3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
2BZ7A 1I53A 3IEAA 2JXMA 4BDVA 3IN2A 1JXGA 1JXDA 5B1JC 2VSMB 5I5IA 1GR7A 1OOWA 3FQYA 2EILB 2DWTA 1OCZB 1L9OA 2I7SA 2X87A 3UADA 4A2HA 2GSMB 2GI0A 4YSRA 1W6LA 4YSQA 3S8GB 2PPDA 3G5WA 2DYSB 2FT7A 1MG3C 3DTUB 3S3BB 3NYKA 1RZPA 2HZHA 4YSEA 4KO7A 3GDCA 4BWUA 1AOZA 4YL4A 3EF4A 4BXVA 1IC0A 2PPAA 1PY0A 5D4JA 4YSOA 2AZUA 4QKTA 2R7EA 1E5YA 2EINB 2JFCA 2X88A 1T5KA 1UATA 4F2EA 1E30A 3NJFA 2TSBA 1PZAA 2PCYA 2HX9A 3WNJA 2BW4A 2DV6A 5I6PA 1RKRA 1GS6X 4HALA 8PAZA 4A2EA 4HCGA 2H5UA 4A2GA 2LLNA 4BXSV 1SF3A 1MZZA 4E9RA 2HLEB 3NSDA 3MX0B 5EHFA 3PAUA 3WKPA 3X1NA 2QPEB 2FQFA 3FPXA 1J5DA 3QJTB 1PLAA 2DWSA 2GIMA 1XB6A 3NSYA 4HAKA 4G7SB 1SHWA 2XWZA 1A3ZA 2GHZA 9PCYA 3OMNB 1AAJA 3S8FB 3V9CA 1RCYA 2CUAA 4UAHA 4WKXA 2XU9A 1GYCA 3L45A 3H4FA 1OCRB 3IE9A 1MG2C 2VMJA 1NIAA 2GB2A 2HX8A 4AKQA 3CVCA 1AZBA 2VM4A 4G72B 1KCBA 5I6MA 1EZLA 1OCCB 1JVOA 2HXAA 2J55A 3T6ZA 4M3HA 1ZIAA 2IDTA 3C75A 4F7KA 2WO3B 2BHFA 3IBOA 2OJ1A 4FAAB 3QJUB 2GC4C 3EHBB 2JKWA 4TXVB 1SJMA 4G70B 2WSDA 1MZYA 3KW7A 5AZUA 4G7QB 1JZFA 3AZUA 4A67A 3OM3B 1GY1A 4DP4X 4CSZA 3FS9A 4AKOA 3ZBMA 3X1BA 1OE2A 4JHVA 5B1BB 5D4HA 5I6KA 1BYPA 4PCYA 2EIMB 2YARA 1URIA 1N70A 2XX1A 1AANA 1NIBA 2P80D 5B1KA 4AKPA 1QNIA 5FC9A 3ABLB 2Y1AA 1TU2A 1ILUA 4PAZA 2RACA 3ZDWA 1PZBA 2GC7C 3BQVA 2PP7A 5B1AB 4G7RB 1PAZA 2PP9A 4HZ1A 1YLBB 4GP8B 3JT2A 3V9EA 1SHXA 3H4HA 1J9SA 2OCCB 2TSAA 3SBQA 3CVBA 3NT0A 2UX7A 3NJJA 4E9SA 3PPSA 4KO5A 1AS7A 1A4BA 4E9TA 3CG8A 1ID2A 2XUWA 1X9RA 2CAKA 1F56A 5TK2A 2DYRB 5PAZA 1WAEA 1ZIBA 1AG6A 2MTAA 3WNIA 1NWOA 1AR1B 1A4AA 1PZCA 3N55A 2QDWA 3PAZA 1HAUA 3SQRA 1NPJA 1AZRA 1BAWA 3FYEB 2YAQA 3ZIYA 1CC3A 2I85A 3S3DB 4A2FA 5B7EA 2AVFA 4Q89A 2HX7A 2YAEA 2W8CA 3FPYA 1NWPA 4KNUA 2J5WA 3MBWB 1L9TA 4JHUA 3AG1B 1A65A 4CSPA 4YSAA 3NSCA 1NINA 3HEIB 5AKRA 4E9VA 2XX0A 2XLLA 3GYRA 2I7OA 3ASNB 2A3TA 3AG4B 3OD3A 3QQXA 3UAAA 4DP0X 2J57A 3T6XA 3H56A 1IBYA 1OE1A 1CURA 1ET5A 4JKNA 1ADWA 1JZEA 1J9QA 2IAAC 1WS8A 1OE3A 4MFHA 3EH4B 1NTDA 1A4CA 2IDFA 3GXUB 1FWXA 1L9RA 1AG0A 2VW7A 4HHGA 1AS8A 1AIZA 3X1GA 1BXVA 4UF7C 2CJ3A 4YSTA 3JTBA 2QDVA 2BWDA 3UACA 2UXGA 2CBPA 4EF3A 2OV0A 1QLEB 3FU7A 3OQRA 7PCYA 4WTQA 3AG2B 2IH8A 3X1EA 1N68A 2YAOA 4HHWA 2YQBA 5B7FA 2YEVB 4KO6A 4KNTA 1OF0A 3T6WA 2XXGA 1FA4A 1ASQA 1HFUA 1SDDA 2XVBA 4GXFA 5B1JA 2FT6A 5A7EA 2PPFA 1WS7A 1ASPA 1SFHA 2PPCA 1DZ0A 1PF3A 3T71A 7PAZA 2UX6A 1BQ5A 4BK5C 2Y69B 4A2DA 1JVLA 1NICA 2ZXWB 2FNWA 1KYAA 3TBBA 3ASOB 1M56B 2FQGA 6PAZA 2ZWNA 2Q5BA 3FQ2A 1NZRA 1DYZA 3FU7B 1FFTB 2NRDA 3EH3B 4YVNA 5B7MA 4NB7A 6PCYA 2UXFA 1AZCA 4E9YA 1BEXA 1KGYE 3NJHA 2CALA 1JZJA 2BP0B 3NSFA 1PCSA 2ZOOA 4X4KA 3OMIB 3NJNA 2FWLB 3D12B 4L0PB 4GP4B 4P5SA 1V10A 4YSDA 1MDAA 1SDDB 4NERA 1GS7A 1V54B 3N2JA 2PCFA 1XMEB 4FA7B 4HCFA 1ET8A 2YAMA 2QT6A 1BYOA 1JOIA 3NJGA 1WA2X 3FT0A 1IBZA 3SBPA 1B3IA 1W6WA 2FQEA 4RH4A 1RZQA 2PPEA 1J9RA 2CCWA 3NJLA 1CYWA 2FQDA 2UXVA 1GW0A 2W88A 5F7AA 3TA4D 2EIJB 3IN0A 2YAHA 2VW4A 3CDZB 4E9XA 1GY2A 1E5ZA 4GP5B 2VN3A 1L9PA 2IH9A 3S3CB 1BQRA 2HRGA 1KV7A 1L9SA 2UXTA 2VW6A 5D4IA 1ZPUA 3HB3B 1KDJA 2B3IA 3FYIB 3FSZA 4BWWA 5IY5B 4DP2X 4YSSA 4YSPA 1ILSA 1VLXA 5ANHA 3KW8A 4N8UA 3T9WA 3ABMB 1JZIA 3AW5A 4DP5X 4W1TA 5AFAA 4DP6X 1L9QA 3X1FA 1AACA 2HRHA 1J9TA 1TKWA 4E9WA 4AX3A 2Q9OA 4DPCX 3NJMA 2B08A 1HAWA 3WKQA 2IDSA 1GS8A 2QPDB 3T6VA 1NIDA 3UAEA 2J56A 2XV2A 1JZHA 1PNCA 1PMYA 1A8ZA 1SNRA 1TEGA 1PLBA 2AANA 4GYBA 4BDVB 5I6OA 3FU8A 2IWEA 3QPKA 3RYMA 4F2FA 1W8EA 1M57B 5F7BA 3PAVA 5I6LA 4KOBA 3FSWA 4Q8BA 1NIEA 2N0MA 5PCYA 1KCWA 3QJRB 5LDUA 2VSKB 3WG7B 2BZCA 2IWFA 2BW5A 2H3XC 2IDQA 3AG3B 2BP8A 1R1CA 4KNSA 2DY2A 4KO9A 2E86A 2XV0A 1SF5A 2XV3A 1AQ8A 2ZONA 4NAJA 4DP1X 1M9WA 4N4YB 3QJSB 2BO0A 2AFNA 1BXUA 2YAFA 3X2QB 3QJQB 3TU6A 3U25A 4UANA 1OCOB 3CZUB 4DPBX 4YSUA 2R7EB 2FTAA 2WO2B 2YAPA 4W9ZA 1ZV2A 2BP0A 4BWTA 4ZK8A 3UGEA 3WIAA 1SFDA 4K9JA 4AZUA 5I5JA 4M4RB 1WA0X 2XXFA 4A68A 3FQ1A 2FJSA 3SBRA 1J5CA 1ZDSA 1TEFA 1EHKB 5I5MA 3DKHA 2IDUA 5I28A 1GSKA 3AY2A 5I26A 1ET7A 2PP8A 1ZDQA 3QJVB 4AI7A 1JXFA 1NPNA 2BP8B 1NIFA 2VM3A 2YXWA 4DP9X 3CVDA 3WI9A 3NP4A 2FT8A 4A66A 2EIKB 1BXAA 1CUOA 4YVUA 4DP8X 3NJIA 3ERXA 5TK4A 1ASOA 4E9QA 1KDIA 3CDZA 3ABKB 1AZNA 1BQKA 1E65A 5E9NA 3PXLA 3FSAA 4KOCA 4HIPA 3FU9A 5B3SB 4DPAX 3ZX1A 1CYXA 3FSVA 1IKOP 1IUZA 3BVDB 4QLWA 3OMAB 1KBWA 3NP3A 2PLTA 4YSCA 4P5RA 2IWKA 1PLCA 5I6NA 4GY4A 2MRYA 2BWIA 2XYBA 3UABA 1NDTA 1AZUA 1XB8A 1PNDA 2AZAA 1QHQA 3TASA 3TBCA 2YXVA 1AS6A 3PCYA 3EH5B 2GBAA 2P80A 1KBVA 1JZGA 1JERA 3DIVA 1WA1X 4HCIA 1E67A 1V55B 1ETJA 1OV8A 3ABGA 4ENZA 1X9UA 4G71B 2H47C 3NJKA 1XB3A 4DP7X 3PLYA
chains in the Genus database with same CATH superfamily
1VQ7V 1UQSA 1A1NA 3L54A 3QG7H 4F15B 5HHOA 1BZOA 2X5PA 1H3VA 2RH0A 4JFDD 2UZIH 1KKDA 1F3JA 5L3BA 3B7YA 2ODIA 3VFPB 4MVOA 1R3KC 2Y2WA 4YSRA 4GYCB 4UNVA 5F9WC 1DE4B 3ZE1E 4UB0H 4AQAB 3MDJA 3O6FA 2NR6A 3RVYA 1TTCA 3TBTA 1IILE 4N0CC 1CGYA 3C2AH 2WN2A 3GXTA 3BC9A 2C9AA 1KLGA 2ADYA 4X6DA 1LVEA 4LPTA 1KYOJ 1TU2B 1IBKO 1ZVNA 1Y76B 2XXMB 3KL0A 5CILL 4N5ED 1A3RH 1E5YA 3ZZ1A 1H9VA 4R7NA 1FL5B 3D0LB 4X6FA 4AYEC 5AAPA 4CVZB 1VEWA 4NVPA 2VDOH 4ZMYA 2CGNA 3HC2A 4S11A 5DJDB 3M1OA 2ERJC 3QZLA 3KPTA 5AVXB 4JQVA 4FLQA 4HBCH 2ZE0A 4GSDH 3TF4A 2K7QA 4BFIB 2XG5A 2CHXA 1LEKA 5KAQG 3TXQA 1HOCB 4FL4B 4PJGA 1IT9H 4DFIA 1KXTA 3BP4B 1IGJA 1KEMH 4KMLB 3RP1A 3NK4A 3S35L 3C90A 4PWJA 1QATA 3MV9D 2A4EA 1A9BB 3PAUA 5E6IB 6FABH 5CN3A 4G7SB 1ZGLB 4DW1A 1ULVA 3ZN0A 1AYRA 1ZS8B 5ICXA 9PCYA 3OMNB 1S7TB 3S8FB 4JI1B 1JJ2U 1QNZL 3U0WH 4AUJA 3L45A 5D96C 3BSZL 2LU7A 3VXPB 4ZFOA 1TT6A 3NCYP 2GTZA 3ILDA 3LNHA 2HT2D 1I8MB 3MXWL 3A0RA 3L9RA 1RK1B 1PG7X 1REIA 4OTXL 4G9FB 4FA8A 3FUHA 1CE1H 4JF3A 1BJ1H 1SOSA 2IANA 3F7LA 1Y74B 4JVUA 2JCCF 4NM8H 3X3GH 1E9OA 1UXLA 32C2B 1XF2A 3V5HA 3VFOA 1NFAA 1ZIAA 2EADA 4M5ZH 4OLUH 3MNVB 4PRPD 2JLLA 4XNQB 5DJCB 12E8H 3QJUB 3ILPB 1VMGA 2OI9C 3FO9A 4HETA 1G6RL 4W68A 4QJ4B 2GJZB 4PJAF 1U8JA 3MUGA 3B2EE 4X5XB 2GW5A 2ZKHL 5JR1L 4TXVB 3I85A 5J13B 2QWNB 1EEZB 1Q0YL 3ZYOA 4PGDA 3H2WA 5JHDE 2VQFB 1MPAL 1JZFA 1LEIA 2GI7A 4R4BB 3T1HO 1AKJB 3K72A 4J3OD 4OCYH 5J9PC 3PREA 4DERA 1KB5B 5SX4I 4L5FE 4NHCH 1WFNA 1UFUA 4B9YA 1KCUH 2A6IA 4FQ2L 4CRPA 2YLHA 2LU5A 3WUWG 5I6KA 5IWAB 5AW8B 5SWZB 2QV2A 3VFRA 2BNRA 2Y69C 1CL7L 4XC1L 1ZLSH 4H8PA 1GAFL 4N90E 1T22B 4UT6H 1AANA 5LXTA 3TZVB 2IFFL 4O2CA 2X6MA 3PNRB 4UAOB 1MI5A 1WZLA 4TUJB 1IGFL 1I7TB 3TJHD 1NC2B 2WQXA 4H0IA 3RNQB 1D5ZB 1P7QA 2P5ED 2C9SA 1S7RB 2RACA 2YI9A 2Q7AA 1F02I 2B5IC 5KX5A 3AXIA 3QNYA 2BHYA 2ZX9A 4GSXA 4M8VA 5EMYA 5IFJA 2XN9D 1U8PB 4G28B 2DEXX 3L3HB 5JORB 3DX7B 3V5KB 1T03H 2VZ3A 2ADJA 5DN6G 3CCSV 3ARRA 3H4HA 4HS3A 4OT1H 1XMQB 2R2BB 5CLYA 4L8CA 1J9SA 5CGYD 4LSSL 1NAMB 2NY6B 5DZPA 3N9GH 2NYYC 3PQYB 4MD0B 2ZUTA 4AM0Q 4DR4B 2WWMC 1DQIA 2XY2A 4KO5A 3RYFB 4MCZB 5EO9B 2H45A 2EBOA 2ZCKH 1G4YB 1NBVL 2CKNA 3ARBA 4NQXB 1TCRA 1H6FA 2DIAA 3QFGA 4G11A 2JEXA 2VLRE 5DMJB 4WJKB 2WC7A 2DLFH 3T3MF 1A6WL 2K0RA 2CRIA 4JDEB 4GBXA 1WEJL 3PPEA 1H0DA 1ETA1 1CT8A 1ZIBA 1TUPA 1I0HA 1QI3A 1N4XL 4NQEE 5DGQA 5JOFA 4JHWH 3WIIH 3VM5A 1RM1C 1YN7B 1ZVYA 1BQUA 4ZBJA 1HAUA 3UBXA 3ZT7A 5ACZB 2FX8L 1A6ZB 4PA7A 2RA1A 3RVVD 5HPOA 4G80A 4PJCA 3K6IA 4ZFZA 3UJJH 3FC8A 3UT5A 2YAQA 3RIFK 2Z31D 4OGQB 4OQTL 2Y48A 4QRPB 3ULUH 3O6LL 4PRNB 5D72L 5IJVB 3TCUA 4R9HA 2IBZX 2YEZB 3KVPA 5FYLE 5D8JL 3W56A 2W8CA 4ALAL 4AVJA 1LK3H 3MUHL 3QHTC 4JM2C 5GGTH 5JPMB 1ZWIC 5CGBA 5FKPB 2B8OT 1MY5A 3S37H 5D5PA 4XBPA 4PJ9D 5JHLH 3RNKB 1NAKL 1R3HB 1XSJA 3Q8CA 3WFDL 1KC8W 3W3BA 4JV5B 5K9KA 3K5OA 4N1EA 1FZMB 3JD0A 1KJ2B 2RTTA 3RWDB 4ERSH 1FQ9C 3L9DA 1SQVH 4GLRI 1KYFA 1PU0A 1XTLA 3ZYIA 5CEXB 2DQFA 5D2LE 4F7CB 3MOBH 4J39A 2ZUSA 4PJ5D 2Q69A 2Q5ZA 4BSWA 2X4NA 1TVHA 2QKAA 2ZOLA 3VB9A 1JWUB 2H32B 4JFEE 1U8HB 3C08H 3VG9C 3WFVA 2IGFH 1J8SA 3SDAA 2CJUL 1AS8A 1AOHA 1RPRA 2ZM6O 2OMVA 4Z9KB 3RJOA 3UZEA 5E9AA 5BQ7A 2WZAA 1SETA 5FO9A 4H88L 2E5LB 5AW7B 5DJ0A 4DV5B 2CDGA 2WMPB 4G3YH 1YYMH 1CLYL 5CP3A 4NKDA 5CWSB 5EORH 5LOVB 1OB0A 1GL4B 4GI9A 2VIRA 4LF6B 4YR6A 4M43H 1ZTMA 4P06A 3K59A 1CDYA 4YE4H 1YVWA 1T66D 1J0ZA 3S7GA 3WS3B 3ZMEA 1JWMB 4Q6YA 2AS5M 4KRPD 3ZGIA 5DLML 4PJIE 1MRDL 4YHNB 4XC3L 4LZKA 5DC0A 3W2DH 2AXFB 5EOCH 4OV6F 3BQUC 4WTWA 5F71A 3X2QC 1QFWH 3QISA 1DVFB 1LO2L 3EYFB 3KXFA 1BMGA 5TE7L 4P23B 3VXMB 4RFEA 2X0UA 3OKNB 4DR1B 4KI5F 5CSZB 3KYKL 2K7PA 3IJ4A 3VWKC 4E41B 4F91B 5FUZH 1MHHB 3CXFA 4FXKB 3KPMB 4JDVB 4PRIB 4EN3B 5LGNA 1YDPA 5CBHA 3OVUB 3RDTA 2OS7A 1YTFB 4NO5A 4UOW0 3IGAB 3MBXL 4WI6A 4AH2B 4MASA 4NNXB 1EZVH 1K5QA 1SLUA 1CS6A 3FU7B 4IRJC 4KK8C 5F1KC 4QRRB 3NOIA 1SOQA 2AV7B 4Q0XH 2IH3A 3CSFA 4HS8L 4ZI8A 2MPAL 4ZO6A 3RZCC 3VYPA 1HK6A 4OIBA 4K35A 3GRBA 3OFNG 2H0EA 2IGTA 1LWJA 2XFGB 3OMIB 3DDFA 3NZ8A 5F96H 3SKUD 2Y23A 4LRNH 2Y9RT 4N2DA 2P06A 1XF1A 1KELL 1SN5A 1V54B 3RWHA 4R0LA 1I1AC 2DWEB 2DJ4A 3G80A 2J8HA 3O81A 4GIPD 4K3HA 1PLGL 3NIGB 1ZHKA 1T1YA 3TNMA 5HFMA 3FT2A 1QQCA 5FKAB 2C9UA 1FZJB 1D5IH 1O5PA 2Z92B 1PZDA 5CUSH 5HDQH 4LPCA 3SBPA 3L5WB 2QMKA 1BG1A 1JI2A 5AWNH 5E6ID 3QPXL 3I3BA 3DX9B 4JE0A 1KCSL 2OR9L 2FNBA 3MA7B 3N43F 3E89A 3ZMRA 2R70A 3NAAL 4XBEL 5CSBA 4G1EA 2X40A 3U6XA 1G9ML 4DGVH 3DBXB 3MNMA 3APNA 3O6ML 3NIDB 3KE0A 3GNML 3K6SB 3B8SA 2UU9B 4Y5VB 4F8OA 2VLKB 2FBOJ 1W0WB 3QEHA 4NB5A 1IKNC 4GX2A 1O7DE 2H2SC 2M26A 4G9FD 4YSPA 1ZXQA 4YY3O 2A83B 4AQZA 5GISL 5GGUB 5IQ9A 4Q6KA 2E0PA 4H7VA 3OF6A 4LCWA 1GZQB 1S7UB 2ZOKB 1OPGH 2O6CA 5L9DH 5GSVA 3VD9A 3Q43A 4AX3A 1OV9A 3FAXA 5LCVH 3QQ4B 3C5JB 4E2LA 1CXKA 4NIKB 5LBSA 2IVFC 1U92B 1OWRM 1XF3B 1YA5A 5H37H 1PKOA 3OUSA 5C08A 1BVNT 4JHBA 4OKDA 3QIBB 5ADPL 1MEXH 3UXFA 3CC7V 1XDCA 3VXUA 1Y1DA 1SQXH 3BWUC 1X4YA 3MLSL 4HZAA 5CJQH 2WWNA 5ESVB 5BUPA 1AKJD 1M57B 3F7VB 1TLKA 4ZW5A 5IESL 5IW6B 2VABA 2W91A 1GHFH 3CVIH 2DQUL 4NYLA 4FN0A 4K3DL 4FERA 1YO4A 1U3HA 4YGAB 1NCCH 5KWYC 1JZ8A 3T2NH 4JFPA 4O5LH 5SWZD 1QUNA 2EX3A 4PM1A 5HGBA 2XN1A 5MERB 5EIBD 3AREA 2DQEH 3FT3A 4IKLA 1HJCA 5E9DA 3TZVD 4OF0A 4Q9CA 4WO4A 2JKRM 3DGGB 4HJ0C 3B2XA 2AFNA 3FL7A 2WLHA 2WSSG 3QJQB 3U25A 5JYLA 4A04A 1NC2D 3K8MA 3ISYA 4GT7A 4WBNB 1ORQC 3H7BB 4K9JA 4YNYA 1CLCA 5EIIA 2ICEB 3VW3H 3CZNA 4PA3A 3D3VA 3GRGA 2A74B 3U30C 1KZYA 1HQ4B 2XNDG 1CG9B 3WFCL 3SBRA 2Q0OC 5KW9L 5EN3A 5IP4A 1FL6B 1A4JB 1EHKB 1OCRC 3PQYD 4WI5A 2UWEB 5H94A 4XMTA 3P3RA 4NJAH 5KSBA 1GGBH 4UU9B 1WCBA 3S9DB 4PLJD 3EDJA 5ITBL 1NPNA 2JF1A 1FG2B 2FX7L 2VM3A 3EW3B 4X42A 2KKQA 1R33A 1DLFL 3RHWF 4XVTL 2JCCA 3TURA 4B3RB 3LXBA 3QO0B 4CJ0A 3HKBA 2CTPA 4W9LC 3EFOB 4LNUA 4Z7AA 1ASOA 3QNZB 1K3IA 1T4KB 1NCWL 1M7DA 3OUFA 5K59F 3ABKB 1JV2A 1RFDL 2PUQT 1RSOA 3FSAA 4XVUD 5FDWA 1BEYH 3GJEB 1QW8A 4QRPD 3RYHA 4HUCA 4J23A 4Y8DC 4YWGH 4KHTH 5IYCO 3LKSA 4H5SA 4MCYA 1KBWA 4PRDA 4DKTA 4RAUA 2PLTA 1N7ML 4BH8B 1J1XH 4IBLT 3LX9A 4JR9L 4UQBA 5L8KB 4GY4A 3FT4B 5AW3B 2ZYIA 2AXHA 5CD3A 1AO7E 3K1DA 2KZKA 3TBCA 4GW4A 2AV1B 4DV4O 1NOLA 4PDMA 3F05A 3VRJA 3GEFA 3EBIA 3PJSK 4WI9A 2YC1B 4A63A 2BDNL 3ULUE 4J3TA 3CB2A 1RZFH 3HZKA 4ODHL 4AEIL 4OJYA 4CADB 3MCG1 4DP7X 2A9MH 1XF4B 1I75A 2BZ7A 4CNIA 3IN2A 4WU7A 5LP6B 5B1JC 4LSVL 4MA7L 2VSMB 3VGHA 1LYQA 2E9BA 4LU5L 2X87A 2DQIL 4ABWA 1F1GA 4FI7A 4WFHA 4H26B 4I9WE 5FM8A 2GHWB 1OP9A 1Y4MA 1RZIB 3KPQA 5TF1H 4HCRH 4R83A 3Q2WA 1ZV9A 3BX7C 4F92B 3JAKB 3SPIA 4X0KA 5GS1C 4GAGH 3ZR5A 4OFDA 4PG2C 3RYCB 1MG1A 5DA4A 3S2AA 4QHUA 4BWUA 3KMDA 1NCUA 1T3FA 1CD0A 3A6CH 3K3QA 1I7FA 3CRCA 3PF2A 4M7ZC 4R26L 1OD7A 4JI8B 2CNZA 3GSVB 5CD5D 3V5DB 3INUL 4S2SA 4I0PD 4Y4HA 1FZKB 2I25N 1DVFD 4RGNC 1UQSB 2XQBH 4OVUA 4K7PH 4P23D 5LA6B 2SEBB 2XCMC 3JTSB 4WTXA 3VXMD 3WNJA 2DV6A 1NC4B 2WVSA 1Q4NX 4PRID 4EN3D 2BOCB 1SF3A 3SE6A 3K79A 4WUUE 1YTFD 4AQYB 1J0KA 1NGXA 3TEYA 3IMBA 3GJFB 4P5TA 3QXDA 2M6YA 3K04A 4RMUA 3TBTB 3IDXH 3M8OL 5JQ6L 4QRRD 3MRIB 4FTVA 1M90W 3QR0A 2VDRL 4U1KA 4NEHB 4JI5B 2JK5C 4X6DB 1BSMA 4X6CA 2W0LA 2AW9A 4XN8A 1SHWA 4HPOH 1VQ5V 2XWZA 3H7LA 5HVHB 4JNXA 4XAKE 3QDMD 5BS0B 4KTEL 2VC2H 4FNPA 3WFBH 4KTDL 3VRIB 1CLZH 3I55V 1RIUL 5J06A 5D1XC 5I17B 2G2NA 2FEJA 2ZWZA 3IAQA 4BQBA 2GB2A 2ZJSH 4M5YL 1NFKA 4XP4H 3MRPB 5JCOA 2XG5B 3HJEA 4U6HA 2G3NA 4K2UL 4PJGB 4LHJB 5ID1A 1K3EA 1IC7L 2YN5A 4N2AA 5BZBA 1ACYL 1HKLL 2XJKA 4ZQKB 3RLSA 5C9JA 2X4QA 2K9PA 4NI3A 1PPJH 2IDTA 3KD4A 3D85A 1F42A 5GGSB 1P5UA 4FX5A 2BOBA 3GSNL 4HK3N 4NUQA 4EB6B 2CXGA 3G6AA 3QDGB 5DD5H 4DW2L 2BCMA 2GC4C 3BPZA 1TNNA 1MCFA 2Y1VA 2ZUWA 3ZJAA 2CE4A 2WQRA 3QDJB 3ZDZE 4L3EE 1UPGA 3C60B 4WI4A 3TN0B 4ZFOB 1FF5A 4FQXB 2GTZB 2MPVA 1NFIA 3LZNA 1XGUA 2YPLA 3SDDB 4L1LA 2BM3A 4MCMA 2KLTA 2JB5H 3U9PL 3K71A 3BYTA 5HHVH 3S6CA 3P77A 4Z3GA 3Q9PA 1ZGLM 1E9OB 4X1YB 2HMIC 1NCAL 1XF2B 3KR3H 2BHUA 4C56A 1VACA 5FUOH 2ZZUT 5HYSG 4FQCL 1P4BL 4G8FB 1XNRB 4RO2A 5B1KA 1HSBA 4KKAC 3QQ9C 4HU8A 2AJYL 3ABLB 3FO9B 2P5WB 4YHPA 5J6SA 4IOFD 2NDGA 4JI7O 2R0KH 3KM1A 3OAYH 4JKKA 2ZCLL 5CJOH 3QIBD 5B1AB 1JI1A 2GK2A 4PGDB 4FFZL 3RHWK 1A7RH 1JV5A 5LGKA 2X4OB 4BQ8A 4XZUB 2Z7ZA 4ZMAT 4U3CA 5EBMB 4Y1AA 3U0PA 3NJJA 5EDSA 1UD8A 2NY0D 5EU4A 2QR4A 3VFRB 3HZYA 2E7MA 3C5SB 2C4FU 4XNUH 1N5AA 3G04A 3BESR 5ITZA 1RZKC 2J73A 4NN6C 3HRZB 4BFOA 1OAKH 2ZSVB 3ATBA 4O2CB 2CTQA 4OX9B 4BSJA 4MZIA 1MI5B 2NY5C 3KPRD 2YXLA 4N0YL 1GN2A 4JG1H 3DMMC 4C58B 3VGBA 3GSUA 5CLXA 2WLYA 1HILB 3CUPA 1UKSA 4MJ4A 3NVQA 4OGYL 1IEAA 2VXTH 2ZNIA 1R47A 3TBVA 3N2KA 2LFEA 4KH2A 4XAWH 4P9MH 4L8CB 1JPTH 2LT9A 4XI5C 1IL1A 1G7LB 1WE5A 2JV6A 5L8JB 2NY7H 1CFTA 3T0EA 2BNQB 1OLLA 4ODBD 4HLEA 3ARBB 2ZUQB 2EDYA 1NBQA 2QTOA 4K3JH 2R2EA 3HKDB 3S5LB 4TPRH 1UJ3A 1CFNB 3QUXB 2YOAA 4GBXB 3OD3A 3QRBA 3K58A 1CT8B 5EBLC 1M1XA 2IH1A 3UYOD 5JOFB 2IG2L 5AOZA 4GUOA 1FNHA 1CLOH 3AQZA 3NXSA 3PWUA 3FO1A 2IAAC 3QBTB 1U8NB 2HFEA 3H9SB 3RURA 3UBXB 1CK0L 1MLCA 2IDFA 1S5IL 4PJCB 4ZFZB 1JWSB 3KYAA 2YQGA 3BT2H 4X0NA 1FWXA 4K73A 1HEZA 2HJKA 4IJ3C 3BAKA 4KDTA 5EIQA 1U3JA 3G7TA 4O4JA 2WXPA 1DJXA 4KUZH 1A9VA 4PB0L 2PXYD 3LN9A 4W9HC 3QUGA 1QPXA 3MCLL 2J7LA 3RYIA 2XYCA 4G59C 1BLNB 4WEBH 3LDDA 2HA1A 5K9KB 3VBBA 1II4E 2OCJA 3I9AA 4P2OB 5EIVA 4NTXA 1I85A 1A5FH 4NQDE 4R2GC 5KOMC 1NLBH 4P9PA 2G75A 2YEVB 1TIUA 1XQ8A 2WYZA 3SODB 3OXRB 5DDHB 2X4NB 4BSWB 1WWAX 4X65B 4FXGA 2YSSA 4O2BB 1FJGO 1Y6KR 1V7ML 2EDLA 2EE6A 2AJSL 3C6LC 3GMPA 4ZJ9A 3WLBA 5B39A 5A7EA 3OKLA 3MCYA 4L1HA 4UQEA 4O4IB 4RWHA 2RNBA 1YEFH 3BPCB 3GMQB 2PPCA 3SDAB 3QORC 1TUBA 4Q6IA 1HWHB 2FGWL 5K69A 4UQ3B 1H2NA 2WINA 2PTTA 4X9YA 3ULVL 3EZJB 5F1IA 4LAQH 4D9LH 2CMRL 2FIRT 2CDGB 2OL3A 3TM6A 2ORBL 3IMTA 4KTYA 1ORSA 5GQBA 2VYRE 2DN7A 2VIRB 3GSWA 4TUYA 4M5TA 1K4CA 3CSGA 2ZF9A 2KZ1B 1NR1A 5TFSL 3VI3E 2QQKL 3U83A 2V17H 3RTQA 3GIVA 3HNVL 1JNNL 1A0QL 3ECVA 3P1VA 4HT1L 5IMLB 3AXHA 2HLDG 1VQLV 3T0WA 3KXFB 3PWLA 2P8PA 4WFFD 4N8CL 3QZWG 3GXIA 4YHOH 1IXBA 1Q0XL 2I60L 4ZS7H 5FIEA 5C0BE 3VH8G 4B9GA 1JUFA 3R65A 3SBWC 3VXTA 2XDHA 1URFA 4JPVH 1X4XA 1NC4D 2CHNA 4LSUH 3BFOA 2P5OA 1S7VA 3G6DL 1QO3B 3QARA 4UMSA 3RDTB 5GS0H 1AGFA 2XICA 4NKGB 3OKKA 1WAAF 5A16A 1AI6A 3S3WA 1SEBB 5C09E 3DXAE 2IU0A 4TLSA 2W38A 3TV3H 1J8HE 3QR1A 1AQDB 3TA3A 4APQC 2OZ4L 2OTJV 3O6KH 5FYKH 3FOLB 5DSCB 4M9OA 1W59A 1DUZA 5CMUA 5GPRA 4EVNA 2OK0L 1L3WA 2W0FB 5EULV 1NGZA 3TBSA 3WEMA 4DKDC 4JFTA 2DJUA 3OGCC 2CHZA 4J6IA 1HL9A 1XILA 5EUKB 3L75H 5BS0D 1COWG 2DQCH 2DIBA 5ENWB 2YMTA 4A6YL 4WFGA 3H54A 1UT9A 4DR7O 4S1SL 2XNAA 3KLLA 5D70H 5K1JA 4LP5A 2ZE8A 1VADA 1ZHKB 4IGBC 3MI6A 3AT8A 5A9GA 3T9WA 2A6JB 4O9HH 3WB1A 4U0QB 3QCTL 5E1AC 4BZ2H 2A4CA 2EE0A 1Q9KA 3D3QA 4MJ5A 1CN4A 2EZ0C 4H1LH 4KKLD 4HWBA 2ODHA 1AACA 4HMCA 5EWIL 1I3GL 5HTSA 2FO8A 4IU3A 1YYLH 3VE0B 3DX6A 3PP4H 3QDGD 3GB7C 2J71A 2H1PH 4AMKL 4NXNB 2UZYB 4S1RL 4BFJA 2DD8H 1OCWL 3FAVA 4GIOA 4EPSA 4G1EB 1LUWA 2PI4A 1TSHA 2VL4A 5I1IL 2F68X 4OZ4A 1PLBA 3ARDA 3QDJD 4A2LA 3W7XA 3CP1A 5EZYB 1MCJA 4K0KO 1X5LA 3C60D 4GEJA 4XNXL 3TN0D 3GSNB 3LKOB 1TA8A 4LF4B 2ESVE 5ABDE 5FL7G 3CVHA 4FQXD 3A0HZ 2AEQH 1XR8B 2VDKH 1KCRL 5F7BA 1KJVA 1DANU 3QEHB 2NSXA 5E2TH 3SDDD 3OC8A 2ZKOA 2PY5A 1KB3A 5JIDA 3LRMA 1W72H 1MREH 3HMWL 3DYMA 4WCYH 4LCWB 1E2ZA 4JKMA 3QXVA 2FL5B 1ZJAA 1JDCA 1IO4C 5EBWB 4EI5C 3QB7C 3FU0A 2IALA 4LOVA 1AQ8A 1B4TA 2CUIA 1VQ8V 4MXVE 4AMXA 4LRIC 3SPGA 2Y6TE 2DEWX 4BCYA 2WCSA 2P5WD 3JV4B 1OP4A 3T0AA 3CYOA 3HKEA 3L08A 3HNTH 1DVSA 3F65A 2R4SH 4LF9O 4GQPH 3TFKD 5A2JH 2D7TL 3BGAA 3G6JE 3ENEA 4KX8A 5MEQA 4L18A 3ILQD 3L72H 4LEBA 2X7LA 2Y36H 3HI5H 3ALWA 2IANE 4NYLB 2GTSA 5BMVA 4F8TA 1JCKA 3ZMUA 3VFSA 4GX0A 5KA5A 1NPUA 4UUJA 4U3XA 1U3HB 1PM9A 3LB6C 4FG6D 1IGTB 4F4LA 1BL8A 1QBLL 1AHWC 1M1SA 4JFPB 3PHSA 1QUNB 3BAEH 3IKCB 4MNGE 1F3RB 1PD0A 2Y07H 3HE7B 3AREB 3B5HA 1YPZA 1V7NL 2ZCEA 1VZIA 2FT8A 4WO4B 2EIKB 3JWDH 4D7BA 3PE9A 2Q68A 1UACL 4DP8X 1YITV 1RMFL 2YMXL 4CS3A 2D4DA 4J4PC 5I18H 1I7RA 2CUHA 1AJQA 7FABL 3PGCA 1JGVH 4HXBL 5E9NA 2JGDA 2R83A 3RGVD 4DOHB 4HWZB 3QS2A 2EIZB 5ISZA 3O3EA 2YPVL 3FSVA 5FFGA 4XP5H 4DETA 3HG1E 4XN1A 1JHKH 3OB0K 4N2CA 4P5RA 2BNQD 3LS5H 5KSBB 1SOKA 4H8QA 5ILTH 1LR1A 1HHIA 4AYDC 2EIDA 4UTBH 4K94L 5AB1A 3N27A 3RQ3A 1MRFH 3QUXD 2GCYB 5FM5O 2EIMC 2A9BA 2JCCB 1C8QA 3RB7A 3OAZK 3HKBB 4XMUA 2VDPH 5IB3B 1S78D 4ETQB 4AGOA 4ZNCD 5C0NC 2EDNA 3H9SD 2VSDA 3P2BA 7CGTA 3B4NA 1UH3A 3D5OF 3PLYA 1RSOB 5FDWB 4PJAB 3L3OA 1V8HA 3WFZA 2JQMA 4RWYL 4I1RA 5L2KE 3LKSB 4TQ8A 4GLRH 1RJYB 3JAWA 4PRDB 4Y4FA 4F7MA 5DRXA 3WNLA 3DO7A 4G1MB 4E0RA 4A2HA 2WOYA 4AJVA 2PPDA 2CDEA 2Z4QA 3KPPA 3CHSA 2FT7A 2B39A 2OMZA 3A23A 4MJIE 5SWQB 4LNVA 3MUZ1 3ZL4H 3DUSA 1M1KW 3O4LE 5FWRA 1DL7H 5E8OA 2HZHA 1J0IA 3IU3A 4P2OD 4MB4A 2Q7HA 3BN3B 4O2FB 5FO7A 2CH7A 2YUXA 4KK5C 3BI9X 2VZSA 4KVPA 4YSOA 3CCRV 2VWEE 1S4IA 4NPJA 4W4KA 3HZKB 1I8IB 3ROOA 2ZUXA 3IS1X 3L16A 5H5NA 2TSBA 3TVMC 3US9A 3DIFA 3B7TA 3SDAD 4PCSA 4GLXA 4KPHH 3MRDA 5I6PA 5M95B 4P3DA 1NUDA 3ZN1A 5IEKB 3Q2CA 1G9NC 3R8BB 3DV6B 4M7KH 5CLTA 3J80N 3J2PA 1NFDA 4IBWA 3PN1A 3NCJL 5EPMA 1ACCA 4DV6B 2LTQB 3MUY1 4XN2A 3WS6C 4UBDC 3SE9L 4JFZL 1R0AH 1E2WA 3T4AC 3ASNC 3DX0A 1QSFA 2Z0UA 2LFRA 1ERNA 4PGBA 3T3MB 2H9GB 4YFLI 1JNLL 4ZSOE 2P48B 2ATKB 1DBAL 4HIHB 3WEBA 1EZUA 2WAQA 3F04A 5F7LB 3Q7JA 1DCEA 4MYWB 3KXFD 1IVLA 1ZLWH 4IS6B 5C07A 4ETYA 5L8LB 5E4AA 1DP0A 4DEWA 1KP2A 1XAKA 3CVCA 4P2QA 1IBLB 4BFRA 1BZEA 3IFPA 4PA4A 1EZLA 1JVOA 3L3KB 5JO5B 2MCAA 1NGXB 4JK0D 4ZTOL 1URZA 2WJ5A 3AK2A 4F7KA 3M1BB 2Y7NA 5MP6H 2F19L 2X89A 3TO4B 2Y0IA 4U1KB 4LH6A 3FX7A 3RJQB 5I74C 2OMXA 2V8MA 3DYOA 4X6CB 2E75B 2ZF8A 5EO1A 4EDXB 5KSVB 5FUCC 3VWJD 3RUGF 4KXRA 3BIBX 4OGAC 5L3FA 2R29A 5J3HD 1MZYA 5IEHB 4N21A 5D6CB 4GKKB 1SQBH 1QUPA 2YGQA 3VAEA 4MA1B 2DI8A 5CEZD 5ALBL 3RX8A 4PJHF 1EAOA 3MFGB 3ZBMA 5MENA 5KYUA 1B0RB 1NMCB 4YUEH 2I32A 1U8KB 3AEIA 2QGCA 3G5YA 3GEWB 5E4EB 5ID1B 5IYDO 4TYUA 1JCHA 4X4XB 5I1LA 1XL4A 3T1YO 1NJ9A 3B7UX 3GBML 3GKZA 4MZRA 1R4XA 1YJWV 1MN4A 2X4QB 3UG4A 1E9QA 1BWWA 3W11C 3D39A 5LBGA 3QPQD 1P5UB 4GRWF 4MGXA 2V7NA 3RVWD 5CS7A 3WB0A 2E7DA 3ISRA 2KB1A 3H3KA 4WDIA 1S9WA 5FC9A 1R3IL 4LF3A 1MCQA 3CFKA 3BUQA 4J28A 3W57A 4OLXH 1BZ7A 4ODSH 3ZDWA 4PAZA 2XIBA 1PX4A 4ELMF 1A7OH 2ADIA 3ETBF 4HMDA 3FQ4A 4C57C 5IV2B 2QWOB 1PAZA 3BZ5A 1D3CA 4IBQA 3ZTJG 1MAML 1YLBB 3NG5A 4GP8B 1DJZA 3SR2C 4B3MB 3KG2A 5I82A 1M9NA 1J8RA 2P46B 3CS5A 2UX7A 3EDKA 4Z7UF 1YAIA 3HBZA 4D7PA 3O2DA 3PU7A 3IRCA 3BZFB 3ZE2E 3CG8A 2EUWA 2O61A 3OF6D 1G6RA 4J3OH 2WN3A 3NTCH 2Z0BA 4GUPB 4I7ZC 5CHNA 3O2WH 1UZ8B 4AILC 4KKBD 4OF8A 4WV1B 1J10A 5F0JB 3OKDA 4CAGA 2FUTA 3CDYA 5MI0C 1JMKC 2WOBA 3C12A 3GMMA 1W9XA 5EK0A 3LHPH 2QDWA 1XNQB 3QXAA 1QBZA 1SEQL 4PY8J 5E6SB 3ARSA 1WP8A 5IUCA 4A2FA 2R8SL 3P30H 4LAJH 3STZC 1WCQA 4Q89A 4UT7L 3BUTA 3F7KA 4Y1SA 4OF7A 1EJ8A 3D06A 4KVCH 2Q3AA 3BD4A 5EU4B 1KXVA 4JI6B 1TTRA 1U3HD 5F88B 3HZYB 4L4TE 3IU4L 4O00A 4E9VA 5I1KL 3OKEA 1FPTL 3G04B 3HE7D 1PQZA 2MCPL 5KN5B 5LAXA 4JY4A 5ECJE 4JBSA 4UZSA 4R4FH 5E1QA 3TT3L 3EJCA 4JZOA 3RB5A 3LEYH 4ZW6A 2K78A 2XV6B 5ICZB 3CPLA 5AKTA 2OLDA 4OZFA 5AKSA 4L29A 3S5ZA 4MFHA 2JLPA 5GRWA 3FFQA 1NTDA 5HI3C 3N43B 3V0WL 3HE6A 4K0OA 3N2KB 4LOUD 4IDJL 4PIRF 1IC4L 4L9LC 1YJDL 4Z3IA 4HIIB 2YI8A 1MH5A 2OSLA 3TJEL 2UXGA 8FABB 2A6DA 4Y19A 4XXDB 1Q0EA 1RI8A 1TJGL 1UH4A 2I9LA 5JIHA 2NX5B 2DWDA 3V0JA 4HXAH 5CIPB 5F93C 1AE6L 3VXNA 3CLEH 4BE5A 1I1YB 4FNRA 1JPST 1U8LB 4TUOB 1YNLH 5MEOB 1JGEB 2XXGA 3Q0HA 3QF7A 3FQTB 2HFEB 1KGCD 3VFGH 2XWTA 1RSYA 1MLCB 1Q72H 5KVEL 2GG1A 2LAAA 5DYFA 2LLLA 1SVZA 2PABA 4XCYA 3DTXB 5DVOA 3S2CA 4OJAA 4M02A 1SF9A 4B9KC 4B7LA 3QA3A 4YZFE 4N28A 2XTLA 4MVQA 2YIBD 1BOYA 1T6WA 1EAPB 1T5WA 3FTWA 3SKJH 3B2VH 4KITB 3SDYH 3T8MA 5HGGS 2HVKC 1BJ8A 4U7MA 2B9ZA 2QPFA 2H8PC 4BZ1H 2BIOA 3BOVA 1AZCA 4GI8A 4HJGA 1XH3A 4JRYE 4PJFF 4RAHA 1XGTA 4QPKA 1FXVA 5E6RB 1NVPB 1KIUA 1CXFA 3KHQA 3UAFA 4FHKA 1A3QA 5K1VA 4L48A 2R15A 5AVWB 3ZDYF 4MMXC 5B39B 4IQHA 4MNHB 1H19A 1DDHA 1B4JH 4JE4B 5CA3A 1TUBB 4Q6IB 3EJTA 4RX4A 3U1SL 4UCTA 2D3NA 2YAMA 3HS8A 4WU5B 5F1IB 5IB1A 5BV7L 1I94B 1BDYA 4JPIB 1R24A 3PGFH 1YMMB 2OL3B 1QSEA 4Z7WA 5M7QA 5EOTB 1N34B 2WLZA 4R8WH 3ZTEA 3SN6N 3GSWB 2CCWA 1K4CB 3NJLA 4KKRA 1MJ7L 5SWSE 2ZIMA 5K9QI 1Z1WA 1OW0C 2Z8VC 2YAHA 3RTQB 3GIVB 3ZHUA 1KGXA 3ZRFC 3MRGA 2EZPA 3NFSL 2WQVA 4Q2ZA 4IRZL 4JHZA 2OZNA 2V8LA 2VGLM 2VW6A 3L1OH 2R27A 3SQBB 3FYIB 2EACA 4NRZB 1HJBC 1JUFB 3RG1C 2WY3B 4DN3H 2WQ8A 1HR0O 4UTCA 2GJPA 5L6YH 1AR2A 3TEXA 1AGFB 2CTWA 4CC5A 1PTZA 1JFQL 4X5WA 1WJZA 3I02A 5E2WL 5F1OB 1OCZC 3IXAA 1N59A 4B9ZA 3CFCH 5F9JA 3TO4D 1XGYH 2B1HH 5HYEA 1FO0L 4LQ1A 1D7FA 2B4CL 4UV7H 3TA3B 1EGJH 1OVZA 4QHLA 2JIZG 5D71H 2E4FA 4KY1H 3TBSB 3WN5A 4N23A 3JUYA 2PTMA 4UCUA 4WF9V 1ZT4B 1R5VA 4LLUB 4XVSH 4KZCA 4M6ML 5EUOE 2G9HA 1JQ0A 2HT3D 4PI0A 2XNAB 3QYNA 1TVBB 2G60L 2R1WA 1D6EB 1VADB 3C5ZB 3T0BA 5D6DA 5I6LA 4XPFL 1FXKC 1RIHH 3MAQA 4QY8B 3VXOA 3E2HC 5LB1A 4PWGA 1FFNA 4BWAA 2VSKB 3BEHA 3EZ8A 4MJ5B 4OZGA 4XNMB 5T1KA 1C1EH 1TPXC 3V95A 4FTVE 3IRPX 3L9EA 2WLLB 5C0DA 1SF5A 4HFUL 5B38A 3BIKA 5FM4A 2VL5A 1FGVL 1FRGL 1CFSB 2FX9H 1HP8A 3MV9E 2QBWA 4HX1A 1M9WA 3DI2B 4YHHB 1P5VB 5IFAL 1D7DA 4JDZA 4GX1A 1KCKA 1BXUA 3GHBH 3EBHA 4Z7VE 5FECA 1DQMH 4PD4J 1XGZA 1DEEA 2KUTA 2XETA 2VRKA 5JQHC 4JQXC 4OZ4B 1GVIA 1ZTXL 1A1MB 2A38A 5DZOA 3UG5A 5CBAA 4NGHH 5JLZA 3JTTB 4Y2OA 3CFDA 1RUPH 5D1QB 3QDAA 1BW8A 4JZGA 1KJVB 3RWJB 1GC1L 2CDFB 3FFCA 3MLYL 2XQ0A 2FB4L 4XX1G 1RZGB 1THZA 4JI0B 1IBHA 2LR4A 1HNXB 4KI5D 3W7WA 1KC5H 1NIFA 1WAPA 1Y7VA 3K0DA 3GRWH 4HGKC 3VXRA 2HT4C 3CBKB 3SGKC 1KB5H 4NYKA 4HLJA 4LSQL 4NFCA 4OCMC 2XHNA 4GNKB 2XWBB 2HVJC 1ZK5A 8CGTA 2HKOA 1Q9OB 4JM2F 1T7YA 2JJSC 1MCIA 1BD2B 1UA3A 2PR4L 5IB2A 2N0KA 3H0TA 3ZDXE 1HXKA 3PXLA 1O5DT 3WO4C 4TV3A 5DEDA 2BRQA 2VLMD 2CZNA 3EADA 5EC2C 1CYXA 1XGPA 4N2BA 4TL5A 4CVUA 5MEQB 1EO5A 4LMQI 1G1CA 3BH8A 1MW3A 1F0LA 3U10A 2X7LB 3LQMA 1CR9H 1GPOH 4XPGH 3DETC 5IVZA 4LVNB 4UDTA 1KZQA 2Q6AA 4QKXB 2F53B 4UUJB 3GFUA 4Z0BL 3QZWB 4XP1H 1MFVA 3CXDL 3D7PA 2OSYA 1NDTA 1ENVA 1IGML 4G8EA 1HH9A 1NAMH 3BCFA 3CCJV 4C56E 3T0VA 1NMBL 1OGAA 3RL2A 1YC7A 4ZUSA 4KRLB 1CD1A 2ARJQ 3QRFM 3W7UA 4I4TA 4G8GA 4JDTL 1U3ZA 2NXYC 1UM4L 2GYSA 3ABGA 1GO3F 1VZGA 2E9WA 2P5EE 3QRLA 4PJ7E 2BY3A 1YEHL 4FQQB 4G42B 5IZ7A 4GG6E 4Q7DA 1H9DA 3MODL 1CP9A 1PPIA 1CJYA 2XN9E 3PFUA 5ISZB 4U1SB 1WVZA 1TQSA 1SJEB 3SE3A 4JM4L 1OOWA 4K8RL 4QPEA 3UC0H 1M2VA 5DRWA 1GMEA 2QDOA 1X7TA 2AK1H 2OYKA 4UXNA 3BPOB 4YXLL 4WW1A 1SHSA 4Z7NF 3WYRA 1BZ9B 2ADQB 3JWOL 1HHIB 2NX5D 3OPZL 5CFAA 2BINA 3EO9H 2J1KA 2CLZB 1KNOB 5IUSA 2QGDA 4LVHC 1S7SA 4DR5O 4OM0L 4LHUA 4BA0A 2A3QA 1EWHA 2EINB 1AR1C 1KJ2H 2J5LB 3IE4A 1OP3H 1S5HC 4F2EA 3DVGB 4Y5YC 1E8ZA 3BVNA 4KQ4H 1BG9A 3L3OB 2P4VA 5MHSD 1W8NA 1DJIA 4WKZA 3SDCB 4N0UE 4P9HH 4Y4FB 2EXSA 2H32H 1HEJC 4MMZC 1IAKA 2HJFC 1TITA 1GZHA 2CDEB 2E56A 1KPVA 2IO5A 4Z5RB 2OMZB 2D8KA 5IW1A 2KMWA 2L7EA 4MQTB 1WPBA 3MRMB 2WM0A 4FABL 2F08A 2MFNA 3V0AC 2WXOA 5GS2D 3IU3B 4N8VG 3VFUB 4B41A 1J5DA 4G7VL 5FO7B 5BVPL 4IYIA 2L8AA 3BP7A 3QJFA 2WKOA 1FNLA 1USQA 4YQXH 3GMNA 1NVPD 3LQAL 3S34H 3C8KB 3WB2A 4PJ5E 3BUIA 1Q8IA 3FQNB 3LZFL 4NKOB 3ROOB 2Z1KA 3H4FA 2XPGA 3MACH 2Q8BL 2F58H 4QCIA 2EH7L 1N6VA 2W9LA 2F5BH 1GSMA 3DIFB 4WFED 1KBPA 1NIAA 1U8IA 1NLDL 2DMXA 2YXYA 3PIQB 4AC4A 1J5HA 4ZMVA 2OR8A 2CO1A 1R6NA 1G7JB 2LGNA 3GI8L 3UAJC 3MGOA 1LM8V 5C2UB 2CUMA 2XZZA 1YMMD 3FRUB 1SS3A 2AABH 1FHNA 5HYJA 3H42H 3ZT5A 3UYRL 1PD1A 2XZCH 5GHWH 1QSVA 2ITEA 5E8DL 5KVFE 1QOKA 4U3FH 1RIVH 1BIHA 3KPOA 4O4YH 4X64B 1G4MA 1QSFB 4ZYKB 5T3ZD 4B3TO 1UOWA 1OAUL 3G5VB 2BZDA 1IE5A 2WBJC 3GZOA 4J5VA 5EZIL 1P53A 1FBIL 5LHIA 1R3KA 4HOXA 1KYDA 3B2DC 1HZHH 3P0YH 2VSCA 2OX5B 4XT1C 1NBZA 2P45B 5JXEC 3U0ZA 2VXVH 5CN1A 2DJVA 5ABAA 3DRTA 2AJVL 5I24A 3FCSA 1X5AA 4Y2DB 5EB9A 4EI6A 5IMOA 1MNUL 4I18B 5FYLL 3BWUF 3ASOC 1AXTL 1DZBA 1INDL 1SA0A 3GXFA 3HJ0A 4JREB 4NOBA 4K9EH 3GO1L 4I48B 3TA3D 3T2PA 4Z77B 1A6UL 1WUZA 3WTUA 3BVOA 4YEFA 4BW9A 1BVNP 4CDGC 1G7PA 4PSPA 5HHMB 3K2KA 5C97A 1X4TA 3JT2A 3V9EA 1SHXA 1ZSDA 4JKPH 1A6VL 1OZUA 1J0JA 2E27L 4JMNA 1S0VA 2VMFA 1GA2A 1SUJA 2YRLA 4JO2H 5HI5C 1NGPH 3C5ZD 3VUAA 1IM9A 1F1DA 5MENB 1TQBC 3PPSA 3S35H 1AS7A 4FFYA 1K9TA 3EGDA 2ED7A 4J3XA 3H3PL 5I1LB 4NQCB 3L4YA 3H2PA 1C7SA 1JRHL 4JY6A 2APTA 1FVEA 5PAZA 1WAEA 2IMNA 5D7LB 1R6TA 3LV3A 1NR7A 3QUYD 1DTUA 4DUYB 2XTJB 4MDIB 3MLXL 3M6DA 1YQ2A 3VVVA 1A21A 4HS6A 1QNZH 3UGUA 4WDIB 5AOIA 4YIQB 3VFNA 3CFKB 4PYHA 1ITCA 5FCUH 1ZE3C 5I1HH 2XA8L 1ZCRA 3IGUA 1EN5A 2ADIB 5DS8B 5IIEB 1IGYA 5LGTA 4PA6A 3ZIYA 1ZA3A 1JR9A 1CC3A 3OJVC 5HJGA 4DTGL 4GCZA 2A7WA 1JF1A 5DQ9B 4QXGH 1NMAL 5D1QD 1SY6H 2VLJD 3W9EB 4IBUA 2FJHA 5D7IA 3EH2A 3GS0A 4O02A 3ETBJ 3EYUH 5FF6A 2JGUA 3M7MX 4G9FE 3L4ZA 1ZHBB 4CSPA 3WMPA 5IY5C 2O61B 3M7OA 3NPSC 1Z5HA 2D31A 3CXHJ 4NZTH 1KB9J 5DU7A 5CLZA 2ZT9C 3KGTA 1X7QB 5CN2A 5DUPH 2A3TA 4PRAA 2G3ZA 1F2XK 5E99L 1EZVX 1MFDL 3IXTA 2H2PC 5AOJA 1U8CB 1H3PH 3OKDB 4RFOL 3VYOA 4DP0X 1LWHA 4YFEA 3CD6V 5BJTA 3PDOA 3QVNA 3CU1A 1VAHA 3OR7C 5KUKA 5FS5A 3LKPA 3U4BL 4AL8C 1BD2D 3F84A 3FN0H 3GXUB 3ZKNC 5J9PA 5JNYA 3ARFC 2AITA 3RY4A 5DTFA 4XOCA 4WSGA 2HKFL 4ZHQB 3PL6D 1F6AA 4Z8FH 4H0GA 3GXMA 1MFBH 3M1CA 1DN0A 1I1FB 2UZIL 3UACA 3CZEA 2OA9A 2F53D 2W5PA 3WHXA 1CF1A 4WHYH 2J1WA 4UB0L 4JL2A 5SWZE 4PGEA 3L2MA 2VJXA 3O6FC 1FXHA 1ADQA 2WLMA 3C2AL 1HCVA 3MTRA 2X1WL 4JY4B 4D0DA 5LGJB 4L1BA 4RFNC 3GSRA 4HOMA 4ADIA 5B7FA 2V7HB 4M1CC 1O9VA 3CPLB 3DJSA 4R4NC 1QZ1A 2ZKYA 5KVDE 1UM5H 1E5BA 1UZ6F 2UXDB 3HE6B 5DO2C 2GJ6A 1PNLA 1DJSA 1SXZA 3IS0X 4WIQA 1PF3A 4XHJD 2VDOL 3ZRSA 1AHMA 2RQ8A 4HBCL 2J12B 1HHHB 2F8XC 5DQJA 3QZBA 4GSDL 4JQVC 4EDWH 3PQYE 3BXNA 4KGJA 4IIZA 2NUPA 3DSFL 1IT9L 1J5EO 1RJLA 4ZZKA 5HY9A 3EOYG 4AK1A 1KFGA 1N4XH 3MGTA 1M6OA 4DR6O 4MQSB 2HVBA 4NB7A 4E9YA 4PRBA 3ISWA 6FABL 1ZA6B 2CLRA 1HYSC 4MVRA 2A1WH 2ZWKA 2CALA 4ZD3H 3MREA 4AJYV 1L0QA 3HRPA 1IX2A 1P0SE 4JAMB 3IMVA 5G55A 3Q2LA 5D72H 5CMAA 2X1PA 2UUAO 3P3NA 2XWTB 3D12B 4MNQB 5DJXB 1IBFA 3T4DA 1T1XB 3OKOA 1UOVA 3U0WL 4FM0A 2BVUA 3PFQA 4JM2A 2GITA 1VFMA 1ZWIA 2P8LA 2WLNA 2PCFA 4KKCD 5E6ZA 5HDWA 5IBTH 2HTLC 1NOAA 3SDCD 3IRZA 1PD6A 3QA3B 4WRLA 5CM1A 2WLIA 4OD2A 4GRLA 4PMEA 3ZRXA 1CE1L 1S9VB 2J8OA 2QT6A 3QIWA 2QVMA 4IYKA 1XBRA 2VR6A 2YPKA 4NN7B 3RBSA 4KY2A 4NM8L 1AI4A 3X3GL 2VR9A 4R8CA 1L8DA 4M5ZL 3P9LA 1XH3B 4HGWB 4NTYA 1IAIL 2LW3A 4HK0B 2N04A 4PIBA 1Q6HA 1KIUB 2EVIA 2YSUB 3VD4A 5HGAA 3QH3A 5T5FL 2FAUA 5F8RC 1KV7A 3QZOA 1JJUA 1AJPA 3PWJA 1WTLA 2CPUA 4G43A 4OCYL 4OLVH 2OYPA 4XO4A 3STLC 2PYEB 1FVCB 4AYID 1XXDC 4NHCL 3S97C 4BIOA 1AC6A 1KCUL 4G6AD 1GRJA 1L9QA 2HRHA 2OQJA 4OV5A 4CN4A 2EC9U 2YD4A 4CN1A 1AR5A 2A0LA 5AD0B 5D93B 1ZLSL 1BE3H 1K34A 5B1CA 1D6VL 3O9WA 4DPCX 4K55A 4OFYD 1MRDH 3MOQA 4UT6L 1A2YB 3FBKA 5E8EB 3T8VA 3WKQA 2GIXA 2IQAB 1HWYA 2F5AH 3JALB 3P69A 5EU3B 3GJFH 4AUYA 5TE7H 2DB8A 2J56A 3SDXA 3VWKA 3CHRA 1MVFA 4BIKA 3KYKH 3APFA 2GTWA 1U8OA 4GYBA 4Q2ZB 4ABQA 4NZRH 4TNFA 2PMZA 4P49A 1T03L 4QT5A 3MBXH 1WZMA 1M9SA 3PAVA 2BIHA 3N50A 3VXME 4IRJA 2LVCA 3BKYH 3N9GL 2OMBA 3D33A 2OZ4A 3MNZB 3IJYA 2PYJA 2ZCKL 3AG3B 4FMTA 4Y2DD 3IXAB 1N59B 4A2MA 4FLRA 4IIQC 5F9JB 4IOSD 4Z6AT 2VAJA 1NH6A 2DLFL 4QO1B 4A6YA 4J3BA 3FOMA 1CFQA 5BCAA 1Q1JH 3VCLB 2CA4A 3TXAA 1DQKA 4QHLB 1AY1H 4MYPA 3PWPA 5A2KH 3VRLF 5I8EA 5CCKH 1OCOB 3D2UA 3QNEA 4JHWL 2BP0A 5CZRA 4X99B 2X4SB 1F4AA 1OTTD 4UVAA 3QDME 2NY4B 2WVTA 5I5JA 3MR9A 3UJJL 5IOKA 4PDLA 2EH8L 4MDRA 1WFTA 3L4VA 2XXFA 3OHXB 2ZOUA 4KHPB 4HIXH 4X98B 3ULUL 1ZDSA 3EJYD 3KGRA 5J1AB 1QR8A 1HNFA 2PWFA 1K2DA 1JPEA 3APDA 4XTRD 4PTUA 5MEND 5DWPA 4RZKA 3AY2A 4XMXA 3FQRB 1LK3L 1T7XA 3VXOB 4LF7B 1QLFA 4CL7A 3ZW3A 3QVAA 4F93B 2B59A 4KKZA 3SKNA 3T0XA 3EG9B 5HSFA 4GT0A 1IJNA 4NQCD 3UBGA 1SN0A 4KJQD 3S37L 4HIEB 5JHLL 1LP9A 1KCSH 1SYSA 2YXWA 1MCWM 4XRCA 5B38B 3CSXA 1WBXB 3BIKB 4PV1C 3EJUA 5D7LD 1FYJA 4HX1B 1XMOB 4ERSL 2KC0A 5DHMC 4JDZB 5DK2B 3FB7B 3IB4A 4LDLB 5DS2A 5DMIH 3O6MH 1NBCA 3MOBL 5CEYA 1CWVA 3CDZA 2JI2A 4E42A 1NGYA 1BQKA 5KAFZ 5K93A 1RL1A 3C08L 1L7IH 5B3SB 5CBAB 4H8WC 2IGFL 5JLZB 3CFDB 1Z9OA 4CH3A 2HFFA 1PKQE 3Q01A 4PPTA 2Z3FA 2G0LA 5HHNB 2C4FT 3UZEC 4K7PX 2IXQA 5BRZA 4FFVD 4AJ0A 1TDQA 3APCA 4WNQA 2YRPA 3UTTB 1QWNA 2XAQA 5E7FA 5EU7E 1UKTA 2BSEA 4G3YL 1AZUA 1YYML 3CH1A 4PS4H 4EZJA 1CICC 1PNDA 4NC2B 3Q8EA 5EORL 3TASA 4F8PA 4ZPTA 4KJPC 5EH1A 4M43L 1T20A 4NKIL 4YE4L 1G6VK 4W9CC 3L48A 2VMEA 2YDEA 2X9YA 4JRXA 5E6YA 2J2ZA 1PG7H 4XMLL 1EQWA 4L3CA 3UERA 1MFEH 2P26A 5IESH 5ITFA 5IB2B 2FRGP 3H0TB 3W2DL 3BYYA 5EOCL 3QWRA 1QFWL 1IQWH 2X4PA 4BDVA 2A6KA 3P4NA 3FULA 3RUGB 5JW4N 4IT5A 3L5JA 3TT1H 3ZT6A 1DCLA 1E7VA 1JZ2A 5FUZL 4JB9H 4YSQA 2XOTA 4NQVB 3FQXA 3FCTB 1H3XA 4KGLA 4PJHB 3QWOA 1AFVL 1HH9B 1H8LA 4LCUA 4LLDA 5I15H 43CAA 2RJMA 3RWCA 4IKNA 1OGAB 4Q0XL 4PJ8A 5GRUL 4OCNC 4ZUSB 2IH3C 4JRLA 4ADJA 3KPRE 4G8GB 4I1NB 3OQ3B 1WIOA 4GRWB 3CZSA 1P7KB 5F96L 5AYQA 1U3NA 5HYQB 4ZS6D 4LRNL 5CZVH 3HE6D 2Q8AH 3ZQ9A 3ORJA 4NC0B 1XGRA 1CDUA 1ZAUA 4ELMB 4ASUG 3JYBA 1ND0B 3UTSA 4ANUA 5IHUL 4R0LC 4C59B 4GAAA 1DBBH 1OM3L 2GSGB 1UXWA 1KCVH 4WW1B 2V5SA 3ME0A 4PJBE 1D5IL 4MJJA 5C8JA 4FZ0A 4E9RA 2DRUA 2BSSB 3MA9H 4Z7UB 4PY8I 5HDQL 2N7BA 4K71B 5CJXC 3N41F 3U4EB 3WKPA 4R96A 1R3LA 5AWNL 3FPXA 5E08H 1JZDC 4BIUA 4U1LA 3TYGH 4K8RD 2GIMA 2BERA 3NSYA 4KK9C 4LLWA 3RPIA 4GAYA 3UH8A 1TTUA 1S7SB 3V0VA 2W9DH 3ZKXB 4LHUB 4U1JA 4I5BA 4WKXA 4LNRA 2FECI 4MNQD 1UFGA 3VSTA 2PWGA 4N20A 3BVNB 3E8UH 3H01A 1FE8H 4X9BA 5JA8B 4WKZB 2VQEB 1JZ4A 4BYHA 3MAWA 1G0YR 3IC9A 2EXYD 5D7HA 1KCBA 4FEIA 3EYOB 1QP1A 3K81A 1P7BA 5GTHZ 1OPGL 2IWGA 5IW1B 5L9DL 1LLAA 1CTMA 1U36A 3KDMA 3KG5A 2HWZH 1F23A 4MHHG 1QLEC 1WFUA 1ANUA 3IBEA 2YQ2A 3ARTA 4PJEF 3I50H 1IKFH 2IBZH 1N32B 4R3SA 2VAAA 4ZZFA 2H6PB 1IZKA 4KUMA 3O3UN 3MZTA 3QI9D 4MA7H 2VDNB 3QNXB 5CJ8A 3O9OA 1FVDA 2MCG1 1XH1A 3OR6A 3NRQA 4HK3J 4DFHA 5I2IA 1E90A 2Z7UA 4RIRB 4RMTA 4X6BA 1GY1A 4Q56A 4DP4X 1MWOA 5CJQL 1U93B 2JIXA 3MV7B 3X1BA 1YUKB 2F1MA 1C12B 1GHFL 3A22A 1Q7YW 4DV0B 3CC5A 3CCMV 3CVIL 4JHVA 4P3WA 3NRPA 5HP5A 2PYED 4YIOA 4GQQA 3Q3GB 3MGOB 1VQ6V 3RVZA 4Y9FA 3T2NL 4O5LL 2I07A 2IAMB 1FNAA 5HYJB 2A99A 3HUJA 3EFFK 2AAAA 1XUQA 2DQEL 4EQ2A 1C5CL 3K9SA 1MCNA 2DM7A 2EDMA 2FBRA 3KJ4C 3OLGA 2YD0A 3L7FA 1A6TA 4ODXA 5D7JB 3U7WH 4PP2A 1K72A 3KPOB 4NO0B 1EO8H 2GUZA 1K5NB 3GLZA 1EHNA 2E74C 2PP9A 1FORH 4I2XA 2ADFH 2B20A 2BY2A 1R3KB 3BPLC 3ZE1F 2VR8A 5IK3B 2LFGA 4NQUA 5F9WB 3KLAA 4FMKA 4WFFE 1PEWA 4MW8A 3PXJA 3VGGA 2NT1A 4F20A 2NTFA 2X2UA 4TTDD 4E9TA 3JWNH 3MCKB 4YLCA 1NCOA 1PZUB 3HPLA 3DRTB 4NJAL 3GBEA 3MO1A 4FHBD 4EI6B 1GGBL 3TNNB 4CC4C 5CEZH 5TK2A 2HP4A 4P59L 4MVUA 5G5DA 4QWWD 5IB4A 3AFLA 2NLJC 4FQJH 4BKLB 1UD2A 5JJJB 2JKNA 1Y18A 3T77B 5D1XA 1JN6A 2XKNB 1N64H 2ERJB 1WISA 3OGIB 1SLXA 4PJFB 1P1ZB 5J6HB 1WG3A 2VXQA 3NIFF 1DANT 3DPDA 5BS0E 5KYWB 1SESA 2UXBB 5B7EA 4B27A 1ZSDB 3MJ9A 4EUPA 1O6SA 4YWGL 3EYVB 4TNWF 4KHTL 4Z7OE 4PWFA 1IM9B 1HKLH 1Q5OA 5TH2A 5J2UA 3P3TA 3ZDYB 4BH7B 4J7ZA 3HB3C 1A7BA 3SYAA 3KPNA 1J1XL 3GSNH 3HEIB 3SEPA 5AKRA 1KMGA 2EXWD 1N4CA 2Q67A 1XIWA 1BM3H 1FVEB 3LKQA 3M86A 3ZMZA 3EGXA 3VGEA 2PW1A 5IT2H 5FNVA 1JVMA 1NL0H 4H1LG 5I1JH 5D96B 3QDGE 1OE1A 4L87A 1VJSA 1G7QB 2O72A 3VFNB 1MSPA 2YC0A 1F7YA 2DTMH 2W6JG 1P4LA 3VGDA 2EICA 1UHVA 2VLLA 1VERA 2VZVA 1YMHA 5JHAA 1RZFL 4DWHA 2J8UF 1H8OA 5LBSH 5GGRY 3DOHA 2A9ML 3QDJE 1JF1B 3U9PH 3EOTH 4YHIB 4P05A 3V4UH 4YK4C 3G67A 1T1ZA 5D7IB 5INCB 4O02B 4JANB 4WGKA 3EXLA 1BZQK 1HHGA 2W9EH 3UTTD 2KG7B 4U1HA 1P4BH 3CDGA 4LFAO 4LGPB 2OI9B 3HR5A 4HCRL 3ETDA 2UUDK 3ML0A 2FTKA 4OIIH 5G4NA 1IAOA 3VH8A 5EEZA 1SVBA 3ZXAC 4GAGL 1MHCB 3IXTB 3EFDH 5IM7B 2XACC 3IF1A 4FTDA 4NCDA 5BJTB 1H2MA 1V5JA 1T2JA 3A6CL 4FFZH 1HL5A 4WTZG 1HFUA 4WSKA 1CL7I 5D2NE 2QVIA 4NFDA 5J9PB 3SGDI 4JFSA 3B9AA 1WS7A 3KWWA 3X12A 3LCYA 3IFXA 4Y4HC 2ICES 2BVPB 2XQBL 3G4SV 3MJ8A 4K7PL 1WTGT 4HAMA 1F6AB 1YEWA 2Y69B 1TZGL 4N5EC 2ZXCA 1CVSC 2YZ1A 3BZDA 4EEEA 4JZ2A 3DRQA 3MLWH 4DR3O 3HKCB 2Y2YA 3EJPA 3VXSA 4FJ6A 4I4WB 5B7MA 4P2YA 2ENQA 1LO0H 2EKJA 3IDXL 4P5TC 5FYJH 5JIIA 2DW4A 1RJZB 5FW8A 3UYPA 2B5IB 4GXVL 2F7PA 1F51A 3LZLA 1YJ9V 4BRVA 1LO4H 4PJDA 4G8GD 2YBGA 3K5RA 4MAYD 4OD3H 4PWIA 4N6RB 4B95C 1GOGA 1PG7W 4HF5L 2VC2L 4JEGB 1N5YL 2NMSA 3WFBL 3V6OE 1CLZL 3LIUA 2WXLA 4OM1H 1DQQA 2E9JA 5MEPA 2ZJSL 5DQJB 5LL6Y 4WW2A 4XP4L 4LGRB 2VN7A 2Z35A 2ITFA 4ISVB 5JCOC 4XDJA 1VF5C 3WE1A 1RJLB 2BNQE 2HT2C 1ED3A 3DOSA 4GKSB 4LSPH 4LPUA 1RM1B 1X6NA 2J6EA 3MRKA 3WFHA 1H8SA 5E79Z 2ZNWA 3HN3A 2FQDA 1OIOA 2CLRB 2BOBC 1AP2B 5DD5L 1SKVA 3MREB 3LSSA 2PF4E 5FW7A 1TJMA 3HR0A 1BPVA 2AF2A 4OKVA 2FWUA 2ICCA 3CCHB 4LEOA 3H9SE 3E3QC 4AGPA 1NEZA 3D48R 4OPHA 3CJHB 4JM2B 5LBVA 1R5IB 4I1PA 1ZWIB 5DMKB 5IHHA 1KBHA 1T04A 1Q9LB 1OHHG 2ZWYA 1VLXA 4PJXE 4R7VA 1Y1UA 3K8KA 4DH2A 1WB7A 1COBA 2JB5L 1AJNA 1T83C 2YPKB 5HHVL 1WH0A 1WLEA 2XT9A 2FO1A 1G4RA 2QELA 2Y06H 5D1ZA 2Q7NA 2BHZA 3KR3L 2I26N 5DEJA 4JASA 4MSWA 4CBPA 4WI0A 1ZL8A 4I13B 3VG9B 2QPDB 1KYUA 3ZTNH 2XT1B 3UKMA 1DF4A 3H55A 4HUVA 2Z34A 5E00A 2AEWA 5KYYA 3QORA 1IQDA 4CA4A 1CU4H 3N1QC 4ENEC 2C9PA 2FYYA 4ZOCA 2GBUA 1ZMYA 3IT8D 4M4RA 1U30A 2Y1YA 5CCJA 5KYXA 5CZKA 1VPOH 4HKBB 3MV7D 3OSVA 4FYRA 4HV8A 2HJLA 4OSUH 5PCYA 5AW4B 3MKKA 3U1QA 2AJZB 5GZNA 2ICWI 2ED6A 2QQNH 4LSRL 5IJDC 4Y5XA 4JJOA 5CGYC 3ZGHA 2HLFD 4POZC 1ROPA 1TETH 2B14A 2EDXA 2IAMD 2QQKH 4P2RB 1WUNT 4XNUL 5JHMA 4TNWK 3IAPA 2VRZA 4JJHA 2GEQA 3CBRA 4N2LA 3SY6A 1OAKL 1CXZB 1IBKB 3BQUB 4EO5A 3X2QB 4UCRA 2AXGA 5D7JD 3B56A 2AXTZ 2FL4A 2XJLA 2WAHA 4JPWL 3CHOA 2YXFA 2FTAA 3HHSB 4NO0D 1F58H 2P9RA 3T1FA 4JG1L 2WVVA 3AABA 4Z23A 4GKJO 3T8XB 4N8CH 3UGEA 3VWKB 5F70A 3SBWA 3E6HA 4V33A 4I50A 2JELL 3LRGA 1X5GA 2VXTL 3IVKA 1WA0X 3IDYC 1G7MA 4UYQA 2C5DC 3WDIA 5IVXE 4BSVA 1TMQA 3GKWH 4P9ML 4XAWL 3RVVC 5JW5A 3OTFA 2Y5TA 4O2EA 2VN5A 4QT5B 1JPTL 2B2XH 3ARXA 4IRJB 1XMQO 2MH4A 1UXMA 4N0CD 1O7VA 2ENPA 1AD9A 4NXMB 1MJUH 2NY7L 3NN8A 5FOBB 4F2ME 4POUB 4APQA 3GK8L 3RZCB 1OQXA 3T0EC 2HFTA 5FOJA 2XFXA 3B9DA 4OFKA 3FQUA 3W0WE 4CW1B 2G30A 3RPKA 4K3JL 4PRHA 4PV8A 4NUPA 4A7QA 4TPRL 3ATFA 1UJ3C 4UM9A 1V3JA 4CGTA 5A6MA 3A8TA 5I8EB 4BZYA 4QJ5B 3D2UB 2IH1C 3RU8H 2X4TA 1CLOL 1JK8A 1I1AB 2C4XA 4JQIL 4Y2NA 4ZUWB 4W9EC 4BUHA 3FTVA 2WXQA 3EHBC 4WGVB 2W0XA 5E1AA 4OUOA 4FZEL 5B3JF 3MJGX 3NP3A 3AU1A 5F44A 1K2DB 3TWYA 5CEZE 3VU2A 4PTUB 4KUZL 3QWQB 2VN4A 4QOKB 5DD3H 3QUZD 3GB7A 1U9KA 3QP3A 1OSEA 4JPQA 4TNVF 2IC2A 4XRCB 4WEBL 3UEQA 3P02A 1EAQA 5BOPA 5B4MC 1EFXB 3KBPA 5F7DB 3MJ7B 5I1IH 1A5FL 5JQIB 1EANA 1OF2A 5H4YA 2R4RH 1P84F 2MWCA 1EIBA 5DJ2A 5CEYB 3X17A 1XB3A 1EH9A 1P6AB 2D7QA 1QMUA 1T66C 1MSWD 2ISDA 4E42B 3MRJB 3WTYA 3SPHA 1AXSA 1YY9D 4FXGC 3DHJA 4KRPC 5KBNC 1JXGA 1C7TA 2CO6A 1YEFL 1GR7A 3X13A 1RZJC 2DWTA 3C87A 5DEFB 2IXQB 1G1OA 3AMKA 4D9LL 1PNMA 4WNQB 2FGZA 2MSPA 3GD1C 3G5WA 1OGSA 2K45A 3I6KA 3MX0A 3CH1B 4OD1H 2H6UA 4UVBA 4B9PA 3QUMB 5BY1A 3J7HA 2VQ4A 5C6PB 5JW4R 4B60A 4J1UA 5AYUH 1GGCH 3P2TA 4MTGA 5IE9A 4U7SA 1YN6A 3TGXA 4HVBA 3VG0L 2PYFA 3LQZA 3SGJA 3MD0A 2D7TH 3IDMA 1PFCA 1NZ6A 5ICYB 1YEJH 5J8OA 3BZEA 5ITFB 1K6QH 4WFAV 5JJNB 4UQCA 4U7KA 1E30A 3MRNB 4AW4A 3THOA 5HHXH 1FYHB 2VM9A 2XQYA 1DJYA 2A6KB 3P4NB 3A6OA 1AHWA 4HKXA 1JPGA 4ECNA 1E79G 4HPHA 1QBLH 4CH6A 2FSDA 4YDKH 5I8OL 1LE5B 4JPVL 3D05A 2GK0B 4LSUL 1J5IA 4G9DA 3QQ3A 5GS0L 1ZVSA 3WIFB 3WJMA 1BVKA 1GMIA 4Y16A 4MTFA 3I9PA 4BQCA 3D50A 4QJFB 3FTGB 5TF0A 1Z9MA 3ZMNA 3TV3L 1ORQB 1HNZO 2CRMA 7FABH 4HXBH 3O6KL 4G2AA 4N2EA 5FYKL 2X38A 5ESQA 3V6FA 4LKCB 4LSDA 3U30B 2E8YA 4KHXH 5E5RB 5IROD 2H41A 2XHBA 4WJG3 2YPVH 2B1IA 3ZOAA 2UXNA 1OCRB 3CC2V 5F2VO 2DQCL 2WWMD 1L5GA 2VMJA 4DOHE 4MB5A 4TUUA 3DYPA 5D70L 1TTBA 4LLQA 4NFBA 3MNWA 5J12C 2ZE6A 1QABA 4LLAA 1MVUA 1K8IA 4G72B 4XBGB 4W6YB 1UXWB 4O9HL 4MT8A 3U6RB 4BZ2L 5F6HI 1YDXA 3O8XD 4MKMA 4APXA 4NUGL 3EGSB 5E1GA 3JATA 3D8CA 4XO8A 4JFHD 4YBLC 4V1DD 1EXUA 1YYLL 4FAAB 2UY7A 5E8PB 3PP4L 2CO3A 4ZW7A 2H1PL 1N33O 1MSDA 2EJ7A 2DD8L 4JO5A 4M61A 2AP2A 4U1JB 4HKZA 1UENA 2FH6A 4G70B 5ECGA 5GS2H 4M48H 5IJKC 1KGCE 4JS7A 4P3CH 1FL3A 4N9GA 4JM2D 5GJTH 3ARDC 3RVUD 2F4VO 1FN4B 2WQWA 4M7LL 4PJAE 1D5AA 2AEQL 2VDKL 4FQIH 4U6YB 2BE3A 1QKZH 5E2TL 1NH2B 2K6YA 3L8QA 3BCCH 3O0LA 1W72L 1MREL 4PCYA 5I6XC 4NJ9H 2YARA 3SE8L 3ULAB 5HVFB 1LNQA 4WCYL 4Q9BA 2GBTA 1OGPA 2ZD9A 2CKBB 1HVXA 3F3HA 4TS6A 3NACH 1LK2A 4X20A 3Q6FB 1UVQA 4U1GC 1HXYB 1X5XA 3O41B 3FFDB 5CBEA 1O6TA 1B2WH 2OL3H 2BC4A 4QE9A 3GHEH 4O2AA 4R3SB 4LSTH 4N68A 5FFLA 3OPUA 1OAQH 2PP7A 4NRXA 2MMXA 3HNTL 4F7EA 4DO2A 3BRDA 1FVDB 2R4SL 4EXPX 4X6BB 3MFFB 1WBYA 4P48A 5T3ZH 2TSAA 5AAWC 3A6BH 1JP5A 3T65B 2KL6A 5E2UH 4E9SA 1LTXA 1GKEA 2DICA 2Y36L 4XODA 5DA0B 2HEPA 5K1PA 4I9QA 4OCXH 2ZE7A 3WS6A 5GS1B 3WL9A 4U4IA 2PWDA 3G08B 3ZBHA 1RV6X 3HC0B 2EIBA 3NFNB 3QJXA 4DQAA 1QW9A 3HVDA 3BAEL 4P2RD 2X05A 5E5UB 1RHHA 4M7ZB 4UCVA 2Y07L 1SXSA 4AYBA 3BE1H 2CO7B 1A4AA 4NQEA 2DWYA 3L7FB 1DBAH 1A6TB 3BQUD 4PP2B 1WF5A 3JWDL 4H20H 2OMTB 3IDUA 4RGNB 3VFTB 3EO0A 3ZHKA 1NPJA 4GW5B 3L4UA 1IAIM 1LXMA 1OARH 5I18L 3NBNA 2RAMA 3T3ME 3VWKD 4TNVK 4FNTA 1PX8A 2X7RB 2ZQMA 1JGVL 1T1WA 2I85A 2HLAB 2P8MA 4I2XB 4PSRA 3RWEA 1RERA 1NDGB 2WHVA 1MFAH 3BO8A 3P11H 2YAEA 2GT9B 1XOUA 4MD5A 1NCNA 1Z5LA 4XP5L 1P84K 2RCVA 4KK8D 1KKCA 2VQ1B 3THMH 3UIZA 2R9AA 1EZVY 4I88A 1JHKL 2ENYA 3MBWB 4YHMH 1SBSH 4YSAA 4TV9A 2JK5B 3LS5L 3RBGA 5IF0A 3RZCD 1KUQA 5ILTL 2ZIOA 1F11B 2FHFA 2Y7OA 4I0KA 2FR4A 4UTBL 1J86A 2RDCA 5FA3A 4DHLA 3MBEA 3OLEA 1XT5A 4DVBA 1MRFL 3KL5A 5D2LA 5SV3A 1UURA 1JZEA 3DC0A 1TZHA 4YHZH 1OT2A 5BR8B 1JN6B 2VDPL 5D1XB 3LXAA 4JFEA 2WQUA 1HXMA 2X1XR 1I1AD 3MQIA 4OZIF 1FNSL 4M1GL 1E9PB 3U6XS 3KH4A 4ZAKA 4IKIA 4RGMC 2FO4A 1F6LL 4JFFE 1B3QA 2NYKA 1O6SB 3HA0A 2EUVA 4N24A 4YY3B 3VM7A 3E35A 4M00A 4RISH 1CGSH 2X3BA 2F54B 5TH2B 5J2UB 2CBPA 5B8CA 4QOKD 5ALCH 5DHVA 1WHOA 3OX8A 1TKWB 4KV5F 4NENA 1LMKA 1TNMA 2JKLA 4NO3B 4KX9A 3WE6B 3CWBH 5IJ9A 2VO8A 3DROB 7PCYA 2QKCA 4GT1A 4H44C 3EGXB 3ZL4L 2PW1B 1DL7L 4YO0A 1EFXD 1P69B 1RVFH 3KLDA 4PJIA 2G5UA 3UTPD 3S4SA 4B7KA 1FA4A 5EEYA 4PBWD 4HIJB 3VB8A 2VLLB 5K9OA 2JVDA 3Q6GH 2GABA 4GXFA 3QAZC 2H2SD 1U2CA 1PVHA 4QGPA 5JDSA 2R39A 1BXXA 1WGVA 2G2PA 4CC6A 2DLHA 4MWFB 4KPHL 3V0FA 1T1ZB 1YHQV 4I0PC 3TBBA 3DPBB 4JLRA 4L8JA 1DQJB 3EO1A 3AJ7A 5AG2A 4DK5A 2Y7LA 1TUEB 4M7KL 4RBPK 4U1HB 1G43A 4NT6A 3RKPA 2NRDA 2VR5A 3HR5B 4GG8B 3B8YA 4ZTEA 1F86A 3KYOA 1IAOB 2UXFA 5T1DH 1X5HA 4OUUA 1U2YA 1R0AL 3IF1B 1TGOA 4X1KA 5AQ0A 4HUUA 3JARA 3RWRD 3KGUA 4XCEA 2JH2A 3VDAA 4PJ0Z 4D94A 2Z4TA 5JYMA 2X70A 1QLNA 3CMOL 3KWWB 2VLME 4JTCB 1KJMB 2R1YA 4R97C 4AT6A 1TENA 4FA7B 1KYOF 3E6FA 3C9NB 3M17B 4AV0A 5IGXH 4QNHB 4WFBV 2RHEA 2Z91B 2BIPA 3DRQB 3G5ZB 4NN6B 1DUYB 4FKEA 1G9HA 4ATWA 1GTNA 3EFFB 5IMMB 3VXSB 1QSZA 4DV2B 4HJ0D 3V4VB 3CFBB 4AQYO 3QC6X 1C9SA 3DMMB 1IM3A 2XWJA 5MP6L 2UXVA 3UYPB 1DFXA 4D8PA 4JMXA 3TA4D 3D36A 3U0TB 4JI5O 3BGFC 2L7QA 3RGHA 2HG5C 3WENA 3BUYB 3DO3A 4PJDB 1TOXA 3SGEH 2OTLV 3Q8FA 4EN2A 4OQ1A 4UT9L 3JZYA 5E5MA 4IDJH 2MOVA 5JPNC 1IC4H 3UCRA 3A21A 1YJDH 4U6XB 4IM8A 5D4IA 5HPMA 2C1PA 2UUCO 4OFIA 5EC1A 4DNLA 1KDJA 4HFWB 1QFWM 1WNSA 1ILSA 4U2ZA 4F9LA 1AIFA 5MEPB 4I0XA 4YUEL 2VR7A 5D5MA 3ZTCC 3CWGA 4L8DA 3D30A 2XWCA 5KAIZ 3WTTA 5EBLB 3P4MB 1FFXA 3HPJA 3L71H 3P9MA 4CBZA 4RA3A 3JD1A 1GGTA 2NX5E 2Q9OA 3ZIMA 1FC1A 4HUWB 3WFHB 2B08A 4LH7A 2CPCA 5EU7C 2CGRH 1CGWA 4WHTA 4HEPG 4KK6D 2RCSL 2G2RA 5I76A 1R3JC 2EC8A 4IHJA 2ITDC 4IJ3B 3FTXA 3TL5A 3UL4A 2BCKB 2UWEF 4OLXL 3GM8A 4ODSL 4OKVB 5D5QA 3FTZA 4HH8A 1A7OL 3CPUA 4IRSC 4H1LB 4LEOB 4NKMA 2LVEA 2HPOA 4LP4A 1PP9H 1DO6A 4IOFC 5MHSE 3FAWA 1KCWA 1NIEA 1RPOA 3VXQA 1Q6IA 2H8PA 4X50A 2LGQA 3T4YA 1W16A 4KO9A 3L3GA 1H3WM 3QZPA 4R2GB 5DFTA 1CLVA 3SYCA 1DK1A 5DJZA 4YMPA 3NTCL 2R56H 2NY0C 1UEYA 3O2WL 1VRSA 4N4YB 2ZKWA 4ZX3A 2VDKB 2BO0A 3SCMA 3E8FA 4FNQA 2B0SH 3C6LB 1OB1A 5AW9B 3T3PE 2R7EB 4KRNA 4XNZC 5F0PB 3LHPL 5E00B 3QORB 2WD0A 4TL4A 4C4KT