4JAAA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
328
Chain Sequence
b'ALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 102
structure length 328
sequence length 328
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4jaaA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jaaA01
5JWPA 2Y0IA 3P3NA 3KCYA 2WA4A 3OD4A 4AI8A 1H2MA 2W0XA 1MZEA 1MZFA 2WA3A 4QU2A 3D8CA 2XUMA 1YCIA 1IZ3A 2CGNA 3P3PA 2YDEA 3KCXA 1H2KA 4Z1VA 1H2LA 1H2NA 4BIOA 4JAAA 2YC0A 4B7EA 2ILMA 4Z2WA 4NR1A 4B7KA 2CGOA
chains in the Genus database with same CATH superfamily
3RYFA 1OQDA 3AMNA 3ZRWA 4U36A 2JG8C 2W08A 1SCRA 1WNSA 1XMOB 2UXNA 5KBFA 1DDLA 1ENRA 4YGDA 2L6LA 3V0BB 2WRAA 2GC2A 2VUCA 1TNRA 4YRDA 3J7HA 1URFA 4GULA 5A80A 2ADPA 3TWIA 3IJ4A 4ZU7A 4MUVA 1OZ0A 3JALB 2HEWF 3SH5A 2Y8KA 1HDJA 1K4DC 2Q67A 3NSTA 1WPBA 1V55C 1HKDA 3HNMA 4KWKA 5BXZA 2E26A 1K33A 3MDPA 1SQ4A 4GB33 1UMHA 1RUNA 4CDUC 4CCMA 2GP3A 3CMEV 2ZBJA 3O1MA 5I8SA 2HP8A 3QO5A 4LF6O 1J83A 3E1F1 1PVC3 3PDQA 2D43A 2ZKLA 1IOAA 3ZRSA 1LJ7A 4TXWA 2XBO2 2ZINA 3MFAA 3RZHA 2DBNA 2VUDA 5FTTC 4DW1A 1ODMA 3JBG1 1TGOA 3EJKA 5T5JA 3MLLA 1QLNA 2E7TA 4RR3A 5HV4A 3CC7V 1DGSA 4ICGA 4A7KA 5FYZA 3WF4A 1SQVH 5JCTA 1ZAUA 4Y1ZA 3VBSB 3L9JT 1LAJA 5LMNO 1CP9A 3USUB 3W7SA 5FPOA 4CH3A 4OMCA 2JB8A 1AVBA 1XNCA 2JG8B 2V72A 3WNXA 3EHBB 1LU2A 1GSLA 3TXSA 5CBFA 2JD4A 2VBDA 2LRPA 5CFDA 1BZKA 1O6UA 4I3PA 1M4WA 2VULA 3AZYA 4P9PA 3ETQA 3CMGA 3TN93 2EX3A 4MVQA 1RUC2 1C8M2 3FN9A 1R6TA 2XHNA 2V4VA 4D8MA 4NRQA 3NV4A 1OOPC 1HJFA 1IBKO 1DBNA 1UX6A 1RUC1 1C8M1 2HJDA 4BA6A 4CDUB 1D0HA 2OCCC 3PUIA 5L3CA 3SR2C 5KA5A 4LF6B 4UV8A 1UMZA 2B1IA 2YGLA 2XJRA 1JFFA 2OKXA 1V6JA 2YBSA 5FOBB 3NJZA 1SFYA 1FD9A 3T1CA 2EVXA 4R8HA 2VVDA 1T6GC 1LNSA 5FR3A 1RJ8A 4AE2A 1N4CA 2IW5A 2WLLB 4YYOA 4BMBA 1JJOA 3K59A 1MQTA 4PDLA 5T50A 2Y69C 1DQ5A 1NXMA 1VP6A 3GM8A 4BU2A 3K0DA 2DFCA 1VARA 5LMNB 3ZXDA 3IDAA 1KDKA 3E83A 1DGRN 3ZKYA 5I8TA 3NJYA 4ZIBA 4H14A 4FAHA 1M5IA 4Q0PA 5FZBA 1XEQA 4DQAA 1M93A 5FY5A 2JEUA 5H9QA 3AZWA 2ENRA 2CWSA 5ANQA 4HK8A 5JOXA 4YM0A 2ZGNA 1O3QA 4ZI7B 1IBKB 3ABTA 1VRH3 4FLWA 5FK8A 2YBPA 1JHNA 1OOPB 3J81N 1IBMO 1GKBA 4LWSA 1S5HC 5E6HA 4X8PA 1L7QA 4J25A 3U1XA 3HWJA 1XQNA 4BQ4A 2OCCB 4X1YA 1AR1B 2R1BA 3WHTA 4CUAA 2X09A 2PAMA 4MVUA 1EV11 3S3XA 5B66Z 3LSDA 2PHDA 2ADDA 4LBQB 1F23A 4FZ1A 3FB8C 2J1UA 5EJ1B 3N9OA 1D2DA 2Y69B 4RUFA 1YCIA 4ZOLB 2IXHA 2NLJC 1N33O 5B5EZ 1OSGA 1VE0A 2C1FA 5FJKA 3A22A 1ULGA 4F6RB 3WX5A 2D6KA 3DPRC 1OUSA 4IV1A 4QPGA 1C5IA 5FPUA 5I0DA 2PHTA 3T1MA 2ETNA 3X2QC 4PD4F 4B7EA 1N1TA 3G4SV 5LP6C 4XABA 3LOIA 3MIEA 4H55A 3WFVA 2R061 4KGQA 4X20A 1IBMB 5GZDA 3SMHA 3OD0A 3K48A 4AF9A 3CXHF 4YVWA 4L87A 1VIWB 3WW4A 3IFXA 3CSXA 2JGDB 4A2UA 3E5XA 5CVRA 3KV4A 1OH4A 5GM0A 4BH9A 3SC7X 4CDQA 3ZDVA 4CBCA 3FB5C 4GX2A 2RDCA 1UU5A 2HWB3 3J7MA 4GKYA 5FZCA 3IMNA 3RJ2X 1I3HA 5A32B 1W3VA 3ASNC 1CIYA 5J37A 1N33B 3VDCA 2BV4A 1Q8PA 4ATEA 3VBHC 2P5BA 4UVBA 1F4AA 2XVGA 2WR9A 5A7SA 4IL6Z 5E8AA 2QKCA 4ABMA 5J48A 2R30A 3OMNB 4WVVA 4RQFA 1MVEA 4HOOA 1BK0A 2RCVA 3DPRB 2GNDA 2WZR3 3QO7A 1KBHA 2Y6LA 1Q86W 4QWNA 3X2QB 4F83A 3QTCA 5LP6B 5FPLA 2Y0IA 3K46A 4LKSA 4NHMA 4X6QB 4GB31 2ZHLA 3AK2A 1SS3A 4GLXA 3I2IA 2KD7A 5FV3A 3WNOA 2WO1A 2W6IG 1QJY1 3CXCU 3NKTA 1JUIA 4GIQA 1PMIA 3HIFA 3BIEA 4AR2A 2QWPB 2VZVA 4OYUA 4PDWA 3R66A 2N7GA 1REFA 1IBLO 4HONA 1J3RA 2ZTNA 3OEHG 2A7AA 2FMLA 2Z3YA 1QLEC 1XQ8A 1NZ6A 1ASJ3 4DV7B 3AK1A 1XHXA 1QCEA 1OLME 2X6AA 1UY4A 2E6VA 5FK7A 4OHWA 2XONA 2IU3A 1LU1A 3ASNB 2IJJA 4MV2A 4Z07A 2QKAA 2BWAA 1FFXA 2CAZC 3ZN6A 3VBBA 3VBHB 1JZ8A 2CAVA 2ERFA 4QGPA 5A6XA 4ZZ8A 3Q8FA 3JASA 2DFBA 4Q5OA 4DR3O 3I2GA 2VNGA 4YJ2A 3QVNA 3MLKA 2VMHA 2P3KA 4M4RA 2FTKA 4XVHA 1ZBE3 3E6DA 4QXBA 2W46A 1OMIA 5FCCA 5LWBA 3DC5A 5A7PA 3B09A 1A34A 1JMUB 3A0HZ 3I59A 5FLJA 3J26N 1FYJA 1X50A 2A5ZA 1HQWA 2XQXA 1YF2A 3AP4A 4DY5A 3OR6C 1HX6A 2QQMA 3BOWA 4JVAA 1D0GA 4NHKA 1IBLB 3I56V 3W7XA 3VOUA 1Y9GA 2Q7EA 3WR0A 2TNFA 2A70A 1NJIW 1S0BA 3SITA 3RZMA 3G6JB 4FFKA 1OURA 1NLSA 1QLEB 3WQBA 4OHVA 2HFEC 2VMDA 1WCDJ 2D40A 3V0BA 3PTYA 4JQTA 1FMD3 1QVFU 1WLDA 1TMF3 3JALA 1K8AW 3DEMA 5JOWA 2QE7G 1VEWA 2IU0A 1N47A 2EF6A 5F6KA 3U75A 2WFPA 2WFF1 2MPFA 1MZ5A 2JDPA 3WW2A 4PQ9A 1PZ8A 4AHYA 5LGUA 2XLAA 3SXWA 2PQSA 1GMMA 2YXHA 3J7NA 1ZVFA 2IVIB 4RQEA 1AYM2 4HVOA 3STZC 1QBZA 3ZS8C 2YHJA 4FLZA 2XXZA 2ZHNA 5J3UA 5CG8A 4O4HB 4MSVA 3M99B 4Q4Y2 5GZGA 5BY1A 1N0NA 4IYIA 2LP7A 4JYAO 2VZQA 4Q4Y1 1M56C 3WB1A 3CCLV 3QF7A 1G4YB 1IS4A 3PUSA 4XDPA 4HVRA 3VBSA 1K5QA 1FX5A 4IDZA 1D4M3 3AG1C 1B6QA 2NN4A 2JG8A 2EIKC 2UUAO 1QQP3 3INAA 4JGZC 4OPHA 3I2DA 4E2LA 1XL4A 5CKNA 5CAZA 3C2UA 3G7DA 4DO2A 1R093 4XJZA 4GT1A 4FIPC 2PA7A 3GZTB 3QCWA 1V6KA 2V7QG 5JPNB 4I2OA 3VBFC 2BVVA 2FCTA 3HBZA 2O1QA 5C5TA 4CDUA 5KA6A 2SBAA 3E2EA 2GTSA 1CN1A 1KYOF 3K2OA 1YJ9V 4CP9B 5DEDA 3PUQA 3ECQA 3BVCA 1IPJA 1O59A 2ZMLA 1M06G 1FOD2 5FUIA 4DNYA 5B1OA 2GDFA 3D5OA 1EY2A 4FLXA 4PI0A 3MUY1 4JYAB 5L9BA 2JGUA 2WLLA 1FOD1 1H30A 4YFWA 1GZCA 5T5OA 1K5JA 2OYZA 1M56B 3ETDA 3H1MA 1PM4A 3BEHA 3O14A 4D6TH 1BBT3 3O1PA 1R6NA 5FYBA 2XTAA 1XDCA 1NTKH 2YC4A 3QH7A 2UUAB 2I74A 4GZ9A 5CBLA 5HI0A 4FP3A 3NL1A 5KAIZ 4AFAA 3E5UA 2J1TA 3DXTA 4DR2O 4EFEA 4FXKB 4GWJA 2Q1ZB 4FTSA 2NM1A 4UFZA 1DK1A 1BK1A 4HKWA 3VN4A 1QHTA 3RN4A 3NAPC 5IYDO 4ZI7A 3O1SA 4JKLA 3AEIA 4DR6O 1AL23 4UFJA 2GN7A 1OOPA 4MGKE 3ZSLA 1H2GA 2WZR1 1SBDA 3LPGA 1ENVA 1PO13 2C0ZA 5F2SA 4GWIA 1R1ZA 4XMIA 2C6SA 4XDQA 3HNBM 4QT6A 5C3SA 1BMV2 3U07A 4B3NA 2QCSB 4LLFA 4LBQA 1SLTA 2GDSA 1BMV1 4LF8O 1N34O 5H9CA 4JPRA 2FHRA 1JH5A 4LF9B 5DAQA 4LQRA 2Q6AA 4CEWC 4Q0SA 2ARAA 4QGNA 5H5NA 4ZOLA 1K9MW 4ZONA 3QD6A 4I5SA 4X62O 5D21A 2ZNIA 2WWWA 1ASJ1 1E5IA 4CZZA 1FAFA 4F6RA 3CMAV 1K42A 3L2HA 3L72H 4DR2B 4LBKA 4XW3A 3R0RA 3GBWA 4DUVA 3OMAB 3FX3A 1W9SA 1V6IA 4J7JA 2DUQA 1VMGA 4HMZA 4P9IA 4DR6B 3IAQA 3NAPB 2GTAA 4ZBMA 5B3SC 4LFAB 3UO3A 1PMJX 2JGDA 1H0BA 3GNEA 2DMXA 1WD3A 2X8KA 1VBC3 1XU2A 1ZBE1 4U7OA 4D6RA 1HXS3 1Q6HA 1ST8A 4XFBA 1RPOA 1BXHA 5A3OA 3ICXA 1C4RA 4LF8B 1N34B 2XG3A 2W6JG 3POYA 2CHHA 4QHZA 2PN5A 3E8FA 5LK7B 1ENXA 3A0RA 2VG9A 2C9AA 4BB3A 4TN7A 1XE8A 2DVBA 3AB0A 1WWYA 5A32A 3OBTA 2NPIA 4CCCA 4CEWB 5FIXA 2AW9A 2LROA 2K9PA 4X62B 1W8TA 1SLLA 2KSDA 5DPNA 4ES9A 4P02B 1W6PB 4GX0A 4ONUA 4LULA 2ATFA 3DPRA 1W0OA 3OUJA 1BMFG 1FI2A 4OPAA 4PF1A 2W91A 3SEEA 3VZJA 3JD71 3VQYA 1V70A 5EIBC 5LP6A 1O3RA 5JXIA 4YXWG 1QNMA 3AK0A 3R6SA 4TSVA 1CZTA 3VBUC 3NNGA 5HFMA 2CV6A 1YTFB 5B3SB 1JA8A 1RUJ2 3GHMA 5DG1A 1HWYA 5A3TA 5CEHA 2GSYA 3GYDA 4ES8A 5L7OB 4S2DA 3BVOA 4QB1A 3BPSA 3I54A 1PD3A 3BYWA 2RS53 5FNVB 5KXCA 4CCOA 3PJSK 1QEXA 1JZ6A 3CWBH 4FXGB 5A1FA 2OZJA 3ZXKA 2H3OA 3AX4A 2HBUA 4HLTA 3UT5B 1DP0A 5L9RA 3DF0A 4YGEA 2RS13 4YZ2A 4ZKIA 2HEPA 3VBHA 3JD3A 2OTLV 1RHI2 2QWOB 3H3LA 1AJNA 5H9SA 4H13B 5F9TA 3AL6A 2XKOA 2OA2A 3ON7A 1IDSA 3WP4A 4C8DA 2FZ1A 2WSUA 4P5HA 3FYEB 1XBLA 3ZIWA 3I7DA 4Q2FA 4R9BA 2VZRA 1HN1A 1YXWA 3WP3A 4AQ6A 3JB4C 4Y5SA 3AG4B 2PLV3 1W06A 1BCXA 3USSA 3VBUB 2QQOA 1VQPV 5FZ0A 3SEPA 1U5XA 3H9AA 2XQRA 3GBGA 4ZS3A 3G80A 4FQZA 3RJRA 4AILC 2EIMC 4R9DA 3NJXA 5LBEA 3THTA 1LGBA 2HWF3 5L3GA 2QM4A 4IT5A 1BEV2 4M00A 1VMHA 3QBQA 4WCEV 1SFNA 2JKXA 4TLFA 3VQXA 5F7UA 3HKEB 1AXKA 1UQXA 5JMCA 5CN0A 4E8DA 2SLIA 4HN0A 2ZA9A 5AC91 3Q8EA 4DO0A 3ZLIA 5J2UB 1AX0A 2QKDA 3WOGA 3BFRA 2ZGPA 1FYUA 1UYXA 3M4FA 2BOJA 5FUPA 3VZOA 3ACHA 3KQRA 1XREA 4LMFA 4Y1VA 2GH2A 4QPYA 1SFPA 4UBGA 5K7PA 5FXXA 1CR7A 3UJOA 1LNQA 3I3BA 4COVA 2DU1A 1SBEA 4O4HA 1CPNA 3LPFA 4FTEA 1OC1A 2EBOA 3UL2A 2Q69A 4L97A 1U5IA 5DECA 1AXZA 2E5LO 5FMCA 1FJGB 1NY71 4EJRA 1PO22 3H9VA 1UY2A 1U5ZA 2ILMA 4WV8A 4E4SA 2LJ2A 1OHHG 3E22B 4CS3A 3U4SA 1S0GA 1KS4A 2YFUA 3U37A 4W4ZA 5K0UB 1UXXX 4XILA 4YNIA 3K5OA 4LH7A 2EIMB 1G7YA 1PIV3 3LB9A 4L0PA 3HMYA 1ORQC 2DU0A 1YRZA 4Q8LA 2PYJA 5JZGC 1GAXA 2D98A 3WDWA 1NVPD 1OA3A 2ZZJA 4BXSV 2OPKA 4JI1O 2VMIA 1EN6A 1ZBA3 4LUKA 2QQUA 2ZZQA 4RUEA 4FI9A 4F4LA 3D36C 5JAXA 2Z69A 2IXIA 4GCZA 3JZVA 2EIGA 4C1XA 5I0RA 3BCCH 1GQGA 3VHOA 4CP9A 2Z4FA 1K3EA 5FZEA 4J9ZB 2WN3A 1O8SA 4ASKA 1C57A 1H2LA 5L3DA 2OVUA 4LF7B 4CUCA 2UUCO 2VBBA 4CU9A 1LR1A 2E5LB 3T08A 2LFSA 3I2OA 1GZTA 2F95B 5JI7A 4LXLA 4I4TB 1H6YA 2D93A 1QR8A 5IT9N 4DXSA 1HXS1 5AVPA 4K8ZA 5F5IA 2YIAA 2DUPA 1US6A 3ZSEA 2BERA 2VW0A 3JQWA 4Q29A 1FS0G 4F3JA 3H1IH 5FQ0B 5HCAA 4UF0B 3WF3A 3CYOA 2WNVC 1E1QG 1PNMA 2E74B 2G38A 3NQHA 1XMQO 2B45X 3ZYRA 4N43C 3HT1A 1AXYA 4IL7A 5EYPB 3HEIA 3FL7A 1LULA 1BCCH 4EB6B 3IPVB 2DWEC 2EXJA 2VZPA 2DVFA 1NUKA 3NV3A 4BIZA 2R1DA 4K8RB 3VHRA 2B39A 4A41A 4BLIA 3S7IA 1IS6A 4XFHA 2D3OW 3LAGA 2A6VA 2Y38A 2UUCB 4N53C 2EZPA 1Y66A 4JCKA 4QB6A 4Q20A 5M0TA 4FLUA 4H44B 4BWAA 2QTSA 3S3WA 4LBOA 4O65A 4DINB 4IE6A 1RMU3 2W0FC 4FOVA 1PNFA 2NR5A 4J7ZA 4LCUC 3PHMA 4H33A 4EQVA 2B9UA 1AB3A 3F5WC 1F4NA 3CL1A 4DV3O 2GP5A 1HB2A 4JZRA 4Q4W2 2OCHA 3KVBA 5GONB 1FXKC 4UCVA 2DOSA 1OV9A 1LOCA 4CXXA 3N9QA 1JZ5A 1Z0HA 4IEXA 1HNXO 5LHHA 1XMQB 4ASLA 1R73A 2WNVB 3H3UA 4ZU5A 4EWDA 4ATFA 4R9AA 5LBQA 1MA1A 3WINE 3AMPA 4HZFA 4N43B 2GN3A 4BZ4A 3FUQA 4JRLA 3SJBC 3NAPA 3OGRA 2UYBA 3CRAA 4HXCA 5BMVB 3CQOA 2PQQA 4NIGA 2DQ3A 2ZGSA 4GWNA 5KLVH 1DCSA 4Q1RA 4LFBB 1POV1 4MVRA 3PURA 2P22C 4N53B 4DUXA 3OUHA 2WT2A 3ZOIA 3PL0A 1UWWA 3ILFA 1HW7A 3J8F3 3N7KA 5D5PA 5EBMC 1GRJA 1ULDA 1M90W 4C90A 1Z2GA 4DV3B 3AZXA 1G9FA 4OHYA 3ZYGA 4CEWA 3G71V 4UFHA 5FP7A 1BL8A 3FX7A 1W6PA 3URFA 1URXA 1NKGA 1WCSA 1HNXB 3TBDA 1FXKB 1TEIA 3LIHA 2WBKA 1Q6IA 5EXOA 3OF1A 4H37A 1PP9H 4LO5B 5L19A 4Q4V3 1W28A 1K12A 4BDVB 2O8OA 1MZEA 4MXWB 2GSMB 4IE4A 3ETGA 1FT9A 1Y67A 3TN92 2QJ1A 3SH4A 1MS1A 5L3FA 1I5YA 2UWAA 2DVGA 1UYYA 5FFOC 3BUCA 2GUZB 3ZIAG 4ASUG 1YQ2A 5L7OA 4JI6O 1ULOA 3D6EA 5LB6A 2DF7A 3KGLA 4EZ4A 5FNVA 1OF4A 3POSA 4OX9B 1XBFA 2YGMA 3VZLA 2YPDA 3GHNA 4D6QA 1REDA 2LGQA 4M3CB 2NP0A 4LKFA 4O4LB 4HETA 5E88A 4UVCA 3UT5A 2X29A 3WHUA 1IPSA 5JOZA 1DQ0A 3OBAA 3K3OA 3OGGA 5FMBA 2BQPA 1Z78A 5IYYA 4MX3A 3T1HO 3FC0A 3ZIXA 1YC61 4LUMA 4NB5A 4UFKA 1E79G 1O7FA 4XJUA 4TQDA 5A7WB 4YGCA 3ZXJA 1GWMA 3OEEG 3ZSMA 1RUF2 5SV5A 1VQOV 5JJEB 3DXRB 3AP5A 4FTBA 2UYAA 3C7OA 1RUF1 4MYEA 1OQ1A 1QJZA 2A6WA 4E2GA 4DUZO 1VRH2 4WZCA 3K9SA 3VBUA 3P5BA 5CA6A 2LUWA 2A3YA 3G6BA 2GBOA 4XQ4A 4JI6B 4XUPA 5ACA2 5H6QA 2VJXA 1GTOA 1CIWA 4HBNA 4LR4A 2IH1C 5ACA1 2CU5A 1OLRA 5FMOS 3LD8A 4CEYC 3C3VA 3CCJV 2FMDA 3HKEA 3S57A 2A6XA 1V9U3 1YEWA 2J1RA 2VQUA 4HKOA 4QPKA 2E63A 2ZGMA 5J2UA 1OVSA 5C9AC 4ZY9A 4X64O 3T1HB 1HV1A 4JI0B 2Y0PA 2LW7A 5EC2C 1KFXL 1HP8A 1LHUA 3K0GA 3WY6A 4QPWA 3CPWU 2WS93 1HR0O 1WMFA 4OQ9A 3R4SA 3HKBB 5E1AC 1GBGA 4BK5A 2R49A 1O9HA 3RW0A 3IBMA 3CD6V 5ANNA 1AVMA 2RG4A 4Q8KA 3O5SA 4DUZB 4JV4A 2PTMA 2WLQA 1NI8A 4AZZA 3NNJA 4GX1A 4W6XA 2RDSA 5F3GA 3BODA 2GALA 2ID4A 3E22A 3KCXA 2XUEA 3HKDB 1R3LC 2LO1A 5K0UA 1C1LA 2DTWA 2AZ5A 3EHKA 1GYKA 2ZJCA 4QX0A 3BABA 3NNFA 3E8GA 2D3SA 4E9KA 4CEYB 3FMGA 4CP2A 2HKXA 3SKJE 1S4CA 2HWB2 4AEDC 4N7UA 3BTYA 3WF1A 4DEVA 2R6QA 4X64B 3MGUA 3ZFFC 1A6CA 2P06A 2D5HA 2LW1A 1W0JG 2EILC 4AI3A 4AGVA 1F31A 1AR72 1EUUA 5C9AB 2ADEA 2NMNA 5DUVA 5IYBO 4B4RA 2JDIG 1MMMA 2ZEXA 3CIHA 1VBE3 1S0VA 1HR0B 5DQ0A 4C91A 1PL0A 4NIDA 1G6UA 4MXVA 2JS3A 4UW4A 3F2ZA 2XH6A 1YJKA 4NRMA 1U5YA 2CGNA 4U7NA 4OHXA 1X9TA 4Y1XA 2BYVE 4I4TA 1P7BA 2P4KA 3IAYA 1WLEA 3SHRA 2P3IA 1Z7S2 4YVSC 2ET1A 4KH9A 3K4DA 5A1AA 3ZVXA 2FZ2A 1Z7S1 2BW8A 5I0SA 4OI0A 2CGOA 2W0XA 1FPN1 1V6MA 5FQ0A 3POEA 4XYXA 4UF0A 4IIJA 2IH3C 1SMVA 1DZQA 5A3LA 2UURA 1KC8W 4JYYA 5D5QA 3ZCCA 2PF4E 4AEDB 2KB1A 4PELA 4KHPB 1IQDC 1OBNA 1COV1 4JTAB 1TVKB 4BLJA 5A3NA 5FZ4A 3ZFFB 5EYPA 2EILB 5ABJC 2GMMA 1BS3A 4EB6A 1UMIA 3IPVA 3KWVA 2H6BA 5KHJA 4X8NA 1K5MC 3D36A 2JG9B 3BALA 1EAH3 1W2BU 2JXAA 2OQ6A 3IGAC 3ZMOA 2VCMA 3RGBA 3PTRB 1XNAA 3ACGA 4MGTA 1RPRA 2BFUL 4FM1A 2R073 2ODMA 1CZVA 1W2NA 3CS5A 3W21A 4W65A 1RUI3 3LIGA 4TSFG 3ZPOA 2ZHKA 3MW4A 4OLLA 4QKFA 4LO6B 4DXWA 5B1AC 1TUEB 1JZ3A 4FPLA 1FNZA 4YIPA 4ZXKA 1U12A 2R043 5EPAA 4XFFA 2VTXJ 3WV6A 4YVSB 4RN5A 5LBCA 1YQ8A 3UM7A 4MW3A 2MEV3 1JOBA 1RTVA 1MEC2 2Q7HA 1JOYA 4JHTA 2EIJC 5GONA 1H1MA 4B3SB 4W8JA 1QHDA 2Z79A 2WLHA 2ZOEB 1P49A 1MEC1 3ZSJA 5KC5A 1HRV3 2WNVA 3V64A 5DUUA 3SPCA 2OXBA 2ZGTA 4GD4A 2EAAA 1CX4A 4N43A 3FUOA 3SGIA 1G1XB 4GQ7A 2OQ7A 3OGSA 5FWJA 2WA4A 3ZFGC 1G8WA 3H7YA 3ZMNA 3GZUC 5BMVA 1EM1A 4Y20B 4N90A 3RVZA 1K5MB 3ABLC 3ZBHA 2CNAA 4XDJA 2QWRB 2EA7A 4FO9A 4I0AA 2Y6HA 3JUUA 2E33A 3VD5A 2GMEA 1WCUA 2P37A 4N53A 3ZN1A 2YI8A 5LEKA 1YQCA 3CZJA 2WLPA 4KL1A 1OF3A 2HYXA 3JAWB 3RDIA 2PHFA 1I5XA 2W1WA 1VBD2 2VM9A 3P3NA 2Q8CA 2X0LA 1VMFA 1WW4A 2JENA 4LNVA 2JJ6A 2V1DA 1UZVA 2IVJA 1VBD1 1VMJA 1UX7A 1SC5B 4N9HA 4PIYA 4LK6A 4O4IB 1GK9A 1MOFA 1RJ7A 1MZ6A 1FXKA 2NNUA 1H9PA 3QACA 4QB2A 3AMHA 4S2FA 2RS31 2AHYA 4Z1MG 2W47A 1WLCA 3JSNA 2PELA 1WW6A 4MTXA 4BIFA 4PIXA 1QQP2 1V9U1 5CNAA 4GYCB 4FPOB 2F1MA 3SYPA 4MXWA 1YUDA 1R092 1BQ0A 1WD4A 2A3XA 4KFMA 2Y26A 4W6WA 4XDLA 1HDKA 2JDYA 3KS7A 4GKXA 5A7QA 1QGLA 2AENA 4E4ZA 3V0AB 2RHPA 1RUG3 4QKDA 2DUOA 2GUZA 2TEPA 1J3PA 1KMIZ 3VV1A 5IAVA 1I0HA 4DUYO 3C7EA 2B46X 3SPIA 3KT4A 5BPXA 4XCAA 1AJPA 1YJNV 1O3TA 3ZMTA 4BIOA 1DG6A 4LK7A 4RGKA 4NWWA 3WNNA 3BHPA 1CAUA 2A7WA 1ZLZA 3I8TA 4QGMA 1PGW2 4M3CA 4O4LA 1ZL8B 4OQ8A 1W6NB 3ASOC 1YFXA 1K5SA 4J1WA 4KMQA 4IEZA 2JEXA 4FCAA 5LA6B 4XF9A 1DGRA 4GUNA 3EB7A 1PGW1 4AHWA 3CCSV 4QKNA 1NQDA 3S5QA 4YZ5A 3AYEA 4XZPA 3L75H 3ENRA 4O9GA 3POWA 3H8XA 4ZU4A 1ZYBA 3B8MA 4BK4A 5CMUA 5IVFA 5A7WA 2YZ4A 4C0HA 1UOBA 3VD9A 3ABKB 5FZ7A 1DLBA 5F8PA 3ZPYA 3DXRA 5LHIA 5J09A 2UY8A 4FFHA 4FLVA 3SDLA 3OTOO 1WMXA 1F9KA 3ZMUA 3D8CA 1AR82 3UGHA 2P1BA 3DXUA 1G86A 1QJX3 1S55A 1UYZA 1H8HG 1R1BA 5IHRA 3WNPA 1JU4A 1GUIA 4DUYB 1NYWA 1PGL2 2QDOA 1DQ6A 3OM3B 2A1XA 2YI9A 4UW3A 3MAQA 5F3EA 1PGL1 5FP9A 3M3CA 1UN1A 1N3OA 3AXDA 1C8NA 1H6XA 3KV9A 4FP2A 5EWSA 4WVZA 3ASOB 2QTOA 3VB9A 4FQ4A 3THDA 3IIIA 1TQ5A 2R70A 2JE7A 3DKWA 2G19A 2OIGA 1HNWO 4L92A 2W3JA 2FDJA 5LASA 1GN3A 4JQRA 2YV8A 5CU1A 4LE3A 3MIFA 2VMCA 4GKKO 3OUSA 2JIJA 3D0SA 4NHLA 5FLHA 4AI9A 3HKBA 3RZLA 3SCGA 1ULFA 4FT8A 4B7KA 1H4GA 2JDMA 5LA0A 3OTOB 2C24A 2B9ZA 4CCDA 3TEYA 1YIJV 4QU2A 4BYYA 3EXUA 5K1XA 2RVAA 1O4ZA 2C9KA 3VKOA 2YPJA 2C2AA 1Z5VA 2VQTA 2EJ7A 4P9JA 4CXYA 1Q90D 1IGOA 1W2TA 4UB6Z 2IXLA 4CCJA 3JBG3 1W8WA 1VBC2 3CX5F 2R071 1TZOA 2ZR3A 5DABA 5DUWA 3N9MA 3LSUA 2A79B 2YB7A 4G27B 3DECA 5FP8A 2RE9A 4CEYA 5JOYA 1VLNA 3U10A 3ABUA 5ITZB 1VBB1 3FHAA 4QJFB 2OYQA 2ZEZA 4NIAA 1HNWB 4X66O 5C9AA 4XUTA 3HKCB 4AL9A 3P30A 4GKKB 2P7TC 4Y33A 2RDNA 5IUQA 1NVPB 1OD5A 1XU1A 1N0JA 4UXAA 3H0OA 4RQPC 3AJYA 3ITQA 3T2TA 4K0KB 4IV1B 5E16A 3AFGA 2MK3A 1RUC3 1K97A 1C8M3 2VZSA 2A9HA 3I4IA 2XOKG 2BCCH 3WZ1A 3LUTB 5KMGB 3RWNA 4MZUA 5FOJB 2GNTA 1AP5A 1O5LA 2HJFC 1D7PM 4X20B 4OZXA 2JX9A 1H2KA 1ZRCA 2WC2A 3N4MA 2BSKA 1VR3A 3T4HB 2F4VO 3K57A 1UU4A 2WLNA 4JI2O 1NA1C 2B4KA 1HRI1 2WAOA 1LOFC 3AG7A 2OW4A 4AEDA 3POIA 1RL3A 1WW7A 4PLMA 1LOBA 4X66B 5F32A 1TVKA 5DXDA 5A33B 3GALA 3ZFFA 4CC5A 2YS8A 1IPKA 4G28B 4JTDB 5JIAA 5IJ9B 1Y6XA 1WA6X 1QJU2 1J58A 3CDZB 2JG9A 3ROUA 1UF2C 2H0BA 2O57A 3ASIA 2RR12 5DM6V 1SQQH 2WO2A 1QJU1 1YFYA 4RQPB 5EYYA 2YMZA 3AKRA 5HFLA 2ATKC 2RR11 2A06H 1XNBA 2QM7A 1HQNA 1MABG 5GLWA 4LH6A 1UYPA 3CRQA 4GZRB 2PAEA 3ST7A 1E1RG 1EV13 5C3QA 2F4VB 2PLV2 1SQPH 4JZ2A 2ZE5A 1OQEA 3RQ0A 2EIEA 2WYSA 4UCRA 4NROA 3VHNA 3IC7A 5EQUA 2BBVA 5L36A 3LDRA 4ARXA 1OKQA 4YVSA 2KA3A 4L99A 1BQZA 3IZOA 3LSEA 4D0QA 3MIBA 3J80N 2CDPA 4FOQA 1NA1B 4LA3A 5F3CA 2PXJA 2WLIB 1DF5A 1Q8VA 1EN5A 4ITCA 4WM7C 3WUDA 3FLPA 4BW5A 3HAGA 1XL6A 1YIPA 4GMP3 1JXNA 2DBIA 5BNNC 1M57C 4DS0A 2UU8A 1O8PA 5IY5C 2X53S 4GMP0 4AI2A 4Y20A 2R063 4GKJO 1K5MA 1R3IC 3F95A 2ZX3A 4CDWC 1OH3A 5GJ6A 1NZCA 4A5UB 4TT3G 3WG3A 3N2GB 3OT7A 4QQ2A 2RMKB 3B69A 1I1EA 1LHOA 3JAWA 3EMRA 5EYXA 1QWRA 3WG4A 5BYNA 3R4DB 1F8VA 3GCWA 1MPXA 4UAPA 4AQ2A 3ACFA 4BMEA 2D6PA 3KD4A 1TUBB 1N1SA 3GBFA 2Y6KA 5FY9A 4O4IA 3ZN5A 1VRBA 2JDNA 4A6SA 4BM8A 1IS3A 1E5RA 5BR8O 5FAXA 3KHBA 3FAVA 2WDBA 4F8AA 1R64A 4YW4A 2HWE2 1PIV2 3ZX6A 2UXXA 4LR3A 3SYCA 3THCA 4XTMA 3W7TA 1ZRDA 2ZEWA 3CHXA 2AGSA 1AR91 1AR62 3QH6A 1QXRA 2HWE1 2J1AA 1YITV 3GCXA 2KG7B 2R7EB 4HPKB 3SJQC 4RAIA 2WO7A 4GKJB 1M57B 3T2QA 5IY5B 1I6XA 2UXCB 1IVSA 1BQPA 2JRIA 5LHGA 2Q68A 4MTOA 1E5SA 5LA9A 3BA9A 3ZSKA 2Y64A 3V0AA 1WLWA 1KGYA 4DOUA 5IVJA 1QJY3 2P5OA 4HKLA 5LYJB 3FLTA 5A3PA 1JYXA 1S5JA 2KKWA 3QG5A 3O7OA 2W2IA 4NWVA 1OA4A 1RYYA 3RZKA 5C3OA 1I5ZA 1OJHA 3LNNA 3N9NA 4OHZA 5EBWC 1BYHA 1ZL8A 1W6NA 4AGGA 1KP3A 4MHUA 1KD7A 5LA6A 2XBO1 1Q8OA 4H7MA 3N27A 5SV8A 1LCLA 1B3QA 2HHHO 4HANA 5BR8B 3RBZA 2RM22 3A0KA 3VDBA 1PKXA 1FXVA 2ZMNA 1AJKA 5CB7A 1K7DA 4IHJB 4B1LA 2RM21 2E53A 3QNEA 4DZGA 3WP5A 5LY1A 3PVBB 3EXAA 4WVMB 1DGWA 4KU8A 4WFHA 3RG0A 2FDIA 4NRPA 2E76B 1N3QA 3R4UA 5KXBA 2A6YA 1V55B 4RO2A 3PUHA 2YXLA 2WKKA 1YI7A 1FATA 2VU9A 2VNOA 4A44A 4WFFA 1ACCA 5ISLA 1AX2A 2XMLA 3IC9A 3NW4A 1O5UA 3JQXA 4LBLA 2WA3A 4DPNA 1N1VA 4D7SA 2GNMA 3LWCA 4WFEA 1TE1B 1CONA 1G8MA 1UD1A 2H0VA 1RUE2 3JAMN 1AR4A 2FBEA 4HSLA 1WUVA 4OUSA 3STLC 3ABMC 5DDJ2 3IDBB 2QZ2A 2YIBD 3NNMA 2P3YA 1VPHA 3MIGA 2HWD2 3OY8B 1NZIA 1GN6A 4J41A 5DDJ1 1UY3A 2QQLA 2WFF3 5KHIA 1QKQA 2HWD1 4NTXA 3L74H 1X8EA 2W1QA 1J1LA 3VZMA 1D2SA 3FWEA 5A7OA 4IE5A 4Y5Z0 5CKQA 3PMEA 4ZXEA 4AWDA 1F5JA 3WW3A 3BTXA 1L7RA 2D2CB 1AYM3 1Y4WA 4I30A 2Q0AA 4KBZA 4UI9L 3CB2A 4MADA 1OT5A 1RVF2 2XB6C 1NQJA 2DYRC 2J22A 4YGBA 4WVWA 1SESA 5IVBA 4CTEA 1NBMG 3J7LA 1H8TC 4Q4Y3 1KFUL 4MVSA 3BU7A 1H8EG 3HB3B 1SACA 3AZVA 5LRRA 4M0HA 5K9YA 4IV3C 1GZWB 1WBFA 2AREA 5TSWA 2JVDA 5F3IA 4BW9A 2WSVA 2YU1A 4R6ZA 3E5QA 2ZCEA 5ITZA 1FV3A 3K77A 3ZRVA 4LO8A 3GWKC 4PCRA 1W9TA 2GAUA 4BQ2A 3HKCA 3ABMB 4UVAA 1H2SB 3EFFK 4IGPA 2XR4A 1W6OB 1S5LZ 4IEOA 2BPA2 3GXUA 2ZMKA 3E86A 1DF4A 4Z82A 4NPMA 5LK5A 4R8CA 2VZUA 5KHGA 2VQEO 2RMU2 2YUAA 3RYRA 5J98B 4GMP1 4Q4V2 1CAXB 4CP1A 2G9FA 3B3QE 2ZEYA 5T3NA 4QQOA 5KMGA 4M01A 3AVRA 2AZ0A 5JPMB 2QQJA 1UOGA 3PNAA 2LM3A 1YIFA 4FM2A 2ES3A 3HQUA 2PY5A 1X33A 4CS4A 2DCJA 1XSRA 4QX2A 2BDRA 5BXXA 2DQ0A 1FOD3 3CU7A 1LOGA 4DV5O 4LORA 4NO4A 5FBJA 2ZS6B 4DEQA 1H8TB 4LF5O 2A3WA 2VW1A 4LTAA 3D82A 4IE7A 4OVEA 1J84A 2NZ9A 3OPTA 5I0UA 4IV3B 4TV8B 1XXNA 4B1MA 3JAKB 3PVEA 3S0MA 2QTWB 2VQ0A 4Q4X2 5LBFA 3HPNA 4O2AB 1SZTA 1DQ4A 2XASA 1JQ0A 4B08A 2VZ3A 5A33A 4Q4X1 1HB1A 2QNKA 1SDWA 1XOUA 1UZWA 1ZA7A 5IJ9A 2Y48A 3LSSA 4CUGA 3KHCA 2DCYA 4NPLA 2IFRA 2JDZA 3K51A 3K5MA 2Z0AA 2VQEB 3BIWE 3MO4A 1GOFA 5EHDA 4RQPA 4AXOA 2KM2A 1ZRFA 5C93A 5DN2A 2V5YA 3HQRA 4NMIA 4XJWA 2NQYA 4JDMA 3MI8A 4QQLA 3B93A 3JU9A 1HNZO 2BUKA 1ZTEA 1UPSA 3A23A 4FMTA 5CFCC 4AVBA 4ISRA 2CTWA 2XJQA 1VBA2 2W9XA 4DV5B 4JC1A 2OTJV 2CE4A 3M70A 3U14A 1QOOA 1CPYA 4XUOA 3LGRA 3H50A 4LF5B 3UNPA 4YIOA 4CS2A 5L3EA 1DQ1A 1GN2A 3T3YA 4O61A 4M0NA 1H1IA 1AYN2 5IATA 1B06A 1YHFA 2BFUS 3OMIB 1NA1A 1S0FA 4RR3C 4B3MO 1LOFA 2WLIA 4MGYE 4CH4A 1U0AA 3AYDA 2BTQB 4UWDA 4V1PA 3AKQA 4YLZA 3I55V 1WLTA 3LDKA 1S3JA 1F51A 1R1A2 1UW8A 4AI0A 2BVBA 1ZZCA 5A6ZA 2JIZG 1KJRA 3POJA 1UZZA 1R1A1 5DAVA 3AMQA 1W0PA 2QUOA 4XUQA 1S72V 1Y4MA 3LDCA 1RFYA 1VAKA 5FYIA 4NKGB 1OKOA 2Q5TA 4MTFA 5J96B 1RINA 2YU2A 4INDA 3T09A 1ZZ6A 4XACA 1Q8IA 3N2GA 4IXLA 4PA7A 2FMYA 2W5FA 1PGSA 1X59A 4RHV2 1HNZB 1H38A 3DKQA 1F5FA 1TME2 5FMOL 4BQXA 3K06A 2IJKA 1PL4A 2XAHA 1CX1A 2K2SA 5CFCB 1TME1 2BTOA 1R082 4IUGA 1NS1A 1OHFA 1KQSU 1TUBA 3OCPA 4QX7A 3SNMA 1R081 1NU1H 2VNVA 1MR5A 2AEYA 3SCFA 1QF3A 2MHFA 5KXDA 1F2NA 2CGPA 2YXSA 2H8PC 4B3MB 4Y26A 4LBMA 3JSLA 2R9AA 2O8QA 4W6YA 1QOSA 4XE9A 4BQ3A 2Y34A 3C8XA 4XF4A 2KG7A 3K5NA 4N21A 4AYUA 2CWMA 3PUAA 4HPKA 1HB3A 4QX3A 1W0NA 4XCBA 4XFGA 5FZGA 5FYSA 5CG9A 2R9IA 3JD73 4FPHA 3KB5A 3JB8A 1J95A 1RUD2 3E8BA 4DR3B 1VQ5V 1VQ4V 5BNQA 3G67A 1JOJA 1VBE2 2G1MA 5J7MA 1XHZA 1NXD1 5LYJA 5LRSA 3CE2A 5C4WC 3RT3C 5CZKA 2GMPA 5GLTA 1QXPA 1FPOA 1VB2A 1AYM1 1I94O 4JI3O 1X8MA 2HWC2 4YSFA 2WNUC 4E4HA 5C3PA 2AH2A 4OUEA 2HWC1 2IZWA 2FDKA 4NIHA 5DZEA 3K58A 4DYLA 3L9DA 2IUWA 2AXTZ 3A8TA 3DC6A 2LFRA 1SPPB 1COWG 4KXRA 4WFGA 4IHJA 1JUHA 4CXWA 3VL9A 4WVMA 1P84F 3MEPA 2XHKA 5BUVA 1ND2C 1BSMA 2XL7A 4Q26A 4QE7A 3LFIA 1OLMA 4TOIA 3M8AA 2HEYF 1EAH2 2CY6A 4RL7A 1YLLA 2E9QA 3B9CA 1XNKA 4YY3O 4QU1A 5IFTA 2RJKA 3ZKUA 3H1KH 4KQ7A 4AQYO 5C4WB 1UIJA 1I94B 4JI3B 2W94A 2QDNA 2PHUA 4COYA 3ZX7A 5A70A 2Y60A 4FLTA 5B4NA 1RUI2 2HVKC 1JJ2U 2WNUB 3C7GA 3ZYPA 2Z42A 5GALA 4D3WA 4FVVA 4P9YA 3SYOA 1VQMV 3OBZA 2O14A 3S30A 1W05A 3MPBA 4AHCA 1QDCA 2A71A 5AC93 2VZTA 1JU3A 2XWJB 4TYSA 3W7UA 3OYWB 3OY8A 4YW7A 2WAMA 1VF5B 3WQ7A 4G4FA 3AG1B 4BE3A 2C5DA 2XJVA 3RVHA 3A4UA 2EIKB 4XAAA 3BA8A 3ES4A 5DZFA 3E35A 4JGZB 4QHBA 1H9WA 3LZZA 5A6QA 1OD3A 5LA1A 1ND2B 1V9PA 2VOKA 5EV7A 1FAYA 5AFBA 5FZDA 1K92A 2QZ3A 5JR2A 1YNAA 2MNGA 1RSOB 4EYUA 4XEZA 5K8SA 4K8FA 5JLVA 2ZAAA 3OTFA 1DQ2A 5A1LA 4YY3B 3HBKA 5E89A 1LKNA 2I2SA 3VBFB 1VQ8V 4UCSA 4AQYB 5K4LA 3B00A 4I7ZB 3AMMA 1XYOA 4IGGA 1AJQA 1H2NA 3ZMSA 3BU0A 2P3JA 5KUMA 4JI4O 3GGLA 5FY4A 1BGYH 4YZ3A 1GZWA 2K0GA 1ZUQA 4GXLA 4Y5TA 4RGAA 1UZ0A 1YYNA 2R72A 4RA0A 3BTAA 4PDWC 2D3PA 4CA9A 5JCOC 5HCFA 2TUNA 4RFT0 1XNTA 3J4UH 3O9OA 1AX1A 3BCWA 5FREA 4E4DX 4XBFA 3KMHA 2WLJA 3M7MX 2XKPA 4PLNA 3JATB 3NV2A 1W6OA 4UBHA 2YIDA 3M7AA 2DTYA 4DB5A 5LBBA 3OE7G 5C8WA 3KF5A 1S1AA 5HBAA 5CYYA 2PUSA 3JYCA 1VQ6V 1IG0A 4AVAA 4DRXB 3A0NA 1CAXA 4FFGA 5F2VO 4V2VA 5KR7A 3KQ4B 1CQ9A 1KITA 1SQGA 4WFBV 1HIXA 2RQ6A 1KP2A 4QM8A 3ZDSA 1NX9A 2P6HA 1K4CC 4KWJA 2FDGA 1TVGA 2QKSA 4P14A 3WQ0A 3LQCA 3I3DA 1WPXA 5IT6A 4ZZ5A 4P9XA 4IESA 4JI4B 2ZIMA 1H8TA 2QQVA 3Q8CA 1CESA 2WLKA 1JTZX 4J7KA 4NAOA 3AKPA 3NJVA 3JARB 1WP8A 3VKLA 1PNGA 1V0AA 1R3KC 1CGPA 3OGCC 4IV3A 4TV8A 4R7CA 5D8AC 3LEIA 2WQ8A 3JAKA 3ZXLA 4IYHA 2GC1A 3MW3A 4JTCB 4O2AA 1GNHA 2WNOA 5GTIZ 2QVSB 3LEKA 1V00A 1H8VA 3AP6A 3VZKA 2FCUA 4ZPIA 4QQHA 2W39A 3KCYA 1ND3C 4KGGA 1JZ7A 1AZDA 1UAIA 2HLDG 3WDTA 3JCUZ 1D4VB 2BWCA 1WCQA 5FZ1A 3OW2U 3ZMVA 1QMJA 1S0CA 3RZZA 2QDRA 4E2QA 3ZMZA 2WWUA 3Q4HB 4R9CA 5FYUA 3LE0A 1NR1A 1OUXA 1JOPA 3H3ZA 4D69A 1Y43B 1V6LA 2WPDG 4GX5A 4DRVA 5GLVA 2Z2SB 4O2BB 2VY0A 1LB2A 2WN2A 4MT8A 4MHRA 5FDBA 1QJX2 1H1AA 2M6YA 2W52A 2WINB 5EJZB 4W4LA 4J6GA 1ZZ9A 1RUJ1 3LKJA 5FUNA 4JGYC 1OXCA 1RXGA 2QQIA 4ZHQB 3EYPA 5D8AB 5FPBA 5FZHA 3N35A 1GOGA 1US3A 2BTQA 4D7TA 4P5YA 3I3EA 1HJGA 3D3IA 3W7WA 4FOWA 3L2YA 1ZZBA 3UKMA 1AUYA 1ND3B 4PQQA 2FDFA 1S2KA 2D3RA 2V4AA 5CKMA 3PVNA 2Q9LA 5F39A 3S5AA 1OCOC 1KKCA 3I3MA 4JI5O 1RUH2 1RHI1 1PV0A 3AKSA 4ZHNA 4NJ4A 1WKYA 4EZHA 5CBHA 5A6YA 1RUH1 2XAGA 2Q30A 5IVEA 2RJ2A 3GJAA 1MS5A 4QPIC 5IJ0B 2D97A 1POV3 5LEJA 3H8RA 2ORZA 3K03A 5CFCA 3VHPA 4M4PA 4LIVA 1POV0 2FD8A 4X6RB 4CU7A 3MHSC 4YJ3B 3VDDC 2LW8A 3H42B 4DXTA 1G6NA 3RFRA 4W50A 4H7LA 3JBG2 5G05L 2EIBA 2B7YA 1MS4A 2DCKA 4JGYB 1M4UA 1Y74B 2RN9A 4META 3GB7C 3UGGA 5I8YA 1J3QA 3OGVA 5FYYA 2VAUA 4CZSA 2PGGA 1BEV1 4CUBA 4IEYA 3KVAA 3M8LA 2CTPA 1W2UA 4TZDA 4PV1B 4Q6GA 2XDVA 1LODA 3ZHQA 2VUJA 2DW4A 4JI5B 1L0NH 4PBOA 2QR4A 2CK3G 1OCOB 2QSAA 5FYMA 1GP5A 3R65A 2JECA 1JS9A 1SLBA 5I93A 2OT7A 2FL4A 2WAAA 5JXGA 5DAWA 4QPIB 1R3JC 1GWLA 4BQ5A 1W0KG 1QQCA 4Y3OA 3ZYJB 2Y6GA 3JD1A 5IYZB 3MLJA 2F93B 4FPPA 4YW2A 3VDDB 4G2KA 4BJ0A 4O4JB 5EZYB 4DXRA 5IK5A 2QFEA 2HR3A 2NN8A 5I0TA 4FFFA 1SPPA 1PO21 2VMEA 2Q1MA 2B1GA 3K75B 3IKWA 3RZJA 1PZ7A 4O7XA 3RYCB 4YG0A 3CEIA 2FQPA 3N3HA 3PJQA 3O1UA 2OX0A 1Q3EA 5F37A 5A2QN 4X88A 4Y4YA 5D1IA 4NHYA 4PF5A 1KEXA 3ZYIB 2RDQA 1RUF3 3ES1A 2VS0A 4WZFA 3POBA 4LBNA 5T55A 4MVZA 2Y4TA 3N9PA 1SHWB 5C4WA 4I55B 4B3TO 1WJZA 1PM7A 1SZBA 5T5LA 5FPRA 2E3CA 2WNUA 1BHAA 5ACA3 1EV12 4QD2A 3OD4A 4J80A 4JAUA 3WD5A 3DYPA 4AG4A 4A4AA 2WWSA 1QNYA 3M1HA 2VRZA 1GZ9A 1XYPA 3W9AA 3OYWA 4JI7O 4K8XA 2YROA 4CRQA 1PM9A 3CCVV 1UY0A 4IIJB 3W20A 1ODNA 2XOMA 1HLCA 4W4KA 1YSCA 4JGZA 4JI1B 5JZGB 3VD4A 2DWRA 3WNKA 2ITDC 1ND2A 4A42A 3T1YO 1LHVA 1YFWA 1RSOA 4D7YA 2D6NA 1NCRC 3UETA 1MS9A 5C5UA 4DR4O 4OUMA 3WUCA 1YXBA 1S0EA 2R062 2VXRA 5IK8A 3LFMA 1LHWA 4XF0A 3RVYA 3VBFA 3LNMB 4JTOA 2IBZH 4LP8A 2EXHA 1EUTA 2QA4V 4HVQA 4LOSA 4YPJA 3POFA 5LCWL 4JI8O 4B3TB 1VALA 5DAXA 3KCCA 4TUYB 2ZPXA 3N2KB 4EROA 1YI2V 1GOHA 2YY1A 1Y3TA 1N1YA 3WEZA 2O0OA 4QDRA 1VAVA 4AGRA 2P4VA 1SF9A 4CDXC 2X6CA 4BQWA 3CLPA 5IK7A 5B4XA 1GU3A 4J9YB 1CAWB 3TCUA 3LA3A 1L8DA 1ZZ7A 4K40A 4MGIE 2Z5WA 4EN6B 3IDEA 4WBBA 1YQ6A 1GQHA 4JI7B 2Y6JA 3JATA 3AM2A 1T5EA 2XAQA 4DV7O 5FXVA 1WW5A 4Q27A 4AEKA 4LLOA 1K3IA 4NOTA 4Q4W1 1JPXA 4IQPA 5FXWA 3H1JH 1AR73 1GLHA 4DRXA 5FYHA 3WCRA 5GTHZ 5KHKA 5JSPA 1UKRA 3T1YB 2VWJA 4GH4C 4RGGA 4EN9B 5DZGA 1NKDA 3AKTA 1AI5A 1CAVB 4FSJA 3T0BA 1X82A 3IM0A 4LF4O 1NLQA 2LQTA 4DR4B 1NCRB 2JDAA 4GA9A 1PVXA 4QMAA 3VLBB 3HT2A 2BOBC 2D44A 4JI8B 4GB32 4NE9A 4YW1A 1XNRO 1ZRIA 1AJOA 2VH9A 4ASMB 3CKHA 1N36O 3DCQA 4AVSA 4R52A 4CCLA 1QJY2 5IW0A 3JARA 2Q1FA 1S2EA 4EE2A 4K1YA 3T4VA 4ORFA 1Z7S3 1KQRA 2XVKA 1PVC2 1W2OA 2XJUA 4JYCA 2QGNA 5FZOB 1FPN3 1Q5OA 1UJWB 4PI2A 3WNLA 4CDXB 4L11A 2QQWA 1PVC1 1JZ4A 2Q0OC 4O9EA 4XTPA 4YW3A 4AW7A 5JCOA 3TETA 3CNAA 4MG2A 3ZHTA 2EINC 1E57A 4XQWA 2YFZA 1SA0B 5FP4A 1COV3 1JVMA 5IAXA 3Q8BA 4GJZA 2HG5C 2PYTA 4DV6O 3TEZA 2R0HA 5FYVA 4XBQA 3ZXGA 2W87A 1ZX5A 3P6BA 2HLEA 3RYKA 3BN6A 4GH4B 4MVOA 3Q4HA 4LF4B 4IEUA 3VKFC 5FZ9A 3AJZA 4IW3A 4Y1YA 4XMAA 1WAZA 1RGSA 1MSWD 2ZGUA 1QR9A 4O2BA 2JIGA 4QKBA 1XNRB 2CSGA 1LR5A 2WWJA 1AI4A 1N36B 5BNPC 4DV2O 2C26A 3TN91 1ZSPA 4NXNO 4A3ZA 2ZX0A 3LEGA 1D5NA 1UY1A 2E31A 5JIUA 2Q5ZA 1BHGA 2A75A 2UWCA 4HYOA 3B9IA 1VF6C 5HPOA 1ZX3A 4ZHQA 1U96A 5D8AA 1XE7A 3ZYFA 3MPPG 2VQAA 1MEC3 2BNOA 4QDSA 3WP6A 1CAUB 4CCKA 4JGSA 3H1LH 4AEMA 2V4DA 1KJLA 1WA4A 3EVKA 5KUKA 5FY0A 2ARHA 2EINB 4DV6B 2EULA 1ND3A 2EXKA 2G4IA 4CPBD 4GALA 2P4EA 4RD7A 5JXHA 3NMBA 2DE0X 4AEJA 2KXLA 3OOXA 3UYJA 4TLGA 2EALA 4CH5A 5KAFZ 2WFF2 4FVMA 5FO7B 4OI4A 2AZ2A 1YWKA 4XIOA 2RDRA 2WT0A 4XHBA 3O0VA 3AC0A 5J9PC 5IJ0A 3NVCA 1F4HA 5FZ3A 1HQLA 1A8DA 5FZMA 1N8RW 5K1PA 5DUXA 3NXSA 1XNQO 1AL0G 3W59A 1LENA 3VKNA 4DV2B 4AAXA 4FFBB 4LO4B 4YJ3A 4NXNB 5BNPB 3K5LA 3JD2A 1VIBA 1VRH1 3VQWA 4MTGA 1VBD3 1ULPA 2GH8A 3OEBA 2VL4A 4JGYA 1Y74A 4WF9V 1IHMA 1UZYA 3B5LB 5JI9A 1W8UA 4NTYA 3WDVA 1WMDA 1BLZA 2VR4A 2RS33 3GJBA 1PZ9A 4ET7A 4I0XB 3USUA 2UWBA 5FPAA 4AHZA 2R32A 3MD0A 2G9ZA 3WW1A 1DLLA 2YEVB 3NRUA 2XAFA 4MVMA 3TK1A 4MGSA 4Q0UA 2AUYA 5DAPA 2KQXA 2D6MA 3WT3A 2J1SA 4JDNA 3IIAA 4CVUA 3FB6C 2GU9A 1O91A 4MW8A 2XL9A 3T0DA 3KT1A 4IERA 2ZACA 4FPFA 1Q6UA 4QPIA 3ZHVA 1XNQB 3B01A 3O1VA 4JKMA 1PHMA 5IDJA 1ZRRA 2JE8A 2E51A 2DCZA 5IYZA 1LOEA 2YUEA 1HV0A 3FKSG 4SBVA 2QQKA 2ZD9A 4A7ZA 2WL1A 3VDDA 2XGXA 3PLQA 4O4JA 5EZYA 2WIIB 5JDBA 3O12A 4P08A 3KZ4C 4QQPA 1WP7A 1W9WA 2BNNA 2EICA 2ZDIC 3H8OA 1WBLA 2WQZC 2GC3A 4HK9A 3RYCA 5LY2A 5LGNA 4XF3A 1G9DA 3FB7C 2QBXA 2RV9A 4LF9O 1LHNA 3KSCA 1A3KA 3WLUA 5I91A 2XNDG 1KXGA 1GNZA 5TISZ 2V73A 1KUQA 2OUHA 5T5PA 3APOA 2HWB1 4LE4A 1YI9A 1GNYA 3TGUH 5B1BC 3IB3A 4JYBA 3MUZ1 2CDYA 3GZAA 1YHQV 2XUMA 1AR71 4LA2A 2A3QA 1YVWA 2CUGA 4A45A 5DN6G 2IXJA 2WT1A 5IVVA 1AR83 2WZR2 4FOYA 3RI8A 1VAMA 5FY7A 3TAYA 4I55A 5HCHA 2BP6A 4TV9B 5F5QA 3CJIC 3HD8B 5FZ8A 3T4ZA 1I9RA 4XQDA 4IGQA 4LFAO 3DSQA 1W39A 3RI9A 5J2TB 4S2HA 1SLCA 2XPJA 2LGWA 5IWFA 2PI5A 2BSKB 5DMYA 3PMSA 3K08A 2P90A 2UU9O 4URAA 4ISQA 1RIRA 1SEFA 4ZS2A 3NNLA 3JXSA 4HZ3A 3LCPA 1W90A 1DGLA 3OEAA 1KRIA 4JTNA 3MIDA 1EZJA 2JE9A 1VP7A 4AFDA 1AF9A 1ASJ2 1NCQC 2QQNA 5JZGA 4DR1O 4J11A 4R4XA 2YIBA 3VL8A 1AR92 4PJ0Z 2JWPA 4B8EA 2ARBA 3CJHB 4WBNB 3GF6A 2JS5A 3TJTA 3NKGA 2ZGLA 1NTMH 3K3NA 3UKTA 5B1BB 1C1FA 4E27A 2OT5A 1XNDA 4WFAV 3WF0A 4I0WB 4YWAA 2WZ8A 3WVJA 3CC4V 3Q9OA 2WZPP 2VW2A 2ZX1A 4AVVA 2J7MA 5LMUO 3H01A 4TUYA 3FHIB 3U78A 3E8HA 3N2KA 4COUA 1W99A 3ETPA 3N36A 1ZBE2 1K45A 5IK4A 1OFNA 4X65O 3IT8A 4HFSA 1F35A 3CJIB 4B4QA 1PX4A 4K9SA 1L7LA 3M3OA 1T6BX 5L7OC 1CAWA 5FZIA 2ZABA 3WG7C 2UU9B 3CRCA 1MG1A 1W8NA 4KNCA 1VBB3 4LEJA 4H2AA 5JSRA 1JYTA 4MOAA 1W2AX 2Y0OA 1L3JA 4I3GA 3PN1A 5FRAA 2J1EA 4BPZA 1SZXA 3MW2A 4P00B 2ZGKA 3FYIB 4HG6B 2P17A 4DR1B 4PBPA 3B4SA 2OS2A 1NCQB 4KBBA 2BTVC 2KR2A 1LRHA 2OIIA 2XHBA 3CCEV 1CAVA 1LEMA 3O0XA 1AR5A 5GZFA 1FMD2 2QM8A 4COZA 1TMF2 5DG2A 1NCRA 3RYHB 1S0IA 3JD72 4DFSA 5ABJB 4LBJA 4ZKTB 2W1UA 1FMD1 4JV5O 1TMF1 2XVLA 2IXKA 5LMUB 1T2XA 2VGDA 2DJVA 5CA1B 3IDCB 4QX1A 3B2EE 4JF3A 2PHRA 1IS5A 3WDYA 4XDOA 1RXFA 3AG4C 4X65B 4AVCA 1NQTA 5H9RA 3BOPA 3BTZA 5GKAC 1OVPA 3B40A 4FJCC 3ME2A 1S2BA 4R4ZA 2Y33A 5J36A 1XRUA 2VMFA 5FZOA 5FL7G 5FZLA 1X36A 3H7JA 4MGZE 4CDXA 1HRI3 4LHSA 2WSSG 1OLQA 4LHNA 5H6RA 5B1AB 3WG7B 3KT7A 2WNEA 4QIWF 3LF7A 4DUWA 4H3WA 3QLQA 4DV0O 4WM8C 1SA0A 2BNMA 4GAZA 3BPZA 4Y1UA 1JYVA 4K3UA 1MS3A 1MSDA 2AACA 4LHLA 3K4ZA 1EN4A 3SYQA 4H0LB 3TYJA 1YQ5A 1POQA 4U3JB 4X1IB 1LGNA 3RS6A 2EIJB 3FAVB 1D4M2 3ZN0A 2HBTA 4XF1A 4DK0A 1SQFA 1SRYA 5FZKA 3RYIB 3M3QA 1FV2A 4PIZA 1QJU3 1D4M1 1DZRA 4GH4A 1Y9QA 3VKMA 3CCQV 4K7JA 5CA0B 5J1XA 1XB9A 4CYDA 1VJ2A 1GMGA 2RR13 4FPJA 2TBVA 1APNA 4PA6A 1QQP1 2LS6A 1E5HA 3HVDA 3FJSA 1GWKA 4JV5B 4FPGA 3CCUV 3ZFGB 5EC1C 3I2FA 3RRDA 3UV9A 5E1RA 1R091 2DCTA 4NAMA 5EJ3A 1OPMA 1DFQA 1LECA 3ABLB 1CD3G 4EN0A 4I50B 2E7AA 3RYPA 2X7RB 3OUIA 1HN0A 2R16A 2ZE8A 1PNLA 3GZEA 4LIUA 1GM9A 4KG8A 2YC2A 1DGWX 3N7LA 4DK1A 1N32O 4NR1A 1WB7A 1FJGO 4AFMA 1IXBA 2RNBA 3ZHUA 1CXZB 3RSJA 5K0UC 2H6CA 2VZOA 4DV0B 3H1WA 4AHXA 2XJTA 2AHZA 3PU8A 2CH7B 1AROP 1O9GA 3PVOA 4HSJA 4WM8B 3U0ZA 1QVGU 3A2FA 3F5TA 1QY4A 1BBT2 1GM7A 4JASA 2BGPA 2IJIA 5AC92 2UXDO 1Q7YW 3JD0A 4BOWA 5LGTA 1BBT1 1UL9A 2VTFA 1ROPA 2PYLA 2HH9A 2XAJA 4YG6A 4AFBA 1UXZA 3NO8A 4SLIA 1YO8A 2D5FA 2Q7GA 5IVCA 4MVTA 5APAA 2L9LA 4FFBA 1P8JA 1NH2D 2BOIA 1AL22 4XXAA 1DTOA 4PDVA 4XDKA 5BNPA 1AR81 1B35C 2VCBA 3AK3A 1AL21 4YHHO 4LF7O 1Q56A 1NY72 1PO12 1KKDA 5JXJA 1N32B 5FYTA 1BHBA 5F5CA 3SPJA 5KX5B 1VF6A 1GR3A 5FPXA 1PO11 3MF6A 4QDQA 4DW0A 1N3PA 3L70H 1XC6A 5FY1A 5LOVB 5FO9B 4BWOA 1KECA 4I0XA 1AR93 4N9IA 1Q81W 2HWE3 1IX9A 4DV1O 1OCZC 2UXDB 5KXEA 3CZUA 4YM2A 1JZ2A 2F43G 1AR63 1I08A 2YEVA 3S7EA 4COWA 4L8QA 4L9BA 1QIQA 2IJHA 4UYBA 2RJLA 3BGAA 3ACLA 3LEMA 3AG3C 4HNAB 3AZZA 2XLFA 2YDEA 5LZ6A 2VNRA 3A21A 3G6EV 3O0WA 1JYCA 1W9YA 3MBWA 3TRSB 2PI4A 3E6CC 4PLOA 2VECA 5FZ6A 1LGCA 4PHZA 2ZM6O 4YW5A 5AVAA 3OSDA 4NHXA 4YHHB 2PHLA 2I45A 1B35B 2PHXA 3PU3A 2JK5C 2XBO3 3MIHA 1PNKA 1HXS2 5FMDA 2C4XA 4RS5C 1X9PA 3O1OA 3FFQA 1VBC1 4G9SB 4CE8A 3CCMV 4IEWA 4A3XA 2Y4UA 3VBRC 3AYCA 1MNGA 4FZ0A 1IURA 1Q43A 1CVNA 2RM23 2N04A 4X1KB 4DV1B 4LHKA 3ZHSA 2YYOA 3OGIB 5H2FZ 1OCZB 4BQ1A 1PMHX 5JMOA 2IC1A 5CA3A 3HR0A 1TNFA 1A32A 3SQOA 4JKKA 4EN7B 4P2ZA 4YZ4A 1FXHA 3AG3B 4DRRA 1H4HA 1V6NA 4D94A 3VD3A 4Y4RA 5IFPA 3LSQA 2GC0A 5BZBA 1W9FA 4P30A 4FPCA 1IXMA 2BE3A 4TV9A 4LO7A 4UV9A 5CBGA 2ZM6B 4YFZA 3JD4A 5J2TA 1UU6A 5JVVA 3DYOA 3CO2A 1VQKV 4NN0A 3ABZA 3PJYA 3ORJA 1CPMA 4LFBO 4UCOA 1W8HA 4Q0QA 2GNBA 2R9RB 4JDOA 2JDHA 2GV9A 4E8CA 3DN7A 1EYBA 4HT1T 4LNUB 3H1HH 4RS5B 3O1RA 2PFWA 3WG2A 2HJIA 1UIKA 2ZDIA 1J5EO 1RUE3 4MH0E 4KG0A 2IFWA 1EP0A 2RS52 1SETA 5EIYB 4NPRA 4FPKA 3VBRB 5DDJ3 3OR7C 1BT8A 1QH6A 2RS51 2HWD3 2ZXQA 4LOTA 3CJHA 1P4RA 4WBNA 2EXIA 4K35A 3P3PA 4L2NA 1UCXA 2RS12 2BOCC 3IWZA 3M2MA 3N9LA 1G9AA 1D2QA 1QNWA 2PHWA 3AYAA 2Q8EA 2ETEA 2DVAA 4OFGA 2RS11 1Y9MA 1PX3A 3OBRA 3AFKA 4UW6A 4CU8A 5E79Z 3ZYBA 3ALQA 1OFSA 1U97A 4OGQB 1DYOA 5A9GA 5A3WA 3OFNG 5C8YB 1YJLA 1RVF3 3THOA 5GLUA 3CJIA 1AILA 3F7VC 1W6MB 4Y22B 4JX0A 2K46A 5B2GB 4PA3A 1ULCA 3TEXA 5CIRA 3FD9A 5FZAA 3SCHA 3MDSA 1NAEA 3K9AA 4PDMA 3GDBA 5FPZA 4FK5C 1DZTA 4JI2B 2PLV1 1I5PA 3K4AA 3T0AA 4TWKA 1J5EB 1QOTA 2ZKOA 4FM0A 3WF2A 1A78A 3ZYHA 5EK0A 5D2AA 4J1XA 3TNPB 5HCBA 3BAAA 3ZXFA 4OX9O 1BJQA 1Y7BA 2ZGRA 2HWF2 4EKWA 1FNYA 2P6CA 3WDUA 4I9QA 1NCQA 2CDOA 1GP6A 2DYCA 2HWF1 4Y24A 5F5AA 3MICA 4FFIA 4X8AA 3PIJA 3RYHA 5ABJA 4QX5A 2RMU3 1THZA 2FB5A 4PDRA 2VUAA 5HXMA 1VQLV 2DURA 4FLYA 2YSUB 1FFTB 2UUBO 5CA1A 4M3CF 5AFEA 5C33A 1EFRG 1K73W 3P1IA 5ERLA 1UPGA 2B8MA 3A0BZ 3CJXA 4EFBA 1Y76B 2ZE6A 1RUOA 1XE0A 3EBRA 3W5MA 3FBMA 2ZHMA 5LXTB 1LTEA 2F17A 2YBKA 5A3UA 4CU6A 3OGJA 5FY8A 4UFIA 5H9PA 5GZCA 1GN4A 1B09A 4XAEA 3F7YC 2WO3A 3MFCA 3MV01 3CCRV 3TEWA 5A3MA 1NG0A 2ARCA 3WSOA 1GFF2 2VE1A 4LITA 3SJAC 4Q4X3 2FYUH 1ZREA 3RMXA 2VVFA 5LATA 3BB6A 4XJ9A 5C8CC 4U3JA 4X1IA 4DR5O 3X29B 3ILRA 2QEXV 4YZ1A 4JRAA 1A8MA 1KU9A 3SISA 3RYIA 4R50A 4AFCA 1NE4A 4XOGA 2Q8VA 4WM7B 5CA0A 3M3EA 1PIV1 4QHOA 4U2AA 2ADQB 4JI0O 1AR61 3LDDA 4QNHB 4X89A 3ZFGA 5BNNB 1ZBA2 2W92A 5BNOC 4BISA 2UUBB 1WMEA 5FP3A 4N7IA 4G3YC 2AEZA 1XILA 1REEA 3EO6A 2WLMA 1ZBA1 3ILNA 4FBFA 4I50A 2UXBO 3M3IA 3VBOC 4XBNA 4J10A 2Q4SA 4CDWB 3ZXEA 2ZXWC 3E89A 1SQBH 4Z92B 5LA2A 3CP1A 5JVDB 1VBA3 1Z5WA 2VOWA 3UT0A 2M7WA 3I5DA 4RWUA 3DTUB 3TXQA 1SG3A 4QPJA 3GVMA 3O65A 1UO9A 1KS5A 2ZCWA 1QDOA 1AYN3 3ZEDA 1EPWA 5FPVA 1W8FA 3FLRA 1JCHA 5JUVA 2NMOA 3KZIZ 2IM9A 4PT6A 2F23A 1DU3D 2CH7A 3NR7A 3UJQA 1ZA4A 4UUJC 1QJEA 3I2JA 4WM8A 4DR5B 3LOBA 2Q8OA 3AXEA 1WB8A 4DY3A 5C8CB 2VCCA 4IEQA 3RPQA 1R1A3 2VD7A 2EAKA 3IAPA 3DGEA 3ZFEC 4RSUA 3TOJA 2ZX4A 1VF7A 3LA7A 3APQA 2E75B 2K9ZA 4KU7A 4MO3M 3E6BA 3S6PA 1GANA 4Z8BA 1JMKC 4U3FH 4IEPA 3MZHA 5BNOB 2UXBB 4RHV3 3B7MA 4LJHA 1PK6C 3OUFA 1F15A 2WYFA 1TME3 2VC9A 5F1RA 3WQ1A 4XFAA 3VBOB 2Q8DA 2ZXWB 4UW5A 4CP0A 1EPZA 3ZJZA 5FLXN 1R083 4EWAA 3WB0A 2BJSA 1OA2A 5KX5A 3RWKX 2DVDA 4OI1A 4K20A 5FWEA 4LBQD 4TWTA 3JCZA 1SLAA 3O1TA 1G9CA 4UT5A 4XPVA 3DL3A 1RMU2 5LOVA 2YC0A 3T1LA 1BE3H 3T4DA 1LESA 3MV11 1J1TA 4XJ8A 2HHHB 4Q0VA 5BY5A 1M9NA 5FO8B 1RMU1 2H94A 1S0JA 1W04A 1BZWA 3ZO0B 5JQGB 2J42A 3AP9A 2UY9A 1QXJA 1RUE1 1GM8A 3B8NA 4Z1VA 3H1YA 5JH7B 4P9LA 1SCSA 2MW2B 5IYCO 4HNAA 4IEVA 3KV6A 3D3AA 4KHPO 3VQVA 2D7FA 2JEMA 4OI2A 3ZFEB 3K3WA 2BGCA 1RUD3 1I7FA 1XPWA 2JG9C 4XFIA 3WB2A 1W8OA 2ORXA 1NT2B 4K6BA 5CB4B 3ZR5A 1NR7A 1S76D 4DV4O 4MGQA 1CJDA 3RWRD 1UPIA 4RFRB 1PK6B 2W1SA 4YARA 3BRCA 3IMMA 4PA4A 1RB8G 3W58A 1B35A 2HWC3 4HAMA 2X10A 3I97A 1RVF1 2ITCC 4UB8Z 3D0JA 3FBYA 1QH7A 4UFLA 4BIUA 5FBZA 2V09A 1WA8B 5B1NA 3DUIA 3OPWA 2VXJA 1C5HA 1QU0A 2BRTA 5IVYA 3EQEA 2ZE7A 1FPN2 3HOBA 5C3RA 4BXFA 2XJSA 5KHHA 3I2KA 4X1KA 3J8F2 4JAVA 3VD7A 3RMYA 4QX8A 1DYKA 4JHZA 1F7YA 5C6CA 5FYCA 2YXYA 2HVJC 4AVTA 2X5IC 2B5UA 3J8F1 2YICA 1MZFA 5T54A 3ELNA 3V56A 2IWGB 4B3SO 1COV2 2WUHA 3MHHC 1ZM1A 2ZGQA 4KWUA 4A6OA 4EEQA 2OUJA 2ZIOA 5IE9A 2A0LA 2PMWB 4K3AA 3POGA 3C3TA 2F6BA 1D5AA 4LBEC 5G04L 2HYKA 2VPVA 4QAWA 3WCSA 4P9OA 2GHYA 4V2WA 1KD1W 1VQ7V 5EZWA 3VGIA 4DV4B 2JJ1G 3WXPA 4CH6A 3AG2C 2RMU1 2ET7A 1UNBA 4MLOA 4UOJA 4Q4V1 4URTA 4XHXA 2VMGA 5C71A 2QJVA 2WZEA 5GLZA 4FPYA 4XXPA 1MS8A 4M3CE 2DWDC 1CEZA 3A7QA 4UCTA 2DYRB 1WZXA 1W6QB 1WCKA 1DLCA 4OXSA 1DIWA 1GQPA 4LNUA 4RS5A 1EBOA 4DR7O 1X7NA 1OPOA 3RZGA 4MS2A 2JKBA 3CC2V 1ZWIC 5JJNB 2FCVA 2DDUA 5JJJB 3VBRA 4DMIA 2ZKNA 4KP4A 2E32A 3H8UA 1O3SA 4AAPA 3U11A 2OPWA 2X5IB 3IN9A 2PAKA 1PPJH 5C7GA 2EJRA 4DIQA 2JDKA 3UK9A 2ZX2A 1Q8QA 2B9VA 5GZEA 5LW9A 1KB9F 2K1EA 4TQFA 3UKNA 1V54C 2R0FA 3VZNA 2HKOA 2VQFO 5C8YA 4GWMA 1DHKB 3VDAA 1BVP1 3I3QA 3AG2B 4Z2WA 3T2OA 1W6MA 4Y22A 5LL6Y 1VB4A 5IWAO 4F6EA 1W59A 2BGOA 3JCIA 1VBA1 4AK3A 3L71H 4DR7B 1BVVA 1GH6A 1GV9A 5F2WA 1TAEA 2B42B 3LA2A 3SPHA 2BBAA 5EP9A 3WNMA 1UFIA 3ATGA 1MS0A 1AYN1 4I09A 1LEDA 4BCUA 3OAAG 2BZDA 3UESA 1NLRA 4CCEA 4QXCA 2RS32 3FFZA 3LDEA 2A73B 4YM1A 1MVQA 2JICA 1V9U2 3RYFB 3ZRWB 1F4MA 4D6SA 3B77A 2E7QA 5KWRA 2WQ4A 3R05A 4P9GA 3ABKC 2NYYA 2Y6FA 5CFDC 4YW6A 4AQSA 3MHZA 2P2KA 2Q73A 1AI6A 5GW7A 3SYAA 1LUWA 2VQFB 2ZR2A 2FDHA 1KDMA 1V54B 2DYSC 3Q8AA 3VUOA 2WS92 1Y76A 3C7HA 2ARXA 4YG3A 4F7ZA 1SLIA 3L73H 4QE9A 1P7GA 4I9WA 1UOJA 4FAGA 5IWAB 2WS91 4B29A 1L0LH 2EIDA 4RHV1 1LOAA 5LXTA 1TA8A 1SDDB 3HJRA 3B94A 2VWKA 3B02A 1XSQA 2CTQA 1S77D 2CAUA 2LTNA 2LALA 2AGAA 1YJWV 2BEOA 3WG1A 2EZOA 4K1ZA 2QQPA 3ZM8A 1FXZA 2WABA 3NWKA 2B5HA 3T30A 1MQTC 1GO3F 3I2HA 1JI6A 4OMDA 4RR3B 4E2SA 3ZXAC 4QXHA 1OCCC 2V5DA 1OCRC 2X05A 4WM7A 3QO8A 4NVPA 1RC6A 1BKZA 3ACIA 4XZUG 4L8JA 5BNNA 4HL0A 3V65A 3N7MA 2WJSA 2XLGA 5CFDB 4NTWA 3KGZA 3T2PA 2F4PA 2ZNJA 1JYIA 5EBLC 2P6JA 3AP7A 4CDWA 1JHJA 4LC1A 1ZNPA 3MF9A 2CYFA 1RUD1 5JVDA 3DV8A 2DYSB 1VBE1 3DGTA 1JBCA 4JZGA 5JSOA 1UKGA 1GP4A 5L9VA 1RUJ3 1RM1C 1UOFA 3KV5A 1H2MA 1DF0A 1CJPA 4YM3A 3CRRA 4S2GA 1JFFB 4LFCO 3SPGA 4OCTA 2L35A 1SKVA 3CBNA 5HXVA 4RYDA 1V6OA 2ZGOA 2OWOA 1CWPA 4QXKA 1HW5A 2Q4PA 3OJBA 5C8CA 4C0BA 4C7UA 2FKXA 3ZR6A 2XT9A 4K21A 2P34A 1C28A 1RP3B 1MQTB 3BI3A 5BV6A 2PZSA 3I49A 2Z5UA 1Q8SA 1OCCB 4CC6A 2XJPA 3J7AU 4UFMA 1RHI3 2G9GA 1OCRB 4CPBA 3HR9A 3MYXA 1J59A 1MACA 3BY6A 1RUH3 1HB4A 1JYNA 2N05A 5CADA 2NLRA 1WN7A 4IV1C 4I0BA 4QPGC 1IKQA 2VBPA 3ETEA 5BNOA 2F4LA 2D6LX 5JR7B 4K0KO 2A6ZA 3WDXA 4EWEA 3UGFA 3VBOA 2GZWA 3K79A 5IJRA 2CTVA 4XURA 1ZZ8A 1EAH1 3SLIA 2VVEA 4BAYA 1ULEA 1NH2B 2D6OX 4XJAA 2R072 4NUBA 1JYWA 4LWSB 1RM1B 1R6KA 2ZAHA 4YVWC 1ENQA 1GKFA 5FKBA 4XETA 5T52A 4IE0A 4LFCB 3KG2A 4X1YB 3SJCC 3HKDA 3UO2A 1RUI1 3KLSA 4CDQC 3C3SA 4B4PA 1SERA 2R042 1VBB2 4DXZA 4I02A 1BEV3 4NYKA 5JQGA 4KWLA 5L3BA 5AG2A 1GICA 2MEV2 2R041 5JH7A 5FZFA 4A7YA 1K34A 4BQYA 3APBA 1B04A 4I01A 2MEV1 3J9SA 1WGPA 1NOVA 3HN1A 4LKEA 3UCSC 3UQ8A 4QGLA 4AOCA 3W5NA 3ZFEA 3OG2A 1XJAA 3BKZA 1HRV2 2X6BA 4NXMO 4XC9A 3TB0A 5CB4A 3QOPA 3AVSA 4LPLA 1G9BA 1HRV1 4XFCA 4XBLA 4QPGB 4B3RO 3FHQA 3ZRXA 1CZSA 1PK6A 3CEWA 1AP6A 4LKDA 2BU9A 3THPA 2OZ6A 4N23A 2W68A 5FJHA 1RITA 2AYHA 3NV1A 3RNSA 2JB4A 4AQTA 1WA8A 2N74A 1L1FA 3CRMA 1PO23 4PA9A 2I07B 4YVWB 4Q1PA 1ONAA 3DYMA 1W8ZA 2QWNB 1LUVA 3KKYA 1JX9A 1HRI2 3D4KA 2RJZA 1SQXH 1XYNA 4AI1A 2QWQB 2VO5A 2DV9A 5F6LB 4CDQB 3OPZA 5CISA 4XIKA 2CL2A 3KM5A 1S0DA 1XUQA 5HV0A 4CSWA 5EFUA 1IQAA 4UCUA 3HN3A 1AI7A 5L73A 1ENSA 1AHSA 2AR6A 2AC1A 2ZT9B 4NXMB 3HPLC 1NTZH 4OULA 3ZN4A 1C3HA 1XI1A 3OB8A 3C90A 2VOTA 4B3RB 1Q82W 2ZQMA 3SH3A 4J42A 1IG3A 4C1WA 4IGOA 1O4YA 4EN8B 5KC6A 1X4TA 1YTFD 3PIGA 2F66C 2JJ2G 1W3XA 4KUMA 1W6QA 1JW6A 1TG7A 2QE3A 4Z2AA 1RUG2 3ML0A 3E97A 1NE6A 4MSWC 4PJYA 1RUG1 5C70A 3SKVA 3KF3A 3HNYM 4P9WA 5FKCA 1EZVH 1YFUA 3LDBA 1FKAO 3K04A 4PDWB 1JODA 2VOVA 5FXZA 2DN9A 1M1KW 4QM9A 4BHPA 4NIIA 2VOXA 1O4TA 2X5IA 3C7FA 1W03A 1NT0A 4XUNA 3D3QA 3FE5A 1JR9A 1XMOO 5A7NA 4EV0A 1YDXA 3AL5A 4E4EA 4IETA 2OIEA 1STMA 2VTXA 1VQNV 4CCNA 3N7JA 1FFXB 3ZN6B 2YG0A 2JDUA 4AI8A 1QU7A 5EIBD 4GJYA 2UXCO 1IZ3A 3TNQA 3JASB 3U4XA 4JAAA 2XWBB 4YJ2B 2JD9A 2VZ1A 1DYPA 1YZBA 1IKPA 1VQ9V 2VCAA 4N8MA 4ARYA 4X9QA 4UXNA 1OI6A 3FZ3A 3I59B 1SBFA 4HN1A 2W95A 3T2MA 5FLIA 4BR6A 1US2A 1QJX1 2CTRA 4LT5A 3CF6E 3HQXA 3ZHRA 2P67A 5JWPA 2IXCA 3UKVA 2HEVF 2J1VA 1ALYA 1JN2P 1XOYA 3P32A 4Q4W3 4OZOA 4TTGA 3VBSC 3WU2Z 3GWOA 4FPEA 1QJFA 4KI5M
chains in the Genus database with same CATH topology
1APNA 1OQDA 1QQP1 2DF7A 3AMNA 3KGLA 4U36A 2JG8C 2W08A 3FJSA 1SCRA 4FPGA 3ZFGB 2K2SA 5KBFA 5CFCB 3POSA 1DDLA 1ENRA 2YGMA 4YGDA 1TME1 3VZLA 3RRDA 3UV9A 3V0BB 2GC2A 3GHNA 1R082 5E1RA 1REDA 1TNRA 1R091 2DCTA 4YRDA 5EJ3A 4GULA 4M3CB 1OPMA 2NP0A 4HETA 1DFQA 1LECA 1OHFA 5E88A 3TWIA 1CD3G 4EN0A 3OCPA 4ZU7A 2E7AA 3SNMA 1R081 4MUVA 2X29A 3WHUA 2HEWF 3SH5A 1MR5A 5JOZA 3RYPA 1DQ0A 3SCFA 1QF3A 3OGGA 3NSTA 2MHFA 5KXDA 2BQPA 1HKDA 1Z78A 1F2NA 4KWKA 2CGPA 2YXSA 2R16A 3MDPA 1SQ4A 4MX3A 4GB33 4Y26A 4KG8A 4LBMA 3FC0A 1DGWX 3N7LA 3ZIXA 2O8QA 4LUMA 1RUNA 4W6YA 4CDUC 1QOSA 4XE9A 1O7FA 4NR1A 4XJUA 4AFMA 4XF4A 4YGCA 2ZBJA 5I8SA 3RSJA 3ZXJA 5K0UC 2H6CA 3H1WA 3ZSMA 4AHXA 1RUF2 2XJTA 5SV5A 1PVC3 4AYUA 2CWMA 4HPKA 2D43A 2ZKLA 4XFGA 1IOAA 5CG9A 3AP5A 1LJ7A 4FTBA 3JD73 3PVOA 4HSJA 4WM8B 3U0ZA 2UYAA 1RUF1 1QY4A 4FPHA 2XBO2 1BBT2 4MYEA 1OQ1A 1QJZA 2A6WA 3KB5A 3MFAA 5AC92 3JB8A 4E2GA 1VRH2 1RUD2 4WZCA 3VBUA 5FTTC 3JBG1 5CA6A 3EJKA 4BOWA 5T5JA 1BBT1 1UL9A 5BNQA 1JOJA 1VBE2 3MLLA 2LUWA 2A3YA 5J7MA 2E7TA 4RR3A 4XQ4A 1NXD1 5ACA2 4YG6A 4AFBA 4A7KA 5LRSA 5C4WC 5JCTA 4Y1ZA 3VBSB 3L9JT 1CIWA 4HBNA 3NO8A 4SLIA 2GMPA 5GLTA 1QXPA 4LR4A 3USUB 1YO8A 5ACA1 1AVBA 1XNCA 1VB2A 1AYM1 1OLRA 1X8MA 2D5FA 2HWC2 2JG8B 5FMOS 4YSFA 4CEYC 3WNXA 3C3VA 1LU2A 2WNUC 1GSLA 4MVTA 2AH2A 2FMDA 2JD4A 5CFDA 4M2FA 2A6XA 2HWC1 4I3PA 1M4WA 1AL22 2IZWA 4XXAA 2VULA 3AZYA 5BNPA 1V9U3 5DZEA 1AR81 1B35C 4HKOA 2E63A 3ETQA 2ZGMA 1AL21 5C9AC 3TN93 1Q56A 1RUC2 1C8M2 1NY72 1PO12 1HV1A 3NV4A 1OOPC 1KFXL 1DBNA 1LHUA 1GR3A 1UX6A 1RUC1 1C8M1 5FPXA 1PO11 3MF6A 3WY6A 1N3PA 4BA6A 1JUHA 4CDUB 4M25A 1D0HA 2WS93 3VL9A 5KHJA 4WVMA 3MEPA 1WMFA 3R4SA 2XHKA 1GBGA 1UMZA 5BUVA 2YGLA 2XJRA 2R49A 1ND2C 5FO9B 4BWOA 1AR93 1V6JA 2XL7A 3IBMA 5FOBB 4N9IA 3NJZA 2HWE3 1SFYA 2EVXA 4R8HA 4Q8KA 2VVDA 5KXEA 4YM2A 1T6GC 3O5SA 4Q26A 4M2CA 4JV4A 1AR63 1RJ8A 2PTMA 4AE2A 2WLQA 4YYOA 3S7EA 4COWA 4L8QA 4L9BA 4BMBA 4W6XA 2HEYF 1EAH2 2CY6A 4RL7A 2RJLA 1YLLA 1MQTA 2E9QA 3BODA 3ACLA 3B9CA 2GALA 1XNKA 5T50A 1DQ5A 1NXMA 3N6WA 1DRTA 1NX4A 3AZZA 1VP6A 2XLFA 2RJKA 2YDEA 3KCXA 2DFCA 3ZXDA 1KDKA 2VNRA 4KQ7A 5K0UA 1C1LA 5C4WB 1UIJA 2DTWA 1DGRN 2AZ5A 2QDNA 3O0WA 2PHUA 3EHKA 1GYKA 4COYA 3ZX7A 1JYCA 5I8TA 2ZJCA 3TRSB 3E6CC 1OIJA 4H14A 4FAHA 4Q0PA 2D3SA 4E9KA 1RUI2 4CEYB 4PLOA 2VECA 3FMGA 2HKXA 4CP2A 2WNUB 2HWB2 4DQAA 3ZYPA 1LGCA 2Z42A 5GALA 4D3WA 4AEDC