4RUFA

Human k2p4.1 (traaak) potassium channel, w262s mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
257
Chain Sequence
GPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPESHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVSFWILLGLAYFASVLTTIGNWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rufA00
1K4CC 2WLJA 2HG5C 4R6ZA 3AG3C 5KUMA 1M57C 3T2MA 1M56C 2WLMA 1R3LC 3KG2A 3OR6C 3F7VC 5E1AC 2Q69A 4PA3A 4MS2A 4UUJC 4XDKA 5EBLC 3OR7C 3STLC 4MTFA 4I9WA 1P7BA 1K4DC 5CBGA 2DYRC 4WFHA 3K08A 2IH3C 3LDEA 3UM7A 2H8PC 2DWDC 3AG2C 4MVRA 3FB6C 2A0LA 3IFXA 3ZJZA 3E8GA 1V54C 3UKMA 4MVUA 4H37A 1R3KC 4P2ZA 4RUFA 1BL8A 4WFFA 3K0GA 4JTDB 3WG7C 3SJQC 2P7TC 1S5HC 2ITCC 4MTGA 4PDRA 4GX1A 4QE7A 1XL4A 3SPIA 2WLLA 3OUSA 5B1AC 2EINC 4F4LA 4G27B 5J9PC 2EIJC 5KUKA 1G4YB 2YEVA 1R3IC 2BOCC 3SYAA 5CBFA 2A9HA 4MVQA 2WLIB 4PA7A 4TWKA 4JTAB 4QE9A 1R3JC 3JYCA 3AG1C 3E86A 4WFEA 2WLHA 2EILC 4JTCB 5IY5C 2OCCC 2R9RB 3ZRSA 4RAIA 4J9YB 4OXSA 3RVZA 1ZWIC 4WFGA 4GX5A 3ABLC 4PDMA 4P9OA 1OCZC 2DYSC 5CBHA 3SPJA 4X89A 5EBMC 2X6AA 4MTOA 3E8HA 3E83A 4J9ZB 4R7CA 3T4ZA 4KFMA 2QTOA 2ITDC 2AHZA 4MVOA 4GX2A 5EBWC 3FB8C 5B1BC 3E8BA 4R50A 3K04A 3EFFK 4PA6A 2WLIA 4HYOA 2NLJC 4LCUC 4PA4A 5BZBA 4X8AA 5EC1C 3TCUA 2Q6AA 3K06A 3LNMB 4PDVA 4BW5A 3T4DA 1OCOC 4P9PA 2Q67A 3IGAC 2Q68A 1V55C 3SPHA 4QNHB 3HPLC 4XDJA 1XL6A 4X88A 2WLNA 3K0DA 4P30A 2X6CA 2QKSA 4MSWC 5B3SC 2DWEC 1OCCC 3E8FA 4PA9A 2EIMC 4MVSA 4GX0A 5EC2C 2ZD9A 3SPGA 3TETA 2HJFC 1QLEC 2K1EA 3E89A 1JVMA 5EK0A 3ASNC 3LDCA 3RW0A 4R8CA 3OGCC 4HZ3A 1OCRC 1ORQC 3LUTB 4XDLA 4ZBMA 3SYQA 3OUFA 4EKWA 2Y69C 3GB7C 4LP8A 3X2QC 3SYOA 2ZXWC 3VOUA 2WLLB 4DXWA 3RVYA 2EIKC 2ATKC 2HVKC 2AHYA 1KKDA 3PJSK 3FB5C 3LDDA 3STZC 3AG4C 3SYPA 2WLKA 1LNQA 3ABMC 3BEHA 3K03A 2X6BA 3F5WC 3SPCA 4PDLA 2JK5C 2HFEC 4LBEC 3ASOC 3F7YC 3R65A 4MW8A 1J95A 3FB7C 4CBCA 4MW3A 3RBZA 4MVMA 3T1CA 2W0FC 4G28B 2IH1C 2BOBC 3ABKC 4H33A 3SYCA 4MVZA 2HVJC 2KB1A 2A79B 4RO2A 4RUEA
chains in the Genus database with same CATH superfamily
2WLJA 3ZHUA 1AI4A 3CWBH 3JD2A 1BGYH 4TUYA 2B5UA 3S3XA 3STLC 1GN2A 2F4VB 4GKKB 3CEIA 4WFHA 2X0LA 4FLTA 2E5LB 2FKXA 3IC7A 2JDIG 3AK3A 4J42A 4H37A 4P2ZA 1Q8IA 4DR6B 2Y4TA 2LGWA 1XI1A 1ENVA 3HKCA 2EINC 1TGOA 1AI5A 3BHPA 1XNQB 3TJTA 4DV6O 4JTAB 4X20B 3EVKA 3JYCA 1OHHG 3E86A 4EFEA 1CP9A 3RYHB 1ZSPA 1QLEB 3QG5A 4RAIA 4LF5B 2K9PA 4P9OA 4LF6B 3IJ4A 1AP5A 4MTOA 1COWG 1RSOA 3M99B 4KFMA 4GX2A 1AILA 1YVWA 1JFFB 4UCUA 3QO7A 4JPRA 3JAMN 4LCUC 4UVCA 3ZRXA 2Q6AA 5LMUO 4O4HA 1HNZB 5TISZ 2Q67A 5IT9N 3L74H 1SETA 1YXBA 4P30A 1DGSA 1O9HA 2VRZA 1VQNV 1KB9F 3EHBB 4J11A 1AR1B 4DV0B 4UVBA 3ZHQA 4XDLA 2OYQA 4O4LA 1U96A 4GT1A 4UCVA 3BABA 4TUYB 2ZNIA 1K7DA 2B9ZA 3OMIB 3OTOO 3IC9A 4JASA 5H6QA 3DC5A 4JV5O 3A0BZ 2HVJC 1GM8A 2WLMA 3OR6C 1ZLZA 2VQEB 2BTQB 4QPKA 1K4DC 4J10A 4FJCC 3K79A 4G2KA 1E79G 1YITV 2A7WA 2ZE8A 4CZZA 3L75H 4JTDB 1N33O 4JYAB 4H44B 3JD0A 5CA0A 1RSOB 3C3SA 3OUSA 1P84F 3LSUA 2AZ0A 4FPPA 5KLVH 1R73A 5CBFA 5KA6A 4U7NA 2P5OA 1IURA 4X66B 1SZXA 3QF7A 4DR1B 3JASA 2UUAO 3E35A 3ASNB 4O4HB 5AG2A 2DOSA 2CTRA 4CS2A 2H3OA 5LL6Y 4R50A 5D5PA 3G71V 5JJJB 5LA6B 2A3QA 3CRCA 4DR5B 1RFYA 4JI4O 4O4LB 2QWPB 3K06A 1JOYA 3LNMB 2DWEC 5GONA 4FVMA 4IL6Z 1NH2D 3LDCA 1H38A 2FMLA 3VBBA 4ABMA 2W0XA 1M1KW 2EIKC 3LDDA 3AG4C 2JJ1G 3AG7A 3SYPA 3OD4A 2F1MA 4YXWG 1VMGA 4NXNB 4JI2O 5CMUA 2IH1C 1BQZA 4B3SB 4O2BA 1QQCA 2HG5C 4R6ZA 5LYJA 4DV4O 1M57C 1NTMH 2E3CA 2YI9A 2AXTZ 2QWQB 3F7VC 4TT3G 2UU9B 5IYZA 3OR7C 2UXDO 1P7BA 1CPYA 2DYSB 3LDEA 5KHJA 3G6EV 1SQQH 3CMEV 3JASB 5J2TA 2YC0A 4FM1A 1FS0G 4K0KB 5C8YB 2DQ3A 2ITCC 4QE7A 3JCUZ 1AB3A 5B1AC 2QDOA 3K58A 5J9PC 3I5DA 3ZHRA 2Q7GA 1IZ3A 1DF5A 3MHHC 3RGBA 4DV2O 3AG1C 1Q43A 1F4MA 2QE7G 1JQ0A 2XASA 5KAIZ 2JJ2G 4PI0A 5IJ0A 3E83A 1B04A 4GZRB 1K92A 1AR5A 5GONB 4QGPA 5B1BC 2DMXA 3OFNG 4K8XA 2P6JA 3CC4V 4X8AA 2KKWA 2W6JG 4UB8Z 2ZR2A 4B3MO 3K0DA 4DR3B 4OX9B 3FX7A 3D3IA 1M56B 2CGNA 2E76B 5FLXN 5BMVA 2VS0A 4FLYA 4QIWF 4PI2A 2ZNJA 4ZBMA 4DW0A 3W7WA 4O2BB 4DRXA 2ZXWC 4AHCA 4HAMA 5LYJB 2QTSA 1KBHA 5B1NA 2AHYA 2YDEA 5IYZB 2QA4V 2JK5C 1EBOA 3F7YC 3CRQA 1CEZA 3K5LA 4CH6A 4JI3B 2JS5A 1PNKA 4FM0A 3HKEA 5JJEB 1N8RW 1KP2A 5J2TB 2OIGA 4XDKA 4DO2A 2F95B 3T2MA 3HR0A 1GTOA 1XMOO 1L0LH 2CGOA 3CXHF 1SQGA 2Q0AA 4BR6A 1B6QA 2DWDC 2CDYA 2EBOA 2Y0PA 3ETDA 4MVUA 1R3KC 4BIUA 1EFRG 1SQPH 1W0JG 1H8EG 1GN4A 5IJ0B 3QVNA 3JAKA 4PJ0Z 2QKAA 4LC1A 2ZQMA 2V4DA 2XUMA 2UXNA 3TGUH 4UV8A 3P30A 2EIMB 2WLHA 4C7UA 5LGUA 1YCIA 3J7AU 4XBFA 3MD0A 2YXLA 3JD1A 2JRIA 1DK1A 2Y0IA 2AHZA 2ZIMA 1BCCH 4JI6O 2EZPA 3EFFK 2VWKA 5BMVB 3C3TA 4DRXB 1MZFA 3R66A 3L72H 2QWOB 1PD3A 1Y67A 1ZTEA 3T4DA 3IGAC 2Q68A 2GV9A 5KHIA 2HJDA 2F4VO 4GKKO 4CC6A 3LSQA 1GM9A 2F23A 4I5SA 2E5LO 2OTLV 4DR4B 4X65B 1VQ8V 4FZ0A 5GTHZ 2GBOA 2Q73A 5EK0A 3BA8A 3I55V 4AILC 4JI7B 1D2DA 2RMKB 1BHAA 1URFA 3P3PA 4NVPA 3VQYA 4LF8O 4NB5A 3ZRWA 3STZC 1HR0B 4ZI7A 1H2GA 1O9GA 1XNQO 3MHSC 1A32A 3RBZA 1XNRO 2EINB 5CB4B 2BOBC 4TQDA 1H2SB 1XHXA 4LF6O 3K5MA 3F5TA 3ZHTA 2WPDG 4MS2A 3JAKB 2GDSA 1MSDA 5EZYA 4O2AA 3OT7A 4DR7B 1S72V 3FB6C 3W7TA 3W7XA 1W59A 3UO3A 3N27A 2JIZG 1HNZO 5GTIZ 3BVOA 1VF6A 3CCSV 2OWOA 4PDRA 1XL4A 1TUEB 3ICXA 2QR4A 3SDLA 2UXCB 5KUKA 4DV0O 2BOCC 2WA3A 5LP6C 2Q9LA 3VQWA 5J2UA 4IHJA 2EILC 2OCCC 4PDMA 1R1BA 5EBMC 1Q5OA 3BAAA 5ITZB 1WP7A 4O4JA 3K04A 3H1KH 3JARA 1N0NA 2VWJA 3M8AA 5FPRA 4O4IA 3TCUA 2YUAA 1PP9H 2LQTA 4CH5A 2VQEO 1VQ9V 5FL7G 4QNHB 3ZRWB 2HHHO 1TAEA 3CSXA 3K9SA 4ZI7B 4BWAA 4UVAA 4IGGA 1IBMO 5EC2C 3SPGA 1AJPA 2A06H 4K8ZA 4U3JA 1BS3A 1GO3F 2LP7A 2D2CB 3OUFA 2KQXA 2RQ6A 1SQBH 4J80A 4X20A 2WLLB 4H13B 3B40A 1IBLO 3RYHA 2D3OW 4N23A 2NN4A 1RM1C 1HNXO 3U0ZA 5IJ9A 2N04A 5EZYB 3LNNA 4O2AB 1VQ7V 4X66O 2P67A 4MVMA 1SERA 1NJIW 4LF9O 5FPOA 4WFBV 1JFFA 4ZOLB 3SYCA 4BIOA 1PKXA 3KG2A 4DYLA 5E1AC 2XAHA 5EIBC 1N32B 2WSSG 1SF9A 2YXYA 2IBZH 4L8JA 2B1IA 1X4TA 5J2UB 4IHJB 1DF4A 1N34B 3ETGA 4RUFA 4W4LA 3K0GA 1AP6A 2EIJB 3WG7C 3ZMZA 3SJQC 2QSAA 3BA9A 4O4JB 4F6EA 3ZN0A 5LHHA 1NH2B 4GKJO 4PHZA 1PPJH 3JARB 2P06A 4FM2A 2DQ0A 1SRYA 4O4IB 4JTCB 1H8HG 4LFBB 2BSKA 3CXCU 1JCHA 4TSFG 2ADPA 3DTUB 1QCEA 4JI1B 1Q6HA 1Q82W 2EIKB 4I0XA 4LH7A 3AG4B 2WAMA 2WLIA 4U3JB 2BTQA 4B3SO 1BE3H 4NTXA 4TV9B 1AR4A 1NVPB 2IU3A 2XAJA 3BY6A 3CCMV 2R9IA 1M57B 5IJ9B 3K9AA 4I55A 2ZDIC 2HJFC 2PYJA 1P49A 5A2QN 4HZ3A 1OCRC 1ORQC 1OV9A 1VARA 3W7UA 3WB1A 2Y69C 1J5EO 3SYOA 3VOUA 3T1YB 3CMAV 2DW4A 4YJ3A 1QHTA 3K03A 2E74B 3R65A 1K34A 2Q5ZA 4ASUG 5B1AB 5B1OA 1YTFD 2Q7HA 4FIPC 2CTWA 1N36B 2E75B 5LA6A 1Y74B 3SR2C 4YJ2A 4LF4B 3AG1B 5EYPA 2QJ1A 3RYFA 3U10A 1YDXA 1YHQV 5EBLC 5IE9A 2P4VA 2DYRC 1JR9A 3K08A 3CE2A 4IIJA 5B1BB 3JATA 1FKAO 4ZHQA 1VIBA 2BSKB 1QLNA 4JI5O 2M7WA 1BSMA 2C2AA 4DR3O 4LFAB 4OX9O 2IJJA 2UUBB 5L3EA 5IYBO 4JYBA 4PD4F 3CS5A 3G67A 5LHGA 4I0XB 2ZE7A 1Q7YW 4BIZA 3CD6V 5KHHA 4KUMA 1R3IC 1AVMA 2YXHA 4MVQA 2WLIB 2YIDA 5IY5C 1F51A 4YHHB 3RT3C 4J9YB 5LGNA 1YI2V 3ABLC 2X6AA 1JJ2U 2ZXWB 4R7CA 2QTOA 3LSSA 2ITDC 4B3TB 4I55B 4JI3O 4I4TA 2GTAA 3H1HH 4YIOA 2GUZB 4PA4A 2QM4A 4LFCO 3CCQV 1I7FA 1NS1A 3SPHA 3JALA 4DUZB 4YJ3B 3P32A 3E8FA 2AW9A 3HB3B 5GW7A 2FL4A 5C8YA 3OGCC 5H2FZ 1PNMA 1WB7A 2P4KA 1FFXA 4YJ2B 5EYPB 3RYFB 1JJOA 1Y4MA 4OPAA 1Q3EA 2JEUA 3RYIA 1VQOV 1WNSA 3FB7C 4EB6A 3T1HO 4IIJB 3JATB 2RJZA 3OE7G 4ZHQB 4DV5B 1YSCA 3WB0A 3DXRB 1R3LC 3G6BA 3OMNB 3OMAB 4MTFA 1S5LZ 4JAVA 1KUQA 2HKOA 1SS3A 1XOUA 2ILMA 4NXMO 4CS4A 1L0NH 4QPJA 2PI4A 5LP6A 3J80N 1XBLA 5IWAB 1YEWA 4KP4A 2HLDG 4DR4O 4X65O 1Q81W 3BCCH 4I4TB 1K97A 1FXHA 4TWKA 4QE9A 1SC5B 1LUWA 1GK9A 3VQVA 4UCOA 4DV3O 3JALB 1S77D 3UT5A 4J9ZB 4MVOA 3AEIA 5EBWC 4DUYO 4MTXA 3HKDB 4UCTA 4X64O 1M9NA 4KHPB 3OGIB 3ZHVA 4JGSA 2RNBA 5BZBA 5EC1C 4KL1A 1LUVA 4LF7B 1SA0B 1VQKV 4GCZA 1FFXB 1FJGB 1JX9A 4XDJA 4X88A 4NYKA 3RYIB 5B3SC 4JI8B 3A8TA 2YIBD 1OCCC 4GYCB 4DR7O 4EB6B 3ZMTA 2KG7A 2LW7A 5LGTA 3CB2A 3A2FA 3FKSG 4UFZA 4MT8A 1NT2B 2JEXA 3KKYA 2HVKC 4FLUA 2Z0AA 1KMIZ 2FYUH 1VEWA 3C90A 2AGAA 1DLBA 4G28B 2P22C 4OGQB 4X62B 2WWWA 3S3WA 2IJKA 5LP6B 1F23A 3ZX6A 2EILB 2OCCB 5C93A 4PA3A 1FD9A 1VQLV 4JV5B 2H8PC 1FAFA 2A0LA 5FNVA 1B3QA 1IVSA 2H94A 2N74A 3APOA 1I94B 4WFFA 2JS3A 5JQGA 1XILA 4DV1B 3UT5B 3SPIA 1AROP 4FLXA 3EXAA 3TXQA 1S0VA 3QO8A 1FPOA 2HP8A 1N33B 4CC5A 5CB4A 4X1IA 4Z1VA 3SPJA 4DK1A 2CTQA 3CJHA 1UPGA 3CYOA 1L1FA 1RM1B 2Y4UA 4HYOA 2QM8A 2KG7B 2UUAB 2ZDIA 2OTJV 4ZIBA 3P3NA 1OCOC 1WPXA 3OEEG 2QGNA 1XMQO 1KD1W 1MA1A 3AK2A 2ETNA 1EN6A 2K1EA 2QM7A 4JI4B 4R8CA 2RN9A 3MAQA 1N34O 1ROPA 2CK3G 3GB7C 2M6YA 5JWPA 4DV7O 1W0KG 2ZT9B 1G6UA 3CPWU 3WG7B 4MW3A 1XEQA 5ITZA 2UUCB 3K3WA 5FNVB 4LFBO 3ABKC 4JI1O 1XQ8A 1P4RA 4DR6O 5JQGB 3CRMA 4ZKIA 4I9WA 5CBGA 1XREA 1Q90D 3B09A 3E8GA 1NQTA 1TVKA 2R72A 3UKMA 1GRJA 5IYCO 1HNWB 4X1IB 1PNLA 2UXDB 4LF5O 1I0HA 5HFLA 2F66C 3CJHB 2WLLA 1YIJV 5KA5A 3JD4A 4WF9V 4PA7A 3U11A 3OW2U 1D5NA 2PTMA 3ZRVA 5IDJA 2HEPA 1JA8A 5H6RA 3ZBHA 1OCRB 1ZX3A 1OCZC 3A0HZ 2P90A 2Y69B 4ZOLA 1VQMV 3E8HA 3ZMUA 3E8BA 5LOVB 3DGEA 4DV2B 3CX5F 2L6LA 4L87A 2NLJC 1IBKB 4H0LB 4LF4O 5KMGA 2IW5A 3HPLC 1SQVH 5BR8B 1R6KA 2XTAA 4PA9A 1NI8A 4MVSA 1N4CA 1ZAUA 2CE4A 1XUQA 2DYRB 4EKWA 2YIAA 4B3MB 2F93B 2OCHA 5KHKA 1RPOA 4I50A 1NR1A 1GN6A 3K5NA 3ASOC 1K5SA 2R70A 1IX9A 1MABG 4LNUA 4J7JA 1EZVH 1TVKB 1YF2A 2UXBB 4TV9A 1F7YA 5IYDO 2JVDA 3H9VA 5IY5B 2KSDA 4Z2WA 2PUSA 4JYAO 3ABLB 4YIPA 2L35A 3APQA 3B2EE 1MOFA 3ZCCA 1M5IA 3OEHG 3A0RA 1IDSA 3CCVV 5L3DA 3SJCC 1S5JA 4TV8A 4DR1O 4WBNB 4Q6GA 1AJNA 4AI8A 2P7TC 4J7ZA 3K57A 2YI8A 1VQ6V 3W7SA 3NXSA 5JJNB 4WFEA 4GLXA 3KCXA 2EJ7A 3DSQA 3N2GA 4DR5O 2EULA 5KMGB 4OXSA 3QO5A 2YSUB 4GX5A 4Z1MG 1Y74A 2ZM6B 1HW7A 1PM9A 3H1JH 4IT5A 1SQXH 4X9QA 2XAGA 4NTYA 4DV5O 5KX5B 1F4NA 1AI6A 4I50B 4B3RB 1V55C 1YJ9V 4KXRA 1XL6A 4JYYA 4JI6B 1Q86W 2Q4PA 1LR1A 1RPRA 1H2LA 2XNDG 3RW0A 3CCRV 4LNUB 2MK3A 4NXNO 3CCLV 2XT9A 5IWAO 3WFVA 2BE3A 4RWUA 2ZR3A 5CA1B 1YJNV 3SPCA 3ABMC 4QJFB 2UU9O 4MW8A 1Q6UA 3B8MA 2Z3YA 2YS8A 5D5QA 4DR2B 1FXKC 4H33A 4MVZA 5JCOC 4LF8B 3QTCA 4TV8B 2XAQA 4U7OA 1XHZA 3ZEDA 3AG3C 1K8AW 2GUZA 3AK1A 4B7EA 4AQYB 2QWRB 3RFRA 4K0KO 3UQ8A 1XNRB 3D36C 4KHPO 4PV1B 3ML0A 4BW9A 1KKCA 4PELA 1BMFG 3TK1A 3ZJZA 5L3CA 4LF7O 1V54C 3N2GB 1US6A 1FJGO 3FD9A 1NU1H 1AJQA 1IXMA 1NKDA 4TOIA 4JI8O 2VQFB 1EN4A 4F4LA 4FLVA 1KYOF 4N21A 5B3SB 3CC2V 1OCCB 3JSLA 3PN1A 3JD3A 5DM6V 1R6NA 5CA3A 4OPHA 5CBHA 1Z5VA 4X89A 4IYHA 4X1KA 4UXNA 3DXRA 3KZIZ 3B4SA 1VP7A 5KHGA 4PA6A 4FFKA 4JI0B 1BQ0A 3CRRA 4X62O 1M93A 2Q0OC 1WN7A 2DJVA 4LWSA 3ZN1A 5LMNB 2ADQB 5CN0A 3VQXA 3RN4A 1WP8A 2X7RB 1H2MA 5BXZA 1CXZB 4D7SA 4F6RA 1Y6XA 1WLEA 3E89A 2LFRA 1K73W 4JZGA 3NR7A 3X2QC 1I94O 3H1IH 1VQ4V 2HHHB 2CUGA 3HKCB 3ZMVA 4NR1A 1KKDA 4DV1O 1MG1A 2ZE6A 3F5WC 1IBMB 4X1YA 5B5EZ 2PZSA 2W0FC 3HKDA 3K59A 1N0JA 2IU0A 1IBLB 1GAXA 2ODMA 2LGQA 1HNXB 2V7QG 1SA0A 3H1LH 2V1DA 4JAAA 1VF6C 2NNUA 4LF9B 3UM7A 1GM7A 3AG2C 3RYCA 2W6IG 3FFQA 5LHIA 1ZL8A 1TA8A 2QWNB 4ICGA 2ARHA 4U3FH 2R9AA 4GX1A 4X1KB 1M90W 4YY3B 1OCOB 1Z5WA 2EIJC 2YEVA 3HKBA 3JSNA 4LWSB 1PV0A 1IXBA 2WA4A 4EFBA 3L73H 1H2KA 3BRCA 1JPXA 4EEQA 1VQ5V 4GKJB 4F6RB 3FYIB 1NBMG 2UUCO 1BHBA 1RP3B 1X59A 4JZ2A 4CH3A 4CS3A 1NZ6A 1T5EA 5JH7A 4WFAV 3ZIAG 3L9DA 4JI7O 4P9PA 4W4KA 3ABKB 4FMTA 5DN6G 5LXTA 3ZHSA 3GWOA 3B8NA 5K1XA 1I5XA 2IM9A 4B7KA 1HR0O 2QKSA 4X1YB 3G4SV 1NVPD 2CTPA 1E1RG 1QR9A 1QLEC 2FTKA 1HDJA 2LO1A 3CP1A 3CCUV 1I08A 3LUTB 4DV6B 1K5QA 2ZKOA 1HNWO 5CA0B 2BCCH 1Y76A 1PL0A 1BZKA 3D8CA 5H9CA 4UCRA 2WLKA 3BEHA 2LFSA 1J95A 4CBCA 1FXVA 3RYCB 5B66Z 1J5EB 1M4UA 1ZL8B 3B77A 4DW1A 4UCSA 3WU2Z 3FAVA 4RQEA 1QU7A 4D6TH 5LMUB 5A9GA 1HP8A 3CHXA 1OCZB 3OAAG 3Q4HA 4E4EA 2IH3C 2YEVB 3HKBB 3WB2A 2UXCO 1IBKO 4DK0A 1E1QG 2ZE5A 1WJZA 3IFXA 3E22A 1MZEA 4LH6A 1KQSU 4LR3A 5BR8O 1KU9A 4UB6Z 1KP3A 4UV9A 1W2BU 2OT5A 3JCZA 2AZ2A 4D7TA 1L8DA 4G27B 1G4YB 2CAZC 1DTOA 1OJHA 3OTOB 3BPZA 4FK5C 2YICA 1QVGU 5HFMA 5JH7B 4JI5B 2IJIA 3ZRSA 2GHYA 1MNGA 4NTWA 2Z5UA 3GVMA 4RQFA 5LXTB 3D3QA 4J41A 4FLWA 2ZIOA 3CRAA 2CH7A 2RDCA 3ASOB 2XAFA 2UXBO 4K3AA 4JAUA 2JGDA 4PDVA 1Y76B 1G8MA 2PI5A 3IAYA 1P7GA 3N2KA 3UCSC 1UFIA 3SJBC 2FB5A 3TETA 1EZJA 3JAWA 3ASNC 3SJAC 4LFCB 4LP8A 1WA8A 3FAVB 2ATKC 1FXKA 1QNMA 3KCYA 3DC6A 3PJSK 1UJWB 5JCOA 3ABUA 2HR3A 5L3BA 3I56V 1N32O 3FYEB 3Q4HB 4JF3A 4BAYA 1GMGA 3D36A 4E2LA 5LOVA 3E22B 2PYLA 1KECA 2GTSA 1FFTB 3UO2A 1WB8A 2LJ2A 2ZM6O 2XHBA 4CH4A 1H2NA 2Y48A 3T1HB 4HBNA 1XDCA 4HNAA 2EZOA 2EJRA 1VF5B 2OIEA 5LBQA 3TXSA 4B3RO 4IYIA 1S5HC 4MTGA 1S3JA 1NR7A 2MW2B 1BT8A 1V55B 3G80A 4NXMB 5DEDA 2A9HA 3ZMSA 2QKCA 4JI2B 2CH7B 2JGDB 2R9RB 3QNEA 1QBZA 1G1XB 2BTOA 1ZWIC 4WFGA 2DYSC 4FFBA 3N2KB 4DV4B 1Y66A 3L70H 3T4ZA 1WPBA 2O57A 3FB8C 1EM1A 3HKEB 3J81N 2LW1A 4DR2O 3ABMB 2DE0X 5JVDA 5L3GA 3JAWB 4NKGB 4DV3B 3ABTA 1WA8B 1PL4A 4AQYO 3H01A 4FZ1A 1FXKB 2XOKG 3T1YO 1QR8A 4DUYB 5E79Z 4X64B 4WBNA 3AG3B 1SESA 2JGUA 2N05A 5K1PA 3ETEA 4GX0A 1JMKC 2ZD9A 4TQFA 1B06A 3CC7V 3SYQA 2ZCEA 1FYJA 3BFRA 1I5YA 1MMMA 5F2VO 4I9QA 4DXWA 1N36O 1SZTA 1V54B 1S76D 3FB5C 3OTFA 2VQFO 2DN9A 1YTFB 2X6BA 5L3FA 1AI7A 4LBEC 4K35A 4HNAB 2PGGA 5DECA 1YZBA 2B1GA 5KAFZ 2KB1A 2A79B 1V9PA 4RO2A 1EN5A 1K4CC 5KUMA 1M56C 5KX5A 4I7ZB 3E2EA 5H5NA 2Q69A 4UUJC 1K33A 2Q7EA 4LFAO 3M7MX 2UUBO 4JI0O 2PF4E 2GSMB 3MDSA 3CCJV 1VQPV 4MVRA 5LMNO 1TUBA 1THZA 1HWYA 1BL8A 2RCVA 4YHHO 2NR5A 1K3EA 1WAZA 4FFBB 3K5OA 5CA1A 4B08A 1SQFA 4B3TO 3SYAA 5JVDB 1Z2GA 1GKFA 1R3JC 3ETQA 1QVFU 3GWKC 1OZ0A 1NTKH 1MSWD 1R6TA 3RVZA 4FLZA 1K9MW 1VF7A 1ZUQA 4J7KA 3X2QB 4DUZO 1YJWV 3O65A 2UXXA 1XMOB 2ZINA 3THOA 1SKVA 4A5UB 4BW5A 3OM3B 3CCEV 1U97A 4WCEV 1KC8W 2WLNA 2X6CA 1Q6IA 4MSWC 1D5AA 1GH6A 2Q8VA 2EIMC 2IJHA 5BY1A 1GN3A 1JVMA 1NTZH 4GUNA 4JYCA 2YIBA 3AG2B 4Q20A 3ZS8C 5EIBD 3RVYA 1XMQB 4YY3O 3L71H 2F43G 1LNQA 4PDLA 2HFEC 2G38A 2PY5A 3T1CA 3SGIA 2QEXV 2EX3A 3RWRD 4DV7B 3O9OA 1TUBB 4RUEA
chains in the Genus database with same CATH topology
2WLJA 1F23A 2V7QG 1AI4A 2EILB 2OCCB 2WPDG 5C93A 3JD2A 4MS2A 4PA3A 2B5UA 3STLC 2V1DA 4WFHA 2X0LA 1VQLV 2NNUA 3UM7A 2H8PC 1GM7A 3AG2C 2W6IG 1S72V 3FB6C 3W7TA 2A0LA 3W7XA 5LHIA 2JIZG 3IC7A 2JDIG 2H94A 4H37A 4P2ZA 4WFFA 3CCSV 4PDRA 4GX1A 1M90W 1XL4A 3SPIA 1ENVA 1TUEB 1OCOB 2EINC 1AI5A 1AROP 2EIJC 5KUKA 2YEVA 2BOCC 4JTAB 3JYCA 1OHHG 3E86A 1CP9A 2EILC 1S0VA 1QLEB 2OCCC 3QO8A 4RAIA 4PDMA 1JPXA 4P9OA 3SPJA 1VQ5V 5EBMC 4MTOA 1COWG 3M99B 4KFMA 4GX2A 3CYOA 3FYIB 1NBMG 3K04A 1L1FA 1BHBA 1RM1B 4HYOA 2QM8A 3QO7A 4JPRA 4LCUC 4UVCA 3ZRXA 2ZDIA 4WFAV 3TCUA 2Q6AA 3ZIAG 2OTJV 1VQ9V 1OCOC 4P9PA 2Q67A 1WPXA 5FL7G 4QNHB 3OEEG 3ZRWB 3ABKB 1SETA 4FMTA 5DN6G 3GWOA 1KD1W 3B8NA 4P30A 1I5XA 2QKSA 3G4SV 4UVAA 1NVPD 1VQNV 5EC2C 3SPGA 1AJPA 1E1RG 1QR9A 1QLEC 2FTKA 2K1EA 3EHBB 1AR1B 2QM7A 1GO3F 4UVBA 2LP7A 3CP1A 4R8CA 3CCUV 3LUTB 4XDLA 1K5QA 3OUFA 1ROPA 2CK3G 3GB7C 1W0KG 2WLLB 4GT1A 1PL0A 5H9CA 2D3OW 4N23A 2WLKA 3BEHA 1RM1C 3CPWU 1K7DA 2LFSA 3WG7B 3OMIB 1J95A 4CBCA 1VQ7V 4MW3A 1FXVA 2P67A 4MVMA 4JASA 1SERA 5H6QA 1NJIW 3K3WA 3B77A 4WFBV 3ABKC 3SYCA 2HVJC 1GM8A 4RQEA 1PKXA 2WLMA 3KG2A 3OR6C 5E1AC 2XAHA 1P4RA 2WSSG 4ZKIA 4QPKA 4I9WA 1K4DC 5CBGA 1OCZB 3OAAG 2IH3C 2YEVB 4FJCC 3K79A 4G2KA 2B1IA 1E1QG 3IFXA 3E8GA 1NQTA 1E79G 1DF4A 3UKMA 5IYCO 3ETGA 1YITV 1KQSU 4RUFA 3K0GA 4CZZA 4JTDB 3ZMZA 2EIJB 1PNLA 3WG7C 1KP3A 4UV9A 3SJQC 1W2BU 5HFLA 3JD0A 2OT5A 3JCZA 2WLLA 3OUSA 4G27B 4FPPA 1YIJV 5KA5A 3JD4A 4WF9V 1G4YB 1DTOA 1R73A 5CBFA 3ZN0A 4U7NA 5KA6A 5LHHA 4PA7A 3OW2U 1NH2B 4FK5C 2DQ0A 1SRYA 3ZRVA 5IDJA 1QVGU 5HFMA 4JTCB 1H8HG 2IJIA 3ZRSA 3E35A 2GHYA 3ASNB 5H6RA 3CXCU 1JCHA 1OCRB 4TSFG 1OCZC 2Z5UA 2P90A 2Y69B 3DTUB 4RQFA 1QCEA 1VQMV 3E8HA 3ZMUA 1Q82W 2EIKB 3E8BA 4R50A 3AG4B 3G71V 3DGEA 2WAMA 2WLIA 4L87A 2NLJC 3ASOB 2XAFA 4JAUA 3K06A 1JOYA 3LNMB 4PDVA 1G8MA 1NVPB 2PI5A 2IU3A 2XAJA 2IW5A 3HPLC 3BY6A 3CCMV 1R6KA 2R9IA 1M57B 2DWEC 1NH2D 4PA9A 3K9AA 2ZDIC 4MVSA 3TETA 2HJFC 1EZJA 3ASNC 3LDCA 1H38A 4HZ3A 1OCRC 1ORQC 2DYRB 3W7UA 3VBBA 4EKWA 2Y69C 4LP8A 3SYOA 3VOUA 3CMAV 1RPOA 1M1KW 2EIKC 2ATKC 1FXKA 3PJSK 2DW4A 1UJWB 3LDDA 3AG4C 1NR1A 2JJ1G 3SYPA 3K03A 3ABUA 2HR3A 5L3BA 3I56V 3FYEB 3ASOC 3R65A 4JF3A 1K5SA 4YXWG 4BAYA 1K34A 4ASUG 1GMGA 5CMUA 5B1AB 2IH1C 3D36A 1MABG 5B1OA 1YTFD 4E2LA 4FIPC 1KECA 2HG5C 4R6ZA 1FFTB 3AG1B 1M57C 5IYDO 3F7VC 4TT3G 5IY5B 1YHQV 5EBLC 3OR7C 1P7BA 3ABLB 1CPYA 2DYSB 2DYRC 2Y48A 3K08A 3LDEA 1MOFA 3ZCCA 3G6EV 2EZOA 2EJRA 3OEHG 3A0RA 3CMEV 5B1BB 3CCVV 5LBQA 5L3DA 1QLNA 2M7WA 1AJNA 1FS0G 2C2AA 2P7TC 2IJJA 1S5HC 2DQ3A 2ITCC 4MTGA 4QE7A 5IYBO 5L3EA 1S3JA 4JYBA 5B1AC 1NR7A 5LHGA 1V55B 5J9PC 4BIZA 1Q7YW 1VQ6V 3CD6V 4KUMA 3W7SA 1R3IC 3NXSA 2A9HA 4MVQA 2WLIB 3ZMSA 1DF5A 3MHHC 3AG1C 4WFEA 1F4MA 5IY5C 1F51A 2R9RB 2QE7G 1JQ0A 4J9YB 3QNEA 4OXSA 1QBZA 3QO5A 5LGNA 2YSUB 1ZWIC 4WFGA 1YI2V 4GX5A 3ABLC 2DYSC 2XASA 4Z1MG 1Y66A 2X6AA 1JJ2U 2JJ2G 2ZXWB 3E83A 4R7CA 3T4ZA 2QTOA 3LSSA 2ITDC 1K92A 3FB8C 5B1BC 3ABMB 5L3GA 3OFNG 2XAGA 2P6JA 3CC4V 4PA4A 4X8AA 3ABTA 2W6JG 1F4NA 1AI6A 3H01A 3CCQV 2ZR2A 3SPHA 1FXKB 1V55C 1YJ9V 2XOKG 1XL6A 1QR8A 3K0DA 1Q86W 3AG3B 3D3IA 1RPRA 3P32A 1M56B 1SESA 3E8FA 3HB3B 2XNDG 5GW7A 3ETEA 4GX0A 2ZD9A 3RW0A 3CCRV 3OGCC 3CC7V 2MK3A 4QIWF 4ZBMA 3SYQA 3CCLV 3W7WA 1PNMA 2ZXWC 4HAMA 1I5YA 5B1NA 3WFVA 4DXWA 1SZTA 2ZR3A 2AHYA 1YJNV 1V54B 1S76D 3FB5C 1YTFB 1Y4MA 3SPCA 3ABMC 2QA4V 2X6BA 5L3FA 2JEUA 1AI7A 2JK5C 4QJFB 1VQOV 1EBOA 4LBEC 3F7YC 4MW8A 1CEZA 3B8MA 3FB7C 2Z3YA 1PNKA 1FXKC 1N8RW 1KP2A 4H33A 2B1GA 4MVZA 3OE7G 2KB1A 2A79B 4RO2A 4XDKA 2XAQA 4U7OA 1K4CC 4DO2A 1YSCA 3AG3C 5KUMA 3T2MA 1K8AW 1M56C 3E2EA 1R3LC 3OMNB 1GTOA 2Q69A 4UUJC 1K33A 3OMAB 4MTFA 4JAVA 2HKOA 3ML0A 1B6QA 2GSMB 2DWDC 3CCJV 2EBOA 1VQPV 4MVRA 4PELA 1BMFG 3TK1A 3ZJZA 4QPJA 5L3CA 1V54C 2PI4A 3ETDA 4MVUA 1THZA 1R3KC 4BIUA 1EFRG 1HWYA 1AJQA 1BL8A 1W0JG 4KP4A 1K3EA 1IXMA 1H8EG 1NKDA 2HLDG 4LC1A 4F4LA 2ZQMA 1Q81W 3SYAA 2UXNA 1K97A 4N21A 1FXHA 4TWKA 4QE9A 5B3SB 1GKFA 1R3JC 3CC2V 1OCCB 4UV8A 1QVFU 3P30A 2EIMB 2WLHA 1GK9A 5LGUA 1OZ0A 3JD3A 5DM6V 1MSWD 3RVZA 1K9MW 1R6NA 5CA3A 4XBFA 5CBHA 3MD0A 4X89A 3JD1A 3X2QB 1S77D 4UXNA 4J9ZB 1YJWV 2AHZA 4MVOA 3AEIA 2UXXA 5EBWC 4MTXA 2EZPA 4PA6A 3EFFK 1M9NA 4JGSA 3ZN1A 5BZBA 5EC1C 1PD3A 4BW5A 3T4DA 1VQKV 4GCZA 3IGAC 3OM3B 2Q68A 5CN0A 3CCEV 1JX9A 4XDJA 4WCEV 4X88A 2WLNA 1KC8W 2X7RB 2X6CA 3LSQA 1GM9A 4I5SA 4MSWC 5B3SC 1OCCC 2OTLV 1WLEA 2EIMC 2IJHA 1VQ8V 3E89A 2LFRA 1JVMA 5EK0A 3ZMTA 1K73W 4JYCA 3I55V 5LGTA 3FKSG 3X2QC 3AG2B 1BHAA 4Q20A 1VQ4V 4MT8A 3ZMVA 2JEXA 3RVYA 2HVKC 1KKDA 3ZRWA 3STZC 2F43G 1MG1A 1LNQA 3F5WC 4PDLA 2HFEC 1H2GA 3MHSC 3RBZA 3T1CA 2W0FC 1DLBA 2EINB 4G28B 2QEXV 2BOBC 2IU0A 2WWWA 2IJKA 4RUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  2WLJ A;  2HG5 C;  4R6Z A;  3AG3 C;  5KUM A;  1M57 C;  3T2M A;  1M56 C;  2WLM A;  1R3L C;  3KG2 A;  3OR6 C;  3F7V C;  5E1A C;  2Q69 A;  4PA3 A;  4MS2 A;  4UUJ C;  4XDK A;  5EBL C;  3OR7 C;  3STL C;  4MTF A;  4I9W A;  1P7B A;  1K4D C;  5CBG A;  2DYR C;  4WFH A;  3K08 A;  2IH3 C;  3LDE A;  3UM7 A;  2H8P C;  2DWD C;  3AG2 C;  4MVR A;  3FB6 C;  2A0L A;  3IFX A;  3ZJZ A;  3E8G A;  1V54 C;  3UKM A;  4MVU A;  4H37 A;  1R3K C;  4P2Z A;  4RUF A;  1BL8 A;  4WFF A;  3K0G A;  4JTD B;  3WG7 C;  3SJQ C;  2P7T C;  1S5H C;  2ITC C;  4MTG A;  4PDR A;  4GX1 A;  4QE7 A;  1XL4 A;  3SPI A;  2WLL A;  3OUS A;  5B1A C;  2EIN C;  4F4L A;  4G27 B;  5J9P C;  2EIJ C;  5KUK A;  1G4Y B;  2YEV A;  1R3I C;  2BOC C;  3SYA A;  5CBF A;  2A9H A;  4MVQ A;  2WLI B;  4PA7 A;  4TWK A;  4JTA B;  4QE9 A;  1R3J C;  3JYC A;  3AG1 C;  3E86 A;  4WFE A;  2WLH A;  2EIL C;  4JTC B;  5IY5 C;  2OCC C;  2R9R B;  3ZRS A;  4RAI A;  4J9Y B;  4OXS A;  3RVZ A;  1ZWI C;  4WFG A;  4GX5 A;  3ABL C;  4PDM A;  4P9O A;  1OCZ C;  2DYS C;  5CBH A;  3SPJ A;  4X89 A;  5EBM C;  2X6A A;  4MTO A;  3E8H A;  3E83 A;  4J9Z B;  4R7C A;  3T4Z A;  4KFM A;  2QTO A;  2ITD C;  2AHZ A;  4MVO A;  4GX2 A;  5EBW C;  3FB8 C;  5B1B C;  3E8B A;  4R50 A;  3K04 A;  3EFF K;  4PA6 A;  2WLI A;  4HYO A;  2NLJ C;  4LCU C;  4PA4 A;  5BZB A;  4X8A A;  5EC1 C;  3TCU A;  2Q6A A;  3K06 A;  3LNM B;  4PDV A;  4BW5 A;  3T4D A;  1OCO C;  4P9P A;  2Q67 A;  3IGA C;  2Q68 A;  1V55 C;  3SPH A;  4QNH B;  3HPL C;  4XDJ A;  1XL6 A;  4X88 A;  2WLN A;  3K0D A;  4P30 A;  2X6C A;  2QKS A;  4MSW C;  5B3S C;  2DWE C;  1OCC C;  3E8F A;  4PA9 A;  2EIM C;  4MVS A;  4GX0 A;  5EC2 C;  2ZD9 A;  3SPG A;  3TET A;  2HJF C;  1QLE C;  2K1E A;  3E89 A;  1JVM A;  5EK0 A;  3ASN C;  3LDC A;  3RW0 A;  4R8C A;  3OGC C;  4HZ3 A;  1OCR C;  1ORQ C;  3LUT B;  4XDL A;  4ZBM A;  3SYQ A;  3OUF A;  4EKW A;  2Y69 C;  3GB7 C;  4LP8 A;  3X2Q C;  3SYO A;  2ZXW C;  3VOU A;  2WLL B;  4DXW A;  3RVY A;  2EIK C;  2ATK C;  2HVK C;  2AHY A;  1KKD A;  3PJS K;  3FB5 C;  3LDD A;  3STZ C;  3AG4 C;  3SYP A;  2WLK A;  1LNQ A;  3ABM C;  3BEH A;  3K03 A;  2X6B A;  3F5W C;  3SPC A;  4PDL A;  2JK5 C;  2HFE C;  4LBE C;  3ASO C;  3F7Y C;  3R65 A;  4MW8 A;  1J95 A;  3FB7 C;  4CBC A;  4MW3 A;  3RBZ A;  4MVM A;  3T1C A;  2W0F C;  4G28 B;  2IH1 C;  2BOB C;  3ABK C;  4H33 A;  3SYC A;  4MVZ A;  2HVJ C;  2KB1 A;  2A79 B;  4RO2 A;  4RUE A; 
#chains in the Genus database with same CATH topology
 2WLJ A;  3ZHU A;  1AI4 A;  3CWB H;  3JD2 A;  1BGY H;  4TUY A;  2B5U A;  3S3X A;  3STL C;  1GN2 A;  2F4V B;  4GKK B;  3CEI A;  4WFH A;  2X0L A;  4FLT A;  2E5L B;  2FKX A;  3IC7 A;  2JDI G;  3AK3 A;  4J42 A;  4H37 A;  4P2Z A;  1Q8I A;  4DR6 B;  2Y4T A;  2LGW A;  1XI1 A;  1ENV A;  3HKC A;  2EIN C;  1TGO A;  1AI5 A;  3BHP A;  1XNQ B;  3TJT A;  4DV6 O;  4JTA B;  4X20 B;  3EVK A;  3JYC A;  1OHH G;  3E86 A;  4EFE A;  1CP9 A;  3RYH B;  1ZSP A;  1QLE B;  3QG5 A;  4RAI A;  4LF5 B;  2K9P A;  4P9O A;  4LF6 B;  3IJ4 A;  1AP5 A;  4MTO A;  1COW G;  1RSO A;  3M99 B;  4KFM A;  4GX2 A;  1AIL A;  1YVW A;  1JFF B;  4UCU A;  3QO7 A;  4JPR A;  3JAM N;  4LCU C;  4UVC A;  3ZRX A;  2Q6A A;  5LMU O;  4O4H A;  1HNZ B;  5TIS Z;  2Q67 A;  5IT9 N;  3L74 H;  1SET A;  1YXB A;  4P30 A;  1DGS A;  1O9H A;  2VRZ A;  1VQN V;  1KB9 F;  3EHB B;  4J11 A;  1AR1 B;  4DV0 B;  4UVB A;  3ZHQ A;  4XDL A;  2OYQ A;  4O4L A;  1U96 A;  4GT1 A;  4UCV A;  3BAB A;  4TUY B;  2ZNI A;  1K7D A;  2B9Z A;  3OMI B;  3OTO O;  3IC9 A;  4JAS A;  5H6Q A;  3DC5 A;  4JV5 O;  3A0B Z;  2HVJ C;  1GM8 A;  2WLM A;  3OR6 C;  1ZLZ A;  2VQE B;  2BTQ B;  4QPK A;  1K4D C;  4J10 A;  4FJC C;  3K79 A;  4G2K A;  1E79 G;  1YIT V;  2A7W A;  2ZE8 A;  4CZZ A;  3L75 H;  4JTD B;  1N33 O;  4JYA B;  4H44 B;  3JD0 A;  5CA0 A;  1RSO B;  3C3S A;  3OUS A;  1P84 F;  3LSU A;  2AZ0 A;  4FPP A;  5KLV H;  1R73 A;  5CBF A;  5KA6 A;  4U7N A;  2P5O A;  1IUR A;  4X66 B;  1SZX A;  3QF7 A;  4DR1 B;  3JAS A;  2UUA O;  3E35 A;  3ASN B;  4O4H B;  5AG2 A;  2DOS A;  2CTR A;  4CS2 A;  2H3O A;  5LL6 Y;  4R50 A;  5D5P A;  3G71 V;  5JJJ B;  5LA6 B;  2A3Q A;  3CRC A;  4DR5 B;  1RFY A;  4JI4 O;  4O4L B;  2QWP B;  3K06 A;  1JOY A;  3LNM B;  2DWE C;  5GON A;  4FVM A;  4IL6 Z;  1NH2 D;  3LDC A;  1H38 A;  2FML A;  3VBB A;  4ABM A;  2W0X A;  1M1K W;  2EIK C;  3LDD A;  3AG4 C;  2JJ1 G;  3AG7 A;  3SYP A;  3OD4 A;  2F1M A;  4YXW G;  1VMG A;  4NXN B;  4JI2 O;  5CMU A;  2IH1 C;  1BQZ A;  4B3S B;  4O2B A;  1QQC A;  2HG5 C;  4R6Z A;  5LYJ A;  4DV4 O;  1M57 C;  1NTM H;  2E3C A;  2YI9 A;  2AXT Z;  2QWQ B;  3F7V C;  4TT3 G;  2UU9 B;  5IYZ A;  3OR7 C;  2UXD O;  1P7B A;  1CPY A;  2DYS B;  3LDE A;  5KHJ A;  3G6E V;  1SQQ H;  3CME V;  3JAS B;  5J2T A;  2YC0 A;  4FM1 A;  1FS0 G;  4K0K B;  5C8Y B;  2DQ3 A;  2ITC C;  4QE7 A;  3JCU Z;  1AB3 A;  5B1A C;  2QDO A;  3K58 A;  5J9P C;  3I5D A;  3ZHR A;  2Q7G A;  1IZ3 A;  1DF5 A;  3MHH C;  3RGB A;  4DV2 O;  3AG1 C;  1Q43 A;  1F4M A;  2QE7 G;  1JQ0 A;  2XAS A;  5KAI Z;  2JJ2 G;  4PI0 A;  5IJ0 A;  3E83 A;  1B04 A;  4GZR B;  1K92 A;  1AR5 A;  5GON B;  4QGP A;  5B1B C;  2DMX A;  3OFN G;  4K8X A;  2P6J A;  3CC4 V;  4X8A A;  2KKW A;  2W6J G;  4UB8 Z;  2ZR2 A;  4B3M O;  3K0D A;  4DR3 B;  4OX9 B;  3FX7 A;  3D3I A;  1M56 B;  2CGN A;  2E76 B;  5FLX N;  5BMV A;  2VS0 A;  4FLY A;  4QIW F;  4PI2 A;  2ZNJ A;  4ZBM A;  4DW0 A;  3W7W A;  4O2B B;  4DRX A;  2ZXW C;  4AHC A;  4HAM A;  5LYJ B;  2QTS A;  1KBH A;  5B1N A;  2AHY A;  2YDE A;  5IYZ B;  2QA4 V;  2JK5 C;  1EBO A;  3F7Y C;  3CRQ A;  1CEZ A;  3K5L A;  4CH6 A;  4JI3 B;  2JS5 A;  1PNK A;  4FM0 A;  3HKE A;  5JJE B;  1N8R W;  1KP2 A;  5J2T B;  2OIG A;  4XDK A;  4DO2 A;  2F95 B;  3T2M A;  3HR0 A;  1GTO A;  1XMO O;  1L0L H;  2CGO A;  3CXH F;  1SQG A;  2Q0A A;  4BR6 A;  1B6Q A;  2DWD C;  2CDY A;  2EBO A;  2Y0P A;  3ETD A;  4MVU A;  1R3K C;  4BIU A;  1EFR G;  1SQP H;  1W0J G;  1H8E G;  1GN4 A;  5IJ0 B;  3QVN A;  3JAK A;  4PJ0 Z;  2QKA A;  4LC1 A;  2ZQM A;  2V4D A;  2XUM A;  2UXN A;  3TGU H;  4UV8 A;  3P30 A;  2EIM B;  2WLH A;  4C7U A;  5LGU A;  1YCI A;  3J7A U;  4XBF A;  3MD0 A;  2YXL A;  3JD1 A;  2JRI A;  1DK1 A;  2Y0I A;  2AHZ A;  2ZIM A;  1BCC H;  4JI6 O;  2EZP A;  3EFF K;  2VWK A;  5BMV B;  3C3T A;  4DRX B;  1MZF A;  3R66 A;  3L72 H;  2QWO B;  1PD3 A;  1Y67 A;  1ZTE A;  3T4D A;  3IGA C;  2Q68 A;  2GV9 A;  5KHI A;  2HJD A;  2F4V O;  4GKK O;  4CC6 A;  3LSQ A;  1GM9 A;  2F23 A;  4I5S A;  2E5L O;  2OTL V;  4DR4 B;  4X65 B;  1VQ8 V;  4FZ0 A;  5GTH Z;  2GBO A;  2Q73 A;  5EK0 A;  3BA8 A;  3I55 V;  4AIL C;  4JI7 B;  1D2D A;  2RMK B;  1BHA A;  1URF A;  3P3P A;  4NVP A;  3VQY A;  4LF8 O;  4NB5 A;  3ZRW A;  3STZ C;  1HR0 B;  4ZI7 A;  1H2G A;  1O9G A;  1XNQ O;  3MHS C;  1A32 A;  3RBZ A;  1XNR O;  2EIN B;  5CB4 B;  2BOB C;  4TQD A;  1H2S B;  1XHX A;  4LF6 O;  3K5M A;  3F5T A;  3ZHT A;  2WPD G;  4MS2 A;  3JAK B;  2GDS A;  1MSD A;  5EZY A;  4O2A A;  3OT7 A;  4DR7 B;  1S72 V;  3FB6 C;  3W7T A;  3W7X A;  1W59 A;  3UO3 A;  3N27 A;  2JIZ G;  1HNZ O;  5GTI Z;  3BVO A;  1VF6 A;  3CCS V;  2OWO A;  4PDR A;  1XL4 A;  1TUE B;  3ICX A;  2QR4 A;  3SDL A;  2UXC B;  5KUK A;  4DV0 O;  2BOC C;  2WA3 A;  5LP6 C;  2Q9L A;  3VQW A;  5J2U A;  4IHJ A;  2EIL C;  2OCC C;  4PDM A;  1R1B A;  5EBM C;  1Q5O A;  3BAA A;  5ITZ B;  1WP7 A;  4O4J A;  3K04 A;  3H1K H;  3JAR A;  1N0N A;  2VWJ A;  3M8A A;  5FPR A;  4O4I A;  3TCU A;  2YUA A;  1PP9 H;  2LQT A;  4CH5 A;  2VQE O;  1VQ9 V;  5FL7 G;  4QNH B;  3ZRW B;  2HHH O;  1TAE A;  3CSX A;  3K9S A;  4ZI7 B;  4BWA A;  4UVA A;  4IGG A;  1IBM O;  5EC2 C;  3SPG A;  1AJP A;  2A06 H;  4K8Z A;  4U3J A;  1BS3 A;  1GO3 F;  2LP7 A;  2D2C B;  3OUF A;  2KQX A;  2RQ6 A;  1SQB H;  4J80 A;  4X20 A;  2WLL B;  4H13 B;  3B40 A;  1IBL O;  3RYH A;  2D3O W;  4N23 A;  2NN4 A;  1RM1 C;  1HNX O;  3U0Z A;  5IJ9 A;  2N04 A;  5EZY B;  3LNN A;  4O2A B;  1VQ7 V;  4X66 O;  2P67 A;  4MVM A;  1SER A;  1NJI W;  4LF9 O;  5FPO A;  4WFB V;  1JFF A;  4ZOL B;  3SYC A;  4BIO A;  1PKX A;  3KG2 A;  4DYL A;  5E1A C;  2XAH A;  5EIB C;  1N32 B;  2WSS G;  1SF9 A;  2YXY A;  2IBZ H;  4L8J A;  2B1I A;  1X4T A;  5J2U B;  4IHJ B;  1DF4 A;  1N34 B;  3ETG A;  4RUF A;  4W4L A;  3K0G A;  1AP6 A;  2EIJ B;  3WG7 C;  3ZMZ A;  3SJQ C;  2QSA A;  3BA9 A;  4O4J B;  4F6E A;  3ZN0 A;  5LHH A;  1NH2 B;  4GKJ O;  4PHZ A;  1PPJ H;  3JAR B;  2P06 A;  4FM2 A;  2DQ0 A;  1SRY A;  4O4I B;  4JTC B;  1H8H G;  4LFB B;  2BSK A;  3CXC U;  1JCH A;  4TSF G;  2ADP A;  3DTU B;  1QCE A;  4JI1 B;  1Q6H A;  1Q82 W;  2EIK B;  4I0X A;  4LH7 A;  3AG4 B;  2WAM A;  2WLI A;  4U3J B;  2BTQ A;  4B3S O;  1BE3 H;  4NTX A;  4TV9 B;  1AR4 A;  1NVP B;  2IU3 A;  2XAJ A;  3BY6 A;  3CCM V;  2R9I A;  1M57 B;  5IJ9 B;  3K9A A;  4I55 A;  2ZDI C;  2HJF C;  2PYJ A;  1P49 A;  5A2Q N;  4HZ3 A;  1OCR C;  1ORQ C;  1OV9 A;  1VAR A;  3W7U A;  3WB1 A;  2Y69 C;  1J5E O;  3SYO A;  3VOU A;  3T1Y B;  3CMA V;  2DW4 A;  4YJ3 A;  1QHT A;  3K03 A;  2E74 B;  3R65 A;  1K34 A;  2Q5Z A;  4ASU G;  5B1A B;  5B1O A;  1YTF D;  2Q7H A;  4FIP C;  2CTW A;  1N36 B;  2E75 B;  5LA6 A;  1Y74 B;  3SR2 C;  4YJ2 A;  4LF4 B;  3AG1 B;  5EYP A;  2QJ1 A;  3RYF A;  3U10 A;  1YDX A;  1YHQ V;  5EBL C;  5IE9 A;  2P4V A;  2DYR C;  1JR9 A;  3K08 A;  3CE2 A;  4IIJ A;  5B1B B;  3JAT A;  1FKA O;  4ZHQ A;  1VIB A;  2BSK B;  1QLN A;  4JI5 O;  2M7W A;  1BSM A;  2C2A A;  4DR3 O;  4LFA B;  4OX9 O;  2IJJ A;  2UUB B;  5L3E A;  5IYB O;  4JYB A;  4PD4 F;  3CS5 A;  3G67 A;  5LHG A;  4I0X B;  2ZE7 A;  1Q7Y W;  4BIZ A;  3CD6 V;  5KHH A;  4KUM A;  1R3I C;  1AVM A;  2YXH A;  4MVQ A;  2WLI B;  2YID A;  5IY5 C;  1F51 A;  4YHH B;  3RT3 C;  4J9Y B;  5LGN A;  1YI2 V;  3ABL C;  2X6A A;  1JJ2 U;  2ZXW B;  4R7C A;  2QTO A;  3LSS A;  2ITD C;  4B3T B;  4I55 B;  4JI3 O;  4I4T A;  2GTA A;  3H1H H;  4YIO A;  2GUZ B;  4PA4 A;  2QM4 A;  4LFC O;  3CCQ V;  1I7F A;  1NS1 A;  3SPH A;  3JAL A;  4DUZ B;  4YJ3 B;  3P32 A;  3E8F A;  2AW9 A;  3HB3 B;  5GW7 A;  2FL4 A;  5C8Y A;  3OGC C;  5H2F Z;  1PNM A;  1WB7 A;  2P4K A;  1FFX A;  4YJ2 B;  5EYP B;  3RYF B;  1JJO A;  1Y4M A;  4OPA A;  1Q3E A;  2JEU A;  3RYI A;  1VQO V;  1WNS A;  3FB7 C;  4EB6 A;  3T1H O;  4IIJ B;  3JAT B;  2RJZ A;  3OE7 G;  4ZHQ B;  4DV5 B;  1YSC A;  3WB0 A;  3DXR B;  1R3L C;  3G6B A;  3OMN B;  3OMA B;  4MTF A;  1S5L Z;  4JAV A;  1KUQ A;  2HKO A;  1SS3 A;  1XOU A;  2ILM A;  4NXM O;  4CS4 A;  1L0N H;  4QPJ A;  2PI4 A;  5LP6 A;  3J80 N;  1XBL A;  5IWA B;  1YEW A;  4KP4 A;  2HLD G;  4DR4 O;  4X65 O;  1Q81 W;  3BCC H;  4I4T B;  1K97 A;  1FXH A;  4TWK A;  4QE9 A;  1SC5 B;  1LUW A;  1GK9 A;  3VQV A;  4UCO A;  4DV3 O;  3JAL B;  1S77 D;  3UT5 A;  4J9Z B;  4MVO A;  3AEI A;  5EBW C;  4DUY O;  4MTX A;  3HKD B;  4UCT A;  4X64 O;  1M9N A;  4KHP B;  3OGI B;  3ZHV A;  4JGS A;  2RNB A;  5BZB A;  5EC1 C;  4KL1 A;  1LUV A;  4LF7 B;  1SA0 B;  1VQK V;  4GCZ A;  1FFX B;  1FJG B;  1JX9 A;  4XDJ A;  4X88 A;  4NYK A;  3RYI B;  5B3S C;  4JI8 B;  3A8T A;  2YIB D;  1OCC C;  4GYC B;  4DR7 O;  4EB6 B;  3ZMT A;  2KG7 A;  2LW7 A;  5LGT A;  3CB2 A;  3A2F A;  3FKS G;  4UFZ A;  4MT8 A;  1NT2 B;  2JEX A;  3KKY A;  2HVK C;  4FLU A;  2Z0A A;  1KMI Z;  2FYU H;  1VEW A;  3C90 A;  2AGA A;  1DLB A;  4G28 B;  2P22 C;  4OGQ B;  4X62 B;  2WWW A;  3S3W A;  2IJK A;  5LP6 B;  1F23 A;  3ZX6 A;  2EIL B;  2OCC B;  5C93 A;  4PA3 A;  1FD9 A;  1VQL V;  4JV5 B;  2H8P C;  1FAF A;  2A0L A;  5FNV A;  1B3Q A;  1IVS A;  2H94 A;  2N74 A;  3APO A;  1I94 B;  4WFF A;  2JS3 A;  5JQG A;  1XIL A;  4DV1 B;  3UT5 B;  3SPI A;  1ARO P;  4FLX A;  3EXA A;  3TXQ A;  1S0V A;  3QO8 A;  1FPO A;  2HP8 A;  1N33 B;  4CC5 A;  5CB4 A;  4X1I A;  4Z1V A;  3SPJ A;  4DK1 A;  2CTQ A;  3CJH A;  1UPG A;  3CYO A;  1L1F A;  1RM1 B;  2Y4U A;  4HYO A;  2QM8 A;  2KG7 B;  2UUA B;  2ZDI A;  2OTJ V;  4ZIB A;  3P3N A;  1OCO C;  1WPX A;  3OEE G;  2QGN A;  1XMQ O;  1KD1 W;  1MA1 A;  3AK2 A;  2ETN A;  1EN6 A;  2K1E A;  2QM7 A;  4JI4 B;  4R8C A;  2RN9 A;  3MAQ A;  1N34 O;  1ROP A;  2CK3 G;  3GB7 C;  2M6Y A;  5JWP A;  4DV7 O;  1W0K G;  2ZT9 B;  1G6U A;  3CPW U;  3WG7 B;  4MW3 A;  1XEQ A;  5ITZ A;  2UUC B;  3K3W A;  5FNV B;  4LFB O;  3ABK C;  4JI1 O;  1XQ8 A;  1P4R A;  4DR6 O;  5JQG B;  3CRM A;  4ZKI A;  4I9W A;  5CBG A;  1XRE A;  1Q90 D;  3B09 A;  3E8G A;  1NQT A;  1TVK A;  2R72 A;  3UKM A;  1GRJ A;  5IYC O;  1HNW B;  4X1I B;  1PNL A;  2UXD B;  4LF5 O;  1I0H A;  5HFL A;  2F66 C;  3CJH B;  2WLL A;  1YIJ V;  5KA5 A;  3JD4 A;  4WF9 V;  4PA7 A;  3U11 A;  3OW2 U;  1D5N A;  2PTM A;  3ZRV A;  5IDJ A;  2HEP A;  1JA8 A;  5H6R A;  3ZBH A;  1OCR B;  1ZX3 A;  1OCZ C;  3A0H Z;  2P90 A;  2Y69 B;  4ZOL A;  1VQM V;  3E8H A;  3ZMU A;  3E8B A;  5LOV B;  3DGE A;  4DV2 B;  3CX5 F;  2L6L A;  4L87 A;  2NLJ C;  1IBK B;  4H0L B;  4LF4 O;  5KMG A;  2IW5 A;  3HPL C;  1SQV H;  5BR8 B;  1R6K A;  2XTA A;  4PA9 A;  1NI8 A;  4MVS A;  1N4C A;  1ZAU A;  2CE4 A;  1XUQ A;  2DYR B;  4EKW A;  2YIA A;  4B3M B;  2F93 B;  2OCH A;  5KHK A;  1RPO A;  4I50 A;  1NR1 A;  1GN6 A;  3K5N A;  3ASO C;  1K5S A;  2R70 A;  1IX9 A;  1MAB G;  4LNU A;  4J7J A;  1EZV H;  1TVK B;  1YF2 A;  2UXB B;  4TV9 A;  1F7Y A;  5IYD O;  2JVD A;  3H9V A;  5IY5 B;  2KSD A;  4Z2W A;  2PUS A;  4JYA O;  3ABL B;  4YIP A;  2L35 A;  3APQ A;  3B2E E;  1MOF A;  3ZCC A;  1M5I A;  3OEH G;  3A0R A;  1IDS A;  3CCV V;  5L3D A;  3SJC C;  1S5J A;  4TV8 A;  4DR1 O;  4WBN B;  4Q6G A;  1AJN A;  4AI8 A;  2P7T C;  4J7Z A;  3K57 A;  2YI8 A;  1VQ6 V;  3W7S A;  3NXS A;  5JJN B;  4WFE A;  4GLX A;  3KCX A;  2EJ7 A;  3DSQ A;  3N2G A;  4DR5 O;  2EUL A;  5KMG B;  4OXS A;  3QO5 A;  2YSU B;  4GX5 A;  4Z1M G;  1Y74 A;  2ZM6 B;  1HW7 A;  1PM9 A;  3H1J H;  4IT5 A;  1SQX H;  4X9Q A;  2XAG A;  4NTY A;  4DV5 O;  5KX5 B;  1F4N A;  1AI6 A;  4I50 B;  4B3R B;  1V55 C;  1YJ9 V;  4KXR A;  1XL6 A;  4JYY A;  4JI6 B;  1Q86 W;  2Q4P A;  1LR1 A;  1RPR A;  1H2L A;  2XND G;  3RW0 A;  3CCR V;  4LNU B;  2MK3 A;  4NXN O;  3CCL V;  2XT9 A;  5IWA O;  3WFV A;  2BE3 A;  4RWU A;  2ZR3 A;  5CA1 B;  1YJN V;  3SPC A;  3ABM C;  4QJF B;  2UU9 O;  4MW8 A;  1Q6U A;  3B8M A;  2Z3Y A;  2YS8 A;  5D5Q A;  4DR2 B;  1FXK C;  4H33 A;  4MVZ A;  5JCO C;  4LF8 B;  3QTC A;  4TV8 B;  2XAQ A;  4U7O A;  1XHZ A;  3ZED A;  3AG3 C;  1K8A W;  2GUZ A;  3AK1 A;  4B7E A;  4AQY B;  2QWR B;  3RFR A;  4K0K O;  3UQ8 A;  1XNR B;  3D36 C;  4KHP O;  4PV1 B;  3ML0 A;  4BW9 A;  1KKC A;  4PEL A;  1BMF G;  3TK1 A;  3ZJZ A;  5L3C A;  4LF7 O;  1V54 C;  3N2G B;  1US6 A;  1FJG O;  3FD9 A;  1NU1 H;  1AJQ A;  1IXM A;  1NKD A;  4TOI A;  4JI8 O;  2VQF B;  1EN4 A;  4F4L A;  4FLV A;  1KYO F;  4N21 A;  5B3S B;  3CC2 V;  1OCC B;  3JSL A;  3PN1 A;  3JD3 A;  5DM6 V;  1R6N A;  5CA3 A;  4OPH A;  5CBH A;  1Z5V A;  4X89 A;  4IYH A;  4X1K A;  4UXN A;  3DXR A;  3KZI Z;  3B4S A;  1VP7 A;  5KHG A;  4PA6 A;  4FFK A;  4JI0 B;  1BQ0 A;  3CRR A;  4X62 O;  1M93 A;  2Q0O C;  1WN7 A;  2DJV A;  4LWS A;  3ZN1 A;  5LMN B;  2ADQ B;  5CN0 A;  3VQX A;  3RN4 A;  1WP8 A;  2X7R B;  1H2M A;  5BXZ A;  1CXZ B;  4D7S A;  4F6R A;  1Y6X A;  1WLE A;  3E89 A;  2LFR A;  1K73 W;  4JZG A;  3NR7 A;  3X2Q C;  1I94 O;  3H1I H;  1VQ4 V;  2HHH B;  2CUG A;  3HKC B;  3ZMV A;  4NR1 A;  1KKD A;  4DV1 O;  1MG1 A;  2ZE6 A;  3F5W C;  1IBM B;  4X1Y A;  5B5E Z;  2PZS A;  2W0F C;  3HKD A;  3K59 A;  1N0J A;  2IU0 A;  1IBL B;  1GAX A;  2ODM A;  2LGQ A;  1HNX B;  2V7Q G;  1SA0 A;  3H1L H;  2V1D A;  4JAA A;  1VF6 C;  2NNU A;  4LF9 B;  3UM7 A;  1GM7 A;  3AG2 C;  3RYC A;  2W6I G;  3FFQ A;  5LHI A;  1ZL8 A;  1TA8 A;  2QWN B;  4ICG A;  2ARH A;  4U3F H;  2R9A A;  4GX1 A;  4X1K B;  1M90 W;  4YY3 B;  1OCO B;  1Z5W A;  2EIJ C;  2YEV A;  3HKB A;  3JSN A;  4LWS B;  1PV0 A;  1IXB A;  2WA4 A;  4EFB A;  3L73 H;  1H2K A;  3BRC A;  1JPX A;  4EEQ A;  1VQ5 V;  4GKJ B;  4F6R B;  3FYI B;  1NBM G;  2UUC O;  1BHB A;  1RP3 B;  1X59 A;  4JZ2 A;  4CH3 A;  4CS3 A;  1NZ6 A;  1T5E A;  5JH7 A;  4WFA V;  3ZIA G;  3L9D A;  4JI7 O;  4P9P A;  4W4K A;  3ABK B;  4FMT A;  5DN6 G;  5LXT A;  3ZHS A;  3GWO A;  3B8N A;  5K1X A;  1I5X A;  2IM9 A;  4B7K A;  1HR0 O;  2QKS A;  4X1Y B;  3G4S V;  1NVP D;  2CTP A;  1E1R G;  1QR9 A;  1QLE C;  2FTK A;  1HDJ A;  2LO1 A;  3CP1 A;  3CCU V;  1I08 A;  3LUT B;  4DV6 B;  1K5Q A;  2ZKO A;  1HNW O;  5CA0 B;  2BCC H;  1Y76 A;  1PL0 A;  1BZK A;  3D8C A;  5H9C A;  4UCR A;  2WLK A;  3BEH A;  2LFS A;  1J95 A;  4CBC A;  1FXV A;  3RYC B;  5B66 Z;  1J5E B;  1M4U A;  1ZL8 B;  3B77 A;  4DW1 A;  4UCS A;  3WU2 Z;  3FAV A;  4RQE A;  1QU7 A;  4D6T H;  5LMU B;  5A9G A;  1HP8 A;  3CHX A;  1OCZ B;  3OAA G;  3Q4H A;  4E4E A;  2IH3 C;  2YEV B;  3HKB B;  3WB2 A;  2UXC O;  1IBK O;  4DK0 A;  1E1Q G;  2ZE5 A;  1WJZ A;  3IFX A;  3E22 A;  1MZE A;  4LH6 A;  1KQS U;  4LR3 A;  5BR8 O;  1KU9 A;  4UB6 Z;  1KP3 A;  4UV9 A;  1W2B U;  2OT5 A;  3JCZ A;  2AZ2 A;  4D7T A;  1L8D A;  4G27 B;  1G4Y B;  2CAZ C;  1DTO A;  1OJH A;  3OTO B;  3BPZ A;  4FK5 C;  2YIC A;  1QVG U;  5HFM A;  5JH7 B;  4JI5 B;  2IJI A;  3ZRS A;  2GHY A;  1MNG A;  4NTW A;  2Z5U A;  3GVM A;  4RQF A;  5LXT B;  3D3Q A;  4J41 A;  4FLW A;  2ZIO A;  3CRA A;  2CH7 A;  2RDC A;  3ASO B;  2XAF A;  2UXB O;  4K3A A;  4JAU A;  2JGD A;  4PDV A;  1Y76 B;  1G8M A;  2PI5 A;  3IAY A;  1P7G A;  3N2K A;  3UCS C;  1UFI A;  3SJB C;  2FB5 A;  3TET A;  1EZJ A;  3JAW A;  3ASN C;  3SJA C;  4LFC B;  4LP8 A;  1WA8 A;  3FAV B;  2ATK C;  1FXK A;  1QNM A;  3KCY A;  3DC6 A;  3PJS K;  1UJW B;  5JCO A;  3ABU A;  2HR3 A;  5L3B A;  3I56 V;  1N32 O;  3FYE B;  3Q4H B;  4JF3 A;  4BAY A;  1GMG A;  3D36 A;  4E2L A;  5LOV A;  3E22 B;  2PYL A;  1KEC A;  2GTS A;  1FFT B;  3UO2 A;  1WB8 A;  2LJ2 A;  2ZM6 O;  2XHB A;  4CH4 A;  1H2N A;  2Y48 A;  3T1H B;  4HBN A;  1XDC A;  4HNA A;  2EZO A;  2EJR A;  1VF5 B;  2OIE A;  5LBQ A;  3TXS A;  4B3R O;  4IYI A;  1S5H C;  4MTG A;  1S3J A;  1NR7 A;  2MW2 B;  1BT8 A;  1V55 B;  3G80 A;  4NXM B;  5DED A;  2A9H A;  3ZMS A;  2QKC A;  4JI2 B;  2CH7 B;  2JGD B;  2R9R B;  3QNE A;  1QBZ A;  1G1X B;  2BTO A;  1ZWI C;  4WFG A;  2DYS C;  4FFB A;  3N2K B;  4DV4 B;  1Y66 A;  3L70 H;  3T4Z A;  1WPB A;  2O57 A;  3FB8 C;  1EM1 A;  3HKE B;  3J81 N;  2LW1 A;  4DR2 O;  3ABM B;  2DE0 X;  5JVD A;  5L3G A;  3JAW B;  4NKG B;  4DV3 B;  3ABT A;  1WA8 B;  1PL4 A;  4AQY O;  3H01 A;  4FZ1 A;  1FXK B;  2XOK G;  3T1Y O;  1QR8 A;  4DUY B;  5E79 Z;  4X64 B;  4WBN A;  3AG3 B;  1SES A;  2JGU A;  2N05 A;  5K1P A;  3ETE A;  4GX0 A;  1JMK C;  2ZD9 A;  4TQF A;  1B06 A;  3CC7 V;  3SYQ A;  2ZCE A;  1FYJ A;  3BFR A;  1I5Y A;  1MMM A;  5F2V O;  4I9Q A;  4DXW A;  1N36 O;  1SZT A;  1V54 B;  1S76 D;  3FB5 C;  3OTF A;  2VQF O;  2DN9 A;  1YTF B;  2X6B A;  5L3F A;  1AI7 A;  4LBE C;  4K35 A;  4HNA B;  2PGG A;  5DEC A;  1YZB A;  2B1G A;  5KAF Z;  2KB1 A;  2A79 B;  1V9P A;  4RO2 A;  1EN5 A;  1K4C C;  5KUM A;  1M56 C;  5KX5 A;  4I7Z B;  3E2E A;  5H5N A;  2Q69 A;  4UUJ C;  1K33 A;  2Q7E A;  4LFA O;  3M7M X;  2UUB O;  4JI0 O;  2PF4 E;  2GSM B;  3MDS A;  3CCJ V;  1VQP V;  4MVR A;  5LMN O;  1TUB A;  1THZ A;  1HWY A;  1BL8 A;  2RCV A;  4YHH O;  2NR5 A;  1K3E A;  1WAZ A;  4FFB B;  3K5O A;  5CA1 A;  4B08 A;  1SQF A;  4B3T O;  3SYA A;  5JVD B;  1Z2G A;  1GKF A;  1R3J C;  3ETQ A;  1QVF U;  3GWK C;  1OZ0 A;  1NTK H;  1MSW D;  1R6T A;  3RVZ A;  4FLZ A;  1K9M W;  1VF7 A;  1ZUQ A;  4J7K A;  3X2Q B;  4DUZ O;  1YJW V;  3O65 A;  2UXX A;  1XMO B;  2ZIN A;  3THO A;  1SKV A;  4A5U B;  4BW5 A;  3OM3 B;  3CCE V;  1U97 A;  4WCE V;  1KC8 W;  2WLN A;  2X6C A;  1Q6I A;  4MSW C;  1D5A A;  1GH6 A;  2Q8V A;  2EIM C;  2IJH A;  5BY1 A;  1GN3 A;  1JVM A;  1NTZ H;  4GUN A;  4JYC A;  2YIB A;  3AG2 B;  4Q20 A;  3ZS8 C;  5EIB D;  3RVY A;  1XMQ B;  4YY3 O;  3L71 H;  2F43 G;  1LNQ A;  4PDL A;  2HFE C;  2G38 A;  2PY5 A;  3T1C A;  3SGI A;  2QEX V;  2EX3 A;  3RWR D;  4DV7 B;  3O9O A;  1TUB B;  4RUE A; 
#chains in the Genus database with same CATH homology
 2WLJ A;  1F23 A;  2V7Q G;  1AI4 A;  2EIL B;  2OCC B;  2WPD G;  5C93 A;  3JD2 A;  4MS2 A;  4PA3 A;  2B5U A;  3STL C;  2V1D A;  4WFH A;  2X0L A;  1VQL V;  2NNU A;  3UM7 A;  2H8P C;  1GM7 A;  3AG2 C;  2W6I G;  1S72 V;  3FB6 C;  3W7T A;  2A0L A;  3W7X A;  5LHI A;  2JIZ G;  3IC7 A;  2JDI G;  2H94 A;  4H37 A;  4P2Z A;  4WFF A;  3CCS V;  4PDR A;  4GX1 A;  1M90 W;  1XL4 A;  3SPI A;  1ENV A;  1TUE B;  1OCO B;  2EIN C;  1AI5 A;  1ARO P;  2EIJ C;  5KUK A;  2YEV A;  2BOC C;  4JTA B;  3JYC A;  1OHH G;  3E86 A;  1CP9 A;  2EIL C;  1S0V A;  1QLE B;  2OCC C;  3QO8 A;  4RAI A;  4PDM A;  1JPX A;  4P9O A;  3SPJ A;  1VQ5 V;  5EBM C;  4MTO A;  1COW G;  3M99 B;  4KFM A;  4GX2 A;  3CYO A;  3FYI B;  1NBM G;  3K04 A;  1L1F A;  1BHB A;  1RM1 B;  4HYO A;  2QM8 A;  3QO7 A;  4JPR A;  4LCU C;  4UVC A;  3ZRX A;  2ZDI A;  4WFA V;  3TCU A;  2Q6A A;  3ZIA G;  2OTJ V;  1VQ9 V;  1OCO C;  4P9P A;  2Q67 A;  1WPX A;  5FL7 G;  4QNH B;  3OEE G;  3ZRW B;  3ABK B;  1SET A;  4FMT A;  5DN6 G;  3GWO A;  1KD1 W;  3B8N A;  4P30 A;  1I5X A;  2QKS A;  3G4S V;  4UVA A;  1NVP D;  1VQN V;  5EC2 C;  3SPG A;  1AJP A;  1E1R G;  1QR9 A;  1QLE C;  2FTK A;  2K1E A;  3EHB B;  1AR1 B;  2QM7 A;  1GO3 F;  4UVB A;  2LP7 A;  3CP1 A;  4R8C A;  3CCU V;  3LUT B;  4XDL A;  1K5Q A;  3OUF A;  1ROP A;  2CK3 G;  3GB7 C;  1W0K G;  2WLL B;  4GT1 A;  1PL0 A;  5H9C A;  2D3O W;  4N23 A;  2WLK A;  3BEH A;  1RM1 C;  3CPW U;  1K7D A;  2LFS A;  3WG7 B;  3OMI B;  1J95 A;  4CBC A;  1VQ7 V;  4MW3 A;  1FXV A;  2P67 A;  4MVM A;  4JAS A;  1SER A;  5H6Q A;  1NJI W;  3K3W A;  3B77 A;  4WFB V;  3ABK C;  3SYC A;  2HVJ C;  1GM8 A;  4RQE A;  1PKX A;  2WLM A;  3KG2 A;  3OR6 C;  5E1A C;  2XAH A;  1P4R A;  2WSS G;  4ZKI A;  4QPK A;  4I9W A;  1K4D C;  5CBG A;  1OCZ B;  3OAA G;  2IH3 C;  2YEV B;  4FJC C;  3K79 A;  4G2K A;  2B1I A;  1E1Q G;  3IFX A;  3E8G A;  1NQT A;  1E79 G;  1DF4 A;  3UKM A;  5IYC O;  3ETG A;  1YIT V;  1KQS U;  4RUF A;  3K0G A;  4CZZ A;  4JTD B;  3ZMZ A;  2EIJ B;  1PNL A;  3WG7 C;  1KP3 A;  4UV9 A;  3SJQ C;  1W2B U;  5HFL A;  3JD0 A;  2OT5 A;  3JCZ A;  2WLL A;  3OUS A;  4G27 B;  4FPP A;  1YIJ V;  5KA5 A;  3JD4 A;  4WF9 V;  1G4Y B;  1DTO A;  1R73 A;  5CBF A;  3ZN0 A;  4U7N A;  5KA6 A;  5LHH A;  4PA7 A;  3OW2 U;  1NH2 B;  4FK5 C;  2DQ0 A;  1SRY A;  3ZRV A;  5IDJ A;  1QVG U;  5HFM A;  4JTC B;  1H8H G;  2IJI A;  3ZRS A;  3E35 A;  2GHY A;  3ASN B;  5H6R A;  3CXC U;  1JCH A;  1OCR B;  4TSF G;  1OCZ C;  2Z5U A;  2P90 A;  2Y69 B;  3DTU B;  4RQF A;  1QCE A;  1VQM V;  3E8H A;  3ZMU A;  1Q82 W;  2EIK B;  3E8B A;  4R50 A;  3AG4 B;  3G71 V;  3DGE A;  2WAM A;  2WLI A;  4L87 A;  2NLJ C;  3ASO B;  2XAF A;  4JAU A;  3K06 A;  1JOY A;  3LNM B;  4PDV A;  1G8M A;  1NVP B;  2PI5 A;  2IU3 A;  2XAJ A;  2IW5 A;  3HPL C;  3BY6 A;  3CCM V;  1R6K A;  2R9I A;  1M57 B;  2DWE C;  1NH2 D;  4PA9 A;  3K9A A;  2ZDI C;  4MVS A;  3TET A;  2HJF C;  1EZJ A;  3ASN C;  3LDC A;  1H38 A;  4HZ3 A;  1OCR C;  1ORQ C;  2DYR B;  3W7U A;  3VBB A;  4EKW A;  2Y69 C;  4LP8 A;  3SYO A;  3VOU A;  3CMA V;  1RPO A;  1M1K W;  2EIK C;  2ATK C;  1FXK A;  3PJS K;  2DW4 A;  1UJW B;  3LDD A;  3AG4 C;  1NR1 A;  2JJ1 G;  3SYP A;  3K03 A;  3ABU A;  2HR3 A;  5L3B A;  3I56 V;  3FYE B;  3ASO C;  3R65 A;  4JF3 A;  1K5S A;  4YXW G;  4BAY A;  1K34 A;  4ASU G;  1GMG A;  5CMU A;  5B1A B;  2IH1 C;  3D36 A;  1MAB G;  5B1O A;  1YTF D;  4E2L A;  4FIP C;  1KEC A;  2HG5 C;  4R6Z A;  1FFT B;  3AG1 B;  1M57 C;  5IYD O;  3F7V C;  4TT3 G;  5IY5 B;  1YHQ V;  5EBL C;  3OR7 C;  1P7B A;  3ABL B;  1CPY A;  2DYS B;  2DYR C;  2Y48 A;  3K08 A;  3LDE A;  1MOF A;  3ZCC A;  3G6E V;  2EZO A;  2EJR A;  3OEH G;  3A0R A;  3CME V;  5B1B B;  3CCV V;  5LBQ A;  5L3D A;  1QLN A;  2M7W A;  1AJN A;  1FS0 G;  2C2A A;  2P7T C;  2IJJ A;  1S5H C;  2DQ3 A;  2ITC C;  4MTG A;  4QE7 A;  5IYB O;  5L3E A;  1S3J A;  4JYB A;  5B1A C;  1NR7 A;  5LHG A;  1V55 B;  5J9P C;  4BIZ A;  1Q7Y W;  1VQ6 V;  3CD6 V;  4KUM A;  3W7S A;  1R3I C;  3NXS A;  2A9H A;  4MVQ A;  2WLI B;  3ZMS A;  1DF5 A;  3MHH C;  3AG1 C;  4WFE A;  1F4M A;  5IY5 C;  1F51 A;  2R9R B;  2QE7 G;  1JQ0 A;  4J9Y B;  3QNE A;  4OXS A;  1QBZ A;  3QO5 A;  5LGN A;  2YSU B;  1ZWI C;  4WFG A;  1YI2 V;  4GX5 A;  3ABL C;  2DYS C;  2XAS A;  4Z1M G;  1Y66 A;  2X6A A;  1JJ2 U;  2JJ2 G;  2ZXW B;  3E83 A;  4R7C A;  3T4Z A;  2QTO A;  3LSS A;  2ITD C;  1K92 A;  3FB8 C;  5B1B C;  3ABM B;  5L3G A;  3OFN G;  2XAG A;  2P6J A;  3CC4 V;  4PA4 A;  4X8A A;  3ABT A;  2W6J G;  1F4N A;  1AI6 A;  3H01 A;  3CCQ V;  2ZR2 A;  3SPH A;  1FXK B;  1V55 C;  1YJ9 V;  2XOK G;  1XL6 A;  1QR8 A;  3K0D A;  1Q86 W;  3AG3 B;  3D3I A;  1RPR A;  3P32 A;  1M56 B;  1SES A;  3E8F A;  3HB3 B;  2XND G;  5GW7 A;  3ETE A;  4GX0 A;  2ZD9 A;  3RW0 A;  3CCR V;  3OGC C;  3CC7 V;  2MK3 A;  4QIW F;  4ZBM A;  3SYQ A;  3CCL V;  3W7W A;  1PNM A;  2ZXW C;  4HAM A;  1I5Y A;  5B1N A;  3WFV A;  4DXW A;  1SZT A;  2ZR3 A;  2AHY A;  1YJN V;  1V54 B;  1S76 D;  3FB5 C;  1YTF B;  1Y4M A;  3SPC A;  3ABM C;  2QA4 V;  2X6B A;  5L3F A;  2JEU A;  1AI7 A;  2JK5 C;  4QJF B;  1VQO V;  1EBO A;  4LBE C;  3F7Y C;  4MW8 A;  1CEZ A;  3B8M A;  3FB7 C;  2Z3Y A;  1PNK A;  1FXK C;  1N8R W;  1KP2 A;  4H33 A;  2B1G A;  4MVZ A;  3OE7 G;  2KB1 A;  2A79 B;  4RO2 A;  4XDK A;  2XAQ A;  4U7O A;  1K4C C;  4DO2 A;  1YSC A;  3AG3 C;  5KUM A;  3T2M A;  1K8A W;  1M56 C;  3E2E A;  1R3L C;  3OMN B;  1GTO A;  2Q69 A;  4UUJ C;  1K33 A;  3OMA B;  4MTF A;  4JAV A;  2HKO A;  3ML0 A;  1B6Q A;  2GSM B;  2DWD C;  3CCJ V;  2EBO A;  1VQP V;  4MVR A;  4PEL A;  1BMF G;  3TK1 A;  3ZJZ A;  4QPJ A;  5L3C A;  1V54 C;  2PI4 A;  3ETD A;  4MVU A;  1THZ A;  1R3K C;  4BIU A;  1EFR G;  1HWY A;  1AJQ A;  1BL8 A;  1W0J G;  4KP4 A;  1K3E A;  1IXM A;  1H8E G;  1NKD A;  2HLD G;  4LC1 A;  4F4L A;  2ZQM A;  1Q81 W;  3SYA A;  2UXN A;  1K97 A;  4N21 A;  1FXH A;  4TWK A;  4QE9 A;  5B3S B;  1GKF A;  1R3J C;  3CC2 V;  1OCC B;  4UV8 A;  1QVF U;  3P30 A;  2EIM B;  2WLH A;  1GK9 A;  5LGU A;  1OZ0 A;  3JD3 A;  5DM6 V;  1MSW D;  3RVZ A;  1K9M W;  1R6N A;  5CA3 A;  4XBF A;  5CBH A;  3MD0 A;  4X89 A;  3JD1 A;  3X2Q B;  1S77 D;  4UXN A;  4J9Z B;  1YJW V;  2AHZ A;  4MVO A;  3AEI A;  2UXX A;  5EBW C;  4MTX A;  2EZP A;  4PA6 A;  3EFF K;  1M9N A;  4JGS A;  3ZN1 A;  5BZB A;  5EC1 C;  1PD3 A;  4BW5 A;  3T4D A;  1VQK V;  4GCZ A;  3IGA C;  3OM3 B;  2Q68 A;  5CN0 A;  3CCE V;  1JX9 A;  4XDJ A;  4WCE V;  4X88 A;  2WLN A;  1KC8 W;  2X7R B;  2X6C A;  3LSQ A;  1GM9 A;  4I5S A;  4MSW C;  5B3S C;  1OCC C;  2OTL V;  1WLE A;  2EIM C;  2IJH A;  1VQ8 V;  3E89 A;  2LFR A;  1JVM A;  5EK0 A;  3ZMT A;  1K73 W;  4JYC A;  3I55 V;  5LGT A;  3FKS G;  3X2Q C;  3AG2 B;  1BHA A;  4Q20 A;  1VQ4 V;  4MT8 A;  3ZMV A;  2JEX A;  3RVY A;  2HVK C;  1KKD A;  3ZRW A;  3STZ C;  2F43 G;  1MG1 A;  1LNQ A;  3F5W C;  4PDL A;  2HFE C;  1H2G A;  3MHS C;  3RBZ A;  3T1C A;  2W0F C;  1DLB A;  2EIN B;  4G28 B;  2QEX V;  2BOB C;  2IU0 A;  2WWW A;  2IJK A;  4RUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...