3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
2IDQA 1KYAA 1AOZA 1ZDSA 2XV2A 5I6LA 2VM4A 2YXWA 2P80D 2QPDB 3FU7A 3IN0A 1YLBB 1W6LA 2RACA 2XV3A 3WNIA 1J5CA 1E65A 2N0MA 2JFCA 3EH3B 2BP0A 3TASA 3QQXA 1GY2A 2PPFA 3S3BB 1AAJA 2IDUA 2J5WA 1KCWA 4MFHA 4YL4A 1L9RA 1AACA 3T6ZA 2BWDA 3L45A 3NJKA 1IBYA 3FSZA 2AZAA 2BW4A 3S8FB 4DP0X 4WKXA 3S3DB 1V54B 1J9SA 2GC4C 2UX7A 3GDCA 3NYKA 4PAZA 3ZDWA 4YSCA 3PAUA 1KDJA 3ABGA 5B1KA 2OJ1A 3WNJA 2IWEA 4L0PB 3X1GA 4YSQA 3PCYA 1CUOA 4HCFA 4HHWA 5I5JA 3SBQA 4PCYA 2HRHA 1V55B 3T9WA 4JHVA 2MTAA 3HEIB 5FC9A 5B3SB 3MBWB 1NINA 2P80A 1ADWA 4Q89A 3CVCA 4GP8B 5I6OA 4AKOA 2UXVA 2EILB 2TSBA 2BP8B 3FYIB 1OV8A 1X9UA 2YEVB 3NJMA 4JHUA 4DP7X 4TXVB 4M4RB 2IH9A 1NIEA 1WA0X 3AG2B 3AY2A 1KGYE 1CYWA 3FQYA 4NAJA 1NDTA 4DP1X 2BP8A 2FT7A 3EHBB 2YQBA 2Q9OA 4BXSV 1PZCA 3T6XA 3G5WA 2VW7A 1ET7A 2DWSA 3AG3B 1SFDA 4DP8X 1ZIBA 2UXTA 4GY4A 1NTDA 1OE3A 2HRGA 1TEGA 2HZHA 1L9QA 1JZFA 2H3XC 2YAHA 2AANA 1JXFA 3S3CB 1RCYA 4A2DA 1ZV2A 5F7AA 4BXVA 3IN2A 3FT0A 2AVFA 1PLBA 5I28A 1JZJA 3ERXA 2YAOA 4YSTA 4A2FA 5IY5B 1BQ5A 3QJTB 1AS8A 2PCFA 2I7OA 4F7KA 2FTAA 1R1CA 4EF3A 1A8ZA 1OE2A 1TEFA 4YVUA 3U25A 3NP3A 3FU8A 4QLWA 4FA7B 2DYSB 3MX0B 2YXVA 1L9SA 3QJUB 4G71B 2IDFA 2QDVA 2BO0A 1NIBA 1PNDA 1F56A 2GB2A 5I6PA 2QT6A 3D12B 4DP6X 5E9NA 1KDIA 2JKWA 3WKPA 3GYRA 4YSDA 4A67A 1SF5A 3NSDA 1EHKB 1GY1A 5D4HA 4NB7A 1PMYA 7PCYA 1M57B 1ILSA 4KO6A 3T71A 1PLCA 4YSSA 1ASQA 4QKTA 4YSUA 8PAZA 1W8EA 3FSVA 1XB6A 1NIDA 3OMAB 3WG7B 5TK2A 3ZBMA 3PXLA 2X87A 3JT2A 1JOIA 2GIMA 2YAEA 4G72B 3ZX1A 2IWFA 4GXFA 1B3IA 2CALA 2YAMA 2VN3A 3IE9A 3N55A 1SF3A 3FPYA 1XMEB 2CCWA 2IDTA 2X88A 2W88A 3EF4A 3OMIB 2CUAA 4HHGA 2PCYA 4GYBA 1J9TA 3NJLA 4G70B 2FQFA 3X1BA 1NPJA 6PCYA 1TKWA 2EIJB 2OCCB 1FWXA 2B08A 4FAAB 4AZUA 1JZIA 4ENZA 1JXGA 2GI0A 3PPSA 5B1BB 4WTQA 1GSKA 4HALA 3KW7A 2E86A 3NP4A 1AG6A 1NICA 2IWKA 1OCCB 4YVNA 3BVDB 1E67A 4AX3A 1ASOA 1E30A 2BWIA 3FQ2A 2MRYA 1JZGA 3FQ1A 4HCIA 1GS8A 2PPDA 1KBWA 1VLXA 4KO5A 1W6WA 4BWWA 1CC3A 3BQVA 3TU6A 1AR1B 3JTBA 3NJFA 1AZUA 2J55A 3CG8A 4Q8BA 2PPEA 4DPBX 4BK5C 3UADA 1AS6A 2HX8A 3FU9A 2AZUA 2DV6A 5ANHA 3DTUB 2OV0A 4YSEA 2PP9A 5I5IA 4K9JA 2DWTA 1L9OA 1T5KA 5B7FA 1A4BA 3GXUB 2UX6A 4E9VA 4E9YA 4UAHA 1AANA 1MDAA 4KOCA 1AZCA 5EHFA 2VW6A 1PCSA 4A2EA 5I6NA 3AZUA 2BZ7A 1PZBA 1IKOP 1SFHA 5D4JA 2HX9A 1QHQA 2B3IA 3QPKA 4DP9X 2XLLA 1AS7A 1AIZA 2EIKB 4NERA 4HCGA 1I53A 2YAPA 1WAEA 5I6KA 1DZ0A 4GP5B 3AG1B 4KNSA 2FJSA 4P5RA 4E9TA 2IDSA 3NSFA 4G7RB 2XXGA 1BAWA 1SJMA 4BWTA 2FQGA 3NJHA 3NSYA 4DPCX 4G7QB 1IC0A 3EH4B 1E5ZA 4YSOA 4E9SA 2HX7A 4E9XA 5B1JC 1MZZA 2VW4A 3OQRA 3PAZA 2A3TA 1PF3A 3WI9A 1BYPA 2CJ3A 2FNWA 4E9QA 1ILUA 2PP7A 2PPCA 5AZUA 4A2HA 3X2QB 1GS6X 2GHZA 5TK4A 3X1FA 3NSCA 2BZCA 4N8UA 4A2GA 5LDUA 3OM3B 1IBZA 4KO9A 1FA4A 2ZXWB 3SBRA 2GC7C 5B1AB 2VM3A 1ASPA 2ZWNA 1L9TA 1ETJA 5PAZA 4BWUA 4CSZA 1ET5A 4M3HA 1SNRA 2FQDA 3SQRA 2IH8A 1JXDA 2HXAA 2WSDA 3QJQB 1FFTB 1WS7A 2BW5A 2GSMB 1J9RA 1BXVA 3FSWA 1BXAA 3EH5B 5B7EA 3ABKB 4UF7C 4F2FA 1BYOA 1UATA 2JXMA 2H47C 5B7MA 2ZONA 1RZPA 3IBOA 1ET8A 3PLYA 1BQRA 4AKQA 4CSPA 3UACA 3CVDA 4BDVB 1CYXA 2Q5BA 1NIAA 2XX1A 1JVOA 2UXGA 3AW5A 3H4FA 1JZHA 2I7SA 3KW8A 5A7EA 4DPAX 1PNCA 2Y69B 2XV0A 3FU7B 1OCZB 1MG2C 1ZDQA 2YAFA 3QJSB 5B1JA 2YARA 4BDVA 3OMNB 1KV7A 2WO3B 3SBPA 1QLEB 2PLTA 1KBVA 4E9WA 4AI7A 3ASNB 1L9PA 1HFUA 3T6WA 1NWPA 2AFNA 1OE1A 3FSAA 3N2JA 4DP4X 1PAZA 3NJGA 4A66A 3CZUB 3FPXA 5AFAA 1A65A 9PCYA 5AKRA 2EINB 2Y1AA 1MZYA 2FWLB 1AZBA 1J5DA 1SHXA 4HZ1A 2NRDA 3NJJA 1PZAA 2XU9A 3QJRB 2YAQA 5D4IA 1JERA 4N4YB 4P5SA 4E9RA 4YSRA 2XYBA 4KO7A 3RYMA 1A4CA 3UGEA 3T6VA 1WS8A 1WA1X 2CAKA 1M56B 1GW0A 2FQEA 3PAVA 1NIFA 1A3ZA 2J56A 3ASOB 3DIVA 3WKQA 2DY2A 2W8CA 1RKRA 2XUWA 3H56A 2TSAA 4ZK8A 3AG4B 4DP5X 3ABMB 5I6MA 2FT8A 1N70A 1V10A 6PAZA 1QNIA 1AG0A 3DKHA 4UANA 1PLAA 1RZQA 1X9RA 1J9QA 2XXFA 2DYRB 2VSMB 2R7EB 2XX0A 1ID2A 1OOWA 3FS9A 4AKPA 2J57A 2XVBA 1JVLA 2ZOOA 3QJVB 1ZIAA 4YSPA 3H4HA 3TA4D 4KNTA 1N68A 2R7EA 5I5MA 4A68A 1BXUA 3V9CA 2CBPA 3NJNA 2PPAA 2EIMB 4RH4A 4G7SB 4KNUA 3IEAA 2WO2B 1IUZA 2LLNA 3ZIYA 1KCBA 1BEXA 3UABA 1HAWA 3V9EA 3CVBA 1SDDB 2VMJA 4GP4B 3X1EA 1E5YA 3WIAA 3TBCA 1HAUA 2FT6A 1DYZA 1GR7A 3OD3A 2QPEB 1XB8A 1NZRA 3UAEA 1MG3C 1SDDA 1EZLA 1GYCA 2H5UA 4HAKA 1A4AA 4W1TA 1GS7A 1JZEA 1NPNA 1OCRB 1ZPUA 3UAAA 4X4KA 1NWOA 3TBBA 3S8GB 4YSAA 2I85A 3X1NA 5PCYA 3CDZB 5F7BA 2QDWA 2XWZA 1AZNA 1XB3A 4HIPA 1BQKA 3FYEB 1M9WA 4KOBA 2UXFA 1CURA 3NT0A 3CDZA 7PAZA 2VSKB 1AZRA 1PY0A 1OCOB 1AQ8A 5I26A 2HLEB 1TU2A 3C75A 1SHWA 3ABLB 1OF0A 2PP8A 4W9ZA 1URIA 2IAAC 4F2EA 4DP2X 3NJIA 3HB3B 2GBAA 1WA2X 4JKNA 2BP0B 2BHFA
chains in the Genus database with same CATH superfamily
1I7RB 2O93L 5JW5B 3I56V 1I4FA 2IDQA 1Z0MA 5E08H 1DSYA 2WBJA 3X12A 3ETQA 4QXGL 1XIWD 4YDLC 1XO8A 4UAOC 2X3AA 1XR9A 3K74B 4MXWL 2RACA 1Q6HA 1W6LA 3L9YA 4JUSA 3WNIA 1AD0A 4ONOA 5C71A 1FYHB 4Y9GA 3EF7A 1LO5A 2D2OA 3C08L 3D06A 3MUUA 5DQDL 3AUVA 1QKZL 1AFVH 4JN1L 4ODTH 3PJSK 3HE7A 4JM4H 2XN9B 1YQ2A 4A6YL 5B1CA 4WK2B 1W59A 3UCRA 1M7IA 2VQ1A 3NCWA 4OLUH 3I3EA 3NJXA 2EKSA 4ZZKA 2ICCA 2L4OA 3H9SA 1BMGA 3VD7A 1JPGB 1LM8V 2N1KA 2OSLB 2YKKA 4WU7B 4A6YA 1U8KA 1CFBA 2CNZA 3UEZA 4XMXA 3PUCA 3RKPA 3RNKA 5K9QI 5LOVB 1MVUA 5HHMB 1QI3A 4GKKB 4DGVL 2WKOA 2BINA 1U30A 3QRGL 3E0GA 3LSQA 4W9LC 1G7QA 2AZ0A 5EZYB 3P9LA 2CSPA 5KVGL 2IM9A 5C70A 3LKOA 4TUKL 4NKGB 2EX3A 1UXSB 3Q9PA 3SDAB 3V2AR 3D36C 3PUUA 5D7LB 4UNUA 4QJFB 1ES0A 3GXIA 3WUWB 4AT6B 3FOLB 5T1KD 1PG7L 1Z3RA 2X3BA 1KC5L 5GJTL 4X20B 5B3SB 3STZA 3QDMD 1INEH 2OMNA 4JFWA 2IH1A 4RMSA 2CDGB 2J1YA 3O45B 2VR7A 4JREC 5CIPB 1UJ3C 2XNAA 4UZSA 4OLWL 1SLXA 4FI6A 1YNLL 1CGWA 2C9UA 4LLQB 2NY4D 5C0BA 5D1QB 5F2FA 2A77L 3FZUD 2FJGA 4U4BA 3S3XA 5EUOB 3OUFA 1NDMB 4OLXH 1NTKH 3OR7B 3BT2L 2APXA 5EWIL 2G5BB 3K59A 5LKNA 3EDKA 2F2HA 5FUZH 3T1YO 2E47A 3DPDA 3KPMB 3CN1A 4A7VA 3HKEB 2H94A 3VOUA 1BZ7B 1EMTH 1K5NB 3W39B 4Y1AA 1DDTA 3VXUB 3GUTA 4PWIA 4PJ8C 1XTLA 2HZHA 3BQUA 1L9QA 3L81A 4JB9L 5FA4B 1LO4H 1D6EA 4GXUM 2CA4A 1P5UC 2X4RA 4JFHE 4PJBF 2UZIL 1XF5A 4Q6IA 4A2DA 5DJ8A 1NU1H 4NRXA 2E46A 4PCTA 1WF5A 4K3JH 2BVTA 1N33O 1KIUA 1QBAA 4MAYA 1NGYB 5F9DC 3FONA 3KMDA 3NPZB 1U8HB 4I3SL 5T3XL 1HS6A 4NQEA 4DV2B 4LLAA 5LHGA 1BQ0A 2J7LA 4Z7OE 5JHLH 1KBGL 2YA2A 5I74B 5C93A 5E4EB 4DH2A 2QR4A 5IYZB 4RIRB 2WLMA 4Z95L 1JZ8A 1QQDA 1CFSB 3A0RA 1OGAE 1U9KA 2QTVA 3BI9X 1O9GA 4CVZA 2BO0A 3B6SB 5DZVA 4N2KA 4Q58C 3T77A 1SEBB 2WUBL 3NGBC 1Q1JH 5FM5O 2EC9T 1RUKH 4WEEA 4ICWA 3LNEA 3BWUF 5GZOC 1RZ7H 1CU4L 2XC8A 1JPSL 3LKRA 1QYGH 4XPBL 2ZICA 3HKBB 2W95A 3IXAA 4WNQB 3ZSSA 3K79A 3H1LH 1K3ZA 4LSRL 4JVWA 3VBBA 2CJTA 43CAA 1J8SA 2Y6TE 3TT3L 1W8EA 1IGCH 5D1ZB 4H8WC 5E5LA 5JQ6L 2VLLA 1ZGLM 4HJJL 3S5ZA 1BMWA 2CUGA 4BIKA 5BV7H 4AE1A 4MKTA 2K78A 2X87A 3JT2A 2OIEA 4H1LG 5E94A 4F7EA 4PJ5E 5TH2A 4NXNO 3T2QA 4JZJC 3BSHA 3G5XA 1XCTB 4PIBA 1SF3A 4XP1L 1YECH 3FPYA 2CR3A 1XMOO 2X88A 2W88A 4CGUB 1AI1H 4XPFH 5EMYA 4Y1TA 1M7DB 1OHZA 1M93A 1MSWD 1N9PA 2W1NA 4HUMB 4E41B 3R18A 3VGAB 1ZAUA 6PCYA 5AVXB 3AG2C 1EZVX 2VISA 4S0TD 3B4SA 1DLHB 2B08A 4NCDA 5KN5A 2DF3A 5KS9B 3K08A 3ZJZA 4FLYA 1BVNT 3C8KB 3PPSA 3D25A 1HESA 1ZHLA 4ANWA 2WLIB 3WFZA 4Z3IA 1TSRA 4I1RA 3SJAC 4L37B 1KGXA 3GI9L 1KXVC 3QZNA 1Q8MA 1FV1A 1BZ9A 3JUZA 2HG5A 4L8SB 2P6JA 2MRYA 4QXTA 5E1HB 3B09A 5I75B 4ADJA 1W80A 4JFFD 3BEHA 3NTCL 3RG1C 1R5IB 4UV8A 1QBLH 1FNEA 3PL6D 2A6KA 3WNLA 5ESVA 5HPMA 1MAML 3DPBB 4HX1B 4QRUA 4I8DA 5FKPA 3UZEA 3VFRB 4TSCL 1BVLB 5HY9B 3J07A 3VXNA 3RHWF 3BP5B 2NY4C 5JZ7C 2JRIA 1M9SA 5FV2A 3JAMN 1MNUL 2CRMA 1N6QL 3SY6A 3R1GH 1BMZA 4C56D 2OS7A 2PO6A 5FO7B 3T0EB 4DR1B 4PSRA 3FU9A 3QZWG 5EU6D 4LLMA 4PB0L 3TVMB 1DR9A 3TJEL 4K55A 4YSEA 5I5IA 4IOFD 3VQVA 4RWHA 5L8JB 3TN0D 2JJTC 5SX4I 1F97A 1MCWM 1MEXH 3PU7A 3DUSB 3SQOL 3SGEH 4FK5C 1RK0B 1K33A 1E27A 1DBAL 3V4VL 2W38A 4WI8A 3MHSC 3MLRH 3VFWA 3GZOA 1KYFA 1SOXA 3ETEA 3V4VA 1RPKA 2WD0A 4L1BA 1AI4A 2Y06L 1A9EB 5KAFZ 1LXMA 1URZA 2EDJA 3B7RL 3CVIL 3DJTA 4EO5A 3LHPL 3Q43A 3FB7C 2EEFA 4XWGL 1LEGB 5BJTB 5AG8A 1RZKH 1URLA 4XNXH 2EDBA 3AAZB 1A9BA 2QEXV 3B2VL 2F9BT 5IVNA 1AJ7H 1SVZA 3M99B 4WBNB 1KTLB 4EUPH 3SJBC 5HHQA 4IBVA 5GS2D 4C57C 4D6TH 5IHUL 4GBXB 1PKQE 4JLRA 3KLKA 2OZNA 2DM7A 4POZC 3ZMRA 2P26A 3QPQC 1MJ8L 2IMNA 2IPTH 4ZFZB 1EDYA 1YA5A 1U93A 5GZND 3T0XA 1V3JA 3HR5A 3O11A 4S0HA 5C08D 2EYTA 2UU9B 3VRIB 5SWSA 1TGOA 4F7CA 5TE4L 1MZZA 3R06B 5EOQH 4PR5A 4PJHF 4HPOL 1J1OH 3DTXA 4IBYA 1RPOA 4FQ1L 5KVDH 1KB5H 3QAQA 4I13B 1XZWA 4MJJA 4U6VL 3K6SB 3GMLA 3KPPA 1SDYA 2F54A 4JI5B 2BDNH 1WFTA 3C8DA 2BZCA 4FTVB 4L48A 1C16A 3H7BA 5IHZB 4YHLH 1AHWB 1P4RA 3DX4A 5I16A 2XCMC 2EEXA 2HWZL 3TT1H 3B3IA 3GLZA 4BUQA 3QDJA 2ESVD 5EA0L 2X6CA 2X6VA 5LLIC 2YJQA 4AY0A 4NNXA 2AZ2A 4MVUA 1IJ9A 4MMZB 3QQ3B 4KWUA 1U3HB 1ODUA 2V17H 2VIRB 1FVCA 1Q6UA 4PJ0Z 1P2CB 2EDEA 3PS6A 2VDPB 1JGLH 2DI7A 1Y1DA 5B1OA 2NCEA 2XVLA 4FFKA 3K58A 3OBAA 2RR3A 4OFIA 5T1JA 4RISH 3EYSH 2PZSA 5B7EA 1RZ8B 3AQDA 1BYOA 5FUOL 1BJ1H 1D2OA 1MXDA 3I6SA 4YGVA 1UOKA 3K9AA 4YDIH 3WNNA 4F15B 5CLYA 3UACA 2H3OA 4BDVB 3DDFA 4TS6A 2ODMA 3T1CA 4NQTA 3V6FB 1HYRC 2CBQA 1OSEA 4MA8H 4D9LL 4UM9B 1SZNA 4XO3A 1PNCA 3CSFA 2HVJB 2Y69B 4JQXC 2GKIA 4BFKA 5I6XC 3HI1B 3IMSA 2XY1A 2YRBA 4PJIE 1P69B 3CFNA 4X4ME 3L7EA 3PHAA 3QI9D 4CKQA 4K94H 5E5MB 4N8PA 5J9PB 2R0ZH 5FDWA 4G42B 5EEVA 3K8KA 4L4TB 1QLEB 4HK3J 5CD5C 3TN0C 3KPRB 1INDH 3EUUA 1TTRA 3SBWC 1BD2B 5IJDC 1HFUA 5EIIG 1BS3A 2AJUL 5F0JB 1JZ5A 2O5XH 4UT7H 4F37F 3SCMC 2D31B 3DGEA 3MOQA 5IHLB 4PGBB 3WFCH 1G7IB 1H2SB 2IO5A 2FBJL 4HHAB 4NQSB 2BCCH 4EN2A 4LF4B 3P02A 1E4WH 4NRZA 2H41A 1P4IH 3K3QA 1KJ2B 2AI0L 4DR6B 3MXVL 4AQYO 1DQDH 1H8SA 3MNDA 4M9OA 4AGQA 3D39E 3RWJA 2R15A 5IQOA 1S3JA 3F5WA 4PHZA 3L3IB 3P11H 1NSNH 3O3DB 4IRSD 5IW1B 4X7FC 1EXGA 2YOCA 5IBLD 1MF2H 2Q3ZA 4S1RH 3T0WA 1WZKA 4N0YH 1Y6KR 4LO9A 3PV6A 4GW5A 2ADJB 5DHVH 2HYMA 1R3IC 1PZ3A 5CBAA 3GSQA 4Z7OF 2CIIB 3ZDXE 1IAMA 1X3DA 1ZGLB 3UBGA 2DY2A 4LASH 2WZPD 3RB7A 2OW7A 5D7JA 5AKTA 1EAQA 3QZWB 1J8HB 2EJ7A 1IX9A 4PGEA 1O5PA 4MNQA 3IYLW 1H3VA 4P3DB 3LB6C 5AB1A 3I75B 3GJFB 2WO4A 3GK8L 5DQ9A 2VWEE 1BA9A 1WFOA 4I0XB 2AW2A 2HUHA 5KVEH 4GI6A 2XZCL 3U7YL 5H94A 4BRJA 5HPMB 5ITBH 2FLRT 1CPYA 3I02B 2P22C 1LLAA 2EXYC 2XVBA 4JFVA 3RILA 3BWZA 3RVVD 2NSQA 2P45B 1P7BA 3DIFA 3BJ91 3V9CA 3LVTA 3C12A 4YHPB 1H6FA 1CYGA 4AITA 3OGCB 2WXLA 2AV1B 3UTOA 5E4OA 3VGGA 5K9KB 4JI8B 1IUZA 3D0LA 3O9WB 5C07A 2HMIC 4X7SL 1BQHA 3K5LA 3MHHC 1RSYA 3C6SA 2FLMA 3CVBA 1OT1A 1W0VB 4E5XA 4BELD 3IFOB 4LSSL 4JYAB 4U1LB 2PR4L 3B2DC 4MAUH 4UNVA 5F1IB 3TJPA 1DJYA 1JK8A 3MLYH 2Z35B 4K8ZA 1W72B 2C3WA 2R2CA 4ZUTB 4D8OA 5HDRA 4K3DH 2DWEB 3RDTB 1U3YA 2VSCA 5CD3A 4OF0A 3MRPB 3W0WE 2RAMA 3LNHA 2EVJA 3CD6V 2Z8RA 3SO5A 2Q76A 4U6XB 2IBBA 5ID0B 4NHCL 5D2NC 1UWEH 3NCXA 1NWOA 3LMJL 4OLYH 1IAIL 4TQIA 2Q10A 1VAHA 4HGMA 1OPOA 3TPUA 1SQPH 3CDZB 4R83A 3HMXH 2EADA 1PBYA 2QDWA 4M62L 4RVBA 1GGYA 4NC1C 4R5XA 4JYCA 5K93A 5I1EL 2V2XB 1BREA 1AGBB 5E8DL 4ZW5A 5C0AB 1BQKA 1AQKH 1EXUA 2VXQL 3BLBA 3IKKA 3K2IA 1DBBL 3MAWA 1I9RL 4JTAB 3QI9C 25C8H 4HSCX 1N0LA 2VC2L 2VR3A 4OSUH 3TFKC 1UYWL 2E27H 5DI8B 4JY6B 1AB3A 1JP5A 2ZQMA 1F8TL 4JFOB 2VLRD 1JFQL 2H0EA 4U1KA 1OV9A 5HDOA 2PTTA 3UPAA 1LEIA 3CHXA 4W9ZA 1URIA 4HOXA 4OU3A 1BXXA 4OJCA 2WV3A 5AB2A 3EZ8A 4HQQL 3ARDD 4OCNC 2GBAA 4LP4A 4TQDA 4HJ0C 3JWNC 1EN4A 1MHEB 3MOAL 4JHWL 3WMSA 2LFSA 2XQ0A 2IGTA 4HIXL 4WNSA 4HUNB 5FPOA 2CBTA 5LNEA 4C54A 4U1SA 1L3WA 1LO3L 1WIPA 1R0AH 2N56A 3RUGE 2PN5A 4I0PB 4HCRL 1H3PH 3F7KA 3P3YA 1ZT1A 4V2BA 1Y74A 2ALAA 2XTJE 2YICA 1GY2A 5F8QC 4Y7OC 1XXFC 4NXSA 4Z23A 2J20A 4IRSC 2BWDA 1YNTF 3NJKA 4TPRH 3H55A 1NI8A 1BM3H 5CBHA 3DSFL 5ICUA 3UO1L 4YXKH 2AZAA 4O00A 5GGUB 5CEYB 4DTGL 3BEVB 2J6EA 3PDOA 4WTZA 4IT5A 1E9PA 1V54B 3U4BL 5T3ZE 5IVXA 2C3XA 2YR3A 3VXTA 2WA3A 4KKCC 3UTSB 1AGCA 2EIMC 4LXFA 3CZFB 4GAGH 2EVHA 2VXTL 3G5ZA 4A7QA 4OFDA 2VERN 5CN1A 5T1LB 2EJ1A 3EIFA 1L7IL 5ESQA 3V4LA 3UO8B 4ZHQB 5I5JA 2Y24A 4PCYA 4XCNB 5EIIB 1FJ1A 3G6JA 4DW2L 2YK1H 5A9GA 1VEWA 4P3WA 1SJEA 2B1GA 3W3BA 4XMLL 4ODSL 3H3PL 4NVPA 1H6UA 3QYCA 4QIWF 4GG8B 2X9YA 2VDOB 3QH3B 2VAJA 2X28A 4KJYB 5F6IB 4YC2C 2BCMA 5IYBO 5I6OA 2X2YA 2WP3T 1OGSA 1I9JH 4TTGA 1M7UA 3RVVC 2CHZA 5DUML 2V7HB 3D7PA 3FO1B 4EI6A 1QFOA 5DC9B 4JHUA 5GS1A 4R8WH 2HEPA 4TXVB 3WFDH 2P5WA 4KI1A 4CU8A 3MCLH 4JFED 5SWQB 5IEHB 3QK0A 4PJXA 4YFLI 3QEQE 5DJZB 3ULUH 3VYNA 3FCSB 4IKJA 1WVZA 1NH2D 2ZSVB 1HWWA 4G59C 4ISVA 3BP7A 5I1GH 2YQBA 3KS0H 5HYFA 1PZCA 1TO5A 4XPAH 4KMLB 3ZGHA 2NX5E 1ZCRA 4LRNH 5JNYA 1CFNA 3ILQC 3ZQXA 2DWDC 5IJ0B 2R0LL 1IGTA 1XGPA 4NO0B 5HGHA 3RYCB 4KU1A 3B2PA 3QZMA 4PJFB 4CVUA 1ZV2A 4NUMA 3D4GA 4M6NL 2HA1A 3JV6B 4Y5YB 4ODXA 4IOSD 1QVOA 4RQEA 5AOIA 4LVHB 2Y07H 4HUWA 5E6ID 3OHXB 1OSZA 3STLA 2PCFA 2OIGA 3PJSA 1F1AA 4NQCE 2HJKB 4QHPA 4XXWC 5TF1L 4FADA 4U3JA 1IURA 1XHZA 3DUHA 1J88A 3CK0H 1MW2A 1Q72H 2D03H 3PQYE 3DGCR 3QFDB 3APNA 3NP3A 3BFOA 4QLWA 3DXAE 4PJIF 2ALWA 1ETZB 4RRPA 5LJYH 4X83A 2GB2A 3QEUB 4KTDL 4MDIB 5DK0B 1QFWI 3Q05A 2GBVA 4AG4H 3KPQB 2NY7H 4L3CA 5FYJL 4HDIA 1TZIB 2P7TB 4QI3A 1Z2KA 1CFQB 4X5PA 2WNXA 5HYQB 4J9ZB 3LDEA 4JN2A 4FFYH 3IAQA 4LNRB 4AGMA 2YPKB 3SSGA 4F3FB 4I7ZB 4OM1L 3BDYH 3H85A 4ZO8A 1F42A 2B4CC 1I94O 4PRIE 4HZLB 2JI2A 2KLRA 1DUZA 1TQBB 4LCWE 5HSFA 3GIZH 2I07A 3HLKA 3RBZA 1CXZB 4APQA 1QPXA 2VN3A 5I1CL 5C0JA 2R1WA 3DX9A 3S6CA 4FABH 2F58L 2YD3A 3FTVA 3NFNB 5A3IC 5ICXA 5DUJA 5TDOB 1YEKL 3QHZL 4P2OC 4L87A 1RU9L 3QUZC 3ZTNH 4G70B 4XP6H 2NY6B 3HHSA 5BZWB 1WEJL 2G4EA 4WIQA 1Z9LA 1QW9A 4X80L 2QEJA 2X2HA 1ZJBA 5FF6B 1YI2V 3AMKA 4OJYA 3RVWD 3ZDXF 1TJHL 3O6MH 4ENZA 2NYZA 1HH9B 3FFOA 5L3EA 1V3MA 3RFZA 3W1ZA 2NXYD 2QR0B 5HJGA 1OCCB 1AQMA 3WJMA 2WCGA 4ETQA 1EV2E 3MU3A 3G5YB 4ADGA 3LKPB 5DZNA 1A7RL 3AXLB 4OLZL 1L3NA 1RP8A 3BVTA 3QIUB 2NNAB 4AWJC 2W9EL 4H0LC 3ARGB 5F7LB 1MFMA 5IT2H 1LNUA 3OB0K 4IBZA 3WHE0 3JV4A 3MRDA 1JMXA 1JV5A 2M83A 1QFWM 2C1PB 4G8IB 2DOCA 4K5OA 5AVWB 2XA8H 2MQ3A 1WP7A 2VE6A 4PTTB 4K8RH 4G1MA 2GCYA 5JPMA 1VPOL 4FQLL 3MV8E 1H15A 2GY5A 3RQ3A 4NGHL 1H9VA 3FTWA 3IF1B 1JVKA 3A67H 5D71L 2OXGB 2OR9L 1AE6H 1G9MC 4I2XA 1XREA 1TQCC 4O4HB 3GBEA 3MO1A 3VFMA 1DN2A 3H42L 2DL2A 4JE0A 2RFXB 2NLJA 4Y2DD 3PNWA 4EI5B 1N4CA 4NKIH 3CUPB 4P23D 5C7XH 4NZDA 1NCBL 5I6NA 3C5SB 2A9NL 4OM0L 4O4YL 1ROPA 2YEVA 1N6UA 2VH5H 1FFOB 3FT3B 3C60B 1JNJA 3MV9A 3QUML 1ZHKA 5CUSL 5I1AB 3AB0B 3F7VC 2EIKB 4U49A 5C09E 4NERA 1JS4A 2P24B 3QUMA 4R5VA 1NCCH 3KBFA 3N5AA 1QHTA 2E3VA 3NCMA 4JW3A 2B9ZA 1WAAA 3DVFA 2G2PA 2OP4H 1NGWB 4GPVA 5I1JH 5I30L 3U46A 2JIXD 1S5HB 4ANUA 5L2KB 3L3OB 1PD3A 1B9ZA 4UINL 3WBDA 5EU3B 5DK2A 5TDPB 3SYAA 3HBPA 2FYYB 5D7IE 3NJHA 3EFFB 2FL5B 4UTCA 4G7QB 3ECQA 5L0QC 3MC0A 1NM9A 5FO9A 4CH6A 2NR6D 1FL3B 2OMXA 3MLTB 3MR9A 4XOBA 2PYEA 2EIJC 4EKWA 1XOUA 2A3TA 1U36A 2XKNA 3I6GA 2Z91A 4WEUD 3ZW3A 5I1KL 3OMZA 4CJ0A 3IAGC 4M8RA 1RZIB 1A2YB 5EU5A 1OCWL 1J0ZA 5JOPD 2D73A 4I0CC 5KTEL 1I5YA 5E70A 2X6MA 2X40A 4Y9CA 2DLTA 1MUJB 3TJTA 5DXWA 2X41A 3RUGF 5IHHA 3U79A 1IBGH 1JV2A 5HDBE 3S34L 4MS6A 4QRRA 4M8UA 5LDUA 5SX4H 3ULVH 4YXHL 1OANA 1I31A 2BY1A 2ZWNA 3RWHB 3GBMH 5J3HD 4G80B 2BOCB 3NEOA 3FTYA 4PLJD 4PY7A 3BGAA 2Z8WC 1SLUA 1MI5B 4GAFB 3WCYA 4E42A 1XH0A 3O4OB 4FQXA 3CGTA 4XWOD 3FCBA 4MCZA 2A9MH 4M8QA 1D6VL 4YHOL 3RVWC 1DVFB 2HXAA 4X64B 4HSQA 2OQJB 3QIBD 3I6LD 2BW5A 2PETA 2FB4L 3FSWA 1LEKB 4EIUA 3GB7A 3KPNA 3IMUA 4V1DA 4G43B 1AR1D 3K46A 3S0PA 2XQYK 1UATA 2XJKA 2PTMA 1XAKA 2NW2B 2OMVB 2ZPKL 4MVBD 2JNZA 1U33A 3ZSTA 4W70A 5DVPA 3O8XB 1S78D 1PP9H 1ORSB 3FQTB 1C12B 4L3AA 3CVDA 1RD6A 1VFOA 4NZRL 4KRPD 4AQ8C 3KYMB 3RIFF 5IFAL 4DPAX 1KGWA 5DRXA 1D5XB 4TLKA 3G80A 1ZDQA 4Z3JA 1EVUA 4GXUN 4PEEA 4XR8C 2VQ4A 2J8HA 4KVCL 1EVTC 4GSUA 4JI6B 1HDJA 1QSED 3FUFA 2JELH 2NW3B 3IJ8A 1VFAA 4IBUA 4GKJO 1I85C 2BIQA 4AQ1B 1NWPA 1FS0G 4OZGA 3VWJA 1T1ZB 5IKCB 4R3SB 4ZSOB 3IETA 5D6DC 3POHA 1IQDA 1KTDB 2WBKA 4P23C 3SDXA 4DFHA 4W6WB 5DHXB 1VENA 3HKZA 4B9ZA 1B3QA 2OW6A 3TEWA 3AJ7A 3L3DA 1J5IA 3T09A 4NUQA 5I1LA 3DRQB 2GK2A 4CS2A 1YUHA 3EYVA 3IJHB 1PZAA 3ARBC 1N59B 4WW2A 4WUUB 1AGDB 1WHOA 3A6CL 4RSYA 3HC4H 3MAQA 2F1AA 4F58H 3GUFA 4FULA 4J1UB 1VGEL 1AXSB 1ACYL 1LP9B 3VXQB 1FO0H 5ACLA 3BGMB 5T8IA 1GYVA 2Z92A 4FRWA 4KO7A 4YR6A 1ENVA 1XIWB 3CMEV 1C1EH 4O58H 4C4KO 3GBLA 2DIAA 1IC5L 5IJCC 4YIPA 4U6YB 4LFCO 4KGLA 1GW0A 3L4TA 4AEIL 3PV7A 5D2NE 3ZHTA 4QTHA 3VQ1C 1S7SB 4BIOA 1NCWL 1CE1H 4OF5A 1I8IB 5GXBB 3AUWB 3QXAB 1R5VA 1HHIA 4EKJA 4K9EL 4Q9RH 1FN4B 2BNRB 4LPYA 2PW2B 2KS0A 3MUZ1 4NC1E 3BWSA 4Z7AA 3ZN0A 3JWDH 1MAJA 2ARWA 3KXFB 3QJHA 5CJXA 3M86A 5IREA 2GTWB 1GN4A 3M7FB 2GJPA 1O9VA 4OZ4B 3LN4A 3UYPB 1V9PA 4M7JL 3VI4A 1WPXA 3GPSA 4ZTPH 5L4IA 5ID1A 5CBEA 3Q6FA 4XCFH 1SMOA 3ZE2E 3VRLE 3VB8A 5IK3A 2QADD 1T6VN 5FYKE 4F57H 3E2HC 4B9PA 2KDGA 4DV1O 5E1GA 3QDMB 3OW2U 3FFCA 3NJNA 5SWZE 1UPGA 2C2AA 2CLZA 4ZXBA 5AW3B 3B9KD 3Q3GA 4EZLA 3GSNH 4PLJC 1TYJA 3EYQC 4B3VA 2HRPH 1P9MA 5DD0L 4WY7H 2Y0PA 1LDPH 3QXUA 4BW5A 3SOTA 2BRQA 4XWOC 3JVGA 4YPGB 3Q1SL 3QIBC 3MOBL 1GR7A 1TR7A 1W0WA 5GRJH 2YD7A 1AKJD 2R1XB 1HOEA 2B7DT 2ZUQB 5IDJA 3V6BR 4HGWA 1G4MA 3A4EA 3JWOC 4OTXL 1QLFB 2WBJD 3NIDE 4L5FH 5BXFA 3U11A 1YEFL 1KBPA 3MV11 4CU6A 3KPSB 2AHIA 1S78C 3H9YA 3MZGB 3CRCA 3NCJH 4W93A 5DJXA 2HPOA 3T2MA 1PFOA 5DMJB 5HGDB 2J5LB 5PCYA 3GDBA 2F5AH 1RSFA 3NSJA 3HE7D 3IDYC 4NOBA 1VEPA 2EKJA 2DQ0A 3HRZC 2OYMA 4P9HC 5EU4A 1YN7B 5IB5B 2WZ6A 3HNSL 4KZEL 1U8IA 2E76B 5L3CA 3H9SD 2UXFA 4RDQF 4HD9A 4X5XB 5F88A 1OAUL 4H44C 4NDMA 4DRXA 5JQGA 1QFPA 5HI5D 2OYLA 1CXIA 3S35H 1B0GA 3DYMA 2FR4B 2BCKA 4PLKD 3KCWA 1NLDL 3Q2WA 4M7LL 2K9PA 1PX8A 1UVQB 4L9LC 4QGTA 4ZMZA 4XVJH 3MA9L 5EOCL 2YC0A 4MVMA 3AABA 3UMTA 1TUPA 4Q14A 4E4EA 2NT0A 3U7WL 1BYNA 2JSFA 3NZSA 3GTNA 3WTSA 4QAWA 5AYTA 5IM7B 2QPSA 4MX7B 5INCA 1UA6H 2IGFH 2ODHA 2ADGB 3K5MA 2A9HA 3MLVH 4ZOLA 4AYDC 4Z7UA 5I6LA 1WB7A 1H3XA 2ATKB 1FFPA 5KOVC 3FU7A 4F8NA 1HR0B 1UZ6E 2AEPL 3EH3B 4O4JA 1FE8H 1T7YA 5FUCE 1I9EA 1J12A 3TH3T 1UFGA 2XAGA 1G0DA 5F7EL 4CUCA 1XNRB 4S1QH 5C0BD 3S8WA 5BQ7B 3T6ZA 1ZTXL 1MA1A 2IAMA 1HC1A 2NZ9D 2QJDA 5DZAA 1BG1A 3BEWA 3APMA 1YYML 5F9OL 1A1NA 2IALA 2JGDA 1EANA 2L35A 2KBGA 2ZCHL 2VCOA 4NSKB 5AAWC 1MNGA 4PRHE 4DGIL 1QP1A 2GC4C 4H13C 1A3RL 5CEZE 4XN2A 3GEFA 4LLVB 2NQDA 3HG4A 1HXMB 3MQIA 3N43B 4YLQT 5I19H 1OD7A 1Q0YH 4Y1AD 3RTQA 3X1GA 4FQQB 3BQUD 2WYTA 5D7IF 4AH2A 1MCOL 3BKCL 4N90D 4MB1A 3TIDA 1F4WL 3KGTA 1XF4A 1AJNA 3D51A 4KKQA 1WK0A 5IOPB 5I2IB 5D9SB 2MCPH 2CKBB 2P80A 5FFGA 4MAYD 3PN1A 1HHKA 2XJLA 2V4DA 1I3RA 2C34A 5D5MA 3CCLV 3BPLB 3DNKA 2TSBA 5EZIH 2QADC 2AK4E 4EOWL 4NQED 4ZYKB 2DBLL 4JJHA 2XNDG 3PL6B 3RY5A 5A6MA 2YUWA 4PA9A 1MRDH 2DM4A 4PV8B 1ZJAA 3B9KC 5HDBF 1QRKA 3MRNA 4JGSA 1CYWA 1MREH 4NLHA 1NDTA 5LBSH 1HW7A 4FQ2L 4DP1X 3EOBB 4LHUA 3QUXA 4FM2A 4L8DB 4HXBL 3G5WA 4C56B 2ZUUA 1TO4A 3LQMA 4WW1A 3ALPA 1JUFB 4NJ9H 2BOBB 3CC4V 3U9PH 1OE3A 1TJXA 3EYFB 5EU6B 1NGXA 5CJQL 3BRCA 4AEEA 1S72V 1THAA 3M8OL 3OXRB 3ML8A 1UGNA 2IG2L 3O3EB 3DURB 3L6FA 2H0FA 2XG4B 1NUNB 2YAHA 5KAQF 2OTWB 4I55A 4JANB 4QTFA 1M4KA 2F1EA 1AZZC 1EFRG 4UUJA 1ZLWH 2GVYA 3AXHA 3UGUA 3K5RA 1T03L 4D0DA 5DHDA 2YAOA 2WA4A 1T0NB 3K04A 3ZYZA 4JFTA 2OMTB 1NEZB 2FBOJ 4EUPG 4HIQA 2EO7A 2ZAHA 1M42A 5LGUA 4QRAA 1VKXA 3R8BB 4B9GA 1TEFA 2JVUA 1NAMB 3H54A 3CN0A 3O2WH 3M17A 2DMCA 5HI5C 2V5RA 4QHNB 3WFBH 3LSOB 3LXAA 3VD3A 4G71B 4PLKC 4OIFA 1BVNP 3KBPA 3ZQWA 2JQAA 1Q6IA 1XZ0A 1IJNA 4DW0A 1F56A 1QRNA 1RULH 4WHYH 4DVRH 5EEUA 1VEMA 3L5XH 4N5EC 3FRPB 5DGRA 2QM8A 4TWKA 3CN4A 3ZYIA 2ZUXA 3SJVE 5DO2C 2Z31A 4HMDA 1VESA 3L1OL 5KSBE 3TO2A 1UM5L 1M90W 3LDBB 1PMYA 2WVVA 1M57B 1NUDA 3EDJA 5C08B 4G6JH 1KLFA 3L4CA 5EBWB 2BVPB 1QR9A 2E59A 2GK0B 3QZOA 4H8WH 5BQDA 2RALA 3P4NB 4YDNA 2HFEC 3CC7V 1QW8A 3VGHA 4R0LA 4TSFG 4M7LT 5KUKA 2AQ3A 4PJEA 1A6UL 1LK3H 3JTTB 5D4QA 4AQEB 2IANA 4FJ6A 1S9KC 1L9NA 1YMMA 1I8KA 5DSCB 1OM9A 3K6FA 1CJYA 3H9ZA 3KJ6L 2HKHH 5AVRB 3HAEA 1MQKH 3OLDA 3RNQB 3VYPA 2PO6D 1XMEB 2IDTA 2OULB 4OI9A 5IF0A 4XNQB 4Z76B 1Q9LB 4UCTA 1ZLEA 2YBRA 4AQAB 5ITFA 4KY2A 4BFIA 5GW7A 4G8GA 4MA1B 3PDDA 2G2RA 4DZ8B 2WAHA 1KELL 2YPLA 3BKJL 3MACH 2VDRL 2WWKT 1IBKO 3VE0B 1GGIH 2ESVB 4Z6AT 4BCZA 3RYFA 1MFVA 3APFA 4LLUB 2OK0H 3KW7A 1KGCE 3PFUA 1HNXB 4TUUA 5FV1L 1I1AD 2FSEA 1EAPB 4XNMA 3BLPX 1R75A 3PP3K 4L2YA 4XPGL 4ES9A 1FVEB 3LKQB 5BUGA 5C97A 3QA3B 4N26A 4C55A 4MAYC 5DQJB 1KBWA 4O2CB 1B2WH 4WI2A 4KKLD 3HS0B 3BQVA 4K7PX 2VO5A 3TU6A 3ZDZB 3U6RB 3GXMA 4JRYE 1VB9A 4Z18A 1GAFH 5I66A 2EYRA 1MSPA 1MJ7H 3LRGA 4S0SD 3GBNH 3VRLF 3ZE2F 4PJGB 5GS3A 1AS6A 4CN6A 4N86A 1QNZH 4EEQA 4XZUA 4BH8B 1CDJA 4BK8A 4NO3B 3GRGA 5HYJA 4K3AA 3VJ6A 4H8UA 2ZR3A 1P84J 4UAHA 4KITB 1MCNA 1NUFA 2GUOA 3RA7L 4L8CB 2VDNL 3D08A 2VLKA 1FXHA 3MBWA 5E2UH 5SWSD 1SY6L 1O9WA 3IDIB 4AGPA 3U0TB 2B16A 1H3TA 4OJAA 1IARB 1SY6A 3RKDD 4C59B 6CGTA 1XX9C 3TV3H 3VVWA 4L29A 4NP4H 3TCTA 2F54D 3NIDF 2KZKA 4IU3A 3P0VH 5LWYL 4J11A 1RUAH 3HG0A 4LLDA 5C6PB 5HVHC 1Z3GH 3PGDA 4APXB 4URTB 3QDJD 3U0PA 5AVZB 1LYQA 4RESB 1NVPD 3US1A 1F86A 3OJMB 4FG2A 4ZOEA 2YD9A 4G7RB 2N4IA 2DMBA 2QKIB 4P5MB 4ZO9A 5TJWK 3GSWB 1N0XL 4CBPA 1OTSD 1WZLA 3FU0A 4O02H 3BHBA 5CM1A 1U8QA 4O4LB 2C4FU 4G5ZL 3SODB 1O7DE 1NMAL 1BFOB 5EO0B 2EUXA 2QLVB 1T5EA 1VQ7V 2VL4A 2ITCB 3V0DA 3VD4A 4G8EB 3ISRA 3VWKB 2UY6A 1ZSDB 2E0PA 4R8CA 1BYPA 4PG2C 5BS0E 5IQMA 1JXJA 1N36B 4LCCA 2JTDA 3WTYA 1LMKA 2Z1KA 3KVQA 3TYGH 4Q74A 4ZNEA 4PVBA 2MH4A 1C5CL 1UZ6F 1FNGB 2R69L 1OP5H 1WUZA 2WINB 2X4UA 1FA4A 5EBLA 1OTTD 5A2AA 3IFPA 3REVB 4ZUWA 2R69A 3E8BA 1ZLSL 2GPZA 2HTKD 4MCMA 2VS0A 1N2RA 4CN4A 2X38A 2HLAA 3LZLA 3MGOA 4FC3E 4Q4IA 2FATL 5E99L 1QHOA 4OZIE 4YQXH 4XNDA 2YQGA 1F4YH 2JI1A 1IC7H 3RYIA 4WTXA 3OAYH 4S1DC 4NM8H 3X3FH 1Q4NX 2VR5A 2XPZA 3FO9B 3KNBB 1MCDA 4JPVH 4K73A 4LP5A 4I1NB 2L7JA 5I1IH 5IMOB 4JMXA 5FNVA 4R4ND 5FGCE 5FYLL 1KPVA 3PE9A 4R96B 4XO9A 3C09B 3CDGB 2VXSL 3U30B 2H2SC 4CC5A 1FNFA 1RZPA 4Y5VA 3FW6A 3ZZLA 2P8MB 4CSPA 2H8PB 4KKLC 1CYXA 1U8JA 3W9DB 1JVOA 5LCVH 1LDSA 2WCPA 1CEZA 3QXDB 1H6TA 2VOTA 2YZ1A 3GHBH 1I7UA 5J6GB 2JDIG 2ZUYA 3U2SA 1I3UA 1KV3A 4JG1L 5HHVH 1TTBA 1GM7A 2IJ0C 2JI3A 1HI6A 4MSWB 4TYUA 2YGNA 2CH7A 3BJLA 4ZPVA 2WOBA 4B0MB 4JI4B 1Z5LA 3NJVA 4UM8B 5GHWL 5J1TC 2X42A 3BD3A 1KBVA 4YX2H 3MYJB 3VSVA 5D7JD 3N3EA 2Q7NA 1HL8A 4MNQD 1FLRL 1I1CA 2J25A 3QEGH 4JO4L 3MRMA 2DQCL 4XVUC 4RUEA 5E00A 1AI7A 1BGYH 4J3BA 3BWAB 3W7WA 3N41B 1HL4A 3E8HA 4PDRA 1AGFA 1VIWA 4GQPH 4NKDA 3N85H 5INDA 2AKRB 1S7QA 3GZPA 3RKDC 5D1XA 2Q7YA 5I8CA 2JB5L 4ZI7B 3MRCB 2ICWB 3N9GH 3F64A 4NNPH 5F0PB 3BH8B 4HZ1A 5GGVY 3VDBA 3ARDB 4PTUB 2L6LA 4UQEA 3FJTA 4JFYB 4QJ3B 5J0BA 3FOMB 1AR5A 4N4YB 5C0CA 4JFZH 1FPOA 1JFHA 1MWAA 4GKSB 5C6TL 3UG5A 2JK5A 2A3QA 4U3SB 4F9PA 4FXTA 4P4RA 1UJTA 4LSUH 1BX2B 1R3IH 2UU9O 4DKEH 4J7ZA 2ZSWB 4MJHA 1TVBB 5C07D 5IUSA 3CZNA 1L8DA 2FRGP 3D07A 4M6OL 4PRNA 3SB3A 3ETGA 3CMOL 4LEXH 4QRPE 4JG9A 2CJUH 2IXQB 3WFVA 5KHIA 3UZQB 4LCWD 2Z6FA 1R3JB 4G7VL 3A6BH 5F3BA 3VI4F 2F93B 2RN9A 3CH1B 4UANA 4JI5O 5IB2B 4GKLA 1IBMO 4MB3A 3V6OE 3P73B 2DYRB 5HGBA 2YD0A 7TAAA 2E7CA 5KSBF 4NJAH 1IKNC 3B2XA 1M6OB 3LKNB 1ITBB 2NUTB 4UBDD 5JCOA 4FL4B 4KUZH 5DJYB 5EN2B 4HBCH 3S5YA 4Z7VA 2R7EA 2F5BL 3H0TB 3GMQA 3QZLA 4NENB 3GHEL 4X6DA 4ZW8A 4HIJA 1CDIA 1M1SA 3OGIB 2HTKC 3P4OA 3IEAA 5EC1B 4PIRF 2H1XA 2GUZA 2ZP8A 4PJBB 5GISL 5ADPL 4YNYB 3DYPA 1HNYA 4GT7A 1NJIW 1BEXA 1OCZC 1OP3K 5JXEA 4GP4B 1F4HA 4LVNC 2G75B 4YHNB 2I24N 1WCQA 3WIAA 4XCYB 3VMPA 2QGDA 1HILB 3V7AE 4K7FB 5IW3A 2X3CA 3CC5A 3GRWL 3UKMA 4R4NC 5ICZB 1X5LA 3KCYA 3L72H 1KULA 1JD9A 3GRWA 4FQHB 4FLWA 3BIAX 4JEGB 5CP7B 3TNNA 2LGNA 4LF3A 4D0CB 1AY1H 3KGRA 5CA0A 1EZUA 3HB3D 2NY1B 4XN9A 4WI6A 1GK9A 1TZHB 5BZXA 2QELA 4LARL 3UAAA 1K4DA 1C5DA 1Z6JT 2E56A 4XBPA 1T1YB 3QDAA 1OWRM 3F5WC 4M9PA 1NFIA 3QUYA 2UZPA 1OGTA 1ZVYA 4CC1A 3CVHL 4AYFA 3IWUA 1NDGB 2WVSA 1TU2B 3AM8A 1P4LB 4LU5H 1F3DJ 5E6IB 4WO4A 5HDWA 1IFHL 3BZEA 2I5YH 5I1DB 1L0YA 1G6RL 1QUNA 4IMLA 2JIZG 1G6RA 4S2SB 4U1JB 1HZKA 1SZXA 4LF4O 4RA3A 1OF0A 1T5XB 5D7JC 4DUYO 2WYZA 4NBXB 4DR6O 1FL6B 4LVEA 2F1BA 3NJIA 1WE5A 1OAKH 2CG9X 3JWNH 1G7MB 4WRLA 2A6DB 1XUQA 1QLRA 4KXAA 5ALBH 2LQTA 1S2EA 4WFEE 4HF5L 2DQ6A 1N34B 1CD9B 4KNQA 3IT8D 5ANME 4Z78B 1ZHNB 2ERJC 1TFPA 3CSPA 2B9AA 4FHBD 2N0MA 2JFCA 3QQXA 4UIMA 4P30A 3MODH 2H6PB 5IFJB 1I7RA 2R23B 3FUMA 4X6CE 5JW5A 1G7PB 4JKPL 1KWGA 4NAQA 2X10A 2YD8A 3BA9A 3B1UA 2P5WD 1A32A 3US0A 2QQNL 5KBKA 5HYSG 2NY5C 1G84A 4MVZA 2Q5ZA 5GRZA 4DQOL 4KVNH 5E8OB 3S8FB 2QE7G 1NQTA 1M1KW 3EOTH 3S3DB 1OARL 4L1DA 3LRSB 3L2MA 2XN9A 1AQDB 1H5BA 2APSA 2G30A 4EB6A 4M93C 4CDGC 3HE6A 4I5SA 1A4KB 1JPGA 4L0PB 5MP6H 1T1WB 3RB5A 1YHQV 3P40A 1HQRB 3PWJB 3UBXI 5LOVA 4HHWA 5LP6B 2AXFB 1KBBA 5E23A 5IW6B 4MVQA 5DJDB 1BBDH 1A14H 2I9LA 6FABL 4JHVA 5EZYA 1KXQA 4PJAE 2VERA 3TH2T 3HEIB 5IEKA 3OD4A 4LH6A 3QXVA 2NOYA 4XVTL 1Z9OA 1NOAA 2HVKB 1UXSA 4FXGA 1U97A 4AVKA 4XB7A 2NXYB 3TXQA 4PRPA 3MMEB 5D7LA 1J0JA 4JI8O 4WSJA 1XNQB 1D5IL 5EF1A 2C7FA 3FOLA 3HFMH 3X13A 3HPJB 2W0FC 4X20A 2GIYA 4Y16C 4OQTH 4M56A 3WUZA 1B0IA 3C9NB 4CNIA 1MOEA 2V2WA 3C5JB 4BIZA 4OI7A 2LU7A 5C3TA 4HUVA 4KHTL 1BT8A 3ZHUA 2JEXA 1KUMA 4M1CD 2Q9OA 2EVIA 2CBMA 5D1QA 4B7IA 1VQ4V 3AG3B 2BY0A 1QACA 3MLUL 3PWNB 4PCSA 5B66Z 1MQ8A 5A6LA 4OZIF 1N0NA 5EUOA 3OR7A 3T8XB 1KY7A 2G5BA 5FYJD 4BKTC 2PW1B 1E90A 2QA4V 1VMGA 4NUPA 3GNMH 4IIZA 5AOJA 1IC4L 2HFFA 1A1MB 1BZ7A 1K5NA 3BMWA 4L1LA 3W39A 4BXVA 2V2TB 2OZ4H 3VXUA 4EAEA 3IDXL 4CRPA 2FH6A 2ZG1A 4WJKB 3HB3C 5CEZH 4X6BB 4Y2DB 1QEWA 1JZJA 1PIGA 1RJZB 3UC2A 1PPIA 4JL2A 4YSTA 5IZ7A 3QJTB 5FW7A 4YAQB 4FXKA 1T83C 1MXGA 4GAAA 4PRAB 3TBWB 1XILA 4OCYL 3VGBA 5IVZB 2GQHA 2MOGA 4LE8A 4APQD 4F7KA 1R3KA 4IIJB 4F6EA 4PVLA 2AV7A 1WIUA 5HI3C 4FQIH 3DVGA 5KMGB 3U25A 1NGYA 5LBVA 5C86A 1R1BA 1KF9B 4U05A 4PJHB 1MLCB 4WHDA 3LY6A 3RPKA 4DO2A 5HHOA 5H37A 4HK0A 1Y1UA 3VFSB 2VXUL 1IGJA 2X09A 4PS8A 2UVEA 3M07A 5IYZA 3FTSA 1GHFL 3D12B 1JNNL 1N12A 3CFJB 4LSVH 1Y6MR 1HHHA 3TYFA 3WKPA 4BQCA 3JD2A 4ZMAT 3MTXA 1JX9A 1HNGA 1SEBA 4F7TB 1MY7A 5BUAA 3FO2B 4ZMOA 2MCAA 4HEPA 4OZFH 1S7RB 8PAZA 2VN7A 4FYQA 4PMFA 4PWFA 5TPWH 1DVZA 2P52A 2WIMA 3ARZA 2EBOA 2B4CH 3HKBA 1EEQA 4G9DA 1V55C 2FD6L 4WNQA 5D6CB 5E2VH 3MRQB 1EFXA 1NBYA 3PXLA 2YAEA 4RFNB 2AJSL 2YEZB 2CALA 3CQQA 4JFSA 3FUEA 1UFIA 3IPEA 2PMZA 4GMTL 1DL7L 4KY1L 3SDCD 2DI8A 1T2QH 2RMKB 4GSDL 2XY2A 1G6UA 4M6ML 4LCUC 1EO8L 3UPCA 4EN3A 2R0WL 3GKWH 1NPJA 2BSBA 4DAGH 3ESNA 5K1PA 1XCTA 4XMKH 3Q2LA 5D8JL 3QG6B 4AZUA 3U0WL 5FYKD 1XL4A 2WN2A 3JATB 4UTBH 2GTAA 1UH4A 3NESA 4E41A 2ORBL 3N2GA 1AG6A 1KPRB 3MRFA 4KXCA 3FAXA 2FO8A 5C0RH 5J13C 1JZGA 2I9TB 2E6JA 5KZCD 3PGCB 4YOKA 3C8KA 4FERA 4TNGA 5F70A 3SO3B 5FEBA 2WLIA 2L04A 1WA8A 1VQ9V 3QCTH 5LYJB 1CXEA 4PJDA 4UNIA 1CC3A 3MV9D 4L37A 3U1SH 4BWWA 3FX7A 1T89C 1TZOA 2B2XH 1AR1B 4MGXA 3K03A 1R24B 3LKSA 5DD3H 2FO4B 4HFUH 3FFDB 3JSLA 1NGQH 5JPNA 1N8ZA 4OPAA 3QCVL 3CCJV 2XWBB 3ESVF 3DLQR 2PF4E 1MFCH 4ZUVB 4P2CG 2J8UE 3VFRA 4KRPB 1JZ6A 1BVLA 3MLXH 4R7LA 1KB9K 1ORQC 2V5YA 4IBTA 4AGOA 3MYZA 1SM3L 3BP5A 4GSQA 1G9MH 2DWTA 4Q6KA 5HYSB 1BF5A 2GJ6E 2B1AL 5KSVB 5FO7A 3T0EA 4TNFA 4JI1B 1RLWA 2QBWA 1JPTH 4HWUA 4YDVB 3TVMA 4E36A 3CAFA 4AMKH 2J6WA 1QSEB 2ZKYA 4ONHA 3A22A 3NXSA 1LO0H 2HT4D 2PYED 1OT2A 2ZXAA 4Z7WE 1UCBL 5EU7C 5GIRA 1ZL8A 4UOZA 3NK4A 5GONA 2YMXH 1SFHA 2ZDIA 4PJCA 3RGVC 4BE5A 4LDLB 1JHLL 1HH6A 2H6OA 2UZXB 1X7QB 3DUUB 3MREA 3DROB 4F5CE 1TQVA 4PBWD 5H35A 1Z9SA 3NIFE 4QRRD 1QWUA 4XMPL 1NKGA 4YPJA 3IFLL 3LPFA 5BJTA 3QFJE 4KNSA 4JPSA 1QBML 1KJVB 2BZDA 2ZT9C 4P9MH 1Z9MA 2AJYH 1IL1B 1TVHB 4QHLA 5ETUA 2RB8A 3EBHA 1KTLA 5GRWA 1JGUL 1I1FB 4FQXD 1XBRA 3I5DA 3HMWL 5I1HH 4DGYH 1OAXL 3QO5A 4WI4A 4JG0H 4FFVD 1T7WA 1V7NH 3ZRFC 3RVYA 1OZTG 3GTVA 4GO9A 1MCHA 4MD0A 2GDSA 4HUKB 4O2BB 3EYUL 5F7DB 1CBVH 4LB8A 3APCA 2IMMA 1FXKB 4V1DD 4TV8B 4I5BA 5AW2B 2OCCC 5F1NB 3OAZK 3WO4B 2EIZB 3WXWH 2BWQA 3SDYL 1BPLB 3VG0L 1PSKL 4MD5B 4GSRA 2Q3AA 4E9QA 4N0CD 1G7LB 2AVGA 2V7NB 4OF8A 4Y19A 2Q0ZX 4GS7C 2BSEA 1SETA 1GIGL 1SOQA 1KLUB 3L9BA 3E9UA 3JBG7 2CHDA 4UDUA 2CGYA 1IBZA 1UCTA 1U41A 3KBEA 4LPCA 2X1QA 1YYCA 1ADQH 5JPMC 3ZE1E 5B1AB 4JAVA 2Y25A 4X6CF 1TQTA 2LP7A 1RFDH 3CEIA 1EAOA 2E74C 3B37A 5PAZA 3L9RB 3S48A 4BWUA 3IJSB 4ZUSA 2NYYD 1AHWA 4I77L 1BVKB 1Y18B 2Y4TA 3CRMA 1XV8A 4HS3B 2V5SA 5IQ7H 5BO1H 5MEQB 1XQ8A 3QISA 3SKJL 3BC9A 4OZHB 3VWJD 3BCFA 5CLXA 1PYWA 1E6OL 1YYLL 2R51A 4J4PC 4FZ1A 2EABA 2XQBL 1F4NA 3RY6A 4HIHB 1KYOJ 2Y1ZA 5DYFA 4MTXA 2KMWA 2VDPL 4IBWA 4MMYB 4JHBA 1ZA3A 1P2CA 2ITDB 4LAQL 2EUVA 3D4ZA 5C0CD 2ZQKA 1HL9A 1KFAH 5JJJB 1QA9B 3L2LA 3G6AA 5ES4B 5EEXA 2VQUA 3APQA 1I4FB 4BQ8A 2WBJB 4D8PA 1RZ8A 2VYRE 2IJKA 1EJOL 5HXMA 4U4IA 1TVKA 3VRJB 4BDVA 1LO5B 4M5TA 4RQQA 1BAFL 1JYVA 2L0DA 4NO5A 5FS5A 4UM9A 4DV6B 3HE7B 2HVJA 4BSVB 3HI1A 2GEQA 1F0LA 3SYQA 1M7IB 2PR9A 4KPHL 3NDZE 4M5ZH 4OIIH 1SN2A 1L9PA 3BPNB 3H3KA 3ZGIA 1QLEL 2DTSA 2ZWLT 5E5MA 2DTML 1FIGH 3WTWA 3BYYA 4H1LA 5AVUB 3M8AA 1PAZA 1MVUB 3VXSE 3ZO0A 4HJEA 1TDQA 1YPZA 2HT4C 1YNTB 3UBXB 1G7QB 2PY5A 3M88A 4WI9A 1MZYA 4N0UE 4CSTA 3LKOB 2NXZD 2CDFB 3FF8A 4YHHB 1VF7A 4BSWA 5GSVB 2D31A 1UD6A 3BUTA 1BSIA 5F1OB 4E9RA 4JCMA 1CI3M 1PKQB 4NQSA 5AUMA 3STZB 3AY4C 5IQLA 2C9SA 2QFRA 5TE6L 3FFCD 3MUGB 5DS8A 4ZXBD 2IH1B 2Q6WA 1M2VA 3X3GH 4W6YB 4H37A 2CO4A 3S4SG 2Q7HA 3L3IA 4J7RA 5IW1A 1IVLA 3IGLA 1MFDH 4FQXC 3LNFA 4D7BA 1ZMYA 3UYRH 1RUPL 2G3NA 2FJGB 3DI3B 3LS4H 3LD8C 2ADJA 2WWMD 4U1GC 1V10A 2WXGA 2VDKH 4FNLL 6PAZA 1QNIA 1CTNA 2CIIA 3DKHA 5AEAA 3IFNL 4LEOB 3N42F 2OTPA 4W4NA 3GB7C 4Y9BA 4ANVA 3QO1A 2DLFL 4XNZB 1X9RA 2XXFA 1SXZA 4LFBB 1J8HA 2WXFA 4OR1A 1ID2A 3BQUB 4P3DA 3UBXA 4D7TA 5I8OL 4PGZA 1XF1A 4I0XA 1SXNA 4LSPL 4Q6IB 2QQLL 4W4KA 4B41A 2CCLA 4NRXB 5DJCA 4ZKIA 2K8QA 3WEOA 4DN3L 2G9HA 2X4OB 5GGVL 2Q87A 1KIUB 3NZHH 5JJNB 2D7NA 2Z4QB 4ZTOH 5JO5A 2DQEH 1UD4A 1X5MA 2B14A 2JCCE 3PG2A 3ZIYA 2CIKB 5E0QA 2K3TA 4M5SA 5MHSE 3CPUA 2CLRB 1U2HA 3D05A 2R2BA 2Z4TA 4IKLA 1M2OA 2AV1A 3D85B 3ZKMD 2EDDA 1QQDB 2NY3D 1YQVL 2EE3A 2QPEB 4K7PL 4M48L 4CVZB 4X50A 2XZAH 3T77B 2R8SL 1W0VA 1T2XA 3JWOH 2BNQE 1Q0EA 3LZQA 3IFOA 1W72L 2Y7OA 1A4AA 3AT0A 4R84A 4WW2C 5E1IA 2Q0AA 2Z35A 3LKRB 3VGFA 4OD1L 2DWEA 3RDTA 3X14A 3KWWB 2ZX7A 1UM6L 1FRGH 2DEWX 3RZCA 4U6XA 2DLIA 4P9HH 2IAMD 1VZHA 1VP7A 2WGXA 4UU9B 1BFTA 2Y7LA 4K23L 4QY8A 1IAII 4IKIA 4GH7B 5FECA 3IJ9A 2AEOA 3CDZA 5FL7G 2O5YL 4R26L 1GXEA 1VSCA 4FOMA 2J8UF 4JO3L 2V2XA 1AGBA 1GL4B 2AERT 2Y7MA 2AGJL 3RTQD 2E5EA 4X9GA 3VYOA 4K9EC 4DP2X 1BP3B 3THML 5DUPH 1WISA 1XBLA 3FB6A 4AMXA 3JD4A 4NM4L 4NWUL 3TJHD 2VISB 5KN5B 4K4KA 3ABMC 2C7UA 2W9LA 4P5TA 2NY2C 5EDSA 3B3BA 4LAJH 3OKDB 5DS2A 2NXZC 2P80D 1ZHLB 2CA3A 3D25B 2R4RH 5CN0A 1SF9A 5H2BA 3P9MB 2J12B 3TASA 1SBSH 2NN4A 5F96L 4AYGA 3H3BC 4KHXL 4QXUH 2WVUA 1I75A 5ALCL 3W82A 3ZDXB 3ZO9A 1G8MA 2A79B 3A2FA 5CZVL 4FFWD 4W4LA 1DJXA 1FNEB 3MN8A 4I0PA 1PU0A 4ZXBC 2V3EA 4QRUB 5FKPB 2WXQA 2BSKA 3T8MA 4G6ML 3NIFF 3VDCA 5LMUO 4PB9H 1R3LC 1P9MC 1BHBA 4LHUD 3QUXD 3HJEA 5MEPA 3MJ9H 5TISZ 1ZX3A 1KCVL 2J2ZA 3DHPA 4PBXA 1OAYL 1WICA 1K4CB 2PO6B 2PF6A 4NQVB 5GGUA 1KDJA 5CEYA 5L8LB 2OJ1A 3BEVA 4LLMB 3VG9C 4QRQA 2J1ZA 3EHBD 4NI6A 4TVUA 1LR1A 4N3UA 3UTSA 4TL4A 2DKMA 3VMOA 3CZFA 1UA3A 5L4JA 4K71B 1VHPA 4WAFA 4EXKA 3DO4A 4X0KB 4GP8B 4LEBA 1I1AB 4GQ9L 5EIIA 1EEZB 2BRRH 4F4LA 1OT4A 1PKXA 1UD5A 3K4ZA 2VDOL 4PW4A 5E5UB 2DQHL 1J48A 4ZAKA 4AILC 3QH3A 3W9EB 2COVD 1N4XH 3Q7JA 5K1JA 4A7GF 1KCSH 2QSAA 3FO1A 5CO1A 4YJ3A 3ZE1F 3WIIH 3ZR5A 1QRND 3T0BA 3FMGL 5ILTL 2BSSB 3RRQA 4KDVA 3VFOB 3S4SB 1VQPV 4RETB 5DJZA 3W37A 3ZKMC 1EGJH 3FCSA 1PLGL 2CRZA 2ZSVA 4BZ1L 1L7TH 2Z31D 1SYSA 1NCIA 3B7UX 5G5DA 3MXWL 4RMBA 1U93B 4HJGA 4BZ1A 4XP4L 4GI9A 2A74C 5L7XL 3HR5B 2CPUA 1HINL 3BW9A 2EYTB 5FM5M 5AZ2L 2JWYA 5SWSB 4QXGH 4NO0A 4F7CB 4FP8L 4MXWH 4NRYA 5FHAL 3RYCA 4D94A 2H0PA 3HVDA 5B39G 3O6KH 5CJ5A 4GCZA 2IAND 3F84A 4PJFA 4NBYB 4Y5YA 3C08H 1YMMD 3DTXB 5DQDH 5GRUH 1MW1A 4NUGL 1QKZH 2YIAA 2C9XA 2IAMC 4JN1H 1HSAB 3OKNA 4DW1A 3KPPB 3MRBA 1XVSA 4A6YH 1GPOL 5CP3H 1C16B 2VXVL 3H7BB 3S2AA 3GJEA 1FLTX 2YXVA 1E40A 1EUUA 1WRFA 4OD2B 5I16B 4G8GD 4QRTB 1QWNA 2VRQA 3QDJB 3QFDA 3MCG1 2YPLD 2WK2A 1EHAA 4PV9A 1NH6A 2VZOA 4DGVH 1NVPB 1ZV5A 3QE5A 3QRGH 4MQTB 4OV5A 2G60L 3GS7A 1UJWB 4Y9FA 1COWG 5CN3A 4RDQG 4PJ9C 5KVGH 2NNUA 2Y4UA 1DFBL 4NNXB 1ETZA 2EO1A 3ARFC 3WY4A 4PWJA 1NKRA 2LGWA 3CLWA 4TUKH 2Y1YA 2XTJB 4WEBL 3SD5A 4N2MA 1XCXA 3QEUA 4LNUB 2EDNA 1SQ2N 1XNRO 5DF0A 2UYLB 3KPQA 5DD5L 3AK3A 4N2CA 1NCOA 4IDLA 4MTMA 4DT2A 4N21A 4ODHL 1PG7H 1TZIA 1KC5H 2UUCB 2P7TA 3OR6A 3QRBA 5GJTH 3NPSC 4J3OD 3V7MA 2QVTA 3WG7B 3V0AC 5DO8A 3VDAA 1OZ0A 4JM2A 4LNRA 1Q9WA 4OLWH 2YPKA 1B0WA 1YNLH 2XFGB 4HT1L 4ZFFA 5EU7E 1U2CA 1AYOA 4IGBA 2A77H 4E9LA 3V4PB 1JZ4A 4WTZG 2SEBA 2Y9RT 1F4AA 3JARA 5KSAA 5HYJD 3HIZA 3KLSA 3BAIA 3WFEH 3PWPE 3BT2H 2Q7AA 5EWIH 4ECNA 2KG7A 3TBTA 2LW1A 3OT7A 3L7EB 5EC2B 5M95B 3NFNA 4A5UB 3P2TA 1B06A 5FDWB 3ZKQD 2LV4A 2VLKD 2QHRL 4LSQL 3EHBC 5JW4N 1QR4A 1ZS8A 4YK4C 1FSKB 4FHKA 3VACA 4JB9H 4AX3A 3ARXA 4P0DA 5DS1A 3GLAA 3LQZA 3FQ2A 4R97C 2UZIH 2W5PA 1HH9A 4F1ZA 1BZ8A 2BNUB 1Z0NA 3Q2NA 1YN6B 4BV1A 2QR0A 3FHEA 3CRQA 3JSNA 2KQNA 1GMEA 4OFYA 2P48B 3LKPA 1QNMA 3UO3A 4RAIA 3TA3B 3VQ2C 2OJEA 4NQDA 1PX4A 4RRPM 3ARWA 2ZKWA 4HLEA 3QIUA 5T3XH 4RX4A 4I3SH 1FXVA 2CO1A 2ENJA 1JF6A 3ARGA 4N25A 4MBOA 3RWJB 3SPVB 1A22B 5HI4C 1KBGH 1U8LB 5JIPA 3WENA 1Q90A 2OKMA 3ARYA 4G8IA 4KDTA 1E28A 1OGPA 1U6AL 3DJSA 3AVEA 5CR1A 1FH2A 3PV6B 5KHHA 2EECA 2JCCF 2UV3A 1A6VL 2IFGA 5CBAB 1F90L 3CFCL 3GSQB 2G0LA 5LL6Y 2Z31C 1LE5B 5EEYA 2OXGA 1FD9A 2QPFA 1HHJB 1FYTE 1JF1B 1CU4H 3QCUH 1JPSH 4JPIA 4BEIA 5JA9A 4XPBH 3KLAA 4MNQB 2Y5EA 4V33A 4MMXC 2HFGL 2A9BA 4J12A 4JK0D 4LSRH 2FX7L 3FQXB 4EI5A 3T65A 3MRGB 3MLWL 4R0LC 4R90L 3ZMEA 5JQ6H 4KXBA 3QPKA 2QSTA 3KVPA 2B8OT 2XXCB 2LT9A 3D30A 1NCDL 1V3LA 2VR9A 4JPWL 5KAQG 3O6FB 3ZMTA 1WAEA 4X6FA 1MCPL 4AXWB 3FT3A 3AG1B 4LMQI 4WFED 4XOAA 5CWSA 1HCFX 4XP1H 4I4WA 1MAKA 1SRDA 2IDSA 3C5ZB 3HVNA 4WKZA 5LN4A 3DIFB 1HJBC 3V5HA 2P24A 1SJMA 4D9QE 4GT1A 2PXYC 2PKDA 4AC2A 2AEIT 5MENE 4B7LA 4RAHA 1INQA 5DLML 1U21A 1VQMV 1YHPA 1S5HA 2KLTA 5E1AA 4BSJA 3D0LB 2EE9A 3PY9A 5L2KA 1MWOA 3K71B 4U1MB 2LTQB 4DYLA 5TDPA 2I60L 2F15A 2NNFA 5EZOL 3GI9H 3EFFA 4FMKA 3NZ8A 1EPFA 1THCA 4J27A 4LCWB 3SD2A 3L48A 3V0IA 4LPVA 3W5MA 4AGLA 3AREB 3IJ7A 4MW8A 2K70A 2KT6A 3U10A 3NTCH 4J3OC 1FL3A 2F6AA 2DB8A 2NZ1A 1MAMH 2JEUA 2VTFA 4TSCH 1YF2A 2FB5A 3M7MX 2Q76B 2IH3C 4F2MA 2WVTA 4FZEL 1JYWA 4RGOL 5IQ9A 1PL4A 3QO7A 5T5NF 3UTTE 5FM8A 1MNUH 3RYHA 3II2A 3T1YB 2JB6A 4XRCB 5EF2A 3LQAL 3QJZA 1FUNA 3NSXA 4P2RE 1HNXO 1IAKA 2VDMB 3RWGA 4PB0H 1AZVA 1TSHA 1EXUB 1Q5OA 3SQRA 2EH7L 1I9IL 1JZ2A 4G80A 2BOCA 4FZ0A 5E9DA 1ED3B 1OW0A 1FFTB 1DBAH 3V4VH 3BZFB 2Y5QA 4NR1A 1FPTH 1G94A 3NCCB 5BRPA 5JOFA 1WZAA 1MI5A 4X2UA 3CQFA 3RWEB 3CCMV 3CCRV 1BFSA 3WLWD 1LEIB 2Y06H 3B43A 4HWEL 4WSGA 4DF9A 4QE9A 1PFCA 3KL0A 3OFNG 1EX0A 5E6UB 3KLHD 1ET8A 3T4ZA 3PP4L 2DN7A 5I0XA 3FB5B 3LHPH 1FF5A 4XWGH 2XX1A 1R19A 3EJCA 5ABAA 5GGTA 3QS2A 4G43A 5A7EA 2C26A 3B2VH 4U2YA 3ZYJA 3MSPA 5D7KE 3KGUA 4JYBA 4WTWA 2ZUTA 2RJZA 2NW2A 4Z3HA 2R9RB 5CNHA 3UCQA 4Z7QB 5FB8B 5IMKB 1ZT1B 1ORSA 3FQTA 1C12A 1Y74B 1VFBA 4TQEL 5B1JA 1Q0XL 5ELIA 1OALA 3KYMA 5JA8B 1CICA 1MOFA 2PLTA 4CBZA 4YBLB 4AQOA 5JR1L 2DH3A 3HZVA 4H8HA 4OB5L 1MJ8H 2Z34A 1K72A 4PBDA 1AO7E 5HYEA 2CO6B 1E9PB 1QSFA 5E6RB 5D2LA 5IVXB 4FNUA 1ZXQA 2P5EA 2MOVA 3HR6A 3UIYA 2OYPA 4GUPA 3D2UA 2Y48A 1AGCB 5TE4H 3G5ZB 2O57A 3N50A 4HKZB 1IBFA 5ESQB 4HPOH 3NJJA 1T1ZA 2XU9A 4UT6A 5IKCA 1NUGA 4ZSOA 1RVFL 3S7GA 3THOA 3F65A 4R7CA 4U6VH 5L88L 1SJEB 3QG5A 1XMOB 1A4CA 3BAYA 5EBLC 3CCEV 3OC8A 1AGDA 3LV3A 4MQXD 5D7IB 4WFHE 1NBMG 3RX5A 1UENA 2HWZH 1M56B 4J1UA 1AXSA 2BPBA 4QWWD 3E86A 1HWYA 4S1SL 5E7BA 3RX9A 1T22B 5EA0H 4EI6B 5BZDA 5GS1B 4Z0XA 2P5WB 1K3EA 1EHNA 3BESR 5JXED 4YBQD 4JVUA 5J57B 5E24E 5CGYD 5I6MA 4DUZB 4PN6A 3DV4A 3BP7B 2IQ9L 4F6RB 1DQQA 4NB5A 3G9VA 2IGLA 5DK3A 2HTLC 1B6DA 1XHXA 2LVCA 4DV4O 4N68A 3UG3A 1IAOB 3QTCA 2VSMB 3IE4A 4MTGA 1FN4A 4Y5VC 2BNRA 3T3ME 4GLXA 4U1HA 2AEWA 3K0DA 5FUOH 1KN2H 1JVLA 3KHOA 3KXFA 4FNPA 3ABKC 3UROR 3QUYD 2FCBA 5FKAA 1QVOB 3BXNB 3BABA 1NEUA 2XDHA 3DX3A 3GXPA 4HUWB 4WO4D 4J3WA 1NQBA 3KYKL 2ZINA 4NWTH 4X9IA 4G7SB 4KNUA 1CLZL 3STLB 2PCFB 3OEEG 2VN6A 3PJSB 4X7DC 2LLNA 1YY9D 4U3JB 1MG1A 1CIUA 4N87A 3JCUZ 4Q4EA 1PKOA 4U33A 1XGRA 4KJWD 1HN1A 1P7QA 2CZNA 2E8YA 2JJWA 2YRPA 3KLQA 5FGBA 3HNVL 4BM7A 2OM5A 2AJUH 4XO4A 3EJZC 4RA0C 3WNPA 4C4UA 1E8WA 1ESOA 1N18A 5A2KH 1Q8IA 2EDXA 3WLWC 5CZXD 1QMUA 1XD1A 5D1XC 4Q97A 3NCBB 1E5CA 1OO2A 3F6LA 4L3CB 4TQPA 4UI2A 3VO0A 1OD9A 4HDIB 2YS4A 1AVMA 5DT1L 3C5XA 3LZOA 3VA2C 2AI0H 2D3NA 3MXVH 2WUCL 1UKQA 3DK2A 1TTCA 1J5OL 2I85A 1Y76B 4CMHC 1QLFA 4X8GA 3OL2A 2CLVA 3SPCA 4BW9A 2EEBA 5AW4B 1YTFD 4F9PC 3KPSA 4Y5XC 1YEHL 4P46A 1M9WA 4X98A 4X0NA 1TUEB 5TE7L 5HGDA 4K3EL 5L4MA 1DUZB 1L6ZA 2I07B 3D6GA 3PAYA 3LSSA 4WV1C 4APQB 2XN9D 3WY3A 1AQ8A 1YN7A 2FKXA 2R1WB 5IB5A 3QIWB 1D9KA 5ICXB 3HE6D 2H1PL 4KQ3H 5BO0D 4X5XA 1RPQA 2X4NB 3P2BA 4XCCL 3ZL1A 4HGKC 5DRNB 1K5SA 2FR4A 2ID5A 5HHMD 4LOEA 2WZAA 4P99A 5A2JH 4N2BA 1A7NH 4XP5L 3GK8H 2OTLV 3P4LA 1J5HA 2Q20A 1FAKT 3C3TA 3FTXA 4OZFG 3B2MA 3U7YH 2F53A 3ELAT 4XNUL 5JUEH 2AQNA 3UL4A 3OWEA 3RFZB 1XAUA 3FN9A 4L0YA 2WSPA 4PRPD 2V8LA 2RD0A 5LXVA 5E9DE 4P9PA 2LU4A 2ADGA 1KCWA 1NCUA 2X9ZA 4FJCC 2EIBA 5D2NB 2ATKA 3SDDA 3L45A 2NY5H 1IBYA 3L08A 4PYHA 4YN3A 1F58L 5M7QA 1LNUB 2G3MA 1DBMH 3PDGA 1P1VA 3MRDB 1JV5B 4QWWC 1CGUA 1OEZW 1J9SA 5TFSH 3QXWA 3NYKA 5D1QD 3CPLA 5KYWB 5BQ7A 5SX5H 3LCYA 4G1MB 2GCYB 4MNGE 4XTRD 3SDCB 1YUKB 4G6KL 1E3ZA 4RFOL 3ABGA 5CGYC 2LVEA 5L8KB 1AP2A 1H15B 1WT5C 2FIKA 1X5GA 2YUXA 2PR4H 4LSSH 3FL7A 3RI5K 1F3JB 4D7PA 2PI4A 1NL0L 2DQDH 3LN5A 4I2XB 4UT9L 4LLVA 3VFMB 3MO1B 3WI9A 3ZE2B 3FN0L 3CDFA 1EK3A 3VXUD 4FQQA 2NLJB 4H0HB 3PNWB 2F8XC 1Q86W 1F6AA 4AZ8A 4NHCH 3CC1A 4R6ZA 1E4KC 2UXVA 3LMJH 1IAIH 2DEXX 4G3YL 4Q7DA 2PCPB 3QUYC 2CKBL 4NS0A 1Q7YW 5CJOH 4DOHB 3EJYC 2ZOLB 5KZCB 2YEVB 4JAUA 4GQQA 4DP7X 5I2IA 5D9SA 3UERA 2CKBA 4M62H 2IADA 5CZRA 3A4FA 4CC0A 5I1EH 5E08L 2ZAIA 5E8DH 3DIDA 3F00A 1BMFG 1ZHKB 2VXQH 1WFNA 4JKKA 1DBBH 3E8UL 1I9RH 4BFGA 2GAZA 4PVMA 3QUMB 2VC2H 3OJ2C 4ZYKA 1UYWH 4JRXA 5HHOD 2V1DA 1DZBA 1UD2A 1ET7A 1F8TH 3CXCU 1JFQH 3KJ4B 3U46B 4DO6A 1DGSA 2LJ2A 3NIDB 2EXWD 1ZT4A 3N06B 4HQQH 5DK2B 2HH0L 2Z3FA 1Z5HA 4AQYB 1KMIZ 1DANT 4GKOA 4JHWH 4JJ5A 1QTSA 1JUFA 1MABG 3IMTA 2BOBA 3NFSL 3RJOA 4I9WA 2D2CC 3EYFA 4XVSL 3RJQB 1P49A 2AVFA 1LO3H 2AXWA 5FO9B 5I28A 3BISA 3B7SA 3E3QC 4HCRH 4KZCA 2PYEB 2QQKL 6TAAA 2DEYX 5IY5B 1BQ5A 1KYDA 1T6BX 1EFXD 2XKNB 4JANA 3CYOA 4AJ0A 1WAPA 2ZE8A 4LVOB 3NZUA 5EU5B 3VXRE 3U9UA 3JALB 2GBOA 4EF3A 1A8ZA 2KLSA 3DSFH 4PSPA 1CGYA 1TTUA 3UO1H 4I1PA 1T0NA 4DTGH 2AC0A 2WLKA 2EDMA 1I7TA 1JV2B 5LA6B 3E6HA 4EN3D 2OMTA 4HPHA 3NACL 1DF5A 1WSST 1NAML 3P32A 5DD1L 2MCMA 3U4BH 3DOSB 3D3QA 1F1DA 4YY3B 1T6WA 5D93B 1MIEH 4KKNA 5EZJB 5E9NA 2CGOA 2QM4A 2L8AA 1GKFA 4DV3B 2D3OW 4PY7B 4QHNA 5FIEA 5ERWA 1L7IH 3DHMA 5HJBA 4B50A 4E42B 2A6IA 5J06A 4JO8A 4UCFA 3Q2CA 1UZ8B 4MCZB 4JM2F 4M8QB 4NB7A 2QJ1A 4JF3A 1OAJA 3HBZA 4DW2H 3D3VA 5FUZL 2RHEA 4BCXA 5ITZA 3SDAC 2AJZA 4XMLH 4ODSH 1EMTL 5JHDE 5BVPH 1ZHBB 3H3PH 3TO4A 2QKSA 4CZZA 2A9CA 2ZKXA 3OMAB 3MKKA 1ZLUH 1LWJA 4PRHB 3TWCL 3KCXA 2GIMA 1CS6A 3NCFB 5DUMH 4XN7A 5B3SC 5C08A 4WI0B 2BVPA 2YAMA 3CWGA 2Z65C 3P4NA 4FDWA 1ITCA 3EGSB 4NT6B 3NN8B 3OMIB 5DRXB 1F4XH 2HKFL 5HDLA 3BVOA 4OD3L 5D1QC 2PYLA 3S97C 1WGOA 4J41A 2CM6A 3PIQA 3RNQA 5H4YA 2F18A 3NCYS 3T0ED 1OK8A 1K9MW 4LRIC 4XNQA 4Z3TA 3OR7C 4LHJB 2ZOUA 3TVMD 2R0LH 3LEXB 4AQAA 5JHLA 3P3UA 3WN5B 4WK4B 5ISZE 3BVDB 1XNQO 4KL1A 2H32H 3I50L 2YI9A 3U36A 2AK4B 3VE0A 2ESVA 4I9QA 4OZGB 4RMQA 5E95B 1SVCP 4M6NH 3V0HA 1GS8A 2MJWA 1ZK9A 3HBGA 1USZA 1CDUA 1W15A 3IETB 1GTNA 2DQJL 3SDXB 3T3MF 1J9CT 1EAPA 4FHJA 3L3DB 1YEEL 1OB1B 5I1LB 3EYVB 3LKQA 5C0CB 3QA3A 4MWFA 5KVFE 3D48R 5TF1H 1RK7A 1T66C 3B9EA 4BUGA 3U6RA 1EN5A 2Z92B 3FO0H 3IDMA 2WGNB 4YR6B 5ANHA 2AXJA 1VCBC 2G3XA 5DWUH 1E8ZA 5BV7L 4K9JA 4QHKJ 4FQJL 2K9FB 3NA4A 2A0LC 5DMKA 3AS0A 4PRBB 4M7KL 5I74C 3L3HA 5E4EC 1MDAA 3WHXB 4LKXB 4KTDH 2EXWC 4OJEH 4BH8A 5FYJH 4NO3A 4FJYA 1QUPA 3WEMA 5KW9L 3ME0A 5ADOL 3N44F 1QBBA 1R5VB 3HRPA 1S3KL 2OFQA 2ZXQA 3CWBH 1F11B 1LK2B 5KEZA 4I3RL 3B9DA 4L3EE 3IDIA 4XBGA 4Y19D 4MDRA 4OM1H 2BSED 1PJWA 3QJHB 4A55A 4FX5A 3MBXL 2OMWB 1RSOB 2ZOTA 3BVNB 1ZS2A 2YAPA 3LN4B 4U7MA 5D1ZC 3VI4B 4MJ2A 2FJSA 5HHXL 3Q48A 5CBEB 4KUCD 1F3DH 3VI3E 1MZFA 3P9WB 5I1CH 2NT1A 1QBLL 2F58H 2NPLX 4RNRA 1BHGA 1KLGA 3F83A 4IKKA 1YEKH 3QHZH 5LG1A 1RU9H 3FFCB 3Q9QA 1BZDA 2WCSA 2X7LA 5AZEH 1UEYA 2FQGA 4APXA 3RZWA 3LIZL 4YDJA