4RUFA

Human k2p4.1 (traaak) potassium channel, w262s mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
257
Chain Sequence
GPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPESHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVSFWILLGLAYFASVLTTIGNWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 81
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rufA00
3BEHA 2ITCC 4KFMA 2ZXWC 3RW0A 4PA7A 4QE7A 3SPIA 3SYCA 4WFHA 1R3KC 4MW8A 4QNHB 3K04A 3SPJA 5IY5C 5EK0A 4PA4A 4RO2A 3ASOC 4LBEC 3K06A 4PA9A 4MSWC 4X89A 2A79B 2ATKC 4HYOA 2BOCC 2YEVA 3F7YC 4JTDB 5J9PC 2EIMC 4EKWA 2ITDC 3E8BA 4MTFA 4MVRA 2Q69A 1K4DC 4XDJA 2WLLA 1OCCC 4J9ZB 3KG2A 1R3LC 1ZWIC 3K03A 4G28B 2WLMA 1V55C 5CBFA 5B1AC 3ABLC 3LDEA 4PDMA 3FB7C 2EIJC 3AG2C 3FB5C 3FB8C 4PDRA 2H8PC 5BZBA 4F4LA 2K1EA 3E8FA 2EINC 3F7VC 4MW3A 2HFEC 3K08A 3VOUA 4RAIA 3RVZA 4I9WA 4MVMA 4R8CA 4X8AA 2WLIA 4H37A 4MTOA 4MTGA 4JTCB 3LDCA 4WFGA 4P2ZA 5EBLC 3SYAA 3T4ZA 5KUKA 1BL8A 1M56C 2Y69C 3E83A 2EILC 3STLC 3UM7A 4R7CA 3SYQA 4RUFA 5EBWC 4P30A 3X2QC 2JK5C 4P9OA 4BW5A 3ABKC 1ORQC 2X6BA 3OR7C 2WLNA 3T1CA 2AHZA 2WLIB 2DYSC 5KUMA 4MVZA 3SPCA 3ZJZA 5CBHA 2KB1A 3AG3C 3STZC 2WLLB 3SPGA 4CBCA 3IFXA 3R65A 3T4DA 4LCUC 3F5WC 1K4CC 4RUEA 3EFFK 4MVQA 1P7BA 2ZD9A 3AG4C 2Q6AA 2WLJA 3UKMA 3LUTB 3E89A 1M57C 2HVJC 1OCRC 4GX2A 1OCZC 4PA6A 2IH1C 2DWDC 4MVOA 2X6CA 4WFFA 1KKDA 3ASNC 3OGCC 2Q67A 3IGAC 3HPLC 3SYOA 4UUJC 4GX5A 3WG7C 2WLHA 2HJFC 2DWEC 4GX0A 5EC2C 4MVSA 2A0LA 1OCOC 2P7TC 3SJQC 3TCUA 3ABMC 2A9HA 3OR6C 4G27B 3SPHA 3TETA 3E8HA 1S5HC 3RVYA 2WLKA 2DYRC 1J95A 3PJSK 1R3IC 3AG1C 4PA3A 2W0FC 1G4YB 4GX1A 3T2MA 4J9YB 3LDDA 4R50A 4WFEA 5EC1C 3FB6C 3GB7C 4DXWA 2EIKC 4OXSA 1JVMA 2QKSA 5B1BC 2BOBC 2Q68A 2QTOA 3E86A 4HZ3A 4XDKA 4ZBMA 1XL4A 3ZRSA 3OUFA 2AHYA 4JTAB 2NLJC 2R9RB 3K0GA 4TWKA 5B3SC 3OUSA 4PDLA 1LNQA 4MS2A 5E1AC 5CBGA 2HVKC 3LNMB 4R6ZA 2OCCC 1V54C 2X6AA 4MVUA 4XDLA 1R3JC 3RBZA 3K0DA 4P9PA 4X88A 3JYCA 4LP8A 1QLEC 4QE9A 2HG5C 2IH3C 3SYPA 4H33A 4PDVA 3E8GA 1XL6A 5EBMC
chains in the Genus database with same CATH superfamily
2OIGA 2WA4A 1XBLA 1YZBA 1M4UA 4FFKA 1KP2A 3S3XA 3OMIB 2ITDC 2QM4A 3MHHC 5IY5B 3AG3B 3UO2A 1M93A 1OCCC 3TXSA 1B04A 4YHHO 1JFFA 1XQ8A 5BR8O 3AG2C 5JCOA 2VQFB 2BTQB 1MZFA 3O9OA 3K08A 1HR0B 4DV5B 1SQFA 5JH7B 3FD9A 1NR1A 3SYAA 3Q4HB 1WA8A 1S77D 4DR6B 1NTZH 1HR0O 1LUVA 5L3BA 5LGUA 1OJHA 3EHBB 1RM1C 1GM9A 1US6A 2JGUA 1IBKO 4CBCA 1EN5A 1KU9A 5CB4B 1VQOV 4BW9A 1K34A 1Q6UA 3ZMZA 1VQ4V 1JQ0A 3OEEG 1P49A 3ASNC 1ZUQA 4UVCA 4UUJC 1JPXA 4KL1A 5KMGB 2PYJA 1X4TA 1YITV 1K8AW 4NTYA 1EZJA 4DV7B 3OAAG 2A9HA 2V4DA 4X1IA 1K9MW 4LF5O 3PN1A 2ZE5A 3MD0A 3JD0A 1Y67A 4LFBB 1G4YB 4UVBA 3J7AU 4OX9O 1VF6C 1BS3A 3H1IH 4FMTA 2UXNA 4ZOLA 3ZRSA 4TWKA 5FPRA 4PDLA 1GN6A 2E76B 2ZNJA 2H94A 1KC8W 1Q90D 5DM6V 4WBNA 1YTFD 4MVZA 1LR1A 1H38A 2E3CA 4FLXA 3JASA 4PA9A 4MSWC 4HYOA 2IJKA 1M57B 3M8AA 3CRQA 4X65B 4Z1VA 4I4TB 3CCSV 3TK1A 1H2KA 4LF7B 2CTWA 4B3SO 4UFZA 2VS0A 3ABLC 2QSAA 3FB7C 1G1XB 2EIJC 3DC6A 2GBOA 2ZM6B 3LNNA 3HKCA 1N36O 4UV9A 1PM9A 2FKXA 3K59A 4DV4O 5BY1A 2VQEO 5D5QA 4NR1A 4DUZO 2YXYA 4JI6B 2QWOB 5JWPA 2ZR2A 2JK5C 2UXDO 3CHXA 2GTAA 2AHZA 3U0ZA 1WAZA 2HHHO 3DC5A 4FLUA 1UFIA 5CBHA 1BE3H 1QLNA 3OT7A 1VF5B 1YHQV 2UXDB 1KP3A 1E79G 2Z5UA 3H1KH 2ILMA 2HHHB 3RYCA 3AK3A 4IHJA 1AR4A 5LMUO 3FFQA 1SKVA 3OGCC 1COWG 3HPLC 2LW1A 1XNRB 2WLHA 4X1YB 2JIZG 1FJGO 1NI8A 1F51A 1P7GA 3RYFA 2BSKB 1JFFB 3DXRA 3AG1C 1IDSA 2W0FC 3VQWA 3TJTA 4X1YA 2RQ6A 2OTJV 4DR6O 5KHHA 1XHZA 5DN6G 5B3SB 4JI4B 3ZBHA 1GO3F 3VQVA 2DJVA 5IYZB 1W0JG 4CH4A 4ZKIA 3CC7V 4X66O 1NT2B 2X6AA 2R72A 4P9PA 2JJ2G 4KXRA 1YVWA 1KUQA 1OCOB 4TUYB 3W7TA 3JCUZ 1OCZB 5L3EA 2YI8A 3K5LA 4DR1O 3CJHB 1QR8A 5J9PC 3J81N 5DEDA 4CH3A 3QO5A 3KKYA 4LFBO 3H9VA 3J80N 1J5EO 4GCZA 4I55B 3G6EV 4UCOA 3JD4A 2DMXA 1IBKB 4I50A 2B1GA 4I4TA 1JJ2U 4J10A 3K3WA 1FKAO 4X20B 3GVMA 2WLIA 1AROP 3K79A 2AGAA 4J42A 2EILC 2Q5ZA 5JVDA 3OR7C 1GM8A 1XI1A 3SPCA 3HKBB 5C8YA 4DR3B 3STZC 1DF5A 1ZSPA 4YXWG 5IE9A 2HVJC 2BCCH 1GM7A 3P3PA 1Y74A 3RWRD 3SYOA 3P32A 3THOA 2YSUB 2HP8A 2QWQB 2A0LA 4LH7A 3BAAA 1N34O 3TETA 4U7NA 5J2UA 1VQKV 1Q82W 2ODMA 3P3NA 2DQ0A 1Q6HA 2RMKB 2H3OA 2O57A 4JYAB 1JVMA 1XEQA 3OUFA 2NLJC 3JARA 4YY3O 2PYLA 4K0KO 4JI1O 4MS2A 3UQ8A 5KHKA 2OCCC 4MVUA 1H2LA 5LP6C 2IW5A 4X88A 3APQA 1QLEC 4IL6Z 4JYCA 5EZYB 1YJNV 4DR4O 2AW9A 2XAGA 3H1HH 2GUZB 1SQBH 2EBOA 4GKJO 1Q3EA 1Q43A 2HEPA 1MMMA 4LF8B 1K3EA 3E22B 4LNUB 1IXMA 2B1IA 5GONA 5FLXN 1KD1W 5H2FZ 2K1EA 3D8CA 1PD3A 3RYIA 1G8MA 1JX9A 4L8JA 2VQEB 2FMLA 1F4NA 2CDYA 3T1YO 1THZA 5JJNB 5KHJA 2UXXA 3ABMB 4NXMO 3APOA 2DYRB 3B77A 4FPPA 4IYIA 2CTQA 4DK1A 4LFAO 1BQ0A 4HNAA 2F95B 1EN6A 1XNQO 4N23A 3I55V 1WPXA 3HKEB 5JJJB 4TV9B 2ZQMA 4JAVA 4FVMA 3AG4B 1SRYA 5C93A 4WFFA 1VQ5V 4N21A 4WFBV 3ETEA 4AQYO 4I9QA 1F7YA 2CUGA 1YXBA 2ADQB 2E74B 2P22C 4BR6A 4GX1A 2P4VA 4O4LB 1Y6XA 4DR1B 3CX5F 5B1NA 4B3TB 1FPOA 2P90A 5KLVH 2YXHA 1FXKC 1JR9A 2P6JA 3CMEV 1PV0A 3U10A 4QE9A 1VQ7V 4LC1A 3JALB 3CCUV 2MW2B 3BEHA 4KFMA 2PY5A 3GWKC 2F23A 1DLBA 4H0LB 1AJQA 5KX5B 1L0LH 3K06A 4X1KB 4WFAV 2CE4A 2XASA 1IURA 2A79B 1OCRB 2QR4A 5IYBO 3N2GB 3E8BA 1DGSA 5JQGA 2VRZA 4LF9O 4JV5O 1YCIA 3SJCC 4JF3A 2WWWA 5ITZA 1SQPH 2YDEA 2OCCB 2HKOA 1SQGA 1P4RA 2QKAA 1PP9H 1NVPD 3RYHB 2HJDA 4D7TA 5CA1B 3Q4HA 4O4HB 3OM3B 2YIBD 2PI5A 3FAVA 3E83A 1VIBA 3HR0A 2X7RB 4B3MB 3ABLB 4LFCO 4JI7O 3L9DA 4DV6B 4IIJA 3MDSA 2Q8VA 1N0JA 3IAYA 3L70H 1WNSA 3T4DA 4JI7B 4YJ3A 2KG7A 4O2AB 2W6JG 1E1QG 1NZ6A 1M9NA 1VF7A 4GX2A 4DV3O 2QWPB 3TXQA 5IYDO 3CE2A 5B66Z 1FYJA 2HJFC 1WA8B 5EC2C 4MVSA 3TCUA 5LYJB 3K5OA 1HNXO 5FNVB 3ZMVA 3GB7C 2QGNA 3SDLA 2BSKA 2EINB 2AXTZ 4YY3B 1Q8IA 3G71V 4K0KB 1GTOA 3LNMB 5KMGA 3VBBA 2OT5A 1K92A 5F2VO 3OTOB 1O9HA 3CJHA 4PDVA 2GV9A 2QE7G 4JGSA 3QNEA 4PA7A 4QE7A 3QO8A 1H8EG 5BR8B 1VQPV 2F1MA 1X59A 2GHYA 1AI6A 3ZMUA 1SQQH 3L73H 3B4SA 1ZWIC 1Y76B 3M7MX 3K03A 3CD6V 2WLMA 1QVFU 4FLTA 2XAFA 3CSXA 4RQEA 5BZBA 2K9PA 1CEZA 4TSFG 3RVZA 3UT5A 4UB6Z 3UCSC 5CMUA 3ETGA 5EBLC 5J2TB 2IBZH 2UXBO 2YUAA 3OGIB 3CC4V 5KA6A 2LJ2A 2X6BA 1Q81W 1YI2V 4IHJB 4DV7O 4LNUA 1IZ3A 3RYCB 5CN0A 4KHPB 2R9AA 3EFFK 1R73A 1HDJA 1IBLO 4LF6B 4LF9B 2QM8A 2GUZA 4PA6A 5TISZ 4O4HA 2JEUA 1T5EA 1FXHA 3AEIA 2DWEC 1S0VA 2P7TC 2CH7A 5ITZB 3ICXA 1QCEA 1B6QA 2YIBA 3HKCB 2QEXV 4JI1B 2CTRA 2UUBO 2ZINA 2KKWA 1ENVA 2PGGA 1H2GA 4QJFB 1VQLV 5B5EZ 4UCSA 2PZSA 1LNQA 5CA0B 1GN4A 3JAMN 1FD9A 1MNGA 3A8TA 3K58A 4LF7O 4CH6A 2YICA 2BTQA 5JQGB 3N2KB 2OWOA 1RSOB 1RPRA 2Q7GA 2ZM6O 1BZKA 5BMVA 4PA4A 4RQFA 5LP6A 1FFTB 4DR5O 5LA6B 4MTFA 4U3JB 1Q86W 4MVRA 3D36C 1O9GA 2QA4V 4ASUG 4O4IA 2BE3A 2OYQA 5H6RA 4DV6O 1W0KG 3D36A 1QBZA 2CK3G 3ABKB 1N36B 1YSCA 4JYYA 3IJ4A 5JCOC 4PELA 1YF2A 3L71H 4DRXA 1W2BU 2Y69C 1NQTA 3HKEA 5B1AB 4K8XA 3T1CA 3ZRWA 2YI9A 1MA1A 2B9ZA 3ZJZA 4O4IB 4OPAA 4YHHB 2LP7A 1GN2A 3SPGA 4LCUC 4DV0O 1AB3A 3F5WC 1DF4A 1P7BA 1HNXB 2F66C 3AG4C 3D3IA 2Q0OC 1OCZC 2IH1C 2D3OW 1FS0G 5LHGA 2L35A 5KHGA 4BIZA 2WA3A 2ETNA 1N33O 2ZE7A 3L72H 3CC2V 3A0RA 2UXCB 2RN9A 5JH7A 4W4KA 3FKSG 2EIKC 2KSDA 1M56B 4WBNB 1XL4A 4E4EA 5CA1A 3IC7A 4O4JB 4YIPA 3ZIAG 1VQ6V 1V54C 4NYKA 4AILC 2B5UA 2VWKA 2EJ7A 1J5EB 3OTOO 2GTSA 3E8GA 3OEHG 2W6IG 4DV5O 4NXNO 2E5LO 5IT9N 2EIMB 3B8MA 5IDJA 4LF5B 1CPYA 3OMAB 1TAEA 1R6TA 1NU1H 2E75B 5LXTA 3BPZA 3R66A 4QGPA 2YEVA 1AR1B 1KKCA 4FZ0A 2ZXWB 5K1XA 1RPOA 1NH2B 5J2UB 5FPOA 1AJPA 1ZL8B 2YXLA 1HNZB 3P30A 4JYAO 3ZHSA 5L3FA 2DYSB 3CCLV 4FLWA 2JS3A 2Z3YA 1DK1A 4RAIA 1HNWO 1EFRG 4R8CA 4J7KA 2NNUA 3UT5B 4DYLA 2Q73A 4X1KA 1Q5OA 4YIOA 3BHPA 3CRRA 2N05A 2KB1A 2ZIMA 5KAFZ 2C2AA 3HB3B 1GRJA 5D5PA 3A2FA 3JCZA 3FYIB 3QVNA 4BIOA 4I50B 2W0XA 1ZL8A 2PUSA 1Q6IA 2XTAA 4JPRA 3IGAC 1GMGA 1WJZA 3SJQC 4I55A 2A06H 3X2QB 3CCQV 2ZT9B 3K5NA 4K35A 3AK1A 1GH6A 1KQSU 4CS2A 5E1AC 1XREA 1ZX3A 4B3MO 3B8NA 4HNAB 2HG5C 4H33A 5LOVB 1SZTA 1XL6A 1YTFB 3KCXA 2DN9A 2EJRA 1L1FA 5L3GA 5IY5C 3ASOC 1NVPB 1PNLA 2BTOA 2BOCC 3LSUA 4JTDB 3K5MA 1AI5A 4UCRA 3T1HO 4LF4O 2EIMC 1YEWA 1WP7A 2Q9LA 1SZXA 4XDJA 4Z1MG 4F6RA 2LFRA 2JS5A 5J2TA 1V55C 4H44B 1F4MA 5GW7A 4NTXA 4PI0A 2H8PC 3G67A 3A0BZ 3E8FA 1JOYA 1S5JA 4B3TO 3CCEV 2WPDG 1SA0A 3CXHF 3GWOA 3T4ZA 5KUKA 4JTCB 3ZN0A 5FL7G 1SERA 5H9CA 4QIWF 4UB8Z 4JASA 4ZHQB 4RUFA 2A7WA 2RCVA 2XAHA 1ORQC 1XHXA 2DQ3A 1N0NA 3C90A 3CRCA 3S3WA 1N33B 5KUMA 2VWJA 4J7JA 1WB7A 4JI4O 1XNQB 2NN4A 4ABMA 2ZD9A 3LSSA 4PI2A 2LFSA 4A5UB 4YJ2B 2GDSA 2WAMA 4CS4A 3F5TA 4EFBA 1EBOA 5A2QN 3L75H 1I94B 3JAWA 3OR6C 4G27B 2PF4E 1BCCH 1S5HC 1G6UA 5JVDB 1RM1B 2OTLV 1R3IC 1WP8A 4CC6A 5IWAO 2UUCO 1F23A 2ZCEA 1OV9A 5L3CA 4WFEA 4KHPO 1BMFG 4GLXA 3OFNG 4GUNA 3JD3A 3OD4A 3K0GA 3BCCH 1AILA 1K33A 3G6BA 2EIKB 1H2MA 4FM1A 1H2SB 4EB6A 4GYCB 4BIUA 3O65A 3BFRA 4JV5B 1LUWA 3CXCU 1XOUA 4JI2O 4MW8A 4QNHB 4RO2A 1VEWA 1EZVH 1HNWB 1RFYA 1URFA 4IYHA 2LGWA 5IYCO 2ZDIA 2YS8A 3RT3C 3QO7A 2WLLA 4TV8B 2XAQA 2M6YA 1QLEB 4DUZB 2YIDA 4X1IB 4FLVA 5IWAB 4MT8A 1BGYH 2UU9B 4X9QA 3VQXA 3VOUA 3ZRWB 2QWNB 5CB4A 4LR3A 2QM7A 4J11A 4ZOLB 1Y76A 4MTOA 4DV2O 1HP8A 4WCEV 2HLDG 1BL8A 2M7WA 3UM7A 4P30A 4IT5A 1WLEA 3N2GA 3H1LH 3ZHUA 1AP5A 3ASNB 1TA8A 2NR5A 5IYZA 3W7XA 2Q6AA 2WLJA 1SA0B 4CC5A 2Q7HA 4FK5C 3I56V 1VP7A 1RP3B 2V1DA 4JZ2A 5K1PA 2IU3A 4LWSB 5EZYA 2AZ2A 4NXMB 4AHCA 3UO3A 1L0NH 3U11A 4R50A 1BHAA 4DV0B 2JRIA 1S72V 2QKSA 1HW7A 1JJOA 2QTOA 5KAIZ 2Y4TA 1JA8A 1Z2GA 4UCVA 1R3JC 3RBZA 1VF6A 5EYPB 5AG2A 4PD4F 1OZ0A 3CB2A 3JD2A 4K8ZA 2ITCC 3SPIA 4J80A 1SF9A 1N32B 4D6TH 1MSDA 1AI4A 2UUAB 4B3RO 4J9ZB 1GAXA 4Z2WA 5LP6B 5B1AC 1SETA 1EN4A 1IBMB 3LSQA 4TQFA 4F4LA 4TOIA 2RNBA 1WN7A 2HFEC 2XOKG 1IBMO 5GONB 4H37A 1VQ9V 2XHBA 2ZE8A 3ZRVA 2JJ1G 3AG2B 3SYQA 2EIJB 2IU0A 3JSNA 3E35A 4NKGB 3QF7A 1NH2D 1BHBA 1OCCB 4B08A 3W7UA 1MZEA 4J41A 3VQYA 1NR7A 3WB0A 2UUBB 1H8HG 4MVOA 2XNDG 5B1OA 4JI5B 1ROPA 4FLYA 3L74H 4TUYA 3H01A 1OCOC 1PL0A 2DYRC 1MOFA 4FFBA 3T2MA 2N74A 3LDDA 1PL4A 4EFEA 3CWBH 1TVKB 1I7FA 1NJIW 1NTKH 4JI8O 1U97A 5B1BB 4DR2B 2IJIA 1R6KA 3ETQA 4NB5A 4PV1B 4LF8O 5LMUB 3ZS8C 1A32A 1QU7A 4LP8A 3CCRV 4FLZA 2IH3C 1R6NA 4I5SA 3K9SA 1SS3A 2ZXWC 3JATA 4BAYA 4F6EA 3T1HB 1R3KC 3ML0A 3K04A 2PTMA 3ETDA 4I0XB 4FIPC 4JAAA 2P06A 3W7SA 2ZR3A 2Q69A 2Q0AA 4ICGA 5IJ9A 1R1BA 3G80A 4DR4B 4G28B 1FXKB 1V9PA 5CBFA 3RFRA 1AVMA 3E2EA 3CPWU 3KZIZ 2EILB 1QHTA 4DW0A 3HKDA 4JI8B 1H2NA 5EIBD 5HFMA 3G4SV 4FM0A 4BWAA 1Y66A 3JARB 4K3AA 2DW4A 1P84F 2ZIOA 3ABKC 2XUMA 4O2BA 3K9AA 4AQYB 1N32O 2WLLB 4TV8A 5CA3A 2EZPA 3ZHQA 3UKMA 3LUTB 3E89A 4X62O 1M57C 2JEXA 3BA9A 4GKKB 4B7KA 1I5YA 1KKDA 4X64B 1N4CA 3OTFA 3WG7C 2F93B 1XDCA 4LFAB 5HFLA 5LBQA 2Q4PA 3SGIA 4GKKO 1KB9F 3ABMC 4HBNA 1MSWD 3E8HA 3PJSK 1YIJV 4U3FH 4YJ3B 4CS3A 1V54B 5BXZA 5C8YB 4NXNB 5DECA 3FB6C 4DXWA 3WFVA 2FL4A 3ZX6A 3E86A 3DXRB 1QQCA 3N2KA 3BVOA 3CYOA 1VARA 2YIAA 5IJ9B 3AG1B 4B3RB 4XDLA 1YJWV 5KHIA 1D5AA 5CA0A 1GN3A 4UCTA 4L87A 4D7SA 1I94O 4FFBB 1ZLZA 4WFHA 3BY6A 3N27A 3CMAV 4JI5O 2G38A 4JI0O 3JD1A 3ZRXA 5LXTB 4EKWA 2F43G 1DTOA 2X0LA 1K4DC 5H5NA 4XBFA 4DR3O 5LHIA 2LGQA 1NTMH 2DE0X 2JDIG 3FB5C 3FB8C 2RJZA 5LMNB 1I08A 4JI2B 5LMNO 1M56C 2R9IA 4B3SB 3TGUH 2Q7EA 3WU2Z 3X2QC 1AI7A 1B3QA 4CZZA 2WLIB 4YJ2A 4X20A 2ADPA 1K5SA 1V55B 3BABA 4E2LA 1TGOA 3ZN1A 3AK2A 4OGQB 4JZGA 3H1JH 4DW1A 1M1KW 1JMKC 3NR7A 1VQ8V 1K5QA 4JI6O 4EEQA 4DR7B 4H13B 4Q20A 1Q7YW 2LW7A 3HKBA 4CH5A 2CTPA 1S3JA 3ASOB 2Q67A 4MTXA 1IX9A 2XAJA 2F4VB 2ZE6A 2GSMB 4Q6GA 4PA3A 2VQFO 1I0HA 3ZCCA 3OMNB 2D2CB 1HWYA 2RDCA 4OXSA 4OPHA 2Y69B 2PI4A 4DV2B 5EYPA 3JAWB 4PHZA 1Y4MA 2R9RB 1FJGB 3OW2U 3ABTA 3DTUB 1K7DA 4LF4B 4GT1A 1AR5A 2V7QG 3EXAA 1D2DA 3JYCA 3AG7A 1ZAUA 3SYPA 5LGNA 4WFGA 4X62B 5EBMC 3C3SA 4U7OA 3FYEB 3RW0A 5L3DA 4FM2A 4U3JA 2UXCO 3SPJA 2JGDB 1W59A 4DRXB 1FXKA 4X89A 3CRAA 5FNVA 4X66B 1M5IA 1RSOA 4ZI7A 1M90W 1VQMV 4I7ZB 2UUCB 4AI8A 5A9GA 3JASB 2UXBB 1R3LC 4UCUA 1FFXB 2DOSA 5LYJA 3LDEA 2EX3A 4FZ1A 5LA6A 4PDRA 2EINC 3DSQA 2L6LA 2E5LB 4MVMA 2ZNIA 1S76D 4MTGA 4EB6B 1XMOB 3HKDB 2Y0IA 2QTSA 1AP6A 2QWRB 3CCMV 3STLC 5H6QA 2KG7B 4O2AA 2LQTA 1Z5VA 1MG1A 4P9OA 1I5XA 1AJNA 2QDOA 2WLNA 2DYSC 3AG3C 5LGTA 4JI0B 3QG5A 5GTHZ 1TVKA 3SJBC 5EIBC 3IFXA 4OX9B 4RUEA 4JI3B 1NS1A 1XILA 3SJAC 5KA5A 3DGEA 1OCRC 5IJ0B 3RYHA 3BRCA 5GTIZ 4JI3O 2X6CA 4X65O 5JJEB 3D3QA 5E79Z 3ZMSA 1KYOF 3SPHA 1PNKA 3B2EE 4IIJB 4DV1B 1Z5WA 1IBLB 4LF6O 1MABG 4J9YB 3ZEDA 3ZHVA 2Q68A 4DV1O 4ZBMA 4JTAB 4TQDA 2KQXA 1GKFA 3JALA 4DV3B 1IXBA 3NXSA 2HR3A 4GZRB 5EK0A 4LBEC 4GKJB 1EM1A 4LWSA 2P67A 2FYUH 4LFCB 1FFXA 3KG2A 2CAZC 2P5OA 2QKCA 2ZKOA 1YJ9V 1BSMA 3CCVV 5LOVA 3F7VC 1QVGU 2UU9O 4MW3A 1FAFA 3C3TA 4X8AA 4PJ0Z 3MAQA 3RGBA 4DR7O 1PPJH 2FTKA 2Y0PA 3T1YB 3FX7A 4R7CA 4UV8A 5EBWC 4RWUA 1WB8A 2YC0A 4WF9V 3WG7B 4W4LA 1FXVA 2A3QA 1K97A 3R65A 1SQVH 1K4CC 1N8RW 2XT9A 2AZ0A 2FB5A 1IVSA 3ZHTA 2MK3A 3RYFB 4TV9A 4NVPA 2EULA 5BMVB 2DWDC 1PKXA 3RYIB 1NKDA 3I5DA 2F4VO 1U96A 3CCJV 3E22A 3RVYA 2WLKA 1J95A 1WPBA 1YDXA 4JAUA 3CS5A 4I0XA 3FAVB 3JSLA 4LH6A 1TUBA 1GK9A 2EZOA 3RN4A 2IM9A 5LL6Y 1PNMA 4C7UA 3OUSA 4F6RB 1VQNV 2UUAO 5CBGA 2HVKC 4FJCC 4KP4A 3JAKB 2CGNA 3SR2C 1JCHA 2ARHA 1TUEB 2OCHA 4JYBA 4NTWA 1HNZO 3SYCA 1NBMG 4IGGA 4UVAA 4B7EA 5IJ0A 2ATKC 3F7YC 2JVDA 4X64O 3JATB 1K73W 2Y4UA 2R70A 1BQZA 1SESA 1SC5B 3CP1A 1N34B 4PDMA 3ABUA 3W7WA 4DUYO 3B40A 3CEIA 4I9WA 5KX5A 1KECA 1UPGA 2QJ1A 4J7ZA 1XMOO 3JAKA 3LDCA 4DV4B 4P2ZA 1UJWB 1QNMA 2N04A 4O4JA 4DUYB 3M99B 4BW5A 3ZMTA 1XMQO 1VMGA 4DR5B 1CXZB 3CRMA 2OIEA 4DK0A 1ZTEA 1XMQB 1Y74B 4MVQA 1QR9A 3OE7G 3ZHRA 2P4KA 1BT8A 1D5NA 4DO2A 4O4LA 3MHSC 2LO1A 2JGDA 3QTCA 3A0HZ 3WB2A 1XNRO 4GX5A 4KUMA 3IC9A 4GX0A 1SQXH 5LHHA 2IJJA 1L8DA 1E1RG 4G2KA 1OHHG 3B09A 3K57A 1S5LZ 1KMIZ 4ZIBA 2Y48A 4TT3G 5EC1C 3BA8A 2IJHA 2WSSG 5B1BC 2BOBC 3EVKA 4QPJA 4UXNA 3KCYA 4HZ3A 1CP9A 4XDKA 2AHYA 1B06A 2CH7B 2ZDIC 3WB1A 5B3SC 1KBHA 1XUQA 4DR2O 4ZI7B 4ZHQA 2CGOA 4R6ZA 4QPKA 3K0DA 4HAMA 2Z0AA 2YEVB 1TUBB 4O2BB
chains in the Genus database with same CATH topology
3BEHA 4KFMA 1YTFB 4WFHA 2EJRA 3BY6A 1L1FA 5L3GA 1DLBA 5IY5C 3CMAV 3ASOC 1AJQA 3K06A 4WFAV 1NVPB 3JD1A 2XASA 3ZRXA 2A79B 1PNLA 1KP2A 2BOCC 1OCRB 3OMIB 4JTDB 1AI5A 5IYBO 2EIMC 4EKWA 2ITDC 3E8BA 3MHHC 5IY5B 2F43G 1DTOA 2X0LA 3AG3B 1K4DC 4XDJA 4Z1MG 1OCCC 2LFRA 4XBFA 4JF3A 2WWWA 1V55C 1F4MA 5LHIA 5GW7A 2OCCB 2JDIG 2HKOA 3AG2C 3FB5C 3FB8C 2H8PC 1P4RA 3E8FA 1JOYA 1NVPD 3K08A 3CCEV 2WPDG 3OM3B 3GWOA 3T4ZA 5KUKA 1NR1A 4JTCB 3SYAA 3ZN0A 2PI5A 5FL7G 1SERA 1S77D 1M56C 2R9IA 4QIWF 3E83A 5H9CA 4JASA 4RUFA 3X2QC 2XAHA 2X7RB 1AI7A 3ABLB 1ORQC 2DQ3A 5L3BA 5LGUA 4CZZA 3EHBB 2WLIB 1RM1C 5KUMA 4E2LA 1K5SA 1V55B 1GM9A 3ZN1A 4CBCA 3T4DA 1M1KW 2ZD9A 3LSSA 2W6JG 1E1QG 1VQ8V 1K5QA 2LFSA 1VQOV 1M9NA 4Q20A 1Q7YW 2WAMA 1K34A 3ZMZA 4GX2A 1VQ4V 1JQ0A 1S3JA 3ASOB 3OEEG 5IYDO 3ASNC 2Q67A 4MTXA 4UVCA 4UUJC 1JPXA 1EBOA 2HJFC 5EC2C 1YITV 4MVSA 1K8AW 2XAJA 3TCUA 1EZJA 3OAAG 2A9HA 3OR6C 4G27B 1K9MW 1S5HC 2GSMB 1RM1B 2OTLV 1R3IC 4PA3A 3MD0A 3JD0A 3ZCCA 1G4YB 1F23A 3OMNB 4UVBA 4WFEA 5L3CA 1HWYA 3ZMVA 3GB7C 1BMFG 4OXSA 2Y69B 2PI4A 4FMTA 2UXNA 3OFNG 3ZRSA 3JD3A 2EINB 1Y4MA 2R9RB 3K0GA 4TWKA 1K33A 3OW2U 3ABTA 3DTUB 3G71V 4PDLA 2EIKB 1K7DA 1GTOA 3LNMB 4BIUA 3VBBA 4GT1A 2V7QG 2OT5A 2H94A 1KC8W 1K92A 3JYCA 5DM6V 1YTFD 3SYPA 5LGNA 4PDVA 4MVZA 4WFGA 5EBMC 2QE7G 1H38A 4U7OA 4JGSA 3QNEA 3FYEB 3RW0A 3CXCU 4PA7A 4QE7A 5L3DA 3QO8A 4MW8A 4QNHB 1H8EG 3SPJA 4RO2A 1VQPV 1FXKA 4PA9A 4MSWC 4X89A 4HYOA 2IJKA 1M57B 2GHYA 1AI6A 5IYCO 2ZDIA 3CCSV 1VQMV 1M90W 3ZMUA 3TK1A 3QO7A 2WLLA 2XAQA 1QLEB 1R3LC 1ZWIC 3K03A 3CD6V 2WLMA 1QVFU 2XAFA 3ABLC 3LDEA 3FB7C 2EIJC 4PDRA 4RQEA 5BZBA 4MT8A 2EINC 1CEZA 4TSFG 4UV9A 3VOUA 3RVZA 3ZRWB 4MVMA 2QM7A 1S76D 4MTOA 4MTGA 5CMUA 3ETGA 5EBLC 4WCEV 2HLDG 1BL8A 2M7WA 3CCMV 3STLC 3UM7A 5H6QA 4P30A 2ZR2A 3CC4V 2JK5C 1MG1A 4P9OA 5KA6A 1I5XA 2X6BA 1AJNA 1WLEA 2WLNA 2AHZA 1Q81W 2DYSC 1YI2V 5CBHA 3AG3C 5LGTA 1QLNA 3ASNB 1YHQV 3IFXA 1KP3A 5CN0A 4RUEA 1E79G 2Z5UA 3EFFK 1R73A 3W7XA 5KA5A 2Q6AA 2WLJA 3DGEA 1OCRC 4FK5C 3I56V 2QM8A 2V1DA 4PA6A 2X6CA 2JEUA 3OGCC 1COWG 3HPLC 2IU3A 2WLHA 1FXHA 3AEIA 2JIZG 2DWEC 3ZMSA 1S0VA 1F51A 2P7TC 3SPHA 1PNKA 1QCEA 1B6QA 3AG1C 2W0FC 1MABG 4J9YB 4R50A 1BHAA 2QEXV 2OTJV 5DN6G 5B3SB 2QKSA 1S72V 2Q68A 1GO3F 2QTOA 1ENVA 4ZBMA 4JTAB 1H2GA 1W0JG 4ZKIA 3CC7V 4QJFB 1VQLV 1LNQA 1GKFA 2X6AA 1R3JC 3RBZA 4P9PA 2JJ2G 1OZ0A 3JD2A 1OCOB 2ITCC 3W7TA 3NXSA 3SPIA 5L3EA 1OCZB 2HR3A 1RPRA 5EK0A 4PA4A 4LBEC 4RQFA 1QR8A 1FFTB 2P67A 1AI4A 5J9PC 3QO5A 4MTFA 1Q86W 4MVRA 2QA4V 4ASUG 4J9ZB 3KG2A 5H6RA 4GCZA 1W0KG 5B1AC 1SETA 1YJ9V 3D36A 1QBZA 3LSQA 3G6EV 2CK3G 3JD4A 3ABKB 4F4LA 3CCVV 3F7VC 1QVGU 2B1GA 4MW3A 2HFEC 1JJ2U 1YSCA 2XOKG 3K3WA 4X8AA 2WLIA 4H37A 1VQ9V 1AROP 4PELA 2FTKA 3K79A 1W2BU 2Y69C 3ZRVA 2JJ1G 2EILC 1NQTA 3AG2B 4R7CA 4UV8A 2EIJB 5EBWC 3SYQA 5B1AB 2IU0A 3OR7C 3T1CA 3E35A 1GM8A 3ZRWA 1BHBA 1NH2D 1OCCB 3SPCA 3ZJZA 4WF9V 3WG7B 1FXVA 2LP7A 3STZC 1DF5A 3W7UA 3SPGA 1K97A 3R65A 4LCUC 3F5WC 1K4CC 1N8RW 1DF4A 1NR7A 1P7BA 3AG4C 3D3IA 4YXWG 2HVJC 1GM7A 2MK3A 1H8HG 1OCZC 2IH1C 2DWDC 4MVOA 2D3OW 1PKXA 1FS0G 2XNDG 5LHGA 5B1OA 1NKDA 1ROPA 3SYOA 4BIZA 3P32A 2YSUB 3H01A 2A0LA 1OCOC 3CC2V 3A0RA 3CCJV 3TETA 4U7NA 3RVYA 1PL0A 1VQKV 2WLKA 2DYRC 1J95A 1MOFA 1Q82W 4JAUA 3T2MA 2DQ0A 3LDDA 3FKSG 2EIKC 1JVMA 1M56B 1NJIW 1GK9A 1XL4A 3OUFA 2EZOA 2NLJC 5B1BB 1PNMA 3IC7A 3OUSA 1VQNV 2IJIA 4MS2A 3ZIAG 5CBGA 1R6KA 2HVKC 4FJCC 2OCCC 1V54C 4KP4A 1VQ6V 4MVUA 1JCHA 2B5UA 1TUEB 2IW5A 4X88A 4LP8A 1QLEC 3CCRV 2IH3C 1R6NA 4I5SA 4JYCA 4JYBA 3E8GA 3OEHG 2W6IG 1YJNV 2ZXWC 4BAYA 2EIMB 3SYCA 2XAGA 1NBMG 3B8MA 5IDJA 1R3KC 3ML0A 1CPYA 3K04A 3OMAB 4UVAA 2EBOA 3ETDA 2ATKC 3F7YC 2YEVA 4FIPC 1AR1B 2ZXWB 1RPOA 3W7SA 1NH2B 2ZR3A 1K3EA 1K73W 2Q69A 1AJPA 1SESA 4G28B 1IXMA 3CP1A 3P30A 1FXKB 5CBFA 2B1IA 5L3FA 2DYSB 4PDMA 3E2EA 1KD1W 3CCLV 3CPWU 3ABUA 2EILB 3W7WA 2K1EA 2Z3YA 1PD3A 4RAIA 1EFRG 4I9WA 1KECA 4R8CA 1G8MA 1JX9A 3LDCA 1F4NA 4P2ZA 2NNUA 5HFMA 1UJWB 3G4SV 1Y66A 1THZA 2DW4A 3M99B 4BW5A 3ZMTA 3ABKC 2UXXA 3ABMB 2DYRB 3B77A 4FPPA 2KB1A 3K9AA 2WLLB 2C2AA 3HB3B 5CA3A 2EZPA 4N23A 3I55V 1WPXA 4MVQA 1QR9A 3OE7G 3JCZA 2ZQMA 4JAVA 3UKMA 3LUTB 3FYIB 3E89A 1M57C 2JEXA 3AG4B 4DO2A 3MHSC 1SRYA 5C93A 4WFFA 1I5YA 1VQ5V 4N21A 1KKDA 4JPRA 3IGAC 4WFBV 4GX5A 3ETEA 3WG7C 1GMGA 5HFLA 5LBQA 4KUMA 4GX0A 5LHHA 3SJQC 2IJJA 1SZTA 1E1RG 3ABMC 1MSWD 4G2KA 3E8HA 3PJSK 1OHHG 3X2QB 3CCQV 1YIJV 4GX1A 1V54B 2Y48A 4TT3G 5EC1C 3FB6C 4DXWA 2IJHA 3WFVA 2WSSG 5B1BC 2BOBC 4QPJA 1KQSU 4UXNA 3E86A 4HZ3A 1CP9A 4XDKA 2AHYA 2ZDIC 5B3SC 5B1NA 3CYOA 3AG1B 5E1AC 2P90A 4R6ZA 3B8NA 4XDLA 1FXKC 4QPKA 2P6JA 3CMEV 1YJWV 3K0DA 4HAMA 4QE9A 1VQ7V 2YEVB 2HG5C 4LC1A 3CCUV 4H33A 4L87A 1XL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEH A;  2ITC C;  4KFM A;  2ZXW C;  3RW0 A;  4PA7 A;  4QE7 A;  3SPI A;  3SYC A;  4WFH A;  1R3K C;  4MW8 A;  4QNH B;  3K04 A;  3SPJ A;  5IY5 C;  5EK0 A;  4PA4 A;  4RO2 A;  3ASO C;  4LBE C;  3K06 A;  4PA9 A;  4MSW C;  4X89 A;  2A79 B;  2ATK C;  4HYO A;  2BOC C;  2YEV A;  3F7Y C;  4JTD B;  5J9P C;  2EIM C;  4EKW A;  2ITD C;  3E8B A;  4MTF A;  4MVR A;  2Q69 A;  1K4D C;  4XDJ A;  2WLL A;  1OCC C;  4J9Z B;  3KG2 A;  1R3L C;  1ZWI C;  3K03 A;  4G28 B;  2WLM A;  1V55 C;  5CBF A;  5B1A C;  3ABL C;  3LDE A;  4PDM A;  3FB7 C;  2EIJ C;  3AG2 C;  3FB5 C;  3FB8 C;  4PDR A;  2H8P C;  5BZB A;  4F4L A;  2K1E A;  3E8F A;  2EIN C;  3F7V C;  4MW3 A;  2HFE C;  3K08 A;  3VOU A;  4RAI A;  3RVZ A;  4I9W A;  4MVM A;  4R8C A;  4X8A A;  2WLI A;  4H37 A;  4MTO A;  4MTG A;  4JTC B;  3LDC A;  4WFG A;  4P2Z A;  5EBL C;  3SYA A;  3T4Z A;  5KUK A;  1BL8 A;  1M56 C;  2Y69 C;  3E83 A;  2EIL C;  3STL C;  3UM7 A;  4R7C A;  3SYQ A;  4RUF A;  5EBW C;  4P30 A;  3X2Q C;  2JK5 C;  4P9O A;  4BW5 A;  3ABK C;  1ORQ C;  2X6B A;  3OR7 C;  2WLN A;  3T1C A;  2AHZ A;  2WLI B;  2DYS C;  5KUM A;  4MVZ A;  3SPC A;  3ZJZ A;  5CBH A;  2KB1 A;  3AG3 C;  3STZ C;  2WLL B;  3SPG A;  4CBC A;  3IFX A;  3R65 A;  3T4D A;  4LCU C;  3F5W C;  1K4C C;  4RUE A;  3EFF K;  4MVQ A;  1P7B A;  2ZD9 A;  3AG4 C;  2Q6A A;  2WLJ A;  3UKM A;  3LUT B;  3E89 A;  1M57 C;  2HVJ C;  1OCR C;  4GX2 A;  1OCZ C;  4PA6 A;  2IH1 C;  2DWD C;  4MVO A;  2X6C A;  4WFF A;  1KKD A;  3ASN C;  3OGC C;  2Q67 A;  3IGA C;  3HPL C;  3SYO A;  4UUJ C;  4GX5 A;  3WG7 C;  2WLH A;  2HJF C;  2DWE C;  4GX0 A;  5EC2 C;  4MVS A;  2A0L A;  1OCO C;  2P7T C;  3SJQ C;  3TCU A;  3ABM C;  2A9H A;  3OR6 C;  4G27 B;  3SPH A;  3TET A;  3E8H A;  1S5H C;  3RVY A;  2WLK A;  2DYR C;  1J95 A;  3PJS K;  1R3I C;  3AG1 C;  4PA3 A;  2W0F C;  1G4Y B;  4GX1 A;  3T2M A;  4J9Y B;  3LDD A;  4R50 A;  4WFE A;  5EC1 C;  3FB6 C;  3GB7 C;  4DXW A;  2EIK C;  4OXS A;  1JVM A;  2QKS A;  5B1B C;  2BOB C;  2Q68 A;  2QTO A;  3E86 A;  4HZ3 A;  4XDK A;  4ZBM A;  1XL4 A;  3ZRS A;  3OUF A;  2AHY A;  4JTA B;  2NLJ C;  2R9R B;  3K0G A;  4TWK A;  5B3S C;  3OUS A;  4PDL A;  1LNQ A;  4MS2 A;  5E1A C;  5CBG A;  2HVK C;  3LNM B;  4R6Z A;  2OCC C;  1V54 C;  2X6A A;  4MVU A;  4XDL A;  1R3J C;  3RBZ A;  3K0D A;  4P9P A;  4X88 A;  3JYC A;  4LP8 A;  1QLE C;  4QE9 A;  2HG5 C;  2IH3 C;  3SYP A;  4H33 A;  4PDV A;  3E8G A;  1XL6 A;  5EBM C; 
#chains in the Genus database with same CATH topology
 2OIG A;  2WA4 A;  1XBL A;  1YZB A;  1M4U A;  4FFK A;  1KP2 A;  3S3X A;  3OMI B;  2ITD C;  2QM4 A;  3MHH C;  5IY5 B;  3AG3 B;  3UO2 A;  1M93 A;  1OCC C;  3TXS A;  1B04 A;  4YHH O;  1JFF A;  1XQ8 A;  5BR8 O;  3AG2 C;  5JCO A;  2VQF B;  2BTQ B;  1MZF A;  3O9O A;  3K08 A;  1HR0 B;  4DV5 B;  1SQF A;  5JH7 B;  3FD9 A;  1NR1 A;  3SYA A;  3Q4H B;  1WA8 A;  1S77 D;  4DR6 B;  1NTZ H;  1HR0 O;  1LUV A;  5L3B A;  5LGU A;  1OJH A;  3EHB B;  1RM1 C;  1GM9 A;  1US6 A;  2JGU A;  1IBK O;  4CBC A;  1EN5 A;  1KU9 A;  5CB4 B;  1VQO V;  4BW9 A;  1K34 A;  1Q6U A;  3ZMZ A;  1VQ4 V;  1JQ0 A;  3OEE G;  1P49 A;  3ASN C;  1ZUQ A;  4UVC A;  4UUJ C;  1JPX A;  4KL1 A;  5KMG B;  2PYJ A;  1X4T A;  1YIT V;  1K8A W;  4NTY A;  1EZJ A;  4DV7 B;  3OAA G;  2A9H A;  2V4D A;  4X1I A;  1K9M W;  4LF5 O;  3PN1 A;  2ZE5 A;  3MD0 A;  3JD0 A;  1Y67 A;  4LFB B;  1G4Y B;  4UVB A;  3J7A U;  4OX9 O;  1VF6 C;  1BS3 A;  3H1I H;  4FMT A;  2UXN A;  4ZOL A;  3ZRS A;  4TWK A;  5FPR A;  4PDL A;  1GN6 A;  2E76 B;  2ZNJ A;  2H94 A;  1KC8 W;  1Q90 D;  5DM6 V;  4WBN A;  1YTF D;  4MVZ A;  1LR1 A;  1H38 A;  2E3C A;  4FLX A;  3JAS A;  4PA9 A;  4MSW C;  4HYO A;  2IJK A;  1M57 B;  3M8A A;  3CRQ A;  4X65 B;  4Z1V A;  4I4T B;  3CCS V;  3TK1 A;  1H2K A;  4LF7 B;  2CTW A;  4B3S O;  4UFZ A;  2VS0 A;  3ABL C;  2QSA A;  3FB7 C;  1G1X B;  2EIJ C;  3DC6 A;  2GBO A;  2ZM6 B;  3LNN A;  3HKC A;  1N36 O;  4UV9 A;  1PM9 A;  2FKX A;  3K59 A;  4DV4 O;  5BY1 A;  2VQE O;  5D5Q A;  4NR1 A;  4DUZ O;  2YXY A;  4JI6 B;  2QWO B;  5JWP A;  2ZR2 A;  2JK5 C;  2UXD O;  3CHX A;  2GTA A;  2AHZ A;  3U0Z A;  1WAZ A;  2HHH O;  3DC5 A;  4FLU A;  1UFI A;  5CBH A;  1BE3 H;  1QLN A;  3OT7 A;  1VF5 B;  1YHQ V;  2UXD B;  1KP3 A;  1E79 G;  2Z5U A;  3H1K H;  2ILM A;  2HHH B;  3RYC A;  3AK3 A;  4IHJ A;  1AR4 A;  5LMU O;  3FFQ A;  1SKV A;  3OGC C;  1COW G;  3HPL C;  2LW1 A;  1XNR B;  2WLH A;  4X1Y B;  2JIZ G;  1FJG O;  1NI8 A;  1F51 A;  1P7G A;  3RYF A;  2BSK B;  1JFF B;  3DXR A;  3AG1 C;  1IDS A;  2W0F C;  3VQW A;  3TJT A;  4X1Y A;  2RQ6 A;  2OTJ V;  4DR6 O;  5KHH A;  1XHZ A;  5DN6 G;  5B3S B;  4JI4 B;  3ZBH A;  1GO3 F;  3VQV A;  2DJV A;  5IYZ B;  1W0J G;  4CH4 A;  4ZKI A;  3CC7 V;  4X66 O;  1NT2 B;  2X6A A;  2R72 A;  4P9P A;  2JJ2 G;  4KXR A;  1YVW A;  1KUQ A;  1OCO B;  4TUY B;  3W7T A;  3JCU Z;  1OCZ B;  5L3E A;  2YI8 A;  3K5L A;  4DR1 O;  3CJH B;  1QR8 A;  5J9P C;  3J81 N;  5DED A;  4CH3 A;  3QO5 A;  3KKY A;  4LFB O;  3H9V A;  3J80 N;  1J5E O;  4GCZ A;  4I55 B;  3G6E V;  4UCO A;  3JD4 A;  2DMX A;  1IBK B;  4I50 A;  2B1G A;  4I4T A;  1JJ2 U;  4J10 A;  3K3W A;  1FKA O;  4X20 B;  3GVM A;  2WLI A;  1ARO P;  3K79 A;  2AGA A;  4J42 A;  2EIL C;  2Q5Z A;  5JVD A;  3OR7 C;  1GM8 A;  1XI1 A;  3SPC A;  3HKB B;  5C8Y A;  4DR3 B;  3STZ C;  1DF5 A;  1ZSP A;  4YXW G;  5IE9 A;  2HVJ C;  2BCC H;  1GM7 A;  3P3P A;  1Y74 A;  3RWR D;  3SYO A;  3P32 A;  3THO A;  2YSU B;  2HP8 A;  2QWQ B;  2A0L A;  4LH7 A;  3BAA A;  1N34 O;  3TET A;  4U7N A;  5J2U A;  1VQK V;  1Q82 W;  2ODM A;  3P3N A;  2DQ0 A;  1Q6H A;  2RMK B;  2H3O A;  2O57 A;  4JYA B;  1JVM A;  1XEQ A;  3OUF A;  2NLJ C;  3JAR A;  4YY3 O;  2PYL A;  4K0K O;  4JI1 O;  4MS2 A;  3UQ8 A;  5KHK A;  2OCC C;  4MVU A;  1H2L A;  5LP6 C;  2IW5 A;  4X88 A;  3APQ A;  1QLE C;  4IL6 Z;  4JYC A;  5EZY B;  1YJN V;  4DR4 O;  2AW9 A;  2XAG A;  3H1H H;  2GUZ B;  1SQB H;  2EBO A;  4GKJ O;  1Q3E A;  1Q43 A;  2HEP A;  1MMM A;  4LF8 B;  1K3E A;  3E22 B;  4LNU B;  1IXM A;  2B1I A;  5GON A;  5FLX N;  1KD1 W;  5H2F Z;  2K1E A;  3D8C A;  1PD3 A;  3RYI A;  1G8M A;  1JX9 A;  4L8J A;  2VQE B;  2FML A;  1F4N A;  2CDY A;  3T1Y O;  1THZ A;  5JJN B;  5KHJ A;  2UXX A;  3ABM B;  4NXM O;  3APO A;  2DYR B;  3B77 A;  4FPP A;  4IYI A;  2CTQ A;  4DK1 A;  4LFA O;  1BQ0 A;  4HNA A;  2F95 B;  1EN6 A;  1XNQ O;  4N23 A;  3I55 V;  1WPX A;  3HKE B;  5JJJ B;  4TV9 B;  2ZQM A;  4JAV A;  4FVM A;  3AG4 B;  1SRY A;  5C93 A;  4WFF A;  1VQ5 V;  4N21 A;  4WFB V;  3ETE A;  4AQY O;  4I9Q A;  1F7Y A;  2CUG A;  1YXB A;  2ADQ B;  2E74 B;  2P22 C;  4BR6 A;  4GX1 A;  2P4V A;  4O4L B;  1Y6X A;  4DR1 B;  3CX5 F;  5B1N A;  4B3T B;  1FPO A;  2P90 A;  5KLV H;  2YXH A;  1FXK C;  1JR9 A;  2P6J A;  3CME V;  1PV0 A;  3U10 A;  4QE9 A;  1VQ7 V;  4LC1 A;  3JAL B;  3CCU V;  2MW2 B;  3BEH A;  4KFM A;  2PY5 A;  3GWK C;  2F23 A;  1DLB A;  4H0L B;  1AJQ A;  5KX5 B;  1L0L H;  3K06 A;  4X1K B;  4WFA V;  2CE4 A;  2XAS A;  1IUR A;  2A79 B;  1OCR B;  2QR4 A;  5IYB O;  3N2G B;  3E8B A;  1DGS A;  5JQG A;  2VRZ A;  4LF9 O;  4JV5 O;  1YCI A;  3SJC C;  4JF3 A;  2WWW A;  5ITZ A;  1SQP H;  2YDE A;  2OCC B;  2HKO A;  1SQG A;  1P4R A;  2QKA A;  1PP9 H;  1NVP D;  3RYH B;  2HJD A;  4D7T A;  5CA1 B;  3Q4H A;  4O4H B;  3OM3 B;  2YIB D;  2PI5 A;  3FAV A;  3E83 A;  1VIB A;  3HR0 A;  2X7R B;  4B3M B;  3ABL B;  4LFC O;  4JI7 O;  3L9D A;  4DV6 B;  4IIJ A;  3MDS A;  2Q8V A;  1N0J A;  3IAY A;  3L70 H;  1WNS A;  3T4D A;  4JI7 B;  4YJ3 A;  2KG7 A;  4O2A B;  2W6J G;  1E1Q G;  1NZ6 A;  1M9N A;  1VF7 A;  4GX2 A;  4DV3 O;  2QWP B;  3TXQ A;  5IYD O;  3CE2 A;  5B66 Z;  1FYJ A;  2HJF C;  1WA8 B;  5EC2 C;  4MVS A;  3TCU A;  5LYJ B;  3K5O A;  1HNX O;  5FNV B;  3ZMV A;  3GB7 C;  2QGN A;  3SDL A;  2BSK A;  2EIN B;  2AXT Z;  4YY3 B;  1Q8I A;  3G71 V;  4K0K B;  1GTO A;  3LNM B;  5KMG A;  3VBB A;  2OT5 A;  1K92 A;  5F2V O;  3OTO B;  1O9H A;  3CJH A;  4PDV A;  2GV9 A;  2QE7 G;  4JGS A;  3QNE A;  4PA7 A;  4QE7 A;  3QO8 A;  1H8E G;  5BR8 B;  1VQP V;  2F1M A;  1X59 A;  2GHY A;  1AI6 A;  3ZMU A;  1SQQ H;  3L73 H;  3B4S A;  1ZWI C;  1Y76 B;  3M7M X;  3K03 A;  3CD6 V;  2WLM A;  1QVF U;  4FLT A;  2XAF A;  3CSX A;  4RQE A;  5BZB A;  2K9P A;  1CEZ A;  4TSF G;  3RVZ A;  3UT5 A;  4UB6 Z;  3UCS C;  5CMU A;  3ETG A;  5EBL C;  5J2T B;  2IBZ H;  2UXB O;  2YUA A;  3OGI B;  3CC4 V;  5KA6 A;  2LJ2 A;  2X6B A;  1Q81 W;  1YI2 V;  4IHJ B;  4DV7 O;  4LNU A;  1IZ3 A;  3RYC B;  5CN0 A;  4KHP B;  2R9A A;  3EFF K;  1R73 A;  1HDJ A;  1IBL O;  4LF6 B;  4LF9 B;  2QM8 A;  2GUZ A;  4PA6 A;  5TIS Z;  4O4H A;  2JEU A;  1T5E A;  1FXH A;  3AEI A;  2DWE C;  1S0V A;  2P7T C;  2CH7 A;  5ITZ B;  3ICX A;  1QCE A;  1B6Q A;  2YIB A;  3HKC B;  2QEX V;  4JI1 B;  2CTR A;  2UUB O;  2ZIN A;  2KKW A;  1ENV A;  2PGG A;  1H2G A;  4QJF B;  1VQL V;  5B5E Z;  4UCS A;  2PZS A;  1LNQ A;  5CA0 B;  1GN4 A;  3JAM N;  1FD9 A;  1MNG A;  3A8T A;  3K58 A;  4LF7 O;  4CH6 A;  2YIC A;  2BTQ A;  5JQG B;  3N2K B;  2OWO A;  1RSO B;  1RPR A;  2Q7G A;  2ZM6 O;  1BZK A;  5BMV A;  4PA4 A;  4RQF A;  5LP6 A;  1FFT B;  4DR5 O;  5LA6 B;  4MTF A;  4U3J B;  1Q86 W;  4MVR A;  3D36 C;  1O9G A;  2QA4 V;  4ASU G;  4O4I A;  2BE3 A;  2OYQ A;  5H6R A;  4DV6 O;  1W0K G;  3D36 A;  1QBZ A;  2CK3 G;  3ABK B;  1N36 B;  1YSC A;  4JYY A;  3IJ4 A;  5JCO C;  4PEL A;  1YF2 A;  3L71 H;  4DRX A;  1W2B U;  2Y69 C;  1NQT A;  3HKE A;  5B1A B;  4K8X A;  3T1C A;  3ZRW A;  2YI9 A;  1MA1 A;  2B9Z A;  3ZJZ A;  4O4I B;  4OPA A;  4YHH B;  2LP7 A;  1GN2 A;  3SPG A;  4LCU C;  4DV0 O;  1AB3 A;  3F5W C;  1DF4 A;  1P7B A;  1HNX B;  2F66 C;  3AG4 C;  3D3I A;  2Q0O C;  1OCZ C;  2IH1 C;  2D3O W;  1FS0 G;  5LHG A;  2L35 A;  5KHG A;  4BIZ A;  2WA3 A;  2ETN A;  1N33 O;  2ZE7 A;  3L72 H;  3CC2 V;  3A0R A;  2UXC B;  2RN9 A;  5JH7 A;  4W4K A;  3FKS G;  2EIK C;  2KSD A;  1M56 B;  4WBN B;  1XL4 A;  4E4E A;  5CA1 A;  3IC7 A;  4O4J B;  4YIP A;  3ZIA G;  1VQ6 V;  1V54 C;  4NYK A;  4AIL C;  2B5U A;  2VWK A;  2EJ7 A;  1J5E B;  3OTO O;  2GTS A;  3E8G A;  3OEH G;  2W6I G;  4DV5 O;  4NXN O;  2E5L O;  5IT9 N;  2EIM B;  3B8M A;  5IDJ A;  4LF5 B;  1CPY A;  3OMA B;  1TAE A;  1R6T A;  1NU1 H;  2E75 B;  5LXT A;  3BPZ A;  3R66 A;  4QGP A;  2YEV A;  1AR1 B;  1KKC A;  4FZ0 A;  2ZXW B;  5K1X A;  1RPO A;  1NH2 B;  5J2U B;  5FPO A;  1AJP A;  1ZL8 B;  2YXL A;  1HNZ B;  3P30 A;  4JYA O;  3ZHS A;  5L3F A;  2DYS B;  3CCL V;  4FLW A;  2JS3 A;  2Z3Y A;  1DK1 A;  4RAI A;  1HNW O;  1EFR G;  4R8C A;  4J7K A;  2NNU A;  3UT5 B;  4DYL A;  2Q73 A;  4X1K A;  1Q5O A;  4YIO A;  3BHP A;  3CRR A;  2N05 A;  2KB1 A;  2ZIM A;  5KAF Z;  2C2A A;  3HB3 B;  1GRJ A;  5D5P A;  3A2F A;  3JCZ A;  3FYI B;  3QVN A;  4BIO A;  4I50 B;  2W0X A;  1ZL8 A;  2PUS A;  1Q6I A;  2XTA A;  4JPR A;  3IGA C;  1GMG A;  1WJZ A;  3SJQ C;  4I55 A;  2A06 H;  3X2Q B;  3CCQ V;  2ZT9 B;  3K5N A;  4K35 A;  3AK1 A;  1GH6 A;  1KQS U;  4CS2 A;  5E1A C;  1XRE A;  1ZX3 A;  4B3M O;  3B8N A;  4HNA B;  2HG5 C;  4H33 A;  5LOV B;  1SZT A;  1XL6 A;  1YTF B;  3KCX A;  2DN9 A;  2EJR A;  1L1F A;  5L3G A;  5IY5 C;  3ASO C;  1NVP B;  1PNL A;  2BTO A;  2BOC C;  3LSU A;  4JTD B;  3K5M A;  1AI5 A;  4UCR A;  3T1H O;  4LF4 O;  2EIM C;  1YEW A;  1WP7 A;  2Q9L A;  1SZX A;  4XDJ A;  4Z1M G;  4F6R A;  2LFR A;  2JS5 A;  5J2T A;  1V55 C;  4H44 B;  1F4M A;  5GW7 A;  4NTX A;  4PI0 A;  2H8P C;  3G67 A;  3A0B Z;  3E8F A;  1JOY A;  1S5J A;  4B3T O;  3CCE V;  2WPD G;  1SA0 A;  3CXH F;  3GWO A;  3T4Z A;  5KUK A;  4JTC B;  3ZN0 A;  5FL7 G;  1SER A;  5H9C A;  4QIW F;  4UB8 Z;  4JAS A;  4ZHQ B;  4RUF A;  2A7W A;  2RCV A;  2XAH A;  1ORQ C;  1XHX A;  2DQ3 A;  1N0N A;  3C90 A;  3CRC A;  3S3W A;  1N33 B;  5KUM A;  2VWJ A;  4J7J A;  1WB7 A;  4JI4 O;  1XNQ B;  2NN4 A;  4ABM A;  2ZD9 A;  3LSS A;  4PI2 A;  2LFS A;  4A5U B;  4YJ2 B;  2GDS A;  2WAM A;  4CS4 A;  3F5T A;  4EFB A;  1EBO A;  5A2Q N;  3L75 H;  1I94 B;  3JAW A;  3OR6 C;  4G27 B;  2PF4 E;  1BCC H;  1S5H C;  1G6U A;  5JVD B;  1RM1 B;  2OTL V;  1R3I C;  1WP8 A;  4CC6 A;  5IWA O;  2UUC O;  1F23 A;  2ZCE A;  1OV9 A;  5L3C A;  4WFE A;  4KHP O;  1BMF G;  4GLX A;  3OFN G;  4GUN A;  3JD3 A;  3OD4 A;  3K0G A;  3BCC H;  1AIL A;  1K33 A;  3G6B A;  2EIK B;  1H2M A;  4FM1 A;  1H2S B;  4EB6 A;  4GYC B;  4BIU A;  3O65 A;  3BFR A;  4JV5 B;  1LUW A;  3CXC U;  1XOU A;  4JI2 O;  4MW8 A;  4QNH B;  4RO2 A;  1VEW A;  1EZV H;  1HNW B;  1RFY A;  1URF A;  4IYH A;  2LGW A;  5IYC O;  2ZDI A;  2YS8 A;  3RT3 C;  3QO7 A;  2WLL A;  4TV8 B;  2XAQ A;  2M6Y A;  1QLE B;  4DUZ B;  2YID A;  4X1I B;  4FLV A;  5IWA B;  4MT8 A;  1BGY H;  2UU9 B;  4X9Q A;  3VQX A;  3VOU A;  3ZRW B;  2QWN B;  5CB4 A;  4LR3 A;  2QM7 A;  4J11 A;  4ZOL B;  1Y76 A;  4MTO A;  4DV2 O;  1HP8 A;  4WCE V;  2HLD G;  1BL8 A;  2M7W A;  3UM7 A;  4P30 A;  4IT5 A;  1WLE A;  3N2G A;  3H1L H;  3ZHU A;  1AP5 A;  3ASN B;  1TA8 A;  2NR5 A;  5IYZ A;  3W7X A;  2Q6A A;  2WLJ A;  1SA0 B;  4CC5 A;  2Q7H A;  4FK5 C;  3I56 V;  1VP7 A;  1RP3 B;  2V1D A;  4JZ2 A;  5K1P A;  2IU3 A;  4LWS B;  5EZY A;  2AZ2 A;  4NXM B;  4AHC A;  3UO3 A;  1L0N H;  3U11 A;  4R50 A;  1BHA A;  4DV0 B;  2JRI A;  1S72 V;  2QKS A;  1HW7 A;  1JJO A;  2QTO A;  5KAI Z;  2Y4T A;  1JA8 A;  1Z2G A;  4UCV A;  1R3J C;  3RBZ A;  1VF6 A;  5EYP B;  5AG2 A;  4PD4 F;  1OZ0 A;  3CB2 A;  3JD2 A;  4K8Z A;  2ITC C;  3SPI A;  4J80 A;  1SF9 A;  1N32 B;  4D6T H;  1MSD A;  1AI4 A;  2UUA B;  4B3R O;  4J9Z B;  1GAX A;  4Z2W A;  5LP6 B;  5B1A C;  1SET A;  1EN4 A;  1IBM B;  3LSQ A;  4TQF A;  4F4L A;  4TOI A;  2RNB A;  1WN7 A;  2HFE C;  2XOK G;  1IBM O;  5GON B;  4H37 A;  1VQ9 V;  2XHB A;  2ZE8 A;  3ZRV A;  2JJ1 G;  3AG2 B;  3SYQ A;  2EIJ B;  2IU0 A;  3JSN A;  3E35 A;  4NKG B;  3QF7 A;  1NH2 D;  1BHB A;  1OCC B;  4B08 A;  3W7U A;  1MZE A;  4J41 A;  3VQY A;  1NR7 A;  3WB0 A;  2UUB B;  1H8H G;  4MVO A;  2XND G;  5B1O A;  4JI5 B;  1ROP A;  4FLY A;  3L74 H;  4TUY A;  3H01 A;  1OCO C;  1PL0 A;  2DYR C;  1MOF A;  4FFB A;  3T2M A;  2N74 A;  3LDD A;  1PL4 A;  4EFE A;  3CWB H;  1TVK B;  1I7F A;  1NJI W;  1NTK H;  4JI8 O;  1U97 A;  5B1B B;  4DR2 B;  2IJI A;  1R6K A;  3ETQ A;  4NB5 A;  4PV1 B;  4LF8 O;  5LMU B;  3ZS8 C;  1A32 A;  1QU7 A;  4LP8 A;  3CCR V;  4FLZ A;  2IH3 C;  1R6N A;  4I5S A;  3K9S A;  1SS3 A;  2ZXW C;  3JAT A;  4BAY A;  4F6E A;  3T1H B;  1R3K C;  3ML0 A;  3K04 A;  2PTM A;  3ETD A;  4I0X B;  4FIP C;  4JAA A;  2P06 A;  3W7S A;  2ZR3 A;  2Q69 A;  2Q0A A;  4ICG A;  5IJ9 A;  1R1B A;  3G80 A;  4DR4 B;  4G28 B;  1FXK B;  1V9P A;  5CBF A;  3RFR A;  1AVM A;  3E2E A;  3CPW U;  3KZI Z;  2EIL B;  1QHT A;  4DW0 A;  3HKD A;  4JI8 B;  1H2N A;  5EIB D;  5HFM A;  3G4S V;  4FM0 A;  4BWA A;  1Y66 A;  3JAR B;  4K3A A;  2DW4 A;  1P84 F;  2ZIO A;  3ABK C;  2XUM A;  4O2B A;  3K9A A;  4AQY B;  1N32 O;  2WLL B;  4TV8 A;  5CA3 A;  2EZP A;  3ZHQ A;  3UKM A;  3LUT B;  3E89 A;  4X62 O;  1M57 C;  2JEX A;  3BA9 A;  4GKK B;  4B7K A;  1I5Y A;  1KKD A;  4X64 B;  1N4C A;  3OTF A;  3WG7 C;  2F93 B;  1XDC A;  4LFA B;  5HFL A;  5LBQ A;  2Q4P A;  3SGI A;  4GKK O;  1KB9 F;  3ABM C;  4HBN A;  1MSW D;  3E8H A;  3PJS K;  1YIJ V;  4U3F H;  4YJ3 B;  4CS3 A;  1V54 B;  5BXZ A;  5C8Y B;  4NXN B;  5DEC A;  3FB6 C;  4DXW A;  3WFV A;  2FL4 A;  3ZX6 A;  3E86 A;  3DXR B;  1QQC A;  3N2K A;  3BVO A;  3CYO A;  1VAR A;  2YIA A;  5IJ9 B;  3AG1 B;  4B3R B;  4XDL A;  1YJW V;  5KHI A;  1D5A A;  5CA0 A;  1GN3 A;  4UCT A;  4L87 A;  4D7S A;  1I94 O;  4FFB B;  1ZLZ A;  4WFH A;  3BY6 A;  3N27 A;  3CMA V;  4JI5 O;  2G38 A;  4JI0 O;  3JD1 A;  3ZRX A;  5LXT B;  4EKW A;  2F43 G;  1DTO A;  2X0L A;  1K4D C;  5H5N A;  4XBF A;  4DR3 O;  5LHI A;  2LGQ A;  1NTM H;  2DE0 X;  2JDI G;  3FB5 C;  3FB8 C;  2RJZ A;  5LMN B;  1I08 A;  4JI2 B;  5LMN O;  1M56 C;  2R9I A;  4B3S B;  3TGU H;  2Q7E A;  3WU2 Z;  3X2Q C;  1AI7 A;  1B3Q A;  4CZZ A;  2WLI B;  4YJ2 A;  4X20 A;  2ADP A;  1K5S A;  1V55 B;  3BAB A;  4E2L A;  1TGO A;  3ZN1 A;  3AK2 A;  4OGQ B;  4JZG A;  3H1J H;  4DW1 A;  1M1K W;  1JMK C;  3NR7 A;  1VQ8 V;  1K5Q A;  4JI6 O;  4EEQ A;  4DR7 B;  4H13 B;  4Q20 A;  1Q7Y W;  2LW7 A;  3HKB A;  4CH5 A;  2CTP A;  1S3J A;  3ASO B;  2Q67 A;  4MTX A;  1IX9 A;  2XAJ A;  2F4V B;  2ZE6 A;  2GSM B;  4Q6G A;  4PA3 A;  2VQF O;  1I0H A;  3ZCC A;  3OMN B;  2D2C B;  1HWY A;  2RDC A;  4OXS A;  4OPH A;  2Y69 B;  2PI4 A;  4DV2 B;  5EYP A;  3JAW B;  4PHZ A;  1Y4M A;  2R9R B;  1FJG B;  3OW2 U;  3ABT A;  3DTU B;  1K7D A;  4LF4 B;  4GT1 A;  1AR5 A;  2V7Q G;  3EXA A;  1D2D A;  3JYC A;  3AG7 A;  1ZAU A;  3SYP A;  5LGN A;  4WFG A;  4X62 B;  5EBM C;  3C3S A;  4U7O A;  3FYE B;  3RW0 A;  5L3D A;  4FM2 A;  4U3J A;  2UXC O;  3SPJ A;  2JGD B;  1W59 A;  4DRX B;  1FXK A;  4X89 A;  3CRA A;  5FNV A;  4X66 B;  1M5I A;  1RSO A;  4ZI7 A;  1M90 W;  1VQM V;  4I7Z B;  2UUC B;  4AI8 A;  5A9G A;  3JAS B;  2UXB B;  1R3L C;  4UCU A;  1FFX B;  2DOS A;  5LYJ A;  3LDE A;  2EX3 A;  4FZ1 A;  5LA6 A;  4PDR A;  2EIN C;  3DSQ A;  2L6L A;  2E5L B;  4MVM A;  2ZNI A;  1S76 D;  4MTG A;  4EB6 B;  1XMO B;  3HKD B;  2Y0I A;  2QTS A;  1AP6 A;  2QWR B;  3CCM V;  3STL C;  5H6Q A;  2KG7 B;  4O2A A;  2LQT A;  1Z5V A;  1MG1 A;  4P9O A;  1I5X A;  1AJN A;  2QDO A;  2WLN A;  2DYS C;  3AG3 C;  5LGT A;  4JI0 B;  3QG5 A;  5GTH Z;  1TVK A;  3SJB C;  5EIB C;  3IFX A;  4OX9 B;  4RUE A;  4JI3 B;  1NS1 A;  1XIL A;  3SJA C;  5KA5 A;  3DGE A;  1OCR C;  5IJ0 B;  3RYH A;  3BRC A;  5GTI Z;  4JI3 O;  2X6C A;  4X65 O;  5JJE B;  3D3Q A;  5E79 Z;  3ZMS A;  1KYO F;  3SPH A;  1PNK A;  3B2E E;  4IIJ B;  4DV1 B;  1Z5W A;  1IBL B;  4LF6 O;  1MAB G;  4J9Y B;  3ZED A;  3ZHV A;  2Q68 A;  4DV1 O;  4ZBM A;  4JTA B;  4TQD A;  2KQX A;  1GKF A;  3JAL A;  4DV3 B;  1IXB A;  3NXS A;  2HR3 A;  4GZR B;  5EK0 A;  4LBE C;  4GKJ B;  1EM1 A;  4LWS A;  2P67 A;  2FYU H;  4LFC B;  1FFX A;  3KG2 A;  2CAZ C;  2P5O A;  2QKC A;  2ZKO A;  1YJ9 V;  1BSM A;  3CCV V;  5LOV A;  3F7V C;  1QVG U;  2UU9 O;  4MW3 A;  1FAF A;  3C3T A;  4X8A A;  4PJ0 Z;  3MAQ A;  3RGB A;  4DR7 O;  1PPJ H;  2FTK A;  2Y0P A;  3T1Y B;  3FX7 A;  4R7C A;  4UV8 A;  5EBW C;  4RWU A;  1WB8 A;  2YC0 A;  4WF9 V;  3WG7 B;  4W4L A;  1FXV A;  2A3Q A;  1K97 A;  3R65 A;  1SQV H;  1K4C C;  1N8R W;  2XT9 A;  2AZ0 A;  2FB5 A;  1IVS A;  3ZHT A;  2MK3 A;  3RYF B;  4TV9 A;  4NVP A;  2EUL A;  5BMV B;  2DWD C;  1PKX A;  3RYI B;  1NKD A;  3I5D A;  2F4V O;  1U96 A;  3CCJ V;  3E22 A;  3RVY A;  2WLK A;  1J95 A;  1WPB A;  1YDX A;  4JAU A;  3CS5 A;  4I0X A;  3FAV B;  3JSL A;  4LH6 A;  1TUB A;  1GK9 A;  2EZO A;  3RN4 A;  2IM9 A;  5LL6 Y;  1PNM A;  4C7U A;  3OUS A;  4F6R B;  1VQN V;  2UUA O;  5CBG A;  2HVK C;  4FJC C;  4KP4 A;  3JAK B;  2CGN A;  3SR2 C;  1JCH A;  2ARH A;  1TUE B;  2OCH A;  4JYB A;  4NTW A;  1HNZ O;  3SYC A;  1NBM G;  4IGG A;  4UVA A;  4B7E A;  5IJ0 A;  2ATK C;  3F7Y C;  2JVD A;  4X64 O;  3JAT B;  1K73 W;  2Y4U A;  2R70 A;  1BQZ A;  1SES A;  1SC5 B;  3CP1 A;  1N34 B;  4PDM A;  3ABU A;  3W7W A;  4DUY O;  3B40 A;  3CEI A;  4I9W A;  5KX5 A;  1KEC A;  1UPG A;  2QJ1 A;  4J7Z A;  1XMO O;  3JAK A;  3LDC A;  4DV4 B;  4P2Z A;  1UJW B;  1QNM A;  2N04 A;  4O4J A;  4DUY B;  3M99 B;  4BW5 A;  3ZMT A;  1XMQ O;  1VMG A;  4DR5 B;  1CXZ B;  3CRM A;  2OIE A;  4DK0 A;  1ZTE A;  1XMQ B;  1Y74 B;  4MVQ A;  1QR9 A;  3OE7 G;  3ZHR A;  2P4K A;  1BT8 A;  1D5N A;  4DO2 A;  4O4L A;  3MHS C;  2LO1 A;  2JGD A;  3QTC A;  3A0H Z;  3WB2 A;  1XNR O;  4GX5 A;  4KUM A;  3IC9 A;  4GX0 A;  1SQX H;  5LHH A;  2IJJ A;  1L8D A;  1E1R G;  4G2K A;  1OHH G;  3B09 A;  3K57 A;  1S5L Z;  1KMI Z;  4ZIB A;  2Y48 A;  4TT3 G;  5EC1 C;  3BA8 A;  2IJH A;  2WSS G;  5B1B C;  2BOB C;  3EVK A;  4QPJ A;  4UXN A;  3KCY A;  4HZ3 A;  1CP9 A;  4XDK A;  2AHY A;  1B06 A;  2CH7 B;  2ZDI C;  3WB1 A;  5B3S C;  1KBH A;  1XUQ A;  4DR2 O;  4ZI7 B;  4ZHQ A;  2CGO A;  4R6Z A;  4QPK A;  3K0D A;  4HAM A;  2Z0A A;  2YEV B;  1TUB B;  4O2B B; 
#chains in the Genus database with same CATH homology
 3BEH A;  4KFM A;  1YTF B;  4WFH A;  2EJR A;  3BY6 A;  1L1F A;  5L3G A;  1DLB A;  5IY5 C;  3CMA V;  3ASO C;  1AJQ A;  3K06 A;  4WFA V;  1NVP B;  3JD1 A;  2XAS A;  3ZRX A;  2A79 B;  1PNL A;  1KP2 A;  2BOC C;  1OCR B;  3OMI B;  4JTD B;  1AI5 A;  5IYB O;  2EIM C;  4EKW A;  2ITD C;  3E8B A;  3MHH C;  5IY5 B;  2F43 G;  1DTO A;  2X0L A;  3AG3 B;  1K4D C;  4XDJ A;  4Z1M G;  1OCC C;  2LFR A;  4XBF A;  4JF3 A;  2WWW A;  1V55 C;  1F4M A;  5LHI A;  5GW7 A;  2OCC B;  2JDI G;  2HKO A;  3AG2 C;  3FB5 C;  3FB8 C;  2H8P C;  1P4R A;  3E8F A;  1JOY A;  1NVP D;  3K08 A;  3CCE V;  2WPD G;  3OM3 B;  3GWO A;  3T4Z A;  5KUK A;  1NR1 A;  4JTC B;  3SYA A;  3ZN0 A;  2PI5 A;  5FL7 G;  1SER A;  1S77 D;  1M56 C;  2R9I A;  4QIW F;  3E83 A;  5H9C A;  4JAS A;  4RUF A;  3X2Q C;  2XAH A;  2X7R B;  1AI7 A;  3ABL B;  1ORQ C;  2DQ3 A;  5L3B A;  5LGU A;  4CZZ A;  3EHB B;  2WLI B;  1RM1 C;  5KUM A;  4E2L A;  1K5S A;  1V55 B;  1GM9 A;  3ZN1 A;  4CBC A;  3T4D A;  1M1K W;  2ZD9 A;  3LSS A;  2W6J G;  1E1Q G;  1VQ8 V;  1K5Q A;  2LFS A;  1VQO V;  1M9N A;  4Q20 A;  1Q7Y W;  2WAM A;  1K34 A;  3ZMZ A;  4GX2 A;  1VQ4 V;  1JQ0 A;  1S3J A;  3ASO B;  3OEE G;  5IYD O;  3ASN C;  2Q67 A;  4MTX A;  4UVC A;  4UUJ C;  1JPX A;  1EBO A;  2HJF C;  5EC2 C;  1YIT V;  4MVS A;  1K8A W;  2XAJ A;  3TCU A;  1EZJ A;  3OAA G;  2A9H A;  3OR6 C;  4G27 B;  1K9M W;  1S5H C;  2GSM B;  1RM1 B;  2OTL V;  1R3I C;  4PA3 A;  3MD0 A;  3JD0 A;  3ZCC A;  1G4Y B;  1F23 A;  3OMN B;  4UVB A;  4WFE A;  5L3C A;  1HWY A;  3ZMV A;  3GB7 C;  1BMF G;  4OXS A;  2Y69 B;  2PI4 A;  4FMT A;  2UXN A;  3OFN G;  3ZRS A;  3JD3 A;  2EIN B;  1Y4M A;  2R9R B;  3K0G A;  4TWK A;  1K33 A;  3OW2 U;  3ABT A;  3DTU B;  3G71 V;  4PDL A;  2EIK B;  1K7D A;  1GTO A;  3LNM B;  4BIU A;  3VBB A;  4GT1 A;  2V7Q G;  2OT5 A;  2H94 A;  1KC8 W;  1K92 A;  3JYC A;  5DM6 V;  1YTF D;  3SYP A;  5LGN A;  4PDV A;  4MVZ A;  4WFG A;  5EBM C;  2QE7 G;  1H38 A;  4U7O A;  4JGS A;  3QNE A;  3FYE B;  3RW0 A;  3CXC U;  4PA7 A;  4QE7 A;  5L3D A;  3QO8 A;  4MW8 A;  4QNH B;  1H8E G;  3SPJ A;  4RO2 A;  1VQP V;  1FXK A;  4PA9 A;  4MSW C;  4X89 A;  4HYO A;  2IJK A;  1M57 B;  2GHY A;  1AI6 A;  5IYC O;  2ZDI A;  3CCS V;  1VQM V;  1M90 W;  3ZMU A;  3TK1 A;  3QO7 A;  2WLL A;  2XAQ A;  1QLE B;  1R3L C;  1ZWI C;  3K03 A;  3CD6 V;  2WLM A;  1QVF U;  2XAF A;  3ABL C;  3LDE A;  3FB7 C;  2EIJ C;  4PDR A;  4RQE A;  5BZB A;  4MT8 A;  2EIN C;  1CEZ A;  4TSF G;  4UV9 A;  3VOU A;  3RVZ A;  3ZRW B;  4MVM A;  2QM7 A;  1S76 D;  4MTO A;  4MTG A;  5CMU A;  3ETG A;  5EBL C;  4WCE V;  2HLD G;  1BL8 A;  2M7W A;  3CCM V;  3STL C;  3UM7 A;  5H6Q A;  4P30 A;  2ZR2 A;  3CC4 V;  2JK5 C;  1MG1 A;  4P9O A;  5KA6 A;  1I5X A;  2X6B A;  1AJN A;  1WLE A;  2WLN A;  2AHZ A;  1Q81 W;  2DYS C;  1YI2 V;  5CBH A;  3AG3 C;  5LGT A;  1QLN A;  3ASN B;  1YHQ V;  3IFX A;  1KP3 A;  5CN0 A;  4RUE A;  1E79 G;  2Z5U A;  3EFF K;  1R73 A;  3W7X A;  5KA5 A;  2Q6A A;  2WLJ A;  3DGE A;  1OCR C;  4FK5 C;  3I56 V;  2QM8 A;  2V1D A;  4PA6 A;  2X6C A;  2JEU A;  3OGC C;  1COW G;  3HPL C;  2IU3 A;  2WLH A;  1FXH A;  3AEI A;  2JIZ G;  2DWE C;  3ZMS A;  1S0V A;  1F51 A;  2P7T C;  3SPH A;  1PNK A;  1QCE A;  1B6Q A;  3AG1 C;  2W0F C;  1MAB G;  4J9Y B;  4R50 A;  1BHA A;  2QEX V;  2OTJ V;  5DN6 G;  5B3S B;  2QKS A;  1S72 V;  2Q68 A;  1GO3 F;  2QTO A;  1ENV A;  4ZBM A;  4JTA B;  1H2G A;  1W0J G;  4ZKI A;  3CC7 V;  4QJF B;  1VQL V;  1LNQ A;  1GKF A;  2X6A A;  1R3J C;  3RBZ A;  4P9P A;  2JJ2 G;  1OZ0 A;  3JD2 A;  1OCO B;  2ITC C;  3W7T A;  3NXS A;  3SPI A;  5L3E A;  1OCZ B;  2HR3 A;  1RPR A;  5EK0 A;  4PA4 A;  4LBE C;  4RQF A;  1QR8 A;  1FFT B;  2P67 A;  1AI4 A;  5J9P C;  3QO5 A;  4MTF A;  1Q86 W;  4MVR A;  2QA4 V;  4ASU G;  4J9Z B;  3KG2 A;  5H6R A;  4GCZ A;  1W0K G;  5B1A C;  1SET A;  1YJ9 V;  3D36 A;  1QBZ A;  3LSQ A;  3G6E V;  2CK3 G;  3JD4 A;  3ABK B;  4F4L A;  3CCV V;  3F7V C;  1QVG U;  2B1G A;  4MW3 A;  2HFE C;  1JJ2 U;  1YSC A;  2XOK G;  3K3W A;  4X8A A;  2WLI A;  4H37 A;  1VQ9 V;  1ARO P;  4PEL A;  2FTK A;  3K79 A;  1W2B U;  2Y69 C;  3ZRV A;  2JJ1 G;  2EIL C;  1NQT A;  3AG2 B;  4R7C A;  4UV8 A;  2EIJ B;  5EBW C;  3SYQ A;  5B1A B;  2IU0 A;  3OR7 C;  3T1C A;  3E35 A;  1GM8 A;  3ZRW A;  1BHB A;  1NH2 D;  1OCC B;  3SPC A;  3ZJZ A;  4WF9 V;  3WG7 B;  1FXV A;  2LP7 A;  3STZ C;  1DF5 A;  3W7U A;  3SPG A;  1K97 A;  3R65 A;  4LCU C;  3F5W C;  1K4C C;  1N8R W;  1DF4 A;  1NR7 A;  1P7B A;  3AG4 C;  3D3I A;  4YXW G;  2HVJ C;  1GM7 A;  2MK3 A;  1H8H G;  1OCZ C;  2IH1 C;  2DWD C;  4MVO A;  2D3O W;  1PKX A;  1FS0 G;  2XND G;  5LHG A;  5B1O A;  1NKD A;  1ROP A;  3SYO A;  4BIZ A;  3P32 A;  2YSU B;  3H01 A;  2A0L A;  1OCO C;  3CC2 V;  3A0R A;  3CCJ V;  3TET A;  4U7N A;  3RVY A;  1PL0 A;  1VQK V;  2WLK A;  2DYR C;  1J95 A;  1MOF A;  1Q82 W;  4JAU A;  3T2M A;  2DQ0 A;  3LDD A;  3FKS G;  2EIK C;  1JVM A;  1M56 B;  1NJI W;  1GK9 A;  1XL4 A;  3OUF A;  2EZO A;  2NLJ C;  5B1B B;  1PNM A;  3IC7 A;  3OUS A;  1VQN V;  2IJI A;  4MS2 A;  3ZIA G;  5CBG A;  1R6K A;  2HVK C;  4FJC C;  2OCC C;  1V54 C;  4KP4 A;  1VQ6 V;  4MVU A;  1JCH A;  2B5U A;  1TUE B;  2IW5 A;  4X88 A;  4LP8 A;  1QLE C;  3CCR V;  2IH3 C;  1R6N A;  4I5S A;  4JYC A;  4JYB A;  3E8G A;  3OEH G;  2W6I G;  1YJN V;  2ZXW C;  4BAY A;  2EIM B;  3SYC A;  2XAG A;  1NBM G;  3B8M A;  5IDJ A;  1R3K C;  3ML0 A;  1CPY A;  3K04 A;  3OMA B;  4UVA A;  2EBO A;  3ETD A;  2ATK C;  3F7Y C;  2YEV A;  4FIP C;  1AR1 B;  2ZXW B;  1RPO A;  3W7S A;  1NH2 B;  2ZR3 A;  1K3E A;  1K73 W;  2Q69 A;  1AJP A;  1SES A;  4G28 B;  1IXM A;  3CP1 A;  3P30 A;  1FXK B;  5CBF A;  2B1I A;  5L3F A;  2DYS B;  4PDM A;  3E2E A;  1KD1 W;  3CCL V;  3CPW U;  3ABU A;  2EIL B;  3W7W A;  2K1E A;  2Z3Y A;  1PD3 A;  4RAI A;  1EFR G;  4I9W A;  1KEC A;  4R8C A;  1G8M A;  1JX9 A;  3LDC A;  1F4N A;  4P2Z A;  2NNU A;  5HFM A;  1UJW B;  3G4S V;  1Y66 A;  1THZ A;  2DW4 A;  3M99 B;  4BW5 A;  3ZMT A;  3ABK C;  2UXX A;  3ABM B;  2DYR B;  3B77 A;  4FPP A;  2KB1 A;  3K9A A;  2WLL B;  2C2A A;  3HB3 B;  5CA3 A;  2EZP A;  4N23 A;  3I55 V;  1WPX A;  4MVQ A;  1QR9 A;  3OE7 G;  3JCZ A;  2ZQM A;  4JAV A;  3UKM A;  3LUT B;  3FYI B;  3E89 A;  1M57 C;  2JEX A;  3AG4 B;  4DO2 A;  3MHS C;  1SRY A;  5C93 A;  4WFF A;  1I5Y A;  1VQ5 V;  4N21 A;  1KKD A;  4JPR A;  3IGA C;  4WFB V;  4GX5 A;  3ETE A;  3WG7 C;  1GMG A;  5HFL A;  5LBQ A;  4KUM A;  4GX0 A;  5LHH A;  3SJQ C;  2IJJ A;  1SZT A;  1E1R G;  3ABM C;  1MSW D;  4G2K A;  3E8H A;  3PJS K;  1OHH G;  3X2Q B;  3CCQ V;  1YIJ V;  4GX1 A;  1V54 B;  2Y48 A;  4TT3 G;  5EC1 C;  3FB6 C;  4DXW A;  2IJH A;  3WFV A;  2WSS G;  5B1B C;  2BOB C;  4QPJ A;  1KQS U;  4UXN A;  3E86 A;  4HZ3 A;  1CP9 A;  4XDK A;  2AHY A;  2ZDI C;  5B3S C;  5B1N A;  3CYO A;  3AG1 B;  5E1A C;  2P90 A;  4R6Z A;  3B8N A;  4XDL A;  1FXK C;  4QPK A;  2P6J A;  3CME V;  1YJW V;  3K0D A;  4HAM A;  4QE9 A;  1VQ7 V;  2YEV B;  2HG5 C;  4LC1 A;  3CCU V;  4H33 A;  4L87 A;  1XL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...