3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
3DTUB 1J9QA 4UANA 4PCYA 4YSSA 3N55A 2PPDA 2AZUA 2VSKB 2UXGA 1L9TA 4W1TA 3T71A 5B7EA 4W9ZA 1AS6A 3TBCA 1NIBA 4NERA 4HHGA 1B3IA 5D4HA 2YAQA 2W8CA 1E67A 2CALA 4YSRA 4E9WA 5IY5B 2BHFA 5PAZA 3FQYA 1L9PA 2H3XC 3QJSB 1FA4A 1IC0A 1BXAA 1F56A 1J5DA 3CVDA 1AZNA 2R7EB 4HCFA 1EZLA 4GP5B 4PAZA 1GY2A 3AY2A 1SDDA 4A68A 5FC9A 1ET7A 1GW0A 1V10A 2QDVA 3PXLA 1L9SA 3FU9A 2GC4C 3ZBMA 1BEXA 3PLYA 1PLCA 2B08A 1AG6A 3UGEA 4G7QB 1ET8A 1OCZB 4HALA 5B7MA 2IAAC 2EIKB 2VM4A 3ABMB 4YSEA 3FS9A 2FT8A 1VLXA 2BW4A 1IBYA 2E86A 4KO5A 4Q89A 1I53A 4M3HA 4FAAB 1PZBA 1W8EA 5I6NA 4F2FA 4HZ1A 3TA4D 5I6PA 4KNSA 2BWIA 1AIZA 2UX7A 1AZCA 4QLWA 2IDTA 2Y69B 1W6LA 2XYBA 5B3SB 3FQ2A 2HX8A 3H4HA 1WA0X 2AFNA 4YSDA 4L0PB 1MZZA 2FQGA 4A2GA 4E9TA 2XX0A 2PPEA 3AW5A 4YVUA 3WNIA 1KYAA 4ENZA 1NIAA 3ABKB 2GIMA 2YXVA 3ABGA 3FSVA 2JKWA 2I85A 3GYRA 3JTBA 1A4CA 3T6WA 1TEFA 3CVCA 2R7EA 1GR7A 4DP1X 4DPAX 2YAOA 2XU9A 3FYIB 2VSMB 3WKPA 2DYRB 1JZJA 3X2QB 1CYWA 2MTAA 2XX1A 3FPXA 1WA2X 1XB3A 1N68A 2FWLB 1ET5A 3NT0A 1SFHA 1NICA 3ZDWA 2JFCA 2QPDB 3V9CA 1J9SA 1PLBA 1JERA 4KOBA 4AKOA 4K9JA 2BWDA 1SHWA 4N4YB 1CC3A 2J56A 1AANA 3H56A 1L9RA 4YSUA 3DKHA 4E9YA 2ZWNA 4DP2X 2PPAA 3G5WA 2J55A 1JZEA 5D4IA 2X87A 3S8GB 5I6KA 1CYXA 4Q8BA 5B1JC 1OCCB 3ASNB 1KV7A 1XB6A 4A2FA 1JVOA 1BYOA 4P5RA 1KBVA 2GB2A 2EILB 2W88A 1E30A 3FSWA 1GY1A 3EHBB 3C75A 4HCIA 6PAZA 4UAHA 5AFAA 1IBZA 2PP8A 1OE2A 2UXFA 2IDUA 3NSDA 4YSPA 3IEAA 3OM3B 2HZHA 2MRYA 4NB7A 2QPEB 5B7FA 1X9RA 1OF0A 2XXFA 1URIA 5B1KA 1X9UA 2LLNA 2VM3A 2VW7A 2J57A 1RCYA 1A65A 3KW7A 3TBBA 3PAUA 1V55B 3NJNA 1JZFA 3ZIYA 3PAZA 2XVBA 4G7RB 3NJHA 5ANHA 3WKQA 2TSAA 1KCBA 2BZ7A 5EHFA 3L45A 2FT6A 2I7SA 3PAVA 2IH9A 2PP7A 1NDTA 3AG4B 3OMNB 4F2EA 1WAEA 1SNRA 3ASOB 1JVLA 4WTQA 1BXUA 1BAWA 3X1NA 1JXFA 1ZDQA 1WS8A 1HFUA 4X4KA 1PZCA 1BQRA 1MZYA 3NP4A 1WS7A 2IDFA 3X1EA 2ZONA 1CUOA 2ZOOA 4DPBX 1OV8A 1ASOA 1JXGA 3S3BB 3V9EA 1A3ZA 1OCOB 2YEVB 1PNDA 5AZUA 3OD3A 2TSBA 2B3IA 7PCYA 4A67A 3NJLA 2H47C 3ABLB 3MBWB 4BK5C 2VN3A 1NWOA 2WO3B 2IH8A 2HLEB 1KDJA 5I5IA 1OCRB 3PCYA 1FFTB 2CJ3A 3GDCA 1SFDA 4G7SB 2IWFA 4AI7A 1SF3A 4DP4X 2CCWA 4BDVB 1AOZA 1AACA 4HHWA 3S3CB 3FU7B 2Y1AA 3NJGA 4A2HA 4YSOA 3FYEB 3CDZB 1AZUA 1JZIA 2AVFA 4AKQA 3NSYA 2XLLA 3RYMA 4TXVB 1OOWA 1NIDA 5I5MA 2J5WA 1KBWA 4BWUA 1QNIA 3T6VA 2ZXWB 1PF3A 2BZCA 1RZPA 2IWEA 1GS7A 1ZDSA 4QKTA 4BXSV 2EIMB 1ASQA 2XWZA 2Q9OA 1ILUA 2XXGA 4DP7X 4RH4A 1ZV2A 3NYKA 1V54B 4DP6X 3U25A 1ETJA 1JOIA 2OCCB 1IKOP 2UXVA 1XMEB 4UF7C 1QLEB 3H4FA 1NZRA 1AAJA 1PNCA 1L9QA 1E65A 4YVNA 2GHZA 4FA7B 2YAEA 2IDSA 1BXVA 4EF3A 2WO2B 2FNWA 5A7EA 1KGYE 1GYCA 3QJUB 2JXMA 3GXUB 1TU2A 2GI0A 1PY0A 2I7OA 3X1BA 2YAMA 4E9XA 1NPJA 1JZHA 1PMYA 4E9SA 2GSMB 1NINA 3FSAA 1W6WA 2PLTA 4A2EA 4CSZA 2FQEA 3SBPA 3WI9A 1E5YA 1PCSA 3KW8A 3EH5B 4BDVA 2DY2A 2UXTA 3EH3B 3FU7A 3NSFA 4GYBA 1N70A 1AS7A 3N2JA 2NRDA 1YLBB 1RKRA 3CDZA 2XV3A 1MDAA 1XB8A 1A8ZA 2DWSA 1J9TA 2YXWA 4P5SA 9PCYA 3NP3A 3T9WA 2HRGA 2PCYA 4HIPA 2GC7C 2BP8B 3WNJA 4YSTA 3NJMA 4HCGA 3QQXA 1ID2A 3NJFA 2DYSB 3NJKA 4GXFA 1NIEA 4YSCA 5I28A 1J9RA 4KO7A 2AANA 3FPYA 3FSZA 3CG8A 1DZ0A 1DYZA 3QJQB 3S8FB 2OJ1A 2YAHA 4YSAA 3OMIB 2HX9A 3FT0A 5I6OA 1KCWA 4YL4A 1SF5A 2HRHA 1PZAA 2YAPA 4GY4A 5I6LA 5PCYA 3OMAB 2YAFA 3WIAA 1HAUA 4G72B 2BP0B 3ERXA 3X1FA 1M56B 4GP8B 5B1BB 5F7AA 1R1CA 3FU8A 3QPKA 3SBRA 3OQRA 3IBOA 1BYPA 1ZIBA 1OE1A 2P80D 3T6XA 4BWWA 1NPNA 3PPSA 2XUWA 1PAZA 1T5KA 3NSCA 1A4AA 4CSPA 1AQ8A 4JHUA 2BW5A 4E9VA 1M9WA 2FQFA 1WA1X 5AKRA 3BQVA 4A2DA 2IDQA 1AS8A 4M4RB 1FWXA 1KDIA 4MFHA 6PCYA 4KOCA 1HAWA 2BP8A 2VW6A 1SHXA 5I5JA 4AZUA 5B1AB 5D4JA 3S3DB 4AKPA 1AG0A 4GP4B 5TK2A 2BO0A 2PP9A 1ASPA 1JXDA 2PPCA 4JHVA 1QHQA 5LDUA 4F7KA 3WG7B 2CUAA 2YQBA 2IWKA 1RZQA 1JZGA 3UAEA 3BVDB 2FJSA 1AZRA 3NJJA 3IN0A 4KNTA 1OE3A 4KNUA 2YARA 3SQRA 1ADWA 2XV2A 1UATA 4DPCX 2AZAA 3T6ZA 1MG3C 1E5ZA 2Q5BA 1AZBA 1L9OA 3DIVA 2BP0A 2QDWA 4BXVA 3CVBA 3D12B 2DV6A 1J5CA 3HEIB 3AG2B 2P80A 3IE9A 2A3TA 5F7BA 1NTDA 1TKWA 4BWTA 2CBPA 1AR1B 2HX7A 3UACA 2DWTA 2OV0A 4G71B 4AX3A 3AG3B 2H5UA 1A4BA 4KO9A 4HAKA 3X1GA 3FQ1A 3UAAA 3NJIA 4DP9X 4NAJA 3UADA 8PAZA 4N8UA 1PLAA 1GS8A 4DP5X 1GS6X 1SJMA 2VMJA 1BQ5A 3QJRB 1MG2C 2QT6A 1TEGA 4G70B 2PPFA 3UABA 2CAKA 3EF4A 1GSKA 5E9NA 4E9QA 3HB3B 2RACA 2VW4A 5I6MA 5B1JA 1ILSA 1NWPA 2FTAA 2WSDA 5TK4A 1SDDB 3IN2A 1NIFA 4JKNA 1BQKA 4E9RA 1ZPUA 3ZX1A 3CZUB 4WKXA 4ZK8A 3TU6A 7PAZA 1M57B 2X88A 1IUZA 2HXAA 3AG1B 2UX6A 2FQDA 2FT7A 1ZIAA 3MX0B 2N0MA 2PCFA 3SBQA 2EIJB 3TASA 3QJVB 4DP8X 2EINB 1EHKB 2GBAA 4KO6A 3JT2A 4YSQA 4A66A 2XV0A 3AZUA 3EH4B 1CURA 5I26A 3QJTB 4DP0X
chains in the Genus database with same CATH superfamily
5CIPH 5DC2A 1XF2A 1OAYH 2YRZA 4GNKB 3DJTA 2AITA 2ENPA 3DVNB 1HQRB 3APOA 2FEDD 3Q6GH 4JY4A 5GS3A 5CAYB 2UXGA 1GA2A 2F19H 1Y6KR 5KYUB 2RQ8A 3L9EA 4V1DA 4OJYA 3OPZL 4MDIB 5F8RC 1UJ3B 1HXYA 3ETTA 2NY6D 3JVFC 4TUUA 4ABVA 2DN9A 5A6MA 4F7TA 4C47A 4NN7B 1YN6B 2IBGA 3OSVA 4HCRA 2KDYA 3RI5F 4NTYA 2PWGA 5HHQA 4LHUB 4PLNC 1KC8W 5GS0H 4DRXA 1WPBA 2ID5A 4ZUVB 3D0VB 3ZR5A 3ZKND 2JLPA 2VTFA 3ZL2A 3BUBA 1L3NA 2KQNA 3DHUA 4LLMB 4B96A 1ET7A 1Q9KB 1DSFL 5EZYB 1RIHL 2AI0H 3QRGL 4PV8B 5HYSB 4AITA 5CZXC 1IM9B 3BPNC 1P4IH 4XODA 3MV7E 1HHJB 1QKZH 2Q1EA 4N2DA 1H9DA 4N6QA 2XFGB 1PLCA 3UOAB 1FNAA 3KHQA 4JFXA 4HG4K 3FHAA 3EFFK 3K1DA 1F4YL 1AG6A 5F9OL 2R9AA 1BSMA 1AD9A 5IFAH 2C2AA 4EO5A 1YNKL 2Z7WA 1OAKL 1S9YA 2B7DT 4K2UL 1BZ9B 5IFJB 3QS3A 4JAUA 4YE0A 2IU0A 3H1LH 1GC1H 1SYVB 4UV4H 1YYML 3ZSSA 2P45B 3BPCB 2X4NA 4FZ8L 2K9UA 2ORBH 3ILPA 2YPVH 3HPJB 1CI3M 2VQ4A 1G7QA 4U3SB 1HHKB 1X5HA 5ESQA 2ZAIA 2NNFA 2V7QG 1EZUA 4XXWC 2GUZB 1SOXA 2Q8AH 1P5VB 1ZE3C 3FBKA 4GUPA 3PWPB 2EEDA 1FYHB 2JJVA 1LO4L 2ARWA 2B15A 5E2WH 4PA4A 1XF4A 3CSYA 4H44C 3S34L 3RN4A 4NBZB 1V55C 3IJEB 1S3JA 3ZTCC 3ZMRA 1FPOA 2OAAA 4DV5O 2PPEA 1WCQA 4N85A 3ABKB 2WXQA 2GIMA 2J5LC 4MXQC 4NFCA 4PJ8A 1NAKL 4U33A 4ZQKA 1E9OB 3V5HA 1JP5A 3H9SE 3DHPA 5LHDA 2UXDO 3G6EV 2FB4L 4ODHL 1H3TA 4AVKA 1T03L 4EN3B 3VGDA 4GUQA 3MLTB 5CA0B 1R3IL 4W68A 4U1MB 3RVVD 1SDYA 1PVHA 3WOVA 5IHWA 3V6FB 1JZJA 1N26A 2WY3B 3GXIA 1H6FA 4NRZA 3LKOA 2IPKA 2FWLB 3DNKA 5DRNA 3GIVB 3WN5C 1DLFH 1WIPA 5AKTA 3T04D 3WSQL 4ACPA 1XIWB 2VISA 4FM0A 1K8IA 4XCNA 4Z5RB 5KVFH 2JCCB 4CN4A 5DT1L 3W0WB 3E38A 2BWDA 3K5LA 2NY3C 4EBQL 2OMTA 2AXJA 1KBBA 2IPTL 1AY1H 3ARPA 4RMQA 4KH2A 1I1YB 1BOYA 3B2VL 5CU9A 5EN3A 5F7MC 5F7YC 1VSCA 2D8KA 1ACXA 3TBWB 2QADD 4GAYB 4OCRL 5D5ME 2NUTA 5EIIG 2YD5A 4KC3B 3ZBHA 5L6YL 1JZEA 1QP1A 2BSEA 4BZ1L 4E41A 2IQ9L 4WWID 1DK1A 1KJ3L 1TZGL 5D72H 1EMTH 4FNUA 3QDMB 4GG6F 3B2UD 4RETB 2A9AA 2ZKXA 2ESVA 2L8AA 5E00B 2EADA 2VO5A 1U42A 3N43F 3VD9A 3DRQB 4LF7O 4FFVC 3ZHRA 1JVOA 4NO3B 4O58H 4X66O 1WE5A 4OZFG 3HG2A 3MRRA 2Y06L 1FD9A 5AWNH 4FQ1H 4BK8A 1KJ2H 2NTSP 1JZ4A 3IGAB 3D34A 3JAKB 2BNQA 3AY4C 1VEPA 3HRZC 3L8QA 3WDJA 2MRYA 4TL5A 4PG2A 1EDQA 1AZZC 3CC5B 1QR8A 4KK5C 4I9WD 2A9HA 4ICXA 32C2A 1ETZB 2KHAA 1FDLL 3NAAH 3EXAA 2CLZA 2F18A 4GQZA 2XOKG 3KM2A 1LMKA 3W2DL 1GZPB 1JZFA 4K94H 4JHWH 2VDNL 2HJKB 1Z9OA 4MNQD 3OAWA 3IJSB 4PJIA 1MJ8L 3L45A 3O65A 2XN9B 5I1IH 3F12A 3IKKA 4CU7A 5DFVD 4X5WA 4F2EA 5BW7A 4MDRA 1X5IA 1JVLA 5KVGL 4OPHA 1SJXA 1WSST 1XCQA 1Q0XH 4YHYB 2RALA 1QFWI 3LZPA 2JIXD 4YX2L 3KPQB 4X4KA 1VKXB 1WS7A 1KCUL 3OUFA 1BAFL 2VXVL 3HZYB 1N4XH 3CXHJ 4RQEA 1CUOA 4WUKH 5LDSA 4MKTA 5EN2B 3OB0H 2X4RA 4JFFA 3B8YA 4JRXD 4HWBH 4YFDB 3ULVF 3GC3A 3PDDA 2O5ZL 4Q14A 5EUOA 3W5NA 1OCOB 2PWEA 3GSNH 1WYJA 3O4OB 5E6IC 1I9JL 4JY5H 1IGTB 3VH8G 1XTMA 4JO3L 4RGMB 1NAMH 3D39A 5BUPA 4NCC1 3FQXB 3NFNA 4XO9A 1MCDA 4LL4A 3TF7C 5LLIC 4NBXB 1KDJA 2V7NB 1WHOA 5KA5A 5HFLA 3GKZA 4MJIE 2Y36L 3QXDB 5ISZB 5E9DE 3OHXC 2XTLA 5D7JD 4TV3A 3LD8C 4HFWB 4GKZB 1UFGA 2FO4B 3S36H 3O4LE 3WUWA 5CSZB 4H88L 1ZSHA 2RN9A 2XVGA 3CCHB 2B3RA 4MJ4A 1HIMH 4AJVA 3DBXA 4YNYB 5IQMA 2NMSA 4QXTB 2KLRA 1V3MA 4NGHH 1ZJBA 2UY7B 3SKMB 4APQD 4BFRA 2E7HA 1JMZA 3GI8L 3ECBA 3OLDA 4G6FD 3HE6A 4W9DC 4M62H 5C08A 1FI8C 2ZXWB 3E1ZA 1J5OL 4HUVA 2HHHB 2LU7A 4OZHE 5B8CA 2GBTA 2AZ2A 1GMIA 3IF1A 1BDYA 2EDNA 3ZRVA 3GMMA 5LCVH 3S2CA 3MCLH 4JVPA 2DWEC 5EIIB 1G43A 1RM1C 3LSQA 3WFCH 4AYFA 5I76A 4XNYL 1Z5VA 2YKLH 3JALB 1OAZL 3LNIA 1F1DA 2J8UA 3O3AA 1NOFA 4JFZH 3HG1E 4RGNC 4FADA 1UWXK 1SDAB 4M6OL 2WAHA 1GC1C 3QUYD 1WQVT 1I1FA 4I3RH 2DLEA 3C8DA 1NCGA 4DESA 3MJ8A 4R2GD 5L2KB 5E1QA 4HLZG 3V0HA 1ZV9A 3QJUB 3ETEA 3X13B 1HWGB 2R2BA 1T1WB 4YUEH 2MQ0A 2YAMA 4XPFH 1IDSA 1UFUA 4K8RL 5D1QE 3F01A 1JZHA 2NCMA 4ZMOA 1NINA 1LK2A 2HMIC 3UZQA 3CCLV 3C5SA 2F4VO 3BD3A 3C2AL 2DQJH 1UM6L 3L3KA 5EBLB 4CDHA 1BZOA 1MRFH 3UTQA 3WDIA 3MRIA 5JDJA 3NSFA 5HD8D 3RUGF 2FSEA 3BX7C 1AS7A 2BNUB 3AREC 4L2LA 5FAAA 3MRHA 3Q2NA 4BIKA 3RGVB 1NLBH 1R5WB 2G2NA 2YXWA 4KHXH 1BL8A 4XBPA 4ZG1A 1H3VA 5GS1B 4GKSB 1JGDB 1TYJA 2OSXA 4LU5L 4YSTA 4Z7OF 5IHZA 4HCGA 4J7RA 1E4WL 3TLRA 4LBAA 3ULVD 3O6ML 3LSUA 4WW1A 5C0CE 2L7JA 4Q58C 3PF2A 3FQUA 3DETD 4XX1E 5JXEC 1HJBC 1EBOA 3FPYA 4XMUA 4I85A 4KJQD 2HWZL 4IGBD 1A7OL 4YHIA 1M6UA 1CDUA 5JO5A 4UYQA 1DVFC 3WMPA 1PSKL 3CFNA 4GT7A 1TZIB 1U3JA 1XZWA 2YPLD 3VD2A 1J9CT 1IRAY 2RTTA 3JTTA 3QA3A 3OMAB 5JOFA 1YDPA 1G87A 3ZDYB 2R56L 2NXYB 4PELA 3AFLA 2FUQA 1K3IA 3FCGA 3NZHL 2Y6TE 2I27N 2XQYG 3VI4F 3T4DA 3DX8B 3QXTA 3NVQA 5EF1A 3OKLB 5AW3B 4JNXA 2NY0B 2V2XB 3BKJL 4G7YL 4JLRB 4RCAA 3QPKA 1JZ6A 3T0VA 1QYGH 3RA7H 1J05B 1ZVSA 4B53A 1KT2A 1TVHA 4UOQA 2CE4A 1JE6A 2E3VA 3WO4B 2NY5L 1MMMA 1XL4A 2XYCA 5F7NC 4ZMAT 3V0VA 3ARXA 3E3QC 3RWEB 1CLCA 2VDLH 3ZLQC 1XREA 5C0RL 3FXIC 4PJEE 3MMEA 4KKRA 5AKRA 5DRXA 4ZODA 3FFCD 5E4OA 1HC1A 1D5ZB 5MP6H 5JORA 2WCSA 4J3VA 1OTUD 35C8L 2G60L 1OP5H 4OX9B 3DYMA 3SDCC 4HOZA 1T1ZA 4WSKA 4Y1SA 3BY6A 4IRSB 4FRWA 3RYIA 2KZBA 3TBTA 4JO2H 5ALCH 3FT9A 3J7AU 4MA1B 2AK1L 2BLFA 2BY1A 4U6TA 1SZTA 4AEHH 4F15C 3VFSB 2ETWA 3NGBC 1S7XA 2WVUA 3QVNA 1AG0A 1VADA 3B9EA 4J3SA 1QHQA 4K0KB 3UKMA 1CU4L 4ZOLB 2CHZA 5C1MB 3E86A 1KFGA 3QUMA 3NCYS 3GQFA 4LSSL 3SCMC 8FABB 4PA9A 2R23B 5IGXH 4XHJD 4KZCA 2G2RA 1KNOA 2P4VA 1MXGA 1D5IH 2WA4A 1U4FA 1D6VL 5DGQA 2EH7L 2XWTA 3GKWL 3DUSA 5HJDA 4YHML 1DVSA 4GYCB 2EXYD 2GAZA 3AXLB 4D94A 4BH7B 5CHNA 2X4OB 3T6ZA 4PUBL 2EIZA 2XICA 2O5NA 3P0VL 3QIBD 4J3OC 4PVNA 5DRZA 2ADJA 3I50L 2ZCKL 1SLWA 3NJXA 3BEWA 5CBAB 1KB9J 1A14L 3T2NH 4PRIA 3TA3D 4E0RB 5DC4B 3C6SA 2DM7A 5AYUL 3KPOA 1JN6A 5HDRA 2B9BA 2DV6A 2QV4A 3J27A 2B1GA 3GFUA 4DUZO 2X4UA 5FK9B 1CL7I 1BAGA 1BM3L 3VXOB 3AVEA 1TKWA 2DQGH 5I1LA 4ES8A 5FO8A 1A9EA 3AG3B 4UIMB 2QR4A 3T1HO 5KVDE 4FG2A 1Z2GA 2YIBD 4I77L 1J0HA 4EDWH 4G8AC 4W6WB 3WL9B 5E1GA 5ABDE 1L0LH 5GGSA 3P54A 3FB5C 1FCCA 2VLJD 1JHKL 2RAMA 3WNLA 4B5ZA 3J80N 1D2PA 4KZ0A 4V2BA 2BSBA 1GS8A 4X5XA 5TFSL 2VMJA 2XRAH 4L9LA 2VIRA 4HT1L 5KAIZ 5DJZB 3VNYA 5A2CA 3L3IA 2B77A 2WKOA 3M7FB 4N2FA 4JZ2A 4XPAH 4AMKL 3GSRA 4BQ9A 4PLKD 1S6NA 2GG1A 3ZMZA 1BD2A 4L5FH 3BWUC 4U1HA 5C0BD 5BRZE 3HB3B 1UZ6E 4AQ1C 3VMPA 2VW4A 4Z95H 4LF6O 2JI3A 3T65A 4TVPE 5FLVA 3MGAA 4JFEB 4I9QA 5TK4A 2QEXV 5KW9H 5KZCD 4J2QA 2R2EB 1DQDH 2Y2TA 5DJ6B 4A6YB 2APVA 2IPUK 2L0DA 1F3DJ 3N2GA 3UT5A 3I55V 1YTFD 5HGDB 3JARA 2APSA 1JTOA 1CD9B 1KIUB 4DKEH 2X2JA 3A4AA 1ND0B 3QWNA 1UH3A 1KENL 4D8OA 2FQDA 4KAQL 4JO4H 2ZWZA 1A21A 3BISA 3FO9A 4KRPB 3HRZA 1NCAL 5DMYA 3FW6A 4AK1A 2Z1PA 2F95B 3TN0D 1XUQA 2FR4B 3X12A 5GSRA 2WYZA 25C8L 4TUJB 3L9BA 3MRQA 1AILA 3MV8B 4QOKE 2HJDA 4WFGD 1ITBB 2ZOKA 2KZ1B 1GGUA 5DVPA 3H3BC 3V6ZA 2OYPA 4Y4HB 2IBZX 1Z7JA 2X12A 2MKLC 3K8KA 5IY5B 2ADFH 5DSCA 2EEXA 4CVWA 4B97A 1UQSA 3LDEA 3D2UA 2BSCA 4IU3A 3VD7A 2YMXL 3SDLA 3QJSB 4HCRL 3MNZA 4M93C 1XSIA 1FFOB 4XDKA 3NSXA 3L3HB 4I87A 4MDJA 1F56A 5D7KD 1PKXA 5KOMC 3FB7B 3SE8H 1L8DA 5D93B 1OSZA 1WFUA 4GP5B 3U2IA 1ZHNB 3GK8H 5DJYA 4LF6B 5IMLA 4X6CF 5CIPA 2ADIA 1Y74B 5E6IA 3HFMH 3LH9A 3QI9D 5D2LB 2ZXEB 3H85A 5J5EA 2WMPB 1C08B 1ZS8B 5I1JH 3FTSA 4G6AD 5FGBA 3UMTA 4LAJH 1TZHB 3TJTA 4YBQD 3L13A 3MDJA 1WK0A 2GQHA 2B5IC 3LVEA 4IIJB 2QWNB 4MQXC 2ZE0A 3OHXA 4RAVB 2AERT 4DO6A 1OF2B 3O9WD 3FCSB 1I8MA 3Q6FA 1K33A 5FYLD 4LCYA 3IMSA 2DI8A 1CLZL 1NGWB 2FWSA 2CBTA 4MRCA 4NWTH 5C0EB 3FK3A 1QRND 2DWYA 1MFEH 5LXGL 4PSPA 4X9BA 4ZFZA 5L3DA 1PZBA 4X20B 4LVNB 4IT5A 1YEIL 2OR9H 4QF1B 4ZS7H 3BA8A 3HI5L 1ZGLB 1O7SA 2VLKA 4PJGF 1QPXA 1MFUA 3TV8A 5AW1B 3B7YA 1IL1A 2V0AA 3E8BA 3B9KC 2J1KA 3TBVB 1U8JA 2CKBL 1XXDC 3IU3B 3RQ3A 4F4LA 5FYJL 3CFKA 2DLHA 3OEEG 5E99L 3BEVB 1H2MA 1Q8MA 3FAXA 5LO7A 4URKA 4PJ6A 4OJFH 5FOJA 4N2IA 4GX1A 2JS3A 3UAJD 4A2GA 2COQA 4ZS6C 1TAEA 4Y16D 3I6GA 1UEMA 5FM8A 4ENZA 1H3GA 1HH9B 1P5UB 2FX8L 3K7UA 4OFKA 4OCWH 2QGCA 1MI5E 5LG6A 2OZ4H 2F74B 2R7EA 3MVSA 3V5DB 3WS3B 2JGDA 4M5TA 1ZANH 1U96A 2DM3A 2X0LA 3D3VA 4FYSA 4WI6A 1IX2A 2EXWC 5HI4D 4K5PA 2XU9A 4UDUA 2BHUA 2PUSA 4E4EA 5G4MA 4A2MA 5CD5C 4HAMA 1K5NA 2R4RL 5E5LA 2DYRB 1NVPB 3DO3A 3LEVH 2YI9A 3X2QB 3L1FA 4NM4L 3PHQB 5LAXB 4DUYB 1FLRH 4NO2A 3V4LA 3LDDA 4PP1D 4OF8A 2AJYH 5D5PA 2PI5A 2ZQKA 2IFGA 2E76C 4L8CB 3IDIB 3LOWA 2PYJA 1DBAH 2W60B 3GXPA 3IJHA 5KS9A 3G5VA 4B3SO 4LLQA 4AH2B 2V2WA 3O3EB 4FJ6A 3HMWH 1NMBL 3FN9A 5GGRY 3ABLC 3BVVA 2DIEA 4GBXC 4PDVA 2ZWNA 1CDHA 3DUUA 4NLAA 2MFNA 1X44A 3P4OB 1X59A 5FGCE 1FXKB 1S7SA 1SQQH 4LKXB 4BIUA 4GT0A 2QTEA 4PS3A 1N36O 2F08A 3BZFB 4R4FH 4IBYA 5B1JC 3DRTB 5IOPB 5JXEA 3GLZA 2UU9O 4B3MO 3RL2B 1G9NH 3DIDA 3V5KA 4H20H 5ANMB 2CDYA 1KBVA 3FFOA 1DVFA 1NCUA 2DMKA 1W91A 4RX4D 4PJXA 3I75B 3HKEA 3LKRA 3MREA 3TCLB 5KSBE 4FIPC 1RIVL 1U3HA 4M8UA 2WIIA 4PJ9C 4WWNA 4LLYB 4YS4A 1QBZA 4I2XA 5B7FA 2BVQA 4YDLC 3S88H 4XP6H 3CHRA 3PDOA 4OIIH 5B1KA 2WCPA 1D5MB 1DJGA 2VABA 2D03L 4OKDA 1XHXA 5JR1H 1FAIH 3EGDB 1TQTA 4TOYH 4H44B 2BC4A 2RFXB 1V55B 4QRUB 1PKQA 3VJ6A 1DLBA 2XVBA 4AI8A 4Q20A 2CIIB 3US9A 4ELKB 2V9TA 2MPAH 4LF8O 4ZX6A 1XR8A 2BZ7A 4R83A 3X14B 5F8QC 2J2ZA 2PP7A 4HJJH 3ZYZA 4NZFA 4AGLA 5IWAO 2LR4A 4PGEA 2VAAB 1KJ2A 2BFVL 2XI9A 1G7HA 2NZ1A 3T2LA 2V3DA 1LDSA 1WS8A 4A6YL 3SDCA 3F7YC 3NFPB 2D73A 2HJLA 4NP4L 3D0LA 4PRHA 1I9EA 3WN5B 1R5VB 2UWEA 1V7ML 1MEXH 4Y5XA 1CDBA 3JAWB 1L9MA 2BRRH 1OAJA 2R70A 4DPBX 2X5PA 3JD2A 1ZK5A 3ZYIA 4I3GA 1ZLSH 4MB4A 1R5IA 1RZ7L 1KEGH 2YEVB 5SWZA 4RESB 1XCWA 4B3MB 1FXHA 2I5YH 2TSBA 1U8QA 2AF2A 4HQQH 4YFLI 3SCMA 3LZRA 4A67A 5EO0B 2VR4A 4ZFFA 3FT2B 4QE7A 1VQ5V 1RUKL 2NYYD 3PP4L 4Y1AB 3IDMA 4U1SA 2IWGA 1NT2B 3BP4A 2ZSVB 1J8HE 4JPWL 2P46B 2IWFA 4PJBE 4QJ4B 1EN6A 4JDEB 4X7FC 3LNFA 3BZEB 1ZT1A 1SEQL 2DZEA 4HF5L 4M61B 4X8JA 5D1XD 1FVDB 5E4IA 5ITBL 3T4AB 1SLUA 3J8F7 4JFTA 3GRBA 1JWMA 3SDDD 3T0ED 5E08L 4JI4O 1DCLA 4X88A 3NCEB 3OAYK 4XNZC 4FN0A 3NSYA 3UBFA 3GT6A 4HWBA 1IBKB 5GGQH 5D7HA 5FKAB 5BQ7A 2F58L 2DN7A 3GSNA 5BZWA 5I17A 2E4TA 5GGVL 4LMQI 1NAMA 3AQXA 3D69B 3X3FL 2BOCA 5C0IB 1O9WA 4YXWG 3MLWL 2IWEA 5A1AA 1BFOA 4NC1E 2P24A 1XR9A 3MRDB 4QRSB 4TNWK 4XVTL 5H37G 3W9EB 2CMRL 3IC9A 3NCXA 3R06B 5AG2A 5MEOB 3BHBA 2ZX7A 1R6KA 5JW4N 1MJJB 3GBEA 4HGWA 1UA3A 4CS4A 1T6BX 3THOA 1X7QB 4HUKB 1LP9B 1XSOA 2IQAB 5EULV 4BYHA 4JG1H 3ARFD 4J4PD 4KI1A 4AQ1A 2ZCHL 2GHZA 2J71A 3B1TA 3CCSV 2R72A 3FONB 2VQTA 1QTPA 4U3XA 1G0XA 5A40E 5FO7A 1UD5A 5EIBD 4AGNA 3GXUB 1Q6UA 1FJ1B 4Y9BA 5C07A 3FO0L 2PGGA 1TUBB 1NPJA 3MBWA 4BR6A 1IAKB 4Q6KA 4DOHB 1YMMD 4C7UA 1INDH 1ZPLA 5K9OB 3Q1SH 2DQUL 2J12B 5LCVA 2GITA 4K3HA 1BLNA 4MSWA 4BBWA 2PUQT 1PCSA 3KBFA 1DUYA 2HKHL 5FHBL 4P06A 4NPKA 2F8VA 3KVDD 1QSFA 2B1AL 3LN5A 1A8ZA 3U6XA 4MVZA 4M1GL 5DXWA 3PWJA 2J6EL 3NABH 2GJZA 2HRGA 2VXQA 3ZSTA 1PD0A 1YEJL 3V52H 3DA0A 4XT1C 2XNDG 1A1NB 5LWYL 3OEHG 1ID2A 1H2NA 1F02I 1I31A 2XXCB 1NGQH 5I28A 3OF6A 4QO1A 1JFHA 3LHAA 4YHHB 1K97A 4B41A 4LAQL 4GW4A 3HC3L 1RFDH 2HX9A 3QJZA 3Q43A 4PLJD 3FT0A 3KPMA 3DGGB 1Q3EA 3CH1A 5K39B 2B4CL 1SA0A 5DDHB 3ZO0A 1KXVC 1G9HA 5H94A 1IBHA 5E94A 4X5RA 2EDDA 3FCTA 4R7DA 2XAQA 2YAFA 4F6RB 1LNUB 1KTDA 3WDHA 1QFUL 3DO7B 5CCKH 2ITCA 4H8PA 3AS2A 1YEHL 4JFUA 3HE7C 1MCWM 4WV1B 2N0KA 4DZ8A 4IHJA 4PCKA 3NQIA 2DWEB 3TIDA 2EACA 1LE9A 4IBWA 4QXUL 5FYJU 1HZHH 2WLZA 2A79B 4KH9A 1BSIA 1Y18A 3SOBH 4B9CA 2X6MA 1KBGL 3APNA 3KL0A 4MJHA 4X4ME 1FFPB 4FI8A 1T4KB 2FQFA 1NR7A 4C83A 4Z3HA 2R9RB 2K6YA 3NA9L 4NZUH 4MB5A 5I71B 4JPQA 2RA1A 4H8WH 4L8DA 4BFFA 2JXMB 3AWEA 1OAQL 3HKBA 5K9KB 3W39A 2CTPA 5AVWB 5DD1L 1HNFA 2HLDG 4ZSOB 1N0NA 3E89A 1G7PB 1IC7H 2X6BA 1NKRA 2X4QA 3VXRD 1JPTH 4NQEB 2DQDH 1MIML 2R69H 2UUAB 1MHHB 1QSEE 4LCWE 5D4JA 1QNZH 43C9B 5TK2A 1IT9L 2B1HH 3MRPB 4X1KB 2TRYA 4QIWF 4Y19D 5EO9B 5J11B 1G7LB 1T20A 1K73W 2OMUB 1F6FB 3B9KA 3KCPA 3ZDXB 3W57A 4F24A 4XMPL 2V9QA 4XP4H 3QUML 3UAEA 3HCVB 3K6IA 2YWYA 5L7XH 2NDGA 4G8FB 4CU8A 5JHAA 4HJGB 1KKDA 4PJFF 3JD1A 4MD0B 4K0OA 4Z7VF 3GJEB 4KNUA 1K2DB 3IJYA 3BDBA 3CJHA 5LP6C 5DMGD 3KEDA 2PTTA 5LOVA 4HYTB 2DOCA 4DR7O 4PREA 1L9OA 5D5QA 3CX5J 3GUFA 3VSTA 4X98A 1RSYA 3SJVB 5J1AB 4HXBL 3VDAA 4F7PA 4S0SD 5D7LE 4ZW6A 1M1XB 4QRPA 1J1PH 5EYPB 3EYQC 4NHUB 3K71B 1JRHI 4AGOA 4OT1L 2EDFA 2QHRH 4KGJA 3MV9D 3RVWD 3UADA 4LHJB 1ZLWH 2P43B 3FU6A 3W9DA 3QP3A 1MUJB 3TS8A 1DJSA 1MCLA 3BN3B 2DF3A 3B2EE 1GS6X 1WC7A 5HGBA 1CFQB 3CSBA 5KVEE 2A5UA 2LE9A 2YSSB 3ALWA 3I6LD 4GBXA 1GZHC 4LSDA 4ODXB 4ZMXA 3N44B 4GKLA 4ETQA 4I55A 4L29B 4QT5A 4MMYB 1YF2A 2CTWA 1KN4L 1XGUA 4G7VH 5K9JH 2NX5D 3NPSB 1JR9A 1MWAH 2XASA 4XNMB 4GX5A 4JI0B 2B39A 4CN1A 5B1JA 2XPGB 4A7QA 4S1SL 1BGXL 2BH0A 5F70A 2DIJA 3GMQA 1Q82W 3W0WD 4ZJ9A 3EAKA 2H0JA 1TSHA 2BZDA 1P7QB 4DWHA 2EDJA 3ECWA 3P11L 5LVEA 2IGLA 3NGBB 2PCFA 4ODSL 4P2QE 4PJ9A 2HVJC 3QJHA 3QDMD 1I1AD 2FO1A 4WFEA 3JT2A 1WZAA 2IOOA 4MLIA 3K2UL 5SX5K 1U8NB 1QVGU 4S1QL 2DI9A 4NQSA 4AW4A 4MQSB 5L8JB 2EYTA 3EJPA 4JHBA 3WJMB 3U7YL 1PDKB 3QNXB 2XUMA 1EDHA 2SODB 4MS2A 3GMOA 2H2PD 1AGDA 2PPDA 4OCSL 3UDWC 4KVCH 4ABUA 4A55A 4JFHD 4B9GA 2NR6D 3D8CA 2HSIA 2QTOA 5DR5L 4M6NL 1WWBX 1IBGH 5SWQB 5E24E 2CBOA 1EZSA 5CJXC 5EU5B 5MEND 1CR9L 2NY2C 2C3GA 1AH1A 2Z93A 1J95A 3QH3A 4NQXA 1CF1A 4R6ZA 2GCYB 5B3JF 1F4WH 1R3JA 3MRFA 1C16A 5JYMA 2EDRA 5DVKA 2OCCC 2V4LA 1M05B 4L3ED 1HCYA 2UXXA 4HIIB 2VC2B 3HZMB 3HAEB 2XQYK 4JZOA 4N90E 4JRYE 5J2TB 3CFEB 3TL5A 3HN3A 3ZT7A 1EZLA 4JJ5B 1RSOA 5KANI 4GX2A 3FB5B 3SYAA 3VB9A 1X5FA 4ABMA 1SDDA 3QPXL 1VACB 4BZYA 5ESAB 4R4BB 5FFLA 4F2MA 2P48B 5A2LH 2X0UA 3P3TA 3ZBMA 3BIKA 3EJYC 5DK0B 2EVGA 3WE6A 1OQOA 5IB1A 5J4MA 1JF6A 4FFTA 3HNSH 3KDMB 2AK4B 2OYMA 3VFPB 5B7MA 1A2YA 5I1GH 5T33L 3CMOL 3GSUA 3UROR 2E27L 4OTXH 2VR7A 2YEZB 1LTXA 2R1WB 3OJ2C 4NBYB 5IV2B 1KULA 2D9CA 3KPRB 4DGVL 1JVKA 4GJTB 3EFDH 4YFEA 4KY1L 1UB5B 1SXZA 2N7SA 2PW1B 5I1HH 1FGVH 1QI4A 4DR1O 5ISZD 1DN2A 2XWEA 3IMWA 4A04A 2XZZA 4K3EH 4HLJA 1SM3H 1U93A 1X4TA 1TNMA 4KK8D 1P4IL 3BZ4B 3LMJL 3GMPB 2Q67A 2W65B 2HX8A 4ISVB 4HIJB 2Q9LA 1O5DT 5L88L 1GAFH 3X3GL 5AB0A 3LS5H 3QUXA 3ZEDA 2NZ9D 1RAMA 5F1NB 5LJYH 2IAND 5IFAL 3WNIA 3KBHE 3BDXA 1VFAA 3ZHKA 1U8CA 4UMSA 3B34A 3QIUC 1EV2E 3ZN1A 1F0LA 2V17L 1FPTH 3OPUA 4UB0L 3CVCA 1GC1L 1W8OA 2YD1A 1XX9C 3ZJZA 4G9FA 1IC4H 4JFDA 3EO9H 1NCIA 1CMOA 4NI3A 3HR6A 3U0ZA 1LO3H 1CIDA 4X1IB 4KQ3H 4LPUA 4YMPA 5L3CA 1BXXA 1FQ9C 3Q05A 1RZIB 1NJ9A 4OFVA 3TO4C 1IAOB 5DVMA 3MROB 2ICCA 1I4FB 3ARDC 5J6GB 4XPHH 1Z2KA 3UBXI 2Q6AA 3QFJD 2JI2A 3QZNA 4PJDF 3L9YA 1EPFA 4QYAA 4XP5H 4XVUD 3NSJA 2BCCH 4G6JL 2Q68A 2CDFB 3ZKXC 5IW6A 2XY1A 4HUXA 1RQ5A 1BBDH 5DJAB 5F1IA 5HYFA 2WBJD 1Q9LB 2OZ4A 4WO4B 2AV7A 1F13A 3AT9A 4JYYA 5JIHA 5D4IA 3QEUA 4B3TO 5D1QC 3MDSA 4HUMB 5A3IC 1CYXA 3OAUH 3V10A 1ZLUK 3RVUD 1HNWO 4Q8BA 3X11A 4RWYL 2QWOB 2A4CA 3ZYJA 1DHKA 1KTRL 5AB1A 2HFFA 2VL5A 3RVXD 1A25A 2BP3A 3NDZE 5EG6C 1H8HG 3Q2WA 3S3WA 4A2FA 5TPWH 2W9EL 2EIDA 5IB4A 2KDGA 4L1SA 4FA6A 1PX3A 3T1WA 3PWNB 4PTTB 4IYHA 3F85A 3HUJA 4HWZB 2DH3A 3BA9A 3L5WB 4FQQB 3OWEA 4LXFA 4RA0C 1SQBH 2VMFA 4ELMA 5AFAA 5JNYA 4UFZA 4JAAA 1CT8A 1FL6A 1S9WB 2BVPB 5F0PB 4QNPE 4WI8A 1Y76B 3JASB 4HKZB 2ZG1A 1KFAH 4NENB 4AGQA 4X99A 3HE7A 2DLIA 3S6CA 3V6BR 1M7IA 1X9UA 5I5RA 1U91A 1XSKA 4NR1A 5KA6A 3EYOB 4N5ED 1F45A 1A4JA 1QHPA 2ADGA 3ZT5A 2NY1D 4IOFC 1JHTA 3PAZA 3CFBA 2VDRL 4JDZB 1HDMB 1TETL 4R90H 4D9LH 3B2MA 4F58L 1TUEB 5DD3H 2JI1A 4JRLA 3OSKA 3ZE1B 4RQFA 1B3JA 1DBKL 4LSRL 1KJ2L 4Z0BH 5F3HA 4XWGL 3TJEL 5IEKA 3B3IB 4P5TB 3ETQA 4TPRH 3L7FB 1BQUA 3VI3B 4X6DA 3LQZA 2AC0A 1D2DA 5LKNA 4BCZA 3O2VH 4PCTA 1HVXA 4KI5F 3NK3A 2R59A 3TCUA 4UIKH 5CGYD 2P8PB 2E76B 2GSGB 1KN2L 5LA6A 3EJQA 2AMUA 4D0BA 2PXYB 4QJ3B 5FUZH 3HKDA 1K85A 1B6UA 1E27A 1L5GA 3BVUA 4LEEA 4DV1B 3NXSA 3S3PA 3ABLB 3I2CH 4NKIH 3H7LA 2CRZA 4DGYH 3K3QA 2WXLA 4UQ9A 2QVTA 5I1IL 3SO3C 3IXTB 3PCYA 4IRSD 4QHUB 2CJ3A 2APWA 1SFDA 1P84K 4JPKL 3KPLA 1H19A 1DJZA 3L95A 4I9WE 5LP6A 5BRQA 1INQB 4G9DA 4A2HA 5CEZH 1X3DA 3CDZB 3KYOA 3GPEA 3C6EA 5H6QA 1ONQA 4WUUA 5HI3D 1LO5B 3SDAD 1N4XL 5JHBA 4MNQE 5KANG 4OLWL 1LGVA 4ZXBC 2BRQA 1PEWA 5F96H 4EI5B 4GLRH 4AV4A 5TQ2L 2ZUSA 5FV2A 3GSNL 4M3KB 3D85B 4MD4A 4OZIE 1NAML 3L3DB 1ZHBA 3PGCB 4N0FB 4M7KH 4XBGA 1N59A 2GUOB 3IFPA 5E2VH 4MT8A 1T0OA 4PGJA 2JVDA 1M2VA 5EEVA 1KBHA 3CJJA 4UNTA 4WTZA 3T5WA 1OP3K 4BFIA 3BOVA 5MI0C 2ZDIC 3WEBA 2XAJA 4CVXA 5CCHE 5B1CA 3WS6C 5I0DA 4JRXE 4GAGL 3QHZH 2Q4PA 3GWKC 1I82A 4FQ2H 3VDCA 1KGJA 2VZTA 1WGVA 3FB6C 5D7IE 2OMZA 5LHGA 3P73B 4FA7B 3PQYA 1R24B 4JB9L 2EYRB 2E74B 1MJUH 1VP7A 1UA6H 4FXGB 4NGHL 4Q9RH 5EPMA 4DR2O 1AKJB 1FZMB 1UCTA 2Z31B 4GRLD 4AQAB 1TU2A 2GPZA 1PZUB 4XP1H 2I7OA 3F7YB 1CLOH 5HGAA 1DQVA 2X70A 4LPCA 2PLTA 5E70A 1NDGB 5D5MA 3V0IA 5FDYA 2NQ3A 1RP3B 5E4EC 3T0DA 1SXBA 3KWWA 1XMQB 2HVJA 4PR5B 2K6WA 3FU7A 2YKLL 1XCTB 1DBJL 2E7LC 2Q76A 2X41A 4JFYB 4YDJB 3VFGH 4LCCB 3NIFB 2Y25A 3TBSA 1ZTXL 4GG6E 2VXQL 2CH7A 3F65A 3ZZSA 3KBPA 3QQXA 5FF6A 1UH4A 5D96B 3OL2A 3UDWA 1DFBH 4YSCA 1IKFL 3AROA 2JKRM 4XI5D 3I5DA 2AANA 1MXDA 2LFEA 4WWKD 4XPFL 2ZE6A 4P30A 1DYZA 1JWUB 1OW0A 1FVCB 1SVZA 2IIJA 2QEJA 3DX1A 3GI9H 3LQMA 3EJUA 3R8BB 3HPLB 3PL6C 3VSUA 4AT6A 3ZHSA 4YSAA 5LGJA 1XF5B 4RVBA 1IIIA 3UBXG 5EEUA 4XNZB 2O6CA 1IM3B 3CFUA 1NMAH 3UP1A 5I6LA 2HFTA 1M1KW 3GBNL 5C0FB 3B2XA 1US6A 1YCSA 3QEHA 1YO4A 1N8ZA 1HAUA 7CGTA 2ZUWA 4PG9A 2P5WB 1NLBL 1WFMA 4P49A 5J13B 1CXZB 3I3DA 2BXYA 3IDNA 1W0YT 1HYSD 5AVQB 3BMWA 2R39A 1ZSPA 5DUJA 4CVZB 3WB2A 4FVMA 1OZUA 2NLJA 5T3XH 4NOFA 4F1ZA 1ECYA 2P80D 1ZUQA 1DLHB 3CZKA 3DXAB 4Y4HD 3V4PB 4JI7O 1YITV 3H9ZA 1T22A 2QMKA 4HSCX 2WQXA 4QD2E 3BLKA 2WXFA 4N25A 3EYSH 5DUMH 3MO1A 4MYWB 3OKNA 2X89D 4KK6C 4UU9B 4YHKH 5IB5B 3OJDB 1BX2B 5GGUB 3O3BB 1Q94A 2CO6B 2GIXA 2YMTA 4W4NA 4Y4KC 2JNZA 5BCAA 1NOLA 3ULVE 2XAGA 4XTRD 3MLPA 5EORH 1LUWA 5IVXF 3HR0A 4IL6Z 1A1OA 4MCNA 4RRPG 3RB7A 1BOGA 2V5RA 2AJSH 4ODWB 4UDTA 3A67L 4L4VB 1HHHA 2A6DA 4YBLC 5CN3A 2DTMH 3QEQB 1JGLH 2CJUH 2YZ1A 4JG0H 4LLVB 6FABH 2YQBA 4U1KA 2YPLE 4QHKI 1K3EA 4Y9GA 1U33A 5DI8B 2VQEB 1HI6B 3QO1A 2Z65C 1BQHG 4A39A 3MRLA 3EHBC 4MQ7A 3BP6A 1KELH 3MJGX 2G4GA 1TPXB 1I8LC 2JE8A 1P84F 3SYCA 1CEZA 1F3DH 4KROC 3RWDA 3UJIL 4EI6A 5CILH 1PFOA 2PI4A 2YS4A 4OZHA 1LQSR 2LW3A 4X7SH 4JO2L 5ALCL 5BVPL 4PPTA 1C12A 4C59B 5C09B 3TCXA 4MW3A 1JV5B 3MGOB 2VDKL 2YLHA 4Y5YC 4DN3H 1ZTMA 3VFWB 4NZRH 4PEEA 3BXNA 4P2RB 2BHYA 2GTSA 3RT3C 1AR1B 5JMRA 2BS8A 3FFCE 1AHWA 1RJZB 1P2CA 2FEEI 1VRSA 3TO4A 3ARDA 4FLOA 1EGJH 2YQGA 1SXAA 5DK2A 3P3RA 1MCFA 1WBXB 2NQDA 2VR6A 3ATDA 4JDVA 2ERJC 4ECNA 3VXMA 2A1WH 3AUWB 4MZIA 3TPKA 5BS0A 5I30H 5I2IB 5LGHH 1E2ZA 3L5XH 1YPZE 1NVPD 4I48A 4CJ0A 1A6WH 5KJRL 3ZL4H 4HUUA 5D1QA 3FZUC 1JFQH 1MW3A 3RAJL 2DLFL 4OM0L 2W0FB 3FHQA 4OVUA 4G8EA 1OCZC 4FQXA 1V27A 1RZ8B 3RWGA 2GTZB 5C9JB 3F83A 3L9RB 4PV9A 4ZOBA 5IJ9A 2VE6A 2MCG1 4C56A 4ZX5A 3G67A 2WXPA 1I7FA 5EZJA 4MBRA 1ZWIC 1SOQA 7PAZA 3KL5A 3DDFA 3RUGE 3DC5A 2VLRD 3MV7B 3ENEA 3S37H 4R50A 3PWLA 1U8HA 5DQJA 4GXUN 4WW2C 3RURA 4BCXA 2QTVA 3GZQA 4Z7OE 4G6MH 4ORGB 3TZVB 4OB5H 2E5EA 4HKJA 2VCOA 4KXDA 1RZFH 3QIWD 4TRPL 2XV0A 3OR7A 4CSTA 4EN2A 2X2YA 4OGQB 3IXAA 5T1LB 5AW5B 1MWAA 3KXFA 2I9TA 4ZTOH 1RZGA 3ATEA 4JANA 1MNNA 4XP9H 4UANA 4WEEA 4ERSL 2IH3C 1A6PA 1FV1B 3MOAL 1OCWL 3LIZH 4R5VA 4D7BA 2VLJE 3RBZA 1DANU 3KDPB 3LH2L 1PZ3A 3TT3L 2HT3D 5FCSH 1EFXD 2X2IA 3U9PL 4GQ9H 4GOSA 3SODB 5AW2B 5LYJB 2AQRA 2WO4A 1UB6B 4G2KA 3I3BA 1WB8A 4R4ND 5FYKH 3C60A 4JM2B 5IM7A 3MFFB 1VQOV 3ML8A 4KVNH 1UWEH 1LHZA 3H9VA 3VI4E 1ZAGA 2G75A 1KOAA 5C0BE 1DJIA 3H1IH 2A0LC 2XFXB 3MLYH 4YIQA 2KG7A 4YXLH 5DZOA 3NEEA 4ADJA 4CBPA 2W0LA 2FZ3B 2BSTB 1CO1A 2LLGA 1ZKAA 3C6LC 3WNKA 2X1PA 5ESVA 1CD1A 4JN1L 1I7UA 1B0RB 4FTVA 4HZLB 4PJEA 1BQHB 4ZUUB 2KQXA 3H9SB 5HJBA 2WQWA 2YUVA 4FG0A 2Q7AA 3ATAA 4K3DL 3BAXA 3ARVA 4OZGA 2WQVA 5IFHH 1NBCA 5EU7E 2WZ0A 2BNRA 1MA1A 5EU3A 1UHVA 2GC4C 1WP8A 2DOSA 1RVFL 3EO1B 3CVHB 2WM0A 1NL0H 5AZEL 2C1OA 2A06H 3CU1A 3CLFH 3DMMB 3BLPX 2OK0H 1L0PA 2FNBA 4FQIL 5FYJE 4C58B 4HALA 4NNXA 2C9AA 3ABMB 3F64A 3FS9A 1VF6C 1T5WB 4JREC 3JV6B 5DO8A 1UT2A 2ZUYA 1JCHA 4Z1MG 4R96A 2NNCA 3JWNG 2WZPD 1XWVA 3EUUA 3IDGA 4ZXBA 1I7ZB 2KL6A 4WFGE 3VFMB 3UZVB 2EIEA 3SHSA 3GK8L 4HJSA 4NT6B 4LVEA 4M5ZH 1UD2A 2JJTA 1AIZA 3I6SA 4P3DA 3HFML 2EVJA 5K1VA 3KCXA 4U6YA 3O2WH 2E75C 1BJMA 2DQTH 1AQMA 2NSMA 3BH8B 3DC0A 3ES6A 2DBJA 3BAEH 5D7KE 1XF2B 2QJDA 4GRWF 3WS6A 4DTGH 5A2JH 4JQVC 3U83A 5I66A 4YVUA 3HNVL 1BMWA 2WYIA 2EDLA 3ABGA 1Z3GH 3V0WL 3O11A 5IBTH 1EX0A 2FJUB 4HOWA 3ZTNL 5E03A 3OR6C 1AO7A 3DUHA 3VFUB 3FYIB 2PN5A 2VSMB 3B9AA 4WHDA 3MHHC 1JPEA 3Q4HA 3ETBJ 1OP4A 2XIIA 4ZO6A 4QXWA 4UVCA 3I74A 5IVOA 1FZKB 3FPXA 5J6HB 5A16B 2JMRA 3K79A 3NOIA 3MC0A 4CW1B 3EYUL 5FYLE 4ZX3A 3BABA 2HFEC 4N2HA 1J9SA 1VGKA 3BUYB 2K70A 2MHAB 4BSVB 3ZE0E 1QRNE 4P04A 5D9SA 4LSVL 2Z91B 3SD5A 4TSAH 3O45A 1EXUA 2E7LA 5CGTA 1YEGH 4I8DA 4HV8B 1Z0MA 1OM9A 3WNOA 1KTKE 2BFGA 2BIOA 2JV6A 3TNMA 3L6FB 2J72A 3ARUA 5E6RB 1A9VA 1T7VA 2OP4H 3FOMA 3LB6D 5I6KA 3QAZB 3BKML 3KPPA 1EAPB 4PM1A 2VQFO 2Z8RA 4XNXH 4F37K 3E8FA 1OGTA 4HZAA 3KGTA 3RJDA 3LEVL 3BVNA 3IJ8A 3IS1X 1ZHKB 5H35B 4N1CA 3VRIA 3PL6A 2GB2A 1LM8V 4HX1B 4M8VA 1MRDH 3A3YB 5ITZA 4JGSA 3HS0A 3DGEA 5FO9A 1DBAL 2E3CA 3RJOA 4JK0D 1WCBA 3GSQB 1G1KA 3PG2A 4EZLA 3H3PH 4Z2WA 1AVAA 4MJIB 3U4KA 5E9DB 3HMWL 1G94A 2WXOA 1GK9A 4PRDA 2YGPA 4N86A 4QRRB 2ZXBA 3O4LB 4TVSa 3CK0H 1QLFB 3ZMVA 4R4FL 5CN0A 3IGFA 5FUOL 1QATA 2ROXA 3NJNA 1Q5OA 3D25A 4HMEA 5IQ7H 4LRIC 5IVNA 5HY9A 3QIUB 2QSCH 5JIKA 1G5GA 3MXVH 3RKDC 4TV8A 1TCRA 5BPPA 3KR3H 3R1GH 3D4ZA 1HINL 4O2BB 3X1NA 1GGYA 3WUWG 1V05A 4LF5B 2MWCA 3DYOA 2M1KA 5AOIA 3VWKD 4LPVA 4D8PB 2DAVA 1BQLL 4NB5A 3O6KH 4ABWA 4XCNB 2C7FA 3HG1B 1JPGB 3M8AA 2ZOOA 4XP6L 4OIIL 3BN9D 1FHGA 5JR1L 4I50A 2ZX5A 3AT8A 4YWGH 4KXCA 1AD0B 3IC7A 3ZKXB 2YS8A 2XAHA 2GBVA 1JPFA 4EKXA 3C8KA 2MPAL 2X10A 3F7QA 2YSUB 2EDBA 2Q3XA 1T21A 4I0PA 1YN7B 5I23A 4OUUB 2OMYA 3BP5B 4JJHA 5ID0A 1RPOA 1I8LA 4TQEH 4NQED 2YD4A 4JF3A 4ZAKC 3RTQA 4M9PA 3PV7A 5GGTH 3NJGA 5KSAD 4YBHA 2ZCEA 5I6XC 5JW3H 2ZX8A 2DYPB 1VIWA 1NCWH 2C3WA 4PJGE 1IAIH 4WWOA 4Y2DC 5FA4A 1MEXL 3BPOC 4AKQA 3MHSC 3VU1A 4Y5YA 4BGDA 3MRGB 4NUMA 1MVUA 2EZOA 3FQTA 3VM7A 3INOA 4QRBA 3KLAA 3K4AA 1D3CA 3D18A 3QUZB 2YIDA 1XGYL 3CN2A 2KKWA 3RY6A 3VOUA 1MI5A 2B0SL 2VN6A 1BCIA 1FSKB 4GAJL 1ZDSA 4LSPH 4U6VL 1FH5L 4CDGC 1JNLL 2XWZA 4N2KA 1OD7A 2APFA 3KLQA 2DMGA 1NFIA 1XF3A 3L73H 4JZGA 1CYGA 5TJWK 2ED9A 2NW3A 3MU3A 2ZR3A 3SJVD 5BV7B 1N5AB 4Z7IA 4L0YA 1GYAA 3B5GA 1DN0B 2VDOL 5TE4H 2C5DC 1KWGA 1OGSA 2YA2A 1RHFA 4IKIA 3CVHL 2OXHA 4G59C 4PJ7B 1OSPL 2IH1B 3P2DA 3X17A 3FRPG 4I0XA 1YEFH 5DMIH 1UM4L 4LGSB 3U9WA 2OW7A 4MNGE 4IRJC 3REVA 1TR7A 1SQMA 1QR1B 2HKOA 1CG9B 3O41B 4TF4A 2GBUA 2JKJA 1MIEL 5F2FA 5TTRA 4DJMA 2QQKH 3KPSA 5H4ZA 1ZWIA 1TF4A 1X6LA 3SQBA 4YO0A 3P30H 4X5QA 1SJEA 1EHLL 5D1XE 1S9XB 2L7UA 1LEKB 4WW2A 5IBLD 5AD0A 4PW3A 2LGWA 3CC4V 3QRLA 3T0EE 1FFNA 4E2LA 4JO8A 2K7QA 5HPMB 1DQIA 2ZR2A 1T7WA 1JPXA 3N2JA 4K7FB 3G71V 3VWJD 4WFBV 3A24A 3NPZB 1F86A 5K59F 2DKMA 1AJ7L 1YEWA 3N42B 3NZ8A 3T9WA 2DTSA 3C90A 5MEQB 4ZFGH 4X7TB 3VXSA 1M6OB 1VFBB 4UAOC 3TYGL 4J80A 7FABH 2IH3A 5DWPA 4DN4H 1P7QD 1J12A 3Q48A 2N7BA 4RMTA 2DYSB 3JATA 5BR8O 4PJAF 3LSOA 2PETA 4LPXA 4I4WB 4F37F 4RAUA 1IEAA 1T7XA 3BFQG 3MBEC 1GN6A 3LAFA 4KQ0A 4EOWL 5IW1B 3T3ME 1S5LZ 2EC9U 1IZ3A 1INDL 3GS7A 3QZWB 5BXFB 1AYRA 4PJHF 4MAYC 1M4UA 4GX0A 3WB0A 1VESA 3T09A 2V3FA 4U6XB 1ICTA 1CFNB 2A0LA 2CZNA 2WZAA 2YFNA 1K5SA 5C08B 1N12A 3ALPA 1RK7A 3R18A 5B38B 4HUVB 3UM7A 2C3VB 2ED6A 1T2XA 1OWRM 2H2SD 4KQ4H 4R7VA 1MKFA 4G72B 3F5WB 1A6UH 1DVZA 5CFHA 2AQ3A 4NYLB 3FQRB 5F7AA 3V52L 2GKIA 5I1AA 3SBRA 3V0FA 3ATFA 2HR3A 1YMME 4AENA 3RE0A 3U4BH 2J8UB 2KZWA 4P5MB 3IKCB 2C34A 3O3DA 4LFCB 3SEPA 3CIAA 3STBA 3ULUD 1RURL 2QSQA 5INDA 5K1XA 4ZPTA 4B9KC 4Z7QF 2BW5A 1AQ8A 2CO1A 3MBXH 3A0HZ 1W0VA 3FB6B 4JCWA 5D70L 2VRAA 1BMFG 4YPGB 4MVBC 5JOEA 2YXMA 4E42A 1HSBB 3IFOA 3RKPA 3AB0B 3V4UL 1VF6A 3CCRV 1FWXA 3I9GH 4XMZA 5EU4A 2ZINA 3VFNA 1UPGA 1LK2B 2A77H 4TTGA 1MHEA 4GIAA 4KTEH 2VW6A 4FQLH 2EVFA 1G7MB 2WKLA 3GO1L 5I75B 2W07A 1E8WA 1BVZA 2BO0A 2R2HB 4UOW1 2BVUA 1WUNT 3TTSA 1AI1H 1JXDA 5BRZB 5BZDA 1RJCA 3CDGB 3QO7A 1F18A 1HZHL 3FOLB 4DEPC 1WBYA 5C8JB 1XTLA 3O6FC 3IJ7A 2VKWA 3UJTH 5ACLA 5B5EZ 3GDBA 4AQZA 2CD0A 3K0GA 2C7UA 2ZT9C 2BMKB 5AUMA 5A2KH 5IT2H 4JQVA 1AMYA 3FRPB 2HTKC 1YMHA 2JELL 3VMNA 4PH8A 1IEBA 3KPRD 4LLAA 2PYED 3AGWA 4P2OB 3DIVA 3EH2A 1N33O 3CCJV 2ZXAA 3OR6A 1WTGT 2OJZL 3L3GB 1MOEA 1JPTL 2F54D 1LK3H 2VRKA 3IE9A 5E2JA 3WFEH 1W8NA 1GPOL 1SVCP 1S72V 1VQMV 3JV4A 4FA8A 4XP4L 4QOKB 5DRWB 1QFHA 2AXFA 2B1IA 2HFEA 3EOTL 5EA0H 3TEWA 4U3FH 3E7JA 3AG4C 5KHJA 1XBDA 1YC7A 2QZ5A 3MRKA 4XZUB 5JLZB 1KIPB 5IF0A 2ZX9A 2G5BA 4BV1A 1BF2A 1SMOA 3VXRE 2ZUQB 5DN6G 4P4KA 1H8OA 5BOJA 1KCVL 2C4XA 2F0CA 5C0AD 1JK8B 3T8XB 4U4IA 3LKPB 1TEGA 1CGWA 2KYIA 5CGBA 4B9IA 4Y19E 4CS3A 2B2XL 3VGAB 5ICZB 1FLTX 3STLC 2XKNB 4MNHB 1OTTD 4ANVA 5KG9A 4NXKA 4JZNA 5DHYB 1ZVHA 4X65B 3FTGA 1EZVY 1W0KG 3LY6A 5KAQG 2AEWA 5JIIA 2EIKC 1ACCA 1IV8A 1QUPA 3FT3A 4I3SH 2YGQA 1J8SA 4LH7A 4ZHQA 2NW2A 4Y4KB 1KG0A 1H0DB 3SKOB 1EGJA 2X40A 2XWJB 2QHRL 2O61A 4WO4D 2UX6A 4YJ3B 5E6ZA 1MFBL 5EBWA 4OV5B 4JKLA 3HG5A 1ZEAL 5CWSB 1NFAA 2UZYA 1EHKB 2ATKA 3ARRA 1SYSB 3IE4A 1V9PA 3W11D 2JIZG 2Y69C 4HEPA 2ZUVA 1SETA 3LXBA 4UQIM 4CAGA 3WLBB 1J88A 5BQDA 2GEEA 3S4SA 2QGEA 4O2AA 3FUHA 4NDMA 5DEGB 1CXHA 3BAYA 2WKGA 2Z7ZA 1WJ3A 4OLVH 4BRJA 3LEYH 5CINH 3QJTB 1MWAL 1CURA 3MA7A 2VDMH 3LNEA 1YG9A 4OU3A 3MV9E 3EBGA 5F1OB 3MLZL 4YSSA 4LRIA 1Y0LB 2O30A 4GMTL 3MRCB 5JIMA 2VSKB 1XILA 2HRPH 1KIQA 4KROB 3C6SB 2ZUXA 5B7EA 4ODVL 3I6LE 2K9FB 5D4HA 2WQSA 4F8LA 3PWVA 4RMSA 4XCYA 2QJ1A 4E9WA 1N67A 5DQ9A 1TEYA 3GSOB 4X6EA 5FS5A 1N8OE 4AEIL 2NX5E 1OARH 3PABA 3U7WH 1U95B 4BH8B 1T2QL 3NRPA 3KEHA 1KJMB 1C5CH 3RTLA 5H9CA 2FLBT 1FA4A 1A3LL 2ZX6A 4RIRA 1S5HC 2R51A 3SGDI 1M53A 2B9AA 2JCCE 4L1TA 1G5AA 4H2AA 3R7QA 3W0WE 5CMAA 3FRUB 5EUKA 2UUBO 4B9PA 3KYMB 4Y5VC 1MZEA 3D08A 3E83A 5FC9A 1SXNA 5GJTH 2H1PL 3LIZA 4V2CB 3UTPD 4LFBO 1PG7X 3DJRA 4XCCH 5IMKA 1JSYA 1GN2A 4PY7B 2ZWLT 5HHOA 1MOFA 2Z0BA 3G5YB 3PFUA 3QDME 2WN2A 3VE0B 3B2UC 4LSTH 4L0ZA 1CDYA 4J8RB 1S3KH 1TCMA 2B08A 1XD1A 5DUPH 1FJGB 1YY9D 1GL4B 1QSEA 3JVGC 3M7OA 5DMJB 1OCZB 1F4WL 1X6NA 4JRWA 3T1FB 1I8KA 2PXYD 3D30A 3WY3A 3UT5B 2FT8A 2YRPA 4L1DA 4AIZB 1VAHA 2CGRL 2YQ2A 3HZVB 3U10A 3M17B 4R7LA 4Y2DA 2EYSB 2C9SA 4UOJA 3WHXB 1E7VA 4FAAB 1W8EA 3DVGB 3MOBL 4F2FA 5TE6L 4JFHE 2AGJL 4UQ2B 5IG7A 1Q0EA 1Z0NA 3HC0B 4GRWH 5FGCB 2QELA 4GKNB 3VXQB 5MENE 4DVBA 3B8NA 3VTTA 1S7QA 4HJUA 1S7RA 4TMPA 1KCSH 4PJFE 2RH0A 2A83A 4QLWA 3NFSL 4JPIA 2WBKA 1FZJA 2YBRB 4Z7VE 4JPRA 4I4TB 4EMZA 1QI5A 1RL1A 4L3EE 3OZ9H 1XHHA 5AAMC 2DQFA 3EZ8A 4NKOA 2XG4B 1YA5A 2LT9A 3QR1A 5BZBA 3AW5A 1N32O 1J86A 3HNSL 3PP3H 5J9PB 1T66D 3IPEA 4JQIH 5KSBB 2HP4A 3P4MA 4TUKH 3D85D 3II2A 5KVDL 1L0NH 3A6CH 4QI3A 3ZTEA 4DP1X 3V6ZB 3FX7A 5E1AC 1COWG 1BREA 2Q6WA 3WYRA 3CUPA 3F7KA 4TULL 4PP2A 1OPGL 1FGNH 2EE2A 4LLUA 2V8MA 1FGVL 3PXHA 4X8CA 1WA2X 2GV9A 3K03A 4DUVA 5I8OL 3QDJA 1ET5A 4O2EA 3U46A 4PGBB 2YD0A 1NCCH 1Q72H 2H9GB 4YGAB 1WWAX 2F66C 1G7IB 2ODMA 1BV8A 2Y7LA 3C6LB 3UP6A 2UZXB 1LEGA 4HW6A 4NJAH 3W7XA 2X9XA 3SB3A 1HKFA 1SN0A 4TVPL 1USZA 2E9WA 3UC0L 4YK4B 1KP2A 5IJBC 2Z31D 4NUJA 2PPAA 5ISZE 3IDYB 4B7LA 3FB8A 5C7XL 5D7JC 3WGVB 3MUY1 5JHLH 4N0UA 1ZXQA 4AQYB 3B5TA 3CZSA 4X89A 1KTLB 1NS1A 4U6HB 1OCCB 3ASNB 1H3PL 1E6OH 1KV7A 5ETUA 2IANE 4O51A 4XOEA 1ORQA 4APQC 4DKFH 4JL1A 3HHSA 4C54A 5FKPA 4YDIL 4MAYA 3K5OA 3N85H 3VXPB 5B1NA 3QGVA 4PS4L 6PAZA 4OCXL 3MJ9H 2F7RA 1EIBA 3QJOA 5L3BA 4KVPA 3S96A 1N32B 2UXFA 4WI2A 4XP5L 1NBZB 15C8H 1UWGH 1QUNB 5EU6A 1J8HB 4FEIA 1WB7A 1FO0H 2CO7B 3K72A 1BBDL 3QQNA 4PIBA 4PJBB 1BBJA 2EE9A 1X9RA 1YJDC 2GVYA 1OB0A 1MELA 1WITA 2GY7B 1KXQA 3AU1A 2BVOA 4BZ2H 1JUFB 4JTCB 4LO9A 2BX5A 3QUKB 3I84A 3QUYC 5E9AA 3WKQA 3QFJE 5LHHA 5FB8B 4NP9A 1U6AH 1LWJA 5BO1H 4Q6IC 4X4ZA 1K4CB 5IWLA 4PRPA 1Z9PA 1VPOL 2AXGB 3AM8C 4R2GC 5B3JE 1IJNA 1UJTA 2XTJD 2FYYA 4OLZH 1P7HL 3ASOB 1L0YA 1JF1B 3H1HH 1BXUA 2W81C 2EH8L 5GS2H 1UADC 1FXVA 3B8MA 4WRLA 5DK3A 5C70A 4ORZC 1Q9OA 3MKKA 5IQOA 3GIZL 4PV1C 1OGAA 4OJAA 1ED3B 3OUSA 1MH5A 1OTSD 4K3JL 3WKMH 1R3HA 1S7TA 3DXAD 3QO0B 4Z78A 1FL5B 1J18A 4FHBD 4YDVA 4AIOA 2CWRA 3SPVB 3V9EA 1A3ZA 3QNYB 4K71C 4P4RB 2YGNA 3SPCA 1J10A 3UPCA 5GQBA 1NCDH 5DLMH 3WTXA 5FA3A 1S7SB 4K8RD 3MLSL 4MVOA 3RYHA 4X7DC 2QQLH 1BFVL 3JD3A 3BGMB 4OLUL 3UTSA 1S9VB 1HOCA 4KJQC 4BA8A 1PY9A 3WLWD 3ZQWA 2AJZA 1VQKV 5LBVA 3QEQD 1IC5H 5CD3B 1N64H 2JVUA 5IEHA 1JAEA 2AVFA 3O2VL 1N0JA 3ARBC 3LEXB 2PCXA 4P59H 5C0GB 1AIFB 1AI6A 2C26A 2BSRB 3JWDC 2HPOA 5FUZL 3WXWH 1KBWA 1AC0A 4N2AA 1A6TB 4XB8A 5I8CA 2CRMA 1NDMB 2Q7YB 1MJ7L 1CWVA 4R8WH 1ZL8A 4LLWA 2D7TH 1MABG 4X80H 2FYVA 1P7BA 3ZMUA 1OK8A 1GS7A 3L7EA 3PDOB 5A7BA 3SDYL 3T77B 1FORH 4DGYL 3LS4L 3APQA 3LQAC 3ARZA 3M45A 4LCVA 4NQDD 4OQ1A 1PG7L 4M6MH 1PD3A 4G8GA 4Z7WB 1XGPA 2ZJSL 3E8GA 4AE1A 5GGTA 1NFDF 2ZWKA 1MFAH 2Z8WC 3ARTA 1UD8A 4PWKA 4UF7C 3STLA 4KKCD 5IYZA 1AR1D 1HNZB 1AAJA 5T1KB 5D2NB 3G6JA 5E8PB 3DIFB 3MACH 1I3UA 5B4MD 4MMXA 1BXVA 2ZXGA 4EF3A 2DMCA 3VQ2C 2PTMA 2X9WA 3G6DH 2J88H 1XH3B 2VN4A 5ITFA 1N34B 4AVIA 3MUGB 4PJDE 2EEBA 4J3UA 4R7NB 1IB5A 2Y0SA 4U0QB 2CRIA 5GZOA 5I19L 3WI9A 4HS8L 4NUGL 2EBOA 2BP5M 1E5YA 1ZT7A 4BDVA 5TD4A 3VQ1C 1KYOK 4GYBA 4OCLC 4XHJC 4ZO9A 3VUAA 1Z5YD 3EH1A 5AZ2L 1YLBB 2OMVA 3KCWA 3R66A 3MXWL 5KYXB 1DQML 5KX5B 1J9TA 2H26B 2HN7A 4FQ2L 3QG6B 3OPZH 3TBYB 2EXYC 2AHYA 3BP4B 2W95A 1DGSA 2YJLA 4NNYA 3RZWA 4QGYA 2GTQA 3P9MB 1FFRA 3QIBC 1MJUL 3GSXB 2BSSA 3S3SA 4Q9RL 3DK0A 5AW8B 1AGCA 2WVVB 4Y4FB 4H1LH 2YWZA 4LCWB 3TA3C 1IBMO 4ZAKB 2WZ5A 4XP1L 1HHIA 1KYUA 1QR9A 4K5NA 2OJ1A 3P30A 1GM7A 1E8YA 3TZVD 2SEBB 4YLQT 3AJ7A 5EOTB 3PE9A 1KMGA 2LW1A 4FQHB 3F84A 3N41F 3QRGH 4YJ2A 2X4TB 4ONFL 3WMQA 1OP9A 2MSPA 5HXMA 3V9FA 1S5HA 4LBEA 1WN7A 4ZYKA 5C6WH 2BP0B 4MA8L 3FUEA 3VFGL 4P3WA 4LHQB 4LCUC 2UYLB 3GS0A 3K6DA 4Y5VA 4WTWA 4FQJL 1F4YH 4AV0A 5F9OH 4BSWA 4X6FA 1TOXA 1YNKH 5FHAL 1OAKH 1OE1A 4K2UH 4BWWA 4DKAA 4FS0A 3PJSA 4PLKC 4MBOA 1BZ7A 2P8LB 1D5NA 5D7LB 4OSUL 5ENWA 3QFDB 1QBML 4WI9A 4Y2NA 1JDCA 4FZ8H 4IHBA 5AVYB 2LAAA 1L7TL 3JVGA 1ENVA 4F3FB 2WWMC 3SY6A 2AHZA 2XT1B 2WLLA 5I74B 2ICEC 1QNMA 4F7EA 2XBZA 2Y2YA 4NKMA 1NC4D 5EIQA 3RWJB 3CZFA 1MCPH 5DTFB 1QPPA 2DQCL 3Q2VA 5EU7C 2GITB 2NUPB 1BE3H 5CJOL 4W9HC 4NAMA 1LO4H 3S34H 4Z1PA 3D87B 3S3DB 4GP4B 2GJJA 3TN0C 3RDTB 4K9EC 4HIXL 5JW4M 4KHTL 1RPRA 4D0DA 4IU2A 1CICA 1HL5A 3GJFH 4HS6A 3WJLC 2UXNA 1J8RA 3MN8A 2FB4H 2ODHA 4ODHH 1BVLB 1OAXH 1T03H 4KXBA 4U1GB 5KBLA 4DUXA 1R3IH 5TDPA 2YA0A 2YARA 3PREA 5IT9N 1KYFA 4CSSA 2YXHA 2JKIS 2EKSA 1BPLB 2VDPB 3RU8L 5E2UL 3ZE2B 1HSAB 1KGIA 3MBEB 3EOBA 3WE1A 3WSQH 4FXTA 4NRYB 3K0DA 3ZRWB 5HDLA 3CH1B 2YD3A 5EO1B 5I8EA 2YRBA 3FTXA 1RP9A 5C71A 3GRWL 1G1YA 4DV3O 5TF1L 1WT5C 1XV8A 4LVHC 1YEDA 4EBQH 2X42A 1X4ZA 2CJUL 3UL4A 3B2VH 5KJ7E 4YXKL 1XMOO 3VRLF 4LP8A 2RIKA 2VWKA 4OCRH 3I9PA 4XVJL 2WLNA 5IUCA 5L6YH 1KEML 4JI5B 1RZKH 2HG5C 4BZ1H 2IQ9H 1XDTT 4EIZC 1KY7A 1T0NB 2NY4B 3QI9C 1KJ3H 1TZGH 4NO0B 4LFAO 4V1DD 5D2LE 1IU1A 3U2SA 1N6QH 2NNAB 4G6AC 4UT9L 4YBQC 5C0JA 1DANT 2WN3A 5AYTA 1OHHG 4PGDA 1QBLH 5CILL 5D7JA 3EF4A 5BY1A 1CGVA 3BDYH 3H9HB 1G6VK 3O6LL 5ACZA 1EHXA 2BTQA 2Y06H 1S4IA 4Y8AA 4QYOA 5GSVB 2HUHA 4WDIB 4L8DB 4JRYB 3HLAA 5I8KL 4NZRL 3P3NA 3RWCA 3HKBB 1U8IB 3W39B 1JNHB 4NM8L 5JJEB 2E7MA 1LD9A 1U58A 1WFJA 3COOA 3EKCA 4O4IA 2IADA 3ILQD 4P5KB 3QG7H 3BH9A 1BHBA 5F7EL 1VCBC 4WFFA 2I9LA 5GJSH 3AG1B 5HYQB 2ATAA 1XO8A 4TUOB 4Y7OC 5J3HC 3B56A 1SOKA 5DJ2A 1HZKA 3W2DH 2VSCA 4QRTB 2F6AA 4PCSA 1YNTB 4TNVF 3S35X 5E56A 2VDNH 5HYIA 4DR6O 2OJEB 1SJHB 5EC2B 5LGHL 5SX4H 4WHYH 1U8MB 3O6FB 4EQ3A 3L5XL 1MJ8H 1KYOF 2D7OA 2VDLB 3UAJC 4Y16C 4XZ4A 1JFQL 2CHNA 3BGFC 4NXMB 2VMDA 4YIPA 4XMXA 2XWXA 5I26A 1LWRA 3U1QA 5KVGH 1J9QA 3MNWA 3CJHB 3UG4A 5AEAA 1S9KC 1A3QA 5GHWH 4KNQA 3VX0A 4MXVE 4Q6IA 1EJOL 1RK0B 1Z32X 3BQUC 1KCUH 4NPYB 5HI4C 1BAFH 2VXVH 3AM8A 1EERB 3KZIZ 3VG0L 4ALAH 4PJIF 1LO0L 3ESOA 3NZSA 3CB2A 2NY6B 1A9BB 4K7PH 1PYWB 4MD5A 4YH6A 2A74C 4FMVA 4QRRD 2O5ZH 1NEUA 5J7CC 3AABA 1W0WA 3ZDZE 1KECA 1XEDA 2Z9TA 4B3VA 1I9JH 2HP8A 3TH4T 3U30C 2DBLL 5HDOA 3UYPA 1IC0A 3SJBC 4LIQE 4PJ8D 3ML0A 1O9HA 2Y36H 3DARA 3HA0A 1LEIB 1HKLL 4QY8B 2VLRE 4HKXB 4NO5A 1ESOA 2JB6A 1K3ZA 2FHFA 3L75H 4DR4O 4GQ9L 2F1MA 4H88H 2BVTA 3PLYA 3UYRL 5I82A 2P8MA 1PX4A 5J12B 3QWOA 3MYJB 4RMVA 4HXAH 3A0RA 3GI8H 4KVNL 2EDEA 1DSWA 4IIQC 1IE4A 4UUJB 5EZLA 4ZTEA 2IAAC 2EIKB 1RFYA 4RZCA 5D55A 1H15A 3JBG7 5ANME 5IVXE 4MCMA 1J5OH 4RQQA 4D9RD 3HG3A 3ARBA 2J21A 2Y7QA 1D6EA 2E8ZA 3BUPA 5I6NA 2MK3A 2CPUA 3D09A 5DD6A 3THML 3QULB 4DZBA 4E41D 1I7RA 1SMDA 3K0WA 4WK4B 4WGVB 4LPYA 1UVQB 3KWXA 4XNYH 5DURD 3MNDA 4ABQA 4UTBL 5I1DB 2JK5B 5HVHB 5IFHL 2Y69B 1W6LA 3L3JA 2ESVD 3Q2CA 1MDTA 5CR1A 4PWIA 4Y8DC 4FFWD 4AM0A 3MNVB 4UCOA 3JSNA 3CDCA 1FIGL 3BC9A 1LO2H 2AJ3A 2D7QA 5CP7B 2DS4A 2FQGA 1B4TA 5IBUG 1GH7A 4IBUA 1AGBB 4NSKB 4WHCA 2WANA 2OK0L 1G9EA 4K35A 2E5LO 2LU4A 5SWSB 3KVQA 3JTBA 3FFCA 3ZHNA 4FJZA 1Q7YW 3RWFB 2WSSG 5I0VA 4GT1A 2QR0A 3ARWA 1M56C 3C2AH 4MJ2A 2GSIA 1F2XK 1U8PB 3MOQA 1EXGA 3IPFA 4YC2B 2PZSA 3VYNA 2WNXA 5B39G 3WKPA 4N2OA 3MRFB 2WINB 2D7PA 4MYPA 2N56A 4H33A 4MJ5B 5TDNA 5JIDA 1EEZB 2ILMA 5C8YB 3MRJB 3DROA 1SFHA 1NICA 5F89B 3N9GL 5KVEL 2NTFB 4UWQB 1OOAA 2JFCA 5GIRB 1FFXA 2QPDB 5CU5A 2HJFB 4ZO7A 1UM5H 4CGUB 2ENQA 3ZQ9A 1E4WH 1U97A 1CGTA 4OJEH 4N4YB 3VAEA 4DTGL 4GIOA 2QADB 2NYYC 3BLBA 1JYXA 1H2LA 1Z3GL 2LV4A 3TXQA 4PD4J 2HWZH 4Q56A 4DP2X 5ADOL 3GHBL 3IWUA 3WE6B 4S1RL 1ZA6B 4X0NA 2ICWA 3QFGA 5AOLA 5D1XC 3APDA 5EF2A 4UINL 4H26A 3VXNA 1T7YA 4FLQA 4HNAA 2AEOA 3T0EC 2VDPL 1ODUA 2R56H 5JHDA 2A6JB 3GSUB 5FFGA 1A7RH 3NZHH 5LNGA 3D39D 1DQLH 4DV0B 1JJOA 1JFFB 2OXGB 3SKJL 3BKJH 4G7YH 5HHPB 2ZQMA 1RZKC 4X1YB 2H3KA 2P90A 4AM0B 5DYFA 3UTZA 4YSPA 4AGPA 4PJCF 4BIZA 2E5LB 1JXJA 2BOBB 2WWKT 3BZDA 4GIPD 2VLJA 5IJVB 3G5XA 4R0LA 2NY5H 4BK4A 2QPEB 1YAIA 3FDWA 1URIA 4MCYB 2LLNA 5C0RH 5JHLA 2IO5A 2ITDB 1SC5B 2XACC 5FECA 1IKNC 1TFHA 2AQ1A 3KWTA 1MLCA 4WBNA 3U36B 5I15L 4MNQB 3W37A 5E0QA 1NA8A 5E95B 4XHQA 4N9GA 5EHFA 2C1PB 1D7BA 4OGYL 5C08D 2NXZB 4JFDB 4ZFOA 4L9DA 4OZIB 4NN6B 1Z9SB 2AK1H 5EIBC 5E1AB 3K04A 4ZPVB 2ICEA 2NPLX 1E4HA 1RJYB 4TS6A 1UZ8A 2Y5QA 3P2BA 1CU4H 4DOHE 2GABA 1FO0A 2VT0A 1S5IL 4LSSH 4CU6A 5CEXB 2F8IA 3RFZB 3HKCB 1KB3A 3PHAA 4JRXB 2ZKOA 4UB8Z 4LQ1A 3UPAA 1A22B 4X5PA 5DFWH 2PYLA 1D6VH 2EH7H 3AADB 3S35L 3S3BB 3GKWH 1FYTA 4H13B 5D7IB 4AQEB 4YHMH 4EVNA 4UM8B 2OTPA 4KMTL 1T04A 3CX2A 1YQ2A 3T3PE 43CAB 4PUBH 5IQ7L 3P0VH 2ZSWB 1PPIA 1WWWX 4X4XA 3WJLA 4O5LL 4WTZG 2QSCL 2ZM6O 1A14H 1Z5LB 5AYUH 3HI1A 4NX0A 4ALAC 3MXVL 2H0FA 4IHOB 4RMWA 4WFGA 3QC6X 1KV3A 4O2CB 1BM3H 3S3CB 5B39B 1T1YB 2YPKB 3FQNA 4JI3O 2IXQA 4QCIB 4R6UA 2YGOA 4WGWB 1X5YA 2MKWA 4X9FA 1PFCA 5LBSL 4I77H 2EECA 4APQB 3O6KL 1TJGL 5L2JB 4M7ZB 2N4IA 2YD2A 1S8DB 1JHKH 4FMKA 1WT5A 1S0VA 3I02A 4GG6B 1M7DA 1BJ1H 5TFSH 3OKMB 3OGCB 3N43B 4U1JA 1S7UB 4HT1H 1U92A 4HS3B 4AMKH 2E0PA 4X99B 4UM9A 4WCEV 1H6TA 3E0GA 3DV4A 3OTTA 4BXSV 4Q4IA 2HG5A 4P05A 3QI9A 1DVTA 2Q9OA 4ZDHA 5AAWA 1ILUA 3E6FB 1PKOA 3NYKA 2OX5B 3U25A 2EJ1A 3TH2T 3WMSA 1CZ8L 2V1DA 2VITA 5KMGA 3T8MA 4UCUA 4NN7C 4HUWB 1EN4A 4MB3A 1XMEB 4MX7A 3BRGC 2IGTA 2EC9T 2WLYA 3ULSA 4R2GB 1R3KC 1KENH 3UERA 3TGXA 1BFSA 4EQ2A 4KAQH 5F3HB 3L1OL 3S2AA 3KGSA 1GYCA 1T6VN 4I1PA 4UQ3B 1F5WA 5HJ3A 1QA9B 1OM3L 1PY0A 4ZSOE 3CXDH 3LQZB 3OHMB 5CZXD 4NQEE 3MCKB 4QHPA 5JCOC 1MLBB 1W6WA 2I07B 5DCCA 3CRMA 4FNRA 4L8SB 1C5DA 4IMLA 2MH4A 3TTYA 1T80A 3JD0A 3CMEV 5C93A 2WWOA 2GJ6A 3ZDXE 4R9HA 3PV6B 3ZXAC 3CZGA 5BVJA 4JO1L 1M7XA 1GSMA 4ZI7A 2X4SA 1CFSB 2EP6A 1EO7A 2WSKA 2QM7A 3UAJA 3RWHB 2FL5A 1QMUA 4Z7UA 2ZNIA 3WNJA 2K6ZA 4X0KB 2R1XA 1X7TA 2F53B 5ICXA 1U8OB 5BMVA 1YEFL 4LKCB 3L95B 3IETB 4IIZA 3DECA 1AGEA 4GXFA 3FNKA 1JGUH 1QI3A 2KLSA 4W6YB 3BQUA 4CADA 4IGBB 4ZO8A 1XDCA 4CC4C 5KAQF 4DAGL 2G38A 4KV5F 1PQZB 3KYAA 3SJVE 5IJ0B 2YPLB