3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
3OM3B 2IDTA 1BQKA 1JZIA 2GB2A 3NJFA 3WI9A 3EF4A 4DP4X 4MFHA 2XVBA 4GXFA 1QHQA 4AKQA 4YSOA 5I26A 4YVUA 2J5WA 2GC7C 3D12B 3NJNA 3TASA 4BXSV 1HFUA 4BXVA 1CUOA 1E65A 1ZDQA 4YL4A 1JXDA 1NIBA 2EIMB 3ABGA 3EH4B 3TU6A 2IWEA 2YAEA 4A2FA 1XB8A 3WNJA 4GY4A 3UACA 1UATA 2XXFA 1BYOA 2HLEB 2YAHA 1NZRA 5B1JC 2PPCA 1EZLA 2Y1AA 2PPEA 3C75A 7PCYA 1ADWA 1F56A 3IE9A 9PCYA 2BO0A 1NTDA 1QNIA 2YXWA 3ABKB 1AG0A 3OMAB 2HX8A 2OV0A 1JZGA 3NJLA 2BZCA 2FQGA 3X1FA 3QJRB 3AG3B 1V55B 5I6PA 3NJJA 3NJMA 2P80A 4HHWA 1OCOB 2OJ1A 2AZUA 2ZONA 4KNSA 2PPDA 1PZCA 3QQXA 1GW0A 1A8ZA 3FSZA 1J5DA 4P5SA 3WIAA 2IWKA 4HCIA 1XB6A 1AQ8A 2WO3B 3ASNB 2YEVB 1WA2X 3UGEA 2CUAA 3FU7A 1BXUA 3WNIA 4DP1X 2XUWA 3UABA 3HEIB 2XV2A 4HHGA 4YSCA 1M56B 3NSFA 1L9OA 2XX0A 5I6KA 5B1KA 2GHZA 1L9PA 1WA1X 3T9WA 1FWXA 4ENZA 3OD3A 1AZRA 3ZBMA 2W88A 5F7AA 1KCBA 4PCYA 4HAKA 3GDCA 4BWWA 1J9QA 1HAUA 4AZUA 1JERA 2GI0A 2HXAA 4FAAB 3KW7A 3FQ1A 4UANA 3AW5A 3FPXA 1GS6X 1IBYA 3CZUB 4RH4A 3S3BB 2YAPA 2E86A 2FJSA 4KO5A 2VW7A 2PPAA 4QKTA 2AANA 1ASQA 1ET8A 1TU2A 1AS7A 1CYXA 2NRDA 1AANA 2J55A 2VM4A 1JZHA 2BP8B 3AG2B 5IY5B 2PP7A 1DYZA 1ET7A 1AZNA 4EF3A 4KNUA 1PF3A 3ERXA 4DPBX 2FTAA 3FU9A 1KYAA 1L9SA 5ANHA 2GC4C 2TSBA 1OE1A 3IBOA 5I5JA 1OE3A 4E9RA 2XWZA 1TEFA 1HAWA 4GYBA 3X1BA 4JHUA 2BP0A 4P5RA 3ZIYA 1CYWA 7PAZA 2TSAA 3RYMA 2VSMB 3HB3B 1OCCB 4HCFA 4YSDA 1NIAA 2HZHA 4JKNA 2IH9A 2XYBA 2EIKB 1GR7A 1GS7A 3PAZA 2PP9A 4N8UA 4BDVA 1M57B 1MDAA 3PCYA 2CJ3A 4KNTA 4DP8X 2H3XC 3FU8A 4KOBA 3QJVB 1X9UA 3DTUB 1E5YA 3AG1B 1T5KA 4N4YB 4W1TA 3H4FA 1SFDA 2GIMA 5A7EA 1X9RA 5I5MA 5AKRA 3S8FB 4YSTA 4WKXA 1AS8A 1RZQA 3FPYA 4GP5B 1E67A 4HALA 4E9QA 2HRGA 4ZK8A 3QJSB 1IC0A 4Q8BA 3FYIB 2EINB 4AKPA 3SBQA 3NT0A 5EHFA 1RZPA 1BXAA 3BQVA 2FT7A 3FT0A 1L9QA 2B3IA 1NIDA 5PCYA 3T6XA 4DP5X 2IDFA 4GP4B 2CCWA 2HX7A 1CC3A 4X4KA 1NIFA 1JXFA 2JXMA 3PLYA 5I6MA 1ZV2A 4BWTA 3MBWB 1SHWA 2VW6A 4DP2X 1FA4A 1TEGA 2XLLA 1J9RA 2YXVA 2BW5A 2FQDA 2IAAC 1AZBA 1QLEB 1BXVA 2XXGA 4A2DA 2MTAA 1V10A 4BWUA 3WG7B 6PAZA 1NWOA 2I85A 1SFHA 1AAJA 5TK2A 1EHKB 4L0PB 2OCCB 4A66A 4CSZA 2CBPA 4YSRA 1KBWA 3UAEA 1ZIBA 2J56A 1A4CA 4E9WA 4CSPA 3AG4B 1PNCA 1GYCA 3T6ZA 3S3DB 1J9SA 2FQEA 2EIJB 1ID2A 3QJUB 1ET5A 1W8EA 1JZEA 4TXVB 1B3IA 1SHXA 2XV3A 2YQBA 4DP6X 1V54B 4PAZA 4A2EA 2W8CA 1RKRA 2P80D 4KO7A 3ZDWA 1MZYA 4DP9X 3EH5B 2VN3A 1GS8A 2UXFA 2FQFA 2VSKB 5B7MA 3FYEB 3NSYA 5FC9A 3CG8A 3T71A 1SF5A 3KW8A 1J5CA 2BZ7A 1OOWA 4K9JA 4A67A 4YSQA 2BWIA 5PAZA 4NERA 3WKQA 2EILB 2PCFA 5I6LA 2N0MA 5D4HA 1I53A 1NPJA 5B3SB 3CVCA 1R1CA 2BP8A 2IDUA 2YAOA 4NAJA 1BQ5A 1WA0X 3EHBB 4FA7B 1A4AA 1KDJA 3ABLB 2LLNA 3T6WA 1SJMA 2QDVA 1PLBA 1A4BA 4KOCA 2PP8A 4G71B 5TK4A 3NJIA 3SBPA 2YAFA 4YSSA 6PCYA 3TBCA 2Q5BA 5I6OA 2X88A 4BK5C 3TBBA 1ZPUA 1N70A 3X1EA 3IN2A 3H4HA 4HCGA 1J9TA 1SF3A 5I5IA 1PLAA 3QJQB 3CVDA 1PZBA 3NYKA 2GBAA 2HRHA 1KGYE 5LDUA 3PPSA 2IDQA 4A2GA 2IWFA 1E5ZA 2ZWNA 2UXGA 1NINA 2PLTA 1NIEA 3NJGA 2XU9A 3JT2A 1PCSA 3CDZB 4M3HA 3G5WA 2CAKA 1XMEB 3DIVA 1XB3A 1JZFA 1JOIA 5B1JA 4YSPA 2H47C 2YAMA 1ZDSA 3OMNB 1ASOA 2A3TA 1KV7A 1SNRA 2VMJA 3OMIB 3NSDA 1WAEA 1A65A 2DWSA 1WS7A 1IKOP 1OCRB 1NWPA 3EH3B 1OCZB 2IH8A 5D4IA 3H56A 4G72B 1PZAA 2AZAA 1W6LA 1YLBB 2DWTA 4E9VA 4F2FA 1GY1A 2PPFA 1CURA 3DKHA 5AZUA 2I7OA 3FQYA 3NJKA 1AIZA 3NP4A 2R7EB 2CALA 3QPKA 2WSDA 1SDDB 2YARA 3V9CA 5D4JA 1E30A 1BEXA 5B1BB 2GSMB 2UX7A 5I6NA 2FT6A 4GP8B 1DZ0A 3NJHA 4A68A 1GSKA 4QLWA 2UXTA 1AS6A 3X1NA 3S3CB 2BWDA 3ZX1A 4UF7C 2QPDB 2JFCA 3N55A 1AACA 2FNWA 4G7SB 2IDSA 2DV6A 4JHVA 3UADA 5AFAA 4YSAA 3T6VA 1W6WA 3FS9A 3NP3A 4UAHA 4A2HA 1PNDA 4AX3A 5B7FA 2MRYA 3UAAA 1L9TA 3GXUB 3OQRA 3JTBA 3GYRA 2DYRB 1IBZA 2QT6A 4G7RB 4G7QB 4AI7A 3AY2A 1L9RA 1PAZA 1AZCA 1PLCA 2H5UA 4HZ1A 1ILUA 4M4RB 3S8GB 1PY0A 4DPCX 2J57A 2Y69B 2WO2B 4DP0X 3FSAA 8PAZA 4F7KA 4G70B 3PAVA 2FWLB 2QDWA 3N2JA 1MG2C 1GY2A 3SBRA 3FU7B 3BVDB 1TKWA 1BYPA 4Q89A 3X2QB 3U25A 4E9YA 1AOZA 2YAQA 1BQRA 1AR1B 2UX6A 1PMYA 5E9NA 5B7EA 3TA4D 3PAUA 4NB7A 3WKPA 2FT8A 2VW4A 1BAWA 2UXVA 3FSVA 4WTQA 4YVNA 3FQ2A 4DPAX 1KBVA 1OV8A 4AKOA 4E9XA 2ZOOA 5F7BA 1MG3C 2AVFA 3CDZA 2Q9OA 3ABMB 5B1AB 3MX0B 2X87A 2XV0A 2XX1A 3V9EA 2VM3A 2DYSB 2DY2A 4YSEA 2BW4A 2RACA 2BHFA 3CVBA 3SQRA 1JZJA 1N68A 2JKWA 3IEAA 5I28A 2AFNA 1MZZA 1JVOA 2I7SA 1JVLA 4F2EA 1FFTB 1IUZA 1ETJA 4YSUA 1KDIA 2ZXWB 1URIA 1AG6A 2QPEB 1ASPA 1VLXA 4HIPA 4KO6A 3NSCA 4KO9A 2HX9A 4DP7X 1ILSA 3FSWA 2BP0B 2B08A 1A3ZA 1ZIAA 2R7EA 1KCWA 1SDDA 4E9TA 1OF0A 3X1GA 1RCYA 1NDTA 1AZUA 1WS8A 3IN0A 4BDVB 2PCYA 1NPNA 1NICA 4E9SA 1OE2A 3L45A 1JXGA 3AZUA 4W9ZA 3QJTB 3ASOB 1M9WA 3PXLA
chains in the Genus database with same CATH superfamily
1WISA 2NY6C 5GS1B 2XN9D 5KVMC 1OAQL 2LGQA 2RD0A 1JP5A 3MGTA 4GXFA 1NGYB 3ICXA 3FB6A 1DDHA 2X42A 1S9VB 3E8UH 4JM2F 5D93B 5T5FH 1NCWH 1BG9A 5BNXD 3IXTB 3G9AB 1T5WA 5E8EA 1RPUA 2EDHA 4CN6A 4CBCA 4UV4L 3FRPA 3VYOA 4NLAA 4P2RD 2O1AA 5F0PB 3E9UA 2XN2A 5EULV 1U36A 1MHPH 3UROR 2CGRH 2H0PA 5E5RB 4I5SA 5BXFB 4OLVL 3VI4B 1QNZH 3KL0A 4GW5A 2VISA 2D9CA 1NKGA 5CA0B 3DDFA 5MI0C 3UC0L 1QATA 1AGFB 5AZEH 4Y2LA 2CA4A 1BAGA 4HS8H 3KR3H 2V7NA 1EVUA 1S76D 3NEEA 3LZFL 3R0MA 1A64A 4G5ZL 4DK5A 5JXAH 5HVHC 4X5XB 1R1BA 5T1MB 1ZHKA 3V4UL 5CCKL 3ULVH 3FFCB 1P6AB 4ICWA 4EI5C 1JPTH 3ZVVA 5E2VL 4R83A 3L9EA 2OJ1A 4E2LA 2YIAA 1CCZA 3I74A 4HDIB 1WO2A 4PG9B 1U2HA 1LO3H 3VH8B 4Y5XB 4OZHA 3W39B 4P59H 2CIIA 2VDNH 3ESOA 3LX9A 3WNLA 1BIIA 5I0WA 1G8MA 1I9JH 1BREA 3UABA 2KDYA 2M8XA 3RNKA 2RCSH 3G71V 2QGBA 3DRQA 4Z7WE 3ZCCA 5EA0H 2BVQB 3WN5A 5EORL 3HMWL 3ZRVA 4O02B 3WAJA 3JSSA 3W7XA 3B9KC 4ODTH 5CGBA 5HI5C 4OW6A 5ITBH 2F5AH 3P0YH 1AZRA 4Y7MA 3MLUH 3GJFH 4NKOA 2K70A 3CGTA 1WZAA 3RRQA 4OJFH 1J1XH 4B5ZA 4PJXF 1SXSA 4I55B 4PJ9A 1I9RH 3AG4C 4Q6IC 1JG9A 2B7DT 4R9HA 3JD4A 1NFDF 5CP7B 1WN7A 1C16B 4MKMA 5GGRB 3SOBL 2XWBB 1XDTT 4E41E 4PJXB 4JAUA 2ESVE 4Q9CA 2C4XA 2JIZG 4OT1L 3PGCA 2AANA 2DQUL 4PV8B 1SLUA 5EBLB 3WJLA 4P2QD 1HEHC 4W9DC 3LSOB 1GH6A 1ET7A 2VQ4A 4N20A 3V6BR 3ZKQD 1ZMYA 3V6OA 5D7JD 4XZUB 4FABH 4JRFA 4PGJA 4F8OA 3QI9B 3HB3D 2IH3B 1HINH 4AGNA 2CIKB 3KBEA 4R4BA 1ZS8A 1W0WB 4Q74A 4W9GC 3T1FA 3UTOA 4K71C 4X6FA 3DC6A 5HFMA 1TQTA 1Z9OA 2LOEA 2LTQB 4H8UA 2HFFA 3EOBB 2HLFD 5CLTA 3IFNL 5DZNA 1QKZH 1F11B 1S3KL 3MV7D 1O9HA 4OJDH 1KLUB 3JASA 2BSTA 2NY7L 1GR7A 3BSGA 5DQDL 5EEYA 4LEXH 3ZYOA 2ZJSL 1S9YA 2CJ3A 4NBZB 3EADA 4HUXA 2R29H 4A7TA 1TMQA 2EXSA 4OR1A 4YJ2A 4JAVA 4C57C 1P7HL 1UHVA 2ED6A 1UGKA 1A3LL 4JCMA 1BGXH 4LEOB 3PIQA 1S7WB 5FAAA 5FDYA 4M9OA 5I5MA 4LCUC 5F21B 2AK4D 1XWVA 1I5XA 3RQ3A 3STLA 4KKPA 1Q0XL 1PQZB 2MQ0A 3EJPA 3T0XA 5HGBB 3C9NB 1HOEA 1AHWC 1WK0A 3SODB 5LXTA 4NUJA 3RX7A 1C8PA 2BIOA 1ES0A 4NM4L 1RJLB 1Q4NX 1A6UH 1JGDA 3GMPA 3I84A 2BVUA 4ZOBA 1MIMH 3BJLA 5JMRA 1RUAL 2ARJB 3APQA 5IMOB 3CXFA 3HBQA 1DJWA 1VRSA 3TVMC 3TA3A 1Q9KB 2IPUK 4LSVL 2QQKL 1IEAB 1PDKB 3ZO0A 5AW7B 1S5IL 3S5LG 1BMWA 4RMTA 4C8XA 4FLHA 2JCCE 4U3JA 3PLYA 2X89D 3QFGA 2WVSA 3WXVL 2QSAA 1DLFH 1FE8H 1X7QA 1IM9A 2DWEA 3VGEA 1E8XA 1WFTA 2GFBA 3AY4C 1SHWA 3ZMEA 4FQXB 4K94C 4WSKA 1CFTA 3QNYA 2VQ1A 5CEYA 2OSWA 1OCRC 4L18A 2QEJA 5KAQF 2V9TA 1OCZC 5LHHA 3MZGB 3GMNB 1W59A 1A7QL 1IAKB 2O5NA 4GRMB 3M1OA 4NN6C 3FTZA 4PWKA 5D4QA 4RQQB 1OP5K 2H8PB 3P0GB 3RX5A 2ZOUA 1UJ3B 2QLVB 4L0PB 4GS7B 4BSVA 1E0OB 4HOZA 2CG9X 1FFXB 4EB6B 4PRAB 4BUGA 5BY1A 5I9QC 4DV6B 4Y1AD 3BP4B 4NRZA 2LQTA 2VDQL 3VB9A 1N3NA 1NCGA 2XG4A 1D2DA 4J2XA 4F6RA 3QNFA 4FNLL 3RI5F 4Y9FA 1INQA 3NMEA 2X44D 4WWNA 1X4TA 3FTGB 5IT2L 3TX4A 2EIJB 3NZHL 5J6SA 3WUWB 1CS6A 1WUZA 1NBZB 4LWSA 2AJUL 1UWEH 2ZUXA 2LV4A 1HT6A 4KJQD 4ZS7L 2BSKA 1D5BB 2NCMA 4K7FA 3WGVB 5BVPL 1LO4L 4L2LA 5ALBH 1AGDA 2WTRA 4HK0B 1A4KA 1IM3D 1BFVH 4W70A 1S7RB 1DQTA 3GSVA 4R26L 4LF9B 3SE3C 1B0GB 1BXXA 3MGAA 4X9GA 1FYTA 3K2UH 1S9WB 4OLUH 4E68A 1QA9A 3ARED 3TT3L 1R6TA 3GI9H 4JM2C 4X9FA 3IPFA 2VMFA 4K7PL 4DR6B 1T83A 3VFWB 4GAYA 1LVEA 3CSTA 3V6FA 3WTYA 5JPNC 5I6LA 3LZNA 4JHWL 3UBGA 1YDPB 1NBVH 2PYED 1J7VR 4IRSC 3W3BA 3D69A 2CGNA 3DBXB 3BE1L 5FHAL 1WA0X 1D5NA 3WNMA 1KPRA 1A4AA 4E0RB 1FL6A 4IMKA 3ARFB 3HBGA 3L95A 1RSOA 4Y9BA 2ISDA 4C58B 5IB1B 1QEWA 3UXFA 5A3IC 1XCQB 1XH1A 2IV9A 5CKAA 4QGTA 5JORB 1U92A 3LH2L 3IF1B 4YSSA 5KTEL 2X88A 3X11A 4OM1H 1LK2B 5FOJA 3I5DA 3IN2A 4YC2B 4QNPE 4UVAA 1HHKB 4KY1L 4HJ0D 2XWEA 5DJ2A 1YJDC 4TNWF 2BINA 4R5VA 5CZKA 1FHNA 1KGYE 1PZ5B 1NANI 1R3JB 4RMBA 4KHTH 2IWFA 1DSYA 1ZA3B 2JCCA 5AL0A 3VQYA 3CCJV 2ZQKA 4PY7B 2HKOA 1J8KA 1SVZA 5CMAB 4XNBA 4ZO7A 5CCHE 1UM4L 1R0AL 4K8RL 1AKPA 3N40P 3N06B 2WXHA 3BN9C 1IQDA 2N7BA 3ARGC 4N2CA 3UAFA 5DT1H 4HIQA 3A4FA 4OI8A 4WQOA 3E38A 4FQJL 4Y4FB 4NO0D 1QR9A 3L4WA 1FG9C 4WFFD 1R3IL 4RZCA 2FB4L 2NCEA 3TT1L 1D5MA 3GSNA 2Y7QB 1DE4A 3MHHC 3EYVA 3LKSB 3LKPA 5HI3D 1JDAA 1HSAA 5D4IA 3CB2A 1ZT1A 1E4KA 3DXRA 2D7TL 2YFNA 3RTQB 1B9KA 2DWTA 1P5VA 1ULVA 3CSYB 4HUKB 2Y2WA 1KCSL 5CIPH 5F0MB 5J57B 4H44C 2MCG1 3N41B 4A04A 4PJCA 1IBFA 3B8MA 2F15A 1I3UA 3UYPA 4R84A 2XZAL 2R7EB 2YUAA 3OPZL 5AOMA 3J7AU 1MREH 2WSDA 4N2DA 1U8OB 3D30A 4X2UA 4AQ8C 1IFHH 1NH6A 2YKKA 3VMOA 5T1LD 4C56E 4GRLA 1DZ0A 1BZDA 1MKFA 4O58L 1DJIA 5LYJB 1R5VB 5J3HD 4PA9A 2XBDA 1BD2B 1E28A 4NO3B 2X6VA 2C2AA 4U7MA 1E9OB 2QWOB 1INDL 3PWLB 3FB5A 3QIWA 1J0IA 2UXTA 2OJEA 2CHNA 1N0XH 5IK3A 4ENEC 1KBBA 4NM8L 2JELL 3RYHB 5IHLB 4JHAL 3WFCL 2ICES 2DQMA 3IKCA 1T4WA 2ZOKB 4TLKA 5G2NA 2SODB 2IDSA 5DSCA 4JI3O 1YHQV 5KHJA 4KGJA 4AI8A 5KSAA 2A9NL 2XY1A 1UXSA 3V4LA 2QSCH 1JPFB 5JXEC 3IDIA 3LN9A 4YEFA 2HRPL 4GX1A 4YE4H 2EECA 3WAKA 2XI9A 3GMMA 4R3SA 3SOTA 4P9MH 5EU6E 4HFWB 4DGIH 5BRZB 3NIDF 5GHWH 3ZE0E 3KCPA 1LD9B 2EZOA 1IBZA 3PNRB 4DEPC 3OKDA 4JFUA 4EN3C 4O9HL 5KOVC 4KJPD 1P53A 1T0NA 3HKDA 3V0GA 4UT6H 4MZRA 3ES6B 5TE6L 1Y66A 1AZCA 2J8HA 4GKNA 2OWOA 4NVPA 2YK1L 3E6HA 3NIDB 4IEFA 5IJVA 3RHWK 5FDWA 3VFSA 2EVIA 2J57A 2WO2B 5CO1A 1A7OH 4X4ME 4CMMA 5L6YL 1OP5H 4O2BA 4HXAL 4OFKA 3CCSV 4HYTB 1MCHA 6FABH 4LPXA 2V7HB 3OLEA 2B3RA 1GN3A 2NY4B 4JDTL 5SWQB 4MA1B 3C6LC 2P8PA 3JZYA 3PDGA 4X1IB 2H8PC 3IJSA 1RJZA 2GY5A 4J3OH 3AG3C 1KXQE 4QHKJ 5I15H 1E9PA 1H3VA 4PJ9D 2PTTA 5EWIL 2VW4A 3MLXH 1CR9H 4MD5A 4X4YA 2WCGA 4AJ0A 2XVKA 1KUMA 3ULUC 4Q9RH 3IS1X 1S7SB 3VX1A 1M3IA 1NUFA 1VA9A 1RMFL 1XF3B 2Z91A 3KPMB 2E7LC 1W8OA 4UTBH 3OWEA 4L3FA 1DSFL 3KPSE 1QZNA 1JZ3A 5HGDA 2IW5A 1T20B 4X6BB 4HIHB 3D2UA 5GTIZ 2G0LA 4ZI7A 2PCXA 3Q8FA 5DMIL 3VXNB 1BQ0A 4C56A 3CLFL 2VIRB 5IMLA 5IJ9A 3IFLH 3LRGA 5B3JF 1P5UC 2VZ3A 3N04A 3QUXA 4ANXA 3LSSA 4GAFB 1H38A 3J2PA 3BGMB 3STZB 2Y0PA 3O6MH 1E2VA 1KT2B 3DX6A 1R3KC 5KYWA 3VQVA 3VGHA 4JREB 3BZEB 2HT3C 5IP4A 1FFTB 1WWWX 3EOYG 5H2BA 1N9PA 1OD7A 4KAQL 1KYUA 5HDWA 1YECL 5CB4A 3P9MA 5FLUA 2VITA 1I8KB 2LT9A 3LNFA 3OR7B 1E27A 1IGCL 3EGXA 4U1KA 2ODIA 5F1IA 2GQHA 3QYMA 2P43B 1E50A 4WWPA 4ZTPH 1AZUA 1XGTA 2QLYA 15C8H 4FFYH 2NLJB 3TZVC 3HG1A 2HUHA 3PXHA 2C9SA 4W9ZA 1Z5VA 1WBYA 1NH2B 3G5YB 3NCYP 4K3JH 4TNVK 4ADIA 1GKOA 2EYTA 1LYQA 2B20A 1B6UA 2R0WL 4QRRA 3KXFA 3BIKA 1AFVH 4X6CB 1DBAL 3JYBA 4WWOA 3E86A 5JH7A 3F5WC 1X5XA 3B8SA 1HCFX 3L72H 4TUOB 1QVFU 3CBJB 3DO7B 4K0KB 3FTXA 4YQXH 3P3TA 4JPSA 1IRAY 5C0BE 1M2VB 1HZKA 3CXDL 1NOFA 4L9LB 3LXBA 3TA3D 3UERA 5BS0B 2JS3A 2Q69A 2WA3A 1BZ7B 4IOFD 1JXDA 5FXCH 4DRXB 2EIMB 3SJVE 3D8CA 2DEXX 1XMQO 4J41A 2WXFA 1I1FB 3LKRA 3QEHB 3OTOO 1IM9D 3GJEA 4DGWC 1H5BA 4P2AA 5H35A 4K4KA 5JHDD 1O7DE 1G4RA 1CLZL 4JI8O 1RK7A 5I30L 5IEKB 1CLVA 3C75A 2BO0A 4PRBB 3NPZB 2HLAB 1RHFA 2A1WH 2XXCB 5CLZA 5CZXD 5FOBA 2FSEB 2MPVA 5AG2A 4FRWA 4P5MB 4CRPA 3OMAB 1ERNA 2G60H 2R69L 4WRLA 2W6IG 3CH1A 3MXWH 1N8ZA 4P57B 1ZL8A 1X5IA 2B0SL 5DHVA 1MI5B 2AXGB 3DJRA 2NR6C 1FSKC 4WV1B 1RJCA 4HWBH 4I0PC 3CWBH 2HG5B 1K3IA 5G4NA 1I9EA 1E6JL 1NCAH 1TJMA 1D5IL 2XWJA 2Y24A 1UH2A 3M07A 5K69A 3RY5A 4EFBA 3WFZA 3CN4A 5CXPA 3MJWA 1HDMB 3E3QE 4JYYA 1XF4A 1TUBA 4N8VB 4B3EA 1RXLA 1RPOA 2OCFD 4HU2A 4MX7A 5C0IB 1I8LA 3U9PH 3MRIA 4O2FB 3WE1A 1JZ7A 1ORQB 3G5XA 4OV6F 4QXGL 2H2PC 2VDNB 3UTTA 4YSCA 5DCCA 5EUKB 1KB9F 3FTYA 3NACH 3J8F7 2IAMA 3MV8A 2GHZA 4POZD 2H3KA 3R7QA 1LHZA 5I74C 4B7LA 1OAYH 3ZE1F 3HKBA 1YMMD 2P7TB 1FYTD 5MENA 1G9HA 4JY4B 4F5CA 3BAEL 3GIVA 3H0TB 4HIJB 1CPYA 3LV3B 3ULAB 4TUYA 4NYLA 5AG9A 3P77B 3GJFB 1ZHLB 1PJ9A 5IF0B 1VGEL 3SPVA 4A2MA 3PGDA 3HLAB 1SUJA 2DW4A 3ZSTA 3KJ6L 3RWIB 4NBXB 1QTSA 3FO0L 4NENB 4O51B 3S96A 2H94A 3OBAA 4DR4O 5F7DA 5SWZB 1EA9C 3GQFA 3JVGC 4UDUA 2VM4A 3H9HA 1K4CC 4XP5L 4LLYB 3KHOA 4BUQA 1COBA 1PF3A 3PQYB 4ZW3A 4Z5RA 3MD0A 2ZE5A 1GZHA 3PGFL 4QXUH 2ZCLH 3CLEL 5CSZB 2B1AL 1YA5A 5C0BA 3ZKMD 4DEWA 1NGZA 4ALAH 4MMYB 1J5OL 3K6DA 1TEFA 5I19L 2WWKT 4NN5C 5IB5B 2KSDA 4GEIA 5TQ2L 3SJVA 3D4YA 5D6CA 1F4NA 1YNTB 2G5BA 2YBRA 4LBEB 2D03L 1DVUA 2F54B 4N2FA 3OJDA 2YXLA 1A14L 4CNIB 3QUGA 1LO5B 2XYBA 3V0AC 2XASA 3F85A 4ZPVA 1EFRG 3SGEI 4D3CH 4B3MB 5DR5H 4PJFB 5EIBD 3A4AA 3WB2A 2RTTA 1WC7B 4KNTA 5C0CE 2JJWA 4DP8X 3BUYB 1AR5A 1M6OB 2OTWA 4GEJA 3MRKA 4GIPD 4K94L 4KOBA 4QAMB 4YHKL 2A9CA 2DQGL 3OG6B 3F7YB 1COWG 4IMLA 4LGPB 1NU1H 2YRBA 5A7EA 1IFGA 1PIFA 2EE6A 4NZ8A 3QULB 3T4YA 1PL4A 4WY7H 1TVDA 2FBRA 4M43H 2NXYD 1IARB 5TDOB 3OUSA 4JI5B 4WWKB 3EJZD 1IAOA 3SBQA 1TZGH 4Y1TA 3EDJA 3ZQXA 3RWJB 3MA7A 3QPXH 5K9OB 5LXVA 3DX2A 1G1YA 1WB8A 2JJUA 5C2BL 3ZRSA 3FB8A 2DD8L 1R19A 5C0EB 1KWKA 3ETTA 4AQOA 3V8OA 4XGZA 1YNKH 3UG5A 3IMBA 4PJGB 4PM1A 3UTSB 1XGQB 2QR0A 3ARZA 4TQIA 2HJFB 3FCGA 4R90L 1M90W 2QSVA 4MKTA 4AM0Q 4H25A 1ETZA 2CO6B 2BOCA 3QIWD 4JB9L 2DL9A 2E27L 1ZT4B 3T1YB 3HZMA 5KW9H 3T1CA 1XH0A 3SDAB 3HPJA 3N91A 2YUXA 3K72A 3SDXF 5LN8A 4DR7B 3ZTJH 4IL6Z 2CH8A 2WXRA 3A5VA 4H8HA 3C60B 2WXKA 1JX9A 4PB0L 5KSAD 4KXDA 4ATWA 5GXBB 2FIRT 5E94A 1NAMA 4DV5B 1Y74B 5A6MA 1KBWA 3REVB 1SN0A 2YQ2A 4HNAB 4HV8B 3GSWB 1EN4A 3AC0A 1U97A 5JW5A 1H3TA 3DPDA 3JTTA 1GTNA 1EBPA 1PZ3A 4V2BA 4EFEA 3W1ZA 1VP7A 3FHAA 2NYZA 1EBAA 1FG2B 2Q7YB 4WHDA 3GK8L 4ZO9A 1RSYA 1RZFH 3O0LA 2KBGA 5D96C 4AYEC 5EH1A 1WIOA 1BMFG 2JIXB 4OLZL 1NDMB 1TSHA 3EJRA 5A2AA 2QJ1A 3QARA 4LF8B 4XX5A 2HTKC 3HG2A 1INEL 2A6IB 2FQFA 2OMTA 3QXUA 3LRHA 3PDOB 2FJGA 5F8QC 3ROLA 3ZQ9A 3FT3A 5MEPA 4OLXL 4MMZA 4BQ8A 1YJDL 1KECA 4L3EB 2CDFB 1KG0A 2XCMC 5IW6B 1MNNA 1IMHC 3SZKC 4LT7A 4JTDB 1SJHB 4QHLA 3C5XA 4ZTOH 2XZQL 5KVFH 1N5YH 1Z5HA 5I75C 3DK0A 4CH4A 1MWAL 4F9PA 2Y6SD 1R3LA 3H1HH 5ECGA 5B3SB 5LCVL 2YD1A 5F70A 2JB6A 4OZIA 4JJOA 3MNWA 2CK0H 2C9UA 4D0CB 1IBMO 1KB5A 3WE6A 3T6WA 1SJMA 2QDVA 1OCWH 2BSDA 2O5XL 4MMXA 2NY3C 1MVFA 3HN3A 3FO9A 3RJDA 3NJIA 1BW8A 4ZMVA 5GS0C 3I02A 3R4RA 4LH7A 1NCJA 4G1MB 5DUJA 4DR2B 4LVHC 4TQEH 3ZHQA 3L7EB 4IKNA 3CFDB 4XPTH 3TBBA 1SOSA 2NY1C 4PA6A 1BFOB 1T21B 3CFKB 3GEFA 3ILDA 2UUDK 4H5SB 3S2CA 5ITFA 2SEBB 3C5ZC 3Q8EA 3ZMRA 3D2UD 1DEEB 4HUCA 3FN0L 1I4FB 3TBTB 3WDJA 1IKNC 3ATDA 3BT2L 1PD3A 4M6NL 4MVBD 5FM8A 2M83A 3WNOA 1E3ZA 5D1XC 1HEZB 1GM8A 1BJ8A 3NIGE 4OXSA 3FU3A 3UZVA 2GUZA 3DIVA 3QUXD 1TZIA 4GKJB 2HHHO 1JOIA 3MROB 2FJUB 3FH7A 4PW9A 1XI1A 3QWNA 1B6QA 1PL3A 2NSMA 1MAJA 1JTOA 1Y6NR 3QHFL 3DETC 2WQSA 3MUGB 3P73B 4RX4A 3ML0A 2X1XR 5I1JL 1AXTH 3SDYL 1W0VB 3L2MA 5JIHA 1YEKH 2K9FB 2I60L 3U0TA 1JV2B 1NZ6A 3MRGA 1GZPB 3EH3B 4HXBL 1MVUA 4LNRB 2ZX7A 3I6KA 2G3NA 1DF5A 2P24B 3PP4H 4G6FB 4Y5YA 3RWGA 1JK9A 5I8OH 1RVFH 2X1QA 4HCRH 3HJ0A 4U1IA 5A2LH 3TESA 3ZHTA 4X9YA 5CIPB 4E5XB 3HG1D 2W9EH 2ICEA 1F3DJ 1ZK9A 3BZDA 3VD0A 2DLHA 2IH1B 4B3SB 3CVHH 3DMMC 4YO0A 4QRRD 1H19A 1CD0A 5B38B 3EUDA 4ETQA 3KXFD 4JUSA 1QHTA 1AMXA 5B1BB 1VQ9V 5HHVL 1VGKB 4BFIA 4NPJA 4DKFH 3T77B 3OZKA 4LBEC 3BMWA 4JVPA 2JKTM 4XMUA 3VXQA 4UBDC 4ZHQB 3WS6A 4UB0H 4AZ8B 3LZLA 1FZJB 1DQKA 4H1LG 5I1CL 2N7AA 1Q94B 2BRRH 4UF7C 2GTQA 4MVSA 2KPNA 1F18A 2BHYA 2E47A 2IANA 2BCKB 1XREA 3BXNA 3JV4A 3P02A 4JQXC 4S2SA 3TBWA 4G83A 1BFTA 2FLBT 1N18A 4JS7A 4KJYA 3QDGB 1YMHA 2KLTA 1RM1C 4ZFOB 4POUB 4JY5L 4P5TB 4HEPA 5IW3A 1AQDB 1EEZB 5FECA 3NCBB 3U7WH 1D3CA 3ASOC 1E6OL 1T3FB 1GYWA 4Q58C 5EUOF 1PX4A 1QWUA 2YPKB 4LF6O 4KH9A 1EJOH 4X8JA 1MG1A 2N04A 1DCEA 5CJXC 5ICXB 1PD6A 1MRDH 5SX4H 1G7LA 2GITB 4JL2A 1IQWL 3T65A 3VXUB 3LNHA 2AK1L 4OCWL 1HNXO 4B08A 1WE5A 4DUZO 5DGRA 1FXVA 4PJ7E 4CC0A 3AU1A 1JZDC 3CCMV 2P5WB 2A9MH 4I48A 5IJ0B 4MNQB 4HOXA 3ULUL 3DUSA 1A1MA 1CU4H 2XT9A 1OANA 5H6RA 4AW4A 4XMXA 1E4XI 4KI1A 3VWJC 5I1IL 3R1GL 3UM7A 4PP1D 2XNAA 4DPCX 1UFIA 1PX8A 1FZOB 5ESVA 5JPMB 5LGJA 2Z8SA 5D7IA 5IB3A 3UTTD 4HJSA 5D2NE 2R72A 2PYFA 1JTPA 2OW6A 1A3RH 4LPVA 1F3DH 2ZKXA 3P3SA 2IAMD 3MV8D 1QQDB 2YKLL 4N25A 4Z7VB 4PW3A 3VE0A 5MEND 2XSKA 5BMVB 2P4AB 1WTGT 2FO1A 5LHDA 3VW3H 5IROC 3X2QB 1SXBA 1TJHL 1R47A 4AEHH 1MCWW 4H0IA 3U9UB 2WVTA 2NSXA 1M7UA 4PI2A 1BHGA 3VGFA 1F5WA 3JARA 5HPOA 2XTLA 2HVKC 3EOTL 1QBZA 1IZKA 3KYNA 5FPRA 4X64B 1MIEH 2AJ3A 4G2KA 4HIXL 4L5FL 1B88A 1CL7I 1IIKA 2A7BA 3QZNA 4MS8D 2WM0A 5IOPB 3AK3A 3RA7L 5BW7A 1R5IB 2PWHA 3LXCA 5AZ2H 3U0WL 1UG9A 3BY6A 2XX1A 2XHBA 3EW3B 2EYSA 43CAA 1BPVA 5ERWB 5FA4B 3OB0K 5IFAH 5ITZA 3EUUA 5J6GA 2WZPA 3SQRA 3NG5A 2H4EA 2ZUWA 4XI5D 4DVRH 3QUYA 2VC2H 3NTCL 4U4BA 4F80A 5I28A 5DMKB 4FX5A 2H7WA 1MZZA 3SJVD 3BWUF 4HGKC 4LEBA 3SGKC 4RAVB 4LMQI 1EX0A 3QDAA 3BD4A 5GJSH 4MCZB 3K91A 3FCTA 3HNTH 1Q1JL 3CBKB 2J1ZA 3LKNB 3CDGA 5F7UA 3LEXB 4TPRH 1ILSA 2DBJA 4XBEH 2VDRH 4Y2OA 4AC2A 1XF5A 2ZX8A 3ZDYF 2XN0A 1BF8A 5AG8A 3VO0A 2MCPH 2UUDH 2AJSL 5JDSA 4X6DA 2X7RB 1N59B 3TO4C 3RLSA 1T7WA 2QVFB 2FX7L 4DK6A 6TAAA 4GXUM 5HI4C 2Y1VA 2Z6FA 3DIDA 1PNKA 3BP7A 4H2AA 4PJ7A 2DKSA 1NICA 5JYMA 2WUCL 4LF5O 1JXGA 1QWHA 3L45A 4QT5B 1BX2A 3UEQA 3VSUA 4N1EA 5ISZA 1NI8A 3IDMB 2UWEB 5T3XD 1OP3K 1BQKA 1JZIA 2GB2A 2ZE7A 4X62B 5JUEH 1OSZB 1JCHA 5EBMA 5ALCH 2GTZA 5D6DC 3DWTA 3CN3A 5D2NA 4NO2A 4TSFG 1D7DA 3K80A 5E03A 1IC5H 3UJTH 4DAGH 3MREA 4P0DA 4M3JA 2VR4A 2ZKYA 1R24B 5FYLL 4AGMA 4JKWA 3JD0A 4JUTA 1DVFA 1WZLA 3ATEA 1RERA 2DW5A 4PJHB 4YZWA 1N4XH 1NZRA 3QORB 4WGWB 2FSDA 2MSPA 1G7MA 4UOJA 4LSTL 1DK1A 2PUQT 3FFQA 2W0LA 1NTDA 1I5YA 5AUMB 3ARBA 4JHZA 5EOCL 1LUVA 3OAUH 4WFEE 1L4IA 1IKFH 3MLTA 3PE9A 4W9JC 5LNEA 4BK5A 3KPRA 4LVOC 1YPZF 3DC0A 3CQQA 5CGYD 5IYDO 3O4LE 1QW9A 5DEFA 2AZUA 4JI4B 1M6UA 1QRNE 2YWZA 4RRPM 3S37H 2NZ9D 5D2LF 3EYFB 4PRHB 1UXMA 3BAWA 3NZSA 4K3EH 2MOQA 1N2RA 1UCBL 4FJ6A 4MJ5A 3OHXA 1AXSB 3MOQA 4O4HA 5LP6B 4YDNA 2G4GA 4UU9A 1E2ZA 4XPFH 1NANH 2IGTA 3NFSL 3TWCH 4KKZA 4K23H 2BXYA 4K73A 2DLFH 3GI8L 4KROC 4M48H 3DX8A 3LD8C 1A7RH 1FDLH 4HUUA 4HLZG 1S7UA 2VXSL 3BAJA 1B3JA 2O61B 1IURA 3MDSA 5GRVK 4IIZA 3D3IA 2C3XA 3RKPA 4BH7B 4ZXBA 2BSRA 4LKXB 5CN3A 1DHKA 3L3KB 3FFOA 4LSSL 4UOW0 4EMZA 1NBYA 4F20A 4QRFA 4IS6B 5HVFB 1I94O 3Q6FB 3U4BL 4RFOH 1XD1A 5J11B 5EO1B 1FZKA 1YEJH 3GZKA 5FO9A 4A39A 4HBNA 1W72L 5IG7B 3SGDI 1OD9A 3FQ1A 1ZX3A 4JE4B 4NGHL 1FFOB 5BR8O 3KYKH 3F7RA 1OM3L 4AQEB 2E86A 4XRCA 5DTFA 3ARDB 2VRKA 2RR3A 3JD3A 4HPOH 3RYIB 1NMCB 4BFGA 4YX2H 1CYXA 1AANA 3KLHC 4MA8L 3VXTA 2D2CB 4WFBV 4PGCB 3A0OA 5JA8B 5IIEA 3M17B 3FU9A 3IDXL 4XMLL 3H1LH 4MS2A 1ZPLA 4BQ6A 2R59A 5AB0A 2YD2A 2P4VA 4B53A 4M7LL 1DFBH 4EKWA 5DURB 2XBZA 1TVKA 3BCFA 3MPCA 4XNAA 4I50B 5F3BA 3S9DB 1XGYL 2ZOLA 3VXMA 4GYBA 5AVSB 5E1AB 3QXTA 3BD3A 2A74A 2BP0A 2DWDA 1FFQA 3CBRA 2PUSA 3C2AH 2FYVA 3DV4A 4FNTA 5HHPB 4U6VH 1YEDA 3VQMA 3P40A 5INDB 5EC1C 4YSDA 2X4QA 1XGPA 3LKOA 4WW2F 5E56A 5IM7A 2DI8A 3EHBC 1WICA 3EO9H 5D1ZA 3RGHA 1YF2A 1A7PH 2X0WA 4PVLA 4XPHH 1JPGB 5K9KA 4XMPL 2NT0A 1H0DA 4WFEA 2H3XC 5B22A 4DNLA 1QBAA 1VJSA 4RX4D 3DTUB 1MCPL 1O6SB 4FXKB 4H8QA 3CU7A 5GZOC 5J5EA 2D3LA 1JNJA 5CCGE 4KZEH 2GIMA 3LNIA 4ABUA 1KEGL 2WYTA 2AABL 4GW1B 1AI1H 2OMZB 3ISRA 4X0KB 2KH2B 4APQB 2AV7A 4OKVA 3OB0H 1ZSDA 1E67A 5JVDA 3OGCB 5E9DE 5I1EH 3MRPA 3WY2A 4JAMA 3FQTA 1BAFH 4J8RB 4Q8BA 5ICYB 3U82B 5IW1A 1WF5A 4QD2E 3VNYA 3ISWA 4HWEL 4DK0A 4KHPO 2OYQA 3IU4H 2O93L 5E2UL 1G94A 2NX5E 1S78D 3I3EA 5AVQB 3SQBB 3H9YA 3QR1A 4F1SA 4YDMA 5IT9N 1CD8A 5I1DA 3SDDA 3FQXA 4ZMZA 1X4ZA 4L4TA 5JZ7C 1IBGL 3Q2NA 1QLEL 3QNZB 4X1YB 3T3PE 4DGUA 2DIEA 4PP2A 5L0QB 2IAND 3BWUC 5J06A 2ITDC 2VDPB 2Z7YA 2PWGA 1SFHA 4W4KA 4R7DB 1LGVA 1P49A 1V3MA 4FLXA 4ACPA 2WZ6A 1OY3B 1TEYA 1OP3H 5CJOL 2AVGA 2MMXA 3I9AA 4XAWL 4NQVA 2JKXA 4CA4A 5IMMA 3O6FB 1E90A 1JDDA 1RK1B 4WNQB 2WSKA 4UM8B 1CTMA 3CHSA 2YLHA 4CC1A 3N42B 1P69B 5HHNB 2FDBP 3TIEB 3U46A 1Q6UA 2PO6A 2DQEL 2X4NB 3HC0A 3UGUA 4ODWB 1B3IA 1N5AA 4UILH 4WW1B 5MERA 5G55A 4FP8H 4XE5B 5GS0L 4ZX5A 2VQFB 4WGVB 2MOGA 3K79A 3AS2A 1N0NA 2CKBL 2E9WA 3QUZC 3VFOA 1XVSA 4RGMB 2MHAB 2X2YA 1XIWC 3K5RA 4M8QB 3DSFL 1CICA 4IT5A 1D7BA 2CGZA 2XIIA 3K74B 1SN5A 4U1JB 3CG8A 1G6RL 3F7LA 4O4JA 4DV1B 1SF5A 1Q43A 3H1IH 2GJ6E 4HZLA 3GINA 1E2WA 4QJ4B 5EBWA 2V2TB 3H1KH 3MRJB 1U8CB 3ZRCC 2ZF9A 4X66B 1ZE3C 4XVUC 5BQ7A 3GSXB 2NY0D 2H32H 2LFGA 2N0MA 5D4HA 1DBBL 4JDVB 1JMKC 3U0PA 4PBDA 2E74B 2W07A 4XP4L 5IB2A 4YDLC 3ETQA 4ZMLA 4L1TA 3ABLB 4AMKL 2IC2A 2V0AA 4MYPA 1PLBA 3FQUA 3V0DA 1KELH 1MHEB 4U1NB 4C54A 5CEXB 5EZYB 1M7IB 1QTYT 2X4TA 2ZYRA 4GG8A 4X9BA 3TP4A 4PJDA 6PCYA 1QZ1A 4HX1B 5KBKA 5B4MD 4L2YA 3B3IB 4K15A 1FH5H 2J20A 3H4HA 1T4KB 2NX5A 3L3IA 1B4LA 3LZOA 1ZY9A 4CADA 4FZ8H 2ZP9A 4U1MB 1Q0EA 4ZAKB 2CMRL 2LU7A 5B39A 3QRGL 3UT5A 1JAEA 4FMFA 4P3CH 1UYWL 2ZUTA 4PDMA 1T1YB 4HC1H 3W7UA 1ZAGA 2HKHL 4ZOEA 4CDHA 4TNEA 3I3BA 3KM1A 2GUYA 3DOSA 3RUGF 4UCVA 5K1XA 1NIEA 2XU9A 2WZPD 2X6BA 4MDIB 3DV6A 4X7FC 3KCYA 2DM2A 3B2MA 3QUYD 1MCNA 4PJBF 2R2CA 4JZJB 1ZANH 3OE7G 4DGYH 5AVVB 4EJ1C 1PFCA 3WO4B 1V3JA 4TM9A 2HVJC 1Z3GH 1BVZA 1DTUA 4Y4HB 4AE0A 1DN0B 5L9DH 5KHGA 5LMNB 2K6YA 3RUGB 4EUPH 3JALA 3V95A 4JGSA 2JVDA 5BZDB 4FL4C 3MV9B 4CBPA 3ABZA 4XCEB 4LSPH 5CR8A 1XEDA 1SHSA 3MBEC 2VR3A 3TWYA 3HFFA 4U6XB 4OX9B 2IGFL 1N6QH 2O6EA 3NCEB 4EI5A 1I1YB 4YGAB 3VFGH 1QO3A 3DURB 4HJTA 3CD4A 1NSNH 1UWGH 3SJQC 5F9JA 2Q8BH 2XJLA 2IBBA 4L1SA 4JV5O 1EMTH 3PWJB 4EOWL 3GKZA 2AQQA 1N7ML 1CMOA 1AO7E 5EDXA 4R4FL 3BPNB 4F15C 1QFWL 3LVTA 3E89A 4WI5A 4PIRF 1KMIZ 2GIXA 5ISZD 3DJSA 2LP7A 4XCCH 4ZX3A 3CVHB 3E1ZA 1X6LA 2H26A 5HSFA 3MFFA 5D5PA 5C97A 2YN3A 2ENJA 4QGPA 1SQQH 2ADIB 1MSDA 2GJ6A 3B9KA 3MRNA 4U3SA 4QLWA 1MW1A 5E8PA 2W94A 2R69A 1NMBL 1OHQA 2BJMH 4HPYL 4JO4L 1G7QB 3GM8A 3H9SE 3F6LA 3N2GB 2V5RA 1AACA 2R2HB 2BVOA 4Q6IA 1N0LA 1IT9L 4IJTA 5LA6A 3ZBHA 1CI3M 1U95A 2XBTA 2XG5A 3M6DA 4MASA 4WW2C 4XVSH 3RE0A 1C5DB 1WITA 5HYJB 4LNVA 1WWAX 4JK0D 2ZUQB 4I7ZC 2QQLH 2GT9B 5EZIH 5CWSA 1XCTA 1WFOA 4DKDC 3ARBD 3MLYL 4X5PA 4A2HA 5BJTA 5A40E 3JUZA 5I1KL 4XVOA 5K5YA 1AXIB 5DK2B 1P84K 4FE9A 3KPRD 2WN2A 3GXUB 1LO2H 1HL4A 3H2PA 4JPKH 4UVBA 4YHHO 5FO8B 4DR3O 2ZUVA 3T1WA 3MRCA 5F6IC 1XSKA 3GLAA 5K1JA 3LH9A 1GJUA 2WBJB 3AY2A 4GJTB 4XP6H 1DEDA 2DQ0A 1BQLH 3Q1EA 3TH4T 3E6FB 3WXWH 2NY5C 1PY0A 1CDBA 1XF2A 3KWWA 3D0LB 3SCMC 3FB7B 1GYUA 4AMWA 2MH4A 1T5XA 4KKQA 3IGAC 1QI3A 4C4UA 1S7QA 2VKWA 2CNYA 3GXNA 3WIFA 3G6JF 4JYAB 3BLPX 5HHMD 4FF9A 4RMRA 2K0RA 4ZXBD 4NP9A 2DJ4A 4ZW7A 4RESB 3T0EC 2UXCB 4LCUA 3PAUA 4A2LA 4G8AC 4KDVA 4IBUA 4GFXA 3BZFA 2C3HA 3B2UC 5EEXA 3R4DA 1AHWA 3IVKA 4A7GA 5DJYB 4XP1L 1U8IB 4PRNB 4Y4KD 2FYYA 2IMNA 3KGRA 1F13A 2XQYA 3DUUB 2XPYA 4ZD3H 3K6IA 3FTWA 4AIZA 4DT2A 1CFQA 2Q8VA 3ZT7A 1BOGA 3TVMA 2DYSB 2K6ZA 4K8RD 4LLUB 4YGVA 3GHBL 4ZSOE 5BUGA 4AIEA 4RGMC 3GHEH 2X4RA 1P2CB 3DVFA 4YSEA 2ZNWA 3IDGB 1NEZG 1KACB 1JZJA 3AY4A 4DJMA 3TNNB 1JRHH 2BC4A 1A4JA 2O5YL 3HCVA 3HS8A 4M62L 1RP3B 3L3OC 3VXMD 4YDVB 1S5HB 5CUSL 2LW7A 5DUBB 4J1UA 3DK2A 4QOKE 2G0KA 5GGVY 1G5GA 1JI1A 3R18A 1TVBA 4ZIBA 1SQMA 5D1ZD 2KI6A 1A9EA 1AG6A 1QSFD 1UACL 3C3SA 2R0LH 3OKNA 1IILE 4JN1L 5HJGA 4DV3O 4MAUL 2PXYB 1V05A 2G5RA 5GGSB 1EAPA 1SYVA 1IIIA 1CWVA 4WFED 4XWOD 5AYUH 5AALA 3MNVB 2VDRB 2FTKA 3AG2C 3W11D 4BQ9A 4KL1A 4QRTA 1HH6A 2X7LB 1VMGA 2AQ3A 1TJIL 2UXBB 4OGYL 4FNSA 4XXDA 4ZQKB 5D5MF 2L6LA 1ZCRA 4YZFE 1CK0L 2EO1A 2UZIL 3QW9A 3H9ZA 3OM3B 1NDGB 1HCVA 1NGWB 1RIUH 2CE6A 2NDFA 3TJEH 4B97A 1H3PH 4FIPC 3P3PA 2FZ3A 2NW2A 1EJ6A 5FYJD 2G75A 2VXQL 1FYHB 3UG3A 3SE3A 1P84J 3LEYL 5D5MB 4XODA 1HTYA 1AOHA 3V8CA 4JY6A 3MA9L 4ZNEE 4ANVA 3UYRL 3TO2B 4JM2A 1TUPA 2XN9B 3SDDD 3IJ9A 1B6DA 1EDQA 1EWHA 5C0JB 1LE5A 3BDYH 1TPXC 3BSZL 3GGWB 3TU6A 5CA0A 5JPNA 2F1AA 2YAEA 3BA8A 4XDJA 2LO1A 4L4TD 2LAGB 4QHMA 4XH2B 1IBDA 4IRSA 5FO7A 3QQ4B 4K8ZA 2HLEB 4XVJL 2BSSA 5EF2A 4X89A 2PPCA 2Y1AA 1VACB 3U1QA 3NCCB 4M7ZB 4H20H 4P2RB 2FX8L 2Y7OA 3HR6A 4DH2A 4RAIA 5I1GH 4QHUB 3H8NA 1J86A 3K06A 1KENL 5HTSA 1Q86W 5CHNA 3QCUH 4ODUA 3L81A 2FJHA 3EBAA 1F7YA 4J3VA 2ZAGA 4N0YL 2PWDA 4ONFH 5J6HA 1V55B 2VQUA 3BZ5A 3D0VB 1ZSPA 1A22B 3VH8A 2HT2C 2F58H 1TJGL 2ZONA 4HIEA 1QBLH 4JLRB 4ZSOA 5MHSD 3DVNA 2X6UA 1BV8A 4Z3GA 2PO6D 1MWAA 3G6DL 1KTLB 1I75A 4LOUC 4Y2DC 3ZE2B 4YXHH 4YHIA 5I1LB 3TEYA 4JFXA 1JPEA 1FVEB 3E35A 4I77L 5LCVA 4AYBA 3CUPA 3OJ2C 2VN6A 3HEIB 2UYLB 4TQFA 4A5UB 5I6KA 3FHQA 2XZCL 3WY3A 3G7TA 3ARGA 1U4FA 5L4JA 2I27N 4KU1A 3W2DH 1OO2A 1CICD 3NA9H 3DHMA 3HKCA 1PSKH 2WAQA 3U4AA 1K5NB 3DYMA 2KLSA 4MVUA 5F7AA 1KCBA 2AHZA 2WSPA 4XNQA 1OSYA 2OXGB 4OVVA 5DDHB 1V7MH 4BKSC 2LFRA 3ZDXF 1NLDL 4ELME 4G8EA 2EXYC 3MMEB 2Z35B 2NNAB 3NFNA 3U7YL 4XZ4A 3EG9B 1BGYH 4PWEA 5E6ZA 3VM5A 4FG6C 3GBLA 1NFDA 3ULUE 5KX5A 3LB6D 4AH2B 1KU9A 2FJSA 1V54C 4UT7H 1ECYA 5ABAA 12E8L 5HYIA 3QTCA 1HS6A 1MQKH 3DXAD 4Z1VA 3SKMB 3FSOA 3HVDA 2PP7A 1CGSL 4PUBL 2NY6D 4X80H 4OCRH 3M8AA 4AQ8A 3FUKA 4OGQB 5ESAA 3GUTB 1S3JA 1J8SA 2DI9A 3L3GA 3SE9H 4BHUI 3DARA 5ANHA 2Y2TA 2NX5D 3FONA 1BS3A 4Z0XA 5I8CA 1CD1B 3V9EA 4PWIA 3ISYA 4QGYA 4YUEL 4PJ0Z 4BE6A 1AJPA 4NWTH 4KPHH 5A7BA 4JRXE 4L1BA 1JN6A 3C8HA 1VFBB 3GRWL 2AGJH 2BY0A 3X1BA 5EZJA 5D7JB 4NT6B 3OT7A 3HNVL 4ZUUB 1T0MA 4OVUA 5SX5K 4H26A 5AD0B 3S35L 1M7XA 1QFUL 3HB3B 3HAEG 1GN2A 4JKNA 2AEOA 3GKWL 5C9KA 3V55A 1FORL 1W80A 2DQDH 2H9GA 3BMVA 1BSMA 3N40F 4FQCH 3S36L 4Z7QB 5FGRA 2UVFA 3TGXA 5JXEA 2Q2LA 4PGBA 4NNPL 5D70L 1Q72H 3S6CA 4L5FE 1UADC 3MV7B 4AWJC 4YR6B 3F58L 2DYPA 3GMLA 2JKLA 1JD9A 3O3BA 1SFDA 5T5NG 3HI5H 2Z93B 4N3TA 4YNYB 2HWZH 4JBSA 4MTGA 3KCWA 1BM3L 4UMSA 1X5KA 1KY7A 1GPOL 7CGTA 4EI5D 1YEGH 4EN3A 1ZGLA 1A6WL 1KJ3L 1BOYA 1QABA 2MQGA 1GJIA 1MHCB 4HSCX 3GSNH 1XL6A 2HFEC 1LNUB 2X38A 5HHQB 2ZG2A 3CIQA 2FBJL 1CQKA 2AK4B 3VCLB 4NKMA 4DHLA 2VDKL 5LBGA 3SJCC 2V4LA 1IXMA 2P22C 2GBVA 1V7NL 4QRUA 3STBA 4BE5A 1K8IA 1E4XH 4Z7AA 3EO1B 1OV9A 2E7DA 4M5YL 3OW2U 4X8CA 5DM6V 4N23A 2ARHA 2GJ6D 3B9KD 2VXUH 3X12A 5HI5D 1KGWA 3C6LA 3KPQA 3QIUD 3EXLA 4U0RC 4RQQA 2H8PA 1OAKL 2ZIOA 1YSCA 3BWAB 1OAZL 4A2DA 1KGJA 1JHKL 3A6BH 4BW9A 4G8GA 3TZVB 2YPVL 1WBZA 2EDXA 4LSQH 4OD3L 2EDRA 2VDLB 4Z18A 3MRDB 1EERB 3C08H 3VXRA 2ZPKL 4KVNL 3TJHC 5EU5B 5FM4A 4B3TB 2Y7MA 2PI4A 2LQRA 4OFIA 4YSRA 3P11L 2UU9O 3BGFC 1UASA 2RN9A 2QGCA 1HI6A 4XCNA 3MODH 3LRSA 4RUEA 3BLBA 4N0FA 4UYPA 3H42H 3N9GH 3QE5A 5T3ZE 3WHE1 3NN8B 1MOEA 1CL7H 4Y1AB 2ADFL 1AJQA 3EOAA 3FTSA 3HE6C 5KYUA 3BPLC 4I2XE 3Q5YA 4JRXA 5IBUB 1U96A 1P5UA 1RZJC 2XN1A 2JTDA 3WHXB 4NO5B 5FYLE 2F19H 4LDCA 3WIHL 3S5LA 3TK1A 3EH5B 1IAIL 4ELKA 3WB1A 4Z7UE 4X20A 4GX5A 3ZL4L 2JEXA 1CE1L 2BXZA 4ZBJA 5LO7A 1TIUA 4EVNB 3T71A 3JAWB 1UD3A 1AP6A 2IG2L 3RIKA 1YN7A 1IM3B 2KDGA 2WXJA 3ZJZA 2JB5H 1ZAUA 1AP2A 2EZPA 1N64L 4BKLA 4X5WA 4OGXH 5IB1A 4X50A 2CDEA 5C9JB 2H32B 5FV1L 3WL9B 4JPWL 4O2EA 4GKZA 2R56H 2VR7A 2ZOWA 1KGIA 4QHPA 4F7PA 3TZVA 2GJJA 1GRWA 1OPGL 2PYEB 3MR9B 3ZMUA 2FEJA 3IB4A 2PW2B 3APCA 3U7AA 3UTPE 1MH5B 5I76B 3RVYA 4TLSA 4OCMC 1XBDA 2ZKHL 4HBQA 4M8VA 4EZLA 3CPLA 1U8JA 3GHPA 3H01A 3F5WA 5EEVA 5BUPA 5JIKA 1WAAF 4NKIL 5E00B 2XWTB 1LEIA 1KIPB 2HJLB 2OL3L 2MPAL 5F7NC 4JFSA 1NBMG 3FX7A 3TVMD 4KK5C 2CZNA 3G6AA 4V1DB 4U2YA 1UOWA 4DV6O 3L1OL 3GBDA 3VFUA 3QEQE 1J5IA 4ZYKB 4EPSA 1GRJA 43C9A 4NQEE 4PG2C 3VACA 3CSBA 3VFNB 3O6KH 5LGNA 5FF6A 1XMEB 4JASA 3HC4H 1AR1C 4Z76A 3D9AL 1KJVA 1NC4A 1UVQB 4LOVA 4PH8A 2FEEL 4LL9A 5E8DL 3BX7C 3JAKB 2L35A 4L8BB 5F7EL 3T0DA 1HWYA 4EUPB 3GB7B 1FFNB 1Y76A 4W9HC 4N8VG 4L29B 1GM9A 1UT1A 3NUKA 5FW7A 3AG7A 2XJKA 2Q8AH 3Q05A 4LF9O 2NR6A 1S9XA 4DUYB 3ABMC 1FGNH 4I0PA 5EIIB 1XSIA 6CGTA 3E2HB 4L0YA 4NO0B 5K59F 3ZHSA 2ZP8A 1AGEB 5F2FA 4I2XA 3RZCB 3OR6C 1ZVSB 3LSUA 2EIDA 3NJKA 2G2RB 1H3UA 2CUMA 3GNMH 5CU9A 1TGOA 2J88L 3AS3A 5SX5H 1V9PA 4MZ3A 1E30A 5TE4H 1XDCA 1FIGL 3G08A 3GMRB 2IADA 2YD0A 3B7SA 1HXMA 5SV4A 3IWUA 1QR4A 4MQXC 1U8NA 3O3DB 4P49A 4RCAA 4YBQC 4LCCB 5D7LE 2V2XB 4MNGE 5AVWB 2E7BA 5EZOL 1P6FA 2B1GA 5IB4A 5DD1H 5E6YA 5HGHA 1IAMA 4S1QL 4JM2D 4K9EC 4LDEB 3LQAH 1DVTA 1YZZA 3MGTB 2IEPA 1CF8L 2NY5L 3FB6B 4UIKL 1DDHB 4Z1PA 1WD9A 4IRSD 4FLUA 5E5MA 3K58A 1LK3H 4WI6A 1T5WB 5E8EB 2OLDA 2FKXA 4HFWA 4R97C 3RVXC 2XUMA 1NL0L 3FRPB 1P1VA 3VD5A 3WELA 2LLGA 3JVGA 3SGDH 3UPCA 1HKLH 5A3ID 5CD5C 3FS9A 5FK9A 4RWYL 2J8UE 1UPGA 3VXSE 1K4CA 5B7FA 5BPPA 4GW5B 3L70H 2F1EA 3L16A 1L9TA 2VISB 5CJBA 1D5AA 1JHTB 5D1QE 3CCEV 3HR5A 2J1YA 5ADOL 3OPUA 4X5QA 2V7NB 5DHVH 1DJYA 4XB7A 1BYNA 2BPBA 5TPWH 4NTXA 1PG7X 5C0AE 1ZHKB 3II3A 1I9IH 2VNCA 2X9YA 4JG0L 3HUJE 1W72A 2FYUH 4Z78A 3PJSA 5DWUL 3IJ7A 3SPCA 4EO5A 4MSWC 2P1YA 4LF7B 5E0QA 1YEEL 4PS4L 3BN9D 4P9HH 4JO1H 1HESA 4OZHB 2CIIB 1CLOH 1DBMH 1PNLA 5C6TH 1BIIB 4G80A 3EZJB 4RISH 1R75A 5DD0H 1FBIL 5GRJH 4F8PA 4J7KA 2CKNA 2F61A 2YAQA 3NABH 3RNKB 1PY9A 3DRQB 3Q3GA 2VWEE 3B8YA 1CYGA 3WN5B 1OSPL 1OW0C 1UM5H 2AEPL 1TQBC 5FUOH 1VFMA 4Z3TA 1T20A 4XC1H 3FQ2A 2GPZA 1BVOA 3IFPA 4NKOB 3IMRA 3MHSC 3QB7C 3ASNC 4E9XA 1KCRH 5F7BA 2YRLA 1T7XA 4AVIA 3D52A 1HU8A 4OY9A 2YDEA 1PPIA 3EJCA 4IK6A 4BA8A 1KEML 4KVCH 1EZVX 2VDOH 2Z8RA 5ETUA 5EOQH 2IPTL 4YE0A 4Z7OE 2VLJE 1J0YA 3VG9B 4MNGA 4XNZB 3BGMA 5CN1A 3UMNA 1NGQL 3PGCB 4K5MA 1TUEB 2RDCA 1NCDL 4RBPK 2CJUH 5D1XE 5DZPA 1X5GA 2Y36L 4U49A 3FT9A 2F8OA 2DN7A 1KLFA 5TH2A 3OL2A 4G6MH 2MNUA 5D7EA 1Q9WA 5CLXA 4Y9GA 3TBYA 2ZWYA 3L08A 2IGLA 2M1KA 4R4BB 1XEUA 1ZS8B 2YOCA 1RURH 1KDIA 4PTTA 5AW2B 3T1FB 5H8DA 2Q0OC 2VL5A 3MTRA 4JKPL 4X6FB 3V0VA 3KE0A 2HFFB 2N0KA 5JXED 1ZIAA 4YFDB 4ACTA 1L7TL 4E9TA 3OLGA 1BVNT 1NEPA 3TV3L 2DYPD 1S9KC 1TETH 1LEKA 3QXAA 3L5XL 4OCSL 2HFTA 2BSTB 2ICCA 1IGFL 1KCUL 1FNEA 3ARSA 1S9YB 4BFEA 4ERSL 2KKQA 4HUXB 3V52L 4BM7A 5BZBA 5C0RH 4JRYA 4LRIC 4LIQE 4EN3D 4JKMA 3TPUA 4YJ2B 4OD1L 2ZUSA 3IBEA 5C0AA 3PIQB 5JR1H 1QHOA 3MACH 4UZSA 5E6IC 4UNVA 3STLB 2NXZB 3H85A 4J7ZA 1YNLH 5T3XH 1UH4A 4HJJH 1I1FA 1QQCA 3D12B 5LXTB 1T7YA 4NUJB 1DVSA 4Z7WF 3W37A 1HFUA 3BPOB 3P9WB 3N27A 4LFBB 5C0NC 5J4MA 5AWNH 1HE8A 3IETA 1JGDB 3GMPB 3DNKA 4FQHB 3TFKC 1NT2B 5L7XL 5D7SL 1IFRA 1KFAL 2X5PA 1WFIA 3C6LD 2NN4A 2YXYA 4YN3A 3TA3B 1QW8A 3JT0A 3SR2C 5CEZL 1IGJA 2H41A 2WPDG 4ONOA 2WUBH 4HYOA 4G8GD 4U3JB 4PR5A 2QWRB 1X7QB 5AYTA 2DWEB 1IM9B 2GFBB 2A5UA 5CJQL 4LASL 3VXRD 1CFTB 2IXQA 1M7DA 3QNYB 2VQ1B 3FAVA 2XWXA 4JM4H 5CEYB 5ANME 2X0UA 4FFZA 1RZ7H 3RZCC 3BKJH 3NPSB 1Q8MA 4PGDA 1WVZA 2Y06L 3C5ZA 1G6RA 1WJZA 4LPCA 1H3XA 2AMGA 1NAMH 2VLJA 3WFEH 2YSUB 3WIAA 1QYGL 1IKNA 1IX2A 2ESVB 2ZSVA 4BSVB 4P4KC 3VGDA 3CC2V 1WA2X 3E80A 3ARVA 4NRZB 5DD5H 2Y3AA 1U9KA 1N3NB 5D1XA 5FUZH 2WW8A 1K6QH 2XG4B 3DHJA 4F6RB 4J6RL 4TS6A 5AOZA 3O3UN 3JWNC 1INQB 5HHXL 4XPAH 1OGSA 1WA1X 3LV3A 1CBVH 1L9NA 4LWSB 1SERA 3BAKA 3HZYA 4NKDA 5AW1B 3SE6A 3KLQA 1Y6MR 2HT3D 3UJIH 2BSKB 4HAGA 4K7FB 3CCHA 2C3GA 3U4KA 3W9EA 4AQ1B 1TZOA 1AGDB 2WTRB 3UO1L 1A4KB 3Q9QA 3QJHA 4E5XG 3RWIA 2PCPA 1EDHA 2YLKA 3GSVB 1H2KA 3PHOA 2GI0A 3U10A 2ZF8A 4LLDA 2YZ8A 5FGBC 4GSDL 4K0KO 1FYTB 5B38G 2GHWB 5GRUH 3N85L 1QA9B 4MXVE 2FWOA 3LQMA 1IGTA 4ONGL 4BWAA 4I9WA 3F5TA 1CDGA 3L3HB 4GAYB 4WENB 3SDXE 3V6FB 1N33B 2A38A 2WJ5A 3TZVD 3OAZK 1ET8A 4OCXH 3P2DA 3D69B 5L3GA 2BHUA 1EZJA 3DMMA 3KYAA 3UZQA 4I4WA 5C92A 5TJWK 4NIYE 1AZNA 1MFDH 1KPRB 1MLBA 2ROYA 3L95B 1KYAA 5I0YA 1RSOB 4P46C 1GO3F 3UBXG 4LBEA 1QEWB 4HPHA 3KLSA 4CBZA 1NVPD 1U92B 3QZLA 1UKTA 2QVTA 4NQXA 1L0QA 5ILTL 2YUWA 3X11B 1EHLH 3RFRA 3GSUA 4JHUA 1XCWA 4IRJA 4JQXA 4YAQA 2JJ2G 4NZUL 5E2WL 2YXMA 5DJ2B 5K9JH 1ETB1 2ADYA 4DK1A 3DGGA 4O4YH 4Q6KA 3EJSA 3RAJL 2XKSA 3IE4A 1NC4D 3MKKA 2JCCB 3GO1H 4XN7A 4Z23A 4JMXA 1AHMA 2IPUG 4DW2L 4GQ9H 4PBVC 2O26U 2R2BA 2ORBL 1X5YA 2BH0A 5ANMA 1GM7A 3CX2A 5CJXA 4J6IA 3D3VE 3CFJA 1MF2L 1IQDB 4FXTA 4U7NA 2NR6D 1XQ4A 5JW3L 4I0PD 4M93B 4WJKB 1Z32X 4FFBB 4OGAC 1ZGLP 1SXZA 4WSJA 3FUDA 1F1AA 1OAQH 2QR4A 1U58A 4AKPA 1MFCL 1F4XL 1Y1UA 4RBPH 1JUFA 1HZHL 1ZV5A 2WGXA 3ZYZA 4CC6A 3D33A 1DQIA 4RZCB 1D5MB 3VWJA 1DE4B 3EYVB 3BKYL 3LKPB 3BOVA 4JYBA 4N0RA 1HSAB 4TUJA 5FYLD 3ATAA 4LCVA 4BZYA 1ZT1B 1NIDA 3DXRB 3CV5A 1C1EL 2CHWA 3GBML 4XCYA 5C0GA 5PCYA 1P5VB 1F86A 4LFCB 1U3HC 2H2PD 2D0FA 2XWRA 4PJCB 4J3OG 4LRNH 1OHZA 3CDYA 4NXSA 3UYPB 1JVMA 1UZ8A 3NQKA 4V33A 5E4AA 4OLVH 5E6SB 3QJXA 1EZUA 1RZJL 2E9JA 3CZNA 3PFUA 1J9RA 4XPBH 2YXVA 2Z65C 3GZPA 2JCWA 1KLGA 5IROA 1N0JA 1T0OA 3UC0H 1US6A 4FFVC 4ZDHB 5FYJU 5T3ZD 5JMOC 1NAKL 4BWUA 4GRLB 1HZLA 2DLGA 3HN8A 3LZFH 4G5ZH 1E28B 2HVKA 1SYSA 3GSWA 1UXWA 3NJVA 4R96B 3QUKA 3FB5B 3QIWB 4HFUH 4H2CA 2OJEB 5IK3B 3SDXA 5CCKH 5IESH 4XBGA 3VVWA 4GKKB 5I23A 5E2VH 3O2DL 3VRJA 3IKCB 4E9WA 4IOIA 5FYKL 1YC7A 4CSPA 1FNAA 5GS3A 4BKTC 5DSCB 1VFUA 4IIJA 3HFML 5KSAB 3Q4HA 4N2LA 4QNPF 5KSVA 2QV4A 2L3BA 1UXSB 1UFUA 4KRPC 1HP8A 1JZEA 3FKUS 5C07A 2UZXA 5EV7A 3IDIB 2Z92A 4BINA 4GI9A 2Y5TA 3OX8A 2DM7A 4P4RA 4CJ1A 3WY4A 3WTUA 3I2CL 1SJHA 3GMMB 3HMWH 2JGUA 2XPZA 4P07A 4R3SB 5EORH 3SKNA 3SGKA 2F53E 1HE7A 3KCPB 3OZ9H 1I85C 3NSYA 3OKDB 4KKLC 3V7AG 5L2KE 4APXA 4FXLA 2Q86A 3JV5A 1J5CA 1CB4A 4JI5O 1T0NB 4GLXA 2APSA 2AXWA 3HKDB 2BWIA 2G5UA 3C6EA 2IWGA 2NY2C 4GKNB 1J9CT 3E6HB 4IEFB 1JQ0A 5IJVB 3VFSB 4QLRA 3S34L 3A8TA 2CA3A 4BSWA 3WMQA 5JO5B 2BP8A 3SOBH 4YHYC 2ICWA 3MUZ1 3TO4A 3HTLX 4U3FH 5DHMC 1MFNA 4CMMB 4O2BB 4OT1H 3UAJC 4LR3A 2DQUH 3FF7A 4P5KA 1VB9A 2PP8A 4Q9BA 3ZN0A 5TK4A 1HXYA 2BOBC 1AZZC 2KT6A 2ERJC 4FYQA 4L8SC 2VAAA 2OTUA 2P8PB 4PMFA 1IX9A 4A7VA 1ZPUA 3IJSB 3D2TA 2A9BA 1E9PB 2YQGA 1LM8V 2WOBA 2Z5UA 2XTJE 2PTTB 1G43A 4MTMA 5F1OB 5LAPA 5TE7L 2ADGA 2N59A 1U91A 4MD5B 4P3DA 4UT9L 4X4YB 5D6DA 4TQPA 4DR7O 2EH8L 3W5NA 2C7UA 2Z91B 4FI8A 2GEQA 1MSWD 3IFNH 2Q7HA 4DV5O 3V0EA 1LXMA 1NINA 3KWUA 2DQCL 3L4YA 3JT2A 1PCSA 5HGDB 1SM3L 2NY7H 4LLMA 2CDYA 1Q9LA 3D2UB 4EIBA 4ZI7B 1NCCL 2ZJSH 1U33A 2RJMA 4BGLA 4C56B 2GAZA 7FABL 2BVTA 5IMLB 2R23A 1JV2A 5IJ9B 4JL1A 4RGNE 1SNRA 3KL5A 1XMOO 1A3LH 4L23A 2CO3A 1X9QA 2O5ZH 3OAZH 4LF8O 3QUXB 1WAEA 4JCLA 4ODHL 4NRYA 4K9EL 2IO5A 3NESA 1TTBA 2F8VA 4O5LL 1Q0XH 4BK8A 4AYMC 3WBDA 1CXFA 1GH7A 3M99B 2HRLA 3DX6B 2P5EE 2VXQA 3HZKB 1YCIA 3UBHA 4AGQA 5KYWB 4F7TA 5KAFZ 2F4VO 2WBKA 1K8AW 4Y2NA 1DQQA 4NM4H 4YHPA 1SLVA 5H2BB 3LRLA 2Y5QA 1T5EA 4Z7NE 3TH2T 2V5MA 1RUAH 2H1LM 4ZTEA 4ORZC 5CB4B 1VGKA 2YD7A 3BSZA 3P9MB 5AKTA 2VITB 1G7HA 4JRYD 3ETEA 1CGTA 1E27B 2CJTA 2QQKH 5J2TA 5B1NA 4ZHQA 3EGXB 2WLNA 4U1KB 5F1IB 1BEXA 4ZRGA 3ZE0B 1WV7T 3FT2A 1JGVL 3WXVH 4ZZKA 2HTKD 1XGTB 5L2KA 3HG1B 1WBYB 4UNIA 2EYTB 2VL4A 4IRZL 4DR2O 4XXCC 3IS0X 2WP3O 1XFPA 4DV2B 1PD0A 2BWDA 2ZWSA 3BIKB 3KXFB 1NR1A 3AXLA 3MO1A 1PZSA 5GZNC 4GAGH 5JH7B 5KVEL 3IK2A 3BDXA 2CRYA 2HJKA 2L8AA 2VN5A 2PMZA 3LMJL 1B2WH 2VDQH 3C3TA 2CK2A 2VMEA 3CZJA 4ABQA 5KA5A 1A6PA 1ICTA 2GITA 5GPRA 4FNLH 5GISL 2NY3D 1I8IA 2RB8A 3LKRB 3GJEB 5IT2H 3O3EB 1H5BB 5H35B 5GS0D 3NZHH 32C2A 3GSRA 5EUOA 2LHAA 5IJ0A 3ZDYE 4GKJO 5KYYA 2AJUH 4IBYA 4S0SD 2JS5A 4YXKL 2NY1D 4ZS7H 3ECVA 5BVPH 1S46A 3C5ZD 4TSBL 2A2QT 1FLRL 2ENYA 4BK4A 1IBKO 4HIIA 4DR5B 3CH1B 5I8KH 1N8ZB 4R26H 4GUPA 5F44A 4BCYA 5DHVB 3QCTL 1ILUA 1HC1A 3VQ2C 1FC2D 4AQAA 3X14A 3MLSL 5DZ9A 3TT3H 5D1XD 1SEQL 4AMXA 5EC1A 4K7PH 2XWJB 2WCPA 4GRWH 1KC5H 3QC6X 5BMVA 3RP1A 3RNQA 4JHWH 1ZTEA 4XR8C 3KBHE 1UENA 3F64A 1TUBB 1F58L 3V0WL 4D94A 3ABKC 4ZUTA 3BE1H 4MX7B 3BVDB 5FHAH 3MRIB 3DETD 4FG4A 4UQBA 2MOVA 4FM0A 3G5XB 3UTTB 4L1HA 4MHHG 5GZOA 4RQFA 1U8LA 2QGDA 4KTEL 2IAMB 2Y22A 3MV8B 3WKPA 4ZUWA 3P3RA 1K9TA 3GXFA 1VIBA 1W16A 5KTEH 2CAZC 3G80A 3HKBB 5MENB 2X6AA 1O9WA 4B6ZA 3F05A 2PTUA 1JCVA 3GIVB 4JI6O 1R5IA 2BTOA 1HQ4A 3GRWA 1G0DA 4GSRA 4I9WD 4AKOA 1KCVH 2APVA 4TUYB 2JI3A 4NYLB 3ARTA 2B1HL 4N8CL 3IJHA 1KN4L 4AG4L 4PBXA 5L88L 5IJBC 3MN8A 1ZV9A 3PGDB 4UDTB 3DMMD 5DVMA 1Z5WA 3S96B 2HFGL 2XQBL 4GIAA 2VDOB 4OIFA 3K2MC 1ZOXA 5F7DB 4FKKA 4ZOAA 3S3SA 1DJXA 1UM4H 1RUML 4QIRA 1FHGA 1VF5B 4UBDD 1NCUA 4K8RH 4UDUB 4H8WL 5B1CA 5A2FA 4YXWG 1JGIA 4UQ2A 4O4IA 3H9HB 1HNZB 2AFNA 4W81A 1VKXA 3ZTJG 1B4RA 2XTAA 5KBMA 3BCCH 4W9KC 2IBGA 3GBNH 4IRJD 4Z5RB 1D6VL 1AZVA 2UXNA 1YYML 2ITDA 1DQDL 4FQJH 2N3JA 5I0ZA 1VESA 5C0BB 2K1MA 1L6XA 1ZEAL 1R3IH 3OTFA 2WNWA 3O0RL 1JK8A 1H8LA 1ASPA 2TRHA 3TT1H 3NK4A 5D9SA 3SJVB 3GLEA 2XKUA 4TUKL 5D6CB 3T6QC 4HS3A 2G5BB 1OXYA 1JWSA 2YBRB 2D7TH 3W9DA 1TTFA 5AQ0A 1SDDA 3OJDB 1KCSH 3H6AA 4MJHA 1F0LA 1KXHA 1GIGL 1SMAA 3W7WA 4ZPVB 1ZVHA 1JXKA 2BIIA 1AC0A 4G7YL 3ZKNC 1EZVY 5D8JL 2AKRA 1YAIA 4D0DB 2OTWB 3NEOA 2W59A 2YMXL 3MRKB 1I8MA 4OF0A 4IMLB 2YPLE 1E42A 1J8HA 3QUZA 4UM9B 4O58H 3I75A 3T4YB 4G8IA 1XIWA 1BZEA 2ZXEB 2YPVA 3S7GA 3VWJD 4TQHA 4YSOA 3TCLA 3O3AA 3ZU8A 3ZZSA 3TTYA 1B0IA 2EIKC 4NM8H 4XVTL 2JELH 3D39E 5I2IA 3VQ1C 4X64O 1A02N 1IAOB 1Z66A 2J72A 5FYJH 3TURA 1DUYA 1E65A 3QAZB 3MA7B 5DJ8A 3WCYA 3CE2A 3WIIL 2CGRL 1UD5A 1M1XA 2YR3A 4FYSA 2A9NH 4UAOB 5HHOE 3FB8B 1QNZL 5JWPA 2EVGA 2DMHA 2UUBO 5BUAA 3SE8L 3OG4B 2ARJQ 3BUDA 5IROD 3FULA 2PPEA 3U1PA 3INUL 2DL2A 4XGZB 2HRPH 3UC2A 1FKAO 4PJAF 2FATH 2QR0B 5CZRA 3P3NA 5L3EA 1AG0A 2Y7SA 2OI9B 3PL6C 4H25B 3EYUL 1ETZB 1A32A 1QAWA 3WIHA 2BOCB 5EUOB 3N44B 1J48A 3MUHL 4BAYA 3X1FA 3Q1SL 1GTFA 4O9HH 3HZMB 1JPTL 1YPZA 4HHWA 4RDQF 3HPJB 5B8CC 2VE6A 3ZHNA 1W0JG 3K72B 5TE6H 2R9HC 5E1GA 5IHUL 2BNRE 2YK1H 3ZGHA 2JKSA 2RCVA 3EIFA 5F89A 1FNHA 3NDYE 5E94B 1LO3L 1NAMB 4ZMXA 2MIZA 1CFSA 1PP9H 5D2LA 3UGEA 1FIEA 5C07D 3BPZA 3ZTDC 3THML 4DP1X 4PJIE 5L6YH 3KAAA 1A5FL 4HXAH 5JW5B 1FNSL 5AEAA 1AHKA 4B7KA 1EIBA 2FB5A 3JTTB 3I9IA 2WZ0A 4KUMA 5DK0A 2HVJA 3CFIC 5ITBL 4IS6A 3QFJA 2F5AL 1MZFA 2BFVL 4H0LB 3G3LA 2F1MA 2FRGP 2XQYK 4LF4B 1A1NA 2O72A 2W88A 3KGTA 9CGTA 4KXAA 4X62O 3GDCA 4WNJA 5EWIH 1N6UA 2R9AA 2OMTB 3MBEA 4LVNC 4KKRA 1FXHA 2FJGB 5MEPB 3ROLB 1A25A 3FT3B 4KX8A 4MMZB 4RRPG 2X12A 3T0EE 5JW4Q 5E8OA 1KG0B 3L5WA 4G8FA 2OL3A 5DVLA 1WWBX 4QHLB 1R6VA 3TO4D 4CS4A 1JTTA 4EIGB 1DSFH 4N3UA 5HI4D 2XOKG 5C0CB 4PGCA 4DR1O 3L3DA 3B4SA 5IWAB 1M71A 1QBML 1OVZA 1R3LB 3UO8B 5DMIH 2YPLA 1JZHA 4GKSA 2JB6B 1BZ9A 3CLFH 4QIWF 8FABA 2FL5A 3MNWB 4OZIB 3KYMA 5CSBA 1H8SA 3EKCA 3WE6B 1KB5B 1MDTA 2CH7A 4MMXB 3HG3A 3FO9B 1JYNA 4YBLB 3I02B 4I18C 5ENWA 4CVXA 5DLLA 1H2LA 3ZT5A 4P5RA 5LHIA 2AAVA 5F3HA 4J27A 4O2CA 5ITFB 5I66A 3JATA 4JI4O 3IT8D 4EZJA 4KAQH 4WW2A 1YECH 1UA7A 4L87A 3OGIB 2EE2A 3ML9A 4F91B 4N2GA 4HAMA 3RW0A 1IGCH 5FM5M 2CM5A 3FBQA 2KUTA 1H8HG 1G4MA 1F8TH 2YD4A 1T5KA 3BCDA 3UZVB 2GUZB 1H2MA 2E76C 3H4FA 4R7XA 1K3ZA 1TZIB 4HSQA 1OLLA 2DICA 3G5VA 1KKCA 4D6TH 3S8FB 1FJGB 4GP5B 4LAQL 1RUPL 3VFRA 4TULL 3GZQA 2X1OA 4BFOA 4UB8Z 1DBAH 1P0SE 4EIUA 3VRIA 3U0TB 3JD1A 2ILMA 3GXPA 4DYLA 3MRGB 4PJIA 1MVUB 2FT7A 5KYXB 2VLME 3CXDH 2WYZA 3I6KB 4WUKL 4DFIA 3SCMA 2NYYC 4R8WL 4J4PC 3QO1A 5AAPA 4HP5A 1I82A 4MDRA 1JK9B 4U1IB 2QE7G 1Q38A 3IGAA 4KROD 4N6RA 1NIFA 2W9DH 1JZ5A 1CPUA 5L2KD 2ICEB 1ZV2A 3OJMB 3W0WE 2ZM6B 3IRZA 1CLZH 2G3MA 2DJMA 1JIBA 1HIML 1VQNV 4YO0B 4YPJA 2QTSA 3FFDA 3QEUA 4QYOB 4ETQB 4WEMB 1AZBA 4P5TD 1A9VA 4BFIB 4OJYA 3T0EA 1LE9A 3ZKXB 1KIUA 1NWOA 2R69H 3VXQB 3NBNA 3ZS8C 1O7DC 1AAJA 4Y19E 2B0SH 3L5JA 2OCCB 3CC5A 3PNWA 5LL6Y 4I9QA 1PZ2A 2IANB 3BXNB 3EGDA 3JV4B 3P2TA 4S2SB 1A4CA 3TBWB 1JR9A 1E6JH 4A37A 3WFVA 1D5IH 1MXGA 2V5SA 4KJYB 1YMHB 4QRBA 1WYJA 1GYCA 3KLHD 1U6AL 5EN2B 2LU4A 2QGNA 3EDFA 2XPGA 4MNHA 4H13B 3H53A 2Y4TA 1W8EA 5FECB 2BVYA 5JW4N 1BSIA 1JMXA 2YQBA 4NRXA 4QXGH 3ZDWA 2DS4A 4NBYB 4X8JB 3WLWC 2CLRA 1G7LB 3UIYA 3L3OA 4EKJA 2V6HA 3T65B 2EO9A 4PDRA 3E2EA 3BAXA 4LLVA 5CEZE 3NIGF 5LOVA 1ADQL 3AU1B 2V5TA 3BAEH 1MY7A 4I48B 3DUSB 3WFHA 1F41A 3FTVA 4BA0A 3EHBD 1A1MB 2BNQE 4YSQA 5KVGL 3FFCE 3O9OA 5PAZA 1VGEH 2EILB 4TV9A 4GH7B 3VNZA 3NIGB 3KJ6H 2XNAB 2YD3A 5IR1A 4JJ5A 4G27B 5LGJB 5ESVB 4PWFA 4HD9A 5D7IB 5IB3B 5GZOD 2B1OA 3FQRB 5C8YA 2PYFB 5LGUA 2ZSWA 4HX1A 3GMOA 2FGWH 4DW1A 4JI2B 1KYDA 1PVHA 2NY0B 4XP5H 2JKIS 3VE0B 5HPMA 3MJ6A 4WF9V 4AJVA 4OLWL 3MJ9L 2D7OA 3HNSL 3PGFH 3CLEH 3QISA 2B1AH 5CNHA 4HJIA 1PL0A 2Y69C 4MTFA 1E5BA 3JARB 4XB3A 2KQMA 2VZOA 5I19H 1ML0A 5DECA 1MFVA 5HD8C 5TQ2H 1NCHA 5LDUA 4Z1MG 4KHTL 1BZ8A 3KYNB 5IQLA 4A2GA 5C7XL 1II4E 2AJ3B 2D03H 3TM6A 4ABVA 3W0WA 1E4WL 1JCKA 3FTUA 3NJGA 4Y4HA 4M3HA 5F96L 5JZ7D 4XNMA 5AVXB 4NJAL 2CPUA 3CFQA 43CAB 2EYSB 2FL4A 5KAIZ 1NOLA 4PJBA 2YS8A 4XCEA 5ITZB 4JDEA 3BPCA 4J28A 3AMLA 4UQIM 1ID5I 4K94H 5J6GB 1KV7A 2DQGH 4Y19A 2HMIC 2VQFO 2V17L 5ABDE 3QUYB 2OS7A 3L1GA 3H6JA 1CXZB 4HD5A 1SF9A 4A7QA 4NS0A 4BGDA 1L0YA 4KBPA 4JI1O 1ZTMA 4WK4B 2ATPA 3FCTB 3ORJA 4X4ZA 3UFIA 2FHCA 3SE4C 2ICWI 2B5UA 4DV7B 3CDGB 4WUUE 1DZBA 5KANI 1XZ0A 2DQTH 4PJ7F 4OGZA 4Y2OB 2JNZA