4RUFA

Human k2p4.1 (traaak) potassium channel, w262s mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
257
Chain Sequence
b'GPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPESHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVSFWILLGLAYFASVLTTIGNWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 81
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rufA00
4MSWC 4QE9A 2X6AA 4PDLA 1ORQC 4PDVA 4RUEA 3K0GA 3LDDA 5E1AC 3UM7A 2Q6AA 3ASOC 2WLHA 3JYCA 1XL4A 4MVSA 1S5HC 1R3JC 1BL8A 2R9RB 3ABMC 3OUSA 3ZJZA 4P2ZA 1R3LC 3TCUA 5BZBA 3T4ZA 3FB6C 4LBEC 3SPGA 5EBWC 5B1AC 3LDEA 3RW0A 2HVKC 2ZD9A 2Y69C 1V55C 5EC1C 2IH3C 3WG7C 4J9ZB 4MVUA 3RBZA 3SYAA 2JK5C 1OCOC 4X8AA 3ASNC 2Q67A 2HFEC 2WLJA 2EILC 4JTAB 3K08A 4XDJA 4QNHB 3SYPA 3SYOA 4I9WA 4MVQA 2ATKC 5CBHA 4LP8A 4MW3A 4UUJC 1KKDA 2WLKA 3K06A 3PJSK 4PA7A 3RVYA 4R6ZA 2WLMA 3IGAC 4BW5A 4MTOA 4RAIA 4JTCB 3IFXA 3E83A 1M56C 3UKMA 3VOUA 3SPHA 1P7BA 3E8HA 4X89A 1ZWIC 2BOCC 2A9HA 2QTOA 2W0FC 2WLNA 4PDRA 2EIJC 2AHZA 4TWKA 3K04A 3F5WC 4ZBMA 3SYQA 4GX2A 4P9OA 4HYOA 3OGCC 4MS2A 3E8BA 5CBGA 3STZC 4CBCA 2BOBC 4MVMA 4WFGA 2X6CA 2DYRC 3K03A 5EK0A 3T4DA 3X2QC 3R65A 4J9YB 5B3SC 1XL6A 4GX5A 1OCRC 3FB7C 2QKSA 4LCUC 3AG3C 3OR6C 4XDLA 1OCZC 3LDCA 3LNMB 1LNQA 4P30A 3RVZA 1R3IC 2H8PC 1OCCC 2ITCC 2K1EA 3K0DA 4X88A 3SPCA 4MTGA 5KUKA 2EIMC 3SPIA 2EINC 4MW8A 4PA3A 2YEVA 4G27B 3SYCA 5J9PC 4R7CA 3E86A 4GX0A 4PA6A 2DYSC 2IH1C 4PA4A 4RUFA 2WLIB 2DWEC 4DXWA 3HPLC 3OR7C 5EBMC 3KG2A 5CBFA 3ABLC 3AG4C 1V54C 3AG1C 2WLIA 2AHYA 4PDMA 4P9PA 1QLEC 4MVRA 1K4CC 4H33A 4WFEA 3TETA 4MVOA 2WLLB 1R3KC 3ABKC 2EIKC 3ZRSA 3FB8C 3AG2C 4QE7A 2HG5C 3T2MA 2A0LA 3FB5C 5IY5C 2HVJC 4F4LA 4WFFA 5B1BC 3SJQC 3T1CA 3SPJA 3BEHA 2WLLA 2DWDC 3EFFK 2X6BA 4JTDB 4XDKA 5EBLC 2NLJC 4R50A 2HJFC 1K4DC 3E89A 4EKWA 2P7TC 4OXSA 1G4YB 2ITDC 3LUTB 2KB1A 2OCCC 3F7VC 4WFHA 2Q68A 5KUMA 1JVMA 4R8CA 3GB7C 3OUFA 2ZXWC 3E8GA 4G28B 4MVZA 3STLC 2A79B 4GX1A 1M57C 3F7YC 4PA9A 4MTFA 1J95A 4RO2A 4HZ3A 4H37A 4KFMA 2Q69A 5EC2C 3E8FA
chains in the Genus database with same CATH superfamily
4FJCC 1NTMH 5IDJA 2Q6AA 2R9RB 3H1JH 1YITV 3LDEA 3O9OA 1AP5A 4DV4B 4UCVA 3GVMA 3LSUA 2PY5A 2PUSA 5LBQA 1MG1A 2JGUA 2P6JA 4LF7B 1IBLB 5BMVA 1HNWB 1SRYA 3CD6V 1B6QA 3RFRA 3ETGA 3D36C 2ZE7A 1WAZA 3M8AA 2LQTA 3TK1A 4FM2A 4Q20A 3G80A 4EB6B 3RYCB 1P7BA 5L3FA 3JASB 1QVFU 1GN3A 1JOYA 1MSDA 1L0LH 4LWSB 4TV8A 4AHCA 2QE7G 1KU9A 4NKGB 3TJTA 5IWAO 1OCRC 1W59A 3CB2A 4TV9B 1OCZC 1M9NA 1UPGA 2H8PC 1W0JG 2RJZA 4UVCA 3OTOB 1I7FA 4DV2O 3FD9A 1FFTB 4F6RA 4LNUB 4GX0A 2DWEC 5H9CA 1EZVH 5C93A 4F6EA 1VMGA 2WLIA 2AHYA 3WG7B 2EBOA 3R66A 4FLYA 1WP8A 4KXRA 1PNMA 4DV1B 1PNLA 5LMNB 2WAMA 1S72V 1TVKB 5EBLC 4JYAB 2PZSA 3BY6A 4EKWA 1NI8A 4O4LA 2JDIG 1QCEA 2EIJB 4CH5A 2VQFB 1M1KW 3IC9A 3E8GA 4D7SA 3JD3A 3CCRV 4O4IB 1SQGA 4DV4O 3OFNG 3OR6C 1VQ9V 4LF7O 1Z5VA 4K0KB 3UM7A 1IBLO 4J7JA 5B1NA 1HNWO 4DV3B 3K5NA 5J2TA 4D6TH 1GM7A 1IX9A 3MHSC 4LFBB 2RNBA 2Y69C 2R9AA 5KX5A 4X8AA 3N2KA 3J80N 2Q9LA 4X64O 4TUYB 4B3SB 1SZTA 3IGAC 2F4VB 5CA1A 4G2KA 4UB8Z 1M56C 2YUAA 4PDRA 1L8DA 3FAVB 3B4SA 1US6A 1VQNV 3CC4V 3OTOO 3MAQA 3JARA 4U3FH 3O65A 2UXDB 5B3SC 3CCSV 5LYJB 2IJJA 1YJWV 3C90A 1F4NA 2HKOA 3H01A 3K0DA 3LNNA 4MTGA 1SZXA 4ICGA 5JH7B 5LMNO 3W7UA 3JALB 5L3DA 1RFYA 3C3TA 4FLZA 1UJWB 4JYAO 4CS3A 2IU0A 2VQFO 2EILB 4IIJB 2A0LA 3RYFB 1SS3A 1JFFB 3B77A 5IT9N 2QKCA 1OCCB 1VEWA 2V7QG 3E89A 3RYIB 3WB1A 4K0KO 3IAYA 1NR1A 3M99B 4DV3O 2ODMA 3IC7A 1NJIW 4K8ZA 2ADQB 4LFBO 3HKDB 4LNUA 4UXNA 2Q0OC 3P3NA 1U96A 1HDJA 3CEIA 3E22B 3RYHA 3JYCA 2BTOA 5BZBA 4B3SO 3A0HZ 3SPGA 2HEPA 4DW1A 3B40A 3ABUA 2F4VO 1JJOA 5EC1C 1RPOA 5CA0B 1OHHG 3WG7C 3CMEV 3CJHB 1NTZH 4MVQA 4X20B 3BA9A 4JI0B 3S3XA 3K06A 2IBZH 2WA4A 5CMUA 3ZHVA 2UXDO 1I5XA 1JA8A 2Y0IA 4LF4B 1VARA 3VQXA 3CP1A 2DJVA 2EIJC 1KKCA 5B1OA 2AXTZ 5H6QA 4P9OA 1FXVA 2CGOA 4YJ3B 4J9YB 2IJIA 4JZGA 1SESA 2QWNB 1EN5A 4FFBA 4X66B 1EN6A 1VF5B 2L6LA 4UCTA 2QWOB 3BHPA 1JPXA 4WBNA 2HR3A 1HNXB 2DQ0A 1MNGA 2JEUA 4PA4A 4PA6A 1N0NA 4DXWA 5B1AB 3KG2A 1SKVA 5IYDO 2GTSA 3CWBH 4PDMA 2EJRA 1K5QA 3ASNB 5EIBD 1WNSA 2WLLB 5BXZA 3FB5C 2ZNIA 4I0XB 4NR1A 1ZL8B 3DSQA 1K4DC 5IJ0A 5JVDB 2HJDA 4GYCB 2DYSB 4JI6B 3SR2C 4HZ3A 2DN9A 5CB4B 1XDCA 2ARHA 2CAZC 1IXBA 4QE9A 3H1IH 4PDLA 1UFIA 1WB8A 2LO1A 4JAUA 5F2VO 1I94B 4JI0O 1FAFA 1KECA 3I5DA 1R6TA 3MHHC 2LJ2A 4LF4O 1GN2A 4OGQB 2YIAA 3H1KH 2KG7A 4ZKIA 2Q67A 5DM6V 2EILC 5LXTA 1VQ8V 4I9WA 2XAQA 4B3TB 4JYBA 3G6BA 1Y74B 2JIZG 3ZN1A 3L9DA 1H2NA 5CN0A 4RAIA 2ZE5A 5EZYA 3E8HA 4X66O 2CH7B 1DTOA 2ZT9B 3CRQA 2XHBA 2AW9A 1RP3B 1HNXO 2BOBC 3J7AU 1XNRB 2UUBB 1ZLZA 2V1DA 1NBMG 4P30A 2K1EA 5FLXN 4B3MO 3RN4A 4R7CA 3E86A 1XMQB 2N74A 3CCMV 1Y6XA 3CCVV 3A0BZ 1GM8A 5EBMC 4WF9V 2JS5A 1IBKB 4P9PA 4DR5B 2IJHA 3KCXA 4MVOA 1URFA 4QGPA 4JI6O 2V4DA 3DXRA 2D3OW 1DGSA 1S77D 1H2KA 4JYYA 3JD4A 4NTYA 2P7TC 4OXSA 1NR7A 3VQVA 4ABMA 1EM1A 1I94O 4R8CA 4X1KA 2YSUB 4MTFA 2YXLA 3MD0A 3ZMZA 3UO3A 1RSOA 3CXHF 1R73A 3RWRD 3RT3C 2VRZA 3OUSA 4B3TO 3BFRA 4Z1VA 2XAHA 1TA8A 1TAEA 5B1AC 1B3QA 1PP9H 2EIMB 2EINB 2M7WA 2QR4A 5BMVB 3BCCH 1Q5OA 1BHAA 4DV0B 1Q3EA 3ASNC 3JCUZ 2ETNA 2ZE6A 1X4TA 2ADPA 1GTOA 2PI4A 1NVPD 4DR6B 1KBHA 4U3JA 1AI7A 1K97A 1XNRO 3UKMA 2UUBO 3W7SA 2BOCC 4TV8B 2AHZA 1E79G 3SYQA 1WA8A 3GWOA 2H3OA 1XMQO 1YZBA 4LF9B 1QNMA 5EK0A 2BTQA 3R65A 2QTSA 1IBMB 1IBKO 1VQ7V 1KP3A 4F6RB 1N33O 3SPCA 3E2EA 2L35A 4DR5O 2KQXA 3ETEA 5C8YA 4YIPA 2ZDIC 2WLIB 1JCHA 2UXXA 5JCOA 1VQKV 3D8CA 5JJNB 1OCOB 2CTRA 1M5IA 4O2BA 2FYUH 3L72H 4QE7A 2HVJC 1AI5A 2WWWA 1AROP 1YCIA 4I4TA 4O4LB 4TSFG 5J2UA 3BRCA 3EFFK 4FLXA 4TT3G 1YHQV 2KB1A 3NXSA 3DGEA 3HKCA 1L1FA 5HFMA 1ORQC 4DV0O 4TOIA 3WFVA 1MMMA 4DR1B 5KX5B 3NR7A 3T4ZA 1F4MA 4J11A 5EBWC 4DR6O 5GW7A 3N2KB 1XNQB 2MK3A 4CH4A 1SERA 1BQZA 5CA1B 1K8AW 1Y67A 3SYPA 4NXNB 2XAGA 4DYLA 3KZIZ 2KSDA 4LF9O 2NNUA 1K92A 1IBMO 5B5EZ 3BVOA 1ZWIC 2QTOA 3SJCC 3JARB 2MW2B 3K04A 1QHTA 1WLEA 4LH7A 4RWUA 3OGCC 4MS2A 3K5MA 4DUZB 1G6UA 4H13B 4JI5B 5EYPA 2JEXA 1M57B 2RCVA 1XL6A 4Z2WA 5L3CA 4Q6GA 1B06A 2CK3G 1P49A 4YXWG 2EIMC 1SQXH 2EINC 2ZNJA 4MW8A 1BCCH 2Q7EA 5IYCO 3M7MX 2NR5A 3ETDA 3ABMB 3OR7C 1XOUA 1Q7YW 4X64B 1XEQA 4LFAB 1K4CC 4WFEA 1N32O 3T1HB 1R3KC 1AJNA 1W0KG 1COWG 3SGIA 1AR5A 1G1XB 3W7XA 1KQSU 1HNZB 2YS8A 5D5QA 2GHYA 3AEIA 3LUTB 5LHGA 4DR1O 1XUQA 3G4SV 3CRMA 2A79B 4CC5A 4X9QA 5LOVA 3K57A 1XNQO 2B1IA 2XAFA 3RYHB 4GT1A 4B08A 3U0ZA 2DYRB 4JV5B 2N05A 3A8TA 4RUEA 3VQWA 2A06H 1R3JC 3JCZA 4NXNO 4ZI7A 4CH3A 4DV7B 2Q73A 4XBFA 2RN9A 3U11A 1OCOC 3H1LH 4XDJA 3KCYA 3JATA 2QEXV 2R70A 4DUZO 1E1QG 1XILA 1YJ9V 1KC8W 1OZ0A 1H2SB 1N0JA 4JI5O 4MTOA 4QPJA 2P22C 2LGWA 2W6IG 4GKJB 2BSKA 4DRXA 3K9AA 1QVGU 3B2EE 1SF9A 4FFBB 4KL1A 3QF7A 5IJ9A 4MVMA 2YXYA 3K03A 2DMXA 1DF4A 5BY1A 1AB3A 4KHPB 1P4RA 4GX5A 3QO7A 4WBNB 1AI4A 4LFAO 4JF3A 1R3IC 2HLDG 2RMKB 4Z1MG 3T1HO 2P06A 3EVKA 2VWKA 3CCEV 4RQEA 4IHJA 4X1IA 4O2AA 3P3PA 1NH2D 1HNZO 3ZHUA 4JYCA 1AILA 1PV0A 2PI5A 1K5SA 3ZEDA 4UCOA 1K33A 3OW2U 3KKYA 1ZUQA 2HG5C 4F4LA 5IJ0B 2CUGA 2GTAA 4DW0A 3BEHA 1IXMA 4JV5O 3AK2A 2JJ1G 3A0RA 1KMIZ 4DK1A 3F7VC 4C7UA 3VOUA 3WB0A 4BW9A 1M57C 2WA3A 4JI3B 4DV7O 3JD1A 1FXKA 5FL7G 3OD4A 2YC0A 1AJQA 5FPOA 2P67A 1VF6C 2RQ6A 2ZINA 3ZMVA 4FK5C 3LSQA 1BMFG 2WLHA 5IY5B 3AG2B 3ZCCA 2E5LB 3ABMC 1D5AA 3ZRWA 2QWPB 2CTQA 1PPJH 2KG7B 2D2CB 2IJKA 5K1PA 5LXTB 4UV9A 3VBBA 4JI8B 1AVMA 3SYAA 4KUMA 4FFKA 3WU2Z 4GKJO 1A32A 2ZXWB 1BSMA 4K35A 3EHBB 5EZYB 4UUJC 1S76D 4R6ZA 1PL0A 4BW5A 1NT2B 2GBOA 4JTCB 4KHPO 1K3EA 4JZ2A 3P30A 4LFCB 2JGDA 1QLNA 1DF5A 2YIDA 2PYJA 4UCSA 4HYOA 5FPRA 2Z0AA 3ZMSA 4CBCA 4UCRA 1FD9A 2DYRC 1M4UA 4B7KA 3AG7A 4I55A 4JI4B 1IURA 4BWAA 1DLBA 5IE9A 1VQ4V 1R6NA 4UB6Z 4DV6B 4FLVA 4D7TA 1IDSA 4U7OA 3L74H 3APOA 3N27A 1Q82W 3DXRB 3OT7A 2O57A 2EULA 4YY3B 3FB8C 2WPDG 4JI3O 1TUBA 3B8NA 4MT8A 1XHXA 2H94A 4QPKA 4X1KB 2ZCEA 4LC1A 4GKKB 4U7NA 1N8RW 5KUMA 1MA1A 2E5LO 4NTXA 3TXSA 1RSOB 1SA0A 1J95A 5HFLA 2Q7GA 5GTHZ 3W7TA 4JI8O 4J42A 3T1YB 4B3MB 2LFRA 1M93A 1ROPA 1SQPH 2FB5A 3K0GA 4PJ0Z 1YVWA 5L3EA 3ZMUA 3FB6C 2UU9B 1NU1H 1S5LZ 1QBZA 3CMAV 1IVSA 4LFCO 1WP7A 4JTAB 5LP6A 4U3JB 2QJ1A 3AG1B 1KD1W 4PA7A 2QDOA 2DOSA 1K9MW 1WA8B 3ABTA 4JI4O 2BTQB 2PF4E 1WN7A 1YSCA 1V55B 4JAAA 4DV6O 4DV5B 2X6CA 2E3CA 2Q5ZA 3ZIAG 1FYJA 4IYIA 3FB7C 4FLTA 5JQGA 2IM9A 2XT9A 3CCJV 5C8YB 1OCCC 5KUKA 3L70H 2VQEB 3JAWA 2UXBB 4YY3O 4DR4B 2W6JG 1GKFA 1GK9A 4JI2B 3G67A 5DEDA 2ZE8A 3BAAA 2FTKA 4O2BB 2P4VA 4PV1B 4GKKO 3D3IA 4I4TB 2E74B 1H2LA 1F51A 1O9GA 3GWKC 5J2UB 4DUYB 3OE7G 1XBLA 1FFXA 1OV9A 4LF5B 4JASA 5ITZA 3J81N 3JSNA 3T1YO 4JI7B 1IZ3A 3T1CA 5GTIZ 2UXNA 1QR9A 2X6BA 3ZMTA 2AZ2A 3ZN0A 4WCEV 2E76B 1FS0G 3HKCB 2YICA 3UT5A 4G28B 3ZX6A 2UU9O 2JJ2G 1N33B 4MW3A 3CRAA 4L87A 3HKBA 2UUCB 1XL4A 2EX3A 1XQ8A 5KHHA 2F95B 1Q6UA 4AILC 1ENVA 3ML0A 1PKXA 4H0LB 2WLJA 2QM4A 2Y4UA 4CH6A 4QNHB 1V54B 4KP4A 1YIJV 3OGIB 3ICXA 4DV5O 3FFQA 3AK1A 3SPHA 2NN4A 2W0FC 5B66Z 3EXAA 5B1BB 4UV8A 4GX2A 4CC6A 4W4KA 5EYPB 2VQEO 2UXBO 2JS3A 4FZ1A 4DR4O 3MDSA 5CA3A 4CS2A 4JI2O 3CHXA 3W7WA 2PTMA 5H2FZ 3HR0A 1NTKH 1XHZA 2ZR3A 3SPIA 4H44B 4DUYO 4G27B 3DTUB 1JX9A 4LF5O 2DYSC 2IH1C 4RUFA 5A2QN 4JI7O 2P5OA 4O4HA 3JSLA 3AG1C 3WB2A 3CRRA 2EZOA 3TETA 5KMGA 1X59A 5LA6A 4DR3B 4NB5A 1OCRB 4N23A 4FIPC 3QO5A 4JAVA 1VQ6V 2NLJC 2UUCO 5LOVB 1BT8A 1G4YB 2GUZA 2ZR2A 3GB7C 4ZHQA 1PD3A 3Q4HA 4RO2A 1O9HA 1P7GA 3JD0A 2KKWA 4LF8B 4JGSA 5D5PA 2ZDIA 5KHJA 3CC2V 2X6AA 3X2QB 2LP7A 4ZI7B 5JCOC 1YDXA 4DR2O 2ZIOA 4FMTA 1JR9A 5L3GA 2X0LA 3ZS8C 4N21A 5LMUB 3JATB 3TGUH 4UFZA 3SDLA 4UCUA 1VQOV 1N32B 3E35A 4HNAA 3AG4B 4LP8A 2UUAB 5IYZA 4BAYA 1QLEB 2BSKB 4AQYB 4DRXB 1ZAUA 3PN1A 1SQFA 1Y76A 2ZM6B 1Q86W 2F1MA 2WSSG 5IJ9B 2C2AA 4TWKA 1AR1B 3ETQA 5CBGA 3STZC 2VS0A 4AI8A 4O4JA 1NH2B 2Y4TA 4ASUG 5JJEB 2QKSA 1H2MA 2AZ0A 4IHJB 1Y66A 4X1IB 4O2AB 2AGAA 2Q0AA 4PA3A 3K5LA 4DR3O 2Y48A 4I5SA 2CTPA 3HKEA 3N2GA 1V54C 1GRJA 2GV9A 5E79Z 4MVRA 2F23A 4CS4A 2IW5A 5B3SB 1E1RG 5KHIA 1I08A 5TISZ 2R9IA 5B1BC 3SJQC 4LF8O 3THOA 4L8JA 3OMIB 3SJBC 4J80A 2XOKG 4WFHA 1FXKB 1JVMA 3OUFA 4WFAV 3D36A 4YIOA 4PA9A 1Q6IA 4I50A 3BABA 5LMUO 1J5EB 1NS1A 1MOFA 3E8FA 1YTFD 1Q6HA 2A7WA 3ZRWB 3K58A 1Z5WA 2XAJA 1F23A 5KA6A 4EFEA 1BL8A 2F43G 2UUAO 3CCLV 5FNVA 1FKAO 4AQYO 5L3BA 2ZM6O 4PD4F 3H9VA 4GUNA 3VQYA 2IH3C 1BE3H 1NQTA 3RBZA 4DK0A 3ZHTA 1CP9A 1BHBA 3CCQV 5LHIA 1SC5B 1M90W 2YDEA 2DE0X 1ZSPA 3SYOA 1VP7A 2PYLA 2YEVB 3OMAB 4GCZA 2JGDB 5H5NA 3ZHSA 3AK3A 1FPOA 2EIKB 1GAXA 1HR0B 3CPWU 4ZBMA 2LGQA 4YJ2A 1BGYH 1AJPA 3JAKA 2XTAA 2FL4A 1XMOB 2OCCB 2GDSA 3QO8A 5DN6G 4I55B 1CXZB 3X2QC 1NKDA 1WPBA 4LCUC 5GONA 1FJGB 4ZOLA 4FPPA 2ITCC 3S3WA 4X88A 3B8MA 4JPRA 2OTLV 3CC7V 5J9PC 2PGGA 3SJAC 2BE3A 1Q8IA 3AG4C 1TUBB 4UVAA 1QLEC 1Q90D 1YI2V 1H38A 1VIBA 2YI8A 1N4CA 2DW4A 4NYKA 1J5EO 1VQMV 3SPJA 1SA0B 3K59A 4R50A 1QR8A 4CZZA 4A5UB 4GLXA 2Q68A 3CYOA 4HBNA 4FZ0A 3F7YC 1BQ0A 4NXMB 1H2GA 1GO3F 3K3WA 5KAIZ 5H6RA 1YEWA 4H37A 1D2DA 2Q69A 3OTFA 4X1YA 3ZHRA 5E1AC 4MVSA 1VQ5V 3TCUA 1ZX3A 5KHGA 2ZD9A 5LP6B 5LHHA 3QVNA 2JK5C 4JI1B 5IYBO 1HR0O 1R1BA 2HFEC 2P4KA 3K08A 3ABLB 4FLUA 1KKDA 1XMOO 3H1HH 1ZTEA 3OMNB 3IFXA 4IYHA 4DV1O 4K8XA 4I7ZB 2VWJA 3LSSA 2WLNA 1FJGO 1FXKC 3CSXA 1T5EA 1TGOA 3F5WC 2Y0PA 1AR4A 1VF6A 4EB6A 5KAFZ 3RYCA 3B09A 3JASA 1VQPV 5JQGB 2F66C 4WFGA 2LFSA 3JD2A 4LWSA 3JAWB 4E2LA 3K79A 1VF7A 1HP8A 3FYIB 2K9PA 4TV9A 1LUVA 2YEVA 4OPHA 3I56V 2W0XA 3QTCA 3CE2A 4DR7B 3FYEB 1FFXB 2EZPA 5LGNA 5ITZB 3HB3B 3CCUV 1R6KA 1B04A 5JJJB 1PM9A 1K73W 2EIKC 4NXMO 4NVPA 1RM1B 1JQ0A 2XUMA 4WFFA 4IT5A 3UT5B 1H8HG 1YF2A 4PHZA 4K3AA 3QG5A 2OCCC 1WPXA 4DO2A 1TVKA 3STLC 3HKBB 4ZIBA 5LGUA 2G38A 5EC2C 3I55V 4JI1O 2E75B 4O4IA 1Q43A 1EN4A 3FKSG 1S5HC 2QM8A 2DQ3A 3ZJZA 3ZRVA 4LBEC 1N34B 3K5OA 2Q4PA 2Q8VA 4LF6B 1PL4A 4TQDA 1S5JA 2UXCB 1SQBH 1SQQH 2X7RB 4J7ZA 4OX9B 2HHHB 2CGNA 2ILMA 3ZRXA 1AI6A 5EIBC 3APQA 2QWQB 4IGGA 1SQVH 3ABKB 2CTWA 4TUYA 4FM0A 1NVPB 1QQCA 4B7EA 2OTJV 2JVDA 4W4LA 4PI2A 1LUWA 3E8BA 3FAVA 3T4DA 3F5TA 1JJ2U 3K9SA 4DR7O 4J41A 2LW1A 2XASA 2QWRB 5BR8B 5LL6Y 1G8MA 5LYJA 4O4HB 5LP6C 3SYCA 2M6YA 4EEQA 3ASOB 2RDCA 2B9ZA 4J10A 3HPLC 1KUQA 5JH7A 5KMGB 5CBFA 3ABLC 3JALA 3G71V 5LA6B 1DK1A 4LR3A 1VQLV 4H33A 3D3QA 1YXBA 3ZRSA 5IY5C 3AG2C 3T2MA 2ZIMA 2GUZB 4IIJA 4JTDB 4ZHQB 3UQ8A 3Q4HB 2QM7A 3ZHQA 3RYFA 1JFFA 2Z5UA 2ZXWC 3RGBA 4FM1A 2B5UA 3CX5F 1N34O 1I0HA 3RYIA 1N36B 4LF6O 4B3RB 4MSWC 4TQFA 1HW7A 2UXCO 4PDVA 3HKDA 4LH6A 4OX9O 3LDDA 1K7DA 2OIEA 4HAMA 2HHHO 2Q7HA 3AG3B 3C3SA 1CEZA 3RW0A 4HNAB 3E22A 1GN6A 1W2BU 2P90A 3OEHG 5IYZB 1PNKA 1GMGA 2JRIA 4X62B 1AP6A 1XREA 3L71H 1RM1C 4BR6A 1Y76B 3QNEA 5CA0A 3OEEG 2ATKC 1L0NH 1THZA 2WLKA 3CJHA 1MZFA 1BZKA 4X20A 4X89A 5BR8O 3DC6A 4O4JB 3U10A 2QKAA 4E4EA 4PI0A 1KYOF 4X65B 1FXHA 1KP2A 5KA5A 4DR2B 5JWPA 4OPAA 5K1XA 4XDLA 3LDCA 4BIOA 1KB9F 4YJ3A 3CS5A 3HKEB 3N2GB 1OJHA 1U97A 2ZKOA 2EJ7A 1QU7A 3G6EV 1Q81W 1EZJA 5A9GA 2YIBA 1MSWD 1TUEB 1K34A 3DC5A 2YI9A 4WFBV 3ABKC 1N36O 2CDYA 1YTFB 2YIBD 4B3RO 1BS3A 1MZEA 1D5NA 2WLLA 2DWDC 4XDKA 4I50B 4I0XA 1SETA 1MABG 4QIWF 4MVZA 1WB7A 4GX1A 1ZL8A 2A3QA 3FX7A 5JVDA 3CXCU 4KFMA 1S0VA 3CRCA 5FNVB 1GH6A 4X62O 5AG2A 1GN4A 1F7YA 2R72A 3OM3B 5CB4A 3ASOC 1OCZB 4QJFB 1V9PA 1R3LC 4P2ZA 4YHHB 3L75H 2HVKC 2QGNA 4IL6Z 1V55C 4BIZA 1S3JA 4J9ZB 4MVUA 4EFBA 3UO2A 2QSAA 2BCCH 3ZBHA 3A2FA 2OWOA 2FMLA 2HP8A 4BIUA 2OT5A 1P84F 4FVMA 5CBHA 1HWYA 4X65O 2XNDG 1JMKC 3PJSK 3RVYA 3BPZA 2FKXA 2WLMA 5LGTA 3P32A 4YJ2B 3E83A 2GSMB 3JAKB 2LW7A 2A9HA 1Y74A 2CE4A 3L73H 5KLVH 1Z2GA 2OIGA 3OAAG 5GONB 2CH7A 2N04A 4ZOLB 1NZ6A 3TXQA 2Z3YA 1EBOA 3AG3C 1RPRA 4PELA 3LNMB 1LNQA 4NTWA 3RVZA 1Y4MA 2IU3A 2YXHA 1WJZA 3UCSC 3IJ4A 5IWAB 1LR1A 4RQFA 3BA8A 1I5YA 4UVBA 2Y69B 4J7KA 4I9QA 5J2TB 2QA4V 5DECA 4DV2B 2B1GA 2OYQA 5KHKA 1XI1A 1YJNV 4FLWA 1CPYA 2F93B 2OCHA 2HJFC 4GZRB 3JAMN 1M56B 2ITDC 1GM9A 4MTXA 1H8EG 4YHHO 1EFRG 4X1YB 2ZQMA
chains in the Genus database with same CATH topology
2LFRA 4FJCC 1ROPA 5IDJA 3K0GA 5E1AC 2Q6AA 4MVSA 1R73A 5L3EA 2R9RB 3OUSA 3ZMUA 1VQ5V 3TCUA 1YITV 2XAHA 3FB6C 5B1AC 3LDEA 2ZD9A 2EIMB 2EINB 1QBZA 2M7WA 5LHHA 3CMAV 2JK5C 5IYBO 1BHAA 5LBQA 3ASNC 2HFEC 1MG1A 2P6JA 4JTAB 3K08A 3ABLB 1SRYA 3AG1B 1GTOA 3CD6V 1B6QA 2PI4A 1KKDA 1KD1W 1NVPD 4PA7A 3ETGA 3OMNB 1AI7A 1K97A 1K9MW 3IFXA 3TK1A 4Q20A 3UKMA 3LSSA 1P7BA 3W7SA 5L3FA 2WLNA 2BOCC 1FXKC 1QVFU 2AHZA 3ABTA 1JOYA 1E79G 3F5WC 3SYQA 3GWOA 1YSCA 1VQPV 1V55B 4WFGA 2X6CA 5EK0A 3ZIAG 3R65A 2QE7G 2LFSA 3JD2A 1OCRC 3FB7C 3CCJV 1OCZC 1VQ7V 1KP3A 1M9NA 4E2LA 3K79A 2H8PC 1OCCC 1W0JG 5KUKA 3SPCA 3FYIB 3E2EA 4UVCA 2YEVA 1FFTB 3ETEA 3I56V 2W6JG 4GX0A 1GKFA 2ZDIC 1GK9A 2WLIB 1JCHA 2DWEC 2UXXA 5H9CA 1VQKV 5C93A 2FTKA 3FYEB 2EZPA 5LGNA 2WLIA 2AHYA 3D3IA 3WG7B 3HB3B 2EBOA 1OCOB 3CCUV 1R6KA 1PNMA 1F51A 1PNLA 1K73W 2EIKC 4QE7A 1RM1B 3OE7G 1JQ0A 2HVJC 1AI5A 4WFFA 4JASA 2WWWA 1AROP 1H8HG 2WAMA 3T1CA 4TSFG 2UXNA 1S72V 5EBLC 3EFFK 1QR9A 2X6BA 3ZMTA 3ZN0A 4WCEV 3BY6A 4TT3G 1FS0G 4EKWA 1YHQV 2JDIG 1QCEA 2KB1A 2OCCC 1WPXA 2EIJB 4DO2A 1M1KW 3E8GA 4G28B 3STLC 3JD3A 3NXSA 3CCRV 3DGEA 5LGUA 1L1FA 5HFMA 2JJ2G 3OFNG 5EC2C 3OR6C 4MW3A 3I55V 4L87A 1VQ9V 1ORQC 3WFVA 3UM7A 5B1NA 3FKSG 1XL4A 1S5HC 2QM8A 2DQ3A 3ZJZA 3ZRVA 3T4ZA 1F4MA 4LBEC 5EBWC 1GM7A 3MHSC 1ENVA 5GW7A 3ML0A 2Y69C 2MK3A 1PKXA 1SERA 4X8AA 2WLJA 2X7RB 4QNHB 1V54B 3SYPA 4KP4A 3ZRXA 1K8AW 1AI6A 1YIJV 2XAGA 1SZTA 3IGAC 2NNUA 4G2KA 1K92A 3ABKB 1M56C 3SPHA 1ZWIC 2QTOA 2W0FC 1NVPB 4PDRA 5B1BB 1VQNV 3CC4V 3K04A 4UV8A 2OTJV 4GX2A 1WLEA 3OGCC 4MS2A 3E8BA 5CA3A 3T4DA 5B3SC 3CCSV 2JEXA 1M57B 1JJ2U 1XL6A 3W7WA 5L3CA 2IJJA 1YJWV 2CK3G 2XASA 1F4NA 2HKOA 3H01A 3K0DA 4MTGA 1G8MA 2ZR3A 4YXWG 2EIMC 3SPIA 2EINC 4MW8A 4G27B 3SYCA 3W7UA 5L3DA 3ASOB 3DTUB 5IYCO 1JX9A 2DYSC 2IH1C 4RUFA 3ETDA 3ABMB 3HPLC 3OR7C 1Q7YW 5CBFA 3ABLC 3AG1C 1UJWB 3G71V 1VQLV 2IU0A 2EZOA 1K4CC 4H33A 4WFEA 3TETA 2EILB 1R3KC 3ZRSA 5IY5C 3AG2C 3T2MA 1AJNA 1OCRB 2A0LA 1W0KG 4N23A 3B77A 4FIPC 1COWG 3QO5A 4JAVA 4JTDB 1OCCB 3W7XA 1KQSU 1VQ6V 2QM7A 2NLJC 2V7QG 3E89A 2Z5UA 2GHYA 3AEIA 1G4YB 3LUTB 1NR1A 3M99B 5LHGA 3IC7A 1NJIW 2ZR2A 3GB7C 2ZXWC 3G4SV 1PD3A 2A79B 2B5UA 4RO2A 3JD0A 4UXNA 2B1IA 2XAFA 4GT1A 4JGSA 4MSWC 2ZDIA 3CC2V 2DYRB 2X6AA 3X2QB 2LP7A 4PDVA 4RUEA 3LDDA 1K7DA 4HAMA 4FMTA 3JYCA 3AG3B 5L3GA 1R3JC 3JCZA 5BZBA 3SPGA 2X0LA 4N21A 3RW0A 1CEZA 3ABUA 1W2BU 2P90A 5EC1C 1RPOA 4XBFA 1OHHG 3OEHG 3WG7C 1OCOC 1VQOV 3E35A 1PNKA 1GMGA 3CMEV 4XDJA 1RM1C 3AG4B 3QNEA 3OEEG 4MVQA 2ATKC 4LP8A 2QEXV 1E1QG 1YJ9V 1THZA 2WLKA 3K06A 1OZ0A 5CMUA 1QLEB 4BAYA 1KC8W 1I5XA 4MTOA 4QPJA 1Q86W 3CP1A 4X89A 2WSSG 2W6IG 2EIJC 5B1OA 2C2AA 4TWKA 1AR1B 3K9AA 5H6QA 1QVGU 4P9OA 1FXVA 5CBGA 3STZC 4MVMA 1FXHA 1NH2B 3K03A 1KP2A 1DF4A 4J9YB 2IJIA 1SESA 4ASUG 5KA5A 1P4RA 4GX5A 2QKSA 3QO7A 1AI4A 4XDLA 3LDCA 4JF3A 1R3IC 2HLDG 1Y66A 1JPXA 4Z1MG 2HR3A 4PA3A 2DQ0A 3CCEV 2JEUA 4PA4A 4PA6A 4RQEA 2Y48A 3G6EV 4I5SA 4DXWA 1Q81W 1NH2D 5B1AB 1EZJA 3KG2A 1MSWD 1V54C 1TUEB 1K34A 5IYDO 4JYCA 2PI5A 1K5SA 4PDMA 2EJRA 4MVRA 4WFBV 1K5QA 3ASNB 1K33A 2IW5A 2WLLB 5B3SB 3OW2U 3ABKC 1E1RG 2HG5C 3FB5C 4F4LA 1YTFB 2R9IA 5B1BC 3SJQC 3BEHA 2WLLA 2DWDC 4XDKA 1IXMA 3OMIB 2JJ1G 1K4DC 1SETA 3A0RA 2XOKG 3F7VC 1MABG 1FXKB 4WFHA 1JVMA 4QIWF 2DYSB 3OUFA 4MVZA 3D36A 3VOUA 4WFAV 4GX1A 1M57C 4PA9A 4HZ3A 3CXCU 4KFMA 1S0VA 3JD1A 1FXKA 1MOFA 3E8FA 5FL7G 1YTFD 4QE9A 1AJQA 3ZRWB 4PDLA 2P67A 2XAJA 3OM3B 3ZMVA 4FK5C 3LSQA 1F23A 1BMFG 3ASOC 2WLHA 5IY5B 4JAUA 3AG2B 5KA6A 1OCZB 3ZCCA 1BL8A 4QJFB 3ABMC 2F43G 3ZRWA 4P2ZA 1KECA 1R3LC 3CCLV 2IJKA 2HVKC 3MHHC 5L3BA 4UV9A 3VBBA 1V55C 2IH3C 4BIZA 1S3JA 1NQTA 4J9ZB 4MVUA 3RBZA 4KUMA 3SYAA 1CP9A 4ZKIA 1BHBA 2Q67A 5DM6V 3CCQV 2EILC 2ZXWB 5LHIA 1M90W 1VQ8V 3EHBB 3SYOA 4BIUA 4I9WA 2OT5A 2XAQA 2YEVB 5CBHA 1HWYA 2XNDG 4JYBA 4UUJC 1S76D 3OMAB 3PJSK 2JIZG 4GCZA 3RVYA 4R6ZA 3ZN1A 1PL0A 2WLMA 4BW5A 5LGTA 3P32A 5CN0A 4RAIA 4JTCB 3E83A 2EIKB 1K3EA 2GSMB 3E8HA 2A9HA 3P30A 1DTOA 1QLNA 1DF5A 3CPWU 4ZBMA 1AJPA 4HYOA 3OAAG 3ZMSA 4CBCA 2BOBC 2OCCB 3QO8A 5DN6G 2DYRC 3X2QC 1NKDA 2Z3YA 1EBOA 4LCUC 3AG3C 1RPRA 2V1DA 4PELA 3LNMB 1LNQA 1NBMG 4FPPA 2ITCC 2K1EA 1Y4MA 2IU3A 4P30A 4X88A 3B8MA 3RVZA 1DLBA 4JPRA 1VQ4V 2OTLV 3CC7V 5J9PC 4R7CA 1R6NA 3E86A 3CCMV 3CCVV 1GM8A 4U7OA 5EBMC 4WF9V 4RQFA 3AG4C 1I5YA 4UVBA 2Y69B 1Q82W 4UVAA 4P9PA 1QLEC 2IJHA 4MVOA 2QA4V 1YI2V 3FB8C 2WPDG 2B1GA 1H38A 2DW4A 3B8NA 1YJNV 1VQMV 4MT8A 2H94A 2D3OW 4QPKA 3SPJA 1CPYA 4LC1A 1S77D 4R50A 2HJFC 3JD4A 1QR8A 4CZZA 2P7TC 1M56B 4OXSA 1NR7A 4U7NA 2ITDC 1N8RW 1GM9A 2Q68A 3CYOA 5KUMA 4R8CA 2YSUB 4MTXA 1H8EG 3F7YC 4MTFA 1J95A 1EFRG 1H2GA 2ZQMA 5HFLA 1GO3F 3K3WA 5H6RA 3MD0A 4H37A 3W7TA 3ZMZA 2Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSW C;  4QE9 A;  2X6A A;  4PDL A;  1ORQ C;  4PDV A;  4RUE A;  3K0G A;  3LDD A;  5E1A C;  3UM7 A;  2Q6A A;  3ASO C;  2WLH A;  3JYC A;  1XL4 A;  4MVS A;  1S5H C;  1R3J C;  1BL8 A;  2R9R B;  3ABM C;  3OUS A;  3ZJZ A;  4P2Z A;  1R3L C;  3TCU A;  5BZB A;  3T4Z A;  3FB6 C;  4LBE C;  3SPG A;  5EBW C;  5B1A C;  3LDE A;  3RW0 A;  2HVK C;  2ZD9 A;  2Y69 C;  1V55 C;  5EC1 C;  2IH3 C;  3WG7 C;  4J9Z B;  4MVU A;  3RBZ A;  3SYA A;  2JK5 C;  1OCO C;  4X8A A;  3ASN C;  2Q67 A;  2HFE C;  2WLJ A;  2EIL C;  4JTA B;  3K08 A;  4XDJ A;  4QNH B;  3SYP A;  3SYO A;  4I9W A;  4MVQ A;  2ATK C;  5CBH A;  4LP8 A;  4MW3 A;  4UUJ C;  1KKD A;  2WLK A;  3K06 A;  3PJS K;  4PA7 A;  3RVY A;  4R6Z A;  2WLM A;  3IGA C;  4BW5 A;  4MTO A;  4RAI A;  4JTC B;  3IFX A;  3E83 A;  1M56 C;  3UKM A;  3VOU A;  3SPH A;  1P7B A;  3E8H A;  4X89 A;  1ZWI C;  2BOC C;  2A9H A;  2QTO A;  2W0F C;  2WLN A;  4PDR A;  2EIJ C;  2AHZ A;  4TWK A;  3K04 A;  3F5W C;  4ZBM A;  3SYQ A;  4GX2 A;  4P9O A;  4HYO A;  3OGC C;  4MS2 A;  3E8B A;  5CBG A;  3STZ C;  4CBC A;  2BOB C;  4MVM A;  4WFG A;  2X6C A;  2DYR C;  3K03 A;  5EK0 A;  3T4D A;  3X2Q C;  3R65 A;  4J9Y B;  5B3S C;  1XL6 A;  4GX5 A;  1OCR C;  3FB7 C;  2QKS A;  4LCU C;  3AG3 C;  3OR6 C;  4XDL A;  1OCZ C;  3LDC A;  3LNM B;  1LNQ A;  4P30 A;  3RVZ A;  1R3I C;  2H8P C;  1OCC C;  2ITC C;  2K1E A;  3K0D A;  4X88 A;  3SPC A;  4MTG A;  5KUK A;  2EIM C;  3SPI A;  2EIN C;  4MW8 A;  4PA3 A;  2YEV A;  4G27 B;  3SYC A;  5J9P C;  4R7C A;  3E86 A;  4GX0 A;  4PA6 A;  2DYS C;  2IH1 C;  4PA4 A;  4RUF A;  2WLI B;  2DWE C;  4DXW A;  3HPL C;  3OR7 C;  5EBM C;  3KG2 A;  5CBF A;  3ABL C;  3AG4 C;  1V54 C;  3AG1 C;  2WLI A;  2AHY A;  4PDM A;  4P9P A;  1QLE C;  4MVR A;  1K4C C;  4H33 A;  4WFE A;  3TET A;  4MVO A;  2WLL B;  1R3K C;  3ABK C;  2EIK C;  3ZRS A;  3FB8 C;  3AG2 C;  4QE7 A;  2HG5 C;  3T2M A;  2A0L A;  3FB5 C;  5IY5 C;  2HVJ C;  4F4L A;  4WFF A;  5B1B C;  3SJQ C;  3T1C A;  3SPJ A;  3BEH A;  2WLL A;  2DWD C;  3EFF K;  2X6B A;  4JTD B;  4XDK A;  5EBL C;  2NLJ C;  4R50 A;  2HJF C;  1K4D C;  3E89 A;  4EKW A;  2P7T C;  4OXS A;  1G4Y B;  2ITD C;  3LUT B;  2KB1 A;  2OCC C;  3F7V C;  4WFH A;  2Q68 A;  5KUM A;  1JVM A;  4R8C A;  3GB7 C;  3OUF A;  2ZXW C;  3E8G A;  4G28 B;  4MVZ A;  3STL C;  2A79 B;  4GX1 A;  1M57 C;  3F7Y C;  4PA9 A;  4MTF A;  1J95 A;  4RO2 A;  4HZ3 A;  4H37 A;  4KFM A;  2Q69 A;  5EC2 C;  3E8F A; 
#chains in the Genus database with same CATH topology
 4FJC C;  1NTM H;  5IDJ A;  2Q6A A;  2R9R B;  3H1J H;  1YIT V;  3LDE A;  3O9O A;  1AP5 A;  4DV4 B;  4UCV A;  3GVM A;  3LSU A;  2PY5 A;  2PUS A;  5LBQ A;  1MG1 A;  2JGU A;  2P6J A;  4LF7 B;  1IBL B;  5BMV A;  1HNW B;  1SRY A;  3CD6 V;  1B6Q A;  3RFR A;  3ETG A;  3D36 C;  2ZE7 A;  1WAZ A;  3M8A A;  2LQT A;  3TK1 A;  4FM2 A;  4Q20 A;  3G80 A;  4EB6 B;  3RYC B;  1P7B A;  5L3F A;  3JAS B;  1QVF U;  1GN3 A;  1JOY A;  1MSD A;  1L0L H;  4LWS B;  4TV8 A;  4AHC A;  2QE7 G;  1KU9 A;  4NKG B;  3TJT A;  5IWA O;  1OCR C;  1W59 A;  3CB2 A;  4TV9 B;  1OCZ C;  1M9N A;  1UPG A;  2H8P C;  1W0J G;  2RJZ A;  4UVC A;  3OTO B;  1I7F A;  4DV2 O;  3FD9 A;  1FFT B;  4F6R A;  4LNU B;  4GX0 A;  2DWE C;  5H9C A;  1EZV H;  5C93 A;  4F6E A;  1VMG A;  2WLI A;  2AHY A;  3WG7 B;  2EBO A;  3R66 A;  4FLY A;  1WP8 A;  4KXR A;  1PNM A;  4DV1 B;  1PNL A;  5LMN B;  2WAM A;  1S72 V;  1TVK B;  5EBL C;  4JYA B;  2PZS A;  3BY6 A;  4EKW A;  1NI8 A;  4O4L A;  2JDI G;  1QCE A;  2EIJ B;  4CH5 A;  2VQF B;  1M1K W;  3IC9 A;  3E8G A;  4D7S A;  3JD3 A;  3CCR V;  4O4I B;  1SQG A;  4DV4 O;  3OFN G;  3OR6 C;  1VQ9 V;  4LF7 O;  1Z5V A;  4K0K B;  3UM7 A;  1IBL O;  4J7J A;  5B1N A;  1HNW O;  4DV3 B;  3K5N A;  5J2T A;  4D6T H;  1GM7 A;  1IX9 A;  3MHS C;  4LFB B;  2RNB A;  2Y69 C;  2R9A A;  5KX5 A;  4X8A A;  3N2K A;  3J80 N;  2Q9L A;  4X64 O;  4TUY B;  4B3S B;  1SZT A;  3IGA C;  2F4V B;  5CA1 A;  4G2K A;  4UB8 Z;  1M56 C;  2YUA A;  4PDR A;  1L8D A;  3FAV B;  3B4S A;  1US6 A;  1VQN V;  3CC4 V;  3OTO O;  3MAQ A;  3JAR A;  4U3F H;  3O65 A;  2UXD B;  5B3S C;  3CCS V;  5LYJ B;  2IJJ A;  1YJW V;  3C90 A;  1F4N A;  2HKO A;  3H01 A;  3K0D A;  3LNN A;  4MTG A;  1SZX A;  4ICG A;  5JH7 B;  5LMN O;  3W7U A;  3JAL B;  5L3D A;  1RFY A;  3C3T A;  4FLZ A;  1UJW B;  4JYA O;  4CS3 A;  2IU0 A;  2VQF O;  2EIL B;  4IIJ B;  2A0L A;  3RYF B;  1SS3 A;  1JFF B;  3B77 A;  5IT9 N;  2QKC A;  1OCC B;  1VEW A;  2V7Q G;  3E89 A;  3RYI B;  3WB1 A;  4K0K O;  3IAY A;  1NR1 A;  3M99 B;  4DV3 O;  2ODM A;  3IC7 A;  1NJI W;  4K8Z A;  2ADQ B;  4LFB O;  3HKD B;  4LNU A;  4UXN A;  2Q0O C;  3P3N A;  1U96 A;  1HDJ A;  3CEI A;  3E22 B;  3RYH A;  3JYC A;  2BTO A;  5BZB A;  4B3S O;  3A0H Z;  3SPG A;  2HEP A;  4DW1 A;  3B40 A;  3ABU A;  2F4V O;  1JJO A;  5EC1 C;  1RPO A;  5CA0 B;  1OHH G;  3WG7 C;  3CME V;  3CJH B;  1NTZ H;  4MVQ A;  4X20 B;  3BA9 A;  4JI0 B;  3S3X A;  3K06 A;  2IBZ H;  2WA4 A;  5CMU A;  3ZHV A;  2UXD O;  1I5X A;  1JA8 A;  2Y0I A;  4LF4 B;  1VAR A;  3VQX A;  3CP1 A;  2DJV A;  2EIJ C;  1KKC A;  5B1O A;  2AXT Z;  5H6Q A;  4P9O A;  1FXV A;  2CGO A;  4YJ3 B;  4J9Y B;  2IJI A;  4JZG A;  1SES A;  2QWN B;  1EN5 A;  4FFB A;  4X66 B;  1EN6 A;  1VF5 B;  2L6L A;  4UCT A;  2QWO B;  3BHP A;  1JPX A;  4WBN A;  2HR3 A;  1HNX B;  2DQ0 A;  1MNG A;  2JEU A;  4PA4 A;  4PA6 A;  1N0N A;  4DXW A;  5B1A B;  3KG2 A;  1SKV A;  5IYD O;  2GTS A;  3CWB H;  4PDM A;  2EJR A;  1K5Q A;  3ASN B;  5EIB D;  1WNS A;  2WLL B;  5BXZ A;  3FB5 C;  2ZNI A;  4I0X B;  4NR1 A;  1ZL8 B;  3DSQ A;  1K4D C;  5IJ0 A;  5JVD B;  2HJD A;  4GYC B;  2DYS B;  4JI6 B;  3SR2 C;  4HZ3 A;  2DN9 A;  5CB4 B;  1XDC A;  2ARH A;  2CAZ C;  1IXB A;  4QE9 A;  3H1I H;  4PDL A;  1UFI A;  1WB8 A;  2LO1 A;  4JAU A;  5F2V O;  1I94 B;  4JI0 O;  1FAF A;  1KEC A;  3I5D A;  1R6T A;  3MHH C;  2LJ2 A;  4LF4 O;  1GN2 A;  4OGQ B;  2YIA A;  3H1K H;  2KG7 A;  4ZKI A;  2Q67 A;  5DM6 V;  2EIL C;  5LXT A;  1VQ8 V;  4I9W A;  2XAQ A;  4B3T B;  4JYB A;  3G6B A;  1Y74 B;  2JIZ G;  3ZN1 A;  3L9D A;  1H2N A;  5CN0 A;  4RAI A;  2ZE5 A;  5EZY A;  3E8H A;  4X66 O;  2CH7 B;  1DTO A;  2ZT9 B;  3CRQ A;  2XHB A;  2AW9 A;  1RP3 B;  1HNX O;  2BOB C;  3J7A U;  1XNR B;  2UUB B;  1ZLZ A;  2V1D A;  1NBM G;  4P30 A;  2K1E A;  5FLX N;  4B3M O;  3RN4 A;  4R7C A;  3E86 A;  1XMQ B;  2N74 A;  3CCM V;  1Y6X A;  3CCV V;  3A0B Z;  1GM8 A;  5EBM C;  4WF9 V;  2JS5 A;  1IBK B;  4P9P A;  4DR5 B;  2IJH A;  3KCX A;  4MVO A;  1URF A;  4QGP A;  4JI6 O;  2V4D A;  3DXR A;  2D3O W;  1DGS A;  1S77 D;  1H2K A;  4JYY A;  3JD4 A;  4NTY A;  2P7T C;  4OXS A;  1NR7 A;  3VQV A;  4ABM A;  1EM1 A;  1I94 O;  4R8C A;  4X1K A;  2YSU B;  4MTF A;  2YXL A;  3MD0 A;  3ZMZ A;  3UO3 A;  1RSO A;  3CXH F;  1R73 A;  3RWR D;  3RT3 C;  2VRZ A;  3OUS A;  4B3T O;  3BFR A;  4Z1V A;  2XAH A;  1TA8 A;  1TAE A;  5B1A C;  1B3Q A;  1PP9 H;  2EIM B;  2EIN B;  2M7W A;  2QR4 A;  5BMV B;  3BCC H;  1Q5O A;  1BHA A;  4DV0 B;  1Q3E A;  3ASN C;  3JCU Z;  2ETN A;  2ZE6 A;  1X4T A;  2ADP A;  1GTO A;  2PI4 A;  1NVP D;  4DR6 B;  1KBH A;  4U3J A;  1AI7 A;  1K97 A;  1XNR O;  3UKM A;  2UUB O;  3W7S A;  2BOC C;  4TV8 B;  2AHZ A;  1E79 G;  3SYQ A;  1WA8 A;  3GWO A;  2H3O A;  1XMQ O;  1YZB A;  4LF9 B;  1QNM A;  5EK0 A;  2BTQ A;  3R65 A;  2QTS A;  1IBM B;  1IBK O;  1VQ7 V;  1KP3 A;  4F6R B;  1N33 O;  3SPC A;  3E2E A;  2L35 A;  4DR5 O;  2KQX A;  3ETE A;  5C8Y A;  4YIP A;  2ZDI C;  2WLI B;  1JCH A;  2UXX A;  5JCO A;  1VQK V;  3D8C A;  5JJN B;  1OCO B;  2CTR A;  1M5I A;  4O2B A;  2FYU H;  3L72 H;  4QE7 A;  2HVJ C;  1AI5 A;  2WWW A;  1ARO P;  1YCI A;  4I4T A;  4O4L B;  4TSF G;  5J2U A;  3BRC A;  3EFF K;  4FLX A;  4TT3 G;  1YHQ V;  2KB1 A;  3NXS A;  3DGE A;  3HKC A;  1L1F A;  5HFM A;  1ORQ C;  4DV0 O;  4TOI A;  3WFV A;  1MMM A;  4DR1 B;  5KX5 B;  3NR7 A;  3T4Z A;  1F4M A;  4J11 A;  5EBW C;  4DR6 O;  5GW7 A;  3N2K B;  1XNQ B;  2MK3 A;  4CH4 A;  1SER A;  1BQZ A;  5CA1 B;  1K8A W;  1Y67 A;  3SYP A;  4NXN B;  2XAG A;  4DYL A;  3KZI Z;  2KSD A;  4LF9 O;  2NNU A;  1K92 A;  1IBM O;  5B5E Z;  3BVO A;  1ZWI C;  2QTO A;  3SJC C;  3JAR B;  2MW2 B;  3K04 A;  1QHT A;  1WLE A;  4LH7 A;  4RWU A;  3OGC C;  4MS2 A;  3K5M A;  4DUZ B;  1G6U A;  4H13 B;  4JI5 B;  5EYP A;  2JEX A;  1M57 B;  2RCV A;  1XL6 A;  4Z2W A;  5L3C A;  4Q6G A;  1B06 A;  2CK3 G;  1P49 A;  4YXW G;  2EIM C;  1SQX H;  2EIN C;  2ZNJ A;  4MW8 A;  1BCC H;  2Q7E A;  5IYC O;  3M7M X;  2NR5 A;  3ETD A;  3ABM B;  3OR7 C;  1XOU A;  1Q7Y W;  4X64 B;  1XEQ A;  4LFA B;  1K4C C;  4WFE A;  1N32 O;  3T1H B;  1R3K C;  1AJN A;  1W0K G;  1COW G;  3SGI A;  1AR5 A;  1G1X B;  3W7X A;  1KQS U;  1HNZ B;  2YS8 A;  5D5Q A;  2GHY A;  3AEI A;  3LUT B;  5LHG A;  4DR1 O;  1XUQ A;  3G4S V;  3CRM A;  2A79 B;  4CC5 A;  4X9Q A;  5LOV A;  3K57 A;  1XNQ O;  2B1I A;  2XAF A;  3RYH B;  4GT1 A;  4B08 A;  3U0Z A;  2DYR B;  4JV5 B;  2N05 A;  3A8T A;  4RUE A;  3VQW A;  2A06 H;  1R3J C;  3JCZ A;  4NXN O;  4ZI7 A;  4CH3 A;  4DV7 B;  2Q73 A;  4XBF A;  2RN9 A;  3U11 A;  1OCO C;  3H1L H;  4XDJ A;  3KCY A;  3JAT A;  2QEX V;  2R70 A;  4DUZ O;  1E1Q G;  1XIL A;  1YJ9 V;  1KC8 W;  1OZ0 A;  1H2S B;  1N0J A;  4JI5 O;  4MTO A;  4QPJ A;  2P22 C;  2LGW A;  2W6I G;  4GKJ B;  2BSK A;  4DRX A;  3K9A A;  1QVG U;  3B2E E;  1SF9 A;  4FFB B;  4KL1 A;  3QF7 A;  5IJ9 A;  4MVM A;  2YXY A;  3K03 A;  2DMX A;  1DF4 A;  5BY1 A;  1AB3 A;  4KHP B;  1P4R A;  4GX5 A;  3QO7 A;  4WBN B;  1AI4 A;  4LFA O;  4JF3 A;  1R3I C;  2HLD G;  2RMK B;  4Z1M G;  3T1H O;  2P06 A;  3EVK A;  2VWK A;  3CCE V;  4RQE A;  4IHJ A;  4X1I A;  4O2A A;  3P3P A;  1NH2 D;  1HNZ O;  3ZHU A;  4JYC A;  1AIL A;  1PV0 A;  2PI5 A;  1K5S A;  3ZED A;  4UCO A;  1K33 A;  3OW2 U;  3KKY A;  1ZUQ A;  2HG5 C;  4F4L A;  5IJ0 B;  2CUG A;  2GTA A;  4DW0 A;  3BEH A;  1IXM A;  4JV5 O;  3AK2 A;  2JJ1 G;  3A0R A;  1KMI Z;  4DK1 A;  3F7V C;  4C7U A;  3VOU A;  3WB0 A;  4BW9 A;  1M57 C;  2WA3 A;  4JI3 B;  4DV7 O;  3JD1 A;  1FXK A;  5FL7 G;  3OD4 A;  2YC0 A;  1AJQ A;  5FPO A;  2P67 A;  1VF6 C;  2RQ6 A;  2ZIN A;  3ZMV A;  4FK5 C;  3LSQ A;  1BMF G;  2WLH A;  5IY5 B;  3AG2 B;  3ZCC A;  2E5L B;  3ABM C;  1D5A A;  3ZRW A;  2QWP B;  2CTQ A;  1PPJ H;  2KG7 B;  2D2C B;  2IJK A;  5K1P A;  5LXT B;  4UV9 A;  3VBB A;  4JI8 B;  1AVM A;  3SYA A;  4KUM A;  4FFK A;  3WU2 Z;  4GKJ O;  1A32 A;  2ZXW B;  1BSM A;  4K35 A;  3EHB B;  5EZY B;  4UUJ C;  1S76 D;  4R6Z A;  1PL0 A;  4BW5 A;  1NT2 B;  2GBO A;  4JTC B;  4KHP O;  1K3E A;  4JZ2 A;  3P30 A;  4LFC B;  2JGD A;  1QLN A;  1DF5 A;  2YID A;  2PYJ A;  4UCS A;  4HYO A;  5FPR A;  2Z0A A;  3ZMS A;  4CBC A;  4UCR A;  1FD9 A;  2DYR C;  1M4U A;  4B7K A;  3AG7 A;  4I55 A;  4JI4 B;  1IUR A;  4BWA A;  1DLB A;  5IE9 A;  1VQ4 V;  1R6N A;  4UB6 Z;  4DV6 B;  4FLV A;  4D7T A;  1IDS A;  4U7O A;  3L74 H;  3APO A;  3N27 A;  1Q82 W;  3DXR B;  3OT7 A;  2O57 A;  2EUL A;  4YY3 B;  3FB8 C;  2WPD G;  4JI3 O;  1TUB A;  3B8N A;  4MT8 A;  1XHX A;  2H94 A;  4QPK A;  4X1K B;  2ZCE A;  4LC1 A;  4GKK B;  4U7N A;  1N8R W;  5KUM A;  1MA1 A;  2E5L O;  4NTX A;  3TXS A;  1RSO B;  1SA0 A;  1J95 A;  5HFL A;  2Q7G A;  5GTH Z;  3W7T A;  4JI8 O;  4J42 A;  3T1Y B;  4B3M B;  2LFR A;  1M93 A;  1ROP A;  1SQP H;  2FB5 A;  3K0G A;  4PJ0 Z;  1YVW A;  5L3E A;  3ZMU A;  3FB6 C;  2UU9 B;  1NU1 H;  1S5L Z;  1QBZ A;  3CMA V;  1IVS A;  4LFC O;  1WP7 A;  4JTA B;  5LP6 A;  4U3J B;  2QJ1 A;  3AG1 B;  1KD1 W;  4PA7 A;  2QDO A;  2DOS A;  1K9M W;  1WA8 B;  3ABT A;  4JI4 O;  2BTQ B;  2PF4 E;  1WN7 A;  1YSC A;  1V55 B;  4JAA A;  4DV6 O;  4DV5 B;  2X6C A;  2E3C A;  2Q5Z A;  3ZIA G;  1FYJ A;  4IYI A;  3FB7 C;  4FLT A;  5JQG A;  2IM9 A;  2XT9 A;  3CCJ V;  5C8Y B;  1OCC C;  5KUK A;  3L70 H;  2VQE B;  3JAW A;  2UXB B;  4YY3 O;  4DR4 B;  2W6J G;  1GKF A;  1GK9 A;  4JI2 B;  3G67 A;  5DED A;  2ZE8 A;  3BAA A;  2FTK A;  4O2B B;  2P4V A;  4PV1 B;  4GKK O;  3D3I A;  4I4T B;  2E74 B;  1H2L A;  1F51 A;  1O9G A;  3GWK C;  5J2U B;  4DUY B;  3OE7 G;  1XBL A;  1FFX A;  1OV9 A;  4LF5 B;  4JAS A;  5ITZ A;  3J81 N;  3JSN A;  3T1Y O;  4JI7 B;  1IZ3 A;  3T1C A;  5GTI Z;  2UXN A;  1QR9 A;  2X6B A;  3ZMT A;  2AZ2 A;  3ZN0 A;  4WCE V;  2E76 B;  1FS0 G;  3HKC B;  2YIC A;  3UT5 A;  4G28 B;  3ZX6 A;  2UU9 O;  2JJ2 G;  1N33 B;  4MW3 A;  3CRA A;  4L87 A;  3HKB A;  2UUC B;  1XL4 A;  2EX3 A;  1XQ8 A;  5KHH A;  2F95 B;  1Q6U A;  4AIL C;  1ENV A;  3ML0 A;  1PKX A;  4H0L B;  2WLJ A;  2QM4 A;  2Y4U A;  4CH6 A;  4QNH B;  1V54 B;  4KP4 A;  1YIJ V;  3OGI B;  3ICX A;  4DV5 O;  3FFQ A;  3AK1 A;  3SPH A;  2NN4 A;  2W0F C;  5B66 Z;  3EXA A;  5B1B B;  4UV8 A;  4GX2 A;  4CC6 A;  4W4K A;  5EYP B;  2VQE O;  2UXB O;  2JS3 A;  4FZ1 A;  4DR4 O;  3MDS A;  5CA3 A;  4CS2 A;  4JI2 O;  3CHX A;  3W7W A;  2PTM A;  5H2F Z;  3HR0 A;  1NTK H;  1XHZ A;  2ZR3 A;  3SPI A;  4H44 B;  4DUY O;  4G27 B;  3DTU B;  1JX9 A;  4LF5 O;  2DYS C;  2IH1 C;  4RUF A;  5A2Q N;  4JI7 O;  2P5O A;  4O4H A;  3JSL A;  3AG1 C;  3WB2 A;  3CRR A;  2EZO A;  3TET A;  5KMG A;  1X59 A;  5LA6 A;  4DR3 B;  4NB5 A;  1OCR B;  4N23 A;  4FIP C;  3QO5 A;  4JAV A;  1VQ6 V;  2NLJ C;  2UUC O;  5LOV B;  1BT8 A;  1G4Y B;  2GUZ A;  2ZR2 A;  3GB7 C;  4ZHQ A;  1PD3 A;  3Q4H A;  4RO2 A;  1O9H A;  1P7G A;  3JD0 A;  2KKW A;  4LF8 B;  4JGS A;  5D5P A;  2ZDI A;  5KHJ A;  3CC2 V;  2X6A A;  3X2Q B;  2LP7 A;  4ZI7 B;  5JCO C;  1YDX A;  4DR2 O;  2ZIO A;  4FMT A;  1JR9 A;  5L3G A;  2X0L A;  3ZS8 C;  4N21 A;  5LMU B;  3JAT B;  3TGU H;  4UFZ A;  3SDL A;  4UCU A;  1VQO V;  1N32 B;  3E35 A;  4HNA A;  3AG4 B;  4LP8 A;  2UUA B;  5IYZ A;  4BAY A;  1QLE B;  2BSK B;  4AQY B;  4DRX B;  1ZAU A;  3PN1 A;  1SQF A;  1Y76 A;  2ZM6 B;  1Q86 W;  2F1M A;  2WSS G;  5IJ9 B;  2C2A A;  4TWK A;  1AR1 B;  3ETQ A;  5CBG A;  3STZ C;  2VS0 A;  4AI8 A;  4O4J A;  1NH2 B;  2Y4T A;  4ASU G;  5JJE B;  2QKS A;  1H2M A;  2AZ0 A;  4IHJ B;  1Y66 A;  4X1I B;  4O2A B;  2AGA A;  2Q0A A;  4PA3 A;  3K5L A;  4DR3 O;  2Y48 A;  4I5S A;  2CTP A;  3HKE A;  3N2G A;  1V54 C;  1GRJ A;  2GV9 A;  5E79 Z;  4MVR A;  2F23 A;  4CS4 A;  2IW5 A;  5B3S B;  1E1R G;  5KHI A;  1I08 A;  5TIS Z;  2R9I A;  5B1B C;  3SJQ C;  4LF8 O;  3THO A;  4L8J A;  3OMI B;  3SJB C;  4J80 A;  2XOK G;  4WFH A;  1FXK B;  1JVM A;  3OUF A;  4WFA V;  3D36 A;  4YIO A;  4PA9 A;  1Q6I A;  4I50 A;  3BAB A;  5LMU O;  1J5E B;  1NS1 A;  1MOF A;  3E8F A;  1YTF D;  1Q6H A;  2A7W A;  3ZRW B;  3K58 A;  1Z5W A;  2XAJ A;  1F23 A;  5KA6 A;  4EFE A;  1BL8 A;  2F43 G;  2UUA O;  3CCL V;  5FNV A;  1FKA O;  4AQY O;  5L3B A;  2ZM6 O;  4PD4 F;  3H9V A;  4GUN A;  3VQY A;  2IH3 C;  1BE3 H;  1NQT A;  3RBZ A;  4DK0 A;  3ZHT A;  1CP9 A;  1BHB A;  3CCQ V;  5LHI A;  1SC5 B;  1M90 W;  2YDE A;  2DE0 X;  1ZSP A;  3SYO A;  1VP7 A;  2PYL A;  2YEV B;  3OMA B;  4GCZ A;  2JGD B;  5H5N A;  3ZHS A;  3AK3 A;  1FPO A;  2EIK B;  1GAX A;  1HR0 B;  3CPW U;  4ZBM A;  2LGQ A;  4YJ2 A;  1BGY H;  1AJP A;  3JAK A;  2XTA A;  2FL4 A;  1XMO B;  2OCC B;  2GDS A;  3QO8 A;  5DN6 G;  4I55 B;  1CXZ B;  3X2Q C;  1NKD A;  1WPB A;  4LCU C;  5GON A;  1FJG B;  4ZOL A;  4FPP A;  2ITC C;  3S3W A;  4X88 A;  3B8M A;  4JPR A;  2OTL V;  3CC7 V;  5J9P C;  2PGG A;  3SJA C;  2BE3 A;  1Q8I A;  3AG4 C;  1TUB B;  4UVA A;  1QLE C;  1Q90 D;  1YI2 V;  1H38 A;  1VIB A;  2YI8 A;  1N4C A;  2DW4 A;  4NYK A;  1J5E O;  1VQM V;  3SPJ A;  1SA0 B;  3K59 A;  4R50 A;  1QR8 A;  4CZZ A;  4A5U B;  4GLX A;  2Q68 A;  3CYO A;  4HBN A;  4FZ0 A;  3F7Y C;  1BQ0 A;  4NXM B;  1H2G A;  1GO3 F;  3K3W A;  5KAI Z;  5H6R A;  1YEW A;  4H37 A;  1D2D A;  2Q69 A;  3OTF A;  4X1Y A;  3ZHR A;  5E1A C;  4MVS A;  1VQ5 V;  3TCU A;  1ZX3 A;  5KHG A;  2ZD9 A;  5LP6 B;  5LHH A;  3QVN A;  2JK5 C;  4JI1 B;  5IYB O;  1HR0 O;  1R1B A;  2HFE C;  2P4K A;  3K08 A;  3ABL B;  4FLU A;  1KKD A;  1XMO O;  3H1H H;  1ZTE A;  3OMN B;  3IFX A;  4IYH A;  4DV1 O;  4K8X A;  4I7Z B;  2VWJ A;  3LSS A;  2WLN A;  1FJG O;  1FXK C;  3CSX A;  1T5E A;  1TGO A;  3F5W C;  2Y0P A;  1AR4 A;  1VF6 A;  4EB6 A;  5KAF Z;  3RYC A;  3B09 A;  3JAS A;  1VQP V;  5JQG B;  2F66 C;  4WFG A;  2LFS A;  3JD2 A;  4LWS A;  3JAW B;  4E2L A;  3K79 A;  1VF7 A;  1HP8 A;  3FYI B;  2K9P A;  4TV9 A;  1LUV A;  2YEV A;  4OPH A;  3I56 V;  2W0X A;  3QTC A;  3CE2 A;  4DR7 B;  3FYE B;  1FFX B;  2EZP A;  5LGN A;  5ITZ B;  3HB3 B;  3CCU V;  1R6K A;  1B04 A;  5JJJ B;  1PM9 A;  1K73 W;  2EIK C;  4NXM O;  4NVP A;  1RM1 B;  1JQ0 A;  2XUM A;  4WFF A;  4IT5 A;  3UT5 B;  1H8H G;  1YF2 A;  4PHZ A;  4K3A A;  3QG5 A;  2OCC C;  1WPX A;  4DO2 A;  1TVK A;  3STL C;  3HKB B;  4ZIB A;  5LGU A;  2G38 A;  5EC2 C;  3I55 V;  4JI1 O;  2E75 B;  4O4I A;  1Q43 A;  1EN4 A;  3FKS G;  1S5H C;  2QM8 A;  2DQ3 A;  3ZJZ A;  3ZRV A;  4LBE C;  1N34 B;  3K5O A;  2Q4P A;  2Q8V A;  4LF6 B;  1PL4 A;  4TQD A;  1S5J A;  2UXC B;  1SQB H;  1SQQ H;  2X7R B;  4J7Z A;  4OX9 B;  2HHH B;  2CGN A;  2ILM A;  3ZRX A;  1AI6 A;  5EIB C;  3APQ A;  2QWQ B;  4IGG A;  1SQV H;  3ABK B;  2CTW A;  4TUY A;  4FM0 A;  1NVP B;  1QQC A;  4B7E A;  2OTJ V;  2JVD A;  4W4L A;  4PI2 A;  1LUW A;  3E8B A;  3FAV A;  3T4D A;  3F5T A;  1JJ2 U;  3K9S A;  4DR7 O;  4J41 A;  2LW1 A;  2XAS A;  2QWR B;  5BR8 B;  5LL6 Y;  1G8M A;  5LYJ A;  4O4H B;  5LP6 C;  3SYC A;  2M6Y A;  4EEQ A;  3ASO B;  2RDC A;  2B9Z A;  4J10 A;  3HPL C;  1KUQ A;  5JH7 A;  5KMG B;  5CBF A;  3ABL C;  3JAL A;  3G71 V;  5LA6 B;  1DK1 A;  4LR3 A;  1VQL V;  4H33 A;  3D3Q A;  1YXB A;  3ZRS A;  5IY5 C;  3AG2 C;  3T2M A;  2ZIM A;  2GUZ B;  4IIJ A;  4JTD B;  4ZHQ B;  3UQ8 A;  3Q4H B;  2QM7 A;  3ZHQ A;  3RYF A;  1JFF A;  2Z5U A;  2ZXW C;  3RGB A;  4FM1 A;  2B5U A;  3CX5 F;  1N34 O;  1I0H A;  3RYI A;  1N36 B;  4LF6 O;  4B3R B;  4MSW C;  4TQF A;  1HW7 A;  2UXC O;  4PDV A;  3HKD A;  4LH6 A;  4OX9 O;  3LDD A;  1K7D A;  2OIE A;  4HAM A;  2HHH O;  2Q7H A;  3AG3 B;  3C3S A;  1CEZ A;  3RW0 A;  4HNA B;  3E22 A;  1GN6 A;  1W2B U;  2P90 A;  3OEH G;  5IYZ B;  1PNK A;  1GMG A;  2JRI A;  4X62 B;  1AP6 A;  1XRE A;  3L71 H;  1RM1 C;  4BR6 A;  1Y76 B;  3QNE A;  5CA0 A;  3OEE G;  2ATK C;  1L0N H;  1THZ A;  2WLK A;  3CJH A;  1MZF A;  1BZK A;  4X20 A;  4X89 A;  5BR8 O;  3DC6 A;  4O4J B;  3U10 A;  2QKA A;  4E4E A;  4PI0 A;  1KYO F;  4X65 B;  1FXH A;  1KP2 A;  5KA5 A;  4DR2 B;  5JWP A;  4OPA A;  5K1X A;  4XDL A;  3LDC A;  4BIO A;  1KB9 F;  4YJ3 A;  3CS5 A;  3HKE B;  3N2G B;  1OJH A;  1U97 A;  2ZKO A;  2EJ7 A;  1QU7 A;  3G6E V;  1Q81 W;  1EZJ A;  5A9G A;  2YIB A;  1MSW D;  1TUE B;  1K34 A;  3DC5 A;  2YI9 A;  4WFB V;  3ABK C;  1N36 O;  2CDY A;  1YTF B;  2YIB D;  4B3R O;  1BS3 A;  1MZE A;  1D5N A;  2WLL A;  2DWD C;  4XDK A;  4I50 B;  4I0X A;  1SET A;  1MAB G;  4QIW F;  4MVZ A;  1WB7 A;  4GX1 A;  1ZL8 A;  2A3Q A;  3FX7 A;  5JVD A;  3CXC U;  4KFM A;  1S0V A;  3CRC A;  5FNV B;  1GH6 A;  4X62 O;  5AG2 A;  1GN4 A;  1F7Y A;  2R72 A;  3OM3 B;  5CB4 A;  3ASO C;  1OCZ B;  4QJF B;  1V9P A;  1R3L C;  4P2Z A;  4YHH B;  3L75 H;  2HVK C;  2QGN A;  4IL6 Z;  1V55 C;  4BIZ A;  1S3J A;  4J9Z B;  4MVU A;  4EFB A;  3UO2 A;  2QSA A;  2BCC H;  3ZBH A;  3A2F A;  2OWO A;  2FML A;  2HP8 A;  4BIU A;  2OT5 A;  1P84 F;  4FVM A;  5CBH A;  1HWY A;  4X65 O;  2XND G;  1JMK C;  3PJS K;  3RVY A;  3BPZ A;  2FKX A;  2WLM A;  5LGT A;  3P32 A;  4YJ2 B;  3E83 A;  2GSM B;  3JAK B;  2LW7 A;  2A9H A;  1Y74 A;  2CE4 A;  3L73 H;  5KLV H;  1Z2G A;  2OIG A;  3OAA G;  5GON B;  2CH7 A;  2N04 A;  4ZOL B;  1NZ6 A;  3TXQ A;  2Z3Y A;  1EBO A;  3AG3 C;  1RPR A;  4PEL A;  3LNM B;  1LNQ A;  4NTW A;  3RVZ A;  1Y4M A;  2IU3 A;  2YXH A;  1WJZ A;  3UCS C;  3IJ4 A;  5IWA B;  1LR1 A;  4RQF A;  3BA8 A;  1I5Y A;  4UVB A;  2Y69 B;  4J7K A;  4I9Q A;  5J2T B;  2QA4 V;  5DEC A;  4DV2 B;  2B1G A;  2OYQ A;  5KHK A;  1XI1 A;  1YJN V;  4FLW A;  1CPY A;  2F93 B;  2OCH A;  2HJF C;  4GZR B;  3JAM N;  1M56 B;  2ITD C;  1GM9 A;  4MTX A;  1H8E G;  4YHH O;  1EFR G;  4X1Y B;  2ZQM A; 
#chains in the Genus database with same CATH homology
 2LFR A;  4FJC C;  1ROP A;  5IDJ A;  3K0G A;  5E1A C;  2Q6A A;  4MVS A;  1R73 A;  5L3E A;  2R9R B;  3OUS A;  3ZMU A;  1VQ5 V;  3TCU A;  1YIT V;  2XAH A;  3FB6 C;  5B1A C;  3LDE A;  2ZD9 A;  2EIM B;  2EIN B;  1QBZ A;  2M7W A;  5LHH A;  3CMA V;  2JK5 C;  5IYB O;  1BHA A;  5LBQ A;  3ASN C;  2HFE C;  1MG1 A;  2P6J A;  4JTA B;  3K08 A;  3ABL B;  1SRY A;  3AG1 B;  1GTO A;  3CD6 V;  1B6Q A;  2PI4 A;  1KKD A;  1KD1 W;  1NVP D;  4PA7 A;  3ETG A;  3OMN B;  1AI7 A;  1K97 A;  1K9M W;  3IFX A;  3TK1 A;  4Q20 A;  3UKM A;  3LSS A;  1P7B A;  3W7S A;  5L3F A;  2WLN A;  2BOC C;  1FXK C;  1QVF U;  2AHZ A;  3ABT A;  1JOY A;  1E79 G;  3F5W C;  3SYQ A;  3GWO A;  1YSC A;  1VQP V;  1V55 B;  4WFG A;  2X6C A;  5EK0 A;  3ZIA G;  3R65 A;  2QE7 G;  2LFS A;  3JD2 A;  1OCR C;  3FB7 C;  3CCJ V;  1OCZ C;  1VQ7 V;  1KP3 A;  1M9N A;  4E2L A;  3K79 A;  2H8P C;  1OCC C;  1W0J G;  5KUK A;  3SPC A;  3FYI B;  3E2E A;  4UVC A;  2YEV A;  1FFT B;  3ETE A;  3I56 V;  2W6J G;  4GX0 A;  1GKF A;  2ZDI C;  1GK9 A;  2WLI B;  1JCH A;  2DWE C;  2UXX A;  5H9C A;  1VQK V;  5C93 A;  2FTK A;  3FYE B;  2EZP A;  5LGN A;  2WLI A;  2AHY A;  3D3I A;  3WG7 B;  3HB3 B;  2EBO A;  1OCO B;  3CCU V;  1R6K A;  1PNM A;  1F51 A;  1PNL A;  1K73 W;  2EIK C;  4QE7 A;  1RM1 B;  3OE7 G;  1JQ0 A;  2HVJ C;  1AI5 A;  4WFF A;  4JAS A;  2WWW A;  1ARO P;  1H8H G;  2WAM A;  3T1C A;  4TSF G;  2UXN A;  1S72 V;  5EBL C;  3EFF K;  1QR9 A;  2X6B A;  3ZMT A;  3ZN0 A;  4WCE V;  3BY6 A;  4TT3 G;  1FS0 G;  4EKW A;  1YHQ V;  2JDI G;  1QCE A;  2KB1 A;  2OCC C;  1WPX A;  2EIJ B;  4DO2 A;  1M1K W;  3E8G A;  4G28 B;  3STL C;  3JD3 A;  3NXS A;  3CCR V;  3DGE A;  5LGU A;  1L1F A;  5HFM A;  2JJ2 G;  3OFN G;  5EC2 C;  3OR6 C;  4MW3 A;  3I55 V;  4L87 A;  1VQ9 V;  1ORQ C;  3WFV A;  3UM7 A;  5B1N A;  3FKS G;  1XL4 A;  1S5H C;  2QM8 A;  2DQ3 A;  3ZJZ A;  3ZRV A;  3T4Z A;  1F4M A;  4LBE C;  5EBW C;  1GM7 A;  3MHS C;  1ENV A;  5GW7 A;  3ML0 A;  2Y69 C;  2MK3 A;  1PKX A;  1SER A;  4X8A A;  2WLJ A;  2X7R B;  4QNH B;  1V54 B;  3SYP A;  4KP4 A;  3ZRX A;  1K8A W;  1AI6 A;  1YIJ V;  2XAG A;  1SZT A;  3IGA C;  2NNU A;  4G2K A;  1K92 A;  3ABK B;  1M56 C;  3SPH A;  1ZWI C;  2QTO A;  2W0F C;  1NVP B;  4PDR A;  5B1B B;  1VQN V;  3CC4 V;  3K04 A;  4UV8 A;  2OTJ V;  4GX2 A;  1WLE A;  3OGC C;  4MS2 A;  3E8B A;  5CA3 A;  3T4D A;  5B3S C;  3CCS V;  2JEX A;  1M57 B;  1JJ2 U;  1XL6 A;  3W7W A;  5L3C A;  2IJJ A;  1YJW V;  2CK3 G;  2XAS A;  1F4N A;  2HKO A;  3H01 A;  3K0D A;  4MTG A;  1G8M A;  2ZR3 A;  4YXW G;  2EIM C;  3SPI A;  2EIN C;  4MW8 A;  4G27 B;  3SYC A;  3W7U A;  5L3D A;  3ASO B;  3DTU B;  5IYC O;  1JX9 A;  2DYS C;  2IH1 C;  4RUF A;  3ETD A;  3ABM B;  3HPL C;  3OR7 C;  1Q7Y W;  5CBF A;  3ABL C;  3AG1 C;  1UJW B;  3G71 V;  1VQL V;  2IU0 A;  2EZO A;  1K4C C;  4H33 A;  4WFE A;  3TET A;  2EIL B;  1R3K C;  3ZRS A;  5IY5 C;  3AG2 C;  3T2M A;  1AJN A;  1OCR B;  2A0L A;  1W0K G;  4N23 A;  3B77 A;  4FIP C;  1COW G;  3QO5 A;  4JAV A;  4JTD B;  1OCC B;  3W7X A;  1KQS U;  1VQ6 V;  2QM7 A;  2NLJ C;  2V7Q G;  3E89 A;  2Z5U A;  2GHY A;  3AEI A;  1G4Y B;  3LUT B;  1NR1 A;  3M99 B;  5LHG A;  3IC7 A;  1NJI W;  2ZR2 A;  3GB7 C;  2ZXW C;  3G4S V;  1PD3 A;  2A79 B;  2B5U A;  4RO2 A;  3JD0 A;  4UXN A;  2B1I A;  2XAF A;  4GT1 A;  4JGS A;  4MSW C;  2ZDI A;  3CC2 V;  2DYR B;  2X6A A;  3X2Q B;  2LP7 A;  4PDV A;  4RUE A;  3LDD A;  1K7D A;  4HAM A;  4FMT A;  3JYC A;  3AG3 B;  5L3G A;  1R3J C;  3JCZ A;  5BZB A;  3SPG A;  2X0L A;  4N21 A;  3RW0 A;  1CEZ A;  3ABU A;  1W2B U;  2P90 A;  5EC1 C;  1RPO A;  4XBF A;  1OHH G;  3OEH G;  3WG7 C;  1OCO C;  1VQO V;  3E35 A;  1PNK A;  1GMG A;  3CME V;  4XDJ A;  1RM1 C;  3AG4 B;  3QNE A;  3OEE G;  4MVQ A;  2ATK C;  4LP8 A;  2QEX V;  1E1Q G;  1YJ9 V;  1THZ A;  2WLK A;  3K06 A;  1OZ0 A;  5CMU A;  1QLE B;  4BAY A;  1KC8 W;  1I5X A;  4MTO A;  4QPJ A;  1Q86 W;  3CP1 A;  4X89 A;  2WSS G;  2W6I G;  2EIJ C;  5B1O A;  2C2A A;  4TWK A;  1AR1 B;  3K9A A;  5H6Q A;  1QVG U;  4P9O A;  1FXV A;  5CBG A;  3STZ C;  4MVM A;  1FXH A;  1NH2 B;  3K03 A;  1KP2 A;  1DF4 A;  4J9Y B;  2IJI A;  1SES A;  4ASU G;  5KA5 A;  1P4R A;  4GX5 A;  2QKS A;  3QO7 A;  1AI4 A;  4XDL A;  3LDC A;  4JF3 A;  1R3I C;  2HLD G;  1Y66 A;  1JPX A;  4Z1M G;  2HR3 A;  4PA3 A;  2DQ0 A;  3CCE V;  2JEU A;  4PA4 A;  4PA6 A;  4RQE A;  2Y48 A;  3G6E V;  4I5S A;  4DXW A;  1Q81 W;  1NH2 D;  5B1A B;  1EZJ A;  3KG2 A;  1MSW D;  1V54 C;  1TUE B;  1K34 A;  5IYD O;  4JYC A;  2PI5 A;  1K5S A;  4PDM A;  2EJR A;  4MVR A;  4WFB V;  1K5Q A;  3ASN B;  1K33 A;  2IW5 A;  2WLL B;  5B3S B;  3OW2 U;  3ABK C;  1E1R G;  2HG5 C;  3FB5 C;  4F4L A;  1YTF B;  2R9I A;  5B1B C;  3SJQ C;  3BEH A;  2WLL A;  2DWD C;  4XDK A;  1IXM A;  3OMI B;  2JJ1 G;  1K4D C;  1SET A;  3A0R A;  2XOK G;  3F7V C;  1MAB G;  1FXK B;  4WFH A;  1JVM A;  4QIW F;  2DYS B;  3OUF A;  4MVZ A;  3D36 A;  3VOU A;  4WFA V;  4GX1 A;  1M57 C;  4PA9 A;  4HZ3 A;  3CXC U;  4KFM A;  1S0V A;  3JD1 A;  1FXK A;  1MOF A;  3E8F A;  5FL7 G;  1YTF D;  4QE9 A;  1AJQ A;  3ZRW B;  4PDL A;  2P67 A;  2XAJ A;  3OM3 B;  3ZMV A;  4FK5 C;  3LSQ A;  1F23 A;  1BMF G;  3ASO C;  2WLH A;  5IY5 B;  4JAU A;  3AG2 B;  5KA6 A;  1OCZ B;  3ZCC A;  1BL8 A;  4QJF B;  3ABM C;  2F43 G;  3ZRW A;  4P2Z A;  1KEC A;  1R3L C;  3CCL V;  2IJK A;  2HVK C;  3MHH C;  5L3B A;  4UV9 A;  3VBB A;  1V55 C;  2IH3 C;  4BIZ A;  1S3J A;  1NQT A;  4J9Z B;  4MVU A;  3RBZ A;  4KUM A;  3SYA A;  1CP9 A;  4ZKI A;  1BHB A;  2Q67 A;  5DM6 V;  3CCQ V;  2EIL C;  2ZXW B;  5LHI A;  1M90 W;  1VQ8 V;  3EHB B;  3SYO A;  4BIU A;  4I9W A;  2OT5 A;  2XAQ A;  2YEV B;  5CBH A;  1HWY A;  2XND G;  4JYB A;  4UUJ C;  1S76 D;  3OMA B;  3PJS K;  2JIZ G;  4GCZ A;  3RVY A;  4R6Z A;  3ZN1 A;  1PL0 A;  2WLM A;  4BW5 A;  5LGT A;  3P32 A;  5CN0 A;  4RAI A;  4JTC B;  3E83 A;  2EIK B;  1K3E A;  2GSM B;  3E8H A;  2A9H A;  3P30 A;  1DTO A;  1QLN A;  1DF5 A;  3CPW U;  4ZBM A;  1AJP A;  4HYO A;  3OAA G;  3ZMS A;  4CBC A;  2BOB C;  2OCC B;  3QO8 A;  5DN6 G;  2DYR C;  3X2Q C;  1NKD A;  2Z3Y A;  1EBO A;  4LCU C;  3AG3 C;  1RPR A;  2V1D A;  4PEL A;  3LNM B;  1LNQ A;  1NBM G;  4FPP A;  2ITC C;  2K1E A;  1Y4M A;  2IU3 A;  4P30 A;  4X88 A;  3B8M A;  3RVZ A;  1DLB A;  4JPR A;  1VQ4 V;  2OTL V;  3CC7 V;  5J9P C;  4R7C A;  1R6N A;  3E86 A;  3CCM V;  3CCV V;  1GM8 A;  4U7O A;  5EBM C;  4WF9 V;  4RQF A;  3AG4 C;  1I5Y A;  4UVB A;  2Y69 B;  1Q82 W;  4UVA A;  4P9P A;  1QLE C;  2IJH A;  4MVO A;  2QA4 V;  1YI2 V;  3FB8 C;  2WPD G;  2B1G A;  1H38 A;  2DW4 A;  3B8N A;  1YJN V;  1VQM V;  4MT8 A;  2H94 A;  2D3O W;  4QPK A;  3SPJ A;  1CPY A;  4LC1 A;  1S77 D;  4R50 A;  2HJF C;  3JD4 A;  1QR8 A;  4CZZ A;  2P7T C;  1M56 B;  4OXS A;  1NR7 A;  4U7N A;  2ITD C;  1N8R W;  1GM9 A;  2Q68 A;  3CYO A;  5KUM A;  4R8C A;  2YSU B;  4MTX A;  1H8E G;  3F7Y C;  4MTF A;  1J95 A;  1EFR G;  1H2G A;  2ZQM A;  5HFL A;  1GO3 F;  3K3W A;  5H6R A;  3MD0 A;  4H37 A;  3W7T A;  3ZMZ A;  2Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...