3WG7B

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wg7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wg7B02
3ERXA 3S3DB 3NJKA 2IDQA 4YSEA 1OCOB 1ADWA 2XLLA 5AZUA 5I5MA 2PP8A 3CDZB 1AAJA 2HX8A 5B3SB 2AZUA 5LDUA 1ET8A 4E9VA 1ZDSA 2CBPA 3NT0A 1I53A 2N0MA 3QQXA 2BHFA 2FQEA 2IH9A 4BWTA 3KW8A 4E9XA 1GY1A 3G5WA 2EIMB 4GY4A 4BXVA 2CAKA 3FU7B 2BP8A 4HAKA 1TU2A 3NJLA 3FYIB 2X88A 3QJVB 2YQBA 2IDFA 1J9QA 1NIDA 1KGYE 4Q8BA 4WTQA 2JXMA 3EH5B 2NRDA 1JOIA 3CG8A 5B1AB 2PP7A 4M3HA 2ZXWB 2VSMB 5AKRA 2VW4A 3ASNB 4KNSA 3AW5A 2VSKB 3U25A 1E67A 3NSDA 1JVOA 3QJUB 2IH8A 1OE3A 2LLNA 2I85A 5AFAA 4KNUA 3NSYA 6PCYA 1NIBA 2BP0A 2WSDA 1NPNA 4A2DA 2QDVA 4DP1X 3WNIA 1SHWA 1V10A 3AG4B 3FSWA 3SBPA 5I6NA 2VN3A 2WO2B 4BDVA 2B08A 4YSQA 3UAAA 1OCZB 1QHQA 5FC9A 3TA4D 2Q9OA 3OD3A 2YXVA 1BQRA 2PPDA 4E9WA 1AOZA 2EIJB 2GC4C 1XB6A 1MG2C 1A65A 2DY2A 3V9CA 3FQYA 2J5WA 1E5YA 1AG0A 3FQ2A 2QPDB 3EF4A 2JKWA 1OV8A 1WA0X 3EH3B 4TXVB 3S8GB 2FJSA 3JTBA 3FU9A 3S3CB 1SFDA 5D4IA 1CYWA 3ABLB 3CDZA 3EHBB 2MRYA 1KDIA 3DTUB 2IWEA 3C75A 4G7RB 5I6LA 2R7EB 4GXFA 1ET7A 1AACA 7PCYA 4GP5B 1M56B 1W6WA 4KO7A 3T71A 3NP3A 3NP4A 3NJIA 4AZUA 3GYRA 2R7EA 2YAQA 1NINA 1OCRB 2FT8A 2HLEB 1NIFA 2YAFA 2OJ1A 1WS7A 4YSOA 1RKRA 1KCWA 5B1JA 2XV2A 3HEIB 4NAJA 2EIKB 1UATA 1NPJA 1N68A 3WG7B 4UF7C 4UANA 2ZOOA 3X1NA 4ZK8A 5PAZA 2FT6A 1TKWA 1XMEB 3X1FA 1L9TA 4HALA 2YARA 3AG3B 2IAAC 4YSPA 2CUAA 2FTAA 2UXFA 3T6WA 5B7FA 2UXVA 2UXTA 1SF3A 2XX0A 2W8CA 3H4HA 1PAZA 3NJHA 1JXFA 1SDDA 3GXUB 3WI9A 3X1EA 1NIAA 3HB3B 1M57B 2AZAA 3NJNA 1CURA 1EZLA 1ILUA 2HXAA 3FSVA 3TBBA 4CSZA 1JZFA 1IKOP 2IDSA 3QPKA 3IEAA 3PLYA 4AI7A 4G7SB 1JVLA 2AANA 3NJMA 4M4RB 4E9SA 2AFNA 2I7SA 1PZBA 2PPCA 1W8EA 1BXUA 2ZONA 1GY2A 1CC3A 2Y1AA 4QKTA 4FA7B 5I6OA 1T5KA 3OMNB 1J9SA 1URIA 5I6MA 3CVBA 3FSAA 1JZIA 1KBVA 4DP2X 3GDCA 3FU7A 1BYPA 6PAZA 4E9QA 3KW7A 4ENZA 1FWXA 2VMJA 3IE9A 2H5UA 3PAZA 2VW7A 1ASPA 3NSFA 1AS7A 2HRHA 3V9EA 4YSTA 3PCYA 3ZDWA 2YAOA 4WKXA 1HAWA 3FSZA 3T9WA 4A2GA 2P80A 4YSUA 3SBRA 2GHZA 1WAEA 1X9RA 1PF3A 3ABKB 2HZHA 4KOBA 3S8FB 2OCCB 2IDUA 1L9OA 2JFCA 2EILB 1RZPA 3ASOB 3L45A 1E65A 2YAHA 4AKPA 2P80D 5B7EA 2FQDA 3ZIYA 5EHFA 4HCGA 3WKQA 4KO9A 5TK2A 1AZNA 3QJRB 1A3ZA 3UAEA 2YXWA 1PZCA 2IWFA 1JZJA 1RCYA 5I6KA 4FAAB 1OF0A 5I28A 1MG3C 2HRGA 1AANA 4CSPA 1PMYA 2GIMA 1SF5A 4AX3A 1QLEB 1GYCA 1MZYA 1PNDA 1MZZA 2GI0A 1BQKA 4JHVA 5I26A 2GSMB 1KV7A 1ASOA 2PPEA 2J55A 1KDJA 1AIZA 2QPEB 4HCFA 1ZV2A 1ET5A 4HHGA 1PLAA 2GB2A 1GS8A 2QT6A 2DWTA 3QJQB 2E86A 1YLBB 2RACA 3JT2A 2BP0B 3NJJA 4NERA 2IDTA 4AKOA 4YSCA 4DPCX 1PZAA 3UABA 1GS6X 1J5CA 2PCFA 4BDVB 3FPXA 1W6LA 1V54B 3PPSA 3WNJA 4BXSV 4E9TA 3FQ1A 4BWWA 1ILSA 1PLBA 1B3IA 4DP9X 5B1BB 9PCYA 4KO5A 5F7BA 1AZRA 1NWPA 4GP8B 2BW5A 1BQ5A 2WO3B 4NB7A 2YAEA 4YSSA 1TEGA 1XB3A 3IN2A 3S3BB 2PP9A 2PLTA 1ASQA 2PCYA 2VM4A 4HZ1A 4HCIA 3DIVA 2PPAA 5B1KA 3UACA 2FT7A 1NIEA 4BK5C 4P5RA 1AZUA 3OQRA 2BO0A 1AZBA 4UAHA 2HX7A 4JKNA 4PAZA 4KO6A 3NSCA 3OM3B 2CJ3A 7PAZA 4G7QB 1DZ0A 4KNTA 5D4JA 5F7AA 1L9QA 1ZDQA 1OE1A 2BWDA 2J57A 1HAUA 3T6XA 1XB8A 2DYRB 1OCCB 1A8ZA 1JXDA 1N70A 3AZUA 3NJFA 2XV3A 1EHKB 1AZCA 3AG2B 4YVNA 4F7KA 1AG6A 5A7EA 4DP6X 1ZIBA 4L0PB 2VW6A 2XUWA 3TBCA 3OMIB 1E5ZA 5B1JC 1J9TA 1AS8A 2FQFA 2EINB 3SQRA 1JERA 2I7OA 1DYZA 2BZ7A 2BW4A 4Q89A 2DYSB 4DP7X 2VM3A 1V55B 2DV6A 3CVCA 3MX0B 4A68A 4EF3A 8PAZA 2XYBA 1BXVA 1OE2A 1E30A 4A66A 1JXGA 4HIPA 1WA1X 1PCSA 2HX9A 1GS7A 1JZHA 2XU9A 3UADA 1NDTA 2UX7A 2YAMA 3T6VA 3N55A 1F56A 3X1GA 4X4KA 1A4CA 3FU8A 3H56A 1ZIAA 1A4BA 3QJTB 3QJSB 2Y69B 1R1CA 4DP5X 2B3IA 1FA4A 4G71B 2A3TA 1NZRA 1FFTB 1J9RA 3SBQA 1IBYA 3WIAA 3NJGA 1NWOA 1ZPUA 1M9WA 2XXFA 3FT0A 4GP4B 1KBWA 2XVBA 3OMAB 4DPBX 4W9ZA 1J5DA 5IY5B 2H3XC 5TK4A 2X87A 4N8UA 1TEFA 1HFUA 1OOWA 2FQGA 4MFHA 5I6PA 5E9NA 3MBWB 1PNCA 5B7MA 2QDWA 1KCBA 1SJMA 4E9YA 4F2FA 2AVFA 3UGEA 2Q5BA 4BWUA 2BP8B 2GBAA 2TSAA 3BVDB 1CYXA 2UX6A 4QLWA 3FYEB 4YL4A 3RYMA 4DP8X 3ABMB 1IBZA 1WA2X 1JZEA 1SNRA 3N2JA 4A2EA 3NYKA 1GW0A 2PPFA 2XX1A 1RZQA 2ZWNA 1BYOA 1A4AA 2YAPA 3AY2A 2J56A 3CVDA 4A67A 1L9PA 5PCYA 1PY0A 1BAWA 4E9RA 4G72B 1ID2A 1AS6A 1NTDA 2CALA 3FS9A 3PAUA 3ZBMA 4HHWA 1BXAA 4AKQA 3EH4B 2XXGA 1IUZA 1SDDB 3PXLA 1QNIA 5I5IA 1L9SA 3TU6A 3H4FA 4P5SA 5I5JA 1L9RA 1X9UA 2FWLB 2CCWA 3CZUB 4F2EA 1JZGA 1SHXA 1BEXA 4G70B 2H47C 2OV0A 1PLCA 1VLXA 4RH4A 3T6ZA 1GR7A 4PCYA 2YEVB 3ABGA 1ETJA 4YSRA 1SFHA 1GSKA 2XV0A 2MTAA 4DP0X 3FPYA 4K9JA 4A2HA 4N4YB 3ZX1A 4A2FA 4DP4X 3IN0A 1AQ8A 1KYAA 4YSDA 2TSBA 3X2QB 4W1TA 1AR1B 4GYBA 2XWZA 3X1BA 3AG1B 3WKPA 4YSAA 2DWSA 3IBOA 3D12B 1WS8A 1IC0A 2BWIA 2FNWA 5ANHA 4DPAX 4JHUA 5D4HA 2W88A 1NICA 3TASA 4YVUA 2BZCA 4KOCA 3BQVA 2GC7C 3PAVA 2IWKA 1MDAA 3DKHA 2UXGA 1CUOA
chains in the Genus database with same CATH superfamily
3T8XB 3V0WH 2JTDA 1NFDB 4N2LA 4N90D 4KROB 2ZXQA 4AGMA 1KKCA 3UTQA 1LD9A 3HOGA 3Q2CA 1S7WA 2AJSH 4KMQA 4PJBB 4KFMA 5IQ9A 3RB7A 3TVMA 2E74C 4AZ8B 4LLYB 5CHNA 5I1CL 3GSRB 4BIUA 1MZFA 4UM9D 4AT6A 4W81A 1EZVH 1BFOB 4DV3B 3BP5B 3FRUB 2BHFA 3H2PA 1QWNA 5LBSA 3HBZA 3VRJB 3C3SA 2OR9H 4U1GC 2PXYB 2VL5A 4RX4D 3QK0A 2V7NB 4HAKA 1OAUL 4XP4L 2GKIA 4AYFB 1X9LA 1NGZB 1E9QB 2A1WL 1OAKL 5M7QA 3PWPD 4G1EB 2MNJB 1MRCL 5JPNC 3IPBA 3QRBA 5GHWH 5L4MA 4UFZA 4PDVA 1PKQB 4Z95H 3ZDXB 2BCMA 4YO0B 3X11B 3EYQD 4JZGA 3DPBA 1XTMA 1BQUA 4IOSD 1ZS8B 4J7JA 4PRBA 1MI5E 5C0BE 3CWGA 3QFJD 1XBRA 1X7SA 3BUYB 5FGCB 2YPVH 3PQYD 3SDDA 4GFTB 3MGOB 5E5MA 5I75C 5I71B 4KXDA 1IBGL 3KGUA 3U0PB 1EFXA 1OSYA 1EDYA 5A2KH 4UU9A 4TVUA 2ZXDA 4LFAO 1IM3D 5GTIZ 4WIQA 1QWUA 3IDXH 1S9KC 3FSWA 2OT5A 1T3FB 2ICEA 4M8QB 2VDKH 4MVMA 1OAYL 5C07B 5I1IH 4MA1B 1T83A 2UXCB 2R56L 3MROB 4M5ZL 4BDVA 1R3KB 1CTMA 1GPOL 4NXNO 5BVPH 5C86A 2K3TA 4JHAH 3UAAA 2Q9OA 3HZVB 2OZ4H 4W9IC 5I0DA 2J8UF 4GEIA 4UT6A 3JAKB 1XF5B 5MEQA 5I1LB 2GJJA 2CWRA 1TUEB 5LUMA 5C0NC 2YMOA 1J1XH 4ATWA 5L9DL 3MLWL 3VG0H 2XHNA 3TBTB 1A6UH 3BISA 1GHFH 1UJ3C 4JK0D 3B8MA 2Y7MA 1GO3F 2FJSA 4JANA 4N1CA 5D71L 2EECA 3WDIA 3KPSB 2CTQA 5BR8O 4BRJA 4OIIL 4D9QE 3V6OE 3DTUB 1KEGH 2FWSA 4KL1A 12E8H 4FFZA 1G9NL 2H2SD 3HCVB 2FLBT 3N1GC 4XP5H 4BGLA 3US1A 3U48A 1KN4L 2AQPA 5IEKB 4TQDA 4H25A 4QXVA 4PJ5E 4X8XA 4AZUA 1RPUA 1IZKA 2ZCHL 4R0LC 1RZKL 32C2A 4K8RH 3GB7A 3NH7L 3T8VA 3A6CH 3LTVA 5F96H 2YMTA 3CN3A 1WFUA 2P6JA 3FBKA 1EO8H 5L3FA 2YI8A 4K3AA 4KP4A 2NDGA 1SQFA 3E8FA 3RU8L 2ZSWB 3ZHLA 5KA5A 1XX9C 2OYMA 3V0HA 3TPUA 3RUGE 2XTJB 5DUJA 4CN4A 3WBDA 4XRCB 1QQDB 1QEWA 4HALA 2R1XA 4R26H 2E27H 1V3JA 3BHBA 4GUCA 5JMOC 2FTAA 4CZZA 1LL1A 5BVJB 2UXVA 2GCYB 1U3HB 1DJZA 1S2EA 4Y2DA 4DAGL 3DGGA 2FUQA 3CZJA 1CG9B 3IXAA 4YY3O 2K9FB 4QLRA 2DQHH 3US9A 4PBWD 1Q90D 4XXWC 3VFTA 1LR1A 1H2SB 1USQA 2BFVL 3NJHA 3OEEG 5FM5M 5FR3A 5KTEH 2ZUQB 4FTDA 3ZMTA 1E4WH 2OMWB 1S3JA 1BZKA 4V11A 4N2CA 5K1PA 2QBWA 3T2PA 5DJCA 1KB5L 1KB5H 3B1UA 3MJWA 2AV7B 4XN7A 2JGDB 1IKOP 3RVWD 3CC4V 4FABH 2EEFA 2GSGB 5FUOL 1EMTL 1C16A 5AVTB 5J89A 1X7TA 4KGJA 3QDJD 1W8NA 4ZAKB 3G04B 4BFEA 3DMMD 4I4TA 5C8YB 3SE6A 4A6YA 2QTVA 1GGUA 3OMNB 1SQXH 1J9SA 4QYOB 2BVUA 3ZTDC 2WSSG 2BHZA 4XCNA 4UOW1 1XEQA 2AQRA 2FL5A 4QIRA 3CJHA 1E4HA 3BO8A 2Z0AA 5MHSE 1AXSA 5DO8A 1UD8A 1F02I 5EZLA 5I19L 2COVD 1WWAX 4LEXH 3CTTA 3LDCA 1R24B 2QADD 2H6PB 1YNKH 2XWBA 3UZVA 2LO1A 2VLRA 2AV1A 4QTIH 2OYLA 1OP9A 3EGSA 2IDCA 5JQHC 3SE3C 3F83A 4NQEA 2L6LA 4AYID 3QI9D 3KPMA 4JI5O 1FC1A 1YN7A 3C6LD 3QISA 5FO2A 3WY3A 4YX2H 4WWOA 4X8JA 3T4ZA 3WN5B 1IGJB 2PW1A 4WNSA 2X53A 1UJWB 3UPAA 1Q9OA 3BIKB 3P30H 2JKNA 3RWIB 2OTPA 1BZ9A 3PXHA 5T1KB 1CLOH 3L45A 2NY0D 4AQ1B 5KVEE 3MXWH 1NMBH 4RDQF 1ODAA 3K74B 5E2WH 2V4LA 4HJIA 2KS0A 2EACA 2X40A 4YJ3B 3WB2A 2VC2H 1PTZA 3AMLA 3F7KA 3MRBB 4WFGD 1BF5A 2R9HC 3DA0A 4P99A 3V5KB 3NVQA 1C1EL 3WLBB 2OZ4L 1VARA 3B7TA 1K8AW 1URLA 1BVZA 2EC9T 4GQ9L 1GYCA 3KG5A 1S7RA 1KOAA 1UZ8B 1BQKA 4GRLB 4HD9A 1XGQA 2HAZA 4JREB 1V5JA 1ASOA 2H9GA 1BJ1J 2H0FA 2CKBH 3FN9A 4ZNCD 5HPOA 4ALAH 4CVXB 5I0VA 5L4FA 5FF6B 1CTOA 3L4ZA 4HHGA 3RVXD 3IJSA 1ORQB 5CMAA 3V5HA 5J12B 2JIXA 4YWGH 2QT6A 2EJ7A 2K3HA 4K0KO 3TA3B 4LLWB 4TV3A 1NFAA 1DP0A 5BR8B 3CFMA 3L9EA 1Q94B 2NSXA 4ZZKA 3GXTA 5JDJA 4KVNH 4F2MA 2R9IA 2YPLD 4P4RB 1VGKB 3MRLA 1DFBL 1E6OH 3BP7B 5EZOL 1I7ZA 5T3XL 5DLML 1IFHH 3PFUA 4UM8B 2O6EA 4IOSA 2P5WB 1I4FB 3FOLB 3RGVC 1MNGA 3T2NL 3N2GA 3KD4A 4MNGB 1JNNL 1HL5A 2XETA 4D0DA 2RCVA 1B3JA 3E9TA 1Y76A 4OZHE 3LIZH 1NWPA 4KNQA 4Q9RH 1UXSA 4MMXB 4JAUA 5D1ZI 4C58B 1Q94A 1P0SE 2BNUB 2ZSVB 4N25A 4RUEA 4PJGA 4UIKH 3AEIA 1T04A 3P0GB 4G9FD 4G1MA 3WNPA 4Z7NF 2JB5L 2PLTA 5FYKH 1IBMB 3CDFA 2E27L 3GDBA 1UADC 3J07A 2WYHA 4C4BA 2NY7L 1NLBL 4NQDD 3FFOA 4CU7A 1JGEB 4Z1VA 2HB0A 3MRGA 1AD0B 4OBRA 3DO7B 3CFNA 2O4EA 4NBZB 5FGRA 4PAZA 5ADPH 3TEYA 3NSCA 2G2NA 2Y1VA 1DZ0A 5AW9B 1DDHB 2PW2A 4HUUA 3EIFA 4XAKE 2V3DA 1CGSH 5DHVB 4NWTL 5B3JE 1XH2A 3F7VA 4W9EC 1BS3A 1K5NB 1J5EB 4WFGE 5FECA 3AG2B 3ZRSA 2FB4H 3EW3B 5FYLL 5DD1H 4L29A 2QLVB 3V0EA 2F8IA 1FKAO 3BQUA 5AUMA 1FGVH 4DR7B 1FL6B 4JQXA 4TN9A 4Y1AD 3TIDA 3RYIB 5L3GA 2EH8L 3RYFB 2O5YH 1W2BU 2XVKA 2AERT 3BQUC 3C90A 4ODHL 1A7PH 4K7PL 5D1QC 3U0WH 4MSWB 4N0FA 4UV7L 3NOIA 4P05A 4FQXD 4EEEA 4I9QA 1JGDB 3ETQA 5SWZA 1XCTB 1M2VA 3L2MA 2PUQT 3VA6A 4FQ1H 5DI8B 5BRZB 3IDGA 2WA3A 1AR4A 4G6JL 1FI8C 3ECBB 3SPCA 3D25A 1YUHA 3PGCB 4WTWA 1WG3A 4UTAH 1N8ZA 1N8OE 2WVVA 5I19H 5GRWA 3EG9B 3O3EB 2JH2A 2QKIB 3W7UA 4DR1B 1XDTT 4X9IA 4XT1C 1P84F 4JI1B 2DQEL 4JS7A 4EKXA 4WUUB 4X1KB 2B3IA 5GONA 3JV5A 3QORA 1N64L 3LRLA 1JPFB 1QNZH 1FDLH 2FSDA 4GXVH 2V2XA 2E56A 5I1AB 3IGLA 2EE2A 4G6KL 4MMZA 1LE9B 2CKNA 4DK3A 3QWQB 2BOBB 5D2LB 1P4LB 5IQ7H 4GI9A 2UWEA 4W9ZA 3OR7B 4N8VB 3GBLA 4R7NB 4TNEA 2W92A 3NJVA 4WFHE 4QTHB 2FQGA 2F7OA 4XHQA 2DLFH 3NGBB 3RI5F 1Z3GL 2EQDA 1COWG 2NNUA 1BJ8A 2W95A 3PGFH 4QRPD 2ITDA 3GI9H 5IK3B 4I5SA 5BZDB 3ULSB 3L4CA 2CHXA 3ESNA 1DBKL 5KBMA 4X6EB 4BRVA 3NABH 3I9PA 3FU0A 1OGSA 3L3JB 1H3PH 3QPXH 5JORB 4Z1PA 3ABMB 2G4GA 4EB6A 1SNRA 5E8PA 1FRGH 5E03A 2C9PA 2FB5A 3KS0J 1WC7A 3VQXA 3ZDZE 1IGFL 5D7SH 2Q7HA 4PB9H 3HG1A 4R4NC 3DMMB 4PJHE 1L9PA 3H54A 5D7JA 3V0AC 2WCSA 1ID2A 4WFAV 1NTDA 3W0WA 1ZLZA 5ALBL 4EI5A 3N5AA 3KPLB 4FEIA 3MNWA 1JE6A 5AW0B 5JTWA 3ARDD 2ZCZA 4RMQA 4UNIA 4M7JH 1P5UC 1E8WA 3A6CL 1UQSA 4KK8C 1GYAA 3ZKMC 4LP8A 2ZOUA 5ILTL 1OW0C 2BNRD 3VWKB 3ELAT 4P2OB 2CH7B 2NY1D 2P8MB 2VC2B 3N50A 3P4MB 1YY9D 3T0AA 4MMZC 4TNFA 4RISH 3ESPA 2XHBA 2C9VA 4WO4D 1UC6A 2KC0A 3KBFA 3VXRA 4KQ3H 4B3RO 3T6ZA 1H19A 4I0CC 1I9IL 4U3FH 4GO8A 2YGVA 4MQ7B 2WLNA 1M42A 5AQ0A 4BFJA 1Q43A 1ZA3B 5I8CB 2HLAB 1XNQO 3L3DA 1QHPA 3PHQB 4LLMB 1ADQL 1NCBL 3BO8B 4PGEB 4AEHH 4B96A 4K3JL 4MA8H 2FL5B 2XWZA 3OAWA 2X4QA 2FJFA 2QKSA 3KLKA 4J6RH 5JDSB 1H3XA 3GD1C 1IDSA 2NY0B 2DQMA 4FG6C 4CNIA 2D7TH 3SY0A 4CAGA 3GO1L 4MQ7A 1F86A 4X2UA 1NS1A 4QRUA 3SYAA 1CQKA 1GGYA 1QX1A 4R7LA 4I9WD 2UXGA 2EYSA 4DO4A 1I3VA 2VLKD 2UWEB 3HKCB 5H2BB 1ORQC 1U92A 3VACA 4FL4B 5TDOA 4OPHA 25C8H 3C8KB 2PP8A 4L8SB 4NSKB 2F1AA 4GKJB 5EO0A 3WE6B 2C9UA 2KHAA 3VI4E 2AK1L 3T1HO 4YLBA 4EOWL 3N40F 1FNEA 4N23A 3H6AA 3QO1B 4L8SC 5C6TL 2BXYA 4XCYB 4A7VA 3TNNB 1X4TA 1T3FA 1VQMV 5FM8A 1H8HG 3DLQR 2HRPL 2CTRA 4H1LB 3FQWB 5DEFB 4BWTA 3TEWA 4M1DL 5DJZA 4E9XA 4BXVA 5CKAA 3RUGB 2EDKA 1JFFA 1V7MH 3A4FA 1HSAA 2EDQA 3Q43A 3Q0HA 3LIZA 2R1WA 4PJAA 4G80B 4P4KD 7FABH 3BJLA 1F4XH 5H6QA 4BFFA 2CG9X 4N90E 4OB5L 1M56C 2IALA 1CI5A 1OSPH 3OJDA 4P5TB 4OV5A 4XMPL 4Z7OE 5C07A 4B60A 35C8H 4DOHE 2DMXA 3BW9A 4IEFA 1BVKA 4PJGF 1L9MA 2VSMB 1CXEA 2K9PA 1VZIA 4KNSA 3HFFA 4PTUB 1NKDA 2VSKB 2I9LB 2FR4A 3TOPA 3RA7H 5TQ2L 5EV7A 1WZKA 5BS0E 2B1AL 2AJVH 4LPCA 1AQDA 3SBWA 5ITBH 1TTUA 2IH3C 2ZPKL 2GEEA 1NPNA 2Y06L 3B8YA 2FDBP 4D0BB 4DUYB 1IEAB 4JM2A 2R8SL 4IBLT 2NY7H 4LLQB 3QORD 3SBPA 2GDSA 4K7FA 2BOCA 3CH8A 4WV1A 2CIIB 2EH7L 1H2KA 4O2BB 4NZTL 1C5DB 2A9NL 1YVWA 4YSQA 3THOA 2VQTA 4F58H 4D8OA 5JA9A 2VZTA 2HLAA 4WI2A 4JZJA 4M1GH 3I6GA 1EPFA 1PM9A 1ZLVK 3SKNB 2YIBA 1BZOA 3ZHSA 1KJ3H 3VXQB 4JJOA 3GSUB 4F9LA 3FTYA 1OV8A 4WF7A 1NDMB 4G1MB 3SJAC 1CB4A 3NDZE 3A0RA 3ALPA 1IGYB 3OB8A 1G9EA 5CN0A 1I7UA 4OQTH 3CCLV 3CZFA 4HIEA 3IJHB 4JFYB 4KI5F 4CC0A 4HJEA 4XH2A 5JQIB 2AJXL 5B1BC 1LD9B 4FTVD 2CA4A 2CGYA 2I07B 2HFGH 4ZUSB 5FYKE 4E0RA 3KEDA 4ZSOA 2DBJA 3CVHL 4OCSH 4P9HH 4JPIB 4GUNA 3KBEA 3IJYA 3VSVA 3Q48A 5E9DA 3U36B 4HUNB 4N26A 4LDOB 3NIGF 2J1XA 2VMEA 4P3DA 4XBEL 4UAOC 5D1ZA 3BCDA 5KYYB 4CH6A 4HOXA 2ADIA 1G1YA 3HPLA 4NAJA 3RUGA 2UY7A 5DYOB 4KU1A 4ZD3L 3OTOO 1LEKA 1BVOA 3WG7B 3ILPB 1G7QB 5FF6A 4LASL 1MY7A 2EDEA 1MF2H 3LH8A 4YPJA 3ZEDA 1CR9H 2J21A 3QAZC 4AJ0A 3WG7C 2NLJB 3WIHA 4JGNA 1TUBB 3Q8BA 3F5WC 2CCVA 5E2WL 1LK2A 2NCEA 1FAIL 5B7FA 4HYOA 3IETA 1EHLL 3VCLB 1UACH 2IQ9H 5B21A 1ZLUH 2HTLD 3MACL 1W0WA 3CCHB 5IMLB 3ESVF 3G04A 3V4VH 2ZG1A 1FZKB 5KS9E 3ILPA 4H20L 3HFML 3K6NA 3B43A 4X5WA 1PCXA 1YQVH 4NQDE 4PV9B 4OT1L 3ZSSA 1D5XA 2EILC 2LW7A 4HIXL 2C5DC 3AC0A 1MN4A 1CFBA 5LBSL 3D4GA 4LZKA 5I76A 4KTYA 1EZLA 3KPOA 3TFKC 1NCOA 1MSDA 4LF4B 1UXSB 2WGNB 3BLBA 3HI6H 3IPFA 3MNVB 4MMXA 5GGSB 3GTTA 3WMPA 3QPKA 4Z7QE 3ML0A 4TTGA 4OZIA 1KTBA 2AANA 2BSED 4NO5B 2B2XL 1IAKB 3A4AA 3PHAA 4FZEL 5D70H 2EDFA 3NTCL 3QNYB 4FQCH 1BXUA 3D3VA 4FPPA 4XBGB 3LPFA 3FB6C 5JQ6L 3UTTD 3ISWA 1DBMH 1MJ8H 2IO5A 4JY4A 3T0ED 5DEGB 1ONQB 1MJ7H 4FM0A 2LGWA 2ADJA 3ARED 2BC4B 2D7QA 1IB5A 4MS2A 3FRPA 3TVMD 1KBVA 2GAZB 2O5NA 4XOEA 3O9WA 3SPVA 4HWBA 1NDMA 2ZAHA 1BYPA 2C3VB 2LQTA 5E94B 3DHMA 4C57C 1ZE3H 1F4AA 1AP5A 3NCJL 3UJTH 4E9QA 4GG6E 4JI7B 1G9NC 1OM3L 3FQXA 4Y2DC 3MRCB 3FU6A 2DM2A 3TH2T 2LU7A 5J06A 1MNUL 2R2HA 3J8F7 1RZ8A 3TN0A 5F88B 1FL5B 5HYJB 2DLHA 4KKRA 2VDKL 4WFGA 2IAMD 5I0YA 5IGXL 3L5HA 1N8RW 3MJGX 1RIVH 3ZOAA 4JHWL 5BOJA 2CO6A 4QCIA 3P2DA 1TZGL 2R59A 2K4WA 4K3JH 4MA8L 2OI9B 1AHWC 3HC0B 1X4YA 5C0AE 2W0KA 1UJTA 3H9SB 3KXFB 1P5UA 5DUBA 4XN8A 2W0FC 1HQRA 1SKVA 2XT1B 4OJAA 3AK3A 4ZMOA 1YEFH 4UUJB 4POZD 1P1VA 4KROC 4P2OA 3WKQA 3F6JA 4KAQH 1SDYA 2IU3A 2DWDA 2VAAB 2VIRB 2WTRB 1F8TH 2VLJA 3KGRA 1RHHA 3MBWA 3Q01A 4PJXF 1EEYB 4Y1AA 1XD0A 3TTSA 3UGXA 1JZJA 3D69B 2XT9A 3D08A 3H53A 1ID5I 3INOA 5CBEB 3DI3B 3U1QA 2P5OA 4LPUA 2YLKA 2CCLA 3IFOB 3EO9L 1JRHL 1BVNP 1MJ8L 1G9MC 4GRLC 4J3UA 3H1JH 2AZ0A 3L3OA 2VDNB 4GG6F 5CIPB 3FZUD 5J0BA 3AGWA 3MGTA 2QPEB 4Z7NB 3TONA 4DR4B 3T1YB 1XMOO 5JPNB 4OFPA 4U6XB 3EFDH 4MXVF 2BK8A 1YLBB 5JH7A 4XPTH 2AW9A 1ETZA 4JO4L 2X3AA 1FC2D 1A7OL 4Z76A 3ZE1F 1T04B 1A32A 3FO0H 1RZ7H 1SN2A 3QHZL 3W39A 4X9HA 3BRGC 5D93B 1I9JH 2B7DT 2IXQB 1I8MB 3ULUF 2ZYRA 5KANG 1FFXB 4NTXA 4M1CC 2VUOA 4K5LA 1X4ZA 2LHAA 3DVNA 4JG0L 3ARBA 3SD5A 3N41F 3KCWA 1JPEA 1A1OA 4B5ZA 4ABQA 4JPKL 4K94H 3WIIL 1O0VA 1KIRA 3I3BA 1YY8A 2DQHL 4AEFA 2L3BA 1KYDA 2FIKA 4WY7L 1Q9LB 1ODUA 5AAMA 3SDXA 4JR9L 4AGOA 4XPAL 2P42B 4TPRL 3L7EA 5T1DL 1EFRG 2ENQA 1UGKA 4AL8H 5EIBC 4Z5RA 4HOMA 3PUUA 4Y9BA 1FO0B 3BPNC 1M1SA 2NY5C 5C0FB 3AWFA 3D30A 3BIKA 4OLWL 2BWDA 2J57A 3NIGE 4GQPH 4ZO6A 4PGDA 4XMKL 5D55A 3BX7C 4A1RA 3C09C 3WMQA 3PXJA 1CGXA 4NWUL 5F6HI 3CRQA 1M2VB 1OB1A 3ZMSA 3JZYA 2CO3A 4PB9L 4X1KA 1LJMA 3GIZH 2VLKA 1TLMA 3ML9A 2N1KA 5I8OL 3BP4B 2AEPL 3DIDA 3TYGH 3WFHA 1V9PA 2XUWA 5F7HA 4U1NA 1CD1A 5D6DA 4WCYL 2B2XH 3LPWA 4OIAA 3ZU8A 3LV3B 3WFVA 4XMWA 5A2BA 2J7LA 3IGFA 2A06H 1JK8A 4X9YA 3BT2L 4OKVB 1YITV 4OJDH 2ROYA 3KCPA 3SCMC 4GT1A 1KUMA 3CFBA 3KH3A 4HJ0D 3CFJB 4HS8L 3PHOA 4Q89A 4CUCA 1ZMYA 3L1FA 3CZLA 3L7FB 4B3VA 2FX9H 2B4CC 1E6JL 4UIMA 2F61A 2RTTA 4A68A 1NFIA 4LCCB 3QZOA 4KQ3L 1N4XL 3GLEA 4WWID 3ZTNL 2QR0A 1JPSL 1FFNA 1ZANL 3H1HH 1K4DC 3OEHG 1JGEA 2RQ8A 3ARWA 1NDTA 3MRGB 4QNPF 2GBUA 1A47A 4ZOCA 4CU8A 1PPIA 1A4CA 5CBHA 3VW3L 4HJTA 4P2RA 4G27B 2H32B 5F3HB 5AW7B 4LF5O 2E74B 5CU9A 5B1AC 5DZ9A 3FFDB 2NNRA 5DWUL 5SV4A 1DN0A 3NJGA 2FUTA 5DD6A 4HOWA 5A16A 4PRPB 3OKLA 3U4EA 4F8TA 1FFNB 4P8QA 1K3IA 1NMAL 3TH3T 1WGOA 1NR1A 2OZ4A 4D3CH 5LGTA 1KMGA 2JKXA 2X4NA 2F15A 3IJYB 4TRPH 1J5DA 3VI4B 4G3YH 1N32O 4RWYH 2X4SB 4HXBH 1A7QL 1MUJB 4DK6A 5A2FA 1RIHH 5FYJL 4J12A 4ZUVB 4BQ6A 5ESVA 1Q7YW 3Q3GB 5EBWA 1CIDA 4Y2OA 3DYMA 4G42B 1BGXL 1H5BC 4XMXA 3TYGL 4LOUC 1E3FA 4J3OG 3NIFB 3GI9L 4DP8X 2AK4D 3R8BB 2BH0A 3TNMA 5A7BA 2CBTA 2LGQA 3ETSA 1EXUB 1T7XA 2N56A 4L3EA 3OSKA 4XVOA 3RKPA 3MV7D 1FE8L 5DMYA 1A7PL 3B3IA 4K7PH 1OAUH 4MAYC 2ZWNA 5HJGA 3FF7A 3DXAB 5F1IA 1LK3L 2OJEA 3BWUF 5L2JA 1P2CB 3BIBX 2G5RA 2F18A 4P9OA 1UXWA 1CPYA 4BSWB 3BPCA 3CBJB 1VENA 4YL9A 4LNVA 5HGHA 4Z3EA 3AREB 4LLUA 1BIIB 4MLSA 1AGCA 4X5QA 1J8HD 1SXBA 2N7BA 2R9HD 4QRUB 2XQYG 4HT1L 3FCTA 3QWOB 4YHOH 1JCHA 5LAXB 3O2DA 1U8MB 5EEWA 5E95B 3DUHA 4LLYA 3IGAC 3CZUB 5CHNB 3E8BA 4PJ7A 3GSNL 1IKFH 2C9AA 3FH7A 4FNRA 4GI6A 4G70B 2X4TA 4OH2A 2OV0A 4G2AA 4AV0A 2YD4A 4EUPA 4K23L 4KV5F 2JJWA 4RRPG 3I75A 3U0TA 4JI7O 1PG7L 1I9IH 1XH1A 5JCOC 1RXLA 2FEEL 1TJIL 3IN0A 4V2BA 1LNUB 4E2LA 4ES8A 1I8LA 1GM8A 3X2QB 2UY6B 4QXGL 3OAZH 2P52A 3Q1SH 4PJGB 1C5CH 3T0EC 3EJQA 3FDWA 3CC7V 3QIBA 5SX5H 1L7IL 1G7HA 1I8LC 3NGBC 3MRCA 3U2SB 5ILTH 2YIBD 5IZ7A 1M4UA 3FQWA 5DEFA 4KOCA 1T0MA 2VITA 2X6VA 2PXYD 4ZO8A 1H3TA 4NPJA 4WSKA 1CE6A 2V6HA 3HRPA 4J11A 3DV6B 4R0LB 3KJ4C 3KBPA 1Z5VA 3RVUC 5EEVA 5DJDA 1OM9A 2RQ6A 4ZJ9A 2NSMA 5BVJA 1FBIH 3JV4B 2KPNA 4KRNA 4JRYA 3CX5K 4H44C 1URFA 1IAIL 3DJTA 1ET8A 2E9IA 1DVSA 1KMIZ 3HI1B 3ZL4L 3W38A 4FYTA 3QDJE 3OJMB 1NCWL 1Q72H 2HT2C 1FL3A 1T66D 1QP1A 2NN4A 3SYPA 3KW8A 4X6FA 3UG5A 2Q8BL 3MV7A 4H5SB 1D5ZA 2UWEF 4B97A 2OMXA 2V9QA 1HC1A 3FUIA 4M48L 1KGYE 1ERNA 3AB0C 1YCIA 3HI5H 3NEOA 3SGDH 3QR2A 5IV2B 1UM6L 2EJRA 3DJ9A 1I8KA 2JF1A 5B1AB 3DNKA 4FQHA 4JG5A 4R8WL 3ZL2A 4KKLC 5JYLA 4RA0C 2Z92B 3K57A 4YHMH 1U8PA 4TYUA 4MRCA 2XWTB 2K45A 4MW3A 1G1CA 3FJTA 1G4MA 4NQXB 2K6WA 4H0LB 3CX5F 2J8HA 4L4TA 3UG3A 2VLMD 1CD1B 3N6YA 2BE3A 4KNUA 2ZX5A 3HKEA 1MHCA 4XOCA 6PCYA 4M29A 4QWWC 2A4CA 3AROA 2AVGA 1KCSL 3GB7C 1DSFL 4O2EB 3KLSA 5DS8A 2C3VA 4FOMA 5IJ0A 3DIFA 4PJBF 1VEPA 2PCPB 3CXHF 5D72L 3V4VA 1NGXA 4LKCB 1CK0L 1WZLA 1QABA 5L4IA 4G5AA 1OQXA 1MIML 3EGSB 3RURA 5D7JB 1QHQA 1RUPH 3TA4D 3D0AA 1N33B 1N36B 1HSAB 1ES0A 1OTUC 1QQDA 4NZRH 2VDKB 4P2CG 3QYCA 3HAEG 4K3DH 3GWOA 2DY2A 4MQXD 4MWFA 2AK1H 2WLLB 2APVA 4YHPB 2A6KA 4HZAA 5ID1A 4TXVB 3MJ8B 4NI6A 3ZS8C 2FWOB 1HDMA 4Z7UE 2H32H 3S6CA 1OHZA 1V7NH 4OW6A 5E9DD 3ULSA 1P53A 1U8HB 4KZEL 3ZQWA 3H9SA 3KXFA 4FKHA 4QJ5B 2ZUSA 5I66A 2VN5A 2OYQA 4UCRA 2YUZA 4I2XB 4ZMPA 4OD3L 1FFQA 1OEZW 1BHBA 4LCIL 3F7RA 2N05A 4DUYO 3R1GL 1LE5A 5T3ZH 3JTTA 1JNNH 3VCLA 1NIFA 3ZN1A 2OL3B 2R9AA 4XC1L 3H9SE 2ZKMX 3KXFE 5K33A 5C09E 2BNRA 4BSJA 2BOBC 5B39G 3VOUA 1C5DA 3HMWH 3ZLQC 1YZZA 4MVOA 4K15A 3EVKA 4FHKA 4WWKB 5EBMB 3BMWA 5GGTH 3U7AA 3TNMB 5E70A 3S9DB 1T21A 3G71V 4ZO9A 5KVEH 1J8HE 2FHFA 2NYYD 4JQXC 4KKQA 1WLEA 4NQCE 3KGTA 3TLRA 3K2UL 2JJ1G 4YNYA 3LV3A 5CJ5A 2VDQH 3PWLB 3FRPB 4TPRH 4BFBD 5CILH 1A14L 1ZSHA 3QJXA 4UCVA 3GSOA 2XKSA 2XWJA 4GRMA 3T2OA 2A83B 3D05A 2Q1EA 4C83A 4ZG1A 1MI5B 1UG9A 2G75A 3IDGB 5C0BB 3EFFA 3GRGA 3N44B 5DT1H 3T4AB 5J1AB 1DSYA 5IHLB 1DQIA 4UM8A 2RBLA 3LRSB 3RZCB 4AK2A 3JD1A 1R4XA 1R9FA 1IGTA 3M46A 4JAMB 2PKDA 2ZM6B 2ITFA 5F6IC 2EXTA 3L81A 1Z6JT 2PYJA 4DGIL 4F9PC 1MXGA 1RJZA 3B56A 4GKSB 1HZLA 4LFHG 4YMPA 4JFZL 1R3IH 1JZFA 2WBXA 2Z65C 2O5YL 4FNSA 3PN1A 1H3PL 3EFDL 3O8XD 3QPXL 4JW3A 4YC2B 3V6ZA 4LP5A 4AC4A 5CEXB 2PPCA 4G6FB 4KUCD 5JIPA 1A7OH 4YHLL 4PWJA 3MGAA 2A1WH 3N85H 4NNYB 5KYYA 3JARB 3CPUA 3MA7A 1A7NH 3B7YA 5E7FA 5F88A 3HKDB 3WE6A 4I48B 1KLFB 1L6XA 3SDYL 1EJ8A 4P2OC 1KEMH 4JL2A 4JI0B 3ZXAC 3ZW3A 3DSFL 4EVNA 1CL7I 1IEBA 1Q1JL 5EFIB 3RJOA 1XF1A 2AEQL 1URZA 3GMOA 1N4XH 2J1YA 3ZTNH 4W93A 4L8BA 5KBNC 4QUOA 5FO8B 2PWGA 4HLZH 2FKXA 4N8CH 3QDJB 5AVYB 2Q7GA 5T1KD 3AWGA 2G5BA 2H9GB 1F4NA 1ZPLA 2VW7A 3FUFA 3HZVA 5ADOH 1E9PB 4GRLA 4YSTA 3AG2C 3QFDB 2IBGA 3E3QC 1KQSU 1ZLSL 1MW1A 2QTOA 4QPEA 2ZKHL 3N43F 1PGRB 4U6XA 5HVFB 2W80C 3C5SA 3QQ3A 3GUTA 3CIQA 4RAIA 2VN7A 1KN4H 2B59B 3EADA 4JKPH 4LCWA 4J4PD 1MKFA 4KOBA 3S8FB 4F27A 4RFNC 5EULV 2ZJSH 3M07A 5C71A 3ECUA 3QFDA 4J6RL 2FCBA 3AT0A 4V1DA 2XA8L 4EDWL 1JGUH 1JZ4A 3ZUCA 3JALB 1DVFA 3ISRA 2Y2YA 3M1BA 3LNHA 4XNZB 2OTUA 3NCJH 3WLWC 1IAMA 1BVLB 1QRND 4JFQA 5DYFA 3ZPDA 5L88L 4LAQL 1G87A 4LEBA 5D96B 2AXWA 1OARL 2O61A 3UTOA 1FGVL 1WBXA 1J0ZA 5JIKA 2XUMA 1HILA 1OAKH 4CSPA 5I1HL 4MRBA 2GPZA 1QLEB 3KYMB 4YEFA 1NJ9B 4TSBH 1I85C 4AGPA 3ZMUA 4M9OA 3OHXC 1KTJA 2I5YL 4N9GB 1WQVT 1O5DT 3SDYH 1Z9SB 2WAMA 1CFMA 2APTA 3RY6C 4AQYO 5DD0L 1LEKB 1GS8A 1BOYA 2HVJA 1K2DA 2CGRL 1MH5B 5JNYB 3JT2A 3P4NA 3W82A 4UV4L 1XSJA 4JX0A 4NERA 5I0XA 3DURB 2UVFA 4IGBA 1HJCA 5I2IB 1K8IA 1QA9B 3L16A 1XXDC 3UABA 4DV7B 5CSZB 4G42A 3RU8H 5IB5B 1JMZA 4IRSA 3WENA 2LFGA 5JUEH 3X3FH 2RH0A 1B0RB 2DN9A 2X4UB 4OZHF 3L3KB 3JASA 9PCYA 1XFPA 5CGTA 4FJYA 4EZLA 2FO1A 3BZFB 3QFJA 4K23H 3O0RH 4GP8B 4IGBD 5BRZE 1NGYA 4EIZC 1FSKB 3V4VL 3TA3A 3D18B 3WGUB 2SEBB 5D1XD 4R4ND 4ECNA 1RK1B 4Q9QH 3VD3A 1UEMA 4AWJC 1GAFL 5F89B 4ONGL 3UIZA 1QR1A 2BCKA 2JI2A 5D1XC 3K3WA 2PPAA 3MCLH 2Z8VC 1N0NA 1NC2D 3M17A 3KE0A 1EH9A 3FOLA 1R75A 2JXMB 3GHBL 1XCWA 1F13A 3JV6A 3PF2A 4GX0A 4Y9EA 3II3A 2GT9B 2NNFA 4OVVA 1JXKA 1U95A 1JV5A 1VQ5V 1BCIA 4BK8A 4YQXL 1N59A 25C8L 4YXLH 3RTQB 4Z7NE 2OL3H 1Z66A 4Z0BL 5B3NA 5F44A 1N70A 1FS0G 1U8PB 4M8RA 4O4JA 4FXKB 2XAQA 1H0DA 3HKZA 4BFGA 5A7EA 4X9FA 1EERB 2VLJB 3CLEL 4S1DC 5HVGB 4BYHA 1I8MA 2HFFB 4NT6A 4PJGE 4UBDD 4X7SL 3EZJB 4RMWA 5T1MA 2A77L 1HWWA 4JEGB 4P2OD 4WFEE 3P3YA 4JANB 5C0CE 1RVFH 4E5XB 3IDIA 4UTAL 1AIFA 1KTRL 3QEQE 5M95B 1AGBB 2YGPA 1P4RA 4JHBA 4M61B 3ZE2B 3JVGC 4UDTB 1Y6KR 2XACC 5EU6A 3QHZH 1ZXKA 2JKRM 1ZJAA 5I1JH 2RMNA 4F6EA 1AYOA 3MX0B 4BCYA 1DTOA 4IIJA 1JHKL 2BNQA 4MCYA 5G5DB 2XYBA 1ND0B 5IR1B 3QUKA 1FCCA 5DVMA 2N74A 3P0VH 4APQC 1SVZA 2F6AA 3C5ZB 3BEVA 1PYWA 3VFSB 2Q4PA 5J6HA 2ZYHA 5FGSA 1QYGH 3BDYH 1N3NB 4LU5H 2NY2D 3F5WB 3BEWB 4N2OA 1EEYA 3QJTB 4AXWA 2H4EA 3HKBA 1D6EB 1CYGA 2YSTA 4L9LB 2WLYA 4G6AC 1KNOB 4FL4C 1BEYL 1CI3M 1ZPUA 5HHMD 1KBWA 4QPJA 4XODA 1JZ8A 4UQIM 2XPZA 3D25B 3PGCA 4A6YB 3NPZB 5CD3B 2WJ5A 4WV1C 5CZVL 5EIBD 5IESH 3LQAL 3LS4L 4X4YA 2H41A 4KTEH 4U6TA 4FKKA 1RZKH 2OMYB 2Z7ZA 3AM8A 3SGEI 4B95C 3RFZB 2XAJA 2B20A 3QJFB 4O9HL 4PRHA 1UYWL 1JZ5A 2QDWA 3G6JE 1AXSB 2Y3AA 4NC0B 4F2FA 3K06A 4XNXH 4U0QB 2Z64C 2AVFA 1SQ2N 3TJEL 5BJTA 2AEPH 1C8QA 4WI4A 3WGVB 3JD3A 4S1RL 1M1KW 2UUCB 1VZGA 4WU5A 3N44F 5AW3B 1ZA3A 5MEND 2J4WH 4Y88A 2IEPA 4I0PA 3NCMA 1CXLA 2XX1A 3K81A 4QTHA 1RZQA 5LQBH 4G6FD 2P8LA 1BYOA 3TESA 1NCAL 4PJIE 4NN6B 3CCHA 3WELA 3SGKA 3VXME 3HUJF 2XBDA 4NX0A 3DX6B 3FS9A 2MPAH 3O2VL 4OFIA 2B9AA 4MXVE 3T2QA 2CPUA 2YK1L 1X5JA 2E75B 5HI5C 1NGWA 4NHCL 3LRSA 1ACCA 4KPHL 1S78C 3DV6A 2R39A 3IWUA 4JFOA 5I9QC 5IWAB 5HI5D 4OUOA 5D2NB 2JLPA 4L23A 3CFBB 5I5JA 4Z8FH 4Z8FL 3FKSG 4JI5B 4XN5A 1HX0A 4FFYL 3ZY7A 3H2QA 3QIBB 1H2NA 4TF4A 2OQJA 5GRJH 3M7MX 1VLXA 5IF0B 1JBJA 5ERWA 5DSCB 1FXKC 2A2QT 3SPIA 2Q7AA 3IPEA 3KVQA 3LZLA 4HKXB 4NQTA 5ENWA 2YEVB 2VZOA 2XPGA 4AQ8C 4ETQA 1OP5H 5AW6B 4OF7A 1GSKA 2WWMD 2Z8SA 1QQCA 4H1LA 3OKOA 4PM1A 4BCZA 1QFUL 2VLKB 2XOTA 5LO7A 4EB6B 1F11B 4ZFFA 4E0RB 1OAQL 3QXAA 4XXCA 1YN7B 4V1DD 2DIBA 1J8SA 3P02A 4A2FA 1A7QH 3WAJA 4YO0A 3HHSB 3HR6A 4YSDA 2TSBA 4MNHA 1A3QA 4NCC1 1XMQB 4WW2B 4KUMA 3M8AA 4Y1TA 4LQFH 4R84A 3RAJL 3J2PA 4UMSA 1T7ZA 1DN0B 4YDVB 5KOVC 3QUXB 1RULH 3FT2B 5JW5A 3HLAB 3HN3A 4YVUA 3PGFL 2VMDA 4OGZA 4MYPA 2GC7C 4X62O 1OSZB 3MRPA 1T89A 2AQQA 2Q6WA 1MDAA 3LNGA 4ZFOA 1AROP 1OPOA 4OIIH 1NVPB 3CJJA 5H94B 4MX7B 5CCKH 3B9KB 2OL3L 2Z31C 3FFCA 2D3LA 5B3SB 5ISZA 3IC9A 2AZUA 5ALCH 4X64O 5T1LA 2BVEA 1E50A 4X83A 2UUDK 5I5RA 3C2AH 1Z3RA 1TOXA 3CK0L 1I1YA 2MCAA 2RALA 4BR6A 3SYOA 5F21B 1KZQA 1TTFA 5J57B 2WTPA 1LEIA 1SGKA 4FLUA 5F89A 1QR1B 2O30A 1BV8A 3GSVA 4I0PD 3VI3F 2PO6C 5K1NA 3JAKA 2X88A 3TF4A 2P7TB 3IU4L 5K69A 2R4SH 2HT4C 5IJ9A 1NIDA 2NZ9C 4FP8L 1ANUA 1QASA 2H8PB 1BL8A 3VQWA 3GBML 3CUPB 3JXAA 1G7JB 3EH5B 4CMHC 3D0LA 3TBYB 3CG8A 3F62A 1AD9A 1F1GA 2APFA 3QEQB 2ARWA 2LV4A 3BE1L 4JGUA 4R96B 3MRKA 4WFED 4Z7QF 2VXSL 1F6AB 2H3NB 1FQ9C 1NJ9A 3V4LA 3BAJA 1ZTXL 1QFUH 3T4YA 1E67A 1R3HB 2A73B 2W65A 1NGZA 2QFPA 3BH4A 2C3GA 3HNSH 4PW3A 1LUVA 3FUNA 5DHYB 1PEWA 4HAMA 5DD5L 4P4KB 3RWJB 4JI4B 5E1AA 2WSDA 4AQYB 4M1GL 1T2JA 3LSUA 1GZPA 3OAZK 3CFDA 4K73A 4BKLA 3WNIA 3UBXG 4YFDB 5F3HA 4PGJA 3BUYA 3QEHA 1MHPH 2ZUTA 1XHZA 1IAII 4PD4J 2F8OA 5D7IB 5D1ZB 4XO9A 3VNZA 3NFPA 3BUQA 4FXLA 4NCDA 4NKDA 1YEDB 1ZCRA 2W65B 4M93C 4U2ZA 1G7MB 1UXWB 5FC9A 4HPYH 3CP1A 2XNAA 3C3TA 2NY2B 2VOTA 2YXVA 5F8QC 1RJYB 3ME0A 4OUUA 2IJJA 4H26B 4UB8Z 5JHDB 3M88A 3H01A 5JOPE 1A65A 3V9CA 3FQYA 1E79G 3CHOA 3MV01 1T2QL 1SZXA 3FQ2A 3EF4A 5F0MB 1YMMB 1WA0X 3A6BH 1LWJA 3U6RA 1RK0A 5CD5C 2WQ8A 3S8GB 5D9SA 4F37K 3QQ4A 2BSTA 2VDRH 4FM2A 2UUAB 1PIGA 1I08A 2YSSB 4Y1SA 4IGBC 4P2QD 3DSNA 4XWOC 1IJNA 5IW3A 2A9AA 4L4VA 3VXPB 4J9ZB 2I24N 3VI3B 5IJKC 1ZT7A 1WH0A 3BT2H 1SBSL 4FX5A 2R7EB 3Q9PA 4K8RD 4PGCA 3MLSH 4JMNA 2Z0UA 1INEH 5ICUA 4JI6O 3WEOA 3CCMV 3AB0B 1F90L 4LVNC 5KBDA 4GAYA 4X65O 3C5JA 1RSOA 4AOFA 1TVKB 1JG9A 1DQLH 3IFOA 3ZZSA 1AQHA 2R23B 5DHVH 1OTTC 1RKRA 1I7UB 5B1JA 4DUZO 5C8YA 2HP8A 4JAAA 3BZ5A 2Y2TA 4WCEV 5IREA 1Q0XH 5G4OA 3Q8FA 4LF3B 3P3PA 2JIXB 4ACPA 3QHFL 3B2EE 3KEHA 1FV1A 1JRHI 2YOCA 2PYED 1R5WA 1NFDF 2Q0OC 3VD4A 4HJ0C 5JZ7D 5EN3A 3MI6A 4H2CA 2ATAA 2YARA 3JD0A 4WW1A 2P46B 3NZ8A 4FQQA 2X4TB 3UTPE 4ANKA 3UDWA 3K2UH 3T6WA 3W2DL 2NY6D 3STZC 4L1DA 2DWDC 4FIPC 2D7PA 2FWOA 3CH1A 4JO1L 5EO1B 1ZGLB 4PWHA 3Q05A 1UOVA 1UOLA 3BT0A 3R1GH 4IS6A 4N8PA 3ARUA 3D4ZA 1RY7B 4Z7UB 1EMTH 2PF4E 3ZHRA 3FOMB 3RQ3A 4IMLB 3SGIA 4OLUH 1X59A 4YDIL 3WI9A 3X1EA 1NIAA 2BP3A 3M8OH 2NNXA 1OT2A 5TH2A 1O7DE 1UWGH 4TUYA 3DHPA 2DIJA 1HHJB 3P4OB 4BEIA 3V4VB 1WTGT 4BINA 1V7NL 1KNOA 1JUFB 3HZYB 3VQ1C 5AVQB 4M7KL 4PS7A 3P30L 1FDLL 4M48H 5DJAB 4QKTA 2P28B 4POYA 5CEZH 2Q69A 4WTXA 2MW2B 1EBOA 2H2SC 2EADA 3APOA 5EG6C 4LHUB 4TOYL 2RJZA 3U6XA 5GHWL 2A9BA 3F7LA 2Q86A 1N34O 4NZUL 1DUYB 4UNVA 3VQVA 4J41A 4A55A 1FNFA 3TV3L 2OCCC 4FQIL 4DP2X 5MERA 4KZCA 4BH7B 1DANU 5C92A 4U1HB 4CA4A 1AKPA 5TFSL 1OZUA 3IVKB 5IEHB 1IAKA 5DC4B 3T3ME 2LJ2A 1N32B 3P9WB 4CBCA 4YAQB 3RYFA 1U30A 4YLQT 2GITA 3POHA 2IJKA 5HGAA 2VRKA 4YLCA 1HIMH 1SEBA 3ZE2E 5L3EA 4J4PC 1FRGL 4KHTH 4MA7L 3KR3L 4W6XB 4MMXC 5E2TH 5DJ8B 2ICWA 1HYSC 2Y1YA 4HHAA 3EJPA 1A02N 2F54B 2QTEA 3CHXA 1DQML 1RU9H 1EEZB 5DVLA 2ZXGA 4HC1L 1JWUA 1KTDB 3PWVB 3KYMA 1X5XA 1K8DB 2QLYA 3FFQA 1AP2A 4OGAC 1RZFL 3D85B 3ABZA 4C59B 5AG9A 4XN2A 3EFFK 4FCAA 4WHCA 5TK2A 1KIUB 2ZM6O 4WV1B 2B8OT 3VG0L 3G80A 3H3KA 3F5WA 4NQED 4FE9A 5AVSB 4YZFF 4POUB 1CJYA 3EYUL 4OD1L 2OSWA 2I9TA 4LE8A 3WY1A 3F3HA 1H8LA 2EUWA 2K1EA 5FYKL 5E5MB 1WZMA 2A73A 2XNDG 2O6DA 2R56H 2DD8H 2FR4B 2F66C 1A6VL 1WBZB 4F93B 3E35A 1KJMA 2MOGA 5DRXA 1MJ7L 1X5ZA 1ZVSA 3QIUC 5GGQL 4TSCL 1HE7A 5F1NA 4BUHA 4Y1AB 5IMMB 5ABZA 1S7UA 1VEMA 3PL6D 4DO6A 2ITCA 1OCRC 3SGKC 5KYWA 2A6JA 3N41B 5BZDA 5E6IA 1BM3H 1AXIB 3H1KH 3ZYJA 4ERSL 3A4DA 3H9ZA 3N2KA 5BOPA 1S7TB 2YD2A 3O6KL 4WRLA 4Y7OC 2YO3A 2PYFB 2WUBH 3AUVA 1WNSA 3R7QA 3V5HB 1YMMD 3WXVH 3ZSTA 1ILSA 1PLBA 3PP4L 5BS0D 1WB8A 2QM8A 4X20A 1TZOA 4JZJB 1U0QA 3AK2A 2DW4A 1AZRA 3BVUA 4Z78A 1UB5B 4NQDB 2D03H 3CRRA 3KWVA 5E8DL 1MAMH 4DK0A 2JMRA 3V4UL 2F93B 1FNAA 1R3IC 1UWXH 3BP6B 1JPGA 1TEGA 4XPHL 1QLRB 3RGBA 1KLGA 1D5ZB 1HEHC 4N6RB 4LRIA 2CUGA 3FB5A 2YZ1A 3MV7E 4I89A 1NBZA 4OFDA 1UA3A 3UACA 3W1ZA 4GG6A 2DMBA 4NNXB 5HDRA 4JTCB 4XBPA 5H37A 3WJMA 3FKUS 4PJIB 4P2ZA 4Y4HC 4N5EC 1BQHA 1MCDA 4KK9D 4JM4H 2FEDD 4FZ8H 2ZCKL 4RGMB 1E27A 1TVKA 4E9LA 3NCYS 1W72A 2JJ2G 1IGJA 2DJUA 3EJJX 3U36A 4GRWH 1KTLB 5CEZE 3PU7A 3U0TB 1JPXA 4HH9A 1SQMA 1JRHH 3MNZA 3ALXA 5CINL 5L3CA 2VXVL 3EKCA 5IYDO 5IYZA 1PNMA 3KPQB 5DRNB 3TBCA 4OZIB 1E6JH 3LSSA 4TOIA 2GUZB 1TYJA 3BEVB 3D09A 3U0PA 4OF5A 43CAB 5D7LD 1N19A 2BHYA 4B9JA 2GTZB 1X44A 4Y0GA 3JQOB 4L29B 3V5DB 2DWEB 4DOHB 2H94A 1S9WA 2BZ7A 1IBGH 7TAAA 1ZT1A 4P5KB 4DP7X 3PWUB 3US0A 4KVPA 1QLFA 2X5PA 4J3VA 1N0LB 1EFQA 4OB5H 4XZ4A 5FKPA 3G5ZB 4CC4C 1K7DA 1XGQB 1K4DB 4YHML 5KJ7E 1PKQA 3BE1H 2R0WL 4UCTA 1WA1X 3FTGB 2GV9A 2XFXA 3PL6C 5C0FA 3D3VE 2WXNA 1VKXB 2OMVB 4GT0A 4EN3D 2GK0B 4BELD 2CUIA 2VLLB 3S35H 3D7PA 4XNYL 2IPKA 3K5NA 3H56A 4HXBL 2NW3A 3OAUH 1C16B 5GS2D 2Y69B 4LH7A 4DP5X 4QHUB 3A5VA 4QDGA 2ETWA 5MHSD 1ZVNA 4RFEB 4LF9B 3T0EA 4YIOA 5C0AD 3ZGIA 4C56A 4L3FA 3QUZC 4RAVB 1E9OA 3ZN0A 3FQNA 5HDQL 1JZ2A 2ALWA 2IFGA 5E00A 1BLNB 1SEQL 4N8UA 3ETDA 2ARJQ 1BAFH 1FG9C 3D2TA 1IM3A 4N8VG 4IEFB 4CVWA 2HMID 3A67L 3UBGA 3SPVB 1AO7B 1IGMH 4G8AC 1WAZA 2F7IA 1N5YH 1JPTL 2P9RA 2DQ3A 4XNXL 3ARBD 2H26B 3O3UN 3ATFA 3TJEH 3MLUH 4I77H 1IV8A 4F8NA 2J8UA 4A2LA 4GW4A 3GZOA 4LARL 2BMKB 4WI6A 2YS8A 4KBPA 5JHLA 1GGCL 2APBA 1AJPA 1HNFA 5I30H 1BOGA 2Z4TA 3VFVA 3IMWA 4NBXB 3ZT5A 4X1YA 3SO5A 2G5UA 3LKQB 1VGEH 2IPUG 1Q90A 2YAPA 3CVDA 2QHRH 1DBJL 1SJXA 4Y2DB 2PWDA 2F58H 2H26A 4YFEA 1P6WA 2Z91A 2X1PA 3RVUD 1XGZA 1QWHA 3IXTA 4FFWD 3EH1A 3LH9A 1A3LH 1BXAA 4NPKA 1RIUL 3E6HA 3MLYH 3MLYL 2LP7A 4RAUA 2JVUA 3GGWB 3STLB 1QNIA 3TETA 3H4FA 4P5SA 5EU6B 4LEEA 4N0UA 3QIWD 1YTFD 4YDVA 4WO4C 4HKZA 5F7WC 4P5TD 1WVZA 5LXVA 2YXMA 1C12A 1YNTA 5BNXD 1CN4A 2E59A 4W9KC 5FKAB 2D73A 5GJSH 5TDPA 4ZBMA 5T1DH 1WSST 5BPPA 4QGTA 1G6UA 1KWKA 2DZEA 1I75A 2BNQD 2BVYA 2HJFA 2EAEA 2JKJA 2RCSL 2WW8A 4HGWB 4DP0X 4L8CA 1MCPH 1N3NA 4K9JA 1NC4A 5CIPA 3FSOA 3RE0A 3G5XB 2AQ1A 5DLMH 1OWRM 1BE3H 1HU8A 3ESMA 5EMYA 4YSAA 5A40E 3AG1B 2FJHA 3KPSE 5IFHH 2ZZUT 1YZBA 1JX9A 5EN2A 4J3OF 5IHWA 2QR4A 5JW4Q 4PJFA 4NQVA 3QORB 1IVLA 3HRZA 4ODUA 3I9IA 1XGRB 1KZYA 2BERA 1GOGA 1IM9A 2B9ZA 1OK0A 4UDUA 3IAYA 1G84A 4PTTA 1QPKA 3DKHA 1GRJA 3GTVA 2DWDB 1MLCB 1OOAA 2FAUA 5I0ZA 1BF2A 2NY4B 5EBLB 2R0ZL 2XLLA 1U21A 5DRZA 1DQQB 2XYCA 3P9MA 2FH8A 2VC2L 2ATPA 3VGGA 2F23A 5EBMC 4WUKH 2J5LC 3OGCB 4WWKC 1Q6UA 2CUMA 2FBRA 4X99A 5D2NE 5DMIH 5IG7A 1I1RA 3QQXA 1DZBA 4FQ1L 3IU3A 4FQ2L 4BIKA 4FTVE 1MRDH 1DQLL 3P77B 4FQIH 4O02L 5ELIA 3QJVB 3CJHB 5IM7A 2OR7A 4JJHA 4LOUD 4LU5L 2PF6A 2ZKYA 3F04A 1KY7A 3UP6A 1YSCA 3B6SB 1HKLL 1W15A 4RZCA 2ZAIA 1PU0A 2DOSA 4J3TA 1WPXA 4OKDA 3GBMH 1JOIA 5SWSE 4Y4KA 3T1FA 2PP7A 3LKPA 1F6FB 4ZX4A 4CJ1A 2ZUXA 3PP3H 5C09D 4UOW0 2LTQB 5KWYC 4LRNL 3VUAA 3P69A 2YRPA 3HLAA 1LP9F 4QHKJ 2ICWI 1BMZA 1CFTB 3GKWL 4OCRL 2IH8A 1S3KL 4I0KA 4KZDH 3CK0H 4N86A 3NZHH 1KELH 2VB5A 3VXUA 4JQVC 2G2RA 5HY9A 4L5FL 1NIBA 3GS7A 4DR4O 1CICA 2OMNA 3L1OH 4N85A 2QDVA 1MY5A 4X4XA 3OC8A 5J6GB 3CFKA 4ELMA 3QC5X 2IPTL 4HCRH 5C0JB 1S7TA 4M93B 1O9ZA 1QHOA 2EO1A 3ZTEA 5IW1B 4HEME 1U2CA 3GMLA 5E08H 4FFVD 4YXLL 1RSFA 4AE0A 5DFAA 1AOZA 4WKZB 2GTSA 4UINH 3ROOA 1JI2A 3EBIA 2COQA 1PD6A 4V33A 3OPZL 1FBIL 5DS2A 2QPDB 1ED3A 3VFPA 3FU9A 3S3CB 1OWWA 5FA4A 3VXMA 2IU0A 4J3XA 2OS7A 3LEYL 4U33A 1SJVA 2BVPB 3CVIL 1EJFA 3C75A 3FFDA 4KQ4L 2J71A 3JUZA 1N6UA 2HH0H 3M1OA 1ET7A 5I6LA 3EBGA 1ZSPA 4HIXH 4KO7A 2CDGA 2IBZH 1AO7D 1BVLA 1MFNA 4J7RA 4XHJC 1INEL 1FO0H 5CJQH 1HP8A 3UZQB 4ZOBA 4QJ4B 3WCYA 1SRDA 1KPUA 1OCRB 3MRFB 4YGVA 4HUUB 2WBJB 1KC8W 4P9MH 4FA6A 3VA2C 5GS0D 5IKCA 4H0LC 4XBGA 5AOLA 3JARA 1LWRA 3QUZB 4NS0A 4BUQA 5EBWC 2L04A 1FNHA 1Q0EA 1V3LA 1JWSA 5LMNO 4AMKH 4HGMA 8FABB 3V2AR 3AT8A 1BCCH 5E1QA 3O9WB 3TWCH 2RNBA 4N9OB 3QS3A 6CGTA 4XB8A 3F58H 4FDWA 4X65B 3S97C 1NKOA 3BUTA 3BAIA 1N7ML 2B0SH 4J8QA 3SDDB 3QDJA 3PRZA 4AYEC 2HKHH 5EOCJ 4YEEA 3KYKH 3OKKB 1F90H 4GBXC 2Q3ZA 3ULUC 2ICEB 4M8QA 1KLUB 3LKRB 3H3PL 4PQXA 1Z1WA 1A5FH 5L3DA 2X4SA 2ZNXA 1UYWH 5HDBB 3VX0A 1GM9A 1WA8A 5IVZA 2DAVA 1D5MA 3T2MA 4O58L 4OM1L 4LF9O 2OP4H 1ILUA 1QSFB 3CC5A 3PWLA 1DLFL 5KW9L 3CRCA 1NCUA 1O6SB 1SN0A 1F3JB 2CIIA 4AG4H 4JRWA 4WCYH 2YXLA 2AFNA 5DD0H 4TV8B 4G5ZH 3X12B 2XQYK 4ZFOB 1W8EA 4Q56A 5DJYA 2P5WE 2NXZC 3OV6A 1FZKA 3FUMA 4KJYB 3KL3A 3SCMA 4HBQA 1UM5L 2XIIA 4ZAKC 1S7WB 1FSKC 1UA6H 3FSAA 2Y0PA 5FPOA 2E0PA 1NANH 1TU2B 4Y2DD 5L2JB 4KGLA 3C60C 2FBJH 1D5RA 1PDKB 4JFUA 4WTZG 3X14B 4X6FB 2WKOF 4ONOA 5CJXA 1E8YA 2O61B 3PJSB 1H0DB 4NUQA 4JMXA 3GMMA 5IQ7L 4GSRA 3EH2A 3FBQA 3MREA 4Y2LA 5C1MB 3MRRA 2H6UA 3HCVA 5C9KA 1FWXA 5LAPA 1XGPB 4LB8A 1KB5A 5FYJE 3WXWH 3FUHA 3BPOC 2X4PA 1JR9A 4M7ZB 3RY4A 3GNMH 4UM9B 2VR8A 3T9WA 1FIGH 1BWWA 1I3RB 4GKZA 5GSVA 1KIPB 5I8KL 5JH7B 5K9OA 3NPSB 5BY1A 3FQXB 2QADC 1IC7H 4KY1L 3B9DA 4PMEA 4AQAA 2E6JA 5KVMC 2YDEA 4OD2A 4GUPB 4EI6B 1I8AA 2Z93B 5HI3D 3PDGA 3VU2A 1ZUQA 2HZHA 1TETH 3QO7A 3BLKA 4XPGH 3NZHL 4LF6B 4GLRI 4B9IA 4ONFH 2ATKA 1YJDH 2W81C 2R1YA 3N1QC 3RAJH 4ELKA 5A2CA 4E36A 5F0PB 4KHXL 3TO4B 2KZ1B 1H3UA 3L5WA 3A6BL 4WO4A 2PCPA 4QTFA 3GBEA 3GBDA 3FAWA 4Q52A 3E8VA 2R2BA 2ZAGA 4J1UB 1DCEA 2KLSA 4PJCE 4EI6A 1GCFA 4XP1L 5I6KA 2HRPH 3TBWB 3KG2A 1OF0A 4NZJA 5BO0D 4F20A 4O4IA 1XHXA 3AQDA 3WO4B 1YYLL 1BJ1H 1HQRB 2WCGA 1OF2B 2BWQA 3EDKA 4TUKL 3ZN6A 5CJ8A 4AQOA 3L8QA 4JHVA 4QO1A 5BZXA 4NQXA 1OAXL 4NZTH 2CO1A 4NYLB 2A79B 2ZCEA 5TE6L 1UASA 3UEQA 2OMYA 3HG1D 4PLJD 5E6ZA 2IJ0C 4O00A 4OFKA 4F8QA 4KRMB 2Q2LA 1W9XA 1DVZA 1T0NB 1DDTA 3HPJB 3TK1A 2WZ6A 4PMFA 3RIAF 1HSBA 1YO4A 4LF8B 2CR6A 3TT1L 4JKKA 1NBYA 4JQIH 2E9JA 4X80L 2DI8A 2Z31A 2ADPA 4YJZL 5KANI 3SCMB 2Q67A 3NABL 2EDYA 1JPST 4XVJH 5E8EA 3KLHD 4EVNB 1VA9A 1BHGA 1T5WA 2QTSA 3MV9A 2EXSA 2OTLV 1QTPA 1XH0A 3GSRA 1UJ3A 3THMH 2GJRA 4LCUB 3THML 5F7KC 4LMQE 1KXHA 2R23A 3MAQA 2NX5A 3I6KB 4L1SA 1G9HA 1DEEB 2WNXA 3UTSB 5EEXA 1PD3A 1BAFL 5BVPL 2LFSA 4FQLH 2DWXA 3GEFA 1GJIA 4X1IA 1WAAF 3AXLB 3WNLA 1FXVA 2BXZA 5GS0L 1HKFA 5CUSL 4BH8A 4BK5C 4AVJA 2WBJD 3SDXB 5K9OB 3I55V 3OZKA 2HPTA 2VXUH 2HX7A 3B6SA 3KPRE 4UT9H 3QXVA 5F9AC 4PV8A 4KNTA 2OR8A 2JCWA 4IGBB 4FNPA 3V4PH 2BSRA 3RWCB 3PWVA 2D4DA 3PWJA 1NU1H 5JLZB 3TWYA 5FO8A 1A6TA 1OQOA 4FFZH 2X9WA 3QI9B 1ZIBA 4IJTA 3VBBA 1T7VA 4MMYA 5L3BA 4JKPL 4G6JH 3NEEA 3NQKA 1E4JA 2F7PA 4HWEL 5JHLH 1WUNT 5EUKB 3G6DH 4OCWH 3K0DA 1G9MH 5C3IA 1VEWA 2GITB 2EINB 2RDCA 3EGXA 4EN2A 4GX1A 2YZ8A 1CLYH 1NT2B 3MTXA 4QRPE 4NCC2 3W9DA 5TQ2H 4BW5A 5LYJA 3P0YL 4CC1A 2WXQA 1OT4A 4GOSA 1Q9KA 5D93C 2AQ2A 3LQZA 5HHOD 5K59E 2WZ5A 5DQDL 1LTXA 1QSFD 2P3YA 1RUPL 3FAVB 1MELA 2Y7LA 5J13C 2FLMA 4FQJL 2CRZA 3RPIA 2XU9A 5KYWB 1UCBH 2JCCB 3UAJA 1NEZB 3MMEB 3RHWF 1J1PL 4Y4FB 2HG5B 3CXDH 3LN9A 2BDNL 3QQNA 3MFFB 2OW7A 2JK5A 5TDNB 5GZOC 3FCGA 5TGBB 4Y19E 4NWUH 2Z31B 5G4NA 4PJHF 5A6MA 3T1HB 3CSYA 5B1OA 3TJHC 1JDCA 2Y36L 2H8PA 3O9WD 4YE0A 3WYRA 4AYSA 1YEHL 4JPSA 4Y5YB 4WK2B 4YNYB 4WI3A 4P9HC 1Y76B 5BO1H 2NPLX 1TEFA 1K2DB 3LD8B 1W91A 3B7RL 3W9EA 3VRIB 3EGDB 2DMCA 3PJSA 5F2VO 1EX0A 2E7BA 3GLAA 3TL5A 1Q9LA 1WHPA 4NGHH 2X4NB 3VI4A 3HPLC 3W3BA 4AYGA 2EEAA 3ISYA 4QHKI 3UJIH 2VR5A 5C7ZA 4A6YH 1GIGL 4IBQA 1N9PA 4DYLA 3OKLB 3MDJA 3EYOB 4Y2NA 1K4DA 2UX6A 3P11H 5KAFZ 4NO3B 2G0LA 3EGDA 4QHLB 1JTTA 3CLWA 2PPFA 4LQ1A 2VDQB 3FQRA 3C6EA 2X1QA 5DD3L 3ZGHA 3H85A 4PY7B 4ZXBB 1UGNA 2EIJC 2GBVA 4LVEA 3TEUA 3V8OA 4MAYA 3SGDI 2W0PA 1UUNA 3MDSA 1TQSA 1VFAA 2FWUA 5EUOB 3S35X 5F9JB 3BZ4A 4AKQA 4K5OA 2ILLA 4KUZL 4YDJB 1XCTA 1QKZL 4H8WH 4AYDC 2A6KB 1NLBH 4KI1A 1AI5A 4JI1O 2B4CH 4N0FB 2YICA 4DV2O 2E7HA 3ZTJG 1NAKH 3UT5B 1NAKL 1R46A 2WBKA 2ZIOA 3L1GA 4FNQA 4L5FE 4FNUA 2MCG1 1E7VA 3B2MA 4IRSB 2H8PC 2GJ6D 3LZPA 3CDYA 3G6AA 1SERA 4UQAA 3WB1A 3GINA 4OV6F 4FKEA 3VGEA 2BNQE 2NUTB 4FZ1A 1HEZB 2YSSA 1DLHA 3OPUA 3DX4A 4KY2A 1H2GA 3EUDA 4DTGL 4PELA 2BRRH 3MQIA 5C0RL 2OX5B 4PA6A 1EGJA 3I6LD 5HPMB 1L8DA 1S9YB 1AO7E 4YXKH 2R69L 2QZ5A 4KK6D 5HSFA 1VGEL 4P57A 4UWQB 4ODTL 1CGVA 3G6JF 4HPOL 5JXEA 4Z9KB 3K5LA 1B4RA 3I3EA 2BHUA 5EZOH 4GSUA 4LVHC 1VFBB 4GYBA 3GB7B 1RMFH 3IBOA 1IGML 3L9DA 1HH6A 1WGVA 1XSKA 1I1AA 2A74B 4NN5C 1BD2E 2MFNA 3HS0B 5D7EA 1WCQA 3WFEH 3VTTA 2XWBB 4FJCC 2BIOA 1KG0B 3JTSA 4PCTA 1D7FA 1XAKA 1IBLB 4DF9A 2Y7NA 3P4LA 3TYFB 3U11A 1KCVL 2CSPA 1CFVL 3R4DA 5T33H 5DQ9B 1RZ8B 3TN0B 5CBGA 5HHME 4DGVH 5AYQA 4H2AA 2FJFB 5JDSA 4O2FB 2HX8A 2PW2B 3NZ8B 4FQQB 5K1XA 4E5XG 3A4EA 2ESVE 4OGXL 4NENA 4W9GC 2VR7A 1INQB 5J9PA 4YBQC 4DGUA 1QVOB 2G9HB 4M9PA 4Q2ZB 4GKKB 3RDTA 2WP3O 4R3SB 4F9LC 2IPUK 3ZMVA 1KN2L 3CBKB 3AXLA 1SLUA 5KUMA 2A7BA 4GW4B 5D1QA 3WTXA 1EO5A 3RW0A 1PLGL 2VXQA 2ZWKA 1BQSA 4GY4A 4Y8AA 5ICXA 2NYZA 1ACZA 4GQ9H 5DVOA 3H8NA 3JV4A 3GFUA 4JPKH 4K94L 4DKFH 1FO0A 4XZUA 2A0LA 3E1ZA 5DJCB 4PV8B 3IGAB 1DTUA 1TDQA 3WNOA 2ZPKH 3K08A 2ZXAA 3HC3H 4NP4H 3SKJH 2V2WB 1LNQA 4YE4L 3F7VC 1T5XB 2O5XL 5IFAH 1QOKA 4TUOB 1X6LA 1BM7A 5LXTB 4XCEA 5GS3A 1U3NA 2DQUL 3VTMA 2J72A 3ZE0F 4HZLB 3T0EE 2WXKA 2ARHA 1H8NA 4XZUB 2H2PD 5I6XB 3SQBB 3VD0A 3KYKL 3VB9A 1ACYL 3NSYA 2LW1A 2BVQA 1OSPL 4G6ML 1DFXA 5HJBA 2EYRB 5LBVA 2PYLA 2JCCE 4AEEA 5JPMA 2DMKA 5JO5A 5D7KE 4LLDA 1YEKL 1SMOA 1BD2A 3O6LH 2ADFL 1IBLO 3QUGA 2EXWD 5EWIH 1ZL8A 2PY5A 3ARDB 2B15A 5KYUA 2V7HB 4M61A 4IBZA 4MVZA 2O6FA 3HJ0A 5E9AA 3D2UB 4R5TA 2OR9L 3MN8A 4HQQL 2EULA 5CFAA 2DDQL 3KJ6L 3F8UB 1RURL 4L37B 4F1SA 3QXDA 4QF1A 1HNWO 3JYBA 2QHRL 4B7EA 2EDRA 2YC1B 1P1ZB 4FI8A 2MOVA 4HK0B 3O65A 4BKLB 2R0KL 3U7YL 3E6FB 5T3XE 4MXWH 3NDYE 5I71C 3RX9A 2ZCLH 5T8IA 2EX3A 1G6RA 2GCYA 1CYWA 3ABLB 5F1OB 2ILMA 3MYJA 4LCUC 3UTSA 3UIYA 1R3HA 3DJRA 4GRWF 1RUAL 4YDNA 4XC3L 4DHLA 1OK8A 1I9RH 2GY7B 1UVQA 4KQ4H 4QXTB 2DOCA 4HK0A 1M56B 3TV8A 2LU4A 1T6VN 3VJ6A 4B41A 4L3CB 3L6FA 1I5YA 3NP3A 4UILL 3FUDA 2K6ZA 1XF4A 1FJGB 5MENE 2VUKA 2ZYIA 5F7LB 4A7GA 5EZJB 1UXLA 4JGSA 2YAFA 3W0WB 5KSAC 3W2DH 4JO2H 1VACA 1PZ2A 5GISL 2Y1ZA 2IMNA 2YQ2A 1QMUA 3EZ8A 1HH9B 4NAQA 2EKSA 3LPGA 4HWZA 3LXAA 1NPJA 5J11C 2APSA 5JHDA 2UUCO 1VCBC 2FD6L 3RWRD 1IRAY 1ZK5A 1TF4A 1UKTA 2AJ3A 4OQTA 4WGWB 4NM8H 3AG3B 3VG9B 5E51A 1RPKA 2HTLC 4Y9FA 2JJTA 4WI0A 3QWNA 2Q7YB 2OMZB 2ZUUA 1U6AH 5LXTA 3Q1EA 1GVIA 1TENA 3ZRWB 4J8RA 1H15A 2AXHA 2W9LA 1CZ8H 1XUQA 3OBAA 5DUPH 1MJUL 2X10A 2PYFA 1TUPA 4NGHL 3DUSA 4BKSC 3H0TB 2B77A 3LMJH 4MGXA 2DQIL 5JIDA 1EO7A 3EXJA 3GI8H 3NN8A 4GRWE 1LEGB 1IGFH 4MXWL 5D7SL 1QUNA 3DO4A 2O26U 4G3YL 4NC1E 4RWYL 1RSOB 3FSVA 3B1TA 3GS4A 1KXVC 1KIQB 1TCRA 1DBBH 1JPFA 4LARH 2JK5B 2VR9A 5TDNA 4QHPA 4F92B 1UTDA 4I1NB 5E99H 3K7UA 4X98B 4YY3B 4PTTB 2IV8A 2D7MA 3QI9C 1KB9J 1BFOA 1BZ8A 4Y5VB 4ZHQA 4UMGA 4FG0A 1URIA 1JK8B 2IH1A 2DEWX 4NDMA 3UYPA 3BH9A 5HD8D 1CBJA 1BAGA 2O6PA 3HI5L 3LEVL 3O2DL 4PS4L 5IQ9B 1M53A 3Q5OA 4UTBA 3WEMA 4RGOL 1C1EH 4BZ2A 1AI4A 4BZ1A 3HZMA 1JYXA 3E2HB 4NNPH 1AHMA 2PZSA 4N1EA 2Z35B 6PAZA 3HB3C 1I4FA 4UT6H 4X4XB 4X0KA 1SXSA 4HH9B 1AZVA 3KW7A 4CKVX 3WTVA 4KZDL 3O41A 4EE2A 3ZT7A 2CDEB 4ABVA 1TJGH 1UT9A 2NY3D 3NUKA 4ODVH 4MTXA 5C6TH 1QTYT 2WXPA 3UOAB 3QUYA 3TPKA 4ZMYA 3PWPE 5JMRA 3RYIA 1NPUA 3DX9A 1PZDA 4JF3A 5TISZ 4DV0O 2W59A 2ZP8A 5ETUA 3MLRL 4S1SH 1IAIM 3D06A 4B9FA 3LIUA 3TJTA 5J56B 3FB8B 2UY7B 2DQTH 3GSNA 4GAJH 3HR5B 5DYOA 2X6MA 2YEQA 1K34A 3QCTL 2E76C 1H5BB 2JFCA 2EILB 5IOKA 4MD5B 3CRAA 2YAHA 15C8L 2P80D 2XFXB 3CCSV 4WJ5A 4AKPA 2K9UA 5LHDA 1SM3H 1KUQA 2P5EA 3S98A 5EHFA 2FBOJ 1CE1L 1UUSA 2E5LO 2ZOKA 2OP4L 2WQUA 1TQCB 3C5SB 2YXWA 3QQ3B 4EOWH 1MAKA 4K71C 2PUSA 5J13B 4OI7A 1NCWH 1Q72L 2JQZA 1XZWA 4XTRD 3P73A 2CIKA 1L0NH 2ZX9A 4R83A 2CNZA 3ZQ9A 2ODHA 1NCDL 1AC0A 4IRJD 5DWUH 3K46A 5FK9A 1SF5A 1HCZA 5TPWL 4XXDA 1SQVH 1MZZA 3CSYB 3K5RA 4HUMB 3WNMA 3EBHA 2D0FA 2XTLA 3UBFA 2AEOA 4AENA 4JI3O 1WAAE 3TO2A 4WFHA 3OQ3B 4X6CA 5EPMA 4RMSA 4GG6B 1A6WH 4U3JB 2OTJV 5C7XH 5EIVA 5LOVA 3NR7A 1IE4A 1ZOXA 1WIUA 5EZYA 4R4BA 5DK0B 2VQEO 5FYKD 3WFCH 2EZOA 3AU1A 3PYCA 2CJUL 5FV2A 2G9KA 4P2YA 1TJMA 3GIVB 1S77D 3L17A 2V8LA 2HJLB 2LLGA 4D9RE 4NNYA 3P4NB 2DIAA 3HFMH 3HZKA 3TYFA 3L71H 5HDBF 4LESA 2KKWA 5I18L 2ATKC 1J86A 4BWWA 2YIAA 1PD0A 1TQVA 4QHLA 1UHVA 2W07A 3QO1A 4WFEA 3T3PF 3H9HB 3EGXB 1YNLH 3PL6B 4TULL 2HFGL 1FG2A 2HJKA 3LN4A 1CF8L 5EUOE 3S88H 4KKPA 4XNMB 1F58L 3BYYA 1CDBA 1T7WA 2C26A 4EI0A 4ZOAA 4DR3B 4LNUA 1ASQA 1B0WA 2QELA 3L08A 3STLA 1D2PA 3A67H 4HCIA 3BAEH 1C7TA 5FFGA 1FYJA 1NIEA 3LN5A 4YHOL 3V0JA 3L9RA 3QP3A 3TF7C 1U3YA 5FDYA 2ETNA 1OTSD 4NYLA 3UTZA 3HAEB 4IHBA 4LMQI 2OMUA 2CLZA 1IT9H 1N2RA 3EJSA 5FYKU 2AXGB 1JN6A 3G08B 1OE1A 3G6AB 3UERA 3UGUA 2PTUA 2R0ZH 43C9A 1IE5A 2LAAA 1DE4A 2DYRB 2CTPA 3LCYA 1A8ZA 5E2JA 1BZQK 3R19A 5EC2A 4AMXA 4Y5VC 8CGTA 3FB6B 1MWOA 2WIIA 3GO1H 3H7BA 1EIBA 3RHWK 3X13B 5IROC 1A3RH 5I1IL 2AJYH 4F91B 2MPAL 2P5EB 1NTMH 1N4CA 2WLHA 4BFIA 5D8JH 1I3UA 3HNTL 1K3ZA 2M2DA 4QXGH 3IMUA 3PPEA 4RNRA 2BSTB 1JF5A 2R0WH 1I9RL 4UQDA 4Z7WF 2F5AL 1AO7A 1DN2A 2CBQA 2BW4A 5IJ0B 1OSZA 3DIFB 4JRFA 4JQIL 2H3OA 1RUQL 2J88H 2IWGA 5DHEA 1JK9A 4UDUB 3QWRD 2W9DL 1SRYA 1HWYA 1T1WB 2GJ6A 2K8QA 2MIZA 5KA6A 2X42A 4LSRH 3UROR 1NSNL 4Y4KC 4NVPA 2GSIA 2FRGP 3TURA 4HETA 3PFQA 2EH7H 1VCAA 4HEPA 2WPDG 3DYOA 2FMLA 3N55A 1JVMA 3DV4B 3IU3B 2XTAA 3NZUA 4I9WE 5CEXA 4F2ME 4AYBA 3QBTB 2CQVA 1T80A 3AS3A 3PWJB 4EKJA 2FX8H 2NXYB 2AJSL 1F1DA 4PJ9A 4WENB 3Q8EA 5D7LA 2BTQB 2Y9RT 3ARTA 4GP4B 1E2ZA 3DTXB 1U8QB 4PCSA 2IH1B 4NDMB 3MRMB 3SO3C 2ZWSA 4MD4A 1PKOA 3S5LB 1FLTX 3KZIZ 2ZE8A 2VXUL 4ZOEA 5E5RB 4OJFL 2X87A 1S9VB 2ODMA 3F01A 3MLZL 4L3CA 4M1CD 4PR5B 1LDPH 2VR6A