 2ZNJA 3OGVA 3GWKC 3E6BA 4EFEA 3BTZA 1LOFA 1EN4A 2OCCC 3KVAA 1SFNA 3WDXA 3K0GA 4NXNB 4IYHA 1W6PB 2BGOA 1QU7A 5C8YA 5GTIZ 3GZTB 2GC2A 3JBG2 5HCFA 1POQA 3LGRA 4CEYC 1G1XB 1I0HA 5CISA 3E89A 4DY3A 4N53A 2ZKOA 1AROP 4L2NA 5BMVB 1H0BA 5FYUA 2WLJA 3CEIA 1XREA 1WB8A 3CE2A 5LMUO 3J7LA 5C3SA 1DZQA 2ZEYA 4FLXA 3HKDA 4WVMB 4OUMA 1A78A 3THPA 5T55A 4FQ4A 2RNBA 2IVJA 4NTXA 4QM8A 2QJVA 4DK0A 1PMHX 1UIJA 4QPIC 4FP3A 2QKSA 2EIKB 1E5SA 4JAUA 4IERA 2X10A 4J7JA 2ZA9A 3K2OA 3WEZA 5FY5A 1YJLA 5K8SA 4YW6A 2Q9LA 4OYUA 3WB0A 2WL1A 4X65O 2B5HA 3QO7A 4IIJB 3RT3C 3CX5F 2VZQA 4GZ9A 4COZA 4X88A 3CC2V 4XDOA 5C93A 5FZ6A 3CIHA 4MG2A 1N1TA 2QQJA 2IXKA 4AR2A 5ACA1 3OD4A 2RE9A 4AQSA 3C3TA 3WX5A 2QA4V 2W94A 3ZFFB 4W8JA 3CU7A 1OUSA 1F35A 2XR4A 2P5BA 1LOAA 3C7GA 1WPXA 1G6UA 3IBMA 1LECA 1CZTA 5LRRA 2JG9C 4DV5B 1VPHA 3CF6E 2R70A 4BMEA 5DECA 2FB5A 1M9NA 2B9ZA 3LUTB 5BNNC 5B1AB 4AE2A 2IU0A 4AHZA 2VECA 3BIWE 5F39A 3PIJA 5FWEA 5IJ0B 2BPA2 3P30A 2CTRA 3O1SA 4E4EA 4QHBA 3LNMB 2LQTA 1O5LA 4BR6A 3EXAA 4MVUA 3R4SA 4P9WA 1JZ4A 1RSOB 5A32B 1F5FA 4IEQA 1POV3 2D3SA 2G9ZA 2RS12 1VMFA 4MXVA 1XILA 3OMIB 1UPGA 1VB2A 2E7TA 5FZ4A 5FY7A 1BSMA 4QU2A 3S7EA 2X5IA 2Q8CA 4YG0A 3W20A 4O7XA 2NMOA 4AHWA 5AFEA 4O61A 4KBZA 2VBPA 3E22B 3ASIA 5EBLC 1C5HA 5FZLA 3LDBA 3ZN6B 3ZXJA 3CNAA 5ABJC 2VE1A 4TSVA 4KBBA 3NWKA 2WC2A 3ORJA 3H1JH 1IG3A 1F7YA 3VZMA 2CV6A 4MGSA 5SV5A 3SEPA 2WFF2 2H94A 2DUOA 4BPZA 2YV8A 1J1TA 1OQ1A 2UUCO 1NUKA 1WW5A 1W0PA 1HXS3 1QDOA 1QH6A 3HQXA 2D3OW 3CCSV 1NLSA 4QPJA 4JQRA 3I2KA 4C7UA 5CBHA 2PAKA 2WAMA 2P3JA 3HNMA 2C6SA 4ES9A 4B29A 3K0DA 4HG6B 4RD7A 1CPNA 4E4SA 4UYBA 2BEOA 3Q4HB 5FZGA 3NJXA 2EAKA 2ENRA 2ARAA 4EFBA 1V6JA 3OOXA 2QKAA 1N36O 4NHXA 4J42A 5EZWA 1ZBE2 1ND3A 4DV6O 3EB7A 1L7LA 1JOPA 5EP9A 1UYZA 4O4JB 5LMNB 3MD0A 1SQQH 1SACA 1ENVA 1V9U2 2DJVA 3T4DA 4CXXA 1QOSA 4GX2A 5FMDA 1Y66A 2KD7A 4QPGC 3VBUA 5DDJ2 2GC1A 5L7OB 1UZ0A 4AZZA 3OAAG 2GTSA 2VMHA 4E27A 2JK5C 4KHPO 2YEVB 1OT5A 1AB3A 1FX5A 2H8PC 3G6EV 3WB1A 2HWE1 1NZ6A 4ATFA 3BOWA 3B01A 1BCXA 4O4HB 4DK1A 1F15A 3GYDA 3T2PA 2GSYA 4X8AA 1Q8SA 4X20B 1UW8A 1OV9A 3SH3A 3O1MA 3ZRWB 1R1A3 2JDPA 3JAKB 2YPDA 5CA0A 3SH5A 3B69A 1K45A 3ETEA 3A7QA 3RRDA 4EN9B 2J1EA 3J7HA 2E75B 5KC6A 4QX1A 2VMFA 4LO4B 4W6YA 4DXTA 3VHNA 3KV6A 1NXD1 1WAZA 2HEWF 4WCEV 4B4QA 4I3GA 4FIPC 2DBIA 5L19A 2YROA 4GUNA 1PKXA 3N9PA 1F23A 2B9VA 4J1XA 3NNMA 3FHQA 3V65A 5FP4A 4YZ4A 4AGVA 4CXWA 2BDRA 1Q6UA 1XMQO 4GLXA 3PUQA 3J8F2 4HMZA 3KHCA 4ZU7A 1PM4A 1MPXA 4G28B 5H6RA 2QQVA 1BQZA 4TLFA 4HK8A 1Q7YW 3CWBH 4N90A 1AR82 3ZKUA 4WFAV 3TB0A 2HG5C 4J25A 4IT5A 5I8YA 4XXPA 3APBA 5B3SC 2J1UA 3ZLIA 4WM7A 3E83A 4JV5O 4OHVA 5LB6A 3VLBB 4AQ2A 3VBOC 4X89A 4OI0A 2ETEA 2RN9A 4P30A 3B8NA 1BHAA 4LIUA 1Z2GA 2XASA 2WNVB 3K57A 4K0KB 4Z1VA 2YXSA 1GZ9A 4OFGA 1A8MA 1LB2A 3POWA 1QMJA 4QD2A 1QIQA 4HN1A 3O5SA 2OCHA 1JYIA 4NHKA 2VRZA 1XNRO 2RVAA 5AVAA 1J59A 2DVBA 2HP8A 3ZRVA 1C5IA 1GP4A 1GQPA 1Y4MA 2D3RA 3T09A 4A44A 3PVEA 2PHFA 1KJLA 3LSSA 3EXUA 1G9AA 3JCUZ 1W8TA 1AZDA 2WWSA 5HV0A 3LA7A 3ETGA 2HKXA 1XBLA 1LGNA 3OBTA 3AXEA 5GJ6A 3POJA 5EWSA 4Q4X2 4TV9B 4A4AA 4UF0B 4LA2A 1N34O 4JDMA 3WF1A 3THCA 3ACIA 1GICA 3RI9A 3CCQV 3N9LA 3WXPA 4MADA 5E16A 1AR61 4CH4A 1ZBA3 2P3IA 2OWOA 3D6EA 1PV0A 3W58A 4AI3A 4MVRA 1LHUA 3V0AB 1QJU3 2VOTA 1ULGA 3T0DA 5D8AB 3EQEA 2HWC2 3INAA 3NNJA 4QE9A 2XLAA 2VCBA 1AJQA 2JDYA 1MQTA 4JHZA 2YUEA 1NZIA 5HI0A 2KA3A 3LCPA 2P3YA 1RUF3 1QR9A 5E79Z 2Y4UA 3HKCB 2VVFA 5GTHZ 5KBFA 2YU2A 1ZA4A 3O65A 5BY1A 4LORA 4UXNA 4IUGA 4IESA 3F95A 3WU2Z 4NRQA 4M3CE 1QXPA 3AKRA 1LUWA 1UY4A 3WDWA 2AXTZ 3ZR6A 4XF1A 3ZFGC 3EYPA 3VDDB 2Y48A 5FPVA 4BXFA 5GLWA 1NR7A 4JHTA 2WN3A 3N35A 5JXIA 4Z2AA 1BZWA 4OI2A 1LOGA 2FCVA 5CFDA 2FMLA 4GALA 1VMJA 2Q30A 1SQ4A 2QCSB 4CDWA 3PNAA 3BU7A 1RUH2 5KXDA 3VBRB 2D40A 3PU8A 3D36C 3GBWA 2ZX3A 3HPLC 2YC4A 3SEEA 1U97A 4MXWB 4AFBA 1CAXB 1DLCA 5IDJA 3GDBA 3FUOA 4LOSA 2QE3A 2VMGA 2CY6A 4DV5O 4H44B 1VBB1 2EIBA 5FREA 4CC6A 3DKWA 1OUXA 1HB2A 4L11A 3M3EA 2QM7A 2MEV1 3CRCA 1A34A 3L9JT 1BL8A 4B3RB 5K9YA 4NXMO 2W91A 1YTFD 4WFEA 4GX5A 2JKBA 4XFGA 2A1XA 2DDUA 2XUEA 3K5NA 3ABLB 2VQEB 1H38A 1W39A 3SPCA 1JOJA 1UYXA 1SZXA 4ZI7A 4L0PA 2IJHA 1DQ0A 3AKSA 4HAMA 3CJIB 4NHLA 5IAVA 4QGMA 3OTOO 4TUYA 5E89A 4YW4A 1UOGA 2R043 3SYPA 1KITA 4INDA 2WBKA 4M3CA 2DCTA 3OTFA 3IC7A 2LW1A 3AFGA 3P3PA 1HRI3 3LA3A 3I3MA 4X9QA 1W9TA 3USUA 5KHKA 1OCOB 2V4AA 1ULCA 5A3UA 1YI9A 2NYYA 3SC7X 4LO5B 4ASLA 4OULA 4L87A 1V6NA 2WZEA 2RDNA 3T4HB 5FMOS 4QQLA 2DQ0A 3I56V 1RHI2 4YJ2B 4JKKA 2XBO2 3I2FA 2PUSA 3HIFA 4LKFA 4GKKB 1W6NA 3AYCA 4U3FH 5DUVA 3QF7A 4XF9A 4I2OA 5A33A 3H1HH 1GKBA 3ZR5A 5GZDA 2WAAA 2HWB3 2JECA 1SLAA 4CP0A 1NCQB 2VD7A 3AG1B 1GZCA 4NIDA 3F7VC 1JHNA 4PIXA 1NH2B 4K3UA 5C8CB 5L3DA 2DCKA 1IBLB 4X1YB 4AWDA 1QNMA 3VDCA 1EZJA 1IBMB 3JARB 2CDYA 4CU7A 1W9FA 3USSA 4B4RA 2GV9A 4DUWA 4P9XA 2WO7A 4AI8A 2BSKB 1G7YA 3IN9A 3WCRA 3J81N 3ZFFC 3O1RA 4DOUA 1XOUA 4HKOA 2LO1A 3ETQA 1XNKA 2HLDG 3P32A 3ZHUA 1YITV 1UD1A 2EXKA 4NTWA 1OF4A 1ULOA 3VHPA 1NYWA 5LMNO 2FKXA 3Q8BA 1SLBA 5CKQA 1AL0G 1QJEA 4KL1A 1X4TA 3PN1A 4LBLA 3AZVA 4FOWA 3SKJE 5I0SA 2UUAO 3JD73 3NV3A 2R071 3GHNA 1IPJA 3GM8A 4P9LA 2HWE2 5IVEA 5FMBA 1O91A 2CL2A 3MLLA 2Y69B 4B08A 2W0XA 2EIGA 4H33A 1BE3H 4CP9A 1I6XA 1AYN1 3CL1A 1ASJ2 3CZUA 2DU0A 3PTRB 5A3WA 2JIJA 3QO8A 4K8ZA 4EN6B 4UFKA 3K4AA 4Y4YA 4DR5O 4QHOA 1J58A 1TE1B 2WO3A 2LALA 1URXA 4L9BA 1W9WA 4MX3A 4AYUA 5CMUA 3N2GA 4BQXA 1YIPA 2JIGA 3BI3A 3BVOA 4K1YA 2PHWA 3S0MA 1WNSA 2WO1A 3ZPOA 1MEC1 3K4DA 3PMSA 4MGZE 1F4HA 2QM8A 3AP5A 2HBTA 4WFFA 3RYHB 2OT7A 1WA6X 1TME1 3SJCC 1JMUB 3K77A 4XJ9A 3RVYA 1W6QA 3MF6A 4MHRA 1QHDA 3E8GA 2WSUA 1O5UA 2KM2A 4UCOA 4N9HA 2W1SA 5J2UB 1K5MA 2GNBA 5BV6A 5FUPA 1WBFA 3SGIA 1YTFB 1MA1A 1DYPA 3B9CA 4LF4B 4TV8A 4B3SO 5C4WB 5LBQA 3GJAA 1EN6A 3BAAA 3EBRA 3WOGA 4ITCA 3KGLA 1CGPA 4HXCA 4K20A 1YJ9V 1GOHA 4ABMA 1R083 4BQ5A 5FZCA 2JD4A 5GONA 5C9AA 1RMU3 1TEIA 2EIEA 1LHNA 3WP6A 2FDGA 2Y60A 2CGOA 4LWSA 3WG2A 2WPDG 4W6XA 2CTPA 3T2TA 3RZGA 3G7DA 3ZXKA 3B2EE 3RYCB 4RQPC 4LEJA 4Y5TA 3K58A 3HN3A 2LTNA 4UBHA 1FNZA 4OLLA 1XNDA 4DEQA 2VUAA 5LP6B 2ZMLA 1CAUB 5LBFA 1VF5B 4BQWA 1COV3 1RUC2 1OHFA 2BOIA 3I8TA 3LDKA 5LYJB 3JQWA 3TNQA 2G38A 3KZ4C 4DR2B 4HSJA 2TNFA 2A70A 2VZ1A 3H3UA 3OBRA 4LC1A 1AI7A 2JE8A 5HXVA 5C70A 3J7AU 4ZU5A 2UWAA 4CU8A 2LFRA 4BISA 1UPIA 1LHVA 4P14A 2JIZG 4J11A 2EALA 1N33B 1PK6C 1VQOV 4A5UB 1AR62 1RM1B 2Y6JA 2CDOA 5K0UA 4WM8B 2NN8A 2XNDG 4NAOA 5DMYA 3ZHSA 3WD5A 5ITZB 3FX3A 4JI7B 4FOYA 1NY72 5KA6A 2YG0A 4Q26A 5C8WA 3GCWA 5BNNA 5AFBA 4CU9A 2ZMNA 4AI0A 3RZKA 3SQOA 3VBFA 3T1HO 1GNZA 1KFXL 2E32A 4IE7A 3L70H 4YVSA 1G9CA 2PFWA 1IHMA 2HHHB 1EPWA 3MPPG 2JGDB 1YHFA 1AHSA 1ODNA 2VZPA 1W2OA 4Q0UA 1XU1A 2C1FA 5LXTA 5IT9N 4LHKA 4UB8Z 1AR93 1TUEB 4AQTA 2HLEA 3L2YA 3BCCH 3GBGA 2GC3A 1M57B 1XNAA 3MICA 2LGQA 1UYYA 1Q86W 3OMAB 3O14A 3AKTA 4HZFA 4GMP0 4K6BA 3OY8A 3VDBA 1UFIA 1L1FA 1G8MA 3JCZA 3HNBM 3MHHC 3A0HZ 5DG1A 2JEUA 2VQ0A 1CD3G 3CMGA 1YQ2A 1NVPB 3KG2A 5JPMB 2IJKA 1BBT1 2YBKA 1JPXA 3DPRB 3SDLA 3UT5B 3JSNA 3O1OA 1XXNA 2BU9A 5ABJA 1JU3A 3LPFA 3CYOA 4H3WA 2KR2A 5LA6B 1FFXA 3D3QA 1QVFU 2GMEA 3WQ0A 3BALA 1HB4A 2JDMA 2XL7A 4LLFA 2Y6LA 1US3A 1UIKA 3LDRA 1ND3B 3BVCA 1DF0A 1O7FA 5IT6A 1WLEA 3M3CA 1Z78A 4PA3A 1FXKC 5AC92 4IHJB 1SBEA 4LTAA 3AP6A 3WP5A 1WMFA 4WVVA 2B46X 3MIGA 5CA6A 1UYPA 2VQEO 3PVOA 3BY6A 3FWEA 1SFYA 1PO23 4BLIA 1PNMA 3WNOA 1KYOF 4K3AA 5BR8O 3WVJA 4KH9A 1NE6A 4BM8A 4XF4A 3X2QB 5GZCA 4X8PA 1GR3A 1GN2A 1KDKA 4CDQA 4NWWA 4GH4C 1FAFA 2BBAA 4JDOA 3H8RA 1SLTA 2GDFA 4TZDA 5J2TB 1XL6A 1WLCA 5IATA 3AYAA 2XHBA 1W6MB 4JTNA 1DQ1A 1FMD2 4LF5B 4GB32 4LITA 5D8AC 2RS31 4FM1A 3I2DA 2AZ0A 4QPGA 1LNQA 5LOVA 5FYZA 5CA0B 5LA0A 4GKKO 3BIEA 3MV11 2ZKLA 1YRZA 5T52A 1TMF3 2V5YA 3OE7G 1H2GA 5JCOC 3JD3A 1UKGA 1AYM1 1M06G 5FNVB 2L9LA 1FFTB 1D4M1 3SISA 2ZE6A 1C28A 2FTKA 3ZXFA 5T3NA 3K75B 4COVA 1YVWA 4JI6B 3TN93 1PNKA 4BHPA 3VHRA 1PL0A 4I50A 2PELA 1NU1H 5D1IA 4P08A 2FDIA 5FP3A 5LEJA 3HT1A 1JOYA 2VUDA 4QB6A 1XDCA 5JOWA 1IBMO 4CUAA 3PTYA 2GH8A 3S30A 4XFBA 3PUAA 4N43A 1UOBA 3JZVA 2NM1A 3WNPA 3JD1A 3T2OA 4X66O 3K9SA 2Q7HA 3NNFA 4IV1C 3R4DB 3OT7A 1O59A 1Y9QA 3E35A 4UAPA 2VBDA 1E79G 1W59A 4J6GA 1YSCA 3J7MA 2X53S 5A2QN 3WP3A 2Y33A 1WB7A 4Q4W1 5G05L 4QDRA 1EAH3 2CWMA 2EXJA 1Q81W 2JG8B 1VBC1 4O4LA 2YXLA 1V6KA 4NPRA 1HJGA 4LF7O 1RUD3 3F5TA 4P9JA 1NT2B 1EV11 4DV7B 4LFCO 3G80A 3VD9A 2R072 2GP3A 2RDSA 3VD4A 1SCSA 3LQCA 5DZFA 4TYSA 2RJ2A 2P17A 4BMBA 1OSGA 4PLOA 2XJQA 5H9SA 1SQBH 3VBOA 2DYSB 2DCJA 1US6A 1AR73 3CO2A 1JCHA 3FKSG 1K8AW 2EXHA 1T6GC 1ZRCA 5LGNA 4RAIA 4XE9A 2WLQA 3PHMA 2R6QA 3TXQA 4PDWC 2X6CA 2MK3A 3OUIA 4HVRA 4ISRA 3SPIA 4RR3A 1JZ6A 4DV1O 1CZVA 3Q8FA 4XW3A 1MEC2 3RG0A 3RWKX 3BUCA 5EHDA 4OI1A 1T5EA 2OVUA 4K8XA 4BWAA 3K46A 1KKCA 3K51A 1WMDA 1GZWA 2OZ6A 4KXRA 4XJZA 3DV8A 5HXMA 3I2IA 2VTXJ 4XZUG 5CA1B 1X9PA 4CH5A 1XRUA 5FP8A 3KVBA 1S5JA 1EN5A 2D6PA 3PUHA 3ETDA 4ZPIA 3AVRA 3H01A 3AG1C 1D2QA 1W2UA 1JJ2U 1U5XA 2EA7A 3ZDSA 2YS8A 5FYMA 2DYRC 1LRHA 5J48A 3IPVA 4YYOA 2AGSA 5EZYA 3OSDA 4Q0PA 2F93B 2UXDB 1J5EB 1STMA 1VAMA 3IAPA 4IV3C 2F4VB 3VD7A 2ZGKA 2YXHA 1MVEA 2VMDA 1V54C 2DVFA 2IXIA 1BCCH 1SQGA 3VBBA 3ZPYA 1PGL1 4Q8KA 4O4IA 5JH7A 2PI5A 2ZZJA 2BE3A 4Y22B 3EHKA 4LK7A 2HWF1 3ZHRA 1AP6A 4P9YA 4A3ZA 5CFDB 2VZTA 1JHJA 3ZHVA 4ET7A 5KC5A 2QJ1A 2VZRA 3E8BA 2WLIB 4CVUA 4QPKA 4LQRA 3VZOA 3UGHA 5A1FA 5JUVA 4UFJA 3DXTA 3D3AA 4NN0A 2YDEA 3ZFGA 2W95A 1NKDA 3NV4A 3AXDA 1XI1A 4JI3O 1RXFA 3WG7B 5D21A 3FYEB 3RBZA 1RUG2 3OGCC 1EPZA 5C3RA 4A6SA 4B1MA 4BOWA 1WA8A 4FFGA 3HB3B 2J1RA 2WNUB 1VRH2 1BQ0A 3MHZA 4IGGA 2YICA 5FZ0A 1CAVA 3D36A 4YIOA 1R3KC 2P90A 2DOSA 2HFEC 3DF0A 5EYPA 3RYFA 3PIGA 4NVPA 3JD0A 2XKOA 4J1WA 2D7FA 3OGJA 2RCVA 1ZTEA 2XPJA 5IVFA 2W3JA 4HETA 4JI7O 4Q4V2 5IYYA 1BK0A 4X6QB 3AMHA 3OUFA 1O8SA 4ZONA 2QDRA 1VBE1 1W28A 3O1VA 1IS5A 1G9DA 4GIQA 4DUVA 4Q1RA 3WNLA 4YG6A 5E1RA 2RS13 3VZNA 4QXHA 2BVVA 1O4ZA 1SKVA 1H4HA 4FMTA 5EFUA 4QJFB 1W0KG 1UWWA 4AVTA 4WF9V 1GNHA 1SBFA 2XMLA 1W6OB 1ZZ8A 5F8PA 1A3KA 3CRMA 2RS53 4LF6B 1W6PA 3KB5A 4FPEA 2DCZA 5CG8A 2D93A 3FFZA 1V6OA 3QO5A 4XHBA 1RVF3 4YW2A 1BBT2 1SLIA 1OCZC 3CCRV 1JYCA 4E4HA 5BMVA 1HDKA 2PN5A 4LF9O 1GZTA 3NNLA 4BDVB 1UY2A 1NOVA 4WVMA 2VL4A 3ALQA 1KP3A 3CKHA 2VOVA 3ZMVA 3KT1A 4QNHB 3D82A 4Q6GA 1H9PA 2ATFA 4AEJA 1SLLA 3UL2A 1VF7A 3T2QA 3AZWA 4H7LA 4RA0A 4R50A 2JDNA 2VW0A 3BTAA 3L74H 5FJHA 3P5BA 4DFSA 2RMU3 3MIBA 3NW4A 4I0XB 4QB1A 4Z2WA 5LW9A 4FT8A 1KJRA 5LP6C 1L3JA 3FAVB 2P6HA 2WQZC 3UO2A 4UV9A 3VBHC 4RFT0 4D8MA 3B7MA 4DXWA 1ENXA 1THZA 3HR9A 2NZ9A 4RS5B 3I59B 4IEVA 2WYSA 1ZBE3 1PGW1 3ZFFA 3MFCA 1VJ2A 4EJRA 1W0OA 1CPMA 3RZHA 5FPLA 2XLFA 2A6XA 1OA2A 4KMQA 1HNWO 3L75H 4LKSA 3RVZA 3HJRA 5T54A 2W6IG 4AEDB 2XAFA 2D3PA 1OH3A 2Q0OC 3UV9A 2F66C 5F2SA 2Z5WA 4RGKA 1UQXA 4LF5O 1RUE2 2O0OA 2HYXA 1DGRA 4XEZA 3T0BA 5FZDA 3FC0A 4O2BB 4MVOA 4GKXA 2NQYA 4CEWC 1XUQA 5L3FA 2BRTA 3IGAC 3AJYA 2YZ4A 2ZX2A 4LLOA 3SJQC 4DRXB 2QQNA 3PLQA 3IMMA 2RDCA 5EBMC 5LK5A 5A32A 4IE6A 1VB4A 1UY0A 2BFUL 3ASNC 2I74A 3FB5C 5JZGB 3MIDA 3WSOA 1DYOA 4AFAA 4MZUA 2LW7A 4F83A 2E51A 4YM0A 4AILC 1S0IA 4JI6O 1DFQA 4I30A 1TVKB 5GW7A 1PO13 4JF3A 2JE7A 1JA8A 5IWAO 3A0NA 3Q9OA 2YIBD 2OCCB 3RWRD 4TTGA 3VBSC 3WF0A 1C57A 1NZCA 4CDUC 3HQRA 4DR6B 5FO7B 3WY6A 3LA2A 3E22A 4K7JA 2JEXA 1UZWA 4QU1A 4FFKA 4CEYB 4HVQA 4Z1MG 3ZN6A 2WZR2 3LDDA 4LP8A 5L9RA 4URTA 3E8HA 4IDZA 2EJ7A 4Q4W2 2R061 1C1LA 4MOAA 3FL7A 1FPN1 2D97A 2VY0A 2CNAA 1MS4A 4AAXA 4KU7A 4ZOLB 1VBC2 4K8FA 4YLZA 2RM21 2C9KA 4XABA 3DCQA 2YFUA 2O1QA 1AR83 2MHFA 1G9FA 4FPJA 4CP2A 3EFFK 1RB8G 1BLZA 1EV12 5C6CA 2WLMA 2AR6A 1GQGA 3W7TA 4FCAA 4RGAA 4J7KA 2VZUA 4X62O 2EIMC 4QPIB 3R65A 1HWYA 4DV7O 1YYNA 4JTAB 3KF5A 1XE7A 1KRIA 1HRV3 1VBD1 3B94A 2N05A 4IGQA 2JDHA 4XBLA 3DXRA 2RDRA 5EJ1B 1QU0A 4CDXC 1D5AA 3Q4HA 3TETA 3ZYHA 2HEVF 4ZZ8A 5IYBO 1S0VA 4GMP3 5IFPA 4A42A 5CKMA 4BE3A 1EY2A 2LM3A 4XC9A 5E1AC 2L6LA 1OLMA 1NTMH 1QLNA 3LF7A 3PVNA 2J1TA 4AGRA 4Q1PA 4O4JA 1QR8A 1PM9A 1X8MA 4AW7A 2HWD1 1I1EA 4N7IA 2BWAA 1OOPC 1PVC3 2JG9B 5K1XA 3W7UA 1U5YA 4I09A 2A73B 1NE4A 1W04A 1RC6A 2JB4A 1YEWA 2VR4A 4ORFA 1JXNA 5BNNB 5L7OA 2WLPA 2CAUA 2VOWA 2FDHA 3H42B 1OURA 1AJPA 2WABA 3ITQA 3H1LH 3ML0A 3KMHA 4V1PA 5A3LA 4BW5A 3WG1A 3WG3A 3TEXA 4BB3A 3HKEA 4E9KA 4CH6A 1RUI1 2ILMA 3F2ZA 3AP7A 2AW9A 4XZPA 4TWKA 1H6YA 4CUCA 1XNCA 4O4HA 1OJHA 1SLCA 3M8LA 2PY5A 1VBA2 3BHPA 3MAQA 4OHYA 1V6LA 4X20A 4FQZA 5FZMA 3EJKA 3JU9A 3ZRWA 3KLSA 2WDBA 5T5JA 2UXDO 2C9AA 3CS5A 1J5EO 1TNFA 1PGL2 1UXZA 1REDA 3O9OA 2XJPA 4NOTA 4ZU4A 3FX7A 1V00A 2HWF2 1JW6A 1VQKV 4K1ZA 3ATGA 1F51A 1PPJH 1H8EG 5FXZA 2QBXA 2XWJB 3MYXA 3JBG1 2R0FA 4I9QA 1W0JG 4XPVA 3RZMA 2P4KA 1DQ4A 2YBPA 4MHUA 5LMUB 1PIV2 4NE9A 2WAOA 3ZX7A 3C7EA 3LKJA 1ZZ7A 4RN5A 3NAPB 5ABJB 5DPNA 4PLNA 1X7NA 2JS3A 2E33A 5BNPC 1ACCA 5ACA3 2A71A 4NRMA 1S5HC 3R4UA 1OCCC 2IUWA 3H7JA 4QX8A 1IX9A 2Y8KA 5B1BC 1CVNA 3OW2U 3A23A 4BLJA 1X8EA 3DSQA 3FE5A 5FYSA 3ZXDA 1Q82W 4GYCB 3LNNA 3D0JA 4YPJA 5A70A 3BODA 3JSLA 3EVKA 1OQDA 4GWNA 1TZOA 4UVBA 1JN2P 4UV8A 1QNYA 3AEIA 1WLTA 2WNVA 2ZABA 5L3CA 1R3IC 4CCEA 4PHZA 5HFLA 3HVDA 1DF5A 1QLEC 1PZ7A 1T6BX 1UZZA 3O1UA 3OCPA 1VBE2 2P34A 2ZOEB 1QGLA 3H3ZA 4QDQA 1B3QA 2IXLA 4F7ZA 2HH9A 2R9IA 4RYDA 3U78A 3GGLA 1RUF1 4HFSA 4FAGA 3OEAA 4GCZA 3POGA 5IK7A 2E7QA 5F3EA 5LY2A 4XOGA 2A75A 1VQ9V 2Q8EA 5IWFA 3OM3B 4UCSA 3A0KA 1E5RA 2NPIA 1R3LC 2PMWB 5LOVB 4Y1VA 4EZ4A 2ZX4A 3B77A 2K0GA 5BNOC 4UF0A 4UW3A 5GZGA 3NNGA 3JD2A 1IS3A 1XJAA 4X64O 4E8DA 1L8DA 1OPOA 4NUBA 4LF6O 1LU1A 4IEYA 3BYWA 4PT6A 1JMKC 5GLZA 4FOVA 4MVQA 3AM2A 4IE5A 5BXXA 3ZRXA 3V0AA 5D8AA 1XYPA 1DYKA 4MGKE 5HV4A 2RHPA 1LODA 2K1EA 1YNAA 1AP5A 2QQKA 1AL21 3AG3C 1B06A 4OMDA 4XYXA 4L99A 3F7YC 3SCHA 3T0AA 1Q8QA 1VIWB 4EZHA 2P7TC 3CSXA 3B3QE 5JCOA 3WUCA 4QX5A 4KG8A 4BAYA 3I2JA 1W05A 5FYTA 1BHBA 3C3SA 4F8AA 3IDEA 2ZGOA 1W99A 3IDAA 1NCRB 4DPNA 1QQCA 5F3CA 1F9KA 3T1YB 5JXHA 2ZX1A 3WG7C 2PI4A 4PDLA 3VDDA 1S3JA 1I08A 1QJZA 2X29A 3I3QA 3TK1A 2E9QA 2QWOB 5DUUA 1FS0G 4BXSV 5FXWA 2UUCB 2GC0A 3FB8C 2O8OA 4UW4A 1M4UA 2RR11 2WFF1 4JYYA 1CONA 1PGW2 4E2QA 4B3NA 1PZ9A 2GTAA 3JXSA 2XOMA 1W03A 1HNZO 4UT5A 3OEHG 1CAXA 2AENA 3K4ZA 2JDUA 1ENSA 1H2SB 4C0HA 4MGIE 2EXIA 4GD4A 3ABZA 5I0RA 3VBOB 4MVTA 4YJ3B 1BK1A 4HOOA 2ZJCA 1N36B 4GX0A 3MF9A 3V0BB 1MVQA 2BWCA 3OGSA 1ND2B 2E5LB 2DMXA 2P5OA 4Y33A 3ZKYA 2ATKC 5I8TA 1Q43A 4ZIBA 2A3QA 1AX2A 3APQA 2Y38A 3U14A 2HWE3 4I0BA 2OUHA 3IT8A 1FOD1 5C7GA 1KQSU 1GH6A 1GTOA 1V9U1 4BW9A 1XSRA 5DG2A 2P6CA 1HXS2 3CJIA 2IM9A 4S2GA 2H0BA 3DUIA 4OZXA 2BV4A 2ZIOA 2AUYA 1SQPH 2WINB 1P84F 1DGRN 5DDJ1 4NTYA 4G27B 1OH4A 3SPGA 1SDWA 1DGSA 2PYJA 4OZOA 3OBAA 5CB4B 1E5HA 4AEMA 1L0NH 3MIHA 3KD4A 4YNIA 4QPYA 5J37A 3UYJA 4TSFG 3HNYM 5FZOA 3I3DA 3T1LA 3SYAA 5B66Z 3BA9A 4EE2A 5JVDB 3WW2A 4YJ2A 3ILNA 2ZX0A 3VHOA 3FUQA 3M1HA 1RP3B 4BIUA 2VGDA 3NV2A 4JGYC 3K03A 2BZDA 3MLJA 1FNYA 4D94A 1WCKA 4GXLA 3AFKA 4CU6A 1MMMA 3BCWA 3OFNG 3ZMZA 2VQAA 1UX6A 3RVHA 2XAHA 4JGZC 2NLJC 1NCQA 1H6XA 3PMEA 1XMQB 1JS9A 3JD71 1REEA 4FPCA 1NQJA 1VBD2 4X1YA 2QQWA 3JARA 3J8F1 2OQ6A 5IY5C 3K59A 3N2KB 4B3TO 2G19A 2A0LA 1YQ5A 5HFMA 1FAYA 1QH7A 2BSKA 1HQLA 4AXOA 1K4DC 2UWBA 3VGIA 1CX4A 4FPYA 3VD3A 4R6ZA 1H1MA 3WG4A 1Z7S1 1RL3A 5LHHA 3E6CC 4AEDC 1ZA7A 2Z42A 4PBPA 1I3HA 3KCYA 1TUBB 2BP6A 1SS3A 5JCTA 2OT5A 5GALA 2G4IA 1WN7A 1J83A 1SHWB 5H9RA 4YARA 1FV3A 4DV4B 1CESA 2YGLA 2WFPA 5JLVA 2EZPA 3IM0A 1KUQA 4O9GA 1XNRB 1NS1A 1XMOB 4YZ2A 4DV0B 1ORQC 3GZAA 2R9AA 4AG4A 1AR63 2PLV1 3DN7A 2D43A 3LFMA 3ZSJA 3NRUA 4IQPA 4XIOA 2P6JA 2VUCA 3B02A 1W3XA 1WCSA 3AJZA 1IURA 5KAFZ 2H3OA 5IYZB 4WBNA 4RQFA 1N34B 4FPGA 4Q4X1 5J3UA 5DABA 1VQ7V 3FFQA 4LNVA 4PIZA 4KGQA 4LR3A 1R081 3ZX6A 1NX9A 2VCMA 2D44A 5FZKA 3RYHA 4XQ4A 2W6JG 1YHQV 2YSUB 3U75A 5ISLA 2VS0A 5JJEB 2KSDA 3ICXA 1AX1A 2R30A 1FKAO 2HWC1 3CD6V 3I2GA 5J96B 3STZC 2W1WA 3KHBA 5JOYA 1YJKA 4MGQA 2F6BA 5J2UA 3ME2A 2AACA 1CWPA 2AEYA 3AL5A 3UJQA 1UO9A 5GLUA 2F23A 4YG3A 3AG2C 2PHDA 4LCUC 1WP7A 5C4WA 1ZX5A 2E6VA 4BK4A 1UF2C 3BABA 1GOGA 2VJXA 5IK4A 3S57A 2HBUA 3DKQA 3AZYA 3PJYA 2XG3A 4PELA 3VQVA 3I54A 1VBB3 1DBNA 1LR1A 1ZBA2 3N27A 2KB1A 1K9MW 4JDNA 5H9PA 2QSAA 4YY3B 2VZVA 4N53C 5FPZA 5J98B 1GWMA 2MEV3 4YGEA 4EB6A 5L9BA 3ZYGA 3VZJA 2UUBO 2CWSA 1QJU2 3A4UA 1D0HA 1JFFB 4KWLA 5A1AA 5HBAA 4HLTA 3BTXA 2AEZA 2I07B 1RUH1 2QWNB 4YVWB 4MO3M 4LFBB 3S6PA 3RYCA 1XHXA 4EWAA 1RUF2 4O2AB 1BEV1 1SESA 2LRPA 2GBOA 1ZZCA 2Q7EA 3RSJA 5LP6A 1X59A 2DF7A 1CAUA 2DVDA 1BQPA 4QKBA 3APOA 2BNMA 1SEFA 4URAA 2BQPA 2E63A 4NXMB 4J9ZB 2ZCWA 4LBJA 1OA4A 5LYJA 3ZMSA 3AP9A 3H8UA 2X7RB 4DR1B 3JATB 4DYLA 4QPWA 3N7KA 4A2UA 2XQRA 5KMGB 2HKOA 1LJ7A 2G9FA 1XYNA 4WM8A 3OTOB 1RJ8A 2W08A 5ITZA 2HEYF 2DWRA 3ZO0B 5DUXA 1VALA 4R8CA 5TSWA 1RITA 5K7PA 2ZR2A 1S2EA 4PD4F 2B9UA 3OPZA 5LA9A 3JB8A 4R8HA 4MTXA 1AL22 3T3YA 1RGSA 4LNUB 2N7GA 2DW4A 3ZMTA 3VKNA 1UNBA 4GA9A 2JGDA 5C3OA 2QQLA 4NMIA 1JI6A 4Z8BA 3PURA 4YGBA 3QACA 3ACLA 3KZIZ 1O8PA 5CFCB 2OKXA 1RHI1 2KQXA 5H2FZ 4F4LA 2PA7A 2NN4A 3NAPC 2XBO1 3E5XA 1RINA 5A7PA 2QQUA 4BZ4A 1MNGA 3C7FA 2LUWA 3K3OA 4XFFA 4YW3A 4DUYO 3T1YO 2PTMA 3TRSB 4NJ4A 1WJZA 3GZEA 1WCDJ 2RR12 2LP7A 2R042 4B1LA 2WLLB 1ZUQA 1LR5A 5FUIA 4PA4A 3K48A 2A3WA 2XOKG 2FCUA 4PA7A 2Q1FA 1BVVA 4GJYA 3DPRA 4D6TH 4MW3A 1HRI2 3T30A 2ZDIC 3UT5A 2WS91 2JJ1G 4W4ZA 3I5DA 4QT6A 2ARBA 1GWKA 3OR7C 5I0DA 4GJZA 5LA6A 3DXRB 2WN2A 2VOXA 5CVRA 2WA3A 2AZ5A 3OR6C 5TISZ 5A7OA 2CSGA 2B7YA 3ES1A 4D6SA 4DINB 1VE0A 1OVPA 5A6ZA 1VQNV 3VZKA 2FDJA 2E5LO 2WSSG 2QE7G 4K40A 1FOD2 1GK9A 1VQ5V 2E53A 3GJBA 3QNEA 4IHJA 3AKPA 2CE4A 3PJSK 4G2KA 4RQPB 1AYN3 2HWB2 5JJNB 1HNXO 1P8JA 1VP6A 1X82A 5EC2C 4CA9A 3CCJV 2YFZA 5EYXA 5CBGA 5DM6V 5CBFA 4I5SA 5A3OA 1JZ2A 3SKVA 5KUKA 5H5NA 3ZYBA 4CDXA 2UUAB 2QZ2A 4DY5A 2A3XA 2IXCA 1N3PA 5LBEA 4COWA 3JD4A 4JAVA 4LUMA 5C5TA 3HAGA 3ZXGA 1YLLA 1QCEA 5IW0A 3HKEB 5J2TA 2W0FC 4D7SA 1AXYA 2SBAA 4ARYA 4Q5OA 2Y34A 1IBKO 1MEC3 3U37A 1CAWB 2WT2A 1W6MA 3GXUA 4MGYE 2OYZA 3MW2A 1PK6B 2Q4SA 3ZSKA 3AG7A 2EIDA 1DZRA 1TME3 2L35A 4DR5B 4LBEC 1ASJ1 3W7WA 3CQOA 1E1RG 4Q0SA 2EICA 3WQ1A 3MEPA 2N04A 4GX1A 2WUHA 4LE3A 3JAWB 2XJVA 4R9BA 4XUQA 3VBUC 3WHUA 2FMYA 1VQPV 2QTSA 2ZGPA 1XSQA 5FNVA 4JTOA 2ZT9B 2X0LA 5A7QA 3JD72 4B7EA 4DRVA 5F5QA 5IUQA 4Q2FA 3UCSC 1MS1A 1NCRC 3MI8A 4U3JB 3WINE 4Y20B 3DYPA 2O8QA 3BOPA 1SF9A 4XQDA 3FB6C 4PIYA 4D69A 3WT3A 2PHUA 1YCIA 4LFAO 4LO8A 3N9QA 5H9CA 2Q6AA 2UXXA 2H6BA 2VVEA 1H30A 3L72H 4NO4A 4DV3B 5K1PA 1Q3EA 5EIYB 2VQTA 4B3SB 2ZGUA 3S3WA 2R1BA 5F7UA 4YGDA 1LGBA 1Z7S2 4Q0QA 3POSA 5JIUA 4XAAA 2EIJC 4EN7B 2GMMA 5IAXA 1N32B 5FIXA 4AVAA 1KP2A 1O3QA 4META 2YUAA 3PVBB 4Q29A 1RPOA 4XVHA 2JG8A 2BTQB 1ND2C 1OHHG 1JTZX 1ZVFA 2UYAA 5BNPA 2IZWA 3B00A 2Q5TA 2XAGA 2XJTA 2JB8A 3VL9A 3PDQA 1GKFA 4DV4O 3KQ4B 3HPNA 2WSVA 3HN1A 1Z5VA 1NLRA 3VN4A 4LOTA 4FFBB 4NKGB 1DHKB 2PLV2 5I93A 4PI2A 1N8RW 5FZFA 1XMOO 1FXKB 4DV0O 2BTVC 1H8TB 3ZYIB 5CG9A 3H1KH 4BIZA 2OUJA 1PX3A 1YXWA 3BGAA 5CADA 1AXZA 3IKWA 1RUC1 4JI8B 4XETA 1JQ0A 1MZEA 1W8NA 4X8NA 1DDLA 2ZAAA 3A22A 1GRJA 4DR4B 4TWTA 3WNKA 3B93A 3SXWA 1QXRA 1OVSA 3AP4A 3KSCA 2V4VA 2HR3A 1R082 1UY3A 4YHHB 2CDPA 5HCBA 3OGRA 4GH4B 1RMU2 3C7HA 1O4YA 1CX1A 1VMHA 4PF5A 2DURA 1XOYA 4UB6Z 3K3NA 5FO9B 5IE9A 5GLVA 4M00A 1NY71 2Y6GA 3T1HB 2R7EB 3OGGA 2ZTNA 2JDAA 1YZBA 5CA1A 2RDQA 1XNQO 1UMIA 4CCDA 4KP4A 1KEXA 2Y26A 2DQ3A 1COV2 1V55B 3WHTA 5GKAC 1IDSA 3W7SA 2Z3YA 3POYA 1WUVA 3HOBA 1EBOA 4OPHA 2A6YA 1W2BU 3UGGA 1BBT3 4FOQA 3U4XA 1EM1A 1M56C 4S2FA 3M3OA 1YQ8A 2DTYA 5CZKA 4UXAA 2UWCA 5IJRA 2GSMB 1K5JA 1N1VA 3B09A 2GNDA 2QVSB 4Y22A 4IE4A 3T2MA 1PMIA 4RHV1 2AC1A 5KHHA 3IDBB 4YY3O 4CS3A 3RS6A 1ZZ6A 1MQTC 4A7ZA 3J4UH 1V6MA 1RUJ3 1SQVH 4XTPA 1WLWA 1MS3A 2WLIA 4DEVA 4IV1B 5FKCA 1BEV2 3KT7A 4LFBO 3E8FA 3ILRA 1LEMA 4Y1XA 3WV6A 1TNRA 4PF1A 1AR92 1QJY1 1JR9A 1K7DA 4XTMA 1W8FA 4JAAA 3MHSC 2WNUA 3U1XA 2VO5A 4MTGA 3QCWA 4XUNA 1Y76B 4DR1O 2RS51 5EYYA 3I2HA 3ZN5A 4XFIA 5I8SA 4CDWC 5AC91 3HKBB 4MVMA 5FYBA 2IU3A 2IC1A 1D5NA 5BR8B 2RS33 1LKNA 5JR7B 2YYOA 2WNEA 1GWLA 1AILA 2E74B 1HB1A 2AH2A 1BS3A 4ASMB 3BFRA 3FN9A 1ST8A 3A0RA 5FLJA 1NA1B 1QJX1 3LPGA 3HT2A 4S2HA 2PZSA 4PDWB 4MVZA 3OBZA 4XCBA 1AYM3 2BVBA 1OC1A 5FZOB 1D4M3 4LULA 1FJGB 1FMD1 4ZXEA 5BYNA 4GB31 3D8CA 1ALYA 4ZBMA 4PDMA 4OUEA 2W52A 3HBKA 3JB4C 2W5FA 4EYUA 3ZMUA 1W6OA 1OD5A 5KUMA 5FPAA 2W46A 1PO22 4XFCA 2RMKB 5DZEA 1CN1A 3ACFA 4FFFA 3TEZA 4XXAA 3FBMA 5CA3A 1VMGA 2VW2A 5F32A 4EWEA 3TEWA 1MZ5A 2CH7B 4PDVA 1Y3TA 4W4KA 2KG7B 2DYRB 4JYAB 4NR1A 4JRLA 2YC2A 3LE0A 2WS92 1HV1A 4N21A 2EAAA 3CCLV 3KF3A 4JC1A 2WT1A 4IV3B 2ZINA 1IPKA 4XURA 3RN4A 3LD8A 2ZQMA 4BQ2A 1Y43B 3CZJA 1V54B 4X66B 4LIVA 3RPQA 4D3WA 4YVWC 1H1IA 1SCRA 2CAVA 3PUSA 5JMCA 1AX0A 2BBVA 3QLQA 4YW7A 1YQCA 2C5DA 1VQ4V 3CXHF 1KS5A 2EX3A 1XNTA 3GF6A 4I0XA 1TMF2 2ZGSA 4QIWF 3FAVA 2VCCA 2W1QA 4QKFA 1K73W 5CIRA 1O6UA 4LF7B 4FJCC 5J1XA 1NBMG 1XQ8A 4ATEA 1C3HA 4MH0E 4LFCB 2PYTA 5FP7A 3SITA 3TN92 1G6NA 2Y6KA 4RS5A 3I59A 4I01A 5LEKA 5BNQA 1R093 3RZZA 1LESA 4FTEA 4XUOA 2QR4A 2XL9A 1KD7A 3ILFA 1ZAUA 1OXCA 3K3WA 2ZIMA 4V2WA 4AEDA 1AR5A 3KT4A 1XC6A 3AK1A 5FXXA 5FY8A 2FQPA 2ZHNA 1GYKA 2ETNA 4DR3B 3R05A 2VWJA 4AF9A 1AUYA 2P37A 1DTOA 3GCXA 1CJDA 3GALA 4WBNB 1LOCA 3G71V 3QBQA 4O2BA 1F2NA 1Y4WA 4DV1B 1K3IA 2QQPA 1EAH2 2ZNIA 5A3PA 3IMNA 5A3TA 4M0NA 4DRXA 4JTDB 1RUD2 2P06A 4QX0A 3WQBA 5CFCC 1KMIZ 3EHBB 4AI9A 3BEHA 2GUZB 3ZHTA 5JZGA 3FHAA 4XBQA 5BZBA 4IEXA 1YO8A 1ZRIA 2JDIG 3KV4A 3OD0A 5JXGA 2ODMA 1KXGA 2E76B 1HRV1 1TVKA 3O0XA 1S0CA 4M0HA 1ZLZA 2ET7A 3ZFEC 2HWF3 3LDEA 2VQFB 4QXCA 4IEOA 3RYIA 4DXSA 3ZRSA 1RTVA 3GNEA 3P3NA 4EWDA 2AHYA 4LK6A 4DS0A 3IDCB 4ZY9A 4DV3O 2VMIA 3TCUA 4CEYA 4YZ1A 4YWAA 2QZ3A 4P02B 3ZXEA 3CMEV 4CCCA 5FZAA 3L9DA 1OCRC 5FBJA 3IFXA 5G04L 2Z0AA 1OCZB 4AAPA 3F5WC 3WDVA 5JDBA 1F4AA 4LHSA 4ZOLA 1N32O 2Y4TA 2VOKA 1KQRA 1E57A 2SLIA 2C24A 4EB6B 1R1ZA 5BUVA 3UESA 3WZ1A 4QPIA 5GM0A 1D2SA 5IYCO 1K5MC 4D7YA 1KU9A 2YI9A 3LIHA 5CAZA 3SMHA 1Q8PA 4FXKB 4EROA 3VQWA 4LBNA 4WBBA 3G4SV 3IB3A 4EQVA 4JI3B 2YMZA 2FDKA 1NTKH 5JQGB 3HWJA 4XACA 4RL7A 3L2HA 1MZ6A 4ONUA 1QJFA 3VBHB 1PHMA 1RUG1 4UCRA 5JOXA 4JI8O 4ASUG 2GN7A 2PQQA 3HBZA 4CE8A 5JMOA 1VEWA 1VBE3 1C1FA 4X1IB 1VRH1 1CEZA 5C9AC 4DR4O 2UXCO 2O14A 2YGMA 4NPLA 3ZXAC 4WFGA 1EP0A 4AI1A 4UI9L 5E8AA 3N7LA 1UOFA 2VAUA 4YHHO 2JG9A 2D6LX 3KV9A 2IH1C 4YIPA 1O9HA 1U5IA 5IVVA 2FZ1A 3POFA 2ZE5A 1CR7A 3WDTA 3TGUH 1BGYH 3MDSA 3QVNA 3BPZA 4PQQA 1NJIW 1L7QA 3ETPA 4XUPA 2GH2A 2A5ZA 2BUKA 5CB7A 3NSTA 5KLVH 1MZFA 1DCSA 4Q4V1 2E26A 1QEXA 5C3QA 3ON7A 4CEWB 3AG4B 4Z82A 3JALB 1GO3F 4BWOA 5CBLA 2WKKA 2A79B 4LHNA 4NB5A 1SPPB 3ENRA 3OYWB 1GLHA 2Q1MA 3ASNB 3CJHB 3AB0A 3KCXA 5K0UC 4CH3A 2R32A 2VC9A 5LGTA 1YFWA 4BYYA 3SNMA 1Y9MA 3H0OA 4HVOA 4RHV2 2QDNA 4WV8A 2WQ8A 5JPNB 3AK2A 3R66A 2V73A 2V72A 4LMFA 4NYKA 4CCKA 3VBFC 3H1YA 3VBSB 4CDUB 3CHXA 4YVSC 2EVXA 4MGTA 4R7CA 4M4RA 2PF4E 1GNYA 1H8HG 4F6RB 2I2SA 3DC5A 4LF9B 3PUIA 5A6YA 1VF6C 2OW4A 3NAPA 5GZFA 4W65A 2M6YA 4L8QA 2ITCC 1PM7A 5I0UA 1QJY2 1K33A 4DUZB 3GWOA 5F3IA 4AOCA 1C8M1 2DWEC 2JXAA 1ROPA 4UFMA 1YF2A 3FHIB 2JVDA 2IVIB 5CNAA 2GU9A 1GANA 5F3GA 2P2KA 1REFA 5F5IA 4Y3OA 2Q5ZA 3JAMN 1VAKA 1DP0A 1NXMA 3KGZA 1QDCA 4I0WB 2RS52 1S0BA 3E86A 1JU4A 2EIMB 3S5AA 1BXHA 2IH3C 5H9QA 1H8TC 3RGBA 2Y0IA 5JR2A 4HPKB 2ZDIA 4AQYO 1U12A 3T4VA 1RVF2 1M4WA 2PHXA 1OZ0A 1GM8A 5FZIA 5D2AA 4Q27A 5IK8A 3B40A 4O65A 4CDXB 3WNMA 1UMZA 3LSUA 4CCOA 1QJX2 3ACHA 3BB6A 3UETA 2B42B 1BZKA 1K4CC 5APAA 1W8WA 2YIBA 1OFSA 3WP4A 1Y67A 2R0HA 2VG9A 2VH9A 1HNWB 5KR7A 1M5IA 4DV2B 3H50A 3JCIA 5FAXA 2WWWA 2ZMKA 3RDIA 1QWRA 3UM7A 3NL1A 4H2AA 5FPRA 1OOPB 1S55A 2OPWA 4OXSA 3ELNA 2HEPA 4FM2A 3ZYRA 2Q68A 1IGOA 5LY1A 1DLLA 3RW0A 2RMU2 5I0TA 1FJGO 2G1MA 4UFZA 1RUE1 4CSWA 2CYFA 3THTA 5FY0A 4IL6Z 2JRIA 2WJSA 4B3MB 1V55C 4QM9A 3SJBC 4DMIA 1S0GA 4RUFA 1FI2A 4JPRA 1XL4A 1OBNA 4BCUA 2XDVA 4CDQC 4MV2A 5IFTA 1SQXH 4JZGA 3PL0A 1JJOA 4IXLA 4DO2A 3H3LA 2AYHA 3SYCA 1HKDA 1HW5A 4KWJA 4CPBD 2R063 3OUJA 1FPN3 1SC5B 2DE0X 4JYAO 5IWAB 4CTEA 1US2A 3Q8AA 4G4FA 1JYTA 4PDRA 2RM23 3OGIB 4COUA 4IGOA 2JENA 2J7MA 3AK0A 4NAMA 4AHXA 2VQUA 1IKQA 4H14A 5FPXA 1VLNA 1Y74B 2X6AA 1WD4A 5LWBA 2IWGB 1U0AA 1VBD3 3BTYA 5FY4A 1NCRA 2WZR1 1NLQA 1W3VA 3C3VA 1WD3A 2DFBA 2IXJA 2HJIA 4YW1A 4P9OA 2QGNA 3R0RA 3O1TA 5FWJA 5BNPB 4X62B 4N9IA 2ZGNA 1FYUA 4ZHQA 4BH9A 5JSPA 1QY4A 1OCCB 5FQ0B 1PO12 5B1BB 4N43C 2ZEXA 5JAXA 2D6MA 4Q4Y3 2FCTA 3HD8B 2HWD3 4JI0O 1IQDC 3AYDA 2VNGA 4KU8A 1D0GA 2AZ2A 4JKMA 4QGLA 3G67A 1S2BA 2HVJC 2WR9A 4YJ3A 2GN3A 3OPWA 3I97A 1O3SA 3Q8EA 4FFHA 1GN3A 3V0BA 1ND2A 2B8MA 2RJKA 1NA1C 1RIRA 1PX4A 4RUEA 4DR3O 1LOBA 4QQHA 1ZL8B 1W8UA 4I55B 3ABTA 3FJSA 5FY9A 1V9PA 1AF9A 4TXWA 2DYCA 2V1DA 2D6KA 1QLEB 1RUI3 5FLIA 4FSJA 3H8OA 1WA4A 3UKVA 5H6QA 3WR0A 4R9AA 4HBNA 1UXXX 1S0JA 2R49A 2XB6C 4AVSA 1FXHA 4WFHA 3H1WA 3RJ2X 1HRV2 4E2GA 1BMV2 3D5OA 2VW1A 1WZXA 4C91A 4N7UA 4LUKA 2YC0A 1DGWA 1OD3A 5CB4A 5FY1A 2CHHA 1GN6A 3ZSMA 4JRAA 2OQ7A 5BNOB 2XUMA 1H2MA 2D6OX 4EN8B 3ASOB 1F5JA 1IKPA 4UFHA 4AL9A 3JBG3 2VQFO 5JVDA 1QQP1 4Z07A 4RR3C 4S2DA 1WBLA 1ZX3A 2ZGTA 3W5NA 1AI5A 2MW2B 1VBA1 3M99B 1C8NA 4AK3A 5CYYA 4FLWA 1NH2D 3N7MA 4LT5A 2D5HA 3N36A 4P2ZA 1PMJX 4XDLA 1PVC2 4MSVA 4LBQD 3ZYJB 1YUDA 5FZ7A 3AG3B 3WDUA 4JI5B 5FPOA 3M70A 1DZTA 5KX5A 4Q0VA 4N23A 4FTBA 2D6NA 2CGNA 1S1AA 1VARA 4JI1B 4MUVA 4JKLA 3ACGA 2XJRA 4LKEA 1PIV1 4XDQA 1Z5WA 2OIEA 3N2KA 4NXNO 2A7AA 3UJOA 4ZHNA 1R6NA 2OTLV 4RGGA 4F6EA 4I4TA 1KECA 1WCQA 5A6XA 4C1WA 4IL7A 2WLHA 4K35A 5FV3A 2B5UA 1HW7A 1J3QA 1SMVA 1MS8A 4HK9A 5CN0A 2K9ZA 1K3EA 4FPFA 4YFWA 1ULDA 2HJDA 3ZM8A 1GQHA 2W9XA 3SPJA 5F5AA 3RNSA 5LZ6A 3RYKA 1TUBA 1OF3A 2JX9A 2EINC 4D6RA 1K92A 2GZWA 5HCAA 1ODMA 3DTUB 1UAIA 4XMIA 5JIAA 1AJNA 4BQ3A 2OIGA 2B1GA 3NQHA 5AVPA 4RSUA 3ZIAG 2A6VA 1NT0A 4LO7A 3QD6A 2ZGQA 4LBOA 2YI8A 1J84A 2ZXWC 5JVVA 1UMHA 3ABMC 3CPWU 3CMAV 3J9SA 5ACA2 3JASB 1TG7A 3ZIWA 1JOBA 2Z79A 1YWKA 1N0JA 2BOCC 3RQ0A 1B35B 5IYZA 3SHRA 5IHRA 1ZRRA 5FK8A 4FPKA 4B4PA 2FD8A 3RFRA 4RO2A 3TJTA 1PP9H 4EV0A 1AL23 4X64B 2BFUS 4YW5A 2OIIA 5IVYA 5A7WB 4FPLA 4GZRB 4R4XA 2ZM6B 1MG1A 1VAVA 1W0NA 2XWBB 5LA2A 4HL0A 2ITDC 4ES8A 4NIHA 1RUNA 4XJUA 3KCCA 4HSLA 2P1BA 4YZ5A 1WP8A 3WB2A 3GVMA 2VUJA 3RYPA 5L36A 5JSRA 3RI8A 4JGYB 4V2VA 2VZOA 3EMRA 1C8M2 1NKGA 2TBVA 3DL3A 3K08A 4A45A 2ZACA 3K79A 4AHCA 1HR0B 2RR13 2WFF3 3VD5A 1GOFA 4DUZO 4J41A 2LFSA 4FXGB 1V70A 1FV2A 4H7MA 4LR4A 3SLIA 3ZN1A 5DN6G 4JGZB 3DGEA 4PA9A 3OEBA 4CYDA 1JZ7A 4Y1YA 3M7AA 4XF0A 3PJQA 2VXRA 1P7BA 2OZJA 5IY5B 1POV1 1UKRA 4JX0A 3WF3A 3GB7C 3OPTA 3LFIA 2Z5UA 1T2XA 3POIA 2XXZA 1JFFA 3S3XA 2WO2A 5IJ9A 3SYOA 5F37A 5IVJA 1DQ6A 4YVWA 1HNZB 2F43G 1N3OA 4U7NA 1FOD3 1A32A 4O2AA 3WFVA 2EIKC 5KXBA 1V9U3 3NV1A 1FATA 1IS4A 1WMEA 3NJVA 4DV2O 3STLC 1PNLA 1UJWB 5DDJ3 5FYHA 3SH4A 1D4VB 4TT3G 4WVWA 5T50A 3JATA 4LBQB 3E1F1 3AG4C 1CXZB 5KMGA 1W8HA 5FLHA 4XILA 3SJAC 4B3MO 5IVCA 1SFPA 5FZ8A 2A6ZA 2XAJA 3IAYA 1LGCA 4XMAA 4IW3A 4QMAA 1SERA 4JI4B 4QX7A 4YM2A 4G9SB 1CIYA 1HXS1 5EXOA 1ZNPA 2LROA 2ORZA 3H7YA 4OHWA 1OLME 3U4SA 1Q6HA 4YSFA 3CJXA 2Q1ZB 4FLZA 5B1AC 3LEMA 3LDCA 5J36A 4LNUA 3T08A 2N74A 2FL4A 2BJSA 2Y6FA 1OFNA 4XHXA 4R9DA 1WW6A 5A3MA 2LGWA 1SZTA 3RYIB 5IYDO 1FT9A 1I9RA 5B1OA 1FYJA 4ZS2A 1YFXA 2ID4A 1NVPD 4LXLA 5CFCA 4ASKA 4K21A 3V64A 1O3TA 1TGOA 2JEMA 1ONAA 3J8F3 1VP7A 4OI4A 2XVKA 2ZHKA 2W39A 4MT8A 4C1XA 5A1LA 4WVZA 3A21A 3WW1A 2HYKA 2VCAA 1G4YB 1JUIA 3N9NA 1KKDA 3ZFEA 3RWNA 3AX4A 5DAXA 5T5LA 3WW3A 1LAJA 4MTOA 2WLLA 4BQ4A 5FMOL 2IXHA 3N9OA 5A7SA 2UU8A 1Z7S3 3IIIA 5FZ9A 4QQOA 2Y64A 3HQUA 2X8KA 3AG2B 4B3TB 1RPRA 5GZEA 5B5EZ 2ET1A 5C8YB 3C8XA 1G86A 2W92A 5EJZB 1PD3A 2ZE7A 4RWUA 4XDPA 1I5PA 2GALA 4FLUA 2GAUA 3CRAA 4BIFA 3IAQA 3BRCA 1LNSA 4N53B 1ENQA 4X1KA 5B2GB 3WF4A 5FYCA 1R1A1 2ZEZA 4MYEA 1LUVA 1OKOA 1N47A 3HKDB 3MUZ1 5FFOC 3I55V 2UURA 1VRBA 3CP1A 2PLV3 3FLRA 4QAWA 4RQPA 3OUHA 4R52A 4UFLA 1CP9A 2E3CA 1GV9A 4PCRA 1W06A 3LSDA 4E2LA 2Z69A 2C26A 4CZZA 3CDZB 4W6WA 4E4ZA 2ARCA 3FYIB 3OMNB 1C4RA 2Q0AA 1U96A 1AJOA 4CXYA 4FM0A 4Q4X3 1AVMA 2RG4A 1D7PM 4CC5A 3RZJA 5FYYA 2EILB 3OEEG 3E6DA 1KBHA 3VZLA 1CAWA 1UL9A 4K0KO 4D6QA 1QQP2 1PK6A 1OLRA 4U2AA 3AC0A 4L8JA 3KV5A 3W7XA 2VTXA 4B8EA 1JODA 4OVEA 4CCLA 1MS0A 4XJ8A 4NHMA 2XTAA 2HWC3 4QDSA 3CCEV 2WIIB 3JAWA 4QQ2A 5L7OC 2FYUH 2AREA 1SG3A 1N4CA 1H1AA 1UU4A 4AQ6A 2PQSA 3MUY1 2WYFA 4IE0A 2D2CB 4HNAA 1PNGA 3AVSA 1MOFA 4Y1ZA 3RMXA 1HP8A 4JI5O 5LASA 1AXKA 4Y4RA 4U3JA 2OPKA 4TLGA 1MS9A 1MACA 4Y20A 5J9PC 1YFYA 3MLKA 4JI1O 1A8DA 2TUNA 3NKGA 1ULFA 2B39A 5FTTC 1UZYA 1W9YA 3N7JA 3A2FA 1OMIA 3IC9A 3N3HA 2R9RB 1W90A 1S72V 2KXLA 2XLGA 4YM3A 2KKWA 5EIBD 1RUH3 1XE0A 2Y0PA 1UY1A 4P9GA 4MS2A 1HJFA 1GMMA 1YJNV 2X5IB 1JVMA 3ZMNA 1H2LA 1HIXA 1GP6A 1BEV3 4LBMA 5J09A 4DB5A 3P1IA 4JCKA 1GP5A 2IFWA 3MDPA 1VF6A 5C5UA 3L71H 2FDFA 5LBCA 2QQIA 2BTQA 5EK0A 1B6QA 2UUBB 1ZBA1 1GM9A 1OA3A 2ERFA 4Y1UA 2BGCA 3X29B 3MW3A 3G6BA 3KS7A 1BMFG 5LBBA 1QJU1 4LH7A 2MNGA 1UOJA 1XNBA 3UKNA 4U7OA 3RJRA 2AHZA 4FFBA 3H1IH 5FZHA 3NXSA 1JYNA 2CTQA 1SQFA 2HVKC 1KC8W 1FXKA 4QXKA 1H8TA 1Y6XA 3K06A 1LTEA 4TQFA 2RJLA 5HPOA 2G9GA 1O9GA 3UO3A 1JYVA 3TAYA 2J22A 1TA8A 4COYA 1LU2A 2C2AA 4YGCA 2WNVC 4JZ2A 4QXBA 2JJ6A 1VBB2 3TYJA 3TXSA 3ASOC 3NR7A 2MEV2 4GH4A 4FFIA 5E6HA 3B9IA 1AR1B 4M01A 1DQ5A 2DCYA 2ZM6O 1RHI3 4MVSA 1RUJ1 4B3RO 5DAQA 1MSDA 1KGYA 1LOEA 2XBO3 2XKPA 4GWIA 4CP1A 3IIAA 1XE8A 3J7NA 1BKZA 1QKQA 2W47A 3FLTA 4XIKA 4MTFA 4ZKTB 3IJ4A 1JZ3A 5BY5A 3VBUB 5FOBB 1F8VA 3T1CA 1IVSA 3KM5A 1PGSA 3QH7A 2A3YA 1HR0O 5D5PA 4D7TA 4PV1B 4MSWC 1NAEA 1URFA 2WWUA 2CGPA 2WS93 1FD9A 5LCWL 1N1SA 1Q8IA 2JDKA 2JICA 1K34A 1GN4A 1JYXA 4ZZ5A 4DUYB 3LSEA 1H8VA 5ANNA 5ANQA 4AFCA 5FZ3A 5T5OA 4FK5C 4I0AA 2PGGA 1W8ZA 4U36A 3ZBHA 3KWVA 1DQ2A 1N3QA 3FD9A 3AZXA 4JQTA 4KGGA 4FVMA 1Y9GA 1CZSA 2XONA 1AI6A 1K12A 5I91A 4ZHQB 1GSLA 2R041 4F3JA 1VQ8V 4E2SA 3HEIA 5FPUA 5FYIA 3UT0A 3CCUV 3FBYA 4IV1A 4GULA 1YDXA 3B4SA 2F95B 1HRI1 2EIJB 3UKTA 2DWDC 3SPHA 1YQ6A 1I5ZA 4QGNA 2H0VA 4LF8B 4GWJA 1M90W 1GU3A 2R16A 2YPJA 4HZ3A 3BPSA 2YIAA 5DXDA 3VKLA 4PA6A 1M93A 3TOJA 3VDDC 5EV7A 1IBLO 1WW4A 2LW8A 3O1PA 3WCSA 2TEPA 1Y76A 4E4DX 4AGGA 4AHYA 3LEGA 5FR3A 1HNXB 5FBZA 1VQLV 2OS2A 3HKBA 4FVVA 3VBRC 2BYVE 2A9HA 4FLVA 1UX7A 2HWB1 1B35C 1ZREA 2X6BA 2BGPA 1ASJ3 4YM1A 1DLBA 4JI4O 2VMEA 2JGUA 3THDA 4Y5Z0 3W59A 3ZSEA 4FTSA 3ES4A 1B09A 4WM7B 3K04A 1QHTA 2BCCH 1R64A 3ZJZA 1NA1A 4YRDA 1J3RA 4ZKIA 1IS6A 3AL6A 4JASA 1IBKB 3UK9A 3DYMA 4PDWA 3ZMOA 1K42A 1Y7BA 2UXBB 1JZ5A 2ZGLA 1ZZ9A 1XHZA 2QM4A 3LSQA 1RFYA 4M4PA 3CEWA 5FXVA 3VUOA 1QOOA 2OX0A 3ABLC 4ZXKA 3LEKA 1NQDA 3C2UA 4FI9A 1RXGA 3CJIC 1ULPA 1AYN2 2WZPP 1IXBA 2VTFA 3M7MX 1FXZA 3DECA 2QNKA 3MIFA 1QF3A 2BTOA 4WZFA 5DAVA 4XJWA 5KX5B 4I7ZB 3I3EA 2CH7A 1R091 1S0DA 2KG7A 1PL4A 2VZSA 5EPAA 4AVCA 2VM9A 1OCOC 1HQWA 4OPAA 1M56B 4AVVA 3K5LA 1F4MA 2GHYA 4LFAB 3LOBA 4CZSA 4IV3A 5BXZA 1AJKA 3LIGA 4EN0A 4XAEA 4XDKA 1MS5A 4OHXA 3CXCU 1TME2 4I4TB 1QXJA 3UQ8A 1NQTA 3H8XA 5FZEA 2X09A 2J1SA 2R1DA 2ZCEA 5JI9A 1IOAA 2UXNA 5L3GA 1R1A2 5JOZA 4XBFA 4EKWA 2UU9B 2QEXV 1DGLA 1MQTB 3E2EA 2GNMA 1YXBA 2P22C 2F4PA 4GKJB 2DBNA 1GMGA 4DO0A 1H2KA 3VOUA 1NCQC 3L73H 3E97A 4IEUA 1IPSA 4BIOA 4JTCB 5C8CC 4KG0A 2ZGRA 3T4ZA 1UPSA 1RUC3 4CRQA 2VVDA 3OB8A 2Q4PA 4NWVA 4LF4O 4Y26A 1YI7A 2JDZA 2P67A 5ERLA 2NNUA 1DK1A 3ROUA 4K9SA 4MLOA 2O57A 2ZR3A 4O9EA 4DZGA 5FYVA 4JYCA 3V56A 2QWQB 4CDWB 1I94B 4PBOA 4RFRB 1YI2V 4Q20A 3WUDA 5F9TA 4HANA 1JUHA 5DZGA 2J1AA 1X33A 3A0BZ 4AFMA 2ZXQA 2ZHMA 4A7KA 1FPOA 2BOJA 3VKFC 2W68A 1I7FA 3I2OA 2JJ2G 4SLIA 3EO6A 1P49A 3K9AA 1G9BA 2ADEA 3C7OA 1AI4A 4Y24A 1RMU1 2GUZA 3JYCA 2WA4A 1H9WA 1VIBA 2OYQA 2QWRB 4DR2O 2QWPB 2Y69C 5F6KA 3OF1A 3H1MA 3AYEA 2XHKA 3SCFA 1XNQB 2WZ8A 5LK7B 2UY8A 5FMCA 5KA5A 4L92A 5FP9A 5T5PA 4ZI7B 1N33O 5EC1C 4RHV3 1HDJA 1WWYA 5A3NA 1L0LH 5B1NA 1NR1A 1X36A 4TUYB 1COV1 1JBCA 1LOFC 4PJ0Z 2ARHA 4NROA 1AVBA 4DXZA 5EQUA 4LH6A 4M3CB 1PZ8A 3NVCA 4IEWA 2BW8A 2F17A 1SA0A 2Z4FA 5FDBA 1ZRFA 1UN1A 4TOIA 4TN7A 5JXJA 3ABKB 3USUB 5B4NA 2A06H 1QNWA 4LKDA 2HHHO 4H13B 4PLMA 5LHGA 3ZYFA 1QJY3 4UCTA 3M3IA 4IEZA 3MBWA 1ZZBA 2DN9A 4DQAA 5DAPA 1ULEA 1U5ZA 4FAHA
chains in the Genus database with same CATH topology
4OI2A 1LOGA 5CFDA 4GALA 5JSOA 1RUF1 2R32A 4HFSA 4FAGA 1W6NB 2Q30A 1SQ4A 2QCSB 4CDWA 3PNAA 5J7MA 3BU7A 5IK7A 1RUH2 5KXDA 1YFWA 1YFUA 3VBRB 4BYYA 2D40A 2E7QA 2QKDA 3SNMA 4R4ZA 3GBWA 3H0OA 4HVOA 2A75A 2QDNA 4RHV2 4XOGA 4WV8A 5JPNB 4I02A 5A33B 1UU6A 2ZX3A 2V73A 5AC93 1OPMA 2WQ4A 3A0KA 2NPIA 4MXWB 4QQPA 5JI7A 3VBFC 1CAXB 4AFBA 3H1YA 3VBSB 3AMQA 3RMYA 4Y1VA 4CDUB 2XH6A 4YVSC 1J3PA 2EVXA 3FUOA 2ZX4A 2K0GA 5BNOC 5C4WC 2QE3A 3AMPA 2VMGA 4GWMA 2CY6A 4UW3A 5GZGA 3TNPB 1VBB1 3VBHA 5FREA 4XJAA 1AR91 3W9AA 1IS3A 2I2SA 1OPOA 3DKWA 4L11A 3M3EA 3GHMA 2MEV1 3L9JT 1QJX3 2OW4A 1LU1A 5K9YA 3NAPA 4IEYA 5GZFA 4W65A 4L8QA 4FO9A 5GLZA 4FOVA 1PM7A 5I0UA 1QJY2 1J1LA 3AM2A 1OI6A 2JKBA 4XFGA 1C8M1 3QH6A 3I4IA 2JXAA 5BXXA 3V0AA 3FHIB 5D8AA 1XYPA 3NO8A 5CNAA 2GU9A 1DYKA 1GANA 1W39A 1JOJA 2P2KA 1REFA 4MGKE 2RHPA 1FMD3 1LODA 1VAKA 2XJUA 1YNAA 3PVJA 1RUJ2 1DQ0A 4GB33 3AKSA 1AL21 1NXMA 3CJIB 3KGZA 1QDCA 4B7KA 4NHLA 4I0WB 2RS52 1S0BA 4L99A 4QGMA 4XYXA 1QOTA 3MW4A 5GLTA 5E89A 3SCHA 3R1JA 1BXHA 1Q8QA 4YW4A 1VIWB 2PHLA 3GZUC 5H9QA 1H8TC 2R043 2Y0IA 2ZZQA 1KITA 3B3QE 4HPKB 3WUCA 4INDA 4QX5A 4KG8A 1U12A 4PJYA 4M3CA 4G3YC 1RVF2 3U11A 2GMPA 1M4WA 2PHXA 2DCTA 3OTFA 4F8AA 4Q27A 5IK8A 5FOJB 3AFGA 4CEWA 3P3PA 1HRI3 3LA3A 1OIJB 3IDEA 4A3XA 2ZGOA 4CDXB 3USUA 2BNNA 4UBGA 5KHKA 1NCRB 4DPNA 3FMGA 1ULCA 1UMZA 1F9KA 1QJX2 1YI9A 3BB6A 2NYYA 5EJ3A 2B42B 4LO5B 4ASLA 4OULA 2ZX1A 1V6NA 2VNRA 3VDDA 5FMOS 1OFSA 4QQLA 3WP4A 3OYWA 4XQWA 1QJZA 1RHI2 2X29A 2R0HA 2VG9A 2VH9A 3TWIA 2E9QA 5DUUA 4FBFA 3N4MA 1MR5A 2XBO2 4WM8C 1LENA 3HIFA 1LEDA 3H50A 2GC0A 3JCIA 2O8OA 3LWCA 4UW4A 5FAXA 2ZMKA 2ZAHA 4YZ3A 1W6NA 3RDIA 2RR11 3AYCA 2WFF1 1CONA 1QWRA 1PGW2 4E2QA 5LRSA 3NL1A 4H55A 5DUVA 2DVGA 4XF9A 4Z92B 4B3NA 1OOPB 1S55A 5IK5A 1PZ9A 4I2OA 3ELNA 2RS32 1Y0ZA 4FPHA 3ZYRA 1IGOA 1LCLA 5A33A 1DLLA 2RMU2 2BNOA 1PO21 5I0TA 3ZFEB 1GKBA 5KXCA 1CAXA 2AENA 3VBSA 1RUE1 5GZDA 1WGPA 2CYFA 4CDUA 2HWB3 1ENSA 4C0HA 2JECA 3CLPA 4MGIE 2QUOA 2X5IC 3THTA 1SLAA 4CP0A 1NCQB 2EXIA 2WJSA 5I0RA 3VBOB 1GZCA 4MVTA 4QM9A 4DMIA 3ZVXA 1JHNA 1BK1A 1S0GA 2ZJCA 1FI2A 4PIXA 4K3UA 5C8CB 2DCKA 3MF9A 3V0BB 1MVQA 2BWCA 1AYM2 1ND2B 4AWDA 4BCUA 1BYHA 4CDQC 3MFAA 1D4M2 3R6SA 4MV2A 4BG1A 5I8TA 1Q43A 3USSA 3QOPA 1AX2A 4P5HA 4B4RA 4IXLA 4P9XA 2ZBJA 3M2MA 2AYHA 2Y38A 5KHJA 1HKDA 4BA6A 2HWE3 4I0BA 2OUHA 1HW5A 4KWJA 4FAHA 2QFEA 2R063 3IT8A 1FOD1