4JAAA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
328
Chain Sequence
ALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 102
structure length 328
sequence length 328
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4jaaA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jaaA01
1YCIA 1H2MA 4Z2WA 2CGOA 3P3PA 2XUMA 4NR1A 4B7EA 4AI8A 2WA4A 5JWPA 2CGNA 4B7KA 3KCXA 3OD4A 4JAAA 2Y0IA 2YDEA 4QU2A 1H2NA 3KCYA 1MZFA 2YC0A 4Z1VA 1H2LA 1H2KA 3D8CA 1IZ3A 3P3NA 4BIOA 2WA3A 1MZEA 2W0XA 2ILMA
chains in the Genus database with same CATH superfamily
2OPWA 4E8CA 4JTAB 4DR2O 4Q0SA 1BEV1 1XNCA 2BOJA 1HV0A 1YJ9V 1G6UA 2PAEA 4PLMA 1FT9A 5FLHA 1VMGA 3JALA 4UV8A 1S0CA 4LBLA 3JQXA 2Y60A 1AR4A 4FFKA 4CU7A 4E9KA 1FPN1 2XR4A 5AFBA 4QPIC 4FM0A 1Q6IA 4O4HA 4LF7B 4WVZA 5B5EZ 4U3JA 5F2VO 3POBA 5A3TA 2B4KA 5FYIA 5FZ8A 3ETGA 1OBNA 2ZXQA 4RL7A 4MTGA 1KEXA 4BXSV 1WNSA 1DZRA 5L3EA 2E6VA 4BQ5A 3MLJA 1K92A 3TXSA 3VD9A 1BLZA 1FNYA 4WVMA 4UXNA 2VECA 2A3YA 2C4XA 3GHMA 1K5MC 4N7UA 1Q82W 2DVAA 3VHPA 1QWRA 3VKMA 1FYUA 1LU2A 1W6PB 1UKRA 3ZSEA 1GZ9A 4JASA 1CONA 2BGOA 1HN0A 5BR8B 3WCSA 3JBG1 3JAKA 1M57C 2UXDO 2V5DA 3AG7A 3WD5A 2PELA 1GOGA 4L92A 1QMJA 1ZRIA 1LCLA 4DV2O 3NNMA 1C28A 4MGSA 4WBBA 2P3JA 4XDPA 1Q90D 3UT5A 1GM8A 2ZD9A 1S3JA 4G2KA 1B6QA 3THDA 3UL2A 2KB1A 1GOHA 2P6HA 1CAWB 1POV0 2VMIA 5FP4A 5KXDA 1OFNA 5FWEA 1LOBA 3H8OA 4JTDB 4PBPA 5CFDA 2HJFC 2UU9B 2PHTA 1D4M3 1CAUB 5B1BB 3AEIA 3AFGA 2ZGQA 4BB3A 3LCPA 1A8DA 2ZMNA 4D6RA 1OOPA 4GB33 4L0PA 3VL8A 3E6CC 2ORZA 3IAPA 2W1SA 1Q81W 3O9OA 3ZFFC 1BEV2 3CL1A 3QBQA 4N7IA 2P3YA 5GONB 3BU7A 5FPZA 1H2MA 3FB5C 5L3FA 2BGCA 3PTRB 3H8RA 5FO8B 2D6NA 1DQ0A 3BTYA 4YM0A 2W46A 4M0HA 5JVDB 2PY5A 2VZUA 2WINB 3LOIA 4ZHNA 4DUXA 4QX2A 1ND3C 4Y1UA 1IZ3A 2BOCC 3RGBA 4FTBA 4MHRA 4FPGA 5FKBA 3KB5A 2Q30A 4IV3A 4QHOA 5C8CC 5LP6C 2YXHA 4X8NA 4KHPB 5LASA 3A0BZ 4Q4X3 3VZJA 3LDEA 3EVKA 3POEA 3TAYA 4E4HA 4JAUA 2ZAHA 1NZCA 1OCCB 2ADQB 4QX8A 3ABZA 3OBTA 3WB1A 4OPAA 2WO1A 4NHXA 1RMU2 4IESA 5EFUA 2W2IA 1F2NA 4LOSA 3RYFA 2PHFA 4O9GA 1BHGA 2EILC 2NQYA 1L7QA 3TBDA 1QLNA 2ZX0A 4K8FA 5FPLA 3ZYJB 5LHHA 3AZWA 3APQA 3BABA 1MZEA 5J37A 2CK3G 2EIJC 4M3CE 4B3NA 3RZJA 1QOTA 3OYWB 3B77A 3AZYA 1NS1A 1Y3TA 1H2KA 2OT5A 5ITZA 3CKHA 4OUSA 2JGDB 1ZAUA 4J7ZA 2R9IA 2XONA 4CDWC 2JG9C 1UF2C 5KC5A 1WWYA 3RYFB 3KLSA 4YPJA 4PA4A 3OTOB 2L9LA 4O4JA 3Q4HB 3LIGA 5LRSA 2HEYF 5A80A 3K9AA 1OLME 4PF1A 5LWBA 1GN4A 2WT0A 3THOA 2Q1MA 4HPKB 1F15A 4HXCA 3E5UA 1PK6C 2YI9A 3I2IA 1RUF2 5CFCB 1SQPH 3VBHA 4Z1VA 5J7MA 5CKQA 3U75A 3ETQA 3OEBA 1QJU3 2W95A 4X62O 3CZJA 5CU1A 1RJ7A 5FRAA 1YQ5A 3TN91 1FPN3 1KJRA 1VEWA 3JZVA 1OQ1A 2VMCA 2DCZA 1AJKA 3PTYA 4UF0B 2V72A 4EROA 1V54B 1NLSA 5ABJC 4AI8A 1H4HA 4Q4X1 1AROP 1TME3 4LF9B 3WR0A 4FQ4A 4P9JA 1QNMA 3W58A 1O9HA 5FZLA 3EXUA 1XREA 2OCHA 1W8HA 4IDZA 4JTNA 1K5SA 2VZVA 4F8AA 1G9BA 3NJVA 2E5LO 4YSFA 3WXPA 1N36B 1HR0B 4XBFA 5GM0A 1HNWO 2ZE8A 3SDLA 1QH7A 1GWKA 1MVEA 2E51A 4OHWA 1WP7A 4AWDA 3NL1A 1JMUB 2WZR1 4LF6O 1KGYA 2EILB 5JVVA 4K0KB 2V73A 1W6MB 2VY0A 2BNMA 3KGLA 4S2GA 2GMPA 2RG4A 4RHV2 3DTUB 3BIWE 5JSPA 1LJ7A 1ZRFA 4CH5A 2PAKA 1H8HG 4Q27A 4FJCC 2KKWA 2VBBA 5FP7A 3VV1A 1Z0HA 4CCJA 2PZSA 1YJWV 1HRI1 1YWKA 1ENSA 5CZKA 2JDYA 3U4XA 3KG2A 4AVTA 3W7XA 1OUXA 4TV8A 1PO22 1OKQA 3TCUA 2FCUA 4XF3A 3GNEA 2VZOA 5HFMA 1FI2A 2NPIA 5KUKA 2ZMKA 2J1AA 2M7WA 3AG3B 3FYEB 1H1MA 2ZEYA 3HAGA 1W59A 3ZDVA 1N32O 3WOGA 4W6WA 1EUUA 3N9NA 3GJAA 3FMGA 5A3NA 4CDWB 3IPVB 2W47A 5FYHA 3WUDA 2LJ2A 5KX5B 1CAXA 1I08A 4LIVA 1RP3B 1TVGA 4IEOA 3U37A 3ZHSA 1O59A 4XJ9A 1GBGA 3AZZA 4C0BA 1B35A 4AQYB 1IS5A 3ZYGA 5F3EA 4LF4O 2C9AA 2WQZC 4JQTA 3S7EA 5B2GB 2HG5C 1G86A 4LH7A 1GQPA 1HRV1 4RFT0 3QG5A 1FJGO 2PHLA 1XNRB 3ZSKA 1WBLA 2AR6A 1WMXA 4U3FH 4JZGA 4OHYA 3ZMNA 3USUB 3JATB 1L7LA 3I3DA 2ZGUA 4NJ4A 2HWD3 5C7GA 1N1TA 1JOYA 1EP0A 3JARB 4NN0A 3SKJE 3RMXA 3CNAA 5T5JA 5T5OA 5A32A 2JRIA 1XUQA 4B1MA 3J8F3 3VBSA 3NNFA 1AP5A 5BNOB 4FFGA 3N2KB 1VR3A 4RR3A 2HHHO 4CTEA 2Y33A 1A32A 2WZR2 4GZ9A 5CBLA 2HVJC 5E16A 1UYYA 5C4WA 1RMU1 4X66B 4YGCA 5FYBA 1UYXA 2ZR3A 4UT5A 5FUNA 3DYPA 1X9PA 2WR9A 1XI1A 4LUMA 3K06A 2UUBB 3ZX7A 3UYJA 2WIIB 5FZHA 1COV2 1ODMA 3R4SA 4BAYA 3LZZA 1HRI2 3TYJA 4PA6A 4EN6B 2LW1A 1OQEA 2K2SA 5CADA 3CX5F 1OVPA 4QQPA 4GD4A 4NRPA 2CAVA 1KDMA 2CY6A 1XNKA 5FZOA 3HIFA 3ZHUA 3SJQC 1H2SB 1LR5A 4YJ2A 4UCUA 3J8F2 5CIRA 5FZCA 1IBLB 2RS52 1W9TA 3F95A 3RZKA 2ZGKA 1GWLA 3I2OA 1LTEA 3HPNA 2XOMA 4KGGA 5B1BC 4MH0E 3K08A 4M01A 1X8EA 4IT5A 3IT8A 1W8UA 3L72H 2BBVA 2YROA 3HKEB 2E75B 4MTXA 5F1RA 4P9XA 3OTFA 3GZUC 4LKFA 4IIJB 1AB3A 5DAQA 2R073 4IE6A 1I5YA 2A9HA 3EJKA 2GHYA 3MIEA 4JI4O 1M5IA 3NAPC 3H1LH 4Q5OA 3VD3A 4UI9L 4CVUA 4X62B 1EV12 2CUGA 1CP9A 4KMQA 1HJFA 5J3UA 4KQ7A 3H1KH 3PIGA 2YV8A 4AL9A 3O1MA 2HWB2 3AL5A 1WA6X 4QPIA 5CFCC 4YZ3A 4LE3A 5C8CA 2R72A 4DR3O 5KC6A 4O4LA 4AEDC 1F7YA 1V9U3 5FZ7A 3L71H 3DKWA 1V55C 4R9BA 2VS0A 2ZEWA 3DN7A 3WP3A 5I0UA 4X89A 5LOVB 1GANA 4IQPA 2JG9A 4UW6A 2Y69B 1S0GA 2W0FC 5H9QA 4XF9A 2DYSB 1QOSA 1RMU3 2AUYA 2VUJA 5FYCA 1R6KA 4FAHA 2UWCA 4DR4O 2Y6JA 3ETEA 2P5BA 1VQ5V 1ENRA 5FYMA 4JGYC 5C3SA 2UUCO 1AX2A 2HVKC 4L9BA 2OPKA 4JYAB 4ZZ5A 1COV1 3R6SA 3H7JA 3BOWA 5BZBA 3N7MA 3UO2A 3WZ1A 4HPKA 3VKFC 2P6CA 4HZ3A 2MHFA 1JYWA 3FL7A 2DJVA 3RS6A 3LOBA 2ZNJA 3M3CA 2V09A 4QKFA 1RUOA 5F32A 1POQA 1WMEA 1UZWA 5CA6A 3IBMA 4XUQA 3RJ2X 5CA0B 4B4PA 2WZ8A 4A45A 2DVGA 3JASB 1WCDJ 3D36C 3PUQA 2JS3A 1BZWA 1W6OA 4HN0A 5BNNC 1YXBA 1GU3A 1W2BU 3I2JA 4LK6A 1E5SA 1DK1A 3CCRV 2RVAA 4D0QA 2YG0A 3F5WC 1VARA 2VZRA 1W0NA 3ABLC 2LROA 4HVOA 1MS1A 2K9PA 2ZS6B 4YZ5A 4NR1A 4MGZE 3FE5A 2JDMA 2VH9A 5EBWC 4GA9A 1FXKC 5LGNA 1QNYA 5BNPB 1SPPA 3VBOB 1DQ6A 3N7KA 1UZYA 4RUEA 1M1KW 2RDRA 1M9NA 5GLZA 4X20B 1PNKA 2GBOA 3SHRA 5HI0A 4DUYB 3IMMA 4QAWA 4LP8A 2R061 3OAAG 1PGL2 3FB6C 4XFGA 4ABMA 4XQ4A 2QR4A 4RQPB 4DR5O 4XF0A 2YBPA 2DCYA 2BTQB 1Q6UA 4GYCB 3SLIA 4N8MA 1IQDC 2GNMA 4RYDA 1OOPC 1PHMA 3OFNG 4BK5A 5IYZB 3VBFA 1XNQO 4NIHA 5J1XA 5JOWA 4AEDB 3CD6V 1D2SA 1HWYA 2WSVA 5JQGA 2DCTA 2ZHKA 1URFA 5IYCO 2ZT9B 5GZDA 4K8XA 2IW5A 5F3IA 3GB7C 1XNDA 5DN2A 4EFEA 2XL9A 1FV3A 1X7NA 1QR9A 3VBUC 2P4VA 2DN9A 3ZXEA 4GMP3 1FXHA 3R05A 2JS5A 4XCBA 5LA6A 1TMF3 4KNCA 3ZHQA 1IX9A 2C0ZA 3P6BA 2OIGA 3ZYRA 5JXGA 5BNNA 1D2QA 2TEPA 5K1XA 4XFIA 2WDBA 2YHJA 2LM3A 5FQ0B 2X09A 2Q8EA 4UFKA 1VRH1 2Z5UA 4NB5A 1I0HA 2WWJA 2Z0AA 3CMGA 4JYAO 2VULA 5FZIA 3X2QB 3UESA 1XNAA 1BMV2 2UUCB 1I9RA 1Q86W 1PO23 2WS93 3NW4A 2OT7A 3DUIA 1AR83 2E76B 1DLBA 4ES8A 4O4LB 3T4VA 1M4WA 4K9SA 5T54A 1O3QA 2ZJCA 3KZIZ 3RVYA 1ROPA 2WFF3 1BCCH 4XFHA 1QH6A 1OCCC 4FPJA 5EP9A 3L74H 4YW6A 4YY3B 2JDHA 3SJAC 1L3JA 3TGUH 3PJQA 1XMOB 1H8TB 1FX5A 1CWPA 1QHTA 2D93A 2JKBA 3N35A 3IKWA 3WQ7A 5IJ9B 4Q4Y1 2EZPA 4LORA 4LO4B 2WLIA 3OCPA 3OF1A 3OBRA 2NYYA 2WT1A 3CF6E 3ML0A 2WYSA 2Z2SB 5DZFA 4DZGA 4UYBA 2YC2A 3UQ8A 5CG9A 2DYRC 3FLPA 1US6A 1TME2 1KD7A 2AENA 1C3HA 3GBFA 4K8RB 3EHKA 2VCBA 4XJZA 3AP6A 3OOXA 3ZSLA 5F2WA 2GTSA 1AI7A 2BDRA 1EPWA 4XC9A 4S2DA 4C91A 4BW5A 3E6DA 2WLNA 2XHBA 4DRXB 3THCA 3SPJA 5IYBO 4MADA 4IV1B 1DGSA 4C1XA 5ACA1 3UKNA 3LEIA 2ZGSA 3H3LA 4YM2A 5IVFA 3ZN4A 4E27A 4DXSA 5H5NA 2PHXA 2CDPA 3MO4A 1CIWA 4J6GA 5F6LB 2FDHA 5I0SA 2QKDA 3N2KA 3ZHTA 1HNWB 1IG3A 4LKSA 4XQDA 1V9U2 4HLTA 2CTQA 2AZ0A 4E2LA 3WW4A 3O65A 4EQVA 2G19A 3B9IA 1REFA 5HCBA 3WQ1A 5IK7A 3TNQA 3ABTA 4Q26A 4KWKA 4QMAA 2BZDA 2PHDA 3WG2A 1H2NA 1NY71 3JSNA 4MTFA 2JDZA 2NLJC 1ZZ8A 3AP9A 4PV1B 4A4AA 1N1YA 2HEPA 2PUSA 3B09A 4FOQA 5K0UA 4JI5B 1R083 3GVMA 4DV5O 3CMAV 2AREA 4QB2A 4MSVA 3TWIA 4CDUC 2YC0A 2RMU2 2QDNA 4MUVA 3SMHA 3T1LA 4QB1A 2JIJA 1R64A 4OMDA 2A6WA 4AZZA 3K4ZA 5DZGA 4OI0A 3VBBA 3BTAA 2EA7A 1SC5B 1SQVH 1JHJA 4FTSA 1GV9A 2PXJA 4J42A 3BOPA 3N2GA 2YB7A 1V70A 1K3EA 5KA6A 1D4VB 3ASIA 3WLUA 4H2AA 3WVJA 2VVFA 4XTMA 4B7EA 3LSQA 2YIBD 5BNQA 1SETA 1S76D 3M3IA 1WPXA 2HWD1 3SYPA 3GM8A 1R092 3QF7A 1Q8IA 1YIFA 4NIAA 4G9SB 5ISLA 2JE8A 2YGMA 4Y22A 1J95A 5IK4A 2Q7GA 5C3OA 4SBVA 2ERFA 4AQYO 2WS91 4CP9A 4QPKA 1PO12 2E7TA 3JASA 5LW9A 1F5JA 3UCSC 4AEKA 4IYIA 5KHJA 3LEMA 4QPGB 4AW7A 3OEEG 1SFYA 1RFYA 1NQJA 4K3UA 1YDXA 2WFF1 3I3BA 4UFJA 4LBMA 5FOBB 2JDPA 5LBCA 3VD7A 4JV5B 3ZXGA 3Q9OA 3AXEA 1NKGA 3MPPG 2ZX2A 3SPIA 1N1VA 4CUCA 1PX4A 1LRHA 4CCKA 1SRYA 3VN4A 4FFFA 2OVUA 1NKDA 3BEHA 1EM1A 4LA3A 4V2WA 3SPCA 4G4FA 2EJRA 4ZY9A 1AR1B 1L1FA 3ILFA 4P5YA 1W05A 3Q4HA 2P4KA 2K0GA 3GDBA 4MVMA 4S2HA 4XVHA 1RSOB 5B66Z 1UD1A 3UGFA 2L35A 3CJHB 3RI8A 4DV3B 3OEHG 1LAJA 3ATGA 4NTYA 4BIOA 3OPTA 2A3WA 1ODNA 3EQEA 3ES1A 2FTKA 3O0WA 3MIDA 2WWWA 4WCEV 2YBKA 5K4LA 1D0GA 3GYDA 2DCKA 1OMIA 1YIPA 4EN9B 2W52A 1UMZA 1F8VA 4K8ZA 2UYAA 1WN7A 4PLNA 4BQ3A 3SNMA 1EZJA 3AKSA 3ZPOA 3S5QA 4FP3A 5A9GA 1O3TA 2H8PC 3V0AB 2SLIA 3CJHA 5F3CA 4DV4O 3AMQA 1S0EA 4Y1XA 4UW5A 4MO3M 2OYZA 1CAWA 1IKPA 4WFBV 2A6YA 3KT7A 2RE9A 4YHHO 2LRPA 3QTCA 3RRDA 1DU3D 2VOXA 4N23A 4LR4A 1TG7A 2WYFA 4XTPA 5LEJA 1WD4A 2F17A 2CH7A 3CCJV 5F2SA 4FFBA 2ZHLA 1APNA 4X8PA 1YQ8A 2X10A 3ZXLA 4AK3A 4AOCA 1W6PA 4FVVA 1K97A 5LGUA 3BI3A 4F7ZA 4CBCA 2R9AA 4JI0B 1EPZA 1RB8G 1H8TC 4YFWA 3VBHC 1DYKA 1W9FA 3LEKA 2Q1FA 2VVEA 4M0NA 3HN3A 4MOAA 3CIHA 3KS7A 2CSGA 2A1XA 4CUAA 2XJPA 2J22A 4BU2A 5LXTA 1YNAA 4W6XA 3T1HO 1VQ8V 4YG6A 3L2YA 1O9GA 4DR4B 1C8NA 1IHMA 1QJX1 2CTRA 4JGZB 4EWAA 2XQRA 1R1A1 3K46A 4BJ0A 3E97A 3I49A 2EINC 3HKCA 4QHZA 1DGRN 4YXWG 4LHKA 3BVOA 1RM1C 1HLCA 3FX7A 1MZ6A 4A44A 2QE7G 3ORJA 3WB2A 3KV5A 2RCVA 4GX2A 4LFAB 2OWOA 5IK8A 3H0OA 4JV4A 1CX4A 4EE2A 1QVGU 3CWBH 1AR82 1QQP2 3T4ZA 3GALA 4IEZA 3ZN0A 4R50A 3V0BA 1S5JA 2JENA 3PMSA 3FC0A 2EVXA 1PVXA 4ZKTB 4L2NA 5JDBA 4B29A 1ALYA 4A2UA 1PVC3 5HPOA 4CSWA 4DV0O 3MIFA 3VQWA 1B35B 2JIZG 2PLV2 3TXQA 4BCUA 1SMVA 4RR3B 5FJKA 2Q1ZB 3I2DA 2WLKA 4RS5C 3SKVA 4Z2AA 3OSDA 5DG1A 1A6CA 4LF8O 2IWGB 2BTVC 4TXWA 4XUNA 2PF4E 4CXYA 3AK3A 4C7UA 2B9ZA 1KITA 4COVA 2EIEA 2BE3A 4HL0A 1T6BX 4QXCA 2LUWA 2G4IA 4CU6A 4AHXA 4PA9A 1K45A 1H38A 5FZFA 1AR71 2JJ2G 1Y43B 2JXAA 3ZPYA 1XSRA 3USSA 4EZ4A 1DGWX 1A34A 3E8BA 2YS8A 3LFMA 2P5OA 4X88A 4CE8A 5C3QA 4XFFA 3K9SA 1QR8A 3ABKC 3L75H 3MHSC 4B3TO 2JECA 3HJRA 3AKRA 3EB7A 2ZMLA 3RYCA 1PVC2 1J3QA 4QPJA 4ZOLB 3ZRWA 4OQ8A 3BTZA 3A21A 1GKFA 5IW0A 4H0LB 1GO3F 4ASUG 4V2VA 4DV1O 4GH4C 3VBOC 5FAXA 1J3RA 2BCCH 1JZ8A 4K7JA 2WNOA 3OGCC 3FHIB 3EXAA 3DPRA 2E33A 4PIZA 5E6HA 1V6LA 4TV9A 3LNNA 4AHCA 4CP2A 3JB4C 1UXXX 4LNUA 2QWPB 1UO9A 4OUMA 4PIXA 3HBKA 1PL0A 1UMIA 5FZ3A 4CH3A 2QFEA 3U4SA 3J7NA 3PUSA 1GYKA 1Y9QA 4RS5B 2VMFA 4RQFA 4NHLA 1DHKB 2H0BA 5J48A 4LFCB 4XURA 1S2BA 4ES9A 3AKTA 1PMHX 5CA3A 4KU8A 4UF0A 3G6JB 2WAMA 3LUTB 4GX0A 2WBKA 4Q0QA 3IC9A 3G7DA 1GKBA 1SESA 2GSYA 2WNVA 5J98B 2RS11 2ZM6O 1XNRO 3POYA 5A7PA 4R7CA 1JYIA 2YFZA 4BQ2A 4ZZ8A 5IVBA 4DEVA 2ZGTA 4DXZA 5FMOL 2E9QA 3O1OA 4JAVA 5ERLA 4QXHA 4N21A 3K58A 4LO6B 2YI8A 1GP5A 1LU1A 4IGGA 4L8JA 1XYNA 1AR72 2K9ZA 3BPSA 1C5HA 2O8OA 5AC93 1GZWA 1Y7BA 3CXHF 5EZYB 2NN8A 3M2MA 5JZGC 2WO3A 3I56V 4X1KA 3MW4A 3LDRA 1UFIA 1WAZA 2D6PA 5H9PA 2OZJA 3IZOA 4H13B 2BQPA 3OUFA 1XL6A 1WLDA 2YIAA 5C33A 1GZWB 4AR2A 2GU9A 1YLLA 3C7OA 3B02A 5AC92 1NZIA 2KG7A 4XETA 3I59A 4LF5O 3T1CA 3J26N 1FKAO 2OA2A 2JEUA 4LXLA 5KMGA 3EMRA 3WF1A 4PJ0Z 4I0XA 2QGNA 4JZ2A 5JAXA 2YBSA 1VBD3 1SLLA 5HXMA 4DR1O 2A6VA 4HANA 4E4SA 5LMUO 3PUIA 1OHFA 3IN9A 2PN5A 3WCRA 3ACLA 5H2FZ 1PMJX 5CVRA 1T2XA 5BXZA 4MGQA 4L87A 2LW8A 4KGQA 5KBFA 2PMWB 1F4MA 2ARCA 1XE7A 1FMD1 2PFWA 5D8AB 1TVKB 3S6PA 4FSJA 5LATA 3JD4A 1US2A 3VBOA 4Y5TA 2VUAA 3CHXA 4CDQB 2F4VB 2WNUC 1G9DA 3NKTA 5JWPA 3WDUA 5FYVA 1AYN3 1KD1W 5FZ0A 1OKOA 4MVOA 5EBMC 3RI9A 1H2GA 2XJQA 4RGKA 1US3A 4P5HA 4JI8O 1YSCA 1GP6A 1S0DA 2ZHMA 4FOYA 1ACCA 5A33A 2A75A 2VRZA 1QJU2 1W6NB 4YW5A 2YFUA 1SFPA 3BODA 1LOEA 3KGZA 4BISA 3HOBA 3LSSA 3ZEDA 4NO4A 3B9CA 1GQGA 1ZA7A 3D0SA 4E2QA 4TQFA 3A7QA 5C9AC 1WA8B 1CVNA 4XJWA 4Y4RA 1OSGA 4YVWA 3LSUA 4XZUG 4A3ZA 3H7YA 3MUZ1 2N7GA 3OT7A 5A32B 1YXWA 5IY5C 1CAUA 4L11A 2ILMA 2L6LA 4TN7A 1N34O 3CRRA 2E3CA 3OGJA 5BUVA 4TZDA 4BIFA 1TUEB 3O1PA 1XHXA 5EJ1B 2EIMB 4PF5A 3ABMB 3V0AA 5LOVA 4RWUA 4LWSA 2D7FA 3LDBA 2VTXJ 1YUDA 3J80N 1YEWA 1PNFA 4NXMB 1AI6A 2RS13 3E86A 4R4XA 2W6JG 5JCOA 1RVF1 4JGSA 1FOD3 4H3WA 3LWCA 3K5MA 4LE4A 3RPQA 2BFUL 2R1BA 4XZPA 2A7AA 3FB7C 1I3HA 2D44A 3FUQA 3V56A 3M7MX 1GP4A 1RYYA 5GZCA 3HKDA 3CJIA 4CU9A 3FLTA 1FNZA 3BTXA 1VLNA 1WD3A 2AACA 2QEXV 1W0JG 3Q8AA 1JOBA 5CFDB 5A3MA 4H33A 2R32A 1AR5A 3VBRA 4DYLA 3M3EA 5J2UA 1HN1A 1Q7YW 2DF7A 4RGAA 4GB32 5KLVH 5FZ1A 2QVSB 3BKZA 4DK0A 1NT2B 5LYJA 3ZFFB 2RM23 4CEYA 2NR5A 4JDNA 2ZQMA 3M7AA 2ADEA 1J58A 4OI2A 2CU5A 4XUTA 1QNWA 2QQMA 1NT0A 3GWOA 4WM7A 1EZVH 3M99B 3HR0A 1UJWB 3JAKB 2RJZA 3H1MA 1GN3A 1S0FA 5L7OA 2QDOA 3UO3A 4U2AA 1OUSA 1YCIA 3SQOA 2CTWA 2BWAA 5JOXA 4QU1A 4U36A 5GZFA 4GX1A 2FDJA 2VNVA 3FAVA 5EV7A 2XAGA 2IJKA 4TT3G 3UT0A 3MF9A 3U10A 4AHYA 2ZBJA 4Y4YA 1AHSA 5EJZB 1PIV1 3VUOA 3OM3B 2D3PA 3VB9A 1U5ZA 2ES3A 3ZYIB 3D3IA 1CAVB 3HN1A 1W2OA 3BFRA 3VBFC 2A79B 4HETA 3W9AA 2FDKA 2GN3A 4BE3A 1RUJ1 1K34A 1XJAA 5FXVA 3OGGA 1RPOA 1S0BA 1NCQB 4GKJO 1HB2A 2Y38A 4KI5M 4I0BA 3C7HA 5A6YA 4TQDA 3F7YC 3ZHVA 4LF6B 4DV7B 2E7AA 4JI8B 1U97A 2UUBO 3RYHA 1L7RA 4I0WB 5BXXA 4DIQA 4AFBA 2HYKA 3IFXA 1HR0O 4Z82A 1HRV3 3ZRWB 1UX6A 1RXGA 2BNOA 2WFF2 2R062 3RQ0A 1IBKB 1PGL1 3HR9A 1UOGA 5FV3A 1KECA 3M8LA 4I2OA 3O1RA 2ZGRA 4X65B 1CESA 1QJX3 3UKTA 1LNQA 2JDAA 2NZ9A 2KSDA 5IJ0A 1W8WA 3VOUA 2IC1A 5CA1A 5L3CA 1M90W 1QF3A 2IU0A 4NE9A 3DYMA 4JZRA 3VKNA 4KFMA 3POGA 5FPBA 3QH7A 1NG0A 2W3JA 4GKXA 3LA7A 4L97A 3IM0A 2H94A 1QCEA 4O9EA 1FFXA 4A6SA 3WP6A 2XAQA 1NA1B 1I5PA 1R6TA 1RUNA 2HLEA 2DUPA 4JI7O 4IV3C 4AGRA 2WA3A 3GZEA 3ST7A 4IL6Z 4HVQA 1BK1A 4TTGA 4ATFA 4MVRA 4LF5B 1O4YA 2VU9A 4GUNA 3U1XA 1F23A 1YI7A 1VJ2A 3KF5A 1RC6A 1XMOO 4OFGA 5IUQA 5LA1A 1RUG1 2QA4V 1XMQB 1F5FA 3KZ4C 4UVAA 2A5ZA 3FLRA 2DU0A 5DQ0A 3AC0A 3T2OA 2OKXA 1QJX2 4MX3A 3JD0A 1XU1A 1FXKB 5HCAA 2ZXWB 2XAHA 1YZBA 3UNPA 4AI3A 1XHZA 4JKLA 1VQMV 1QXRA 3AG4B 2JICA 3AYEA 3S7IA 3E22B 4QXBA 5GLVA 2BTQA 3MPBA 5GALA 3CRCA 1QQCA 2VQFO 3K5OA 4QX0A 4C0HA 1YFWA 4HZFA 3KWVA 3K2OA 5DDJ2 1LHVA 4D7TA 2VMHA 2AW9A 1G4YB 3UETA 3PVNA 2Y6FA 5L9RA 2DVFA 2JJ6A 1WJZA 5JCTA 1RUJ3 5FYZA 1AR81 4ZHQA 1EN6A 2HJDA 1HXS1 3O1UA 4XAEA 4JVAA 4OHXA 4CCNA 5KXBA 1NA1C 4JI0O 2WN3A 3O1TA 2D3RA 1MS8A 4GWNA 1UMHA 4N43C 3KV9A 3ZXFA 2RDNA 3ZLIA 4NROA 1G7YA 4J10A 2AEZA 2KR2A 4Q4V1 1SQXH 1VIBA 2WSUA 1OCZB 2LGQA 1X59A 1PK6B 2QWRB 5IHRA 2BFUS 4CC5A 1UXZA 3T2PA 2IJHA 2ZCEA 2F43G 1RVF2 1GUIA 3ELNA 5TSWA 4AG4A 5DAPA 2WLMA 3AG1C 3UGGA 1VBD2 1RUH1 3CCLV 4GKYA 5C8WA 4F6RB 5AG2A 4LLFA 2OXBA 1VE0A 3GZTB 2ZA9A 1F31A 1ST8A 4PELA 2A3XA 4WBNB 1WCKA 3I5DA 3PUAA 3E2EA 2VQEB 4O4HB 4FT8A 3K3WA 4W50A 4HSLA 2WKKA 1SACA 1CJPA 4LKDA 1SLTA 4GWJA 5FZEA 2GAUA 1U5YA 3QACA 3WQBA 3K4DA 3WDYA 4CXXA 3W59A 4PDWA 1HV1A 4B08A 1N8RW 3JCIA 5ACA3 3OR7C 1Q8VA 2B45X 1RUD3 4I4TB 5HCHA 4OLLA 1D5NA 2Q7EA 2V4DA 1JA8A 5TISZ 1NX9A 3BHPA 5JSRA 2C24A 4LT5A 4QKDA 1VP6A 5LMUB 2DDUA 2OZ6A 1ONAA 3AKQA 2YXLA 1X8MA 5ACA2 2MEV3 4QQ2A 4Q4W1 2JX9A 3L9DA 2ZZQA 3RYIA 4X64O 4W6YA 4M00A 1JHNA 4QPGA 2ZGLA 3B7MA 2QWQB 2WABA 3VD4A 1I5XA 3MLKA 2AEYA 1T5EA 5LZ6A 2FMLA 3LAGA 4W8JA 1E5RA 4IL7A 1R081 3T3YA 1POV3 3K5NA 2RR11 4DUWA 2PYLA 1NXD1 3KT1A 1N1SA 2VZQA 1L0NH 5I8SA 2F4PA 2H0VA 1TAEA 2A6ZA 4BQWA 4X8AA 2CWSA 3I97A 4XOGA 4CCCA 4MW8A 4GJZA 2WL1A 3C90A 3GF6A 5HXVA 3DC5A 5APAA 2VZPA 4YJ3A 2XQXA 2XJUA 4IHJB 1MS4A 3STLC 3MLLA 2ARXA 2YPJA 5EQUA 4YJ2B 1SBDA 2LS6A 1BQPA 2C2AA 1OF3A 1KXGA 3J9SA 1NBMG 1XMQO 4CEWA 2FMDA 1WW6A 2XASA 2XL7A 1R091 1ZZ7A 4Q2FA 4R9DA 1YI9A 1W6OB 4FPLA 1LOFA 4ATEA 4N53A 1NAEA 1Y6XA 3MF6A 1Z7S1 2B1GA 2BNNA 4IV1C 2C9KA 4AQ6A 1RUF1 2W08A 1RHI3 1MPXA 2R70A 3HNBM 3BALA 1Z2GA 2QTWB 4G3YC 1C8M3 3K5LA 1DF4A 3DGTA 3RYCB 1AYN1 4CUBA 5C4WB 1JI6A 1UX7A 1Y4WA 2EIBA 2D5HA 1STMA 3BA8A 4Q0VA 4FM1A 5DUXA 3NWKA 1W6NA 3VBSB 3B3QE 5FNVB 1IPSA 1VAVA 2VD7A 2DQ0A 2V5YA 3OPZA 3VGIA 1N0JA 1ND2C 3FFQA 4I5SA 1LHUA 5I0DA 3ACFA 2ET1A 1OH3A 4DXWA 2ZPXA 5FY7A 1JFFB 5EHDA 4K1YA 1Y76B 4D6QA 5FMBA 3SCFA 3TOJA 4YHHB 4IGQA 2WSSG 1VBC2 4AI9A 4YW4A 5DN6G 2R7EB 3GJBA 4B4QA 3B93A 1GM9A 3ABKB 3KCXA 4F6RA 2HP8A 5FMDA 1K5JA 5L3DA 1URXA 4XQWA 2ZOEB 1HXS3 3WG4A 4QHBA 4AE2A 1AILA 2Q0OC 4GX5A 2OQ6A 5LHGA 5LB6A 3WF2A 3ZXKA 5C9AA 4TUYA 5T52A 2GUZA 4JPRA 4DR1B 4FLZA 1PPJH 1CAXB 4XDLA 1Y9MA 4YGDA 3KQRA 2VOTA 1N3PA 5FLJA 5A7WA 4UFHA 3AFKA 3RYKA 3DGEA 1JYVA 4QDSA 1LECA 3AM2A 4XHXA 3W7SA 3I59B 2DV9A 1Y74B 3AZVA 3AZXA 5B4NA 2XTAA 1LB2A 1QHDA 3WHTA 3ETDA 4LF8B 2ITCC 3G6EV 3A8TA 5BY1A 4ZHQB 1N33O 3JD3A 1O6UA 4HOOA 2M6YA 2VMDA 3RVHA 3VHRA 1K9MW 3FHQA 4JHTA 2Q9LA 1HW7A 1BHAA 4FMTA 3K51A 5KHHA 2HH9A 1D5AA 1Z78A 4YY3O 3RZHA 1KS5A 2XWBB 1JYNA 5K7PA 2QM7A 3TRSB 5JH7B 2IXCA 4CPBA 3MBWA 4XEZA 1MS5A 1ZRDA 2BEOA 1R6NA 4GMP1 1VBE2 2PQSA 2Z3YA 4NRMA 5FXXA 2WA4A 4B3RB 1R3JC 1OURA 4WBNA 3OY8B 5KWRA 3RWNA 3OD0A 3MFCA 2WLLB 4GAZA 1VMFA 2GH2A 4AAXA 4JC1A 4Q4Y3 4IYHA 1WMDA 1N33B 2FCVA 1KRIA 2VNOA 1P49A 5A1AA 1LOFC 3T1HB 4Q4W3 5EZYA 1UYZA 3ZN5A 1OCOC 5JXIA 2GNBA 1AR73 2Y6GA 1N34B 1SS3A 1QXJA 2P37A 4UFLA 3N9PA 4YG0A 2Q68A 4UB6Z 5IVJA 2LP7A 2XT9A 1PGSA 1VBA1 1LULA 1JZ4A 3H50A 4JDMA 2WQ8A 2P17A 1W0KG 5A7NA 2D43A 4Q29A 5FZ6A 1IBKO 2VTFA 1WB8A 5FO9B 4DNYA 5BNNB 1IGOA 3N9OA 2QKAA 5DM6V 2BVBA 1IKQA 1GZCA 4HT1T 2YEVB 3NJYA 3VZMA 4DXTA 3W5NA 4J9ZB 1VAKA 3PJYA 1SLAA 3ZIAG 1SF9A 4IEYA 4RD7A 1UQXA 4J41A 4XW3A 3RYHB 2P90A 4HMZA 4BWAA 2PTMA 4N43A 5JIAA 3CCQV 5JMCA 5CMUA 1AX0A 4JGZA 5ANQA 2ID4A 3NQHA 4DEQA 1X36A 3CE2A 1H2LA 2X5IA 2CV6A 4M4PA 4NUBA 2QM4A 4PD4F 1ZBA2 5JR7B 4B1LA 1BBT2 4P9WA 5LXTB 1XNBA 3AP7A 2JDNA 2GNTA 1RUF3 1CZSA 2I45A 3ZR5A 1G9CA 1BQ0A 1MG1A 2PHUA 2J1EA 4HFSA 1XC6A 4IEQA 4XCAA 1GFF2 2UURA 3H9AA 4CA9A 1ZBA3 4C90A 1RUE1 4Z8BA 5GZEA 1KKCA 1AJPA 1OD5A 3NJXA 3KM5A 1W3VA 2R16A 1LUWA 1I5ZA 2TBVA 3NV3A 2B5HA 4XDOA 4E4EA 3HPLC 4IE4A 4WVWA 3B00A 4BHPA 1REEA 1Q8SA 3ASOC 2SBAA 1AL22 4GCZA 5C5TA 1W8TA 1ZYBA 5LGTA 2BRTA 4C8DA 1DLCA 5FUIA 5CKNA 1OFSA 2BSKB 4BQXA 2QNKA 4D94A 1GICA 4MXWB 2LALA 4A7ZA 3TETA 2MEV2 4HBNA 5HCFA 1HKDA 2O14A 4PHZA 5KXEA 3P3NA 1SA0B 2JGUA 1JQ0A 4ARXA 2W5FA 1J59A 4W4KA 2V7QG 3OTOO 2DW4A 1RXFA 4XUOA 2CWMA 4MV2A 4BR6A 3AG4C 4YNIA 1LR1A 1YITV 3D3AA 1LGBA 4TWTA 5L7OC 2VCAA 2ATKC 3T0DA 4LHNA 1QBZA 4AVAA 1ND3B 2RQ6A 1UZVA 1YYNA 2WNUA 2N74A 2YMZA 1RUG3 3WG7B 2QZ3A 2WZEA 1OI6A 1VQ6V 2R063 2FHRA 4JGYB 4Q4V3 2UXCO 3ZKYA 3ZRVA 3DSQA 1MMMA 3ZDSA 3OE7G 1AR61 1RUI1 1YQ6A 1IS6A 4AVVA 3OUSA 2X6CA 4AAPA 4COUA 2ZM6B 2RS33 2IZWA 3HBZA 1G6NA 5J09A 3IDCB 1BT8A 3FUOA 4XFCA 4J7KA 4YW3A 3S0MA 1WUVA 1I7FA 1H8VA 5FP9A 5FMCA 3VZOA 2X7RB 3MHHC 1GZTA 4I0XB 4GWMA 2GSMB 5K1PA 4CDUA 3NMBA 2W1WA 4CXWA 5IFPA 4MVQA 5D5QA 1J83A 1HNZB 4DXRA 3NV4A 2ZX4A 3UJQA 5LBBA 4AEDA 1W04A 1ZA4A 4CEYB 4EN7B 5E8AA 1VQPV 3OMNB 5FYSA 1BL8A 2WLJA 3A0KA 2PYTA 4DV4B 1ZZBA 1COV3 2BUKA 5L3GA 2LW7A 2VUCA 2JE9A 2CTVA 2GALA 3VKOA 1VBD1 4OPHA 4JCKA 1W3XA 4AXOA 4XAAA 3WY6A 1XQNA 3A2FA 5CNAA 1IPJA 4TSVA 3C3SA 3ZFEC 4X20A 3CCSV 2GDFA 3ZBHA 1W0PA 2ZNIA 1G9FA 1PL4A 2YDEA 1NCRC 5A6XA 5LK5A 4I3GA 5EC2C 3I54A 3AG1B 3CC2V 3CJXA 4YIOA 4DV3O 4NRQA 2NM1A 1V9PA 3JALB 1KJLA 4MGIE 2ZAAA 1DG6A 1F4HA 2GH8A 5FYUA 5G04L 3IAYA 1MOFA 4EFBA 1E5HA 5HFLA 4CDQC 1NZ6A 1HXS2 1NQTA 1CX1A 1WLEA 2D3SA 2DUQA 1VQNV 4H44B 4LCUC 4IEWA 2XUMA 5I8YA 1S0VA 3ZRSA 4FAGA 3T2QA 1VRH2 2FMYA 4CDXC 5JQGB 3SYAA 2BP6A 4R4ZA 1M4UA 1D7PM 1MABG 1SLCA 5FBZA 3CCVV 1JUIA 1HNXO 3E83A 2XJRA 4WFHA 4I55B 3OY8A 3MICA 4AHZA 2EBOA 5JUVA 3N7JA 3JCZA 4COZA 4P9YA 2CL2A 1DQ1A 1E79G 2Z5WA 4E2GA 3JD2A 2D5FA 5JJEB 2O1QA 2D98A 4J7JA 1PZ9A 2CDOA 1SCRA 1K8AW 3E1F1 3UKVA 1AR91 4ISRA 4FI9A 3WF4A 3JBG2 3JUUA 2P6JA 2J1VA 1N47A 3H3UA 1NE6A 1DQ2A 2CE4A 1OXCA 3UGHA 3B2EE 3LF7A 5EYPB 4A3XA 1IS4A 1TVKA 3SEEA 4PA7A 2WPDG 3AK1A 5EYYA 1AXKA 4P9IA 1UCXA 3JAWA 1W9SA 3H42B 1F4NA 3POJA 2WLLA 3LSDA 1PP9H 5LYJB 2HWE1 2JDIG 1XXNA 3LSEA 3LGRA 1KU9A 4XXAA 3JAMN 1ASJ2 1HQNA 2E26A 4JI6B 2HLDG 1QLEC 1ZBE3 4NHMA 2OQ7A 3C2UA 4QNHB 1WPBA 4DR3B 3KVAA 2VMGA 4N43B 2DQ3A 4LFBO 1GM7A 1W2AX 4A7YA 4TLFA 2QZ2A 2R9RB 5CN0A 2Y26A 1K7DA 1UWWA 1X82A 3OGRA 4QPYA 4PIYA 1GTOA 3F7VC 4QKNA 4Z92B 2VXJA 4PBOA 2F66C 3RMYA 4YVSA 3THPA 4JI4B 4UWDA 3QLQA 3GGLA 4FLUA 4NAOA 4K0KO 2XJSA 1NCRB 2EIGA 5IYDO 5HV0A 4XMAA 2IXLA 3MZHA 2HFEC 5FZDA 1M06G 3MD0A 2EZOA 1YJLA 4GIQA 1U96A 2W1UA 1SFNA 4K20A 1KKDA 4LQRA 1O3RA 2B5UA 2JG8A 3MV11 5EK0A 3S3WA 1W06A 4BXFA 2VBPA 2R0FA 1TNFA 2HWC3 1IBLO 3PHMA 3SXWA 4AFCA 1JZ3A 1QU0A 2O0OA 1AR62 2RS51 2RS31 2K1EA 4SLIA 4XUPA 2IM9A 1NCRA 1ASJ3 1TGOA 2X8KA 2OIIA 2EICA 4ASKA 2YY1A 4RA0A 5IVYA 2Y64A 3ILNA 3ZN6B 5AFEA 3ZFEA 1W8OA 5GTIZ 2BV4A 4BZ4A 1GRJA 2DBNA 1THZA 5A7WB 3K57A 1NLRA 3DV8A 1EUTA 4QDRA 4P9LA 3CCUV 3HMYA 5FY8A 4LC1A 1LNSA 5DEDA 1AJQA 1SCSA 3PNAA 1HQWA 4LO8A 1Q8PA 4KBZA 3S3XA 2OIEA 1IQAA 1SDWA 1ZZCA 2B8MA 2OCCB 3TEWA 1PZ7A 5IT9N 2UWBA 1JFFA 1UN1A 1K33A 4XPVA 3VBUA 3ACGA 1EV11 5GLUA 3BUCA 1JZ2A 1MQTC 5C5UA 2W91A 3MW2A 3E8GA 2HWB1 2ZXWC 3ZS8C 3IAQA 2V4AA 2FDIA 3FKSG 1DQ4A 1JN2P 2DFCA 3ZMOA 4NKGB 2Y6HA 1GR3A 1ZBE1 1W2NA 2DVBA 4JI2O 5IVEA 1XYOA 4GH4B 1N3QA 3PL0A 1SEFA 1UOJA 3E8FA 2JG8B 2LGWA 1VP7A 4LBQB 2JG8C 2GMMA 3LA2A 2WZPP 2ZEXA 2X53S 4LULA 4WV8A 1NY72 3TN92 4NXMO 3AJYA 2B9VA 1YJKA 3ENRA 3K0GA 1RHI2 3ZRXA 1VQ9V 1MS3A 4X1IA 4FLXA 3J7AU 3PVOA 4QDQA 4DS0A 2GTAA 1CZVA 1IS3A 3W7TA 2QWNB 4MSWC 1VBB3 4Y22B 3K4AA 5EYXA 3V65A 3WX5A 4LF7O 1LOGA 3APOA 4CUGA 4D8MA 2AZ5A 1COWG 1P7GA 3WSOA 4NWVA 3M3OA 3LFIA 5C4WC 2WT2A 4AFDA 5EC1C 5E79Z 4I9WA 4QX1A 1HNXB 2QQIA 2BTOA 2X5IC 4JI7B 1Y76A 1NH2D 3A4UA 2Y0PA 1OLRA 1OVSA 2X6AA 1FAFA 3STZC 3WV6A 1FFXB 1UU5A 3ASOB 1TNRA 2JD4A 1Y67A 5FZ4A 3INAA 1NTKH 2KQXA 3OGSA 1GQHA 3TK1A 1D4M2 3UT5B 2EIDA 1FMD3 4B3SB 2A73B 2QQNA 1LHOA 1IG0A 1QOOA 1V00A 4UBGA 5L7OB 2GN7A 2ZKOA 2EALA 1SG3A 1LOAA 4R52A 2ZE5A 1TUBB 5L9BA 3JB8A 3N9QA 1V6JA 3WW3A 1MQTA 1UIJA 1OLMA 1LGNA 1BCXA 1UY4A 1JZ6A 3ILRA 1TMF1 1ZREA 1JCHA 2GC2A 3MDSA 3OD4A 2ADDA 4FLWA 3D4KA 2GZWA 4RS5A 1QDOA 2LFRA 1AX1A 5LY2A 5IFTA 1Z7S2 4UW4A 2UU9O 5IT6A 1MNGA 5LCWL 1NH2B 5DUVA 3U78A 4AQ2A 2IFRA 1MEC1 4Q4V2 4P9PA 2O8QA 3CRQA 2VUDA 3AYDA 5KAFZ 1MQTB 3LPFA 3SH3A 3G4SV 4O2AB 2PGGA 1D0HA 1DP0A 1AYN2 1VBC3 4FFIA 4IETA 4QT6A 2XUEA 2QQJA 4FFHA 1LKNA 5H9SA 1EBOA 2RM21 2ZX1A 4RR3C 4DV2B 5K8SA 1VQOV 2VOWA 1L0LH 2EXIA 5FO7B 3ZX6A 5BNOC 1U0AA 2EAKA 2DU1A 3UV9A 1JYTA 1VBA2 3OBAA 5DABA 3A0NA 4CCMA 1ENXA 3D82A 4FVMA 4XXPA 1ZL8A 1QJY1 4KBBA 1REDA 1C1LA 1SQFA 4AFAA 2R042 5BNPA 1WLTA 5ANNA 3T1YO 2XBO3 2QKSA 1RUI3 4PDWC 2ZABA 3MI8A 3T2MA 5L3BA 3ZOIA 2D40A 5CEHA 2R0HA 2ORXA 4YRDA 2IU3A 2QQKA 1VRH3 2G9GA 1OC1A 3O1SA 2Y8KA 1M56C 4UCRA 1A78A 3UKMA 5JI9A 1JZ7A 4LMFA 5J2UB 1Z7S3 5CBHA 4HN1A 5H6QA 1XL4A 3ZYPA 2PI5A 1W8NA 2JD9A 4LPLA 1BS3A 4UCTA 4OX9O 3VHNA 2Q5ZA 1DBNA 1VQLV 5GONA 4CU8A 1XOUA 4IUGA 2IXKA 2WFPA 4A41A 3D5OA 3GBWA 1LODA 4OXSA 5FP3A 4DW1A 4LKEA 1S2EA 4EEQA 3AP5A 4AVSA 4TYSA 1PNLA 3NVCA 1VBE3 1JOPA 1GH6A 2QWOB 3VBHB 1SQBH 1FOD1 3SC7X 1FS0G 4ORFA 4KXRA 1EAH2 3O0VA 1XPWA 5FZMA 3AVSA 5I0TA 3WP4A 3HD8B 4DV5B 3OGVA 1XBLA 1RUC1 1NOVA 5ABJB 1QLEB 2FD8A 5FXZA 3BN6A 1ULFA 3ROUA 2BYVE 4DK1A 1H9PA 4Y1YA 1F9KA 1FXVA 2QQOA 3CYOA 3OBZA 1RPRA 1V6OA 3WINE 4JQRA 5FZBA 4D3WA 2EXHA 4CDXB 3USUA 4I0AA 2QJ1A 1JMKC 1JVMA 3BRCA 5EIBD 4DO2A 1R3LC 1ULEA 3AMNA 5LHIA 1YFXA 5IWFA 4G28B 4GB31 1H6XA 4GKJB 1PGW1 2P3IA 1OHHG 3J4UH 4YM1A 1AVMA 1E1RG 3TEYA 1KP3A 5A6QA 4IEXA 4UCOA 4FK5C 1UOFA 3BA9A 5F37A 2J1UA 4D7SA 4PT6A 5A3PA 1AP6A 4Z2WA 4ZKIA 1G8MA 4EB6B 3DF0A 3KF3A 3DCQA 2VL4A 2AGAA 2FDGA 2A6XA 3CC7V 2WN2A 3CSXA 3LD8A 3RG0A 4O2BA 2E7QA 3CU7A 4IV1A 3AX4A 1QY4A 1BMFG 1N4CA 4EWDA 1EYBA 2BPA2 4XDKA 4BPZA 1O5UA 2AZ2A 1X50A 2Y6LA 2V4VA 3A23A 2KD7A 1PD3A 4JRLA 1GMGA 1PV0A 1HP8A 4FLYA 1K73W 1U12A 2UXNA 2FZ2A 3AG2B 2Z69A 4OHVA 4IERA 4GXLA 4QJFB 1JS9A 1HB1A 2H6CA 2J1SA 3K77A 1V6KA 4JI3B 1I94B 3ETPA 4TLGA 4QWNA 3WDXA 1JU3A 3V64A 4OI4A 2VQUA 2RS12 3PUHA 5GZGA 1J5EO 3LEGA 2TUNA 4QE7A 1CAVA 3E5QA 3LB9A 2R071 3FWEA 2YIBA 2UXDB 4E2SA 2ZGMA 2JVDA 2WAOA 1H1AA 1ND2A 3O12A 4ZONA 1R3IC 1DZQA 4XFBA 2P06A 4YZ1A 1HDKA 5FBJA 1BVVA 1ULDA 4QPGC 3B8NA 2C26A 3IDEA 2I74A 4HG6B 2G9ZA 4GMP0 4X1KB 2LO1A 2ETNA 4I09A 3JCUZ 3VQVA 2VW2A 2HEWF 3VBSC 3MEPA 4IGPA 4P02B 4RQPA 1BZKA 4NTXA 4LWSB 5T55A 3J81N 5A70A 4KL1A 4Q20A 5LBQA 4OYUA 3VZLA 4URAA 5FNVA 4RFRB 5FJHA 2QSAA 4JYCA 2ZGOA 3ZXJA 4CCLA 2FCTA 2W0XA 1AL21 5K0UB 2G1MA 1OLQA 3IIAA 5JJJB 5IYYA 3RFRA 1RUD2 1KFUL 2VGDA 3WNNA 5LBEA 1FATA 3K59A 1RUG2 2XXZA 4HAMA 3F5TA 1S77D 4WM7C 1Q43A 1J1LA 5B3SB 2XVGA 1WBFA 4RGGA 2IVJA 5I0RA 1ORQC 5T5LA 3DKQA 2DWEC 1JJ2U 2OUJA 1FV2A 4Q4X2 3HT2A 4IE7A 3B4SA 4XF1A 1F51A 3P1IA 2QQVA 2JB4A 3Q8BA 3OJBA 3DECA 1G8WA 2ZIMA 2QM8A 1UIKA 2E5LB 3DXRB 2P4EA 3URFA 2QTOA 2XVKA 1FMD2 4QGPA 3P5BA 3ZSJA 2FBEA 5F7UA 4ZXKA 2YPDA 2F23A 3OGIB 5A3WA 4D6SA 2YC4A 5HV4A 3K3NA 5LMNO 1AR92 2EINB 2AGSA 1PNMA 4L8QA 4UVBA 3R0RA 3JD73 1ZLZA 1WMFA 3GXUA 4BQ4A 3A22A 2AXTZ 3WNXA 2HWF1 4XABA 2F4LA 1UY1A 4PJYA 3B40A 2GP5A 3HT1A 3HKBA 4IGOA 3GBGA 4UUJC 3ZMVA 4FP2A 5IY5B 1LENA 4WM8A 2EIMC 4QQOA 3POFA 3GZAA 3SJBC 1MZ5A 1H8TA 4QPIB 1RUH2 4O4IB 4FM2A 3I2GA 4N9IA 4J25A 1IXMA 2QQPA 3SPHA 1BGYH 4YZ2A 1AF9A 1HNZO 3JYCA 3G80A 4DRRA 2NNUA 2P1BA 1CJDA 4RAIA 4ISQA 5L36A 4CDQA 3IB3A 3OUJA 1UW8A 4K6BA 4AYUA 5A3UA 4P14A 4DUZB 3ZO0B 2X05A 1QJZA 5C8YB 4GKKB 3RYRA 5F5IA 2R1DA 4F3JA 3WP5A 3TEXA 3QVNA 4AQSA 1ZBA1 5KAIZ 1RUE3 3PVBB 4FPEA 5C9AB 1BBT1 1PO13 3ABUA 4YVWC 4KWJA 5C3PA 3D3QA 1G1XB 3VHOA 1RUD1 3OB8A 1KB9F 4UCSA 4DV0B 2WNVC 4UVCA 1XDCA 1FJGB 3FBMA 4MLOA 4ZI7B 1OOPB 1SBEA 1JYXA 4LEJA 4ASMB 2J1RA 1L8DA 1UOBA 3KD4A 2I2SA 3NV2A 5JPNB 5DDJ3 1SHWB 1HQLA 2E63A 4YGBA 1PMIA 1DF0A 4CRQA 4Q4W2 1MVQA 3ZFGC 5FYYA 3THTA 3X29B 3AP4A 5BMVB 5T5PA 4AGGA 1ZL8B 3K75B 4BM8A 3HB3B 4Y1VA 3IWZA 5LA6B 4BLIA 5IVVA 3FAVB 5FPVA 1SZXA 1J5EB 3LA3A 4X1YA 5JCOC 4JHZA 4OQ9A 2CH7B 2KM2A 3F2ZA 5FREA 4GKKO 1I94O 2D2CB 4QQHA 2CNAA 5F6KA 1NE4A 4BIUA 2FYUH 2A71A 3CZUA 3PIJA 4UFMA 4WVVA 3CCEV 2Q4SA 4LR3A 2GV9A 1XB9A 2OYQA 2ET7A 4MGTA 4XDQA 1HX6A 4XMIA 3WNKA 1VF7A 3PURA 1ZVFA 3HWJA 5EPAA 3ZN1A 1ULCA 1UAIA 3ACHA 3N36A 4QX7A 2VBDA 5JZGB 4R9CA 1ZX3A 1CZTA 4QB6A 1RSOA 4L99A 1DCSA 1NJIW 2XLFA 2NMNA 1IBMB 3TB0A 1W39A 1PIV3 1QIQA 3LDDA 5DXDA 4OZOA 4K1ZA 3MDPA 4BLJA 3I55V 4Q8KA 1YC61 1QDCA 1NI8A 3PLQA 1KMIZ 2OTJV 1N36O 1TUBA 4IHJA 2GC3A 3S57A 4RUFA 4F6EA 2G9FA 4IXLA 3MYXA 4DO0A 3HKBB 2WNUB 4MVTA 4DFSA 1LGCA 1NCQC 5D8AC 1K42A 5KHIA 1UL9A 3SR2C 5B1NA 3AVRA 1Q56A 4DY3A 3I4IA 1MSDA 4LUKA 4Y1ZA 5EIYB 1R1BA 3ICXA 5BNPC 3HQXA 2A3QA 4HKLA 4OZXA 1J84A 1W28A 4CDWA 3CO2A 3CDZB 2ZDIA 1W6QB 3HKDB 4B3SO 2BBAA 3WT3A 4YVSB 4K35A 4JTCB 3CRMA 4QPWA 2UWAA 2UUAO 3UK9A 4AVBA 4BOWA 2XNDG 4D7YA 1V6MA 1W6QA 1LHNA 2RM22 1GOFA 4BMBA 4A5UB 4FPFA 1GMMA 3I2HA 1VBC1 4R8HA 4CCDA 5K0UC 2Y48A 4KH9A 3CXCU 5SV8A 5AVAA 2AHZA 5A7QA 2CAZC 2BERA 4GALA 1S2KA 4FZ1A 4GJYA 1AI4A 3CPWU 3CLPA 1ENVA 2RN9A 4MGKE 1H0BA 5JPMB 1W9WA 1UU6A 2A7WA 4EKWA 2VR4A 4NOTA 2WWSA 4Q0UA 5FP8A 4MG2A 1SPPB 3E22A 5CBGA 3CEIA 2F93B 3ZIXA 3CRAA 2C5DA 4Y3OA 1KBHA 4OI1A 4LK7A 2IFWA 3OR6C 4UBHA 1VF6A 4NIDA 4Y5SA 1NVPB 3T1YB 4TV9B 2ZACA 1NUKA 1H6YA 3PJSK 1B06A 1O3SA 1ND2B 1EAH3 2YICA 4Y33A 4FPPA 4FXKB 5E89A 5GKAC 4Y26A 3O0XA 2VE1A 1NXMA 1W2TA 2EIKC 3KCYA 4KUMA 5JIUA 1TEIA 3WDVA 1DIWA 4Q1PA 1FPOA 5FOJB 2W68A 4UAPA 4QGNA 4XBLA 1BVP1 3ZJZA 1BK0A 3FN9A 5EYPA 2OUHA 5K9YA 2A06H 1KUQA 4NXNB 4BDVB 1VBE1 3D6EA 2ARHA 1BJQA 3BGAA 4LHSA 4XIOA 2CDYA 4DB5A 4LBEC 2C6SA 2WAAA 2HWE2 3IGAC 4HNAA 4QX5A 1J1TA 2W6IG 2Q69A 2OS2A 2H3OA 2Q73A 5H6RA 3JATA 1AJNA 2JE7A 4MGYE 5B1AB 1C4RA 1JODA 2KA3A 4XILA 2OW4A 5I91A 5CB4A 1YTFD 3FFZA 1DQ5A 2BOBC 2Y4TA 1GLHA 2OX0A 2B42B 1V6IA 1HW5A 2ZGNA 4JTOA 5IVCA 3WNOA 2D6MA 4LIUA 2YSUB 4JGZC 1X33A 5FY0A 5GLWA 4J1WA 4YWAA 1SLBA 4JYYA 4YFZA 5FFOC 4H37A 1AYM1 5FYTA 3RYPA 4RQEA 5IJ9A 2WRAA 2Q8VA 2VNRA 4UXAA 3BYWA 1GK9A 1YIJV 4IIJA 2YZ4A 4P2ZA 4LBKA 3DEMA 4DR6B 2OCCC 4DRVA 2DMXA 2QCSB 2W1QA 3HNMA 4LFBB 1MZFA 3FX3A 4JKMA 5FKCA 3AB0A 2QDRA 2H6BA 1P84F 3SYCA 1HJGA 1XE8A 5FWJA 2ZX3A 4K21A 3H1YA 1WZXA 3CEWA 1B35C 1B09A 4JX0A 2WWUA 1Y4MA 4H7LA 3B8MA 4NTWA 3QO7A 3CB2A 4JI6O 4A42A 4COYA 5LP6A 4ZU5A 1I6XA 2ZZJA 1WA8A 5KA5A 2UXCB 2XAJA 4FZ0A 3NO8A 2KXLA 4Q0PA 2IH3C 2VO5A 1OCOB 2AYHA 3KHCA 3E35A 4QKBA 2C1FA 3I3QA 5D1IA 2WQ4A 1YI2V 2EF6A 4W4LA 2EIKB 3W20A 4UOJA 3IIIA 2XBO2 5DUWA 3SCGA 2VG9A 3P3PA 2Q0AA 1Z5VA 4P9OA 5HBAA 4AEJA 1CPMA 2P34A 3OG2A 4JGYA 5DUUA 4GLXA 4URTA 1JW6A 2PYJA 4GZRB 3H8UA 4XE9A 1VPHA 1NTMH 1OF4A 2XAFA 4DOUA 4I9QA 2O57A 1JU4A 4E4DX 4MVSA 1PX3A 1Q8QA 4BIZA 3VLBB 5DAXA 5LBFA 1HDJA 4FPHA 4IEUA 4YGEA 4XJAA 4ET7A 5IAXA 3VDDA 1YHQV 4GQ7A 1XRUA 2GC0A 5FUPA 1CEZA 2DFBA 2HKXA 1R1A3 2XOKG 5M0TA 2F95B 4KG8A 2PHWA 2W92A 4A7KA 5BY5A 3N7LA 1NVPD 4FPYA 1DGLA 3PN1A 5DMYA 3LIHA 1XQ8A 3H1HH 5IK5A 2BSKA 3SYOA 3ZCCA 1R1A2 3K48A 4BK4A 2DOSA 5FY5A 1S72V 4EWEA 4RHV3 4JDOA 4LNVA 3C8XA 2R041 1CXZB 3AMPA 4X64B 4DR7B 1A3KA 1NQDA 5J2TA 3ME2A 2DTYA 4X65O 4BYYA 4XACA 2MK3A 1K5MA 3E6BA 3PDQA 4AF9A 4YYOA 2PLV1 3ZXDA 3C3VA 4QM9A 3HKCB 1M93A 1DZTA 1IURA 2RMKB 2MPFA 2RMU1 5C8CB 2RDQA 2DE0X 1EY2A 4LNUB 2Q4PA 2EXJA 1SQGA 1J3PA 2BW8A 2VZTA 3PU3A 1TA8A 4NPLA 2BU9A 3FD9A 1JJOA 2BOIA 1AI5A 2QE3A 4K3AA 2P2KA 4QXKA 4ZXEA 4J1XA 4LH6A 3J8F1 4OGQB 2JB8A 3ABLB 3SEPA 1W90A 1Q5OA 5I8TA 4FQZA 2VW0A 1S5HC 2IBZH 1CPNA 3VZNA 3N2GB 2EXKA 4XJ8A 4P30A 2VCCA 4HK8A 2WNVB 5FPOA 3JBG3 3AKPA 3VDDC 1HB3A 3NJZA 1UY3A 1V55B 1ZX5A 4LHLA 4PI0A 4J9YB 4YIPA 2HHHB 4FCAA 2QQUA 1R1ZA 5LA9A 3H1JH 1O8PA 5E88A 4QE9A 1RUC2 4Z07A 2F6BA 4NHYA 2DWDC 4DR7O 1FAYA 2XKPA 5DAWA 1XBFA 1LESA 4GH4A 5JXJA 4I01A 2WS92 2N05A 1H4GA 3C7GA 5JLVA 2J7MA 5IE9A 3AK0A 4CP0A 5JXHA 1YHFA 4I02A 5G05L 1UKGA 3RZZA 1YRZA 3N9LA 2Q8DA 3PU8A 2RNBA 3ZXAC 5FPUA 4CEWC 1SDDB 4ONUA 3A0HZ 4AQTA 5F5CA 2GUZB 1I1EA 4TUYB 1PM9A 1O91A 4LFAO 5IATA 4B4RA 1ULPA 1VB2A 5F8PA 2XWJB 5FIXA 2YEVA 3UJOA 1BKZA 5CISA 4O61A 5FZAA 4DY5A 3T4HB 1QJY3 3TEZA 3WU2Z 3LPGA 4CEYC 2BJSA 1ZZ6A 5F39A 4E4ZA 1O4ZA 2FKXA 1JYCA 2VPVA 2P3KA 1RUC3 5LRRA 1EN4A 2EULA 3E5XA 4RN5A 5DDJ1 3H01A 3NNJA 3EHBB 2DCJA 1QKQA 4NIIA 5IWAO 1S1AA 4HNAB 1ENQA 4ZU7A 4QX3A 5FY1A 2XB6C 3O5SA 4YLZA 4HVRA 4FOWA 3IJ4A 5C71A 1FD9A 2DUOA 2YIDA 1CGPA 4I50B 4MW3A 3ZYBA 1W9YA 5B3SC 3QO5A 5GLTA 1NA1A 1LEMA 3SGIA 2D6LX 2K46A 1YQCA 4FPKA 5A1FA 2HR3A 1YF2A 4BWOA 1ZRRA 1QGLA 4RHV1 4FXGB 5CFDC 3VDCA 3HVDA 4O2BB 2R49A 4C1WA 1RINA 2XHKA 2VQTA 1YTFB 1U5IA 1LHWA 3OPWA 2PA7A 3IPVA 3BB6A 1W8ZA 1P8JA 5IAVA 4A6OA 3RT3C 1DTOA 1BMV1 4F4LA 3L9JT 2VQEO 4M3CB 3T08A 2XG3A 3ZYHA 3ZFGA 5SV5A 4UV9A 4DRXA 4LF9O 1IVSA 3B5LB 3BU0A 2RMU3 2UXBO 1FOD2 1KS4A 3QCWA 2F4VO 2MW2B 1XU2A 1K3IA 1SQ4A 1W8FA 1OCRB 3KVBA 4B7KA 4X9QA 2ADPA 3AYAA 1CR7A 3ZVXA 4MXVA 3FB8C 2RR13 2QBXA 2B39A 3X2QC 2FL4A 2P7TC 3IC7A 1BEV3 3KHBA 5A7SA 4CZZA 2UU8A 1ULOA 2NP0A 3T2TA 3NKGA 4YW1A 3H9VA 1H8EG 5KX5A 4WFAV 2QKCA 1PZ8A 1VBB2 1RVF3 1IBMO 1PGW2 3FBYA 1SERA 5LA0A 1JOJA 3JD72 2PI4A 2VOKA 4XYXA 4CH4A 3RDIA 4MT8A 1AR63 4UW3A 3KV4A 1HRI3 5GJ6A 1MACA 2Y4UA 1C1FA 1Q3EA 4DMIA 3MHZA 3FZ3A 2NN4A 1TME1 2WLHA 5CA1B 4W4ZA 4I7ZB 4MHUA 3U14A 4TV8B 4CPBD 4CS3A 3BVCA 2WLPA 1E1QG 3FHAA 4JI1O 1OPMA 4ZPIA 3GWKC 5H9CA 5I93A 1TZOA 4AEMA 1OZ0A 3LE0A 3T1MA 5EWSA 3CP1A 1UPIA 4FPOB 2JG9B 1LOCA 4B3RO 2ZGPA 4Y24A 3DC6A 4BQYA 4PDWB 3DYOA 3SH5A 1EN5A 2HWF2 1FXZA 4UFIA 3MAQA 1WLCA 2B1IA 1YQ2A 2RHPA 3L2HA 2R072 2Y6KA 2RDSA 4WFFA 1QQP1 5JSOA 3WEZA 2VZ3A 4XJUA 5CKMA 4XDJA 2VM9A 4YW7A 1ZWIC 4N9HA 2Q5TA 4I55A 4AILC 2YUEA 4MVUA 3AYCA 4U7OA 3LNMB 1DF5A 3K0DA 3JXSA 2DTWA 3ES4A 3NXSA 4ZBMA 3SJCC 4LTAA 1GWMA 2VC9A 1OQDA 4N53B 4DW0A 5BV6A 4YARA 1RIRA 1DYPA 4TSFG 4LITA 1H30A 4RSUA 1AUYA 4CYDA 3ZHRA 4V1PA 4LO5B 1KC8W 4ASLA 2OTLV 3V0BB 4NAMA 4XF4A 1XILA 1MS0A 1UYPA 3WNPA 2IUWA 2DURA 5EZWA 4I50A 2NMOA 2J42A 1VBB1 3AG2C 4BQ1A 3WHUA 4EYUA 4ITCA 3JD71 1SBFA 4AGVA 4DV7O 3D0JA 5IJRA 1MEC2 1PVC1 2HBUA 4CDXA 3RSJA 3PVEA 3N4MA 2UYBA 1W0OA 4Y5Z0 4W65A 1EFRG 2E32A 3ZMSA 2YXYA 3WUCA 2FQPA 2DYSC 2VAUA 2YYOA 3K3OA 5EIBC 1ULGA 4CH6A 3B94A 1OD3A 5FQ0A 4DPNA 4IEPA 1QEXA 3ECQA 1C8M2 3MUY1 2B9UA 2WUHA 4AI1A 3KCCA 2FB5A 3KQ4B 1QJY2 5CG8A 4UCVA 2VW1A 2D6OX 3ALQA 1OA4A 5JZGA 4XHBA 5FZ9A 3WNMA 4PI2A 1N0NA 5BR8O 1UNBA 5JVDA 3I7DA 1Q6HA 5JOYA 2JDUA 4D69A 1NU1H 1FYJA 1ZSPA 1VMJA 3OMIB 2WO7A 4NPMA 3TNPB 3W7UA 4OHZA 4X6RB 4GT1A 4FBFA 3B69A 4WZCA 4BA6A 5FPRA 2DYRB 2IXHA 3ZFEB 3W5MA 1M57B 4XBQA 1QJEA 1Y9GA 1JZ5A 2JIGA 2HWE3 3QH6A 4JYBA 5LP6B 4OX9B 1LEDA 4Q1RA 2VQFB 1VALA 4HK9A 1OCRC 5KMGB 4BW9A 2IXIA 4WM8B 5FR3A 3J7MA 1WCQA 4U7NA 2ZTNA 4I30A 4PCRA 4LBNA 4JRAA 2EAAA 4META 3ZFGB 1KDKA 5AC91 2Y0OA 3BCCH 4NVPA 5BMVA 4JV5O 1AVBA 1Y66A 5D21A 1QXPA 5C3RA 3LQCA 1VBA3 5A1LA 3HQRA 1IXBA 1C57A 5FXWA 3VD5A 2ODMA 2JGDA 3GCXA 2GP3A 2HEVF 2IVIB 4UFZA 2LQTA 3EFFK 1C5IA 5IDJA 5FY4A 3JARA 4DR2B 4WM7B 2R043 3OMAB 2AHYA 4D6TH 5LEKA 2ATFA 1RITA 4NYKA 4KG0A 1JXNA 3H1WA 1GN6A 2JJ1G 5A3LA 3RZLA 4FLVA 1JUHA 3DPRC 3VBFB 5FMOS 1QJFA 2IJJA 4CDUB 4R8CA 2BWCA 4X1IB 1XEQA 1YFUA 1K4CC 4JI2B 1IPKA 1N3OA 1V0AA 1OA3A 4FLTA 2GDSA 5A7OA 1S0JA 3HQUA 4N90A 1MSWD 3W7WA 3U11A 4J11A 1P7BA 2XGXA 3WDWA 2Z4FA 4FFBB 4Q6GA 5FCCA 4XFAA 4EV0A 4WFEA 3AJZA 1XOYA 3RJRA 4F83A 1X9TA 2VWKA 3ZR6A 2R6QA 2VVDA 3I3MA 3EO6A 3CQOA 5BPXA 2RV9A 1KFXL 3K79A 3I2FA 4H7MA 2VNGA 3GHNA 5T50A 3B01A 4DR6O 1BSMA 1WW5A 3H1IH 3M8AA 3NSTA 1W2UA 3LDKA 3L73H 2LTNA 4CP1A 5JOZA 3MW3A 3IMNA 3AMHA 4TOIA 2GMEA 5EBLC 2Q8OA 4NPRA 1EV13 1JX9A 3KT4A 1AJOA 1XNQB 3RZGA 2XLAA 2AC1A 1KQRA 5CYYA 4ARYA 5C8YA 1UPSA 2HWB3 5FK7A 4MYEA 2XMLA 3VQXA 2RS32 1RTVA 1MR5A 5FPAA 2HWC1 3K04A 1BYHA 2VMEA 2VXRA 5JR2A 3NRUA 4B3MO 3OEAA 1RUH3 2ENRA 5F3GA 3JD1A 5CBFA 4CCOA 1CD3G 1AZDA 4IE0A 4MXWA 3BAAA 4LBJA 1OH4A 1ZNPA 1ASJ1 3L70H 5DZEA 1SZBA 5E1AC 3NR7A 4WVMB 1A8MA 3SCHA 1IDSA 4J80A 1HRV2 3ZKUA 2FZ1A 3POWA 4K40A 4IE5A 3T30A 4CEWB 4YG3A 4BH9A 4FIPC 4LOTA 1K5QA 4HSJA 2XJTA 1GNYA 4X66O 1GSLA 5FLIA 4MTOA 1SZTA 3WG1A 4H55A 3SISA 1OPOA 2N04A 3KV6A 5J96B 5D5PA 2AH2A 5IWAB 2XHNA 3GCWA 1FXKA 2MEV1 5LY1A 3HEIA 5FZGA 4FPCA 3DPRB 1S4CA 3LDCA 1DGWA 4CCEA 2EIJB 1WKYA 3ZM8A 2E74B 4KP4A 1YVWA 1ZZ9A 3BIEA 5JH7A 2Q8CA 1AYM2 3SH4A 4JI1B 2W94A 1R082 4EB6A 5LA2A 5C93A 4CS4A 3R66A 3MIBA 3ZMUA 4O65A 2UY8A 3NNGA 3ZIWA 3HKEA 1RL3A 1V6NA 1K12A 4FO9A 3RVZA 1JPXA 2BVVA 3WNLA 4PDMA 2W39A 2HWF3 2HBTA 2WLQA 1OT5A 3DXUA 4KHPO 2D3OW 5FZKA 3WW1A 1H9WA 2P22C 3QNEA 4OVEA 3ZFFA 3RN4A 4LO7A 4G27B 2QJVA 4ZU4A 1PM7A 1Q8OA 2RJ2A 4Y20A 5AVPA 2F1MA 5E1RA 4LBOA 3G71V 3APBA 2VZ1A 3M1HA 1WP8A 2R30A 3VBRB 1R093 5J36A 3O1VA 4DUZO 1UZ0A 2ZDIC 1VIWB 1VAMA 3RWRD 3VDDB 1PK6A 1PO21 4QQLA 4QD2A 5B4XA 1T6GC 2XJVA 5ITZB 4AI2A 4RO2A 1ZM1A 2XLGA 3H3ZA 3T0AA 3NV1A 2W9XA 4JI5O 4OCTA 3MGUA 4YVSC 1Y74A 1BXHA 4M4RA 3M3QA 2B7YA 2QQLA 1LUVA 1TMF2 3Q8FA 1NLQA 5JI7A 1O7FA 3CBNA 3TJTA 1CPYA 2VQAA 5C6CA 3MIHA 2DYCA 1NR7A 2E53A 2CGOA 1R3KC 3M4FA 1S55A 3T09A 5FTTC 1KQSU 2GNDA 2JEXA 2J1TA 4O4JB 1VRBA 3ZMTA 3M70A 2UY9A 4O4IA 2DVDA 5C70A 1SLIA 2YU2A 4EN0A 5JMOA 4PDVA 1UY2A 3POSA 4N53C 1SKVA 1V9U1 4JAAA 5DG2A 1YO8A 1VQ4V 2G38A 1OJHA 3VZKA 4YVWB 1WA4A 1DLLA 1B04A 5KR7A 3CJIC 4AHWA 3VBRC 2UXXA 4ZI7A 2ZCWA 3G67A 1AR93 5L9VA 4MVZA 3JQWA 1F35A 2XDVA 2JEMA 5F5QA 3ZYFA 1MS9A 5CA0A 2RJLA 2LFSA 4ZS3A 3NAPB 2X29A 3OYWA 1SQQH 2YGLA 4LBQD 2ZR2A 5DECA 3AK2A 1ND3A 3P30A 2X6BA 5IYZA 5KHGA 3VL9A 4FOVA 4QGMA 2ETEA 2WC2A 3OW2U 1AL0G 2CGNA 3O7OA 1QVFU 5FPXA 3JU9A 1NYWA 5BNOA 3ZMZA 1GN2A 4ZIBA 1XYPA 1KP2A 1BHBA 1MEC3 3LKJA 5LL6Y 2QUOA 2GC1A 1SA0A 1S0IA 3FJSA 4COWA 2D6KA 1OV9A 4KWLA 2EX3A 3RWKX 4P00B 4PQQA 5FDBA 4B8EA 4WFGA 1FFTB 4KWUA 3VQYA 3R65A 4I4TA 2TNFA 3I8TA 1AXZA 4PA3A 1WCSA 5J2TB 2IXJA 1G9AA 2DBIA 2JWPA 1YJNV 1HB4A 1CN1A 4QIWF 2X0LA 1OA2A 3P32A 5A6ZA 3QD6A 1BBT3 3FYIB 1PO11 4LLOA 2ZKNA 5CFCA 1QQP3 4INDA 3TN93 2XKOA 5B1AC 1DFQA 3RYIB 1WW4A 2ZEZA 3AL6A 3IDBB 2ARAA 4AFMA 2YU1A 4ZS2A 3BPZA 3WQ0A 4PDLA 2XBO1 1WB7A 1JH5A 3Q8CA 2A0LA 3NAPA 1W99A 5EXOA 1NR1A 4UB8Z 3VKLA 1HIXA 4JI3O 4NWWA 3VDAA 3BY6A 1UY0A 1RM1B 4PDRA 4YZ4A 4O2AA 4DV6B 2XH6A 5B1OA 3A0RA 1B3QA 4GULA 1BQZA 4EJRA 1VF5B 2PHRA 3MV01 2B46X 4FTEA 2X5IB 5F9TA 2YXSA 4JKKA 1VQ7V 1CQ9A 2WO2A 2ZIOA 1XNTA 2VCMA 4QGLA 3RW0A 4YJ3B 2QTSA 2Q7HA 1FPN2 1RUE2 5A2QN 5CB7A 5GW7A 2ZE6A 1QJU1 5JJNB 3DXTA 4DR5B 4OULA 2RJKA 2Q67A 2HYXA 3RZMA 2JK5C 4X1YB 3AG3C 2HJIA 4AVCA 3WB0A 3QOPA 3PMEA 1W6MA 1UPGA 2PLV3 4LJHA 4WM8C 3ABMC 1U5XA 1JBCA 1IOAA 2Y34A 2WLIB 3OUIA 4H14A 3WFVA 4O7XA 1V54C 1E57A 5A33B 2RR12 1EAH1 2RS53 4X6QB 3HNYM 5FK8A 2XPJA 1OCZC 1GNHA 3CCMV 3ASNB 3ON7A 3CS5A 3C7EA 1DGRA 1O5LA 1BE3H 5FL7G 4NIGA 1JR9A 1UZZA 1POV1 3E89A 2I07B 2Y0IA 2CYFA 1TE1B 1PM4A 2VQ0A 2WZR3 3CJIB 4WF9V 4DUVA 3NNLA 2WNEA 4OUEA 3SYQA 2VWJA 2ZINA 1K5MB 3R4DB 3KSCA 4BMEA 2BGPA 3T4DA 5GTHZ 3RBZA 1YFYA 3IDAA 2V1DA 4CC6A 4XBNA 4NHKA 3ACIA 1VB4A 4LBQA 2E31A 4HYOA 2Z79A 1RGSA 5A3OA 2ARBA 1XSQA 4RQPC 1RUI2 1XE0A 4I3PA 3KMHA 4GWIA 2Y69C 2P67A 1DDLA 3DL3A 5BYNA 1O4TA 2CHHA 2CTPA 3MIGA 4HKWA 1VF6C 4JF3A 2A70A 2ZKLA 4Z1MG 3POIA 3WG7C 4E8DA 4KU7A 3UM7A 2WJSA 4R6ZA 3SITA 4Y20B 1RHI1 1GNZA 3N9MA 4LF4B 2EJ7A 5FY9A 4MS2A 1ZBE2 3C7FA 4IEVA 1TQ5A 2IJIA 1WW7A 4PQ9A 1C8M1 4CZSA 4Q8LA 1DYOA 2QQWA 1PNGA 2PQQA 1AYM3 3S5AA 1Z5WA 3MFAA 5L19A 4ICGA 1NTZH 2KG7B 3OUHA 5H9RA 5KHKA 4LFCO 2ZE7A 1WCUA 4WZFA 1WGPA 5T3NA 3DXRA 3J7LA 3T0BA 3W21A 4XIKA 3ITQA 4PLOA 1N32B 3ZSMA 3Q8EA 3VBUB 1E5IA 3N27A 1KYOF 3EYPA 2VJXA 1F4AA 3C3TA 1R73A 1RJ8A 1CIYA 3KKYA 1X4TA 1UU4A 1PIV2 2UUAB 5LK7B 4AI0A 4CP9B 4DQAA 1S5LZ 4TWKA 4B3MB 3JSLA 4S2FA 4P08A 3E8HA 3AXDA 2JDKA 1D4M1 5FLXN 4HONA 3I2KA 2DWRA 2RDCA 3H8XA 4YM3A 5ABJA 5CB4B 3U07A 3R4UA 2UXBB 1H1IA 5DPNA 3D8CA 5D8AA 5IJ0B 4DV1B 2D97A 5J9PC 3BCWA 1QU7A 1PKXA 2JKXA 2CAUA 4MZUA 4QM8A 3CC4V 5FZOB 1NCQA 1W03A 2CGPA 4M3CA 1RUJ2 2XVLA 1WLWA 4B3TB 1VQKV 2ITDC 3G6BA 2NLRA 2VOVA 2W87A 5LMNB 1P4RA 3S30A 3N3HA 1AXYA 4M3CF 4P9GA 4DV6O 1AL23 2MNGA 3D36A 2HWD2 3QO8A 3I3EA 2FDFA 4CS2A 5F5AA 1ZRCA 5KUMA 2ZHNA 1GAXA 2YUAA 4NXNO 2VTXA 4R9AA 3WF3A 4DINB 3SPGA 3J7HA 1M56B 1D2DA 3VDBA 3RNSA 2HWC2 1K4DC 3AMMA 1VMHA 4OMCA 5EJ3A 3ZN6A 4DUYO 1ZUQA 4EN8B 1JTZX 1O8SA 2PAMA 4HKOA 4LA2A 3K03A 4ZOLA 3WDTA 3JAWB 2HKOA 5L73A 4EZHA 4Q4Y2 4U3JB 4IW3A 3EBRA 2Z42A 4YW2A 1MA1A 5DAVA 2Q6AA 3WG3A 1ZTEA 3WW2A 4NMIA 3WF0A 3CMEV 5D2AA 5KXCA 3ASNC 3O14A 2IH1C 4IV3B 2VZSA 5CAZA 3U0ZA 4QU2A
chains in the Genus database with same CATH topology
3ME2A 1SLCA 2DTYA 5FBZA 1Y43B 4Q0SA 2JXAA 3ZPYA 1BEV1 3USSA 1JUIA 1XNCA 1DGWX 4BYYA 1HV0A 2XJRA 1K5MA 3E6BA 3OY8A 3MICA 4AHZA 4AF9A 2PAEA 4PLMA 1FT9A 5FLHA 4YYOA 2PLV1 3ZXDA 1S0CA 4LBLA 3C3VA 3JQXA 3N7JA 4XFFA 4QM9A 1OIHA 4COZA 4P9YA 1DZTA 2CL2A 4E9KA 1FPN1 4M2EA 1DQ1A 1GVGA 5AFBA 4QPIC 2JECA 2Z5WA 4E2GA 3AKRA 4WVZA 2D5FA 2MPFA 2O1QA 2D98A 2ZMLA 2RMU1 5C8CB 1EY2A 1PVC2 1PZ9A 1J3QA 1SCRA 2EXJA 3UKVA 1AR91 1J3PA 2BW8A 4ISRA 2QE3A 3JBG2 3JUUA 2P2KA 4QXKA 4GH4C 4RL7A 4J1XA 1N47A 3J8F1 3H3UA 1DZRA 3VBOC 1NE6A 5FAXA 1DQ2A 1J3RA 2E6VA 3MLJA 4A3XA 1Q5OA 1IS4A 5I8TA 4FQZA 2VW0A 4K7JA 1CPNA 3VZNA 1FNYA 3FHIB 4WVMA 2EXKA 4XJ8A 2VECA 2A3YA 3DPRA 5EYYA 1AXKA 4P9IA 4PIZA 4HK8A 1UCXA 3GHMA 1K5MC 1V6LA 2WNVB 4N7UA 2DVAA 3AKPA 3JBG3 3VDDC 3VHPA 1QWRA 3NJZA 1ZX5A 3LSDA 4LHLA 3VKMA 1FYUA 1LU2A 2HWE1 1W6PB 3O2GA 4FCAA 1UKRA 1XXNA 3ZSEA 1R1ZA 3LSEA 3LGRA 4CP2A 3JB4C 1GZ9A 5E88A 1RUC2 4XXAA 4OUMA 4Z07A 1ASJ2 1CONA 4PIXA 2F6BA 1HQNA 1ZBE3 4NHMA 3WCSA 3JBG1 1FAYA 2QFEA 2XKPA 3C2UA 1LESA 4GH4A 2VMGA 1GYKA 4I01A 4N43B 1Y9QA 2WS92 3WD5A 1H4GA 4RS5B 3SWTA 4NHLA 1DHKB 2PELA 2H0BA 5J48A 4L92A 4A7YA 5JLVA 4TLFA 1QMJA 1S2BA 1LCLA 2QZ2A 4ES9A 3AKTA 4KU8A 2Y26A 3G6JB 3AK0A 1C28A 4WBBA 1X82A 2P3JA 4CP0A 4QPYA 1YHFA 4I02A 4PIYA 4Q0QA 3G7DA 1GKBA 1UKGA 3UL2A 4Z92B 2GSYA 4PBOA 2WNVA 3RMYA 1CAWB 1POV0 5J98B 3RZZA 2RS11 4CWDA 4YVSA 1YRZA 2VMIA 5KXDA 3THPA 3POYA 1OFNA 1LOBA 3QLQA 4PBPA 5CFDA 3ZXAC 4CEWC 2PHTA 2XJSA 1D4M3 1CAUB 1JYIA 1NCRB 2EIGA 4XMAA 2IXLA 3MZHA 3AFGA 4ONUA 2ZGQA 1M06G 4AQTA 2ZGTA 4DXZA 5FMOL 3LCPA 1YJLA 2E9QA 4GIQA 1I1EA 1O91A 1A8DA 4B4RA 2ZMNA 4LO6B 1SFNA 4K20A 1LU1A 1OOPA 4GB33 3VL8A 1VB2A 3E6CC 1XYNA 2XWJB 1AR72 3UJOA 1BKZA 1O3RA 2JG8A 2K9ZA 3ZFFC 1BEV2 3CL1A 3QBQA 1C5HA 2O8OA 4DY5A 5AC93 1GZWA 1QJY3 1Y7BA 4N7IA 2R0FA 1TNFA 3BU7A 2NN8A 2HWC3 4M2CA 5FPZA 3PHMA 3SXWA 1H2MA 2BGCA 4AFCA 3M2MA 4CEYC 1QU0A 2O0OA 5JZGC 1AR62 2RS51 2RS31 5FO8B 1JR7A 1ZZ6A 4E4ZA 1O4ZA 2D6NA 1DQ0A 3MW4A 4YM0A 1JYCA 4SLIA 2D6PA 5H9PA 2VPVA 4M0HA 2OZJA 2P3KA 1RUC3 5LRRA 2BQPA 1NCRA 2WINB 1ASJ3 3E5XA 3LOIA 1WLDA 5DDJ1 1ND3C 1GZWB 2X8KA 2OIIA 4Y1UA 1IZ3A 5C33A 2DCJA 2YY1A 4RA0A 3ILNA 2GU9A 4FTBA 1OIJA 1QKQA 1YLLA 4FPGA 3B02A 3ZN6B 4M25A 5AC92 3KB5A 5AFEA 4XETA 1S1AA 3I59A 3ZFEA 1ENQA 2Q30A 4IV3A 4ZU7A 5C8CC 2XB6C 3J26N 3O5SA 4BZ4A 2OA2A 4X8NA 4YLZA 1NLRA 4HVRA 3DV8A 4FOWA