4JAAA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
328
Chain Sequence
ALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 102
structure length 328
sequence length 328
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4jaaA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jaaA01
4JAAA 2W0XA 3D8CA 2CGNA 2CGOA 5JWPA 2Y0IA 2ILMA 3OD4A 1H2NA 2YDEA 3P3NA 1YCIA 3KCXA 4Z1VA 2WA3A 2WA4A 4NR1A 4B7EA 1MZEA 4B7KA 4BIOA 2XUMA 1IZ3A 1H2MA 2YC0A 1H2LA 3P3PA 1MZFA 4Z2WA 1H2KA 3KCYA 4QU2A 4AI8A
chains in the Genus database with same CATH superfamily
2E31A 4ZZ5A 4PIXA 1PNMA 3WDTA 1CAVA 4S2DA 4LWSA 4D7SA 1PO13 1TE1B 2JDAA 2Q30A 4DV1B 3S7EA 2XLFA 2ZX1A 1YZBA 5FY7A 1FOD1 3U11A 2NMOA 2ZPXA 3M7AA 4DR1B 2OVUA 4HK9A 1W6PB 2UY9A 3HWJA 1I5YA 1JN2P 1CIYA 1QNWA 3U4SA 4O4LB 4UCOA 4JZRA 3THTA 1HRV3 4LNVA 5FJKA 3A2FA 1S0IA 1SFPA 1H8VA 2ZXQA 2YU1A 3WG7C 1VMFA 1KKDA 5FXZA 1SBDA 4X65O 4RHV1 4TWKA 5HBAA 3KHCA 1D5AA 4AOCA 5A6XA 4FXGB 4DY5A 1R6KA 3CC7V 1SEFA 2JJ2G 1HW5A 1WD4A 1LEMA 1FMD1 2JDHA 4MHRA 2YI9A 4QKBA 4A5UB 1Y9QA 3H8RA 1ND3A 2IH3C 4EV0A 2WBKA 2HJFC 2HWF2 2WL1A 1THZA 1QKQA 3AKTA 1NZCA 2ADPA 3OTFA 1GN4A 1M57B 4ATFA 4YZ5A 2KA3A 3I2KA 2D43A 2Q1FA 4MGSA 3UGHA 1ULDA 3CD6V 4G28B 1R3IC 5ITZB 4D6SA 4DV7O 1OI6A 2ZNIA 3UETA 4QPGB 4GX5A 4X1IB 1G7YA 4Q27A 4COWA 2P3JA 4EE2A 1W8TA 2ZM6O 3EHKA 3QH7A 4P9LA 2GNMA 3OOXA 3GHMA 1EFRG 4IERA 1DFQA 3M99B 4U36A 1Y4WA 5GTHZ 1PKXA 4QM9A 2VR4A 5F39A 5IDJA 1XB9A 1ZBE1 1RUI3 5GM0A 4KU7A 4NMIA 5JJJB 1CR7A 2ARAA 4UV8A 2J1VA 1I5ZA 1D4VB 2B9ZA 2TNFA 4LFCO 2ZE6A 1A8DA 2R072 2QM7A 3HQXA 2TBVA 4KBZA 5BUVA 3WD5A 3C7OA 3ON7A 3NNLA 2VOTA 5FYSA 5KUKA 2AZ0A 4Q4V2 1PGW1 1WA6X 1UX7A 2EIKB 4K3AA 1DZTA 4BE3A 4ATEA 3ZYIB 2BZDA 1LNQA 2XAHA 1LENA 3PJSK 1YQ6A 3FUQA 1L3JA 1N1YA 4LOSA 5F5QA 4RQEA 4HPKA 2X6BA 4O4HB 2VMIA 1BL8A 2XL7A 2Z3YA 1YITV 2VQUA 2XJRA 4NHKA 4XMIA 5FZOB 3JU9A 4CDQB 3IMNA 1UJWB 2PI4A 4FO9A 1UXXX 3I55V 3H1JH 1JYTA 5EC2C 1YNAA 3K4ZA 2E32A 3CMEV 1HB1A 2ERFA 5FUIA 2VMCA 4UBGA 4XXAA 4IE5A 1VP6A 2HJIA 4A42A 1VQ8V 5FMOS 4IV3A 1LJ7A 1SRYA 3ZPYA 1FKAO 1W6PA 3O5SA 1AYM3 4FZ1A 1EV11 3ME2A 1COV2 4LBEC 2P22C 2BGPA 4JI0O 2J1SA 4R9BA 1B35B 3LIHA 1XBFA 2RMU2 4I50B 1RUC1 2OCHA 2Y6HA 2RS52 1EN4A 4JRAA 4IYHA 4ZHNA 3NKGA 3H8OA 2VMFA 4EJRA 2QZ2A 2VUDA 1X59A 3H50A 3D3QA 3T1YB 1DF4A 3ZN4A 5D1IA 4BA6A 2FMDA 1VQ7V 2WNVC 1GFF2 1UOFA 2XBO1 4DV0B 4GZ9A 4N53C 5JVDB 5CA1B 3VBHC 3EJKA 1SQPH 1AL23 1J3QA 4MZUA 3CJHB 3T4ZA 5C5UA 1Q82W 2I45A 4D6TH 1UYPA 2GC0A 2RR13 1N34B 5C5TA 4NWWA 4YW3A 4QPGA 2BVBA 1AXYA 1R3LC 3IC9A 2PZSA 3ZFFB 3WW3A 3MHZA 2F23A 4BQ4A 4I9WA 4JTDB 2LROA 1O5LA 2VTXJ 4B4PA 2DU0A 4J10A 4HONA 3LZZA 4TXWA 2VMGA 4DINB 4ZS2A 3OUSA 3ZN0A 2G9GA 3G80A 4BAYA 1OT5A 3OBTA 5A33A 4AGVA 4M4RA 3ZSEA 4G27B 1IDSA 3WNPA 4XFCA 1UQXA 1HQNA 1BEV3 2GN3A 3TWIA 4OGQB 4DV4O 3OJBA 3C7EA 3IPVA 1N1SA 1CJDA 2VTXA 3O1VA 5H9SA 1DF5A 1LHUA 4QHBA 4XZUG 4FPGA 3MFCA 2HLEA 2ZGLA 4EQVA 2F4LA 1RJ8A 1OJHA 1WLEA 2E26A 5GLVA 1RM1B 3WF1A 4QHZA 3K08A 2W87A 3LOIA 1FAYA 4YVSB 2CL2A 4MYEA 2HWD2 5KAFZ 3DGEA 3PU3A 4JVAA 1VBE2 4UFJA 4X9QA 1NS1A 1YEWA 2C0ZA 3VBUA 4CBCA 1SLIA 4Y1ZA 2BW8A 1POV3 3I2GA 2VGDA 4AEDA 5FPUA 2CGOA 3ST7A 3LPGA 2RS12 1DQ2A 5IK7A 4AL9A 1TUEB 3RVZA 4QPIB 4YVWB 3PJYA 2HWC3 5FP7A 3O1MA 4DR6B 2W08A 1ZWIC 3SXWA 4XYXA 3FLPA 4DR2B 2B4KA 2XWJB 2MNGA 3T0BA 1XC6A 3GCXA 1MS8A 2Q5ZA 4LF6O 4RSUA 4LO8A 4I50A 1U12A 3APQA 4X62O 4PIYA 3HJRA 1XSQA 5FZGA 3U1XA 1W6OA 3A0HZ 4D8MA 5F2WA 4JYYA 2A7WA 3BA8A 4ICGA 1Q6IA 1W39A 4UB6Z 2VWKA 2IXJA 2PHUA 4P08A 1UMIA 4DR4B 5KXCA 4PA4A 5LGUA 1I9RA 3K77A 4Q29A 2XOKG 3BHPA 3MDPA 1MVQA 5K9YA 5B1AC 2EF6A 1KD7A 5JSOA 4I0AA 3B5LB 4ZU7A 3K51A 1H1IA 3WG1A 1IVSA 2KKWA 1LULA 1E1QG 1HJFA 1QQP1 3RPQA 4UF0B 4PF1A 5IT9N 3Q4HB 4OUEA 1OF4A 4RD7A 1KQSU 2CDYA 5K0UC 1WJZA 1W04A 2IJKA 1C8M2 1NXD1 2FCTA 4DO0A 2DYSB 1HWYA 1PNLA 4GB33 2GZWA 2WSUA 2EIJB 1YQ8A 2QKCA 3KT7A 4PDLA 2DE0X 3HD8B 3POGA 2G1MA 1BJQA 4MSVA 4NXMB 2VECA 1AX0A 1OCOB 4E8CA 4TLFA 3RYRA 4B3RO 1GANA 2XAJA 2Q1MA 5GALA 3M70A 1Q6HA 1EPWA 1HNWB 2FKXA 1FV3A 2O14A 2E74B 4NIDA 5C9AA 2Q7GA 3CCEV 3ZYPA 3QBQA 2X5IC 4QKFA 1OA4A 1AX1A 1DQ4A 3KV9A 4W8JA 3O14A 2ZE8A 4QJFB 1KEXA 2CAZC 5FJHA 2HWE2 3T30A 1G8MA 1SZBA 3GB7C 2W91A 4XUTA 3B94A 4ZXKA 4FPLA 4XJUA 4OXSA 2HWF1 1A34A 1KGYA 1Y3TA 4MVZA 2YFZA 4CUCA 5L9BA 1R1A3 2WZPP 4A3XA 5IYZA 5FP3A 5FR3A 4WM7C 1IOAA 1AR81 2P6CA 5EJ1B 3WDWA 5A70A 3JSNA 3ASOC 2XKOA 4X66O 1JJ2U 2DF7A 3WQ0A 4B3SB 2WIIB 5IVBA 1Y9MA 3I3BA 4R9CA 3WZ1A 4FMTA 5A7WA 1OQ1A 4QB2A 3M1HA 3T2MA 1STMA 4AI2A 1SQQH 1TME3 2C24A 4CUAA 1CAUA 4AAXA 2EICA 3AZYA 4JKMA 1KQRA 3MGUA 5B3SC 4N9IA 2DYRB 3WP4A 3OBZA 1NLSA 4Q1PA 1BQPA 2XG3A 2HWB3 2ZGOA 1TUBB 5CISA 1PMHX 3JALA 2QFEA 1LTEA 1ZL8A 2BDRA 4IL7A 1DU3D 1NVPB 5BNNA 3ETPA 3WSOA 2RM23 4XAAA 3NJZA 3CWBH 1GMMA 5LATA 3RJRA 2E3CA 3HKEB 4YXWG 5LY1A 2J7MA 3ZXGA 1WCKA 3ZIAG 2JE8A 4AGGA 2YG0A 5FREA 4QXKA 1SERA 4E4ZA 1VR3A 1XSRA 2X09A 4CU6A 2FZ2A 3NJVA 2IXHA 3OSDA 1W6NA 4IEQA 1O9HA 1BQZA 1YSCA 1OOPB 1KYOF 2UU9O 4YW2A 4C1WA 3CCSV 4XQDA 4DV5B 2ZGUA 2ZNJA 3CMAV 3UNPA 5C4WA 4RQFA 5BV6A 2IFRA 2FDGA 3J7AU 5A3PA 4WM8A 5J09A 5SV8A 4DUWA 4GX1A 3CJIC 3SJAC 1JFFA 3UT5A 3KT1A 4JTCB 4IUGA 3J80N 4XF4A 3CXHF 1J58A 4NR1A 1BXHA 4AFBA 2MEV3 1OZ0A 2WS92 4TYSA 2W5FA 4JZ2A 2PHDA 3ECQA 1W3VA 2RMKB 1LOAA 4P5YA 5L3BA 2WYSA 4UW3A 2VQAA 4H0LB 1S0JA 1N3OA 5IAXA 4KP4A 5JXJA 2PYLA 4BH9A 1FXKA 4FFBA 3T3YA 3RYCA 2FDKA 3WF4A 1BVP1 3PUSA 3MIHA 1RUH2 1KC8W 3BA9A 3MV01 2H0BA 4L97A 1EUTA 1RMU3 1FXVA 2VH9A 3UJOA 3B01A 4GLXA 1TEIA 3BRCA 2JG8B 4MSWC 1QJX2 4O9EA 5F3GA 1VF6C 3SLIA 4JGZC 4DEVA 4FM1A 5I8TA 1S1AA 2W2IA 4AXOA 3B00A 1SFYA 3OGGA 3CLPA 2YBSA 5FOBB 1AYN3 2EULA 2WLLA 3A21A 3AK3A 1VBC2 1MA1A 1HJGA 3FWEA 1NI8A 1WMDA 4YZ1A 3JARA 2P67A 2HYKA 3ZMOA 3H3LA 1ZRIA 5CVRA 2BTVC 1QHTA 4TUYA 5BXZA 3HMYA 4EZHA 5CFDB 2R043 1FATA 4QX0A 3RVHA 3WY6A 5E1AC 4TV9B 5J2TB 3TEXA 2WNVB 1G8WA 1O7FA 4GIQA 4PQ9A 2BE3A 4P14A 2YYOA 1J84A 5BMVB 1FX5A 5C7GA 4FVVA 2Y6GA 1Y9GA 3E2EA 1NR1A 3LEIA 4D6QA 1LU1A 4AYUA 1VBE1 5I0RA 4CPBA 1CEZA 1APNA 5DQ0A 2B39A 3SYPA 3ABUA 1RVF3 3CNAA 5CA3A 5KA5A 1F9KA 2HEYF 1QJY1 5HXMA 2UUCB 1G9AA 1XU1A 3ACHA 4ZXEA 1SF9A 3VL8A 3N4MA 1ULPA 3USUA 3RFRA 4K1ZA 4Q26A 1O91A 2IVIB 3WOGA 1YRZA 2B46X 4X20B 1RFYA 5EWSA 2WRAA 4JGSA 3IZOA 1MQTB 1QNMA 2LGWA 1VQ5V 2AACA 5FYZA 5DZEA 1YFWA 3EHBB 2RCVA 1NE4A 4EWAA 1UXZA 4XAEA 1D0GA 3AP6A 2Y38A 1DYKA 4XDLA 2XMLA 5IWAB 4OLLA 2YIBD 3E8FA 2ZAAA 3UQ8A 3RZJA 2PXJA 1BZKA 4KU8A 4IHJB 2VUCA 3R65A 4PI2A 3VKFC 2E5LB 2A9HA 4K3UA 3OMIB 4HT1T 3HKCA 4K7JA 2UXDB 1CAXA 1ENSA 2KD7A 3T1HB 5AC92 1PVC3 4GQ7A 1GU3A 5KX5A 1E79G 1W06A 4DV3O 1AR73 2VBBA 2P4VA 5GW7A 2WQ4A 3R05A 1FJGO 1RUF3 2VXRA 1GWLA 1FNZA 2XL9A 4XFGA 3V0AB 2K46A 5T50A 3R4SA 1SZXA 4BU2A 2YC2A 1WN7A 1C8M1 1AILA 1FFXB 3W9AA 5GONA 2HEVF 4KHPO 4I01A 5DAVA 1VRH1 2WWUA 5FMOL 1V54B 1F7YA 1JYCA 2R70A 4TN7A 4DIQA 2BWCA 3LSEA 2LO1A 3BAAA 2WQ8A 5C8YB 4XHBA 4CU9A 5L36A 1E5RA 1FPN3 1FD9A 5L3EA 1QF3A 1XMQO 5LRRA 2NLRA 4DUZB 1BK1A 1W8WA 4YFZA 1K8AW 4CA9A 4I7ZB 3LWCA 4KWKA 4XJ9A 1AI5A 1MS4A 4Q4W3 5LP6C 2MW2B 3OPZA 4CS2A 2WNVA 3BIWE 4H7MA 5FZKA 4MGZE 1FNYA 2GSYA 4QX8A 2VMDA 4XTMA 5ISLA 4N53A 5KMGB 1YHFA 1U5YA 2WFF3 3OPTA 1O3SA 4R9AA 1HRI1 2ZKOA 1VIWB 2JVDA 3VBHA 1XHXA 4B08A 3ZBHA 1ODMA 1PM9A 1QXJA 5B1AB 4ABMA 2CDPA 3SDLA 1C5HA 1N8RW 4GMP1 2N7GA 3C2UA 4RS5A 2E75B 3VBFC 1HRV2 4H2AA 1GN2A 2JD4A 2ARHA 1VBA3 3AP5A 1XUQA 3AJYA 3R66A 2YS8A 2ZHLA 2OTLV 1RP3B 3OY8B 5M0TA 4HLTA 1OCZC 1EUUA 5LBQA 1N32B 2AHYA 4XDOA 4E9KA 4P02B 2UUAO 5CA0B 3PNAA 1K73W 2Q7HA 3D0JA 4GH4C 3EMRA 3NAPC 4O4JB 1W9FA 1AP5A 2VMEA 4ZU4A 4IGPA 1PIV3 2Q9LA 4XBQA 1G1XB 2WWWA 4H44B 3J7MA 4META 3WDYA 5LHHA 5IY5C 4CEWC 2JDKA 3LQCA 3ZIXA 4GAZA 1C1FA 2FZ1A 2NR5A 3VHOA 2AW9A 3GZEA 1YCIA 1GZWB 3EXUA 4IHJA 3ZR5A 3CCRV 4CTEA 2PF4E 1RPRA 2X5IB 2W9XA 3RZMA 1I7FA 2XLAA 1W0OA 2VTFA 1ASJ2 1EAH2 1UOBA 2OZJA 1XHZA 4AQYO 2OIIA 3CCLV 3SPIA 3RYFA 1QVGU 4BQWA 4BQ1A 4WFFA 1OCCB 4JDMA 2E53A 3HR9A 2IBZH 1R1ZA 1W2AX 3K58A 5FZIA 3ABKB 1D5NA 4BIFA 4JI8B 5EK0A 4XXPA 2PUSA 2LP7A 1T6BX 2C26A 1R091 4CZSA 2ZGTA 4A41A 4WM7B 3HKBB 4PD4F 2WNUA 3FE5A 2WZR1 4B3TO 4WCEV 2OT7A 2PAEA 4UCVA 2CH7A 5EYPB 3AEIA 1D0HA 3ZMVA 4CH4A 5DG2A 2ATFA 1I5PA 3O0WA 3T1LA 1GBGA 4JAVA 4MV2A 1N0NA 2EIMB 5TISZ 2BTQB 1W6QB 2QCSB 4RO2A 1XMOB 3UESA 2Y33A 2HHHB 4O2BA 1MSWD 2VM9A 1KP3A 3VBSB 2WS91 4IEYA 5DAQA 4DV6B 5CAZA 1S4CA 1MEC3 5IE9A 1K12A 3F7YC 2V4AA 1UIKA 5KMGA 3MPPG 1EZJA 2PYTA 2ZZJA 2JDYA 2J1AA 3SMHA 4E8DA 2OKXA 2H94A 2R062 3K4AA 3TNPB 2FTKA 3GBWA 2WNEA 1AYM2 3O1TA 2PGGA 2RS33 4KQ7A 2FHRA 1BBT2 3AYAA 5FTTC 4CCCA 1RUH1 4GYCB 5JQGB 3OR6C 2QQJA 3URFA 5BPXA 4YLZA 4HKLA 2WLHA 2ZX3A 2PFWA 5K0UA 3OY8A 3CZJA 1Q6UA 2RJKA 5I8YA 3N9OA 3BN6A 1LHVA 4NWVA 5G04L 1QOOA 4D7TA 1PO23 2Q4PA 3KQRA 3GM8A 1ACCA 1BZWA 2DDUA 3NRUA 4DUVA 4LF7O 2Q8OA 2OIEA 3FB5C 1DGRA 1AL22 2HVJC 1V9U3 2FDJA 1PK6C 1VBC1 3S3XA 3POJA 3Q8BA 2JDPA 4XHXA 3MIFA 4GJYA 3J4UH 2X10A 2K1EA 3J8F1 1GZWA 2RR12 4PV1B 3WXPA 5LL6Y 5KHKA 3VHPA 2ZAHA 4ZONA 2X5IA 3RNSA 2AYHA 4TWTA 4Y1VA 5D8AB 2WUHA 5FP9A 4XF1A 1SA0B 3CHXA 4K0KO 3JAKB 2CY6A 2XUMA 2GTSA 4LLFA 4N43C 5T5OA 2VZTA 5LEJA 3DKWA 2VZ3A 4M0HA 1YTFB 2ET1A 4NIIA 2UXXA 4Q2FA 2YXYA 4AW7A 1ZBA1 1TVKA 2A79B 4TLGA 1OQEA 1VBD3 4N9HA 4YW5A 1RUD3 1YQ5A 3T4VA 2DWDC 3N2KA 4L87A 1KJLA 5J37A 2YU2A 3ZVXA 2DVBA 2PTMA 1K42A 3WW4A 1GKFA 1YUDA 4PDRA 5BZBA 4URTA 1VRBA 1HIXA 4U3JA 4DYLA 3E35A 2OIGA 4DR5B 5T55A 3UKVA 4BQXA 4KUMA 3GNEA 2Y60A 3V0BB 1REDA 1R3JC 2JD9A 2ZTNA 4HAMA 3DPRB 4Y26A 5FZBA 5FMBA 1AJQA 1QR9A 1W6QA 4RWUA 1JZ2A 4LT5A 1EY2A 2VNGA 4LIVA 4CH3A 3SJCC 2RDCA 1M06G 5B66Z 1V6LA 5FWEA 2XJSA 5F3CA 4IEVA 1WCSA 1LAJA 5A3OA 2ZE5A 3RRDA 3POWA 4XABA 5JUVA 4DW1A 1P7GA 1QNYA 1V55B 5JH7B 2HWC2 3VDDB 5AC91 3POFA 4AWDA 2UWAA 1B6QA 2BYVE 5LZ6A 3O9OA 2EINC 1JZ6A 4DPNA 3ILFA 4COVA 2A3QA 3LNNA 1NCRC 2V4DA 4AI0A 1UY3A 5JQGA 1VB4A 2B9VA 1LOCA 4DV2B 5J2UA 4TSFG 1XQNA 1ZA4A 4MVQA 1IKPA 2V5YA 2VQ0A 5I0UA 2QDNA 3VHNA 2VQEB 4CVUA 1X50A 5BXXA 3MLJA 4W6XA 3PIJA 1RHI3 1WGPA 2F17A 3PMSA 5IK5A 4UWDA 1RINA 1S5JA 1GUIA 4HYOA 1Q90D 2Y6KA 2P3KA 4B8EA 2QM8A 1I94B 2B9UA 3CJIA 5JLVA 2NZ9A 3AP4A 1H2NA 2C2AA 1A3KA 2AEYA 3ZKYA 3DXTA 4YM1A 1LCLA 4IEUA 4RR3B 1YLLA 4AFDA 4XIKA 3PVNA 1G6UA 1ZM1A 2QGNA 3CKHA 2J1RA 3ABLB 1OSGA 1K34A 4YW4A 4LF9B 4X88A 1GN3A 4XDQA 5FY1A 5K1XA 1P8JA 2Q1ZB 4CCDA 2VUAA 4J7ZA 1X9PA 2B5UA 1PO11 1WCUA 3HPNA 4BISA 5BNOB 1JMUB 5FK7A 2CAVA 4EFEA 5LCWL 3G4SV 2W3JA 4QDQA 3K0GA 1N36O 4FPYA 1W05A 4UYBA 3IDBB 1QY4A 1GQPA 1JR9A 1M90W 5FPRA 1VQ6V 2BSKA 3CDZB 4ASLA 1OHHG 5LGNA 5DZFA 1LOGA 1GSLA 1F15A 3AZVA 1HRV1 3WF3A 5L9RA 3SEEA 4I02A 3L2YA 5BNPC 1JA8A 2ZEZA 1ZZ6A 2CUGA 5GTIZ 1R3KC 3ROUA 1XL4A 2SLIA 3VV1A 2GMEA 1AZDA 1UF2C 5LA6B 2W92A 3CF6E 3VD4A 1VF6A 4JGZA 4Y5SA 4FPJA 1VARA 3G7DA 3SH3A 1A6CA 3E86A 3OUHA 1M56C 3E8BA 3AG3C 2HP8A 2YY1A 4AGRA 4DR3B 1CAWA 3K75B 3AK2A 2CAUA 3MZHA 2R7EB 5DDJ3 3M3QA 5FY9A 2EAAA 3RG0A 3UT0A 4Y4YA 2ZCWA 3D82A 5C33A 3OGJA 5E89A 3T09A 2R9AA 1HV1A 2RDRA 3OD0A 3CZUA 5IWFA 2M7WA 1ZX5A 3THOA 4HETA 1UY0A 3ZIWA 1Y74A 2WT1A 1S0DA 5ABJC 3UYJA 1GM8A 1HB2A 1LECA 4B3MO 1RUI1 4DEQA 4HOOA 3RYIB 1T2XA 2ZEWA 4PDWB 3JBG3 2NM1A 3JD3A 3R4UA 5GJ6A 2QKAA 1WAZA 2UXBO 1K5JA 3APBA 3NNMA 3RMXA 4A6OA 4I09A 2A6WA 1WA8A 2MPFA 3ZMZA 1Q43A 3ZHQA 2HWB2 1GAXA 2ETNA 2GH2A 2XWBB 3TK1A 1NYWA 2ZR2A 2EAKA 1XQ8A 2ITCC 1IBKO 3J7LA 3X2QB 3KF3A 1M5IA 2QQNA 4Z2AA 4ARXA 4AG4A 1BMFG 1N4CA 3S5AA 2DVGA 2CYFA 1HR0O 2F66C 4E2GA 1HDJA 1DTOA 3DYOA 3HN3A 1WP7A 5EJZB 5J96B 3QF7A 3HQRA 2P17A 3BOWA 4CH6A 3SPGA 1CX4A 4A7YA 4OVEA 2WO7A 5A3LA 1N33B 3RMYA 4X6RB 4Z07A 3UM7A 3BTYA 4CEWB 5E1RA 4K6BA 3ASNB 1QJU3 1F23A 3K5NA 3IT8A 2IM9A 2HR3A 3JATB 4XBNA 3JD72 3K79A 5LHGA 3PMEA 1IS5A 1XI1A 1X7NA 4H3WA 1HW7A 1OD5A 2WFPA 4WVZA 2XAGA 4JRLA 2A6YA 1WWYA 3ZHSA 4NE9A 4WVWA 2XJPA 4I3GA 1KKCA 1SLTA 2VZQA 3OGSA 1AYM1 3AKRA 1DZRA 4FPFA 4NHLA 4R8HA 3JAWA 5EBMC 1NQDA 3ZFEB 4XFHA 4IDZA 2D97A 3ITQA 4P9GA 5H9QA 2GC2A 3ETGA 5EFUA 3VD5A 4X8PA 2W52A 1M4WA 4OI4A 1W99A 2Q0AA 3IAQA 3M3IA 4JKKA 3L74H 1PV0A 4LBQD 4NAOA 5LRSA 1RB8G 3SISA 3WR0A 2DTWA 4FT8A 3EBRA 1HN1A 3ZRWA 2EXHA 2C5DA 4BK4A 4WVMA 4B1LA 4OFGA 2ZDIA 2ZGRA 1YI2V 3H9VA 2FDIA 1EN6A 2VNVA 3DCQA 3ZYGA 3WNOA 1OLME 1AL21 3PLQA 1W0JG 1AR62 2WAOA 2JG9B 5A7PA 4BLIA 2ZKNA 4ONUA 2GDSA 3K3OA 3VZKA 1JZ4A 3RWRD 4XETA 1RSOA 2RR11 3HR0A 2ZOEB 2ZE7A 3NNJA 4MGYE 2VCMA 3P1IA 1AB3A 4JI3O 5ACA2 4N21A 4FJCC 1IGOA 3WVJA 2D6PA 4I55A 1UYXA 5GZCA 5LP6A 2EXKA 4MHUA 3AP7A 3OGCC 1K3EA 3DEMA 2YBPA 2PAMA 3VQWA 3TYJA 3QD6A 3KZIZ 2B45X 3UKMA 1GR3A 4Q4Y2 2XASA 4MW3A 5FMDA 3C7HA 4GJZA 4K8XA 2WLIB 1M57C 3ZHTA 3A22A 4JYAB 4BQYA 3VBFA 5J98B 3BCCH 5JZGB 4GKJB 1BEV1 2W1UA 2QQOA 4WVVA 5IFPA 3OT7A 4UXAA 3T4DA 5I0DA 3UKNA 4UVAA 2RG4A 1K45A 3EO6A 4HG6B 4LO6B 2R042 4L9BA 4MH0E 4GWMA 1JUHA 4PDMA 1AROP 1JU4A 4GH4A 5D5PA 1JHJA 1ZLZA 4GMP0 3NAPA 2HEPA 2XR4A 5JCOC 3K4DA 3MLKA 2RJ2A 1Y76A 1K5MB 4A6SA 2VZSA 4IXLA 1X9TA 2JEUA 4JGYA 5JIUA 3BEHA 1POV1 1ULGA 3OB8A 4FPHA 4UVBA 4XCBA 1MABG 4UFHA 2EIKC 2JEMA 1S72V 4RHV2 4BMEA 2NYYA 2HWC1 4OHYA 4LF8O 1QIQA 1V6OA 3NSTA 1SMVA 5FP8A 1FMD2 1NBMG 3ZO0B 5IK8A 2WLKA 1ODNA 3OYWB 5J9PC 2JIZG 1ND2B 4ASUG 4NN0A 4F4LA 5CA6A 2XAQA 4BHPA 4LFBO 4CDQC 4BIUA 2FQPA 5FY0A 1YI7A 2DBNA 1KP2A 4IE0A 1ENQA 1PM4A 3QG5A 4JDNA 2ZS6B 3A23A 3J7NA 2R0HA 3ZDVA 1F2NA 1TAEA 1JMKC 2GMMA 1H1MA 3S0MA 1OH4A 5CB7A 3AZWA 4JQRA 3CC4V 3UK9A 5JXGA 2B1IA 3POEA 2DFCA 2AC1A 4H7LA 2BJSA 4AVCA 4CSWA 3FX7A 3VDCA 4GCZA 3WB0A 5IJ0B 4FPPA 2YIBA 3WDUA 2D98A 4BQ5A 5IYDO 4L0PA 1NZ6A 2DWRA 3WQ1A 3N2GA 1JVMA 1QHDA 1ZBE2 1MS1A 5FPZA 1B35C 2H6CA 5A9GA 4GXLA 5HV4A 4DRXB 2JX9A 3BY6A 4H13B 4CP0A 2Q73A 1P7BA 5EZYB 4GKKO 4V1PA 1DQ0A 3E22A 2LQTA 1SLCA 5L19A 3GWKC 4RUEA 3ZSMA 2W68A 1OFSA 2UUBB 2QJVA 2W1WA 1PGW2 4GB31 5A7NA 1MMMA 1W6MA 4YHHO 3SCGA 3U78A 4GUNA 3T2PA 3SPJA 4EWEA 1LUWA 3I7DA 4YJ2B 1E5SA 3USSA 2W6JG 1UFIA 3ZYJB 2GDFA 3ACGA 1Z7S3 1YFYA 3ILRA 2JIJA 4NRQA 5FZ4A 4CP9B 3WNXA 3ZFFC 1JZ3A 4Q4W2 2LALA 4XDJA 1ALYA 4ORFA 3GWOA 4RGAA 1JZ8A 1N0JA 1AJKA 2XH6A 3F5WC 3MFAA 2ID4A 3TN93 1DQ6A 2G38A 4QMAA 4RQPB 3CEWA 4LF5B 4CDXC 3ZRSA 4GKYA 1I5XA 1H4GA 1R1A1 1PK6A 4N90A 3SJBC 1F31A 1EV12 2W46A 1ZUQA 4KWUA 5CU1A 1YIPA 2ARCA 4LHLA 4LTAA 1IPKA 3SITA 5B5EZ 1SBEA 3WHUA 1OH3A 5JPNB 2ZGMA 3CU7A 4JTOA 1R083 1GO3F 4LF4B 1HNZB 4OX9B 3AZZA 4YG6A 4ARYA 4N43A 3TXQA 2ZKLA 5LA1A 1TME1 2ZABA 4LKEA 5JSPA 5CKQA 1PZ7A 4D7YA 2EX3A 3AYCA 4JI6B 2HBTA 3ZMSA 4HNAA 3VHRA 4I0XB 5HCFA 1WP8A 1J5EB 1RM1C 3H1WA 3BTXA 1NVPD 2IXIA 1JYVA 4MVSA 2W0XA 3WDXA 4YVSC 5FPAA 3AM2A 5JI7A 3RZKA 5CBLA 1LHWA 2XAFA 2HWB1 3L9DA 1IZ3A 2CSGA 4YIPA 2DCJA 4H33A 3E6CC 2Y0PA 3QTCA 4JDOA 4YZ4A 4DMIA 3VKLA 2D6OX 3CX5F 2Q8DA 5BNPB 2Y0IA 2RM21 3VZJA 1CPYA 4C7UA 4JI1B 1KFXL 4N8MA 4QPIC 4OPHA 3AVRA 4PF5A 4CZZA 3JASA 4BB3A 2JGUA 2ZMKA 3JZVA 1OCRB 3U10A 4QT6A 3M7MX 1O3TA 4YPJA 1EN5A 2AREA 1BMV1 3AG3B 4DRXA 1MZEA 3JUUA 4YM0A 5HCAA 5EZYA 2D3PA 2WLMA 5LOVA 3LNMB 3W7WA 1RUE3 1UY2A 2V5DA 2Z5WA 5C3RA 2WPDG 2Q4SA 3DXRA 1D4M3 4PLOA 4A3ZA 5FZHA 2A73B 1W28A 4DR7O 4CCNA 5KUMA 4LO5B 4Y3OA 5A1FA 2W39A 1IHMA 2Z2SB 4P2ZA 3EB7A 1OHFA 1BLZA 3ZYRA 1V6JA 4Q0VA 1Q3EA 5FL7G 4XE9A 3AG7A 1MPXA 4YJ2A 5E16A 1NCRA 4IIJA 5EC1C 3K5MA 2AGAA 1ZTEA 4FIPC 1GM7A 1YXWA 2VZVA 4YY3O 1VPHA 4ZI7B 3ZFGC 4DS0A 3ZOIA 4NXNO 1ROPA 1UKGA 2MEV1 5LMNO 1ZRRA 2RN9A 3NWKA 4XW3A 5CG8A 1W2TA 1DZQA 3LAGA 2OXBA 1XE0A 2P2KA 2XVGA 3WP6A 3VQYA 2DYSC 1OV9A 2EIJC 2OQ7A 3ZMUA 3RGBA 1G9DA 3IWZA 4QB6A 1P84F 1OLQA 1Q8IA 1OCOC 2Q8VA 4P9JA 4JI7O 4YIOA 2HFEC 3CXCU 2YEVA 1N3PA 5AVAA 4F6RA 5ANNA 4A44A 4EEQA 3CQOA 3HAGA 3IIIA 3I2IA 4UCRA 2DYCA 3MAQA 3MHHC 2LUWA 3WF0A 2NNUA 4A7ZA 3NL1A 1RMU1 1UPGA 4P30A 5EIYB 4X64O 2GC1A 4LA3A 3W7UA 5FQ0A 4BIOA 3LDRA 1TGOA 3X29B 3CRQA 4UFZA 3A0BZ 3V65A 4Q0PA 4GT1A 1GNHA 4SLIA 5F5CA 1H9PA 3U75A 4Y22A 2KXLA 1JOYA 3ES4A 3BI3A 1AYN1 4AQTA 2WWSA 4Q5OA 5J7MA 3ALQA 2GHYA 1QQP2 3O12A 3Q8FA 1U96A 2KR2A 2R041 1W03A 2ORXA 2Q5TA 2PHRA 1XU2A 1IBLB 2DWEC 2XLGA 2X6AA 4NROA 5IYBO 3MF6A 3AMQA 4J80A 1SCRA 2VCCA 3ETEA 1ZAUA 4JI4O 1J3PA 2DYRC 2ZHMA 4EN0A 2XNDG 3LA2A 1U5XA 3VDBA 3K48A 1Y6XA 2R073 2D3SA 2F95B 1AVMA 3ZMTA 2RDSA 1BYHA 3BABA 1L0LH 5F2SA 2QE7G 4IESA 4MVMA 4Y1YA 3U0ZA 2QWRB 1RVF1 1DP0A 4Q4V3 1WNSA 1JZ5A 1NOVA 1CD3G 4OULA 4U7OA 3I3QA 5LXTA 3K03A 1Y4MA 4AK3A 2CV6A 3R4DB 4ZOLB 4UFMA 1ZNPA 1DGRN 3CCMV 1V9PA 5ABJA 3ZKUA 1S2BA 3H7JA 1OVSA 4MVTA 3ZX6A 1XNRB 4RFT0 2VZPA 2A71A 1DHKB 1CXZB 4K40A 5EP9A 2BOBC 4DB5A 2EIGA 4W4LA 2WDBA 4Q0UA 1OOPC 3SKJE 4DOUA 1NCQB 1A8MA 3ZN6A 4DFSA 5JOYA 1AR82 1GOFA 5LYJA 1WA4A 4XUNA 1L8DA 3APOA 3KMHA 4X6QB 4H14A 4Y20A 4KG8A 3S30A 3QLQA 2D6NA 3BU7A 5K7PA 5CFCB 5LMUO 3I3EA 1PVC1 1COV3 4JZGA 1WKYA 4I3PA 2LW8A 1AL0G 2RMU3 4WFGA 5A6YA 3B09A 3RW0A 2I2SA 1RC6A 2RS53 4HSLA 1AR71 5CYYA 4PDVA 1RUF1 1UZ0A 5IJ9B 5LWBA 2ADQB 3MLLA 2KB1A 4NO4A 1QU7A 4FAHA 5FZMA 1W0KG 3TEWA 3H0OA 2ZGQA 4FAGA 1RPOA 3MICA 3VD7A 2Z4FA 4FLZA 2Q68A 4DK0A 1C57A 3OTOO 4L2NA 1LU2A 4TV8B 1SDDB 2WO1A 5FZFA 4LCUC 3DYMA 4MTOA 3AP9A 3ZHUA 4DUYB 1NQJA 1YC61 1Z2GA 5L73A 3IDAA 5LK5A 3LF7A 2EIEA 1R73A 4O2AA 3I59B 4LBLA 3A4UA 3E6BA 4E4EA 4NRPA 3FBYA 1SPPA 1FPN1 2GUZB 1MNGA 4XQ4A 4LHSA 5I91A 3ABTA 3LB9A 5HXVA 4PQQA 1QDCA 4COYA 1X82A 4IGOA 5FYIA 4DZGA 1DLCA 2BCCH 1XNQB 4QE7A 1I08A 3H1KH 1YQ2A 3L71H 4K8RB 3OMAB 3I3DA 2AUYA 3GYDA 4Q4W1 1YI9A 1G86A 5IVYA 1SHWB 4BW5A 4J41A 3V64A 3E89A 2DN9A 2JG8C 4FLYA 1OLMA 2WFF1 3PJQA 4FOQA 2VC9A 3KGZA 3THCA 3WV6A 2OW4A 1NQTA 3AG2B 4KWLA 4XC9A 1AI6A 1O9GA 3HOBA 2IU3A 4FI9A 1YJ9V 2CTVA 3O1OA 5FZ0A 1GYKA 4O4LA 3AMHA 3LGRA 4URAA 4CDUB 4BWOA 3AC0A 2O8OA 4S2GA 4JI5B 1VBA1 1Y67A 3OAAG 3BTAA 4LJHA 3A7QA 5CFDC 4PBOA 4OI0A 3WP3A 5FKBA 1N1VA 4ZOLA 1MS0A 4W4KA 4ZHQB 4JV5B 1SQVH 4NB5A 4X1KB 1RUJ3 3A0RA 5CN0A 2CNAA 3T08A 4DRVA 4ZKTB 3VUOA 3WQBA 4CCLA 2RDNA 5G05L 3H9AA 4LBQB 2HWD3 1PIV1 3B02A 3VZMA 3WU2Z 3O65A 3P5BA 1IS4A 4IEOA 4NIAA 5B2GB 4OHWA 2XB6C 4DV1O 5ITZA 1IBMB 1KUQA 3PDQA 2XXZA 4X1IA 4H37A 5DDJ2 3CPWU 1H8TC 2RS13 4XILA 4DR1O 1N3QA 2HEWF 1HP8A 4O4IB 4MTGA 3ZXEA 4YYOA 2HH9A 3B9IA 2C4XA 2JE9A 1MQTC 4LKFA 2W0FC 4P9XA 3S5QA 4O9GA 3KLSA 5JCOA 4GKXA 2O8QA 1V6MA 4ES8A 2VS0A 4FPOB 3SGIA 4CDXB 1LOEA 4J11A 5IJ9A 2ITDC 1S0VA 5D21A 3A8TA 4LOTA 4CCMA 3Q8EA 3O1SA 3KG2A 4JPRA 3KT4A 4LBKA 3KF5A 3OCPA 3PVBB 5F5AA 1RYYA 1W8ZA 1AXKA 3UGGA 2L35A 2ARBA 4XZPA 4FOWA 4O4HA 3ES1A 1US2A 3H8UA 2Q0OC 4OQ9A 3OR7C 3N7LA 1Q8OA 1H2KA 1POV0 1IS3A 2XOMA 5FZOA 5IK4A 4CDQA 2E6VA 4UB8Z 1HNXB 4IV1B 2X53S 3NJYA 4BW9A 5LBEA 1TMF3 2FYUH 3WEZA 1S0EA 4QKNA 5C3QA 1ENXA 5A7OA 1AR93 2YIDA 4W6YA 1MEC1 3WINE 5A1AA 2ZZQA 1QJU2 1HDKA 4CE8A 3BALA 1QQCA 1QJY2 2WKKA 4XJAA 3H7YA 5JCTA 4IEWA 2BNOA 1Q8SA 1S2EA 2XONA 4XPVA 1V54C 1JI6A 3E5QA 3HNBM 1VIBA 3WUCA 1HQLA 3IDEA 2YXSA 1YQCA 3CRRA 4MXWB 1B35A 1RGSA 2RS31 5FBJA 4X1YB 5A1LA 2F4VB 4QX7A 2ZIMA 1MR5A 5BR8B 2V4VA 2WSVA 1VQKV 1VQLV 2OA2A 3C90A 3JCIA 5JAXA 1YYNA 3MIBA 2VY0A 2D5HA 2DQ0A 1K3IA 1OD3A 2HWE3 3I3MA 4A7KA 3QACA 1PO21 3BIEA 4FTBA 5JVDA 2DOSA 3WP5A 5CA1A 1COWG 1JOBA 2LTNA 4MTFA 4LBQA 2NN8A 5FY4A 3OD4A 4LKSA 5L9VA 2VQFB 1RTVA 3CJHA 1V9U1 4LH7A 2KG7B 1YTFD 1EPZA 4D6RA 3PURA 3ZFGB 1JH5A 3ZFFA 4UW5A 4D3WA 1KU9A 3GHNA 3VZLA 1M1KW 3S7IA 1XYNA 4QU1A 1OKOA 2ZMLA 4JI2B 2VVDA 3TBDA 3RI9A 2Q7EA 1G9BA 2XT9A 5FZ7A 2JK5C 2FD8A 5DUXA 2QA4V 4V2VA 4GZRB 3PHMA 4J6GA 4I0BA 1DLLA 1CONA 2R32A 1VRH2 1XRUA 1PGSA 3O1UA 4HK8A 1VBD1 1KRIA 4KFMA 1RUD1 3OUJA 2UXNA 4XBLA 3T1YO 2Y4UA 3FAVB 1TNFA 1XPWA 1PZ8A 2BQPA 3SYOA 1LOBA 3LDCA 1W8HA 3PUQA 1US6A 4DV0O 1CZTA 3ILNA 1LRHA 4OI2A 2YICA 2PI5A 5E88A 5IVFA 1ZRDA 4DUXA 1XNDA 2UYAA 3VBRB 2JGDB 2PYJA 1OUXA 4Q1RA 3OEAA 5HCHA 2Y26A 4G4FA 1GZCA 5A32B 2FCUA 1N34O 1OCCC 4JCKA 2X7RB 3HB3B 3RVYA 1HRI2 4UV9A 2EIDA 4LR4A 5I0SA 4BCUA 1QMJA 4YVSA 1V6NA 5BY5A 3ABKC 3SH4A 4UW6A 5KHGA 2ZACA 1NA1B 4IEPA 3JD2A 3OG2A 4NPRA 3CS5A 2OPKA 5A3TA 4JI7B 1TQ5A 2DFBA 2WLPA 2MK3A 3FB7C 2ZX2A 3K06A 4QPIA 4PELA 4YVWA 2GC3A 1B06A 4XACA 4MVRA 2FMYA 2WO2A 4KWJA 1Q8PA 3FB8C 4PHZA 3EYPA 5LY2A 2V1DA 1PD3A 1C3HA 1QVFU 3VLBB 2EIMC 4ISRA 1S5LZ 4LC1A 2P06A 3DECA 2DVFA 3DN7A 2VAUA 2UXCB 4NHYA 4MGQA 1Q5OA 2WT0A 3VBSC 2EIBA 1L7LA 3C7FA 4K8FA 2VULA 5EYYA 4BXSV 3VBOB 4PA3A 1SFNA 5DEDA 1RHI1 1UKRA 1JZ7A 3GXUA 5IW0A 4UCUA 2R9RB 1S76D 3WF2A 4M3CB 2RNBA 4A2UA 2L6LA 2VCBA 2JECA 3K59A 4ZPIA 3ZXDA 1MZ5A 2P37A 2PHTA 1S5HC 3RS6A 4FQ4A 2OZ6A 3PL0A 2A06H 4LHKA 4HMZA 2D40A 2NP0A 2YPJA 1BSMA 4YW6A 4I4TB 5KBFA 3T4HB 4UF0A 4FLWA 3Q4HA 3ZFGA 5J3UA 1Z5WA 4CEYB 2W1QA 1DIWA 2Y34A 4DR6O 4EB6B 3ZCCA 3B69A 5H9CA 1R092 2DCZA 2XHBA 4DR2O 4Z1VA 4AVAA 3M3EA 4AFMA 2WZR2 1QJX3 3NNFA 3DSQA 1F8VA 3VD3A 2F93B 3RZLA 4COUA 4X65B 5FLIA 3B77A 4L99A 4QGMA 2Q69A 1EZVH 1S0BA 3RWKX 4FPCA 4N7UA 3OMNB 4XQWA 5T54A 1Z5VA 4DR4O 1H1AA 2DV9A 2OWOA 2VUJA 5H6RA 5D8AC 3POSA 2VZUA 2IFWA 4B7KA 3HIFA 1DG6A 1CAVB 3KD4A 3DC5A 1YJNV 4LWSB 3LEKA 1S2KA 1T5EA 4OUSA 1VALA 5FPXA 3HNMA 4MGTA 1VQNV 1RJ7A 4DV7B 3J7HA 5DN2A 1UW8A 3BTZA 2ZM6B 5A7QA 2EBOA 2P3YA 3WNMA 2IJIA 1O59A 5LASA 2ADEA 3FJSA 4AAPA 5KXEA 3H1IH 4FM0A 3IBMA 3JQWA 2EXJA 1F5JA 2VWJA 3GBGA 1W0PA 5DDJ1 5GZGA 1Q8VA 1VAKA 2VE1A 1GP6A 3ABMB 1QOTA 3OGVA 5F6KA 2DVAA 4LFCB 5FLXN 2DCYA 4NXMO 1YO8A 3N7MA 2P1BA 1OC1A 4R4XA 3D36C 1GN6A 2ZCEA 2B42B 4LEJA 4W65A 3LPFA 4NHXA 3E1F1 1HNWO 4WZCA 3T2TA 3DPRC 2Q6AA 5FLJA 3JBG1 1ND3B 4YW7A 1I0HA 4BK5A 4KGGA 3G71V 5H6QA 4QXCA 1TUBA 4IETA 1SQGA 3WB2A 4LQRA 3ZJZA 3AYEA 4LXLA 1SCSA 3QCWA 2VW0A 4AHYA 5CB4B 5F3EA 4FQZA 3T1CA 5CMUA 3J8F2 4LUKA 5A3NA 2B8MA 3DGTA 3IGAC 5CKNA 1PMIA 2R6QA 4LLOA 4XTPA 4BOWA 5IAVA 3ZS8C 5C4WC 1V55C 1G6NA 1IX9A 3HKEA 2QQUA 2QUOA 4HANA 1UPIA 3VDDC 2QJ1A 2YXHA 4DXRA 3AMPA 2G9FA 2YUEA 1ZBA2 5JIAA 1OA2A 3LA3A 1E5HA 4B3SO 4Y33A 4MUVA 4LK6A 5CEHA 1AUYA 1OOPA 5B1OA 2GV9A 1CX1A 4CUGA 1ZZ8A 1RUE2 4WV8A 4XJZA 1FS0G 2ZEXA 2P4KA 4BYYA 1QJU1 4JI0B 1UZWA 2W95A 1H8TB 1GP5A 1AI7A 4UCTA 3HPLC 3OEHG 3HN1A 5FAXA 5CBFA 1NUKA 5FYVA 2A1XA 3ACIA 1B04A 1ZZCA 4HPKB 3INAA 3A0KA 1FXKC 3POBA 1PP9H 2JWPA 5DECA 4QE9A 3CP1A 1UOJA 3M2MA 4RR3C 3GZAA 2UU8A 2PHLA 1KECA 1WB7A 3ABLC 3LDEA 2D6KA 2G19A 3S6PA 2FB5A 5FZEA 5I0TA 4ZKIA 1ENVA 5BNOC 2QZ3A 4CS4A 3ZYFA 1QH7A 4B4QA 2ZR3A 4QPWA 4IV3B 1AP6A 4BR6A 1YIFA 5FKCA 2JJ6A 1BHAA 4LUMA 1OUSA 4KH9A 3ENRA 5T5JA 4AQSA 1JS9A 3I97A 1OURA 4DV5O 1H2MA 2OCCB 1K5SA 4LBNA 4DXTA 2TUNA 2ZJCA 3R6SA 2YUAA 3QO8A 5FYYA 3M8LA 2G4IA 2BOCC 2K2SA 1OQDA 3IJ4A 4RL7A 5F1RA 2BP6A 1S0CA 1NAEA 4Q8KA 1MG1A 1W2OA 3I8TA 2WINB 2JG8A 1US3A 3PTRB 4CP2A 4XMAA 5FXWA 4ZBMA 2ZGPA 1IQAA 4DV4B 4HVRA 4C0BA 5LA2A 4RN5A 3GCWA 5BYNA 3RYKA 1HXS3 2CTQA 2YV8A 4L92A 4RGKA 3WT3A 5FZ6A 4NPMA 1W9TA 2WLQA 1JW6A 3SKVA 3RZZA 1LR5A 1QH6A 1TVGA 2P6HA 5CB4A 4ISQA 2K0GA 1UAIA 3B40A 1VB2A 3WG2A 1K97A 4QPYA 3WNNA 2R0FA 1GH6A 5CFDA 5LEKA 3OE7G 2J1UA 1GNZA 4TV9A 1MOFA 5J2TA 5IUQA 1ASJ3 1EAH3 4RA0A 3UO2A 5FRAA 1OF3A 1PO12 5DXDA 3VN4A 3MD0A 4P5HA 4TSVA 5BMVA 1BQ0A 4I9QA 2GH8A 4PDWC 3N9MA 1WW6A 5HCBA 4G3YC 3N9LA 5T3NA 2PA7A 5FZ9A 4YGBA 4UOJA 5C8WA 5A33B 1REFA 2IUWA 3O0VA 3ZXJA 1DGSA 5K1PA 2QTWB 1MVEA 4XFBA 2ZHNA 3H8XA 1H8TA 3X2QC 1QLEB 3G6EV 4LF6B 3B8MA 4J7JA 3IPVB 2DTYA 4X62B 1QGLA 2GP5A 3L75H 4BPZA 3FZ3A 5DUVA 4BJ0A 1TZOA 3SCHA 4EFBA 3IAPA 5DPNA 1BT8A 1O4YA 4DNYA 4X20A 2JKBA 1VEWA 1MQTA 1H2SB 1TA8A 4INDA 4FLUA 4FZ0A 1RXFA 1VAVA 3LFIA 4F83A 2QEXV 3THDA 2QDOA 2P3IA 2ZGKA 5C8CC 4FTEA 3K2OA 2BWAA 1OXCA 5JI9A 3JSLA 2VOVA 3ZSLA 2XJUA 3OM3B 3SH5A 3LDBA 4HXCA 3OEEG 3TXSA 3W7TA 3VBUB 5IHRA 2GBOA 3ASNC 2IW5A 4HVQA 5KHHA 3L2HA 1YFXA 3AG4B 4AEDB 1JYWA 1GRJA 2X05A 2LS6A 4Z82A 5LK7B 3DC6A 2R063 3GF6A 4JASA 4DXSA 3N3HA 4GD4A 3B3QE 2JDIG 3LSSA 3G67A 4WBNB 1AX2A 1PVXA 1QXPA 1RUI2 4V2WA 3ZFEC 1BBT3 4ITCA 4XJ8A 2UUCO 2JKXA 1UWWA 4I5SA 3J9SA 4MVOA 2YI8A 2XKPA 3V0AA 2YSUB 2D2CB 1CVNA 5B4XA 2R9IA 1VP7A 1GM9A 3CB2A 3JQXA 3I56V 4G9SB 5EIBD 1FFXA 2ATKC 1W6OB 4B3RB 2XDVA 2QQIA 4IQPA 3RZGA 3DV8A 1ULOA 1NXMA 1Z78A 2OYQA 2GU9A 3JAMN 3LSUA 5IWAO 1F4AA 5C8YA 2JG9C 3JCUZ 2AENA 3U07A 4JKLA 1UCXA 5ANQA 5JXIA 5J36A 2E5LO 4RS5C 1QDOA 1Z7S1 3TEYA 2UXDO 1XJAA 3C3TA 2YC4A 2JJ1G 1VQOV 4JQTA 4P9IA 4R9DA 5F6LB 4ZY9A 4B3NA 3ZXKA 4NIGA 3T1HO 5AVPA 3SQOA 3D0SA 5DN6G 2PHXA 2QWPB 1MACA 3DUIA 2RE9A 2LJ2A 4NTXA 3BOPA 2VVFA 1F51A 3O7OA 2DJVA 3TN91 4JTNA 4X66B 3HT1A 5B1BB 3RYPA 5AFEA 1W8OA 2Z5UA 2H0VA 1JODA 1GLHA 4Q6GA 5CADA 3WW2A 2P5OA 3SEPA 1VQ9V 4FLTA 3VKOA 5JZGC 2C9AA 4IYIA 5KHIA 5F3IA 3P6BA 1WZXA 2RDQA 1GK9A 2R1DA 1R081 4P9YA 4BLJA 2D7FA 2YXLA 5C9AB 4HKOA 1S55A 1JYNA 3ZHVA 1G9FA 2MHFA 2BBAA 3FHAA 2PN5A 5CA0A 3IN9A 2M6YA 1RUJ2 2O1QA 2CTRA 4CU7A 5CNAA 5C70A 2R16A 3IM0A 4DUZO 1ZRFA 4O4JA 2H8PC 3AMNA 2XJVA 2QDRA 2QWNB 2PQQA 3QO5A 5EPAA 1K5MC 1H30A 2L9LA 1W90A 4FFFA 2CK3G 3WDVA 5IYZB 4LK7A 4E4DX 4IGQA 2WNUC 1O6UA 2D5FA 5A6ZA 2IU0A 5A7WB 3LEMA 1AJOA 3M3OA 2UU9B 2OUHA 1H8HG 1L7QA 4C0HA 1PNFA 2XQRA 3BPSA 3IB3A 4WBNA 4HVOA 1CAUB 2YPDA 1QWRA 5FFOC 1C28A 1NH2B 1ND2C 4HL0A 2WN2A 5LB6A 4LFAO 4TOIA 1ULEA 3OEBA 3KV4A 2XHNA 2Z69A 4B29A 1RUE1 1N32O 5FYMA 4FXKB 4WM7A 3ACLA 2VBPA 4MGKE 2LW7A 3HKBA 5LBBA 1WBLA 3JALB 1D4M1 1MS5A 1ZL8B 1UIJA 1BEV2 3LFMA 5L7OC 4YJ3B 4JF3A 3N35A 1Q86W 5BNNB 5A7SA 3ZM8A 4FTSA 4CYDA 5EYPA 1DQ5A 4DW0A 2WLJA 3S57A 2ADDA 3LSQA 1M9NA 4Y1UA 3KVBA 4JAAA 5FUPA 5KC5A 3CO2A 5BNQA 2GNTA 2HJDA 3H1YA 4CCKA 1JHNA 4FP2A 2QQKA 3K46A 4QX5A 3M4FA 2LFRA 4W6WA 1VBB3 2BTQA 3T1MA 5K4LA 1Q56A 2Y69B 3G6BA 2BERA 2N05A 1XXNA 1QOSA 5GLUA 1W6NB 2YDEA 1TMF2 3VBSA 2DQ3A 4XBFA 1KDMA 1AR92 3FFZA 2VZ1A 4Y5TA 4AILC 4J42A 1KB9F 2WR9A 4UAPA 3K57A 2DMXA 4HBNA 5AG2A 3C8XA 5C4WB 4XUPA 3W59A 4JI8O 4IE6A 3O0XA 4YGCA 2PMWB 3K9AA 4XF0A 2WAMA 1PNGA 4MVUA 4XIOA 2R49A 3LA7A 5EIBC 4WM8B 2BEOA 4C90A 5D5QA 2W47A 5JDBA 3SYAA 4YGDA 1JFFB 3UT5B 4Q4X3 5EJ3A 1SQ4A 1RUG3 3ZLIA 2PQSA 5CKMA 4BWAA 1UO9A 5H9RA 5IT6A 4YG0A 3NV4A 3A0NA 1IG0A 2QM4A 4LH6A 1YVWA 2WZEA 2F43G 3CCQV 2QE3A 2UWBA 2YMZA 3OGRA 4P00B 1CWPA 1XMOO 3C7GA 3CBNA 2ZX0A 1N47A 2HHHO 3KV6A 4H55A 3P3PA 1VE0A 4RQPC 4QU2A 4NAMA 3K3NA 4DV6O 1QXRA 1RIRA 1FXKB 4FFBB 2A3XA 2P4EA 3RYCB 2J22A 5FO7B 4NUBA 1IKQA 2FDFA 5KHJA 4CH5A 5ERLA 2E33A 2UYBA 5D8AA 4YG3A 1SA0A 3W7XA 5JOWA 3JAKA 1RL3A 2CTPA 4PJYA 3JCZA 5IYCO 5C93A 3EVKA 4K35A 1ENRA 5FYCA 4GB32 5HV0A 4OQ8A 2YROA 1XE7A 3ZYBA 3GDBA 2AXTZ 2PHWA 2P7TC 2R071 4YNIA 3TOJA 4F6EA 1AR4A 4MT8A 2WLLB 2HKOA 1EYBA 4COZA 1HN0A 1XNAA 3H3ZA 3JARB 3AZXA 1J95A 4YJ3A 5A80A 5A3WA 1CGPA 4Q4V1 3WG7B 2Z79A 4IT5A 4EN8B 1CZSA 5FWJA 4TUYB 1XBLA 5CG9A 2V7QG 3DKQA 4UW4A 3D36A 4XVHA 3LD8A 2R1BA 3NV2A 4KL1A 3KWVA 1JX9A 3V0BA 3WW1A 3BGAA 5FOJB 4AFAA 3FYEB 3DPRA 2FL4A 1OCRC 1HX6A 1VLNA 2D6LX 2VZRA 4B4RA 4LA2A 1H6YA 1T6GC 3SJQC 5FUNA 1J3RA 1R1A2 5JOZA 1JYIA 3KKYA 3H1LH 1W8UA 2W94A 4C8DA 3WG3A 2F1MA 4ES9A 1PX4A 3I2HA 3B2EE 3JD73 2VU9A 1W9SA 2OT5A 3GALA 2WABA 4WF9V 4DV3B 2PAKA 3E8GA 1PNKA 1FJGB 2BV4A 2WSSG 1CIWA 3K9SA 3MW4A 5JH7A 3TCUA 3USUB 3VDDA 1VF5B 5CIRA 1TME2 4PLNA 1URFA 1WLTA 3ZN5A 1COV1 3THPA 3W7SA 3RN4A 2Y6FA 4DQAA 5FPBA 1ST8A 5C71A 1O3QA 2RMU1 4LIUA 4KHPB 5FZAA 2RS51 4I0WB 4YW1A 2BPA2 5GZFA 1Q7YW 4HSJA 1WCQA 5A3UA 4MGIE 4FLXA 4DR5O 4D94A 3TRSB 5DAXA 3FFQA 1LHNA 1XMQB 2PLV3 2VG9A 3W20A 2RM22 5JR7B 4PI0A 3RBZA 3KCXA 2W6IG 2LFSA 4R50A 3HKCB 1CAXB 1UNBA 1AR63 1CPMA 5FXXA 4Y1XA 1GZ9A 4XCAA 1UU5A 1CN1A 2KM2A 2E7TA 3M8AA 4NTWA 3TNQA 2Y6LA 5C8CB 3GJBA 4RR3A 3JYCA 2A70A 3RI8A 1NTKH 1BMV2 5KX5B 1NG0A 5ACA3 1ZSPA 1H38A 1XREA 4UFKA 2CHHA 2XJQA 3EFFK 2LW1A 1NU1H 4FFGA 1QJFA 1WLWA 1V6IA 5FNVB 4AVVA 1CJPA 5BNOA 1XYOA 2QKSA 4AZZA 5GONB 2YFUA 3JD4A 3J81N 3MEPA 1A78A 1UY1A 4DV2O 4HN1A 4Q4Y3 4BMBA 1NY72 2AZ5A 4MG2A 2WN3A 4J1XA 3MYXA 1Y66A 3PN1A 1KJRA 3DXUA 4UFIA 4YZ3A 2VQEO 3E97A 3TB0A 3OW2U 3CRCA 4AEKA 3MF9A 2OYZA 2UUAB 1V0AA 2Y6JA 5FZ8A 3ASIA 2VO5A 5T5LA 2PY5A 2KSDA 4XF9A 4KG0A 1JXNA 3PUHA 2Q8CA 1UPSA 5SV5A 5IVVA 1MS9A 2MEV2 1I94O 5LA6A 5B1NA 5FZCA 1L1FA 1RUJ1 4LO7A 2E7QA 4ASKA 1NE6A 4ASMB 5JOXA 4EKWA 1SBFA 3AK1A 4N53B 3VKNA 2Y0OA 4PA6A 3WCRA 1FOD3 2JDUA 2QWOB 3VBHB 4LF9O 3ZRVA 3B8NA 2WWJA 1F4NA 3HNYM 2HWD1 3FLRA 1W0NA 1GV9A 4D69A 1F5FA 2W1SA 4QXBA 4AQYB 2J1EA 3LUTB 1BCCH 3HQUA 4IW3A 1AI4A 4PIZA 1XE8A 1H6XA 5GLWA 2HBUA 4UT5A 3P32A 3J26N 4RS5B 3NO8A 2O57A 3KGLA 1UZVA 3OUFA 3MUY1 2Q67A 2RS11 5TSWA 5E79Z 4O65A 4RHV3 4E27A 1HKDA 1SETA 1SLBA 3UV9A 3RQ0A 2DCKA 1RMU2 2JS5A 3UKTA 5CBGA 3JD0A 3B4SA 2GNBA 1FMD3 3WCSA 3RYIA 4PDWA 4B3TB 4X8AA 2VOXA 3E83A 5KWRA 1NKGA 3QOPA 3T2QA 3MI8A 3ZMNA 2ENRA 4FM2A 1MS3A 2OPWA 4SBVA 1QLNA 4QWNA 1AYN2 2BRTA 1NCQC 3HVDA 1AR5A 4QXHA 2VNOA 3AFGA 4NRMA 3TGUH 4CP1A 4WZFA 5EBLC 2C6SA 4DO2A 1PM7A 1ZZ7A 5LGTA 4AHCA 2IXKA 1DLBA 4J7KA 2ZBJA 1JQ0A 4GX2A 4DR3O 4PCRA 5J1XA 2NMNA 3IDCB 2I74A 1JUIA 1ONAA 1BS3A 4S2HA 5CFCC 1BVVA 1NJIW 5DUWA 4AI3A 5F9TA 1ZBE3 3RYFB 1ZYBA 4Y4RA 1FXZA 5C8CA 1LODA 3K3WA 3GVMA 4MS2A 3I54A 3TEZA 1WB8A 4UXNA 4GWIA 1TMF1 1WLCA 3IIAA 4CEWA 5KXBA 1AR91 1K4CC 1IXMA 5FNVA 3TAYA 5FYBA 3VZNA 3JATA 2WNUB 1RVF2 1M93A 4CCOA 4BDVB 4E4HA 4Q0SA 2ORZA 5FYUA 2NLJC 2CH7B 2ZDIC 1BGYH 2YHJA 3Q8AA 4QPJA 4Z1MG 1VQPV 4RGGA 3ATGA 4G2KA 3NJXA 2A6ZA 1IPJA 3F7VC 1D7PM 2P34A 4QD2A 5IYYA 3ZFEA 1K9MW 1DGLA 5FO9B 1H2GA 1E1RG 1KMIZ 1RXGA 5KR7A 5JJNB 3D4KA 4JTAB 1WMFA 2QQWA 4LO4B 3SC7X 4FLVA 1VAMA 3NNGA 5GZEA 5LA9A 4O2BB 4LF7B 3FHIB 3TETA 3WNKA 3BKZA 3UCSC 2B7YA 2HKXA 5L7OB 3BUCA 3KCCA 2HWE1 2GNDA 2EZOA 2A5ZA 2ODMA 4YM3A 1F4HA 5JR2A 2RJZA 1N33O 5FBZA 3WNLA 1JBCA 1LOFC 5DUUA 2CDOA 4QDRA 1GWKA 1WW4A 3AG2C 4JC1A 1UD1A 5FZ3A 4E4SA 4K0KB 2JG9A 4CU8A 1PVC2 1EV13 4J25A 4I2OA 2XHKA 3I49A 4CDUC 4FOYA 4DK1A 2ZMNA 2VXJA 3PVEA 1SZTA 1DYOA 2P6JA 1RUC3 4J9YB 4AVTA 2IXLA 1AR72 1RUF2 1A32A 5L3CA 2EXIA 1S3JA 4LFAB 5K0UB 2YGLA 2QNKA 4AI9A 2F4PA 2WJSA 1FPOA 1VF7A 1REEA 3VD9A 3ZXAC 4ZS3A 4NJ4A 3NQHA 2BNNA 4TT3G 2XBO3 1TNRA 1PGL2 4XFIA 4AVSA 1LHOA 2A6XA 4NIHA 4QNHB 1H0BA 2AGSA 3OF1A 3MDSA 1GOHA 3LKJA 1HXS2 1X33A 2WLIA 3FC0A 3FD9A 3AKPA 5BY1A 3JB8A 1V00A 2FDHA 2P90A 3K5OA 1FPN2 1SC5B 5JZGA 4CC5A 2DW4A 3WQ7A 3CRMA 4JGYC 4QAWA 3ZXLA 2Z42A 1IPSA 3ICXA 1XILA 1YDXA 3I2JA 2EA7A 4GALA 5FCCA 3E8HA 1K33A 1FAFA 4YM2A 2QR4A 3JXSA 3W58A 3ACFA 4R7CA 3K5LA 1DF0A 2WFF2 1W9YA 1TVKB 4W50A 3CC2V 4ZIBA 1K5MA 3N2KB 2GAUA 2V09A 5J48A 3D8CA 3D3AA 5AFBA 1Q81W 3FUOA 3AX4A 3HKDB 5L3FA 2JEXA 1LGNA 3T0DA 2VJXA 3ASOB 2V72A 5KA6A 1VBA2 5LA0A 4R4ZA 4JYBA 3F95A 2Y48A 4F8AA 3VL9A 2QBXA 4WFHA 5JMCA 3IAYA 2WNOA 2NQYA 1GWMA 3ZHRA 4U3JB 1JU3A 4JYAO 4P9WA 4NTYA 3I2DA 3W5NA 2DU1A 3BVCA 2IXCA 4GKJO 5B3SB 1PHMA 3OYWA 4XOGA 3QVNA 2CU5A 1ND2A 3Q9OA 1IURA 1UOGA 1QBZA 5DZGA 1AR1B 4IV1C 1WW7A 5KXDA 1PIV2 4RYDA 2VCAA 1AXZA 1XNKA 3MIGA 4QX3A 3UJQA 1QCEA 4QIWF 4FP3A 3L73H 1ORQC 2FBEA 5L7OA 1D2DA 2E9QA 4PJ0Z 1H8EG 3V56A 2CTWA 2JB8A 4LORA 3OGIB 2RQ6A 5T5PA 1PPJH 3CMGA 3ELNA 2D3RA 5IJ0A 1TG7A 1K5QA 4MTXA 3S3WA 1ZRCA 5HPOA 4RUFA 2Y4TA 1U5IA 4QQPA 3FLTA 3LDDA 4GA9A 2BU9A 4AEMA 3AK0A 2ARXA 2VD7A 5C3OA 3I2OA 4DXZA 3NKTA 3QO7A 1N36B 2FCVA 3EXAA 4A4AA 5J2UB 1UZZA 4EWDA 2GP3A 5F32A 5L3DA 2CGNA 5F2VO 1GOGA 2UY8A 5IVCA 3WLUA 1C1LA 1WBFA 1QJX1 4X89A 2BFUS 2G9ZA 3MO4A 3KS7A 1V6KA 1NY71 2BNMA 4CS3A 2WZ8A 3HT2A 3MW3A 1GMGA 2A3YA 5FYHA 2BGCA 4B7EA 2EVXA 5FY8A 3CJIB 4FBFA 4QM8A 4AE2A 3VBBA 4IE4A 3OBRA 2QSAA 1MZFA 1XYPA 5FK8A 1KXGA 1R6NA 1QQP3 3ABZA 2QQPA 4E2SA 4EYUA 4AHWA 4CP9A 4XUQA 4QQ2A 4CXWA 1M4UA 3SYQA 1WW5A 2X8KA 1MEC2 1L7RA 4XJWA 3BODA 5D2AA 3NMBA 2JXAA 1POQA 4M3CF 3EQEA 5JSRA 3N7JA 4QPKA 5JVVA 2VOKA 1OVPA 1YWKA 3RWNA 4RQPA 5EXOA 1B3QA 1F35A 3QNEA 2AHZA 2BSKB 1KDKA 1GKBA 4KXRA 4L8JA 2UUBO 3CEIA 3HKDA 5FV3A 4B3MB 3BPZA 2RS32 3Q8CA 4P9PA 1X8EA 3O1RA 1E57A 2IZWA 2XJTA 1J83A 2UXBB 1DCSA 2A3WA 1U0AA 2VZOA 3VBRC 4LR3A 3GZTB 1W2UA 4NHMA 1GQGA 5C3SA 1UN1A 5DAPA 2OTJV 3L9JT 4ZU5A 1PO22 4I0XA 4QGNA 3CJXA 1IBKB 4JGZB 2WYFA 5KAIZ 4YWAA 2HLDG 1SLLA 3RJ2X 3ZPOA 2HWF3 1WPXA 4PBPA 3ZR6A 4HZ3A 3M3CA 1UU6A 1HR0B 5LW9A 3AKQA 5C6CA 2WQZC 2N04A 1CAWB 1NA1C 1V9U2 2CWMA 4N23A 1W9WA 4FFIA 4OZOA 5IVJA 4UBHA 2HYXA 3STZC 1AR83 2VW2A 1UU4A 5BNPA 3D3IA 4E2LA 1KD1W 5APAA 2AR6A 3T0AA 4Q0QA 4EROA 4LF5O 3AG1C 1LUVA 3WB1A 5K8SA 3MIEA 4KGQA 4F7ZA 3JB4C 4JX0A 1DK1A 4EN9B 5JJEB 1YJKA 1Y74B 4FCAA 4UVCA 1KFUL 4FPEA 2JDNA 3FMGA 3UO3A 1GNYA 4AQ2A 1VBD2 4LF4O 3PUAA 2ZXWC 5JXHA 3PUIA 1RUD2 4MO3M 1HNZO 4OX9O 4NYKA 1WA8B 3UL2A 1QR8A 2XQXA 3WG4A 1WMXA 4JI6O 2YZ4A 3MIDA 5GKAC 1X36A 2GMPA 2XTAA 1J5EO 3VBOC 4W4ZA 4QB1A 5FZLA 2QVSB 2O0OA 4U3FH 2LGQA 4IEXA 1NKDA 2TEPA 1OPMA 5EYXA 4YRDA 5DAWA 3BFRA 2ZQMA 4M3CE 4OPAA 3W5MA 4QX2A 5LHIA 3N36A 4MXVA 4LPLA 4Z8BA 1VBB2 4N7IA 1EM1A 1H2LA 3VGIA 2XGXA 2VMHA 4JI1O 3I2FA 1S0GA 4ZI7A 3LIGA 4CEYC 5EBWC 4UUJC 1YJLA 2VOWA 5E6HA 1O4TA 1C8NA 3RYHB 2CE4A 3PVOA 4GWNA 4CRQA 4BIZA 1OMIA 5KC6A 4XDPA 1JYXA 3B7MA 5HFMA 4JI3B 1HB4A 1FT9A 1LEDA 3OBAA 2QQMA 4YSFA 4EN6B 1YF2A 1E5IA 2AZ2A 4BZ4A 2XVLA 1J59A 2WO3A 3ZN1A 2OS2A 4HFSA 4HKWA 1I1EA 3CE2A 3JAWB 3OFNG 4Q4X2 1UY4A 4QQHA 2QTSA 1XEQA 1RUG2 3P3NA 4CDWC 4ET7A 1VJ2A 4QHOA 4YZ2A 1NLRA 3U4XA 4TZDA 3KQ4B 5FXVA 1CZVA 4KMQA 2EZPA 2ZD9A 4BQ2A 1PGL1 4A45A 3ZRWB 1NX9A 5H5NA 1RHI2 4WVMB 3WHTA 4Q20A 2X0LA 1QJEA 2JDMA 1L0NH 2J1TA 1V70A 2OX0A 4C91A 1HXS1 3ZRXA 3ZSJA 2WT2A 4K9SA 1NT2B 1NLQA 3CL1A 2VNRA 2ETEA 2VVEA 4XFFA 3GGLA 2Y64A 1FYUA 1RSOB 2V73A 5B4NA 1J1TA 4LE3A 1BHBA 1BKZA 5E8AA 1QU0A 3JD1A 4NOTA 2QQLA 3ABMC 4I55B 1ASJ1 1EAH1 5LP6B 2JB4A 1GTOA 2OQ6A 2VPVA 3B9CA 1G4YB 1JOJA 2E76B 4LHNA 4K20A 2SBAA 1NT0A 3C3SA 4JV4A 3ETQA 1ND3C 5HFLA 3LSDA 1W59A 3WFVA 5DABA 4OI1A 4LF8B 2D3OW 2X29A 2WA3A 1UMZA 3OUIA 1DBNA 4TQFA 3VBFB 3NXSA 3CCJV 1XDCA 4DRRA 3FYIB 5GLZA 2QTOA 4XFAA 4AVBA 1K92A 1Y7BA 4LFBB 4LKDA 2RVAA 4JYCA 4WBBA 1OCZB 1XNBA 2JRIA 3SNMA 5H9PA 3N7KA 3LCPA 4LITA 2JE7A 4GH4B 3VQVA 2HG5C 3NAPB 4AEJA 5FP4A 4GWJA 4AQ6A 1WCDJ 3HBKA 4QGPA 1UYYA 1IBLO 1VBE3 1Y76B 1SACA 1Q8QA 5IY5B 4M00A 4LULA 1NCQA 4EN7B 1BK0A 3PTYA 4AI8A 1GZTA 4JGYB 2JICA 2BBVA 3AVSA 3RYHA 3NR7A 1LR1A 4NVPA 1QJY3 1VMHA 2IJHA 4XF3A 2EILC 1ZX3A 1JJOA 2JIGA 4GKKB 1RUOA 2VBDA 5FPOA 2R061 4MLOA 5CFCA 3H42B 3DL3A 2ZIOA 4OHZA 2DUPA 4QQOA 2HVKC 3MUZ1 4LNUB 1OKQA 3NW4A 3H01A 3H3UA 4RAIA 1K4DC 4M01A 1BBT1 3JBG2 3N9PA 4YHHB 3E5XA 1W8NA 2PELA 1WLDA 3ZXFA 5FDBA 4Z2WA 3GBFA 3VB9A 3ZEDA 1VQMV 2QQVA 4AI1A 2JENA 3MBWA 3FHQA 2QKDA 3R0RA 4OYUA 1XNRO 1BE3H 4KI5M 5I93A 3CCVV 3OPWA 5FIXA 1NZIA 4JHZA 4WFAV 2NPIA 2PLV2 4L11A 2Y8KA 4TV8A 3F2ZA 3KHBA 4IV3C 4GX0A 4K21A 4AR2A 4JAUA 3RDIA 4R6ZA 2WLNA 3I59A 1VMGA 3RT3C 2BOIA 3QH6A 4CUBA 3VKMA 5F7UA 3PIGA 2GUZA 2OCCC 3N2GB 1IQDC 5FPLA 2E63A 3L70H 1P4RA 2IWGB 5IFTA 1CESA 3AYDA 5CBHA 1YFUA 3E22B 4XDKA 2IJJA 4QGLA 3TJTA 1C8M3 2OUJA 1OFNA 1KS4A 5A3MA 5IVEA 1HV0A 1UL9A 5EHDA 3SR2C 4E2QA 1VRH3 1LOFA 1SG3A 1W6MB 4TQDA 2VW1A 4YFWA 4CXYA 4BM8A 1O8PA 3KSCA 1W8FA 3D5OA 3MW2A 2DBIA 5FPVA 2E7AA 4MOAA 4WFBV 4CDUA 4YARA 2LM3A 5F5IA 1NTMH 3E6DA 1R6TA 4FSJA 2N74A 1EP0A 1HB3A 3FBMA 5JMOA 2ZEYA 2ZHKA 3BB6A 4LE4A 1LESA 1SQFA 2ZA9A 4X8NA 4DXWA 4QPGC 1RUNA 4BXFA 4L8QA 3N27A 4M4PA 4DUYO 4R52A 4AHZA 4ZHQA 3ZDSA 1AJPA 4X1KA 3P30A 3CYOA 1W2NA 4B1MA 1R64A 1W3XA 1SDWA 5LBFA 2EALA 2F6BA 1HRI3 5A6QA 4TTGA 3AL6A 2B1GA 2EJRA 2ET7A 1XNQO 2ZX4A 4O7XA 3GZUC 1FOD2 1LKNA 3VDAA 1KS5A 1UZYA 1ZVFA 5C3PA 1O8SA 3POIA 3O1PA 3KM5A 1C4RA 5GLTA 4KNCA 1MSDA 1F4MA 1RITA 1PK6B 1SQXH 3U14A 3AMMA 1S77D 3AXDA 1UYZA 1FI2A 4GMP3 3NV1A 2GALA 1LB2A 3FL7A 1QLEC 4UFLA 3IMMA 3AB0A 1DGWX 1NH2D 3AL5A 2WC2A 4O4IA 5GZDA 2YGMA 5LBCA 4N43B 2K9PA 5FY5A 1D2QA 2D93A 1HQWA 1XNTA 4JI5O 4LNUA 1XNCA 4HNAB 4DR7B 3U37A 2GSMB 3BU0A 5F37A 4CDXA 4IE7A 2I07B 2BTOA 2PHFA 4LBJA 3F5TA 3KV5A 1UX6A 4JV5O 3B93A 3HEIA 1U5ZA 3VBUC 1CPNA 1YIJV 4OHXA 1JPXA 3UGFA 4IGGA 3FN9A 4AEDC 3AG4C 1Y43B 5EZWA 2EJ7A 1UMHA 5L3GA 4MX3A 1VQ4V 4OCTA 1AVBA 2A7AA 4XURA 1H9WA 4BQ3A 4YY3B 1LGBA 1IS6A 4FK5C 1JCHA 3KCYA 4NXNB 5FO8B 2ES3A 5LMNB 3JASB 1IBMO 1P49A 2C1FA 2Z0AA 1N1TA 1VBB1 3N9NA 4K1YA 4IV1A 3FKSG 1JTZX 4OZXA 3W21A 4HN0A 3ZYHA 1BCXA 1OPOA 2BVVA 4FVMA 5LOVB 3KB5A 3K0DA 1R093 3GJAA 5FZDA 1X4TA 1G9CA 2RHPA 2WZR3 3DXRB 1I6XA 4CCEA 1J1LA 4PA7A 2QWQB 2Q8EA 1D2SA 3T2OA 3AG1B 2K9ZA 4AF9A 2GTAA 4YGEA 1XOUA 4PLMA 1DDLA 4JHTA 2IVJA 4FOVA 3H1MA 4PA9A 3SCFA 3CSXA 4MXWA 2EINB 3POYA 4NPLA 2XVKA 4PT6A 4X1YA 4X64B 5H2FZ 4Q4X1 1NCRB 1PZ9A 4IIJB 3ORJA 2ZXWB 1H4HA 3LOBA 1U97A 1SLAA 1YJWV 1RUG1 1MZ6A 4C1XA 1AJNA 3NVCA 4U2AA 3STLC 5FZ1A 2DUOA 2WS93 2VL4A 2IC1A 1WMEA 4QDSA 1ULFA 4XEZA 1PL4A 2X6CA 3FB6C 5IJRA 1PL0A 4J9ZB 3L72H 3ML0A 2BGOA 1SESA 2BFUL 3VQXA 4CXXA 1HNXO 2P5BA 3H1HH 3IFXA 3RZHA 2YB7A 5B1BC 2JDZA 2J42A 4P9OA 2VQTA 3FX3A 5DG1A 1WPBA 1SKVA 1SQBH 2WAAA 4DY3A 2KG7A 5IATA 1W2BU 2DUQA 2E51A 1QJZA 1JOPA 1OA3A 4QKDA 2YEVB 4F6RB 1RUH3 4JI4B 1RUC2 1ULCA 4LMFA 1ZREA 1KITA 2ZT9B 5C9AC 3SPHA 1IXBA 4LP8A 1FFTB 2BUKA 4QQLA 1AHSA 1SS3A 2WA4A 2ZGNA 4Z92B 1QEXA 2F4VO 3IC7A 2XBO2 5FQ0B 5BR8O 3PU8A 3I4IA 5FLHA 3MV11 5JWPA 1ZA7A 3LDKA 1CQ9A 2UURA 2KQXA 3FAVA 1DGWA 4OHVA 5A2QN 3KVAA 4K8ZA 2FMLA 1FXHA 1VBC3 4Y22B 1FV2A 2A75A 1CP9A 2YC0A 4Y5Z0 4WFEA 3J8F3 5KLVH 1XL6A 4CDWB 3BCWA 2VRZA 1Z7S2 5DM6V 1WD3A 4OUMA 3SYCA 4QX1A 4OMCA 1EBOA 4F3JA 3VBRA 2VQFO 4YVWC 2JGDA 2LRPA 4NKGB 5A32A 3D6EA 3MPBA 1K7DA 4CPBD 4I30A 3BYWA 3I5DA 1ZBA3 3LE0A 1WUVA 1M56B 2IH1C 3TN92 3BVOA 1YHQV 3AJZA 2D44A 2A0LA 3LEGA 1AF9A 3DYPA 5EQUA 1R1BA 5JPMB 4GULA 1NA1A 2CGPA 1O5UA 4JI2O 2R72A 5LMUB 4FPKA 1S0FA 2NN4A 3CIHA 4J1WA 4M0NA 4ZZ8A 3JD71 4IL6Z 3MHSC 3DF0A 2H6BA 4UI9L 4XUOA 5BNNC 2UWCA 1R082 4O61A 5LXTB 1YXBA 4Y24A 2CWSA 4U7NA 1NTZH 2C9KA 5ABJB 5I8SA 2D6MA 3DTUB 3WX5A 1OLRA 5FMCA 1BHGA 1VMJA 3OTOB 2GN7A 2DCTA 2Y69C 3SHRA 2RV9A 1X8MA 3G6JB 2ZINA 2YIAA 1FYJA 1Z0HA 4FFHA 4MADA 3ETDA 1HLCA 1URXA 4OMDA 5CZKA 4KBBA 3ZN6B 3VBOA 3HBZA 5LYJB 2PLV1 1DQ1A 3E5UA 1ZZ9A 2ILMA 4UCSA 3N9QA 4M3CA 4Q8LA 3AFKA 1I3HA 5DMYA 4Y20B 2DURA 2XPJA 5AC93 1AR61 4LBOA 2B5HA 1DYPA 3KZ4C 5HI0A 4S2FA 4FFKA 2AEZA 4WM8C 4I4TA 1ZZBA 3ZSKA 2R30A 3AXEA 3SPCA 3ZX7A 2ZGSA 2XUEA 4AFCA 4CC6A 1C5IA 4RFRB 4CEYA 5ACA1 3WUDA 2DVDA 4EB6A 4CCJA 5EV7A 2AH2A 4HZFA 1LNSA 1OBNA 1D4M2 3C3VA 1XOYA 3CRAA 4R8CA 5T52A 2H3OA 1LGCA 2EILB 4IEZA 4Q4Y1 2UXCO 2A6VA 3IKWA 2RJLA 1GP4A 1KBHA 1O3RA 2JS3A 3K04A 1O4ZA 3VOUA 1PMJX 4AHXA 4EZ4A 4O2AB 2BOJA 2YBKA 4D0QA 1GICA 1NR7A 1SPPB 4MW8A 1GQHA 1PX3A 3CCUV 1IG3A 4LBMA 3AKSA 3NV3A 5FYTA 4CDWA 1B09A 3VZOA 3RSJA 5F8PA
chains in the Genus database with same CATH topology
2LTNA 2R6SA 2NN8A 1EY2A 4LBQA 2VNGA 4PCRA 4PIXA 3OD4A 2NMNA 3WDTA 3IDCB 2I74A 1JUIA 1CAVA 1ONAA 1M06G 4S2DA 1RTVA 1V6LA 1V9U1 4S2HA 4D7SA 5CFCC 1BVVA 5DUWA 1PO13 1TE1B 4AI3A 5F9TA 1ZBE3 2Q30A 1ZYBA 2XJSA 4IEVA 3S7EA 1FXZA 1WCSA 2XLFA 2ZX1A 5C8CA 1LODA 3RRDA 1EPZA 3I54A 4C5WA 3POWA 1FOD1 3U11A 3ZFGB 1JH5A 1QNYA 2NMOA 2ZPXA 3M7AA 3ZFFA 1TMF1 1WLCA 3IIAA 2OVUA 4HK9A 1W6PB 4CEWA 2UY9A 3HWJA 4UW5A 4D3WA 1JN2P 3GHNA 2HWC2 5KXBA 3VDDB 3VZLA 3S7IA 1QNWA 3R1JA 5AC91 1AR91 1XYNA 1GVGA 4AWDA 1GY9A 2UWAA 2BYVE 2ZMLA 2VVDA 3TAYA 3TBDA 3RI9A 3N6WA 4DPNA 1G9BA 3THTA 3VZNA 1HRV3 4LNVA 5DUXA 2WNUB 3ILFA 4COVA 1RVF2 1S0IA 3PHMA 4J6GA 4I0BA 1DLLA 1CONA 2R32A 1VRH2 1XRUA 1PGSA 4Q0SA 1H8VA 1NCRC 4AI0A 1VB4A 1LOCA 4HK8A 1VBD1 1KRIA 1SBDA 1XQNA 1RUD1 1ZA4A 1IKPA 4RHV1 2YHJA 2V5YA 5HBAA 2VQ0A 5I0UA 4XBLA 4RGGA 2QDNA 4FXGB 3VHNA 4DY5A 3ATGA 1TNFA 1SEFA 2A6ZA 1IPJA 1HW5A 2P34A 1WD4A 4QD2A 1LEMA 1FMD1 1PZ8A 2BQPA 3ZFEA 1LOBA 1DGLA 1X50A 1GQWA 5BXXA 3MLJA 5FO9B 4W6XA 1Y9QA 1RHI3 1WGPA 3PMSA 5IK5A 3ILNA 3D4KA 1LRHA 1WMFA 1ND3A 4LO4B 4OI2A 4EV0A 2HWF2 1RINA 2WL1A 1VAMA 5E88A 5GZEA 1QKQA 1ZRDA 3AKTA 1NZCA 1XNDA 3OTFA 3FHIB 2UYAA 2P3KA 3VBRB 4B8EA 4ATFA 2B9UA 4YZ5A 2KA3A 3CJIA 2B7YA 2D43A 5JLVA 2NZ9A 3AP4A 4Q1RA 1H2NA 1A3KA 2HKXA 5L7OB 3KCCA 1ULDA 2HWE1 2Y26A 4G4FA 1GZCA 5A32B 2GNDA 2A5ZA 4YM1A 1LCLA 4IEUA 4JCKA 4YM3A 4RR3B 1YLLA 1HRI2 1OI6A 4AFDA 4LR4A 5I0SA 4XIKA 3PVNA 1ZM1A 4QPGB 4BCUA 1QMJA 1G7YA 4Q27A 4YVSA 5FBZA 4COWA 2P3JA 1JBCA 1LOFC 1OSGA 1V6NA 3EHKA 5DUUA 3QH7A 4YW4A 3V15A 4P9LA 5BY5A 2GNMA 1WW4A 3GHMA 4XDQA 4IERA 1DFQA 2Q1ZB 4JC1A 3SH4A 1UD1A 4UW6A 2VUAA 4U36A 5KHGA 2ZACA 4E4SA 1NA1B 4IEPA 2JG9A 1PVC2 1EV13 4I2OA 2XHKA 4QM9A 1PO11 3V17A 4NPRA 4CDUC 5BNOB 4FOYA 1ZBE1 1RUI3 2ZMNA 2CAVA 5GM0A 3PVEA 4BGMA 4KU7A 1NX8A 2OPKA 1RUC3 1TQ5A 2DFBA 2WLPA 1CR7A 4AVTA 2IXLA 2ZX2A 1AR72 1I5ZA 4FPYA 1RUF2 1D4VB 3IDBB 2TNFA 4QPIA 4YVWA 1QY4A 2GC3A 2EXIA 1A8DA 2R072 3HQXA 2TBVA 5K0UB 2YGLA 2FMYA 2QNKA 4KWJA 1Q8PA 3WD5A 2F4PA 5BUVA 2WJSA 4ASLA 1REEA 5DZFA 3ZXAC 1LOGA 1GSLA 3AZVA 1HRV1 2BNNA 2XBO3 1TNRA 1PGL2 4XFIA 4AVSA 1C3HA 4Q4V2 1Y0ZA 1PGW1 1LHOA 3VLBB 2A6XA 1H0BA 4I02A 3L2YA 5BNPC 4ISRA 2AGSA 3OF1A 1DZTA 2DVFA 3DN7A 4BE3A 4ATEA 1ZZ6A 3ZYIB 3LKJA 1HXS2 1LENA 1X33A 3ROUA 1Q5OA 3FC0A 2SLIA 3FUQA 1L3JA 1N1YA 3VV1A 2GMEA 2WT0A 3AKPA 3VBSC 5F5QA 1AZDA 4HPKA 1UF2C