3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
4YSQA 1IKOP 1N70A 4N4YB 4X4KA 4YSPA 5D4HA 1KGYE 5AFAA 1AAJA 1J5CA 4WKXA 2J55A 2HLEB 5TK2A 1ID2A 3CVDA 3OM3B 2XUWA 4YVNA 1A4CA 2XWZA 2B08A 3UACA 2YAOA 3UGEA 1OCZB 1AZRA 2VN3A 2EIMB 4HCGA 2AANA 3BVDB 1IUZA 4W9ZA 1OE1A 2LLNA 1R1CA 2YXVA 4M4RB 1MG3C 4WTQA 2GHZA 2YQBA 2FQGA 5I6MA 1A8ZA 2BP8A 2XXFA 1SHWA 1ZIAA 3JT2A 1J9SA 1L9PA 4YL4A 1XMEB 4A2FA 4HAKA 4GP4B 4AKQA 1I53A 4KOBA 1ET7A 1NIDA 4YSDA 4YVUA 1AR1B 3SQRA 4YSSA 3QQXA 2JFCA 4G70B 3NJMA 4KNSA 5A7EA 1BAWA 1JZFA 1TU2A 2XV0A 3FQ1A 1NTDA 2I85A 1PNDA 2HRHA 1FA4A 4YSRA 1PY0A 1CUOA 2UXTA 3EH3B 3NJFA 4E9RA 1JXDA 1YLBB 4NAJA 3X1FA 4HZ1A 3QJUB 2BP8B 4DP8X 3AG2B 2H5UA 3PAVA 2FT7A 3ABLB 2RACA 3GXUB 2GC4C 1NIBA 1JERA 3OMIB 4F2EA 5B1AB 1MDAA 4G7QB 3WIAA 4G71B 2QPEB 4AKOA 5E9NA 1PLBA 2GI0A 5B1KA 3WKQA 1PLCA 3TBCA 2XYBA 3ZDWA 4Q8BA 5TK4A 3IBOA 3ASOB 4HIPA 1OE2A 2VSMB 1MZYA 1L9TA 1KYAA 6PCYA 3FSAA 4GP8B 1M9WA 2A3TA 3JTBA 1QNIA 2XVBA 4NERA 2ZXWB 1IC0A 1T5KA 2UXFA 2YAEA 4G7RB 4KOCA 1NPJA 3DIVA 4DP2X 3ERXA 2AFNA 3S8GB 2Y69B 5I28A 2BW5A 3FSWA 2QDWA 1AIZA 1WS7A 1AOZA 2TSAA 1WA1X 2FJSA 3MBWB 3OMNB 2WSDA 3NP3A 2OCCB 5I6KA 3FS9A 2OJ1A 3WKPA 5I5IA 3T6ZA 3T9WA 1JOIA 1AG0A 1L9OA 1KDIA 4UAHA 1PCSA 5AZUA 1OCRB 4P5SA 4BWTA 1PF3A 3WG7B 1J9QA 3CDZB 4ZK8A 3ABMB 2YARA 3V9EA 1KBWA 1AZNA 5AKRA 2YAFA 2HXAA 3AZUA 1NDTA 2XX0A 1L9QA 3T6WA 2E86A 3D12B 1AG6A 3CG8A 1WAEA 3PLYA 1KBVA 1OOWA 5LDUA 1NZRA 3ASNB 1GS6X 3FYEB 1DZ0A 2CUAA 4A2GA 1ET8A 1PAZA 2FTAA 4BDVA 1NIFA 1AS6A 1ZIBA 2XU9A 1HFUA 3ZIYA 3NT0A 2FT8A 3AY2A 4BWUA 1KV7A 2HX9A 2PCFA 4DP6X 4DPAX 3AW5A 3RYMA 3CVBA 2IDUA 2BZCA 3AG4B 4HHGA 2GB2A 2TSBA 2I7SA 2BO0A 1SHXA 1PZBA 1BYPA 2FNWA 3X1NA 2CALA 3T71A 4YSCA 2XV2A 1NINA 4N8UA 1ETJA 3OD3A 2ZONA 3FQYA 2PP9A 1JXFA 1PLAA 1CURA 5I26A 4FA7B 2H3XC 2YEVB 4PCYA 3ABKB 3FQ2A 3FU9A 1RCYA 3HB3B 1XB3A 4NB7A 2J57A 1HAUA 2UX7A 4DPCX 5B7FA 2GIMA 1OV8A 1AZBA 3NSFA 4KO5A 2GSMB 4Q89A 4YSOA 1J5DA 4DPBX 2PP8A 1M56B 4YSTA 4DP4X 5B7EA 3SBRA 2P80A 4A2HA 3PCYA 4BDVB 2R7EB 5FC9A 4CSZA 1GS8A 2GC7C 4KNTA 2Q5BA 4TXVB 4HALA 4KO6A 2IDSA 1SJMA 2PCYA 1TEGA 3IN2A 5PAZA 2EILB 3T6VA 4YSEA 3H56A 4BXVA 2IDTA 2X87A 1GY1A 4HHWA 2BW4A 4E9VA 3CDZA 1JZEA 4GXFA 2FQDA 5F7AA 3X1GA 2B3IA 1JVLA 4AKPA 4EF3A 2IAAC 1AANA 2EIKB 4K9JA 1ZDQA 1JZIA 3QJSB 1X9UA 1BXVA 3C75A 4UF7C 2DV6A 3CZUB 2J5WA 4E9QA 5B1JA 1ET5A 2HX8A 3UABA 3H4HA 3QJQB 1J9TA 4KNUA 3QJTB 3PAZA 3S8FB 1SFHA 2AZAA 5B7MA 1TKWA 4A2EA 4MFHA 4FAAB 2QPDB 2DWTA 2MRYA 3V9CA 3TBBA 1L9RA 3PXLA 1RKRA 2XLLA 2W88A 4M3HA 1CYWA 3ABGA 3GDCA 1F56A 5I6OA 1OCOB 3WNIA 3WI9A 2VMJA 1ASPA 2JKWA 2XX1A 3NJNA 4G72B 1JZHA 3FU7B 2W8CA 4A2DA 4JKNA 2YXWA 1SNRA 1RZQA 1XB8A 5B3SB 3KW7A 2VW6A 3IEAA 2EIJB 1FWXA 3CVCA 2YAMA 2PPEA 3WNJA 1AQ8A 1NICA 1V10A 1SDDB 2IH9A 4CSPA 2BZ7A 3NJGA 1IBYA 3NSDA 1IBZA 1ASOA 5I6NA 3FU7A 2BP0A 1ADWA 4QKTA 4DP9X 1OE3A 1ZDSA 2BWIA 1XB6A 1FFTB 4HCFA 1L9SA 1VLXA 4RH4A 1URIA 2AVFA 2IDFA 3N2JA 1SFDA 3FPXA 3NJKA 1V55B 5B1BB 2WO2B 2YAQA 2P80D 1GSKA 2VSKB 4A66A 1A65A 3EHBB 1GW0A 3S3BB 2DWSA 2FQEA 3FSZA 1BQKA 5B1JC 4GY4A 1M57B 2IWFA 4JHVA 3NJIA 1JZGA 3QJRB 3OQRA 3G5WA 1E5YA 1JZJA 1AZCA 2YAHA 2VW4A 4A68A 3NSYA 1UATA 3AG3B 1BQ5A 2NRDA 1AZUA 3FYIB 4DP7X 4L0PB 1WA2X 1QLEB 3NP4A 2UXGA 2ZWNA 1PZAA 4JHUA 3QJVB 1X9RA 1V54B 1EHKB 1KCWA 5I5MA 7PAZA 2PPAA 2ZOOA 5D4IA 3NJLA 2J56A 5EHFA 7PCYA 4BK5C 1HAWA 2FT6A 2BHFA 2HX7A 1NWOA 1E5ZA 9PCYA 3NYKA 2R7EA 3U25A 4GYBA 3S3CB 3PAUA 1BYOA 2GBAA 2HZHA 2HRGA 3IN0A 4E9SA 2VM3A 3NSCA 6PAZA 1KCBA 1NWPA 2VW7A 4AI7A 8PAZA 1NIAA 4YSAA 1BQRA 3IE9A 4UANA 1ASQA 3KW8A 4QLWA 2MTAA 3SBQA 2VM4A 4KO7A 2EINB 1MG2C 1B3IA 3FU8A 4AZUA 3MX0B 2PPCA 1DYZA 1MZZA 5ANHA 3H4FA 3S3DB 3SBPA 1A4BA 5I6LA 2CCWA 5I6PA 1AACA 4HCIA 3UADA 2FWLB 1A3ZA 4BXSV 1OF0A 3X1EA 1JXGA 1E30A 3TU6A 3X1BA 5IY5B 2WO3B 3BQVA 2XXGA 2DYRB 1NIEA 3NJHA 3UAEA 4GP5B 3AG1B 4F2FA 2QT6A 2BWDA 2AZUA 3TASA 1SF3A 1GR7A 1QHQA 1OCCB 1ZPUA 1BXUA 2JXMA 2QDVA 3EF4A 3EH4B 3FT0A 3TA4D 4DP0X 1JVOA 3QPKA 4AX3A 1J9RA 1E67A 2PPDA 4A67A 3T6XA 4P5RA 3UAAA 2CJ3A 2CAKA 3L45A 3NJJA 1PNCA 2X88A 1BXAA 1KDJA 1W8EA 2I7OA 2IH8A 2OV0A 2PPFA 1TEFA 3PPSA 5F7BA 1W6WA 1PMYA 3N55A 4DP5X 1RZPA 4ENZA 1NPNA 4KO9A 3X2QB 2XV3A 1GY2A 1E65A 1W6LA 3DKHA 1AS8A 1CYXA 2IWEA 3HEIB 2UX6A 5I5JA 4PAZA 1GS7A 1CC3A 3FSVA 4E9TA 2DYSB 3ZBMA 2N0MA 2BP0B 1A4AA 1GYCA 1ILSA 2IWKA 2UXVA 1ZV2A 4E9WA 2PP7A 1AS7A 3EH5B 4BWWA 2YAPA 1SF5A 3FPYA 4W1TA 1BEXA 1SDDA 4F7KA 3GYRA 3DTUB 2IDQA 2CBPA 1ILUA 3ZX1A 4DP1X 4E9YA 1EZLA 1N68A 5D4JA 1WS8A 2H47C 2DY2A 2PLTA 2FQFA 1WA0X 4G7SB 4YSUA 2Q9OA 4E9XA 5PCYA 3OMAB 2Y1AA 1PZCA
chains in the Genus database with same CATH superfamily
3MRFA 4N0CC 4JPIB 1VQLV 1IJNA 3CP1A 2OMVB 4FFBB 3CSBA 3MYJA 4LESA 3UZVA 2WCSA 1U3ZA 2X3CA 3MLZL 2IPTH 3VFWA 3TYFA 3KBFA 2BP5M 4TTDC 2ADIA 4OSUH 3AU1A 4EI5A 5E00B 3D07A 5E4AA 5IIEA 1MCLA 4CBPA 3CDGA 5D7IE 3IFPB 1KEML 1R5VB 1TMCB 4IIQB 5I30H 3UC2A 3BVDB 4Z1PA 1S7VB 1YPZE 3QRGH 2APWA 4H0IA 4U1GC 5G5DA 5DUPH 3EAKA 4U4IA 1VA9A 2YDEA 5EN2A 4OH2A 3RFRA 1Q6HA 1ZIAA 3SJBC 4YHOL 4PVBA 1JK8A 4GRMA 3OSKA 4FCAA 5IOPB 4GEIA 4FXKA 1G9EA 4YSDA 4PA4A 3FN3A 5DZNA 5TE6L 3Q2NA 3SQRA 1KGIA 1LMKA 1ZUQA 3OGOE 2HUHA 1KFAH 1C5DB 1NBVL 1UWFA 2AJYH 1MNGA 3LQZA 4G2AA 4U7MA 3MLXH 1AR1D 3PRZA 3ARZA 1JZFA 1IGFH 2XWRA 5FA3A 3BEWB 3UTTE 3T1HO 1WEJH 1QKZL 3BAWA 3MLWH 4QHUA 3JWNG 2MJWA 4ZUUB 2RQEA 3ZYJA 3DMMA 3VXNB 1CUOA 1E9PB 3EUUA 4O02H 4DV2O 4HS6A 2OULB 1AD0B 1PW3A 4HJ1A 1UCBL 4GKLA 4MD0A 5I0YA 1OARH 1WAAA 1NC2D 4JYAO 2VDKB 5JXED 3TEZA 1L8DA 5BRZB 5TISZ 3QIWD 4WBNA 3G6EV 3UM7A 3GXUB 4OGAC 5J6HB 4BZ2H 3QQ9C 3AABA 4GAYA 2B59A 1MIMH 4QOKE 4L0YA 1A7BA 2BSED 5I8KL 3WHXB 3QH3B 3U9PL 5H9CA 1KB5A 5AW5B 3VD2A 2E9IA 1G6UA 4Z7UE 5DHDA 4XCEB 4WHCA 3AT0A 4Y88A 3RJOA 4WTZA 3U82B 5FDWB 3DJZA 3OSVA 1JGEA 4OCSL 1FVEB 3OJ2C 5IB5B 5F9JB 4ODHH 4XHJC 4K3DL 2ETNA 1G7PA 3ZE0E 3QYNA 3IETA 3RI5K 3JTBA 3NCYP 1SZTA 4DNLA 1OGAB 1T2XA 2X89D 2IBZX 3LSSA 3LSUA 4JMNA 1JNLL 4U1JB 3LKOB 4QHNA 5BO0D 3TP4A 4DQOL 4TQDA 3TN0A 1NTZH 5KS9F 2A5UA 4X4YB 2TSAA 2WJ7A 3HW7A 3WGVB 4HFWA 3NZSA 5J6GB 2RH0A 3MBWB 4Y9FA 2EXYC 4QHMA 1EM1A 2J1WA 2Y9RT 3V0IA 5CN3A 3WKPA 3SJAC 5DQ9A 2CRYA 1FZMA 3WNLA 4HPOL 1JOIA 3A22A 2ZP8A 1GH6A 1PSKH 2DF3A 1ZY9A 1QD0A 3LPFA 2IPUG 2WWOA 5AVYB 5H4YA 4BZ1H 3EBAA 3OAAG 4XCCH 1ZHNB 2XG5B 3O45A 2Z93A 2RMNA 2VSCA 5CUSH 3VM5A 3TONA 4DH2A 4EKJA 1L0NH 1JTTA 3UZQA 3DVNB 4ACPA 4GKKO 2P5WB 4R96B 2BRRL 3EH2A 1CPUA 1Y18B 2WN2A 2YAFA 2NUPA 4I3RL 4PJIA 1J0JA 1UKSA 5KBLA 2ARHA 2E86A 1AGEA 5GGQL 1TZOA 2E9GA 4P2ZA 2M26A 2WB7A 5K39A 1BPVA 5A40E 3QNXB 1WAEA 4LFBB 3BEVB 4FLTA 4I18A 1QWNA 3U4AA 4A7TA 5LDUA 5JQHC 2BSSA 4OLZH 2OXHB 1ET8A 2QTSA 3HPJA 3N0AA 3TPUA 2CD0A 3ZDZF 5DRZB 1UZ8A 1QFWL 3UJTL 3MXVH 1HWHB 4XCNB 1IC4L 1R3IH 2E5EA 4Y1SA 5CZRA 3L1GA 5EZYB 2B1HH 1FNHA 3PGFL 1MW1A 3GD1C 2FIKB 5I19L 1KN4L 2EUVA 1G6RA 3RYMA 2HSIA 5GIRB 4YDLC 4ZNEE 1A1OB 3Q01A 3RB7A 3L7EA 3ZJZA 1K8IB 4JJ5A 4LSTH 5MERB 1U3HA 2DQTL 2YSSB 1MUJB 4LFHG 3C6LD 2Z31A 2R2CA 4DO2A 3OGCA 4GRLA 2CLVB 4HUVA 3F7VB 1ML0A 3PHOB 4M8VA 2X3BA 2Z8VC 1MWOA 1OGAA 1J8HB 1D5ZA 5D7SL 3BHPA 4YHML 1ETJA 3ZHQA 4UM9A 1AZZC 1J1OL 3FO0H 4JG0L 3DPDA 2VUYA 2YD5A 3GI9H 3H3BC 2X2UA 1OF2A 2H3XC 2PYEB 4KKBD 4EN3D 3FU9A 2ARJA 3GZOA 3P54A 3EYVB 4R7LA 1PBYA 1UEMA 1PKOA 3VRIB 4HYTB 4JKMA 4KY1H 2JV6A 3QH3A 5C9JA 4Y2NA 3AREA 5CD5C 4MJIA 1WH0A 4IIZA 4A1RA 4IHOB 4PJ8B 3SOBL 1IAKA 4XPBL 5DQJB 3EO0B 4OZIB 3VGGA 3L1OL 4WIQA 5FLXN 4M8QB 5FC9A 1BF2A 4Y5XC 4M48H 2XSKA 4LKCA 2Q5BA 1C16A 5LHIA 1BAGA 2BNQA 4GFTB 5J5EA 1HHHA 1FBIL 1QRKA 5BS0E 1H2MA 3IJ8A 5D2LA 4YSEA 5FHBL 4UYPA 1MHPL 4DCQA 3ILQC 5JIQA 2BHUA 5DUBA 2X4TB 2GTQA 3LH2L 3HN5A 3LRHA 4WQOA 4Z7NF 4E9VA 3IJSB 3FQTA 1MCNA 3LQZB 3AG1C 4R5TA 4NHCL 4GI6A 4C59B 5FO8A 1CCZA 4ODSL 2UZYB 4HJTA 5GS0L 4WJ5B 4P2RD 4LCCC 3ZOAA 2YRPA 3EADA 5IHUL 5LGTA 3PY9A 1YPZF 3AM8C 3QJSB 4U0RB 3L6FA 4A7QA 4QXGH 1KD1W 1QPKA 2XAQA 1B0GB 1UENA 3TJEL 1ND0B 4WUKH 4XTRC 1U6AL 1BD2B 3GLDA 3ISRA 1KTKE 4HOWA 2WSKA 4DEPC 4Z76A 3HZ3A 1OGAE 3QQ4B 4FNPA 3LZOA 5IHLB 4OT1L 2XBTA 3T2QA 3QJTB 4M43H 1XMOB 2QZ5A 3O6FD 4U1KB 1FHNA 3GRWA 1DJXA 3UJIL 1C08B 4OCRL 4MFHA 3EDKA 3X2QC 4OW6A 4W9IC 3M6DA 4LASH 4JQXA 3SPIA 3G5VB 5C0DA 3SZKC 2IDCA 1R6TA 4M3HA 3QUYC 3ABGA 2YUWA 4JKWA 3TZVD 3P0GB 3G08A 4C8XA 5LXGL 1N36O 2CO7B 2QTVA 3IYLW 3VD0A 3RZWA 2X9ZA 4O9HL 3CFKB 2XZAH 4AIEA 1AILA 2HP8A 1NKDA 1M1SA 2IAMA 4O4YH 4QRUA 4CADB 1MNUH 3O8XB 5A1AA 5ADOL 5C6PB 2Y0IA 3F5WA 4A04A 4L8JA 1R4XA 2CM5A 2MFNA 1FGNH 4HT1L 2P46B 4W9EC 3SGEI 1U3HC 2KQMA 5BRPA 3CVCA 5ENWA 3GTVA 3WNJA 5EF2A 4BFNA 3OHMB 5J12C 3RBGA 4PTUB 4JM2D 5DHXB 4HWBA 1ED3A 4WI8A 2ITCC 2GK0A 3V7AG 5IB2A 3JWDL 1RUQL 5F8QC 2F8XC 2CO1A 1G7IA 4FYQA 2C4XA 5JHLH 2P5PA 3HE6B 3L5XL 1N7ML 1TVBB 1FRGH 1HHJA 1OD9A 2AEQL 2JGDA 3EJUA 3OPZL 4JEGB 4K23H 4NO2A 2DQIL 5DFVC 5C09E 3FMGL 3RNQB 4P59H 5IMMA 1BMFG 4F6EA 4ADJA 3ZTCC 2WBJA 4N0UB 3K72B 1TQVA 1IVLA 2EZPA 4IIQC 1F7YA 4OI9A 4X99A 3BWSA 1BQKA 4HSQA 3S6CA 4QIWF 3ALXA 3PU7A 1NGPL 3QJRB 3OQRA 3DJ9A 2R9RB 2GCYB 1HNYA 3ULUE 4D9LL 2O5NA 1MXGA 1DQJB 3BPNC 4PLNC 3FNKA 4U1IB 3OJDB 5T33H 4BIKA 5I0XA 2C4FU 5T1DL 3QWRA 1EV2E 1QLEB 5MEOB 2W6IG 1FGVL 1G7HA 4L4VB 2CIKA 3U4BH 3RIFF 4N2BA 3V8OA 1U36A 1GC1H 2P67A 2E3CA 2DQGL 4HDIB 2D2CC 3DSQA 2BHYA 1EBAA 3V4UH 5EZJA 2V8LA 4PRBB 1XCWA 1X5YA 4MTXA 2CDEA 4M6MH 4FYTA 5ESQA 4ERSH 1SJXA 2FJGB 4HD5A 4LF3A 2PCXA 3ECVA 1E5ZA 4IM8A 4UU9B 4OCYL 4ZX3A 1P4IH 3UTQB 5D7IA 3THOA 3BMWA 3U25A 1HNWB 1JWSA 3BKCL 3OWEA 4S1QH 4KI5E 4XBGA 4YHZH 5FUZL 4P9OA 4YLQT 3RYFA 1UXLA 3SD5A 3ZKNC 2X1XR 4LCUB 4JGSA 3ESVF 2WK2A 1MRDL 4HZLA 5E4OA 3WHE1 5IB3B 2DW4A 3QAZC 1SRYA 3W9EA 1KZQA 3NN8B 5SX5H 1M2VA 3ZGIA 1NC4A 4MWFB 1CG9A 1IC7L 5E51A 2QTEA 4FKHA 2BOLA 4HZLB 5IB3A 5GW7A 2DIEA 2HKFL 2P5EB 2D7TH 2FHBA 2BC4B 1GW6A 2NX5A 3BQUD 3EYVA 1XL6A 4HJUA 4NO0D 4ODXB 3V5HA 1UVQB 1VQ8V 3WGUB 1HCZA 4R0LC 5GS2D 3K06A 4JHWH 4EDWL 4XP5L 3AUVA 5KVGH 1P49A 4NYLB 3VGAB 1LNUA 3QK0A 3ZK0A 3H2QA 4FI8A 2J8OA 5C92A 1TTUA 3UYPB 1J8HA 3FX7A 3KWWB 3TJHD 2CGRH 4MCYA 5DURB 3VXSD 4F7CB 3BDBA 4NQSA 4PGBA 5HDRA 1Y74B 3HZYA 1F4XL 1M9NA 5MHSD 2WO3B 3MLYL 4H1LH 3M17B 4BFFA 4GP5B 4PD4F 4LOEA 4E68A 3CDYA 5ILTH 5HHMB 5AZ2L 1S3KH 1XR9A 3FUFA 4IBSA 4IOFD 3UC0L 1XGTB 4ENEC 4U1IA 4LFCO 1Z9OA 1ZPUA 2JXMA 3WAJA 1WF5A 3GJEA 4JL1A 4OLYL 5INCB 1FL3A 2YIAA 3DVFA 3TF7C 2WOYA 2EE6A 5DZAA 3BKYL 1A6ZA 2J1KA 4G8GE 5F3HA 3ZZSA 2AJSL 1KULA 1F11A 3EHBD 2LGNA 4K7PL 5HGBA 3QTCA 3TYGL 1DLHA 1R17A 3BVNA 2GJRA 3TV3L 5CP7B 2BMKA 1R33A 3OKMA 3S98A 2VCOA 5D6DA 4XP6L 5I5JA 2B5IC 1P4BH 4P2OD 4TSBL 3VQWA 4NIKB 5ALCL 1B3QA 3GSNB 2OA9A 5H8DA 1AI4A 1XH3A 1BREA 4NTYA 1ZHLA 3HLKA 2BY1A 4NJ9L 5CBEB 4W6WB 4ZTOH 3EVKA 1M2VB 3UBXB 2VN7A 4H20H 5DRXB 4X7TB 2ADPA 4Y8AA 1BZOA 2RN9A 5KYYA 4I4TA 4Y2DD 4HFWB 4NQEE 2VITA 2LR4A 3EYFA 5FGCB 4KK6C 1JPTH 3RWDB 5BS0D 4K94L 3ZX1A 2ATKC 3KEDA 2JKIS 5E4EC 1N68A 1QSZA 3LKOA 4QHNB 4U1JA 4XOAA 1FVCB 3F01A 5E08L 1IQWH 3ALWA 4GO8A 4AEHH 5JZ7D 1SYVA 4LSRL 4AM0B 5CR8A 2H8PB 3FQWB 5DRWB 4M1CC 4LSUH 2JEUA 1HNWO 1GRJA 3JCZA 4JE0A 1AAJA 3WCYA 1TVHB 3WIIH 2H0FA 5JZ7C 1YMHB 2JJSC 4JK0D 2YBGA 1Q43A 5ABAA 3V5DB 3VBBA 5FYLE 3RW0A 2DL9A 5HDLA 5B3SC 3W11D 3N6YA 4N9GA 1L3WA 4OJFH 5E7FA 4PJ8C 2X2HA 4IMKC 3IB4A 5E2UL 1TUPA 1EBPA 1HXYA 1UUNA 4N2AA 3D2TA 2VQFB 2VDRL 4LSVH 3SE9H 4J9YB 4KUCD 3SDXB 2ZXCA 2BOCB 3RZCC 4DR6O 2EDQA 3RUGE 1OSEA 1NCAH 3CX5J 4DV1O 4X7DC 5E9DA 1HXYB 2E7MA 5K9JL 3WTSA 4G6JL 2BS9A 3B3BA 1GTOA 2XN9B 4ZFZB 4IGBD 3J7AU 2GUOB 4YVUA 2DBLH 2J4WH 4UNIA 4Y2LA 3FCTA 4U2YA 4XBFA 3KNBB 3T3MB 3VRLE 3VXMA 1CGWA 1BX2A 4K07A 4BH8A 2ORBH 2WTOA 2P7TC 1NQTA 3QFDB 4DW2H 5JXEC 3WYRA 1DQQB 1TYRA 1X5ZA 3DX0A 3MV7D 4FK5C 4MLSA 3IDMB 3VMNA 4YHKH 1H2SB 2H32A 2VXTH 4RWYL 4E9RA 1RK7A 1JZ3A 1A21A 2OMUB 4Q2ZA 4AGPA 1YCIA 2Z9TA 5JWPA 1BZ8A 3NFPB 3HG2A 2L4OA 1E1RG 4X80H 3AG2B 4KMQA 2N7AA 4PV9B 1CICC 5DS8A 3EO0A 2B1GA 3WJMA 3TO4A 3ZJAA 3ABTA 3ZMEA 3NSJA 1R5VA 3MACL 1TUBA 1TVDA 3KJ6H 4LEXL 4P3CH 5DR5L 4PRNA 2MQ3A 3KZIZ 1EGJL 3VRIA 2WBKA 4UBDD 1JPST 1P5VA 1PD3A 2K9FB 3QNYB 4JFDA 4LVHB 3GSNA 4JY6A 5TK4A 3U30C 4YXLL 1IBKB 5G2NA 5KS9A 2X4NB 3KYAA 3F6JA 5TFSH 1H38A 4RRPA 1C12B 4CW1A 1M9WA 1SEQL 2F58L 1YEJH 4JI5O 4KQ4L 3SSGA 4YEFA 2EULA 1UUSA 2Q7YA 1T6WA 1RZ8A 3E9UA 3IT8D 1V55C 1F3DH 3E8GA 1E27B 1GPOL 4G8GB 4P49A 3ARSA 4U1KA 4WGVB 3ETEA 5I28A 2HHHO 1AIZA 3CFDB 4YX2L 4EVNB 1BZ9B 1DUYB 3K71B 5E8EB 5EBWC 2JLPA 4LGPB 1JZ8A 2FJSA 1FXKB 2CAZC 1GAFH 2OR7A 2BSRB 3NP3A 1AIFB 1OQOA 2ITCB 3FS9A 3T8VA 1GRWA 4DGWC 4NXMB 3QIUD 1BEYL 2FX8H 3CXHF 1J0YA 2EXTA 4J4PA 15C8H 1XH3B 3QQNA 5DK2A 1USQA 1XREA 3J81N 4ZYKA 4HKJB 2DIJA 4N2KA 1NGZA 4O2CA 1D5NA 4GQPH 2R15A 4QTHB 2Z92A 3FB5C 3CDZB 5GGSY 1YEFL 1IX2A 2H3KA 2YARA 5T1JA 3TBYA 3D3IA 1D9KC 3NUKA 5K39B 4B53A 2GVYA 3A0OA 5TF1H 4DR4B 3BE1L 1AHWA 4U1HA 2XA3A 3T6WA 5LN8A 2PW2B 4MAUH 5EO1A 3P9LB 5F1NA 3FOMA 2A6JA 4CDGC 4NQCB 4TVPE 1NM4A 1CFSA 5E6ID 2FTAA 5C08E 4PMFA 2BSKA 3LN5A 3CCQV 2XU9A 5GSVA 4AQ1A 4FULA 2FT8A 2Q0ZX 1ZOXA 1MCPH 2XJLA 2CR0A 3MBED 3QO0B 4NKQB 4BWUA 2CA3A 1K33A 2V5TA 4MVRA 3I56V 3EDJA 4ZTEA 5AYUL 4PELA 4DR1O 4NNXB 3OUSA 1A6TA 1N6UA 3SE4A 5IW1A 2RNBA 5GGVH 3QW9A 2BOBB 2ZICA 2E8ZA 5CBAA 1BVKA 2MQGA 4RZCB 4YFLI 2FX7H 4YJ3B 2CLZA 4YO0B 3NFNA 2MCPL 4YSCA 3GHEH 1XCQB 1KQSU 4AYGA 4OZ4B 5FLUA 2JELL 2XV2A 5I1EH 2VR4A 3L4CA 4M29A 4TQ8A 4L4TE 2KT6A 2QQLH 3L9RB 1NGXA 2EDYA 3DLQR 4PJ7A 3ULAB 2XPYA 1JI2A 5A43C 1N0XH 2VUKA 4QCIB 5IW1B 4FQ1L 2A83B 2OI9C 4GMTL 5INDA 1ZAGA 4DPCX 4V2BA 2F1EA 5D7JB 1Z5WA 1CGTA 4DGYH 3RNKA 1CBJA 4XPGL 4DPBX 5T3XH 2OTJV 4L1HA 2LGQA 1TLMA 2P80A 3JUYA 3LZQA 1QFUL 5EOCH 5EZYA 4QPEA 3R0NA 4BSWB 4CMHC 4KAQL 5DMGC 1H3PL 2JKNA 5DRZA 2X6CA 5LBQA 5F7HA 3B37A 5HY9B 3UTQA 4U6XA 1ORSB 2CXKA 3AQDA 4DO6A 3ULUL 3MCKA 4OZFA 1OGPA 4PRHA 4NLAA 1X5KA 4WWKB 5D7LB 2DH2A 4DKEL 2NY6C 4AYDC 1I3RB 3V4VA 3A0HZ 1IZJA 1N64H 1O5PA 1I5YA 1E8WA 2DPKA 2NLJB 2PCYA 2NUPB 1L9NA 4Q97A 4AENB 4BXVA 2QEXV 4E41D 4UTAA 5L6YL 4F3FA 2ZUYA 4GX1A 2NR6A 3LPWA 2GJPA 5CCGE 3DPBA 2ZXBA 3EO1B 2P44B 1DBJL 2IH3C 4J3UA 1G7HB 4R7NA 5ISZA 3HKBA 1YEDB 3MNWA 2YXHA 2H6UA 2R59A 4I0PB 5DK2B 3P0YH 5MP6H 1PZ2A 3WTUA 3L73H 3VDCA 5C0BA 1U8HB 1AVAA 4QHMB 3QDHA 5LN4A 4TUUA 4AJYV 2QM8A 1ONQA 2WUCL 3KG2A 1VERA 3ROLB 1NCCL 3S97C 1OHZA 2AXGB 3L3OB 2CG9X 1HVXA 1ZLSL 3INUL 4K35A 1YVWA 1IAIM 1XFPA 3K6DA 4QGYA 3OR6A 2EH8L 5D1ZD 5AG2A 5F6IB 1S7VA 4OFIA 4MTMA 2YPLA 1OO2A 1RZ8B 5JXAL 2CO4A 3FTWA 2VR7A 4NDMA 2DWDB 3R8QA 2XAGA 1JV2A 1QVOB 4NPKA 2AJUL 4I2XE 1WN7A 1TVBA 4GAFB 2DJVA 4OIBA 1IO4C 4I5BB 2Y72A 3K5MA 3GEWB 3HAEH 4DTGH 1FV1A 3FO2A 4FG0A 4XCEA 3Q05A 4QRRE 4Q9BA 4NN7B 3BH8A 5LMUB 2BIIA 3FULA 5H2FZ 3HHSB 1M7XA 4UTBH 5DJCB 4DR1B 2A73A 4BH7A 1F58L 1HT6A 2A4EA 5T1KB 1S7TA 4TSCH 5CMAA 1AXSB 1RZQA 5F1KC 2PI4A 4CJ1A 5IJ0A 1V7NL 2DMGA 4MX7B 4IJTA 2HJFC 1U8MA 4UDTA 1UM6L 1Y66A 4S1RH 5EBLA 4QE9A 4LNUB 4U3FH 1ND0A 5L9DH 1HQ4B 2QSVA 1RHFA 2C1OA 3CQFA 5HHNA 4BWAA 2BFVL 3P69A 4J3OF 3VXSE 3E22A 3MQIA 3HFFA 3G08B 4PJIF 3WEOA 3CMOH 3HJ0A 5KTEH 1URIA 4BHUI 4N3TA 3JWOL 4QRAA 5C0CA 1S7SB 2AVFA 1HSAB 1I08A 3B9AA 3V6FA 4GKZA 3NABH 1P5UB 4GKJB 5FCSH 4JGMA 1KNOA 3CZJA 1JRHH 4K2UL 4MMYA 4FFKA 2ZCKH 3BX7C 3I3EA 3OKLA 3C6SA 2XT9A 2DWSA 2DE0X 3FSZA 3O9WA 5B1JC 4XMLH 4HQQL 3LN4B 4C56D 2ED8A 1NOLA 3VH8B 5EOTB 2E6PA 3V0HA 1PQZB 2QEJA 1M57C 5DYFA 3CD4A 1JZJA 5D1XA 4I77L 4A68A 4H8WC 5FB8A 3PUUA 3C5JB 4MS6A 5J7CC 1AQKH 2FUTA 3VACA 2N4IA 2IGFH 3CFJB 5FYKL 4L0PB 2CRIA 4Y4KD 5KS9E 2Q7HA 3DO7B 3EYUH 4YE0A 4GNKB 4QJ5B 1JFHA 1T0MB 1F4MA 1NMCB 4QIRA 3TO2A 3EOBA 3UO8B 3QEHA 5D7IF 3II3A 5MENE 4M9PA 2OTWB 4OTXH 1PX4A 2YBRB 3P4MB 2B2XH 3RGVC 4M7KH 5DUBB 1C8PA 5D1XE 3P2BA 5DRNA 3MLSH 3T77B 5CLYA 4K8RD 5T8IA 4JGNA 2WMPA 3UQ8A 1S7XB 3OTTA 1YMMD 5BMFH 1X9LA 2KG7B 4MXVF 1LGVA 2ZXQA 43CAB 5IWAB 4LPTA 4MTFA 3WTXA 3NYKA 4WO4D 2J3SA 3SKOA 3D3VE 3MLTA 3O2VL 1KPRA 2HT3D 2EDHA 1G43A 4JZNA 4K7PX 2IPTL 4OF3A 1YY8A 3FF8A 4OIFA 5E2TH 4GSDL 3ZRXA 1BZKA 1P7GA 3HZVB 4OQTH 4AQAB 1GM7A 3KW8A 1NGWA 5CZVH 2G60H 3SBQA 4KQ0A 2XCMC 1GGBL 3EBHA 4WFHD 1M7DB 2FSEA 2HLAB 2VM4A 3JTTB 4KO7A 4UWQB 5DO2D 3NJXA 5KBMA 3LD8B 4U1NA 5TDOB 3RYHA 5TQ2L 2OXHA 3D4CA 5LMUO 1WIPA 1BJ8A 4G3YH 1BQHG 4GAJH 5T3ZL 4ANXA 2QDOA 1H6EA 4HETA 2DWEC 3ARDA 1F90L 2FWLB 1I31A 1DLHB 1WBXB 5IZ7A 1CF8L 3RPBA 1M1XB 3BLKA 5M7QA 2NY3D 1RZJC 4B95C 1LP9A 2Q8BL 5MEPA 2XG5A 3O45B 2PYJA 1DVXA 3V10A 3VTMA 2EYRB 4DEUA 4HJJL 4QRRA 3K6SA 2CRMA 1UD8A 3MLXL 5EBWB 3FRPA 1FLRL 3JV5A 2FEEL 4OM0H 2V9QA 4IBWA 4MS2A 2XKUA 3GDBA 2AZUA 2ZYSA 2WP3O 5TTRA 1Q0YL 3MAWA 5B8CB 2NY1C 1S77D 1A6UH 4IJ3B 4DV4O 4UQ2A 3UAAA 3S96B 3H3PL 3NJJA 4PJDF 4WWID 4HAGA 1Y1UA 3C5SA 3O3DB 3GTNA 2HH0H 4TNFA 2PPFA 1TSHA 4KH9A 3FB5B 5KVFE 4XMZA 2J6EL 3BZ5A 2M8XA 1NCNA 35C8H 3FHQA 3NPSB 3RX9A 1UD3A 1F51A 1SMDA 1I7UA 2NY5H 2QPFA 5E70A 4BFGA 5JPNB 4KKPA 3MGOA 2IADB 5IHWA 5F0MB 1TJHL 5LBVA 1FZOB 5IYCO 1KCVH 1KBKA 1MLCB 2MOGA 2DYSB 3ZBMA 2CO3A 3DXAE 3LEVL 3DX7B 4ODHL 3QUMA 3FAVB 3JAKA 2QJDA 4S1SH 2FD6L 3ARUA 5ADPL 4XZ4A 1S5IL 4I88A 4ODVH 4OJAA 4OQ1A 2YLHA 2YMXH 4KDWA 1VQ4V 1MCOH 4TTDD 5G4NA 1EZLA 2LW7A 2PETA 4K7FB 4TM9A 5HHXL 3M45A 2XOKG 3SYQA 3ASWA 1AKJB 1L6ZA 3HG1E 1AFVH 3U0TA 3NIGF 3K6OA 2NX5E 3VXRA 3TVMA 5IROD 1KGYE 1HNZO 2VDQB 3O6LL 3K5NA 4KBPA 3FTUA 4P2RB 1XTMA 3POCA 3G9AB 2J55A 1MREH 5T5FA 2HLEB 5TK2A 1Q94B 1SOQA 2Q7NA 2Z31C 1U97A 2WQ8A 3GLZA 4YVNA 4V1DA 2FB5A 2ERJC 1J1XH 3MRKB 2OI9B 4GG6B 4WCEV 1BSMA 5EZLA 12E8H 1CFTB 2R39A 5IOPA 4GXUM 1KLGA 5GHWH 1IAIH 4PS8A 1JPXA 3W7TA 2QHLA 2YXVA 1FO0H 1DQTA 5EEXA 2G9HA 3GXDA 3AK2A 1LTXA 1NLBH 2CBQA 4TVUA 3VXTB 2FO1A 4GW1B 2FEDD 3T3MF 4CMMB 4I48A 1TTCA 3VD9A 3FT9A 4TULH 1ET7A 4X5WA 5FA4A 1RZGB 5FYLD 4W68A 1N2RA 4ZW3A 2GAZA 2PR9A 1OZ0A 1I7ZB 2XDHA 1I9RH 4TVPD 4LAQH 5C8JB 3ARRA 3DYPA 4G70B 2VH5H 4OX9O 4DV7O 1MJUH 4KHTH 2IALA 4JANA 1N8ZB 1K97A 3G6BA 1WC7A 4FFZL 1CVSC 4NENA 2V37A 4QHKI 1YEIL 2FB4H 4LF6O 2R1XB 3ES6B 1U92A 2HMIC 1ORQC 1WQVT 4XNUL 2Y36H 1BOGB 1P7KA 3VQ2C 1VF5B 5I73B 3OKNB 5JDSA 3QEQA 2KDGA 4XO4A 2CDGA 1FFQA 4H8HA 2R2BA 4AHCA 2N1KA 5KA5A 5LGJB 1CGUA 3L9BA 1ZLWH 43C9A 4ODWB 5FK9B 3DI2B 2RACA 2WVVB 3FTZA 5D7JD 1C9SA 1QWUA 1U8QB 3Q48A 4BK8A 4Q56A 3T2OA 1V54C 1UWXH 3VQVA 3RWHA 1H8SA 1WTGT 2AEPL 4RGND 2DWDC 2XY2A 5B1AC 3MVSA 1H9VA 3NA9L 2OTUB 3MRGB 4JI3B 2H32H 3QIBA 4XPBH 4D0BB 1Q94A 1IGYB 4OFPA 5JVDB 2HVBA 2Q1EA 1OAYH 1BIIA 4JFQB 5E9DD 4WO4A 2P48B 4L8SA 4E2LA 1WCBB 3FU5A 1I9IL 2J20A 3A6BL 3G3LA 1ZLUK 2PO6C 1DVFD 3QWRD 5I0WA 5LXTB 3G6DH 4KXRA 4FC3E 3I75A 4QPKA 3BP6B 5DM6V 1FBIH 1TTRA 1RY7B 1JVKA 1XR8A 1W0VA 4PS7A 1MHPH 3DX3A 1LQBC 3FH7A 1L5GB 4E41B 3JD2A 4Y2OB 3MHZA 4DW1A 4G6MH 4TQHA 1QSEB 3QGVA 4M3JA 8FABA 1JWUA 1C1EL 4YHNB 4IOSA 1QRNB 1G9ML 4G1MB 4JE4B 4WZ9A 1QSFB 3SDCA 1HYRC 1UA3A 1HNFA 5BRQA 5JA8B 3T6ZA 3T9WA 1F4NA 2DM7A 5E03A 3S7GA 1D5BB 4ZUTA 2NNFA 4IRSB 4IOIA 3DUSA 4X7SH 3PWVA 4MRCA 1NCGA 1KJMB 1X5JA 1HEHC 1R46A 1XV8A 3FU6A 2FZ3B 1MFUA 3QWNA 2FYUH 1JV5B 1DQLH 4LIQE 1XILA 1U4FA 3LSQA 1I9JH 4TLKA 5JW4R 2UWEA 4WNJA 5E4EB 2R9HD 4R50A 5I1CH 4GG8B 4Y89A 3EKCA 1R6KA 2E27H 2DMXA 3GBEA 2Z0BA 1T22B 2OJEB 3W3BA 1DZ0A 4U6YA 2O57A 5HYJB 3N41B 5L4IA 3VFRA 1I94B 3IDJA 3B9VA 4ODTH 4XI5C 1SLXA 3P4NB 4JM2F 1HNGA 3TTYA 3OD4A 3DX8B 3T0EE 3VVWA 5AG8A 5DEFA 4DP6X 1GGUA 3AW5A 2ZKMX 1FFPA 3BUDA 1UB5A 3QPXH 1DL7L 1QSEA 1IGFL 4QWWD 2NQCA 4MA1B 4GG6E 2PYEA 2I7SA 1ICTA 1WEJL 3D39E 2OL3A 4JZGA 4UFZA 3V6OC 4OV6F 1KLFA 4JI7B 1MZFA 3AG4C 4C4UA 3DHMA 5F44A 5D8JH 4J3BA 3UOAB 5H6RA 1NINA 4NO3A 5GZNA 3SKMA 4EDXB 1A25A 5KG9B 2RR3A 4P2OC 4W70A 4OZFH 4R3SB 2UYLB 1NFDB 4LF4O 3D8MA 5KVDE 3NJVA 4W4OA 4ELKB 1HAUA 4E36A 4LSDA 2PF6A 2OQJA 2FEEI 2BTQB 5C6WH 2AP2A 3E2HB 2PCFB 5A6LA 3DYOA 3FMGH 3OTOO 1O75A 1AGCB 3GVMA 1FG9C 2IOIA 4GRWH 1B0IA 4OCMC 4R90H 5DWPA 4BDVB 5I1JH 2NZ9D 5EC1B 4ONHA 3L72H 4XPTL 1BQSA 1MVUB 4KNTA 1MPAL 4LMQI 4U49A 2RB8A 4R26H 3ZN6A 4AJVA 3P11H 5KSAD 4XNMB 3FB8B 3BP4B 3ILEA 3FUDA 4M5YL 2C9RA 3LUTB 1AXTL 2J1XA 4ZNEA 4XOCA 4RDQF 2KC0A 1UT1A 1LEIA 4DUZO 1KGJA 3G5XB 3GQFA 1FCCA 3JAWB 1I8UA 1SQQH 2EAEA 4HHWA 4UQ9A 1AI5A 2Z93B 1ROCA 2DLIA 3U1SL 1JZEA 4F2MA 2D7MA 1VJSA 5C8JA 2QGBA 5C0GA 4W6XB 4PJAA 1KCSH 4KWUA 5GZOA 4PDLA 1AANA 1DJSA 1JE6A 32C2A 2APVA 4L4JA 2XQYG 3CFEB 5DQ9B 1KELH 1VFBA 3IFNL 4FNQA 1BM3H 5JQGA 2OP4L 3MBWA 5D2NA 1XF3B 4Y4HA 2J5WA 1W80A 1K4DB 4PRIB 4RMUA 5AVXB 1AVMA 1KC5H 1QNZL 4X4YA 4PTTB 4OPAA 5T1MA 2C8NA 3APQA 4ZUSA 3FO1A 4HEMA 4NRZB 5C2BH 5FUZH 2RFXA 2H3NA 1KIRA 4M56A 1K5QA 3ARQA 1JF5A 2LAGB 4WRLA 1T5XB 5BXFA 4YGVB 5EMYA 2HJFA 3B4NA 3NIGB 4JFFA 1ZLVK 3OUFA 2A6KB 3S34H 4GG6A 4V11A 3WY2A 3RVZA 3V9CA 3VWKD 2D2CB 4NQEA 4ORGB 3RPKA 1IC7H 3LZRA 4MNGB 3X12B 1FJGO 3HC0B 5DMIH 1GTNA 4ZMLA 3UG4A 1X5LA 4XCFL 4KXZI 5IJCC 3C60D 3RBZA 2ZP0T 3P4LA 3WUZA 4DKAA 2BSDA 4JKNA 2YXWA 4EXPX 1JF1A 1CLZH 3BSZH 3EF7A 3WU1A 4A7GA 4I0XB 1T5XA 3HC3H 2DJUA 5BXFB 4HUKB 1K5NB 4ZRGA 3RWCB 1H3TA 1VADB 1UCTA 2BIQA 4L0ZA 2ZCZA 3RY5A 1E4KA 4XNAA 4JFED 3CFTA 2VN6A 1H8HG 2YI8A 3RWCA 4Z7WB 1M05A 1RJZB 3GSUB 1XSJA 3HMXL 4MJ5A 3WEBA 3PGDB 3ASOC 1YN6B 3PDOB 3QUYA 4QKTA 5CP3A 4AQ1C 4AC2A 5IM7A 3QA3B 4OLYH 2V1DA 5IB4A 2C3VA 3ZT6A 4WHDA 2VZVA 2EO7A 3S2AA 1S7WB 5A2IH 3P30L 2CK2A 1PEWA 2DYPA 2DI9A 4EEQA 4DGVH 4X6CE 3IVKA 1W91A 4CC0A 1PLGL 1J48A 2JB5H 2VSKB 4FXKB 3GMPA 3IF1A 1Y67A 1FFXB 3T1YB 2FQEA 2GSIB 5DLMH 3MNVB 2PXYD 3FUMA 5ACMA 2MPAL 2ZTBA 1Y6XA 3L3IB 4HC1H 5LL6Y 1P69B 1ZT1B 3H1KH 2XA8H 5BZDA 5E99H 3BSHA 3TJPA 4YE4H 4Q9QH 2JDIG 2DQMA 4FNUA 4FPPA 1TYEB 2WXLA 4FJZA 1DVTA 3CDGB 5H2BA 1Y76A 3ABLC 2JEXA 1P1ZA 3CC5A 4U6VH 2X1QA 3SDDA 5C0GB 3AU1B 4X6DE 3DPBB 4N8VA 4G8GD 1R3JC 5F93C 3GBDA 4JM4H 3T3PF 4EKWA 4PCSA 2AKRA 4H8WH 4F3FB 2PPAA 3MYJB 3UZVB 3CHQA 4ZUSB 2W9EH 3KJ4B 4EDXA 1WWAX 2Z4QA 4JPIA 3ZIMA 2JK5A 3BGAA 1WB7A 1X7TA 1ZV9A 3BGFC 4QRPB 2NR5A 3LQAL 4UINH 2NW2B 1R6VA 4Q7DA 1C5CL 1NDMA 1BGYH 3GUFA 3FW6A 4WW2F 1EVTC 3TBVB 1HL5A 2MNJB 2WLYA 3H9HA 4R8CA 4I3SH 4L29A 4AEEA 4MXQD 3MU3A 1NGWB 1R6NA 3UIYA 4KDTC 1U2YA 1J11A 4MDJB 4X1YB 1ZA6A 2OQJB 4NX0A 1E4XI 1FNEB 2JJTC 4HJIA 1J9CT 1DYZA 2YGPA 2ZOKB 2HG5C 3OEEG 1QW9A 2UYLA 1HXKA 5JQIB 3MBXL 2WNXA 3SBPA 1BDYA 1TIUA 2FL5B 3LKRB 3C90A 1EANA 3KCPA 4WV1C 5BVJB 2NYYC 3H7LA 2XT1B 5HI5D 5I15H 3RGBA 1XTLA 4KJWD 3SPHA 4OD1H 5AVVB 3U36B 4CAGA 5M95B 3CLEL 4FG2A 1ZXQA 2E4TA 4Z2WA 4YIQA 3RGVA 5IQ7H 3S9DB 2H0JA 4FL4C 4TRPL 2OR8A 3P4MA 2DBLL 4MXQC 4PRPA 4PMEA 2UY6B 3C8HA 3ZYZA 3TF4A 2BNUA 5DJ8B 3GIVB 3GKWH 4LC1A 4DXWA 4LHQB 4N3UA 4ETQA 4LVNB 3GMMB 1RMFH 1SMOA 2WAHA 4OLWL 4WTWA 2R1YA 1BBDH 5CA3A 2OTPA 4W1TA 3TA4D 3TT1H 5JHLL 2YUXA 2ZKHL 1OB0A 1UPGA 1RZJH 2PPDA 1CPYA 3OPZH 4K23L 1G9NL 3JCUZ 3ZHLA 2IJ0C 2I7OA 3ZDXF 4X64B 3TFKC 1DVYA 4B3RB 4JFOA 2VZOA 3N55A 1QABA 1WZAA 2DQUL 3ME0B 4WCYL 1QX1A 3I6GB 2K6WA 4LVEA 1NH2D 4M7LH 4KI5C 1XBLA 4EMZA 1HILA 2CIIB 3MACH 1JV5A 4P3CL 1WE5A 4K5NA 5B22A 1ZWIC 3HEIB 4YHOH 3LKRA 1JX9A 3QUHA 2VDPL 3AT9A 3KVPA 1FYJA 1X7QA 4P23A 1S7UB 2QLVB 3ZKMD 1JQ0A 2ZQMA 1U8CA 2OTUA 1V3KA 1XD0A 5T1DH 5FCUL 5JOEA 1A4AA 2J21A 1LP9E 2YQ3A 5A2CA 4X1YA 2QADD 4RGOH 5E5MB 1AS7A 1MHCB 4LHUG 2X4OA 3GNML 1SLUA 5TDPB 2EIJC 1FYTA 2VQTA 3RBSA 1ACYH 2AK1H 4ZMNA 2ICWA 1D7FA 3FTVA 4ODWA 3LN9A 5I74B 3OC5A 3IPFA 4N25A 3PUCA 4BUGA 1GKOA 4PDRA 5HHOE 5CBHA 3QI9A 3U2SA 2Z5UA 2KQXA 3DJTA 3KL5A 4PRDA 4B7KA 1E6OL 3WIHL 3T6QC 1JHKL 4PREB 2V2TB 2JVUA 3JD4A 1QRND 2GUZB 5IQ9B 4JDVB 4WHTA 4AXWA 5I0ZA 2O6FA 4KK9C 1AJQA 1XNQO 1AE6H 3LYRA 4P46D 5DS2A 1GM9A 5SWQB 3K9SA 2F0CA 2LU3A 4XN5A 1JBJA 3UKMA 3BGMA 3QIBB 2WIIA 1P5VB 5B1BC 4G43B 3U0PB 5LXVA 3PJLA 2B08A 3ZDXB 2JE8A 1LXMA 2YAOA 3MODH 4UNTA 1UD6A 4PRNB 3W39A 3DHPA 2X28A 5H2BB 4OLVH 2CXGA 1IBGH 2D7TL 1E7VA 4LIQH 4X6DB 1RZKC 4CU6A 1YEEH 1YEKL 1T5WA 3OTFA 3VD1A 4W9ZA 2LLNA 1TQCB 3ZTNH 1B88A 1RUMH 3VXTA 3L3IA 1PPIA 2FO4B 1AO7D 3S35L 1HP8A 1J05B 4FQ2H 2YQGA 5GRUL 4MHHG 1LUVA 2HN7A 3ZTDC 3HZKA 1KB9K 3N2KB 2DIAA 4HIQA 4KKLD 3QZBA 4YL4A 5I9QC 1HSBB 1WSST 1XMEB 4QRPE 1V8HA 4PJHB 4HKBA 3IDMA 1RUPH 4FG6D 1KSRA 3DTXA 1UYWH 2HTKD 4OJEH 3MRKA 2GFBB 4JCMA 2D3VA 3UTZA 5FDYA 1N0JA 3LIUA 1KBGH 4Q6YA 3BVWA 4LVOB 1O9HA 4XN2A 3TCLB 1VFMA 1D9KB 1S3RA 1YITV 4NCC1 3HHMA 1OP3H 4BQBA 1A9EA 1TETL 1ZEAH 3KCYA 3VQMA 2Y1VA 1PY0A 2FR4A 3UTSD 3CS5A 5GJTL 4HXBL 3EH3B 3WMQA 1RJZA 3NGBB 2JELH 1IGTA 1BFTA 3X1FA 4UV4H 4HZ1A 1K4DC 2DWYA 1KTRL 3BH9B 3F84A 3H9ZA 2IU0A 3VYOA 1W59A 2MOVA 4WI5A 4L8BA 3R7QA 1BF8A 4H1LA 5ESAB 4BRVA 1N0XL 1UJTA 4JFYB 4R97C 1RZKH 2JJUA 3QQ9D 4KK8C 1QZNA 3D08A 4XP6H 2ZZUT 1CZ8L 4OSUL 1PLCA 2OX5A 5B1NA 1UXWB 2R23A 4G9FA 3ARBC 3WIFA 3K5RA 4PY8I 2JQAA 3DURA 2Y5EA 5LMNB 4AUUA 3KYOB 3PREA 4CS2A 2FBOJ 4AYSA 2KKQA 1TNMA 3IXTB 5CJ8A 1Y0LA 3U0TB 5IJ9A 1MKFA 3QORB 3SCMB 1NPJA 3NFNB 4P5MB 2HLFC 1OAZL 3GO1H 1IM9A 1BJ1H 4RZCA 4NRXA 4U1LA 5CFAA 1O7SA 2X9WA 3CGTA 4OUOA 2VC2L 2X6AA 3NCMA 1I0HA 4J1UA 4PCTA 2MW2B 3HR5B 5I8OH 1S5HC 4YY3B 1N10A 5BS0B 3TZVB 1B2YA 1KYFA 4M7LT 4I4TB 1F86A 2XKSA 4F7MB 5LJYH 3GI9L 2OCCB 3UBXA 5LP6B 3GRGA 3ZMTA 3QO0A 1P84K 2FJHB 1NVPB 2OL3H 4OUUB 4WVRA 3WE6B 1AHKA 3F8UB 5C0EA 1M7UA 1H5BC 3GI8L 3K59A 5H6QA 1LP9B 4OF5A 5MEPB 4CC1A 4IYHA 5CKGA 1AZNA 1GKEA 1OAQL 4QWWC 1PS3A 2GBVA 3N91A 1Q9KA 2AITA 3AFLA 2ALAA 4ZOAA 5AKRA 2EH8H 4FQCL 1ERNA 2VXUH 1KTDA 2XX0A 3Q8FA 4LPWA 5KVMC 1IBHA 2WXNA 4QXTB 1AG6A 3PXJA 3E7JA 5C0IA 3IJ7A 4LBEC 3MV7A 3QG7L 2Z4TA 2H26B 1ZE3C 3RHWK 4NNYB 1F1DA 4RAUB 1T5EA 3ASNB 2AJ3B 3ZO0A 1MIML 3RYHB 1ZPLA 2L7JA 3S96A 4OZHB 3ZQ9A 3QS3A 5CGYC 2MTPA 4J4PC 4Z3GA 1MH5A 1ZCRA 4FFVC 4ANUA 3D3VD 5D5ME 5I6XB 1QNMA 2KQNA 3MD0A 1IBLB 2GITA 5ACZB 4Y4FC 1F8TL 4GZRB 2Q3ZA 1KPVA 2X7LA 4MA3A 1RZIB 2Q0OC 2IDUA 1ETA1 2BZCA 4ODSH 3MCG1 2CLRA 3CWGA 3L4ZA 2GB2A 3QQ3A 1GVIA 4N22A 1XCTB 4NJAL 2OR9H 2ZPKH 1MIEL 4PJXF 5SWSA 3SKOB 4XMXA 3QR0A 3P02A 1QO3A 1LEKB 4WUKL 3MNMA 4K3AA 1PX8A 4F8TA 2AABH 1KTBA 2VLME 3CHPA 4I9XA 2CR6A 2BFVH 1R3LC 5HJDA 3X13A 1OPGL 3ZMZA 5H94B 1IGIL 3R4DA 4X80L 4UUJB 4YDVB 4JRYE 5LUMA 3WNOA 2YBRA 3CMOL 3ZHVA 5KTEL 1HHIB 1B0RA 2EUXA 3OQ3B 4LASL 2Q86B 1CB4A 1JYWA 3AQYA 3GB7C 3QDGE 4YSOA 4NCDA 2WN3A 4LLVB 4PJ7E 4E4EA 3CEIA 3ETDA 5J1AA 3HAEA 4RVBA 1ZE3H 4X98B 4N26A 2ZNWA 3WJMB 5ISZD 5C09B 1UXSA 2PO6D 2AF2A 3PCYA 4PJ7F 1CR9L 2R7EB 1YUHB 4Q14A 3ZRWB 4CSZA 1MZEA 5GGQH 5C7ZA 4JBSA 1KCUL 1LEIB 4POZD 5DVLA 2GTZA 3B7YA 4DUYO 5F9DC 4A6YH 2FLMA 3VG9B 3NPZB 5J0BA 5FYKH 1F97A 3SDDC 3ATFA 3ZLQC 5D5QA 5K5YA 1TVKB 4UVBA 1P5UA 4EBQH 4AL8L 5ITFA 2CIKB 5C0CB 1S8DB 3NIDB 2LVEA 5DC0A 3V55A 3APDA 1BEYH 4K8XA 4JPKL 2WA4A 5L2JA 3O65A 4ZFZA 5E6IA 4ZMAT 2C5DC 3TCTA 2UXBB 4C47A 4JO3H 4HBCH 2VDMH 1B4TA 4TLTA 4Y5YB 3QZNA 1DLBA 3MCLL 4LEOA 5CR1A 4IRJB 2FVNA 1KB5L 2P3YA 4LRNH 3SHSA 1PQZA 1EZVH 2WQUA 4UCVA 3IDNB 3VXQA 5J9PC 2VAJA 1J9TA 2EP6A 2YHGA 3BH4A 4WI0A 1T3FB 2H4EA 3OKLB 2FYYA 3PAZA 3CZLA 3O6FC 5CSZA 5DU7A 3W0WD 4JPQA 4MJ6A 1ZGLP 3E8FA 1LK2A 1MFEL 1TJMA 3HZMA 4FAAB 4LNVA 5DJ2A 1ETZB 2UUAO 2R4SL 5IJVA 2NSMA 3F5WC 4KROD 1L0QA 3L7FA 4YHYC 4KXBA 1AJ7L 1FFNA 3F2LA 5E0FA 2A1WH 3K0YA 4IK6A 3SKNB 4LF8O 3NZHL 1KY6A 3O6KH 1X5FA 4ZW8A 2FTKA 1F56A 4ORZC 2LOEA 3WNIA 3HBPA 5E2WH 2ESVB 4WUUD 3CFBA 3TT3L 3SO3C 4RMRA 1YJ9V 2YK1L 2H1PH 5AYUH 2ENQA 4UZGA 1A6WL 1SNRA 1GIGL 3GBMH 4JO1L 3WLWC 3ZZ1A 4J23A 3EOAB 4M6ML 1EK3A 4ZPTA 1S78D 4H25A 3EYFB 3PQYB 2IQ9L 1P4IL 2JIXB 4DQAA 2PWGA 3QEQB 4KZDL 3TEXA 4JHAL 5ETUB 3A3YB 3DVGA 4XAKD 4FFVD 4JQVA 3SPGA 4X8AA 2E59A 2A7WA 5IUCA 2FLBT 5CGYD 1ZDSA 4FLWA 1OP5H 4Y16D 3OB0K 4ANVA 5J11B 4GAAA 3RIAK 2EVHA 5GISH 1WWWX 4WEBH 5JLZB 2IALB 2FSDA 4JANB 3N2JA 1X4XA 1PV0A 3QNZB 5B1BB 1U21A 3O3EA 2Z91A 3QZOA 3T8XB 2Y06L 2YA0A 2HFEB 3MMEA 1K8DB 2VDLB 3LS4H 3ELAT 4ZAKA 3ZE1E 2AZ0A 3D85A 3B9KA 3TIDB 3M1OA 5KANG 3N2GA 4OGXH 4AMWA 3DO3A 5KHHA 1J0IA 1OAUH 2ZUTA 3QQ4A 1CFMA 2G3MA 3M46A 3NJIA 3ULUH 1I1FA 4YHIB 2CGRL 3O3AA 3OKDB 4FXGA 2WTRA 3G5WA 4YJ2B 3NAAH 4KJYA 2AJXL 3EO9L 5KBNC 3GM0A 3FTYA 1U8HA 5EC2A 3VFSB 3JWNE 3VNZA 5B8CC 2RCVA 2NY1B 4DP7X 4IGBA 1GXEA 1ZTXL 3LQAC 3E35A 1N0NA 1A5FL 1S3KL 2UXGA 2YRLA 1DVQA 1X5IA 2YD4A 4OD3H 4NGHH 1OSPH 3QDGB 4WW2A 5GRWA 4PJ7B 3TN0D 3STZC 3ALPA 1AP5A 2UXBO 3MUZ1 3QXUA 2P1YA 4LEBA 1IAII 2OYPA 3L9RA 2APXA 2CKBA 3FQRA 5FWQA 2BHFA 4W9LC 3EOTL 2ENSA 4ELMB 3ZUNC 3W57A 1SQVH 4DK0A 4MQXC 2IMNA 1CN4A 3DX1A 3K2KA 4D9QD 4UZUA 1BVKB 1FDLL 3SKUD 5C70A 3ZXAC 1M6UA 5B1OA 1AP2A 4X6EA 5CCJA 3NCJH 1FHGA 1RLWA 2YFOA 2E74B 5FM5M 3ECUA 1UB6B 3PGCA 2HVJC 1A4KB 4X6EB 1AP2B 3N9GL 4L87A 3D18A 2ZNIA 2BZDA 3C60C 3WO4B 2ARJB 4APQB 1YNTF 5LG6A 1G84A 5GHWL 1FPOA 3I9PA 1LO3H 1R3HA 3ZYOA 2IJKA 1A4BA 2DZEA 2VIRB 3GBNL 4IKNA 3HIZA 4LHUD 2GBOA 2IADA 4HCIA 5IHBA 3H9SB 4NM4L 1A3ZA 2AV7B 4DR3B 5CEZD 2J6WA 1I7UB 3QORC 3SCMC 4KV5F 5D9SA 4A38A 4D9LH 3RVWD 5A3ID 5E08H 4AEHL 4LH7A 4ZHQA 5HI3C 2PF4E 2NY2D 3PWLB 2VR3A 4K0OA 5CINH 1S9KC 3AG1B 1FPTH 2O1AA 2Q9LA 3CFIC 4HUCA 3MLRH 5JIKA 2CJUL 2XQBL 4AYEC 3T3ME 1RP9A 2DQGH 3NRPA 2YPVL 1KIQA 1OCCB 4ONGL 1BXUA 2F61A 2UV3A 3O81A 2JCCB 3V4UL 4B9IA 4LARL 4LR3A 2Y5TA 5ITZA 3AXIA 4LLQB 4O2EB 4PG9A 2VKXA 3CHRA 1KIUB 1LP9F 1U2HA 2CJ3A 3MRNB 4AMKH 5JYLA 2X7RB 1FNSH 2MOQA 1RPUA 1MVYA 5LCVL 3QJXA 3LKPB 3BZ4A 5EWIL 4P4KD 1RZPA 4Z77A 5DZ9A 3N2GB 3ATDA 4TN9A 2WBJC 3ZT5A 1BYNA 3I02B 1XGRA 2DQFA 3PV7A 3L95B 1WFNA 3QIWC 1W6LA 1AS8A 4J28A 1EH9A 1R3KA 2CUGA 3HS8A 4L1SA 2XHBA 2HFGH 2WLKA 2V3EA 4PAZA 4O2CB 4BKLA 2NZ9C 3LKQA 4P46C 1MFAH 3QNYA 4JFDB 2UVEA 2YIBD 2ZXAA 5GGSA 4PRPE 4RIRA 2UXVA 3STLB 3X3FL 1N18A 1XSKA 1W72L 5FW7A 3NMEA 1JGVH 4M8UA 4DAGL 4J3WA 4P57B 1SDDA 4WFGD 4LE8A 1NMBL 3CFDA 5IWAO 1QLRB 3HMWL 4ZNCD 2FK9A 1L0PA 5AW0B 5J12B 2K9UA 1DQDH 2VZ3A 2IO5A 3O8XA 2JI3A 3VQXA 3S5ZA 4GUCA 4ZPVA 1RK1A 4PJEF 3TXSA 1HYSC 1G9MH 3B1UA 1XIWC 1IL1A 3RILA 4XPAH 3VXUD 3LIZH 3ZKMC 4JPSA 5C07B 1RURL 1FVEA 1J5CA 2LW3A 4PA6A 3KJ6L 5IY5C 5DR5H 2D73A 3SKNA 5IV2B 3N85H 3WD5L 3MRPA 4UOZA 2FH8A 1G1CA 1AGBB 1SRDA 3BZFB 4JN2A 3DO7A 1OCZB 1SVCP 1PL0A 2G75A 2HT4D 2BY2A 2VJ8A 2WXJA 3D69A 4JFHD 4M4RB 4WTQA 1XWVA 3O3UN 4APXA 1GZPA 2BP8A 1KGCE 4NQDD 3SDXA 1D7DA 4FJYA 3VD3A 1MF2L 4X9YA 5DTFA 3SY6A 1EPFA 1WP6A 5HVHC 2G30A 1CF8H 4IBZA 4ZSOE 1RM1B 4H0GA 3RTQB 3SE6A 5MENA 4KOBA 4PJFB 1UQSB 1YUKB 4HUMB 1D5XA 4O2BA 1MAJA 1AGBA 1L9MA 3BZFA 2KYIA 1KJVA 3BUYB 4JN2B 4NC0B 4WSJA 3QQXA 2JFCA 4I13B 5FF6B 1DFXA 4ZMWA 5LNDA 5IW6B 1PDKB 1WDAA 1KJVB 3BUYA 4MZ2A 4BJLA 2Y7NA 2EDFA 2K1MA 4PJBF 1FAIH 4KZCA 2DRUA 4DT2A 3QDAA 7CGTA 5JOFA 4DR7O 3WDIA 3RWFB 3IWVA 4NAJA 1CGSH 4AYID 4Y7OC 3NK4A 4P48A 2BOCA 3L3HB 3BSZA 2Y7OA 3IK2A 3F64A 5DT1H 3MGTB 5EBGA 5F7MC 5CCKH 1I8AA 2GSGA 2NNAA 1UM5H 3R65A 1NPUA 3CFCL 4L5FL 1D7BA 1U0QA 4RQQA 5IJKA 3S36L 2ZIOA 1KIPA 3RAJL 2AAAA 2CHWA 5A9GA 2Z34A 4JASA 1JIBA 4N90E 1G6VK 2K45A 4TLSA 4YDJB 4A2LA 1DVFC 4QRSB 3E6FA 2F6AA 5MHSE 4MA1C 4Q8BA 1TCRB 2AEIT 3V2AR 4P2QA 1MHEB 3V52L 2PW1B 4FNTA 4UT9A 1A4JB 2VSMB 2FKXA 3X13B 5FM4A 5IQOA 1A7NL 3TWYA 5D5MA 4FXLA 4OIAA 2OMVA 2JMRA 3BRCA 1PL3A 3VDBA 2VMFA 4NVPA 2AZ2A 1QNIA 4GEJA 4PGCA 4UM9B 5FECB 4CZZA 4I87A 4RGNC 2CMRH 2ZUQB 2YMXL 3ERXA 1C8QA 4X5RA 1CFVH 3HS0B 2AFNA 2MCPH 2EIBA 2ICEA 1AXTH 3S8GB 3OR7C 5I1EL 1IQDB 1EXHA 4JDTL 3P2TA 4Z0BL 4N2CA 1SOXA 2L3BA 2V7NB 4WDIB 1HEJC 3TXAA 5EU6B 1MWAB 4PUBH 2LQTA 1OCWL 5ERWA 5C0BB 5K9QI 1M7IA 3H1ZA 4GMSL 5T1LA 3DUUA 4XVJL 3KLHD 1L9OA 1PY4A 1KDIA 4MVZA 1UWXK 3ARDD 4O4JB 1YQVL 1EDYA 3GLAA 1DVZA 5C0BD 2G5BA 5HD8D 4U7OA 1VQNV 1EEYB 1Z5LA 5FNVB 1CEZA 1PF3A 2YPLE 4OCXL 5DXWA 4B0MB 5C0RL 1QW8A 2OMTB 4JS7A 3V9EA 4LL9A 4MJ4A 12E8L 1DTOA 4H8PA 3HZYB 3EIFA 2VLKB 2PYFA 1NCHA 3D85D 4UCOA 3BZ4B 5SX4I 2X4PB 4GBXA 3CVIH 2B5IB 3FB6B 1NFIA 3BPCA 2OIGA 1FN4A 2WQWA 1OB1B 3ZTJG 1K34A 1E40A 2AXJA 3EFFK 1NIFA 4XE5B 1AS6A 1ZIBA 4TQEH 5D6CB 4RNRA 1NC2A 2AQ1A 2CCLA 4XNYH 4XZUB 5DSCA 2HG5A 2J72A 1JCHA 4G1EB 3VJ6A 1KFAL 1NBVH 2AJYL 5T5NG 5L3EA 3AEIA 4G5AA 2XAHA 2VMEA 3KPSD 5TE7L 3HR5A 2XWTB 3KL0A 3G04A 4I1RA 4B3MO 3VU1A 5AOLA 4F7EB 4F5CA 3FBQA 4DKDC 1T7VA 3R1GH 1BYPA 4HEPG 5AALA 1AQHA 2CZNA 3PWPA 1U3NA 2CALA 3ZZLA 3BRFA 3WY3A 1UOLA 1T1ZB 1NR7A 3INUH 1BZEA 4NYLA 2UZXB 3MR9A 2DDQL 2ZXWC 1JFQL 1G0DA 5EB9A 3HKEB 2F15A 2B77A 4YO0A 1XVSA 4NSKA 2C9XA 4KKZA 5JCOC 2CO2A 3BABA 4UV7L 5FDWA 2Q8VA 1X3DA 3BP5B 2X6VA 1NCUA 1RCYA 5DQDH 2XWTA 5E8DL 1EO5A 1FC1A 4KV5E 3IDUA 2I9LA 1OV8A 4ZDHA 5I8KH 2UUDH 3ETQA 1S76D 2DQJL 5IEKA 4YSTA 2WXFA 3MHHC 3MPCA 3CCVV 1E4WH 1TO5A 3FONA 1NH2B 3N42B 4AGMA 3DTDA 4Y5XB 4DPRA 4JG9A 5B39A 5GZOD 5KVDH 4JFSA 2J8UB 1G6RL 4V33A 4XCYB 3BCCH 1R5WB 3G6AB 4ZFOA 1ITCA 3CZKA 5HHOA 2EYTB 3CSYA 3WG7C 2XWBA 2ZOUA 4NAQA 2E7LC 3FOMB 4CUCA 3DHUA 3UT5B 1I1AB 4ZUVA 4HALA 1JNLH 1XMQO 2BVUA 1NBZB 3AUWB 4G7VH 4ZMOA 5C0FA 1TEGA 1K85A 4LPYA 5KYXA 1IAOB 2HFEA 4ZAKB 5L9DL 1YMME 1Q9LA 3BUBA 3FH8A 5BV7L 2QADB 4G6ML 2VDNL 3T2MA 1KU9A 2MWCA 4XP4L 5I1LA 3GXNA 2G3XA 4XXWA 1SZXA 5JLZA 1CWVA 5MEOA 2PUQT 4AVIA 1QP1A 1RJLA 2VERA 4U0RC 5C08A 3ZDYE 5I1IH 1JWMA 3C2SA 4AK1A 2Q0AA 3OJDA 5D1XC 4QRBA 3L16A 5DFTA 2Z35B 3FT4A 3PV6B 1BXVA 1BZDA 3CSGA 4GI9A 4NI3A 4R4BA 1L6XA 3CZUB 2GIXA 1CL7H 4BZ1L 4K2UH 5LDSA 2WTRB 4JI2O 4ZS7L 5B1JA 2HX8A 1WITA 3W82A 3ARBD 4H25B 3RVTD 3CN1A 2OXGA 4RGMC 4LF7O 2ICEB 3P3SA 4HQQH 1QEWB 1L1FA 4X99B 5CJBA 5L4FA 1HQRB 2J12B 1F4WL 3APFA 3VVVA 5K59E 3IDYC 4MZ3A 2Q7YB 1KJ2L 5FO9A 3BA8A 3I2CL 3KPLB 5T3ZD 4U1SB 3I5DA 4EI5B 2ADIB 4EZKA 4NKIH 3N0PB 4P2QD 3LQMA 4LLDB 2GTSA 2PXYA 4HD9A 3L9YA 3BQUA 1MCFA 4G7YH 4NS0A 4UDUA 4P2QB 1UWGH 2H2SD 3B4SA 1T83A 2A79B 2VMJA 4JI1B 4E5XG 2QVMA 3MRFB 2OTLV 3NIFB 4G72B 1E90A 2E46A 4PJ8D 5I15L 5KUMA 3DJRA 5CWSB 1HQRA 2QKIC 3KW7A 1NDGA 5F9OL 5DS8B 3MRDB 3UP6A 4HX1A 2HKOA 3RIAF 5KVFH 1J5OL 4Q9RL 5IJBC 1AQ8A 5FGBC 4IIJB 2OS7A 1AXIB 3LIZA 5E1QA 1ZVSB 3QO1B 1EJ8A 1TQSA 1N32O 1KKDA 5I1KH 3O2VH 1S9VB 1CT8B 3H1LH 2CUIA 5K9KB 1PVHA 3GHBL 3WFCL 3TURA 4XN4A 3ZL1A 2AQQA 4H44B 3RYIB 3OTOB 5E56A 5CJ5A 1RQ5A 1Y1DA 4RH4A 5A16A 2WVSA 2WGNB 3P0YL 3QIWA 3GMRA 4XHQA 4B97A 1IE4A 3B2UD 5M94B 3U6XA 4FX5A 1FVDA 1ZKAA 1OL0A 1BMGA 2E7HA 1F13A 1ZLSH 5C8YB 4PFEA 1I8MA 5CZXC 4GY4A 4FKEA 2OKMA 4OZGF 3KM1A 4XN1A 2VAAB 2N59A 4ZQKB 5E6SB 3ZRWA 3T2LA 5DI8A 3C87A 3OW2U 2QKCA 2WKLA 4HH9A 2BTOA 1LNQA 4KK9D 4R26L 5DVMA 4M4RA 1ZGLM 2QM4A 3L6FB 5BZWB 4CH4A 1Q90D 2A6DB 2X4QB 3OKOA 4PBDA 4PEEA 4QTFA 5E6IB 2IG2L 2WBXA 4HP5A 5A2QN 1OTTD 2NR6C 4TMPA 1MN4A 4MSWB 2N74A 4OV5B 4UQ3A 5DJ8A 2ZWSA 4JFFD 3IMUA 5SX5K 3BP5A 2GW5A 3CCHA 3CU7A 4X6FA 2F53B 5C6TH 4QOKA 2J8UF 7PAZA 2X1WL 1QASA 4MQTB 4PJ5A 3VQYA 4YZFE 1YSOA 1P6AB 5EO9B 3HE6D 1UM6H 2HH0L 1G7QB 2LO1A 2HX7A 3ARTA 3WENA 5LWYL 4WV1A 3MBEA 1UJ3C 1MFVA 1F6LL 1FVCA 2ZT9C 2ZOKA 4JRWA 4WNQA 1MAMH 3HI1B 1CI5A 4JLRA 3KGSA 3SGKC 3O4OB 4M43L 5L3DA 3H9VA 4F37K 3BPLC 4BEIA 1TJHH 5FFLA 2PUSA 1DE4B 1NWPA 1OT1A 2R69A 4WHYG 3VI4A 4MDJA 4X7TA 3VWKB 5AVUB 2WSPA 3WN5B 2Z8WC 2Q5ZA 1EUUA 1BQRA 3IE9A 1SDYA 4K71B 2MTAA 3MO1B 3BIBX 4CH6A 3QS2A 3ULVF 2YN3A 4R0LB 1Z3GH 3QEUB 4EB6B 1JRHL 1GJIA 4AG4L 1T7XA 3D25A 3DOSA 4X4XA 3RDTB 5FYLL 2AHZA 4WWKC 4P5TD 2LFGA 3QNXA 3IRCA 4HUUA 3K6IA 3OKMB 4I18B 3CJHB 3OAUH 5AOJA 5EUKA 4M61B 5HGDA 2WINB 3UYRH 1MCOL 4WW2C 2D3JA 3IKCB 4RGNB 2CO6B 1VQ7V 3K9AA 1CIDA 4JAAA 2QL1A 4TOYL 4MTOA 4O2FA 2WWMC 2BNRD 4BSVA 4V2CB 4ZXBA 3QQ3B 3V4VH 3MAQA 2QPSA 2AERT 4O4LB 5JHDE 3BFRA 2B9BA 1P7QA 1G6RB 2J1YA 3I74A 2NUTB 3N1MC 2NYYD 1HHKB 1CE6B 1SY6L 4MB4A 4Y5VB 2QDVA 4JFTA 5DHYA 3RL1A 3Q06A 5D96B 1N59B 1XBRA 3DSFH 1FRGL 3KAAA 4FLRA 6FABH 1BT8A 4WFBV 1U3JA 2VDKL 4XRCB 1DBBL 3B56A 5B3JE 3CLWA 2ROXA 4OCNC 3QDGD 4NNYA 5DJAA 1IEBB 2ZF9A 2CR3A 4NP4H 1PMYA 5L3FA 5HDQH 4DGVL 4ZMYA 1C7SA 3QCTL 4OF6A 4I5SA 1NPNA 3FQXB 4I9QA 4JGJA 4MCYB 1I1RA 5EORL 2QVFB 1E2ZA 4R96A 5D2NE 4MNGA 1GZHA 5KSUB 2IWEA 2V5YA 4YHLH 1U8JB 4U6HB 1SJHB 1FJ1A 2YGNA 1E4JA 1GS7A 2IU3A 3PABA 2BRQA 5CZVL 2R9AA 3V5HB 4O4IA 2BVPA 2G5RA 3LRSB 5EF0A 1N6QL 2CPCA 1YN6A 3PDOA 3UYOD 1QFOA 3NGBC 4PJEA 1OTSD 5EU3A 3W9EB 1JMZA 3SJVE 4BWWA 3HFMH 1GYVA 4OM1L 1SF5A 4CH3A 5FOBA 4PV1B 1G7JA 1XHHA 4RQQB 1II4E 3H42H 4XNUH 3ULUD 2R69H 4MDIA 4XBGB 5T5NF 4E9YA 1SHMA 1ADQH 4FTVD 1OY3B 4I0XA 3CWBH 1JD9A 2BJML 4LHUB 3HC4L 4HUNB 4XPHH 1TTFA 4JF3A 1K2DB 2QHRL 5EU6D 4TL5A 1RP8A 3JD3A 1U3YA 1A02N 5D1QB 2HWZH 2WB1A 4JQXC 3X14A 1QRNE 1UACL 4EE2A 2UZIH 2EABA 2DYRC 1ID2A 2VDMB 3I84A 4H8UA 2AEPH 3NRFA 1PPJH 3BAEL 1ZMYA 4WGWB 3RJQB 4LFHD 3BY6A 3G6JF 1A4CA 5I8EB 4QF1A 1RUAH 1AD9A 1TKWB 3KXFA 4R6UA 3VXOB 4LLMA 3KPQA 1OAYL 5DJYB 4Q9CA 3D33A 3DK2A 4LPVA 4YPJA 1IUZA 4FTVA 4HS8L 1I9IH 3RZCB 3TETA 3S3JA 4Z0XA 4XH2A 4ES8A 1OD7A 4Q0XH 1VARA 5I6MA 3TZVC 3M1BB 4FN0A 3Q6FA 5EO0A 3U7AA 1XF5B 4HUXA 4UI2A 3MNZB 1M9SA 2VR8A 3AITA 3UO2A 4GUNA 2ZX6A 3H7BA 2R0KH 5JHLA 2W80C 3IDXH 1ZT4B 2ZINA 1K8DA 2EDMA 3BEWA 1M71A 3K2UL 4LRIC 4KX9A 4LLYA 5L0QC 3HI5H 4DR2B 4ELDA 5IREA 4UIMA 4Y4KB 1TU2A 5LHGA 1EDHA 3B5TA 4WGKA 5C07A 4B9PA 5EYPB 1PZSA 3A21A 4U3SA 1TYJA 4IU2A 4ODVL 1G7IB 1T7YA 1MIEH 1LE9B 3T0DA 1PD1A 4XC1L 2FECL 1H3VA 1ZTEA 1KXTA 5HJBA 1CS6A 2QQNH 3DX9B 1H6TA 3OKKB 4X0NA 2A77H 2N01B 4N2HA 4Z1VA 5B38A 2YS8A 2XVGA 3MYZA 3NH7L 1PYWB 4Q6IA 4DP8X 3KPTA 4PA7A 2DLGA 1LHZA 5D71H 4WF7A 5IHZA 4RGMB 3A4FA 4RGNE 2HJLB 4DUZB 1XGUB 1ITBB 2ICEC 4IW4C 1YNLH 3TV3H 1MHCA 5IT2L 1JGLH 4G7QB 3CFQA 5KWYC 4ZBJA 3M86A 4ZXBD 2CBOA 3MRLB 4XVUD 4UV9A 2VDPH 3ZKSD 2XYBA 2DWXA 4XO8A 2ESVA 5DMKB 2RQ6A 4UIKH 4RLDA 4WWKD 5D7LD 3VGHA 1XIWA 4HIPA 4A39A 4F24A 1E8YA 3HNTH 5CA0A 3OKEA 5FCUH 4P9MH 1SBSL 2B4CL 3Q5OA 1N5YL 2AK4A 4CC5A 4JDVA 4K8RC 3G6JB 2CA4A 3LTVA 4RDBA 2XVBA 3RDTD 3RU8H 4G7RB 4KOCA 1C08A 2BVQA 3NVQA 1K92A 3IRPX 4NHUB 2OSLA 4LOUD 4OKVA 5TGBA 1UT2A 2BW5A 3VFPB 3GJFH 1MJ8H 5E5RB 3CN2A 4X88A 4MZIA 1TITA 2Z7YA 1FYTB 2ZF8A 2JGUA 4CGTA 2K7QA 4PGZA 4LSUL 2VABB 3VFTB 2XASA 4GRWB 1HINL 5D2NC 4OD2A 3L4TA 3RE0A 2P8MA 1PY9A 1UOVA 4IBUA 2L04A 3SYOA 1QYGL 1XL4A 1X7QB 3QCVL 4P23B 3E89A 3LHAA 1L7TH 3WKYA 4GSQA 1TVKA 3ZL4L 4ZK8A 4LRNL 1KB5H 1YPZB 4PM1A 2ZOWA 3I6LE 2R0ZH 1KBWA 3IAGC 4HEME 4ADIA 3HG3A 1CDHA 1HILB 2CIIA 1FSKB 1EEZB 2BVTA 5B1CA 3BAAA 4OCLC 3SJVB 4TNEA 2OSWA 1JPSH 1I8KB 1NKRA 2OM5A 4QHLA 3ZHKA 4S10A 2W0PA 5JPNC 3ULVL 4RDQG 2F68X 4M93C 4UCRA 1E5BA 3HE7C 3PLYA 2WLLA 2OCJA 3P11L 1OTUC 3LDBC 4FZ8H 3MROA 2CGYA 4G6JH 1RXLA 1J0ZA 2DYSC 2LABA 2H6PA 3T0ED 4P9HC 2OMWA 4LDLB 3F05A 3B09A 1EAJA 3L54A 5E2WL 3KPSE 1EO7A 4HGMA 4NWTL 2D3NA 3K3QA 3IFXA 4N2DA 4KUCF 4Y1AB 5D1ZA 1P9MC 2HFFA 4ZZFA 5DGRA 4PGDA 2EDBA 3RP1A 2OZ4L 3O4LE 2F19H 5T5FL 1ZEAL 4NIYE 2FNWA 3L3GA 2CBTA 2OP4H 1BQHB 3BWAA 4YC2B 1MVFA 4DR4O 2F18A 2MSPA 1QNZH 1S7RB 4YK4B 1IGMH 3I3BA 2VKWA 4RFEA 4M1CD 4YHYB 2HPTA 3D4YA 1UJ3B 3FQYA 1LO4H 4UT6H 3I3DA 3F5TA 2ZT9B 1RULL 1CD9B 1AGDA 5JHBA 5GGUB 4N8VB 3L7EB 1FIGL 1JYNA 1XZWA 1Q72H 3WFVA 2UX7A 2WW8A 3U0WL 4IBQA 4WNSA 2O30A 1MCWM 5ANMB 4R7DB 3K58A 5B66Z 1IZ3A 5LOVB 1T4KA 4JRYA 4JX0A 4NKOB 5JPMB 4J6IA 3IS0X 5D1ZC 3U7WL 2YD6A 1FORH 1R47A 1NBCA 3ZE0B 5GGRB 1LUWA 1COBA 4XMWA 2ZYRA 1ZJBA 4OGXL 4R8WL 1WD8A 1I9JL 2R2BB 4YZFF 4KFZC 3D7PA 2F58H 4IRZL 1YEJL 2MPVA 4KQ4H 1PD0A 4I18C 1CDYA 4FFYL 4H8QA 3P3NA 4LPCA 2Z4QB 1EUTA 4XMPL 4LSQH 3D85B 3O2WL 4W4NA 3FRUA 3ESMA 2EILB 2IAND 1IKNA 1NAMH 3H56A 5FOJA 4MB1A 1TU2B 1MW0A 2LE9A 2HP4A 4OGAD 2Y07L 4FZ1A 1OAXL 4D8PB 1GAFL 2FQDA 1US6A 3X1GA 1WFUA 4RWHA 4JNXA 2C3XA 2WP3T 3TC9A 3WFHA 1DL7H 3AROA 2B8OT 1F00I 1ORQB 1TSRA 4AVKA 4K9JA 2LV4A 2R70A 1GM8A 1NANI 1BW8A 4XXDA 3LZFH 2EEXA 3QUMH 2JIXD 1N19A 4PHXA 4DV0B 4YMPA 1WB8A 2P5WE 4TYUA 1Q6UA 4NUQA 1YI2V 1ET5A 4TUKL 4PVLA 3L2LA 3VWJD 2X4UB 4IKLA 3G6JE 4ZPTB 4WJG3 4PR5A 5TF1L 4G5ZH 4MD4A 5DLML 1RZ7H 3S5YA 2XTSA 4KNUA 1SYSB 2X1OA 1WV7T 3CV5A 4HIIA 2WHVA 3DXRB 2XPGB 3BIKB 4PJFF 4UT6A 4V1DD 5E7BA 3S8FB 3BYTA 4ZO8A 2KDYA 3TBSB 3SE8L 1QLFA 1Y0LB 4UDUB 4AE0A 3FDWA 3GJFB 4PGJA 2FGWL 3TBBA 1RKRA 3QFJA 3AT8A 1EXUA 2X6MA 3N9GH 1CXEA 1AZVA 4QGTA 3GMNA 3MCYA 4P2RA 1NEZA 4QXVA 2Q68A 4GRWE 1AP6A 4AVHA 3WI9A 1KUQA 3H1IH 3E1ZA 3QFJB 3QUZC 4MXWL 2OX5B 1CK0L 2FECI 1S2EA 1SY6A 2B20A 5IGXH 2A6KA 4JM4L 5JW5B 2NY3B 5JIIA 2Z3YA 1TNNA 2IFFH 2R2HA 3LKNB 3NR7A 5CIPA 1MPAH 5EN3A 5F3BA 4JRXD 5K1XA 1EFXD 4FEIA 1J8HE 3TNNA 3FO1B 4NRZA 2VRZA 3K2IA 1PIFA 4R4NC 4ZMTA 2O93L 1GCFA 5E8PA 1S0VA 4KTDL 3IXAA 4DZBA 1N0LA 3S37X 3P0VH 5CAYB 5CIPB 5I1AB 2W65B 3QNEA 2NN4A 3VG0H 1IBZA 5JW5A 4AIOA 1O7DE 3MLRL 5DWUH 4QJ4B 1H2NA 3QDME 5L2KA 3HKCB 3GMOB 4PI0A 3QZMA 3DMMC 3V0FA 2C9PA 5I1HH 2QQQA 4EFBA 1KTJA 3HC0A 3JV6A 1HDMA 4FQ1H 1VB9A 5F6HI 4D8PA 1EXUB 2XYCA 1RL1A 3B2EE 1BVZA 1BVLA 3BFWA 3FB7A 4MJID 2QWQB 1BM3L 2EZ0D 5CN1A