4RUFA

Human k2p4.1 (traaak) potassium channel, w262s mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
257
Chain Sequence
GPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPESHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVSFWILLGLAYFASVLTTIGNWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 81
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rufA00
3E8FA 1XL4A 4PA4A 2EINC 2R9RB 2JK5C 2KB1A 1K4DC 3HPLC 4G28B 4EKWA 5CBHA 3IFXA 1JVMA 5KUKA 2IH1C 3LUTB 4KFMA 4MTFA 3E89A 4LBEC 3OR6C 3SYOA 3ZRSA 4PDLA 1G4YB 4TWKA 2WLLA 2W0FC 2DYSC 3ASNC 2QTOA 4MVOA 3UKMA 1R3LC 3ASOC 2HVKC 3T1CA 4GX1A 4X88A 2HVJC 2X6AA 4QNHB 5EC2C 4MW3A 2YEVA 5B1BC 3UM7A 3RVYA 4H37A 4CBCA 3TETA 3E83A 3SPIA 2HFEC 1V54C 2Q69A 2H8PC 2DWDC 4JTAB 3GB7C 3SPJA 3AG2C 1LNQA 3ABMC 4X8AA 5KUMA 3SPHA 3K04A 1V55C 3SPCA 3SYPA 2P7TC 4PDMA 2Q6AA 4PDRA 1K4CC 4MVRA 3E8GA 3KG2A 4XDJA 4WFGA 3K03A 1M57C 2BOBC 4G27B 4UUJC 4MS2A 3T4ZA 4OXSA 4MVSA 2ATKC 3WG7C 3JYCA 3LDCA 3E8BA 2IH3C 5CBFA 4RUFA 5EC1C 4MVZA 2WLJA 2K1EA 3RBZA 2WLLB 5B3SC 1XL6A 5IY5C 3T2MA 1R3KC 3SYAA 2ITCC 3AG3C 3BEHA 3FB5C 3IGAC 2DWEC 2QKSA 3SYCA 1QLEC 2WLIB 1M56C 3ZJZA 4GX5A 4RO2A 4F4LA 4GX0A 3OGCC 4H33A 3SYQA 3RVZA 4J9YB 1BL8A 4MVUA 4JTDB 5CBGA 3SJQC 3F7VC 3F7YC 4P30A 3X2QC 3LNMB 4MW8A 4P9OA 4MSWC 4LCUC 2ZD9A 4QE9A 4R7CA 3RW0A 3AG4C 1OCOC 3VOUA 3FB6C 4MVMA 4HYOA 4WFFA 2HG5C 1OCCC 1ZWIC 4R50A 3FB7C 4ZBMA 1ORQC 3E86A 4DXWA 2WLMA 4PA6A 1J95A 2DYRC 4XDKA 5EBLC 5B1AC 2OCCC 2EIMC 4WFEA 3TCUA 2WLKA 2AHYA 4J9ZB 3OR7C 3PJSK 3SPGA 2Q67A 3AG1C 4GX2A 4PA3A 4WFHA 4BW5A 5J9PC 3ABKC 4JTCB 4MTGA 4MVQA 2Y69C 3EFFK 5BZBA 1OCRC 2WLHA 5EBWC 2A0LA 2ZXWC 2AHZA 3F5WC 4PA9A 5EK0A 4X89A 2ITDC 2EIKC 5EBMC 3E8HA 3STLC 1KKDA 2X6BA 3K08A 4RUEA 3LDEA 2NLJC 4P2ZA 3OUFA 3LDDA 1R3IC 2HJFC 3ABLC 4QE7A 4HZ3A 2WLNA 4XDLA 4R8CA 3K06A 4I9WA 2A9HA 3K0DA 2A79B 4PA7A 2X6CA 1R3JC 2WLIA 3OUSA 4LP8A 5E1AC 2EILC 4P9PA 3T4DA 4MTOA 2Q68A 1S5HC 4RAIA 2BOCC 3R65A 3FB8C 3STZC 3K0GA 1OCZC 2EIJC 4R6ZA 4PDVA 1P7BA
chains in the Genus database with same CATH superfamily
3UCSC 4RWUA 3G67A 5B1OA 4B08A 4NYKA 5CBHA 1XMOO 1B04A 1Q6IA 2D2CB 2FTKA 1N33B 4A5UB 1KD1W 3B4SA 1EN6A 5KA6A 2ZM6B 2DYSC 4DR5B 3G80A 2QTOA 1YTFD 1NZ6A 1DLBA 2DWDC 2CDYA 3CCMV 4W4KA 5LP6A 2Z0AA 5LOVB 4QIWF 1BS3A 1BHAA 3K03A 2QWPB 2E75B 1VQ8V 1EZVH 4IYIA 1Y76A 5HFLA 5B3SC 4TUYB 3CC2V 1K9MW 5FLXN 4LFCB 2KG7B 3ZJZA 4ZIBA 5LL6Y 1AI5A 2HHHB 5LMUO 1GN6A 1P7GA 4NXMO 4TT3G 5B5EZ 5EYPA 4X9QA 3LNMB 4AILC 3G4SV 4MT8A 1HW7A 2EIMB 5CA0B 1F4MA 3AG4C 3RW0A 4MVMA 3JAWB 1MG1A 4PA6A 1YF2A 4XDKA 2ZXWB 3TCUA 4I9QA 2Q7HA 4MVQA 5L3BA 1YITV 4LC1A 3F5WC 1I94O 1BMFG 3HKCA 2AZ2A 4OX9O 3K08A 2E76B 5BR8B 4TQFA 3DXRA 3APOA 4KHPO 2YSUB 4JI3B 2WLNA 3H9VA 2PTMA 3ABTA 3TXSA 4LF6B 1N0JA 4RAIA 1K33A 1L8DA 4AHCA 4CBCA 1P7BA 4X66B 1DF5A 2F1MA 5KA5A 3LSQA 2JEUA 3WG7B 3JCUZ 4H44B 1JVMA 5KUKA 3SJCC 4X62O 4DUZB 2JJ1G 4PDLA 2W0XA 1Q5OA 2MW2B 2BTQB 4DK0A 1QVGU 1H2KA 3BY6A 1N34B 2Z3YA 1FJGB 4DK1A 1B6QA 3FYIB 4XBFA 1NH2D 2H8PC 4ZOLA 1N33O 1SZTA 2UU9B 2CGOA 2LGQA 3M99B 4FM0A 1E79G 2RNBA 1WNSA 4CH3A 5A2QN 2B9ZA 4QPKA 5BY1A 1CEZA 3BPZA 4UB8Z 1T5EA 4YJ2B 3T2MA 5IY5C 1R3KC 1MMMA 3IGAC 2YC0A 2YIDA 2DJVA 1US6A 4JYYA 2JEXA 3BA9A 3OGCC 1YJWV 4LF8O 5LP6B 3IC9A 4P9OA 3AK3A 1KQSU 1D5AA 4LFCO 2O57A 1OCZB 1ZWIC 3FB7C 4ZBMA 4JYCA 1IBMB 1YTFB 2HHHO 2EIMC 2BSKA 3ZMTA 5B66Z 1Y76B 2P4VA 2Q0OC 3MAQA 1IBKB 1M93A 2RN9A 2A0LA 2ZXWC 4IHJA 5KAIZ 1FFTB 4NXNB 2QWQB 3STLC 1RPRA 2ZE7A 3ZX6A 2LQTA 1WAZA 1I08A 3EHBB 4TV8A 3CCJV 5EYPB 4FM2A 4MTXA 2N04A 4ASUG 3OEEG 4LP8A 3GVMA 1GM8A 4X1KA 1JFFA 1I0HA 4L8JA 4X1YA 2UXXA 4DV5B 3HPLC 1GTOA 3UT5B 1GAXA 1IXMA 2LP7A 3ICXA 4LF6O 3HKCB 2AXTZ 4WBNA 3BCCH 3IAYA 3DXRB 4TWKA 2EX3A 2DQ0A 4KXRA 4UB6Z 4X66O 1IBLB 1U96A 1P49A 2GUZB 1Y6XA 5JJJB 2EULA 4UCOA 4DUZO 4LFAB 1QU7A 3EXAA 1GMGA 2P7TC 4U3JA 5FPOA 3VQXA 1VF6C 4OXSA 2ZKOA 4EFBA 3B8MA 2LW7A 4MVZA 2UU9O 3JCZA 2JS5A 3RFRA 2Q5ZA 3DTUB 3CCRV 4ZOLB 4JGSA 4MW8A 4K3AA 3CPWU 1B3QA 4JI1B 2R72A 1JX9A 4GZRB 2IJKA 2Q9LA 4F6RA 2VRZA 1S76D 3ABKB 5JVDB 3D3IA 3JAKA 2A7WA 2LGWA 3BAAA 3ETEA 1SA0A 1M4UA 1NBMG 3RYHA 4CC6A 3B8NA 5KHGA 1KKDA 2RJZA 3AG7A 4JI8B 2QWOB 2A06H 4P2ZA 3OW2U 2WAMA 2UUBB 2IBZH 2A79B 5LHHA 2PGGA 1IBKO 5JQGA 4NXNO 2QEXV 3QVNA 2BSKB 4LH7A 3B2EE 4PA4A 2RCVA 1VQLV 4ZHQA 4LF4B 2QR4A 1S77D 3ASNB 4IHJB 2IJJA 3ASOB 5KHIA 1WA8A 4JYAO 3K5NA 4TV8B 3TGUH 4X88A 3L74H 4O2AB 2V1DA 1NR1A 3BRCA 4YJ3A 4X1KB 1M1KW 2E5LB 1JFFB 4B3SB 5KUMA 2Y4UA 4X1YB 2Q6AA 3QO5A 3VBBA 3M8AA 1IBLO 1XNQB 4UUJC 4U7NA 4WBNB 3ZN0A 1H2MA 3BEHA 3OGIB 1FXKC 4J42A 4RO2A 2N74A 4FLYA 2YICA 4O4LA 4YY3B 3F7VC 3X2QC 3QNEA 3J7AU 4HYOA 1Q90D 1KBHA 1EBOA 1W2BU 2XAHA 3SJAC 3KCXA 4PA3A 2YI9A 3ABKC 3D3QA 3B40A 1JR9A 3EFFK 5DN6G 2XNDG 1OCRC 4DV3B 4JI1O 3F5TA 2EBOA 2RMKB 1NTZH 1O9GA 5LXTA 3QO8A 4K8ZA 4CH6A 4R8CA 1E1QG 2WLIA 1L0LH 2BOCC 1NKDA 5ITZA 1S3JA 4JI8O 1SA0B 1KECA 4LR3A 1WJZA 1H8HG 3RYHB 2UUBO 3T1YB 4DR3O 1AB3A 3B77A 2NN4A 1NVPD 3CSXA 3U10A 3ASNC 1LUWA 2P90A 2WA4A 5LA6A 3ASOC 2JRIA 4GX1A 4MW3A 2YEVA 3K5LA 5JQGB 1KUQA 4GKJO 1WN7A 1UJWB 2B1GA 4CS4A 2X0LA 1ZAUA 1K4CC 4ZHQB 3AG1B 1S5JA 2JS3A 2ODMA 3CE2A 1XQ8A 4GLXA 1ROPA 5EC1C 2XASA 5F2VO 2E5LO 4KUMA 1Q6UA 4UV9A 4PI0A 1XNQO 3Q4HA 1E1RG 3NXSA 5H9CA 4YIOA 4YJ3B 3TK1A 3F7YC 4P30A 1WPXA 5AG2A 4DV2O 2BCCH 3SGIA 4QE9A 2AGAA 1OCOC 3CWBH 5H6QA 4GT1A 5CA3A 2Q8VA 5LMUB 1XILA 1ZSPA 4JI6B 4NXMB 4RQFA 1H8EG 1FAFA 1QQCA 3CCEV 4FLZA 3LSUA 3K5OA 1FXHA 4BW9A 4DW1A 1XNRO 1NTMH 4O4LB 1MNGA 1PKXA 1VQ5V 1LUVA 3KCYA 1RFYA 3OTOO 4OX9B 4DV3O 4JAUA 1YZBA 5IYZA 1PNMA 4ICGA 2EIJC 3L72H 1VQOV 2QKCA 2QTSA 4FFBA 4KL1A 3BHPA 3IFXA 1IZ3A 3P30A 2CTWA 1SKVA 3E89A 3OR6C 3HKBA 3CEIA 2F23A 2XAFA 1G4YB 1SC5B 5LXTB 1R73A 1V54B 1L1FA 1VQ9V 3CD6V 4BIOA 4WCEV 2G38A 1X59A 1KKCA 3CS5A 1VQ6V 4X62B 2F66C 1XMQO 2QWRB 3T1YO 4I5SA 4EB6A 2B1IA 2CUGA 2IJHA 5KHJA 5C8YA 5ITZB 5JJNB 4LF5O 2QA4V 5D5QA 1Y66A 2NR5A 3QTCA 3A0RA 1TGOA 1KYOF 3KZIZ 4MVSA 4OPHA 2JDIG 1M56B 3LDCA 4NVPA 1VF7A 3IJ4A 2ARHA 5HFMA 2YUAA 5LA6B 1YSCA 3CCQV 2DWEC 3CC7V 1BQ0A 4J80A 2HP8A 2ZIOA 5E79Z 3ABLB 2KSDA 3FKSG 4H33A 4J9YB 4MVUA 3VQWA 1ENVA 3VOUA 1RP3B 1NVPB 4LF8B 3E86A 2WLMA 1AJNA 2GV9A 4DR4B 2QWNB 1F7YA 1HNXO 4FLWA 4NTYA 3SPGA 4GX2A 2VWJA 2RDCA 1QR9A 2QM4A 3Q4HB 2CGNA 4X89A 3OM3B 4JI6O 3HR0A 4DYLA 2CK3G 3LDDA 3ZMVA 1NT2B 4WFAV 4Z1MG 4B3TO 1AROP 1ZTEA 2EILC 2Q68A 2P6JA 1VF5B 1COWG 1EZJA 1TA8A 2YI8A 4X65O 4NR1A 2GDSA 4TOIA 3ZRSA 1I5YA 2WWWA 4O4IA 1R3LC 1WLEA 4QNHB 5DM6V 2YXYA 1TUEB 1V54C 5IYZB 2X7RB 5LYJA 1LNQA 4LH6A 3RWRD 3ZRWA 4JI4B 1OHHG 3JAMN 4FFBB 2ETNA 4WFGA 2LW1A 3AG3B 4DO2A 1LR1A 2YIBD 1QLEB 3HKBB 3E8BA 2K1EA 2PI5A 4UXNA 2FYUH 1JJOA 3SYCA 1M56C 4GX5A 4YXWG 2E74B 4EB6B 4F4LA 4GX0A 1QCEA 2Q73A 5C8YB 3M7MX 1D2DA 1N32B 1AILA 4JTDB 4LCUC 2YIBA 2P06A 2GTSA 2E3CA 5IJ0A 5EBLC 3AK2A 1GRJA 5J9PC 1FYJA 2L35A 5BZBA 4B7EA 1MZFA 1VQPV 5EBMC 4O4HA 2KQXA 4DV1B 2GSMB 3LDEA 3C3TA 4DR4O 2JGDA 3D36A 3JARA 1KP3A 5LGTA 5E1AC 4D6TH 4FZ1A 3ZEDA 2W6IG 3R65A 1QNMA 1SQXH 1QR8A 3S3XA 1P4RA 1SQGA 2IH1C 1GM9A 2F93B 1G1XB 2UXNA 5B1BB 3N27A 3CCSV 1FFXA 3J80N 1THZA 4JYAB 3H1IH 3I55V 4JTAB 2PI4A 1EFRG 2ZNJA 4JZ2A 3SYPA 5JCOA 2Q7GA 3P3PA 3CHXA 4JPRA 5LHIA 1XUQA 5BMVA 3WG7C 1JOYA 3L9DA 3G6BA 3ZBHA 4O4IB 1BHBA 4Z1VA 2OIEA 2ITCC 3AG3C 5LGUA 2EIKB 4JI4O 5JWPA 4DV4O 1QLEC 2PYLA 4JZGA 1YIJV 3T1HO 2CE4A 2ZDIC 2XAGA 4I50A 5LYJB 3SJQC 1GM7A 1KP2A 2XAJA 3CXHF 5IT9N 2LO1A 4R7CA 3HKEA 1VQNV 2F95B 1AI6A 5K1XA 2UXDO 4DXWA 4EFEA 2UXCB 4GYCB 3SDLA 1N32O 4FPPA 4WFHA 3LSSA 4FMTA 1K7DA 1JJ2U 1JPXA 1Q81W 2XUMA 4HAMA 4PD4F 3H1HH 4PI2A 3JALA 5KLVH 1AR1B 2VQEO 3K79A 3CC4V 3K57A 3VQYA 3K06A 2P4KA 5IYBO 2A9HA 1BE3H 3LNNA 3E22A 3OD4A 5LP6C 5IJ0B 4UCUA 3OUSA 3OTFA 2LJ2A 1S5HC 4PJ0Z 3FB8C 3RYIA 1WB7A 1OCZC 4N23A 4DV1O 1NH2B 1M57B 4IGGA 4D7TA 4JI2B 4LBEC 5TISZ 4J10A 4O4HB 2P67A 2JJ2G 2JGDB 2V4DA 3JARB 1PL0A 3UKMA 1SQPH 1ZLZA 3P3NA 4DR3B 3BVOA 5B1BC 1XREA 4B3MB 2AZ0A 3TETA 2B5UA 1H2SB 1VARA 1SESA 2L6LA 3H1JH 5IJ9A 3ZMZA 1VQMV 3RT3C 1ZUQA 1KU9A 3ZHRA 4MVRA 4GKJB 3E8GA 4UCTA 4NKGB 4B7KA 5GONA 2ATKC 1M90W 3JYCA 3DGEA 4QJFB 4J11A 1FXVA 1KC8W 3CP1A 3FB5C 1FFXB 2QKSA 4BIZA 3K3WA 2Q4PA 2IJIA 3CJHA 3U11A 4C7UA 3ZIAG 2BTOA 1K73W 3FFQA 3CYOA 3RN4A 4X64O 4MSWC 1JA8A 4CH5A 2ZD9A 2HG5C 3ETGA 1DK1A 1W0KG 2ZE8A 1RSOA 5BMVB 5J2UA 1K3EA 4DV2B 2XAQA 3AK1A 1YHQV 3QG5A 4JYBA 1URFA 3JD2A 5IYCO 5H2FZ 4RQEA 3RGBA 2QSAA 3R66A 4YHHO 1IDSA 4OPAA 3WB2A 3CCLV 2UXCO 2X6BA 2R70A 4BIUA 3MDSA 1RM1B 3C3SA 2OT5A 4EEQA 4J7JA 1TVKA 1R6TA 1GK9A 4U3JB 1XNRB 5J2TA 2ZNIA 3H1LH 1XL4A 3OTOB 5IWAB 2IU0A 2JK5C 3WB0A 5LMNB 3JALB 4F6EA 2HJDA 5CN0A 3VQVA 1K5QA 5L3EA 1SF9A 1ZL8A 2WLLA 4OGQB 5FPRA 2W0FC 2DMXA 3ZMUA 1TUBA 4FK5C 5DECA 4QPJA 4CS3A 4F6RB 2M6YA 3E22B 2Q69A 3JAKB 4K35A 4JI2O 3D36C 3OEHG 3GWOA 3OMAB 3I56V 3RYIB 3A8TA 4AQYB 4UCSA 1XMQB 1PD3A 3FAVA 1DGSA 2BOBC 4B3MO 4LFBB 3T4ZA 4LF5B 1Y4MA 4IIJA 4FIPC 1CPYA 3ZRXA 3UO3A 1W0JG 3SYAA 3FD9A 4TSFG 1P84F 3RVZA 4BR6A 2Z5UA 3ZN1A 5IJ9B 5FNVA 4UCRA 1S72V 4JI0O 2CTRA 4LF9B 1IURA 1WA8B 5GONB 5FL7G 3OMNB 2AHYA 5H6RA 1WP7A 1Q43A 4KP4A 1HNXB 1NU1H 3CJHB 1HNZO 2OTJV 1N0NA 2PF4E 4TUYA 3FX7A 4JASA 4XDLA 1Q86W 1VQ7V 4I9WA 3W7TA 3K0DA 4DUYO 2X6CA 1PNLA 4UVBA 1RM1C 1SRYA 5D5PA 5J2UB 1YCIA 1N4CA 4B3TB 1J5EO 4B3RB 2PZSA 1HR0B 5B3SB 2IW5A 4DR7B 2PUSA 1KMIZ 3H1KH 3BFRA 4W4LA 4X65B 5CA1A 1F51A 3W7SA 5DEDA 4CH4A 1TVKB 5IYDO 4MVOA 2OTLV 1K92A 2X6AA 3I5DA 5IWAO 1PNKA 3UM7A 3RVYA 3E83A 3GB7C 5J2TB 5LMNO 3AEIA 4PELA 4LWSA 2YS8A 1EN5A 4DV6O 2GBOA 1BQZA 1AVMA 1ZL8B 2WLLB 1OZ0A 4J7KA 1TUBB 2UXBB 2WLIB 2JVDA 4WFBV 4AQYO 3W7XA 2QDOA 4UCVA 1O9HA 4LFBO 2ZR2A 1SQBH 1N8RW 2BTQA 3N2KA 4WFFA 3FAVB 1K5SA 3L73H 5GTHZ 3ML0A 2ZE5A 3JD4A 4IIJB 4WFEA 3AG1C 3L71H 3U0ZA 2YEVB 3E2EA 3J81N 3A0BZ 2AHZA 4LF9O 1BT8A 2Y48A 5EK0A 2ITDC 4WF9V 1BSMA 4RUEA 1AR5A 1H2LA 3QF7A 4FM1A 5FNVB 4QE7A 3OFNG 2HEPA 3JSNA 4YJ2A 3CXCU 2QE7G 3SJBC 4JF3A 4LF7O 4R6ZA 3E8FA 1NJIW 1PM9A 4FJCC 3TXQA 1Q3EA 4BWAA 3K59A 2UUCO 5IY5B 3SYOA 1N36B 1PP9H 2WSSG 3CCUV 2XOKG 3ZRVA 2HVKC 1IXBA 5LBQA 2HVJC 5GTIZ 2UUAB 4B3RO 1QLNA 1HR0O 1V9PA 3ZHQA 4JV5O 4DR7O 4HNAA 3ZMSA 2Q7EA 4X8AA 4O2BA 3CRCA 1Y67A 4DW0A 4PDRA 3KG2A 2F4VB 1R6KA 2YDEA 2ZQMA 4MS2A 1EM1A 1MA1A 1W59A 1WPBA 4DV7B 5CA1B 5A9GA 4TQDA 2M7WA 2WLJA 3DC5A 1CP9A 4NB5A 3CRRA 2OYQA 1F4NA 3UT5A 2F43G 4O4JA 4HBNA 1AP5A 1MSWD 1S5LZ 3B09A 5JJEB 5K1PA 1X4TA 2HKOA 4DV4B 1G8MA 2QJ1A 4LWSB 1VIBA 1GO3F 1M9NA 3T1HB 2UXBO 2VQFB 1MSDA 1PL4A 2GUZA 2R9AA 2Y0IA 3UO2A 3KKYA 4BAYA 1A32A 1HNWB 4JI5O 2Q67A 3HKDA 4LNUA 2QM8A 2UXDB 5EZYA 2ADPA 3H01A 5B1NA 3CCVV 2W6JG 2GTAA 4K0KB 3G6EV 4JAVA 5C93A 4GKKB 1FXKA 4I4TA 4CC5A 3ZCCA 4DR1O 3ABLC 3JD3A 1MABG 3SR2C 4DV0B 3W7WA 1TAEA 4Q6GA 5KHHA 2YIAA 3N2KB 4DRXA 1R3JC 4IYHA 4P9PA 1GN2A 2VQEB 3G71V 1YJNV 1JMKC 2P5OA 2AW9A 3L70H 2FL4A 2KKWA 3CRAA 1Z2GA 3UQ8A 4PV1B 2ZM6O 2KB1A 4DR5O 1K4DC 1WB8A 4I7ZB 2YXLA 1Q7YW 4J7ZA 5JVDA 1OJHA 1K8AW 4H13B 2QGNA 4Z2WA 1NR7A 2XHBA 1L0NH 1XBLA 2XT9A 3T1CA 3WU2Z 1OV9A 4JAAA 1V55B 2C2AA 3SPJA 1N36O 3RYFA 5KMGA 4XDJA 2Q0AA 3ZHSA 2K9PA 2UUAO 1HDJA 2ZT9B 2NNUA 1XHXA 2RQ6A 1XEQA 1MZEA 4FLXA 3RBZA 1XL6A 1U97A 4UVAA 3E35A 1GKFA 1GH6A 2R9IA 4N21A 3ETQA 2F4VO 4DR2B 3NR7A 4ZI7A 4DV7O 4FLVA 4HNAB 5CB4A 4O2BB 1EN4A 3O9OA 3FB6C 2IU3A 4IT5A 4D7SA 1AR4A 4O2AA 1PPJH 3MD0A 2ADQB 4X64B 5L3FA 4DR6B 2D3OW 2WLKA 4J9ZB 1RPOA 4BW5A 1Y74A 5BR8O 2ZINA 5EIBD 4MTGA 4JI3O 1I7FA 2VQFO 2EJRA 3E8HA 4O4JB 1K97A 2CH7A 1SQVH 3L75H 2Y0PA 3ZRWB 1HNWO 4HZ3A 3D8CA 4YHHB 1Q8IA 2OCHA 3T4DA 1H2GA 4K0KO 2EINB 4GKKO 3JASA 4G2KA 2XTAA 1ZX3A 3HKDB 4LNUB 2IM9A 5EZYB 3OAAG 4DV0O 1SQQH 1VMGA 1Q82W 1Z5VA 4EKWA 3HB3B 2CAZC 1N34O 4MTFA 1FJGO 1FXKB 4I4TB 3OT7A 1AI4A 4UV8A 1VEWA 4IL6Z 1SZXA 1UFIA 2CTPA 2V7QG 4DRXB 1CXZB 5L3DA 3X2QB 3RYCA 1DF4A 2JGUA 2WA3A 1D5NA 1DTOA 4Q20A 4TV9A 5L3CA 1FKAO 1V55C 3SPCA 2JIZG 4PDMA 2QKAA 1Q6HA 4ABMA 3ZHTA 3ZHUA 5KHKA 3APQA 3TJTA 1OCRB 1BCCH 1SS3A 4E2LA 3SYQA 1H2NA 1S0VA 1IBMO 4YIPA 5B1AB 2DYRB 1IVSA 2OCCB 3RYFB 5KMGB 1FS0G 1BZKA 2MK3A 2Y69B 4DR2O 4JI0B 3PJSK 2LFRA 1NS1A 4CS2A 2Y4TA 5EBWC 2WLHA 3MHSC 1VQKV 4X1IA 3BA8A 2EIKC 4ZI7B 1NTKH 4AI8A 4FLUA 4DR6O 5CB4B 1R3IC 2HJFC 3O65A 4PHZA 3CX5F 1FD9A 3DC6A 2LFSA 4PA7A 1SQFA 3CRMA 4DV5O 1HNZB 1GN4A 1XOUA 3K0GA 4PDVA 2ZIMA 1Y74B 4DUYB 3N2GA 1HP8A 4I55A 5KX5A 2EINC 4G28B 1YEWA 4KFMA 2QM7A 1XI1A 1XHZA 4I50B 2CH7B 1J5EB 1WP8A 1B06A 3HKEB 4FFKA 4LFAO 3AG2B 5JH7A 1QBZA 5EC2C 1AJPA 3ABMB 3ZHVA 1HWYA 1OCOB 3JASB 3CMAV 3A2FA 1SERA 3JATA 1M57C 3QO7A 4G27B 2HR3A 2IH3C 5CBFA 2OWOA 4RUFA 3C90A 3S3WA 3PN1A 3EVKA 2FMLA 2DOSA 2A3QA 4DV6B 1R6NA 1JQ0A 3GWKC 3CB2A 2GHYA 1R1BA 4GUNA 5GW7A 3RYCB 2ZE6A 3K58A 4X20A 1OCCB 5CBGA 3OMIB 1JCHA 4TV9B 1BGYH 2FB5A 3WFVA 4JI7B 2EIJB 3ABUA 4R50A 1ORQC 1GN3A 5B1AC 2DYRC 4I0XA 2HLDG 2OCCC 1I5XA 4E4EA 1NQTA 3OR7C 1SETA 1QHTA 5LGNA 4FLTA 3P32A 4JTCB 2Y69C 1UPGA 3OE7G 4PA9A 3THOA 5IDJA 1YXBA 2NLJC 3BABA 2VS0A 2VWKA 2OIGA 2DW4A 1XMOB 1KB9F 4LF4O 5JCOC 1QVFU 2DQ3A 4MTOA 3STZC 2H94A 2N05A 3FYEB 1YDXA 4FZ0A 5LOVA 4H0LB 2R9RB 2ZCEA 2P22C 3K5MA 2DYSB 3LUTB 4X1IB 1G6UA 2H3OA 3DSQA 5H5NA 4LF7B 2EZOA 5IE9A 5LHGA 3ZS8C 1AJQA 2UUCB 2EZPA 1AP6A 3WB1A 4B3SO 1M5IA 2KG7A 1PV0A 1RSOB 1YVWA 4H37A 1XDCA 4L87A 3SPIA 2HFEC 2PYJA 3MHHC 3CMEV 2YXHA 3AG2C 2DE0X 3ABMC 2FKXA 3JSLA 1FPOA 1Z5WA 3SPHA 3K04A 3N2GB 4NTWA 5CA0A 2PY5A 4I55B 5EIBC 5KX5B 4JV5B 3JAWA 3JD1A 1YJ9V 1MOFA 4J41A 4YY3O 1NI8A 4UVCA 5JH7B 1IX9A 3AG4B 4FVMA 5CMUA 1VP7A 1BL8A 3ETDA 1YI2V 4UFZA 2EILB 1VQ4V 4U7OA 1OCCC 3JATB 1I94B 2CTQA 2WPDG 2ILMA 5KAFZ 1J95A 4KHPB 3W7UA 1AI7A 4CZZA 5BXZA 4ZKIA 1F23A 3K9AA 4QGPA 3IC7A 4JI7O 2BE3A 4JI5B 5L3GA 4X20B 3OUFA 3K9SA 4U3FH 1H38A 3JD0A 2ZDIA 4GCZA 3CRQA 4NTXA 1K34A 3A0HZ 4DR1B 4I0XB 2EJ7A 2DN9A 4K8XA 1VF6A 2ZR3A
chains in the Genus database with same CATH topology
1KECA 1M57B 5B1OA 2KB1A 1K4DC 1H8HG 5CBHA 2FTKA 1Q7YW 4LBEC 3B77A 1KD1W 1K8AW 2P67A 5KA6A 1NVPD 2JJ2G 1NR7A 2DYSC 3ASNC 2QTOA 1PL0A 2P90A 3UKMA 1YTFD 3ASOC 3T1CA 4GX1A 4MW3A 2YEVA 5B1BC 1V55B 3TETA 1DLBA 2B5UA 2DWDC 2C2AA 3SPJA 1UJWB 1SESA 2B1GA 3CCMV 3ZMZA 2X0LA 1VQMV 4QIWF 1K4CC 4MVRA 3E8GA 1BHAA 4XDJA 3K03A 1VQ8V 3AG1B 2ATKC 2NNUA 1M90W 3JYCA 1ROPA 5EC1C 2XASA 3DGEA 4QJFB 3RBZA 5HFLA 4KUMA 5B3SC 1FXVA 1XL6A 3CC2V 1K9MW 4UVAA 3E35A 1KC8W 3CP1A 3FB5C 2QKSA 1GKFA 4BIZA 3K3WA 4UV9A 3ZJZA 1E1RG 2R9IA 2IJIA 3NXSA 4N21A 1AI5A 5H9CA 3ZIAG 1K73W 4TT3G 3TK1A 3F7YC 4P30A 3CYOA 1WPXA 3LNMB 3G4SV 4MSWC 2ZD9A 4MT8A 4QE9A 2EIMB 1F4MA 3AG4C 1OCOC 5H6QA 3RW0A 3FB6C 2IU3A 4GT1A 4MVMA 5CA3A 2HG5C 3ETGA 1W0KG 1MG1A 4RQFA 3MD0A 4PA6A 1H8EG 4XDKA 5L3FA 1K3EA 2ZXWB 2D3OW 2XAQA 2WLKA 3TCUA 4J9ZB 1RPOA 4BW5A 1YHQV 4JYBA 3JD2A 4MTGA 4MVQA 5L3BA 5IYCO 1YITV 4RQEA 3CCEV 4LC1A 3F5WC 2EJRA 1BMFG 1FXHA 3E8HA 3CCLV 2X6BA 3K08A 1K97A 4BIUA 1PKXA 1RM1B 2YSUB 2OT5A 3ZRWB 1GK9A 4HZ3A 2WLNA 1VQ5V 3ABTA 3T4DA 1H2GA 4JAUA 2EINB 4RAIA 1K33A 1PNMA 2EIJC 1VQOV 4G2KA 4CBCA 1P7BA 1XL4A 1DF5A 5KA5A 3OAAG 3LSQA 2JK5C 2JEUA 2IU0A 3WG7B 1Q82W 4EKWA 3IFXA 1JVMA 3P30A 5KUKA 3HB3B 4MTFA 3E89A 3OR6C 1FXKB 5CN0A 1K5QA 2JJ1G 2XAFA 4PDLA 5L3EA 1G4YB 1AI4A 2WLLA 1R73A 1V54B 2W0FC 4UV8A 1L1FA 1VQ9V 3ZMUA 1QVGU 3CD6V 4FK5C 4WCEV 4QPJA 3BY6A 2Z3YA 1VQ6V 2V7QG 1B6QA 3FYIB 5L3DA 4XBFA 3X2QB 4I5SA 2Q69A 1NH2D 2B1IA 2H8PC 2IJHA 1DF4A 1SZTA 3OEHG 3GWOA 3OMAB 3I56V 1DTOA 4Q20A 2QA4V 5L3CA 3M99B 1V55C 3SPCA 2JIZG 1E79G 1Y66A 4PDMA 1PD3A 3A0RA 2BOBC 3T4ZA 4MVSA 4QPKA 1Y4MA 2JDIG 1M56B 3LDCA 1CEZA 4FIPC 1CPYA 1OCRB 3ZRXA 5HFMA 5IY5C 1W0JG 3T2MA 1R3KC 3SYAA 3IGAC 1YSCA 3CCQV 2DWEC 3CC7V 4E2LA 4TSFG 3ABLB 2JEXA 3FKSG 3OGCC 4H33A 3SYQA 1YJWV 3RVZA 4J9YB 2Z5UA 4MVUA 3ZN1A 1S0VA 1ENVA 4P9OA 5B1AB 2DYRB 1KQSU 2OCCB 1S72V 3VOUA 1FS0G 1NVPB 1OCZB 1ZWIC 3FB7C 4ZBMA 3E86A 4JYCA 2MK3A 2Y69B 2WLMA 1YTFB 1AJNA 2EIMC 5FL7G 3OMNB 3ZMTA 2AHYA 5H6RA 3PJSK 3SPGA 4GX2A 2LFRA 2WLHA 3MHSC 2A0LA 1QR9A 2ZXWC 5EBWC 4KP4A 1FFTB 1VQKV 4X89A 3OM3B 2EIKC 3STLC 1RPRA 3EHBB 3CCJV 2OTJV 2CK3G 3LDDA 3ZMVA 1R3IC 2HJFC 4MTXA 4JASA 4XDLA 4WFAV 1Q86W 1VQ7V 4Z1MG 2LFSA 4I9WA 3W7TA 3K0DA 1AROP 4PA7A 4ASUG 2X6CA 3OEEG 1PNLA 4LP8A 4UVBA 1RM1C 2EILC 1SRYA 1GM8A 2Q68A 2P6JA 3K0GA 1COWG 1EZJA 4PDVA 2UXXA 2EINC 3HPLC 1GTOA 4G28B 1IXMA 5B3SB 2IW5A 4KFMA 2LP7A 2QM7A 3ZRSA 1I5YA 1F51A 3W7SA 4TWKA 2DQ0A 2WWWA 5IYDO 4MVOA 1R3LC 2OTLV 1K92A 3AG2B 2X6AA 1WLEA 1QBZA 5EC2C 5DM6V 1AJPA 1PNKA 3ABMB 3UM7A 4QNHB 3RVYA 1TUEB 3E83A 1V54C 3GB7C 2X7RB 1HWYA 1OCOB 3AEIA 1LNQA 3CMAV 1GMGA 4PELA 3ZRWA 2P7TC 1OHHG 1SERA 4WFGA 1M57C 3AG3B 3QO7A 4G27B 4DO2A 4OXSA 2HR3A 1QLEB 3B8MA 3E8BA 2IH3C 5CBFA 4RUFA 4MVZA 2K1EA 2PI5A 2WLLB 1OZ0A 4UXNA 3JCZA 3SYCA 1R6NA 1M56C 1JQ0A 2WLIB 4GX5A 4YXWG 2GHYA 3W7XA 4WFBV 5GW7A 3DTUB 4F4LA 3CCRV 4GX0A 1QCEA 2ZR2A 4JGSA 1OCCB 5CBGA 4JTDB 3OMIB 1N8RW 1JCHA 4MW8A 3CPWU 4LCUC 1JX9A 4WFFA 2IJKA 3WFVA 1K5SA 2EIJB 3ABUA 1S76D 3ABKB 4R50A 1ORQC 3D3IA 3ML0A 2DYRC 3JD4A 2HLDG 5EBLC 2OCCC 1I5XA 5B1AC 4WFEA 3ETEA 1NQTA 3OR7C 1SETA 5J9PC 3AG1C 5LGNA 3P32A 4JTCB 2Y69C 2YEVB 5BZBA 1NBMG 3E2EA 2AHZA 1VQPV 2Y48A 3OE7G 4PA9A 3B8NA 5EK0A 2ITDC 5EBMC 4WF9V 1KKDA 5IDJA 2GSMB 4RUEA 3LDEA 2NLJC 4P2ZA 4QE7A 3D36A 3OFNG 2DW4A 3OW2U 1KP3A 2WAMA 2A79B 5LHHA 3CXCU 2QE7G 5LGTA 5E1AC 1QVFU 2DQ3A 4MTOA 4JF3A 2QEXV 2W6IG 3STZC 3R65A 2H94A 3FYEB 4R6ZA 3E8FA 1NJIW 1QR8A 4PA4A 1VQLV 4FJCC 2R9RB 1P4RA 2DYSB 1S77D 3ASNB 2IH1C 3LUTB 1GM9A 2IJJA 3ASOB 5IY5B 3SYOA 2UXNA 2EZOA 5B1BB 5LHGA 1AJQA 3CCSV 2WSSG 3CCUV 2XOKG 2EZPA 3ZRVA 2HVKC 5LBQA 4X88A 1THZA 2HVJC 4H37A 1QLNA 4L87A 3SPIA 2HFEC 2V1DA 3I55V 4JTAB 3MHHC 3CMEV 1NR1A 1M1KW 3AG2C 2PI4A 1EFRG 3ZMSA 3ABMC 4X8AA 5KUMA 3SPHA 3K04A 3SYPA 2Q6AA 3QO5A 4PDRA 3VBBA 3KG2A 3JD1A 4JPRA 5LHIA 1YJ9V 1R6KA 4UUJC 2ZQMA 4MS2A 4U7NA 3WG7C 1JOYA 1MOFA 2M7WA 2WLJA 3ZN0A 1CP9A 1BHBA 5LGUA 2ITCC 3AG3C 3BEHA 2EIKB 4UVCA 1FXKC 1QLEC 4RO2A 1F4NA 1YIJV 3AG4B 5CMUA 2F43G 1MSWD 2ZDIC 2XAGA 1BL8A 3ETDA 3SJQC 3F7VC 3X2QC 2HKOA 1GM7A 1KP2A 1G8MA 2EILB 2XAJA 1YI2V 3QNEA 4R7CA 1VQ4V 1GO3F 1M9NA 1VQNV 4U7OA 4HYOA 1OCCC 1AI6A 4DXWA 2WPDG 1EBOA 1J95A 3W7UA 1W2BU 4BAYA 2XAHA 1AI7A 2Q67A 4FPPA 4PA3A 4WFHA 3ABKC 4CZZA 2QM8A 3LSSA 4FMTA 1K7DA 3H01A 4ZKIA 3EFFK 1JPXA 5B1NA 1F23A 2XNDG 3K9AA 5DN6G 1JJ2U 1OCRC 3CCVV 2W6JG 3IC7A 4HAMA 1Q81W 3G6EV 4JAVA 5C93A 1FXKA 5L3GA 2EBOA 1AR1B 3ZCCA 3OUFA 3K79A 3ABLC 3QO8A 3JD3A 1MABG 1H38A 3CC4V 3JD0A 3W7WA 4R8CA 3K06A 1E1QG 2A9HA 5IYBO 2ZDIA 1R3JC 4GCZA 2WLIA 3OUSA 4P9PA 3G71V 1K34A 1S5HC 1YJNV 2BOCC 3FB8C 1NKDA 1S3JA 1OCZC 4N23A 1NH2B 2ZR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8F A;  1XL4 A;  4PA4 A;  2EIN C;  2R9R B;  2JK5 C;  2KB1 A;  1K4D C;  3HPL C;  4G28 B;  4EKW A;  5CBH A;  3IFX A;  1JVM A;  5KUK A;  2IH1 C;  3LUT B;  4KFM A;  4MTF A;  3E89 A;  4LBE C;  3OR6 C;  3SYO A;  3ZRS A;  4PDL A;  1G4Y B;  4TWK A;  2WLL A;  2W0F C;  2DYS C;  3ASN C;  2QTO A;  4MVO A;  3UKM A;  1R3L C;  3ASO C;  2HVK C;  3T1C A;  4GX1 A;  4X88 A;  2HVJ C;  2X6A A;  4QNH B;  5EC2 C;  4MW3 A;  2YEV A;  5B1B C;  3UM7 A;  3RVY A;  4H37 A;  4CBC A;  3TET A;  3E83 A;  3SPI A;  2HFE C;  1V54 C;  2Q69 A;  2H8P C;  2DWD C;  4JTA B;  3GB7 C;  3SPJ A;  3AG2 C;  1LNQ A;  3ABM C;  4X8A A;  5KUM A;  3SPH A;  3K04 A;  1V55 C;  3SPC A;  3SYP A;  2P7T C;  4PDM A;  2Q6A A;  4PDR A;  1K4C C;  4MVR A;  3E8G A;  3KG2 A;  4XDJ A;  4WFG A;  3K03 A;  1M57 C;  2BOB C;  4G27 B;  4UUJ C;  4MS2 A;  3T4Z A;  4OXS A;  4MVS A;  2ATK C;  3WG7 C;  3JYC A;  3LDC A;  3E8B A;  2IH3 C;  5CBF A;  4RUF A;  5EC1 C;  4MVZ A;  2WLJ A;  2K1E A;  3RBZ A;  2WLL B;  5B3S C;  1XL6 A;  5IY5 C;  3T2M A;  1R3K C;  3SYA A;  2ITC C;  3AG3 C;  3BEH A;  3FB5 C;  3IGA C;  2DWE C;  2QKS A;  3SYC A;  1QLE C;  2WLI B;  1M56 C;  3ZJZ A;  4GX5 A;  4RO2 A;  4F4L A;  4GX0 A;  3OGC C;  4H33 A;  3SYQ A;  3RVZ A;  4J9Y B;  1BL8 A;  4MVU A;  4JTD B;  5CBG A;  3SJQ C;  3F7V C;  3F7Y C;  4P30 A;  3X2Q C;  3LNM B;  4MW8 A;  4P9O A;  4MSW C;  4LCU C;  2ZD9 A;  4QE9 A;  4R7C A;  3RW0 A;  3AG4 C;  1OCO C;  3VOU A;  3FB6 C;  4MVM A;  4HYO A;  4WFF A;  2HG5 C;  1OCC C;  1ZWI C;  4R50 A;  3FB7 C;  4ZBM A;  1ORQ C;  3E86 A;  4DXW A;  2WLM A;  4PA6 A;  1J95 A;  2DYR C;  4XDK A;  5EBL C;  5B1A C;  2OCC C;  2EIM C;  4WFE A;  3TCU A;  2WLK A;  2AHY A;  4J9Z B;  3OR7 C;  3PJS K;  3SPG A;  2Q67 A;  3AG1 C;  4GX2 A;  4PA3 A;  4WFH A;  4BW5 A;  5J9P C;  3ABK C;  4JTC B;  4MTG A;  4MVQ A;  2Y69 C;  3EFF K;  5BZB A;  1OCR C;  2WLH A;  5EBW C;  2A0L A;  2ZXW C;  2AHZ A;  3F5W C;  4PA9 A;  5EK0 A;  4X89 A;  2ITD C;  2EIK C;  5EBM C;  3E8H A;  3STL C;  1KKD A;  2X6B A;  3K08 A;  4RUE A;  3LDE A;  2NLJ C;  4P2Z A;  3OUF A;  3LDD A;  1R3I C;  2HJF C;  3ABL C;  4QE7 A;  4HZ3 A;  2WLN A;  4XDL A;  4R8C A;  3K06 A;  4I9W A;  2A9H A;  3K0D A;  2A79 B;  4PA7 A;  2X6C A;  1R3J C;  2WLI A;  3OUS A;  4LP8 A;  5E1A C;  2EIL C;  4P9P A;  3T4D A;  4MTO A;  2Q68 A;  1S5H C;  4RAI A;  2BOC C;  3R65 A;  3FB8 C;  3STZ C;  3K0G A;  1OCZ C;  2EIJ C;  4R6Z A;  4PDV A;  1P7B A; 
#chains in the Genus database with same CATH topology
 3UCS C;  4RWU A;  3G67 A;  5B1O A;  4B08 A;  4NYK A;  5CBH A;  1XMO O;  1B04 A;  1Q6I A;  2D2C B;  2FTK A;  1N33 B;  4A5U B;  1KD1 W;  3B4S A;  1EN6 A;  5KA6 A;  2ZM6 B;  2DYS C;  4DR5 B;  3G80 A;  2QTO A;  1YTF D;  1NZ6 A;  1DLB A;  2DWD C;  2CDY A;  3CCM V;  4W4K A;  5LP6 A;  2Z0A A;  5LOV B;  4QIW F;  1BS3 A;  1BHA A;  3K03 A;  2QWP B;  2E75 B;  1VQ8 V;  1EZV H;  4IYI A;  1Y76 A;  5HFL A;  5B3S C;  4TUY B;  3CC2 V;  1K9M W;  5FLX N;  4LFC B;  2KG7 B;  3ZJZ A;  4ZIB A;  5LL6 Y;  1AI5 A;  2HHH B;  5LMU O;  1GN6 A;  1P7G A;  4NXM O;  4TT3 G;  5B5E Z;  5EYP A;  4X9Q A;  3LNM B;  4AIL C;  3G4S V;  4MT8 A;  1HW7 A;  2EIM B;  5CA0 B;  1F4M A;  3AG4 C;  3RW0 A;  4MVM A;  3JAW B;  1MG1 A;  4PA6 A;  1YF2 A;  4XDK A;  2ZXW B;  3TCU A;  4I9Q A;  2Q7H A;  4MVQ A;  5L3B A;  1YIT V;  4LC1 A;  3F5W C;  1I94 O;  1BMF G;  3HKC A;  2AZ2 A;  4OX9 O;  3K08 A;  2E76 B;  5BR8 B;  4TQF A;  3DXR A;  3APO A;  4KHP O;  2YSU B;  4JI3 B;  2WLN A;  3H9V A;  2PTM A;  3ABT A;  3TXS A;  4LF6 B;  1N0J A;  4RAI A;  1K33 A;  1L8D A;  4AHC A;  4CBC A;  1P7B A;  4X66 B;  1DF5 A;  2F1M A;  5KA5 A;  3LSQ A;  2JEU A;  3WG7 B;  3JCU Z;  4H44 B;  1JVM A;  5KUK A;  3SJC C;  4X62 O;  4DUZ B;  2JJ1 G;  4PDL A;  2W0X A;  1Q5O A;  2MW2 B;  2BTQ B;  4DK0 A;  1QVG U;  1H2K A;  3BY6 A;  1N34 B;  2Z3Y A;  1FJG B;  4DK1 A;  1B6Q A;  3FYI B;  4XBF A;  1NH2 D;  2H8P C;  4ZOL A;  1N33 O;  1SZT A;  2UU9 B;  2CGO A;  2LGQ A;  3M99 B;  4FM0 A;  1E79 G;  2RNB A;  1WNS A;  4CH3 A;  5A2Q N;  2B9Z A;  4QPK A;  5BY1 A;  1CEZ A;  3BPZ A;  4UB8 Z;  1T5E A;  4YJ2 B;  3T2M A;  5IY5 C;  1R3K C;  1MMM A;  3IGA C;  2YC0 A;  2YID A;  2DJV A;  1US6 A;  4JYY A;  2JEX A;  3BA9 A;  3OGC C;  1YJW V;  4LF8 O;  5LP6 B;  3IC9 A;  4P9O A;  3AK3 A;  1KQS U;  1D5A A;  4LFC O;  2O57 A;  1OCZ B;  1ZWI C;  3FB7 C;  4ZBM A;  4JYC A;  1IBM B;  1YTF B;  2HHH O;  2EIM C;  2BSK A;  3ZMT A;  5B66 Z;  1Y76 B;  2P4V A;  2Q0O C;  3MAQ A;  1IBK B;  1M93 A;  2RN9 A;  2A0L A;  2ZXW C;  4IHJ A;  5KAI Z;  1FFT B;  4NXN B;  2QWQ B;  3STL C;  1RPR A;  2ZE7 A;  3ZX6 A;  2LQT A;  1WAZ A;  1I08 A;  3EHB B;  4TV8 A;  3CCJ V;  5EYP B;  4FM2 A;  4MTX A;  2N04 A;  4ASU G;  3OEE G;  4LP8 A;  3GVM A;  1GM8 A;  4X1K A;  1JFF A;  1I0H A;  4L8J A;  4X1Y A;  2UXX A;  4DV5 B;  3HPL C;  1GTO A;  3UT5 B;  1GAX A;  1IXM A;  2LP7 A;  3ICX A;  4LF6 O;  3HKC B;  2AXT Z;  4WBN A;  3BCC H;  3IAY A;  3DXR B;  4TWK A;  2EX3 A;  2DQ0 A;  4KXR A;  4UB6 Z;  4X66 O;  1IBL B;  1U96 A;  1P49 A;  2GUZ B;  1Y6X A;  5JJJ B;  2EUL A;  4UCO A;  4DUZ O;  4LFA B;  1QU7 A;  3EXA A;  1GMG A;  2P7T C;  4U3J A;  5FPO A;  3VQX A;  1VF6 C;  4OXS A;  2ZKO A;  4EFB A;  3B8M A;  2LW7 A;  4MVZ A;  2UU9 O;  3JCZ A;  2JS5 A;  3RFR A;  2Q5Z A;  3DTU B;  3CCR V;  4ZOL B;  4JGS A;  4MW8 A;  4K3A A;  3CPW U;  1B3Q A;  4JI1 B;  2R72 A;  1JX9 A;  4GZR B;  2IJK A;  2Q9L A;  4F6R A;  2VRZ A;  1S76 D;  3ABK B;  5JVD B;  3D3I A;  3JAK A;  2A7W A;  2LGW A;  3BAA A;  3ETE A;  1SA0 A;  1M4U A;  1NBM G;  3RYH A;  4CC6 A;  3B8N A;  5KHG A;  1KKD A;  2RJZ A;  3AG7 A;  4JI8 B;  2QWO B;  2A06 H;  4P2Z A;  3OW2 U;  2WAM A;  2UUB B;  2IBZ H;  2A79 B;  5LHH A;  2PGG A;  1IBK O;  5JQG A;  4NXN O;  2QEX V;  3QVN A;  2BSK B;  4LH7 A;  3B2E E;  4PA4 A;  2RCV A;  1VQL V;  4ZHQ A;  4LF4 B;  2QR4 A;  1S77 D;  3ASN B;  4IHJ B;  2IJJ A;  3ASO B;  5KHI A;  1WA8 A;  4JYA O;  3K5N A;  4TV8 B;  3TGU H;  4X88 A;  3L74 H;  4O2A B;  2V1D A;  1NR1 A;  3BRC A;  4YJ3 A;  4X1K B;  1M1K W;  2E5L B;  1JFF B;  4B3S B;  5KUM A;  2Y4U A;  4X1Y B;  2Q6A A;  3QO5 A;  3VBB A;  3M8A A;  1IBL O;  1XNQ B;  4UUJ C;  4U7N A;  4WBN B;  3ZN0 A;  1H2M A;  3BEH A;  3OGI B;  1FXK C;  4J42 A;  4RO2 A;  2N74 A;  4FLY A;  2YIC A;  4O4L A;  4YY3 B;  3F7V C;  3X2Q C;  3QNE A;  3J7A U;  4HYO A;  1Q90 D;  1KBH A;  1EBO A;  1W2B U;  2XAH A;  3SJA C;  3KCX A;  4PA3 A;  2YI9 A;  3ABK C;  3D3Q A;  3B40 A;  1JR9 A;  3EFF K;  5DN6 G;  2XND G;  1OCR C;  4DV3 B;  4JI1 O;  3F5T A;  2EBO A;  2RMK B;  1NTZ H;  1O9G A;  5LXT A;  3QO8 A;  4K8Z A;  4CH6 A;  4R8C A;  1E1Q G;  2WLI A;  1L0L H;  2BOC C;  1NKD A;  5ITZ A;  1S3J A;  4JI8 O;  1SA0 B;  1KEC A;  4LR3 A;  1WJZ A;  1H8H G;  3RYH B;  2UUB O;  3T1Y B;  4DR3 O;  1AB3 A;  3B77 A;  2NN4 A;  1NVP D;  3CSX A;  3U10 A;  3ASN C;  1LUW A;  2P90 A;  2WA4 A;  5LA6 A;  3ASO C;  2JRI A;  4GX1 A;  4MW3 A;  2YEV A;  3K5L A;  5JQG B;  1KUQ A;  4GKJ O;  1WN7 A;  1UJW B;  2B1G A;  4CS4 A;  2X0L A;  1ZAU A;  1K4C C;  4ZHQ B;  3AG1 B;  1S5J A;  2JS3 A;  2ODM A;  3CE2 A;  1XQ8 A;  4GLX A;  1ROP A;  5EC1 C;  2XAS A;  5F2V O;  2E5L O;  4KUM A;  1Q6U A;  4UV9 A;  4PI0 A;  1XNQ O;  3Q4H A;  1E1R G;  3NXS A;  5H9C A;  4YIO A;  4YJ3 B;  3TK1 A;  3F7Y C;  4P30 A;  1WPX A;  5AG2 A;  4DV2 O;  2BCC H;  3SGI A;  4QE9 A;  2AGA A;  1OCO C;  3CWB H;  5H6Q A;  4GT1 A;  5CA3 A;  2Q8V A;  5LMU B;  1XIL A;  1ZSP A;  4JI6 B;  4NXM B;  4RQF A;  1H8E G;  1FAF A;  1QQC A;  3CCE V;  4FLZ A;  3LSU A;  3K5O A;  1FXH A;  4BW9 A;  4DW1 A;  1XNR O;  1NTM H;  4O4L B;  1MNG A;  1PKX A;  1VQ5 V;  1LUV A;  3KCY A;  1RFY A;  3OTO O;  4OX9 B;  4DV3 O;  4JAU A;  1YZB A;  5IYZ A;  1PNM A;  4ICG A;  2EIJ C;  3L72 H;  1VQO V;  2QKC A;  2QTS A;  4FFB A;  4KL1 A;  3BHP A;  3IFX A;  1IZ3 A;  3P30 A;  2CTW A;  1SKV A;  3E89 A;  3OR6 C;  3HKB A;  3CEI A;  2F23 A;  2XAF A;  1G4Y B;  1SC5 B;  5LXT B;  1R73 A;  1V54 B;  1L1F A;  1VQ9 V;  3CD6 V;  4BIO A;  4WCE V;  2G38 A;  1X59 A;  1KKC A;  3CS5 A;  1VQ6 V;  4X62 B;  2F66 C;  1XMQ O;  2QWR B;  3T1Y O;  4I5S A;  4EB6 A;  2B1I A;  2CUG A;  2IJH A;  5KHJ A;  5C8Y A;  5ITZ B;  5JJN B;  4LF5 O;  2QA4 V;  5D5Q A;  1Y66 A;  2NR5 A;  3QTC A;  3A0R A;  1TGO A;  1KYO F;  3KZI Z;  4MVS A;  4OPH A;  2JDI G;  1M56 B;  3LDC A;  4NVP A;  1VF7 A;  3IJ4 A;  2ARH A;  5HFM A;  2YUA A;  5LA6 B;  1YSC A;  3CCQ V;  2DWE C;  3CC7 V;  1BQ0 A;  4J80 A;  2HP8 A;  2ZIO A;  5E79 Z;  3ABL B;  2KSD A;  3FKS G;  4H33 A;  4J9Y B;  4MVU A;  3VQW A;  1ENV A;  3VOU A;  1RP3 B;  1NVP B;  4LF8 B;  3E86 A;  2WLM A;  1AJN A;  2GV9 A;  4DR4 B;  2QWN B;  1F7Y A;  1HNX O;  4FLW A;  4NTY A;  3SPG A;  4GX2 A;  2VWJ A;  2RDC A;  1QR9 A;  2QM4 A;  3Q4H B;  2CGN A;  4X89 A;  3OM3 B;  4JI6 O;  3HR0 A;  4DYL A;  2CK3 G;  3LDD A;  3ZMV A;  1NT2 B;  4WFA V;  4Z1M G;  4B3T O;  1ARO P;  1ZTE A;  2EIL C;  2Q68 A;  2P6J A;  1VF5 B;  1COW G;  1EZJ A;  1TA8 A;  2YI8 A;  4X65 O;  4NR1 A;  2GDS A;  4TOI A;  3ZRS A;  1I5Y A;  2WWW A;  4O4I A;  1R3L C;  1WLE A;  4QNH B;  5DM6 V;  2YXY A;  1TUE B;  1V54 C;  5IYZ B;  2X7R B;  5LYJ A;  1LNQ A;  4LH6 A;  3RWR D;  3ZRW A;  4JI4 B;  1OHH G;  3JAM N;  4FFB B;  2ETN A;  4WFG A;  2LW1 A;  3AG3 B;  4DO2 A;  1LR1 A;  2YIB D;  1QLE B;  3HKB B;  3E8B A;  2K1E A;  2PI5 A;  4UXN A;  2FYU H;  1JJO A;  3SYC A;  1M56 C;  4GX5 A;  4YXW G;  2E74 B;  4EB6 B;  4F4L A;  4GX0 A;  1QCE A;  2Q73 A;  5C8Y B;  3M7M X;  1D2D A;  1N32 B;  1AIL A;  4JTD B;  4LCU C;  2YIB A;  2P06 A;  2GTS A;  2E3C A;  5IJ0 A;  5EBL C;  3AK2 A;  1GRJ A;  5J9P C;  1FYJ A;  2L35 A;  5BZB A;  4B7E A;  1MZF A;  1VQP V;  5EBM C;  4O4H A;  2KQX A;  4DV1 B;  2GSM B;  3LDE A;  3C3T A;  4DR4 O;  2JGD A;  3D36 A;  3JAR A;  1KP3 A;  5LGT A;  5E1A C;  4D6T H;  4FZ1 A;  3ZED A;  2W6I G;  3R65 A;  1QNM A;  1SQX H;  1QR8 A;  3S3X A;  1P4R A;  1SQG A;  2IH1 C;  1GM9 A;  2F93 B;  1G1X B;  2UXN A;  5B1B B;  3N27 A;  3CCS V;  1FFX A;  3J80 N;  1THZ A;  4JYA B;  3H1I H;  3I55 V;  4JTA B;  2PI4 A;  1EFR G;  2ZNJ A;  4JZ2 A;  3SYP A;  5JCO A;  2Q7G A;  3P3P A;  3CHX A;  4JPR A;  5LHI A;  1XUQ A;  5BMV A;  3WG7 C;  1JOY A;  3L9D A;  3G6B A;  3ZBH A;  4O4I B;  1BHB A;  4Z1V A;  2OIE A;  2ITC C;  3AG3 C;  5LGU A;  2EIK B;  4JI4 O;  5JWP A;  4DV4 O;  1QLE C;  2PYL A;  4JZG A;  1YIJ V;  3T1H O;  2CE4 A;  2ZDI C;  2XAG A;  4I50 A;  5LYJ B;  3SJQ C;  1GM7 A;  1KP2 A;  2XAJ A;  3CXH F;  5IT9 N;  2LO1 A;  4R7C A;  3HKE A;  1VQN V;  2F95 B;  1AI6 A;  5K1X A;  2UXD O;  4DXW A;  4EFE A;  2UXC B;  4GYC B;  3SDL A;  1N32 O;  4FPP A;  4WFH A;  3LSS A;  4FMT A;  1K7D A;  1JJ2 U;  1JPX A;  1Q81 W;  2XUM A;  4HAM A;  4PD4 F;  3H1H H;  4PI2 A;  3JAL A;  5KLV H;  1AR1 B;  2VQE O;  3K79 A;  3CC4 V;  3K57 A;  3VQY A;  3K06 A;  2P4K A;  5IYB O;  2A9H A;  1BE3 H;  3LNN A;  3E22 A;  3OD4 A;  5LP6 C;  5IJ0 B;  4UCU A;  3OUS A;  3OTF A;  2LJ2 A;  1S5H C;  4PJ0 Z;  3FB8 C;  3RYI A;  1WB7 A;  1OCZ C;  4N23 A;  4DV1 O;  1NH2 B;  1M57 B;  4IGG A;  4D7T A;  4JI2 B;  4LBE C;  5TIS Z;  4J10 A;  4O4H B;  2P67 A;  2JJ2 G;  2JGD B;  2V4D A;  3JAR B;  1PL0 A;  3UKM A;  1SQP H;  1ZLZ A;  3P3N A;  4DR3 B;  3BVO A;  5B1B C;  1XRE A;  4B3M B;  2AZ0 A;  3TET A;  2B5U A;  1H2S B;  1VAR A;  1SES A;  2L6L A;  3H1J H;  5IJ9 A;  3ZMZ A;  1VQM V;  3RT3 C;  1ZUQ A;  1KU9 A;  3ZHR A;  4MVR A;  4GKJ B;  3E8G A;  4UCT A;  4NKG B;  4B7K A;  5GON A;  2ATK C;  1M90 W;  3JYC A;  3DGE A;  4QJF B;  4J11 A;  1FXV A;  1KC8 W;  3CP1 A;  3FB5 C;  1FFX B;  2QKS A;  4BIZ A;  3K3W A;  2Q4P A;  2IJI A;  3CJH A;  3U11 A;  4C7U A;  3ZIA G;  2BTO A;  1K73 W;  3FFQ A;  3CYO A;  3RN4 A;  4X64 O;  4MSW C;  1JA8 A;  4CH5 A;  2ZD9 A;  2HG5 C;  3ETG A;  1DK1 A;  1W0K G;  2ZE8 A;  1RSO A;  5BMV B;  5J2U A;  1K3E A;  4DV2 B;  2XAQ A;  3AK1 A;  1YHQ V;  3QG5 A;  4JYB A;  1URF A;  3JD2 A;  5IYC O;  5H2F Z;  4RQE A;  3RGB A;  2QSA A;  3R66 A;  4YHH O;  1IDS A;  4OPA A;  3WB2 A;  3CCL V;  2UXC O;  2X6B A;  2R70 A;  4BIU A;  3MDS A;  1RM1 B;  3C3S A;  2OT5 A;  4EEQ A;  4J7J A;  1TVK A;  1R6T A;  1GK9 A;  4U3J B;  1XNR B;  5J2T A;  2ZNI A;  3H1L H;  1XL4 A;  3OTO B;  5IWA B;  2IU0 A;  2JK5 C;  3WB0 A;  5LMN B;  3JAL B;  4F6E A;  2HJD A;  5CN0 A;  3VQV A;  1K5Q A;  5L3E A;  1SF9 A;  1ZL8 A;  2WLL A;  4OGQ B;  5FPR A;  2W0F C;  2DMX A;  3ZMU A;  1TUB A;  4FK5 C;  5DEC A;  4QPJ A;  4CS3 A;  4F6R B;  2M6Y A;  3E22 B;  2Q69 A;  3JAK B;  4K35 A;  4JI2 O;  3D36 C;  3OEH G;  3GWO A;  3OMA B;  3I56 V;  3RYI B;  3A8T A;  4AQY B;  4UCS A;  1XMQ B;  1PD3 A;  3FAV A;  1DGS A;  2BOB C;  4B3M O;  4LFB B;  3T4Z A;  4LF5 B;  1Y4M A;  4IIJ A;  4FIP C;  1CPY A;  3ZRX A;  3UO3 A;  1W0J G;  3SYA A;  3FD9 A;  4TSF G;  1P84 F;  3RVZ A;  4BR6 A;  2Z5U A;  3ZN1 A;  5IJ9 B;  5FNV A;  4UCR A;  1S72 V;  4JI0 O;  2CTR A;  4LF9 B;  1IUR A;  1WA8 B;  5GON B;  5FL7 G;  3OMN B;  2AHY A;  5H6R A;  1WP7 A;  1Q43 A;  4KP4 A;  1HNX B;  1NU1 H;  3CJH B;  1HNZ O;  2OTJ V;  1N0N A;  2PF4 E;  4TUY A;  3FX7 A;  4JAS A;  4XDL A;  1Q86 W;  1VQ7 V;  4I9W A;  3W7T A;  3K0D A;  4DUY O;  2X6C A;  1PNL A;  4UVB A;  1RM1 C;  1SRY A;  5D5P A;  5J2U B;  1YCI A;  1N4C A;  4B3T B;  1J5E O;  4B3R B;  2PZS A;  1HR0 B;  5B3S B;  2IW5 A;  4DR7 B;  2PUS A;  1KMI Z;  3H1K H;  3BFR A;  4W4L A;  4X65 B;  5CA1 A;  1F51 A;  3W7S A;  5DED A;  4CH4 A;  1TVK B;  5IYD O;  4MVO A;  2OTL V;  1K92 A;  2X6A A;  3I5D A;  5IWA O;  1PNK A;  3UM7 A;  3RVY A;  3E83 A;  3GB7 C;  5J2T B;  5LMN O;  3AEI A;  4PEL A;  4LWS A;  2YS8 A;  1EN5 A;  4DV6 O;  2GBO A;  1BQZ A;  1AVM A;  1ZL8 B;  2WLL B;  1OZ0 A;  4J7K A;  1TUB B;  2UXB B;  2WLI B;  2JVD A;  4WFB V;  4AQY O;  3W7X A;  2QDO A;  4UCV A;  1O9H A;  4LFB O;  2ZR2 A;  1SQB H;  1N8R W;  2BTQ A;  3N2K A;  4WFF A;  3FAV B;  1K5S A;  3L73 H;  5GTH Z;  3ML0 A;  2ZE5 A;  3JD4 A;  4IIJ B;  4WFE A;  3AG1 C;  3L71 H;  3U0Z A;  2YEV B;  3E2E A;  3J81 N;  3A0B Z;  2AHZ A;  4LF9 O;  1BT8 A;  2Y48 A;  5EK0 A;  2ITD C;  4WF9 V;  1BSM A;  4RUE A;  1AR5 A;  1H2L A;  3QF7 A;  4FM1 A;  5FNV B;  4QE7 A;  3OFN G;  2HEP A;  3JSN A;  4YJ2 A;  3CXC U;  2QE7 G;  3SJB C;  4JF3 A;  4LF7 O;  4R6Z A;  3E8F A;  1NJI W;  1PM9 A;  4FJC C;  3TXQ A;  1Q3E A;  4BWA A;  3K59 A;  2UUC O;  5IY5 B;  3SYO A;  1N36 B;  1PP9 H;  2WSS G;  3CCU V;  2XOK G;  3ZRV A;  2HVK C;  1IXB A;  5LBQ A;  2HVJ C;  5GTI Z;  2UUA B;  4B3R O;  1QLN A;  1HR0 O;  1V9P A;  3ZHQ A;  4JV5 O;  4DR7 O;  4HNA A;  3ZMS A;  2Q7E A;  4X8A A;  4O2B A;  3CRC A;  1Y67 A;  4DW0 A;  4PDR A;  3KG2 A;  2F4V B;  1R6K A;  2YDE A;  2ZQM A;  4MS2 A;  1EM1 A;  1MA1 A;  1W59 A;  1WPB A;  4DV7 B;  5CA1 B;  5A9G A;  4TQD A;  2M7W A;  2WLJ A;  3DC5 A;  1CP9 A;  4NB5 A;  3CRR A;  2OYQ A;  1F4N A;  3UT5 A;  2F43 G;  4O4J A;  4HBN A;  1AP5 A;  1MSW D;  1S5L Z;  3B09 A;  5JJE B;  5K1P A;  1X4T A;  2HKO A;  4DV4 B;  1G8M A;  2QJ1 A;  4LWS B;  1VIB A;  1GO3 F;  1M9N A;  3T1H B;  2UXB O;  2VQF B;  1MSD A;  1PL4 A;  2GUZ A;  2R9A A;  2Y0I A;  3UO2 A;  3KKY A;  4BAY A;  1A32 A;  1HNW B;  4JI5 O;  2Q67 A;  3HKD A;  4LNU A;  2QM8 A;  2UXD B;  5EZY A;  2ADP A;  3H01 A;  5B1N A;  3CCV V;  2W6J G;  2GTA A;  4K0K B;  3G6E V;  4JAV A;  5C93 A;  4GKK B;  1FXK A;  4I4T A;  4CC5 A;  3ZCC A;  4DR1 O;  3ABL C;  3JD3 A;  1MAB G;  3SR2 C;  4DV0 B;  3W7W A;  1TAE A;  4Q6G A;  5KHH A;  2YIA A;  3N2K B;  4DRX A;  1R3J C;  4IYH A;  4P9P A;  1GN2 A;  2VQE B;  3G71 V;  1YJN V;  1JMK C;  2P5O A;  2AW9 A;  3L70 H;  2FL4 A;  2KKW A;  3CRA A;  1Z2G A;  3UQ8 A;  4PV1 B;  2ZM6 O;  2KB1 A;  4DR5 O;  1K4D C;  1WB8 A;  4I7Z B;  2YXL A;  1Q7Y W;  4J7Z A;  5JVD A;  1OJH A;  1K8A W;  4H13 B;  2QGN A;  4Z2W A;  1NR7 A;  2XHB A;  1L0N H;  1XBL A;  2XT9 A;  3T1C A;  3WU2 Z;  1OV9 A;  4JAA A;  1V55 B;  2C2A A;  3SPJ A;  1N36 O;  3RYF A;  5KMG A;  4XDJ A;  2Q0A A;  3ZHS A;  2K9P A;  2UUA O;  1HDJ A;  2ZT9 B;  2NNU A;  1XHX A;  2RQ6 A;  1XEQ A;  1MZE A;  4FLX A;  3RBZ A;  1XL6 A;  1U97 A;  4UVA A;  3E35 A;  1GKF A;  1GH6 A;  2R9I A;  4N21 A;  3ETQ A;  2F4V O;  4DR2 B;  3NR7 A;  4ZI7 A;  4DV7 O;  4FLV A;  4HNA B;  5CB4 A;  4O2B B;  1EN4 A;  3O9O A;  3FB6 C;  2IU3 A;  4IT5 A;  4D7S A;  1AR4 A;  4O2A A;  1PPJ H;  3MD0 A;  2ADQ B;  4X64 B;  5L3F A;  4DR6 B;  2D3O W;  2WLK A;  4J9Z B;  1RPO A;  4BW5 A;  1Y74 A;  5BR8 O;  2ZIN A;  5EIB D;  4MTG A;  4JI3 O;  1I7F A;  2VQF O;  2EJR A;  3E8H A;  4O4J B;  1K97 A;  2CH7 A;  1SQV H;  3L75 H;  2Y0P A;  3ZRW B;  1HNW O;  4HZ3 A;  3D8C A;  4YHH B;  1Q8I A;  2OCH A;  3T4D A;  1H2G A;  4K0K O;  2EIN B;  4GKK O;  3JAS A;  4G2K A;  2XTA A;  1ZX3 A;  3HKD B;  4LNU B;  2IM9 A;  5EZY B;  3OAA G;  4DV0 O;  1SQQ H;  1VMG A;  1Q82 W;  1Z5V A;  4EKW A;  3HB3 B;  2CAZ C;  1N34 O;  4MTF A;  1FJG O;  1FXK B;  4I4T B;  3OT7 A;  1AI4 A;  4UV8 A;  1VEW A;  4IL6 Z;  1SZX A;  1UFI A;  2CTP A;  2V7Q G;  4DRX B;  1CXZ B;  5L3D A;  3X2Q B;  3RYC A;  1DF4 A;  2JGU A;  2WA3 A;  1D5N A;  1DTO A;  4Q20 A;  4TV9 A;  5L3C A;  1FKA O;  1V55 C;  3SPC A;  2JIZ G;  4PDM A;  2QKA A;  1Q6H A;  4ABM A;  3ZHT A;  3ZHU A;  5KHK A;  3APQ A;  3TJT A;  1OCR B;  1BCC H;  1SS3 A;  4E2L A;  3SYQ A;  1H2N A;  1S0V A;  1IBM O;  4YIP A;  5B1A B;  2DYR B;  1IVS A;  2OCC B;  3RYF B;  5KMG B;  1FS0 G;  1BZK A;  2MK3 A;  2Y69 B;  4DR2 O;  4JI0 B;  3PJS K;  2LFR A;  1NS1 A;  4CS2 A;  2Y4T A;  5EBW C;  2WLH A;  3MHS C;  1VQK V;  4X1I A;  3BA8 A;  2EIK C;  4ZI7 B;  1NTK H;  4AI8 A;  4FLU A;  4DR6 O;  5CB4 B;  1R3I C;  2HJF C;  3O65 A;  4PHZ A;  3CX5 F;  1FD9 A;  3DC6 A;  2LFS A;  4PA7 A;  1SQF A;  3CRM A;  4DV5 O;  1HNZ B;  1GN4 A;  1XOU A;  3K0G A;  4PDV A;  2ZIM A;  1Y74 B;  4DUY B;  3N2G A;  1HP8 A;  4I55 A;  5KX5 A;  2EIN C;  4G28 B;  1YEW A;  4KFM A;  2QM7 A;  1XI1 A;  1XHZ A;  4I50 B;  2CH7 B;  1J5E B;  1WP8 A;  1B06 A;  3HKE B;  4FFK A;  4LFA O;  3AG2 B;  5JH7 A;  1QBZ A;  5EC2 C;  1AJP A;  3ABM B;  3ZHV A;  1HWY A;  1OCO B;  3JAS B;  3CMA V;  3A2F A;  1SER A;  3JAT A;  1M57 C;  3QO7 A;  4G27 B;  2HR3 A;  2IH3 C;  5CBF A;  2OWO A;  4RUF A;  3C90 A;  3S3W A;  3PN1 A;  3EVK A;  2FML A;  2DOS A;  2A3Q A;  4DV6 B;  1R6N A;  1JQ0 A;  3GWK C;  3CB2 A;  2GHY A;  1R1B A;  4GUN A;  5GW7 A;  3RYC B;  2ZE6 A;  3K58 A;  4X20 A;  1OCC B;  5CBG A;  3OMI B;  1JCH A;  4TV9 B;  1BGY H;  2FB5 A;  3WFV A;  4JI7 B;  2EIJ B;  3ABU A;  4R50 A;  1ORQ C;  1GN3 A;  5B1A C;  2DYR C;  4I0X A;  2HLD G;  2OCC C;  1I5X A;  4E4E A;  1NQT A;  3OR7 C;  1SET A;  1QHT A;  5LGN A;  4FLT A;  3P32 A;  4JTC B;  2Y69 C;  1UPG A;  3OE7 G;  4PA9 A;  3THO A;  5IDJ A;  1YXB A;  2NLJ C;  3BAB A;  2VS0 A;  2VWK A;  2OIG A;  2DW4 A;  1XMO B;  1KB9 F;  4LF4 O;  5JCO C;  1QVF U;  2DQ3 A;  4MTO A;  3STZ C;  2H94 A;  2N05 A;  3FYE B;  1YDX A;  4FZ0 A;  5LOV A;  4H0L B;  2R9R B;  2ZCE A;  2P22 C;  3K5M A;  2DYS B;  3LUT B;  4X1I B;  1G6U A;  2H3O A;  3DSQ A;  5H5N A;  4LF7 B;  2EZO A;  5IE9 A;  5LHG A;  3ZS8 C;  1AJQ A;  2UUC B;  2EZP A;  1AP6 A;  3WB1 A;  4B3S O;  1M5I A;  2KG7 A;  1PV0 A;  1RSO B;  1YVW A;  4H37 A;  1XDC A;  4L87 A;  3SPI A;  2HFE C;  2PYJ A;  3MHH C;  3CME V;  2YXH A;  3AG2 C;  2DE0 X;  3ABM C;  2FKX A;  3JSL A;  1FPO A;  1Z5W A;  3SPH A;  3K04 A;  3N2G B;  4NTW A;  5CA0 A;  2PY5 A;  4I55 B;  5EIB C;  5KX5 B;  4JV5 B;  3JAW A;  3JD1 A;  1YJ9 V;  1MOF A;  4J41 A;  4YY3 O;  1NI8 A;  4UVC A;  5JH7 B;  1IX9 A;  3AG4 B;  4FVM A;  5CMU A;  1VP7 A;  1BL8 A;  3ETD A;  1YI2 V;  4UFZ A;  2EIL B;  1VQ4 V;  4U7O A;  1OCC C;  3JAT B;  1I94 B;  2CTQ A;  2WPD G;  2ILM A;  5KAF Z;  1J95 A;  4KHP B;  3W7U A;  1AI7 A;  4CZZ A;  5BXZ A;  4ZKI A;  1F23 A;  3K9A A;  4QGP A;  3IC7 A;  4JI7 O;  2BE3 A;  4JI5 B;  5L3G A;  4X20 B;  3OUF A;  3K9S A;  4U3F H;  1H38 A;  3JD0 A;  2ZDI A;  4GCZ A;  3CRQ A;  4NTX A;  1K34 A;  3A0H Z;  4DR1 B;  4I0X B;  2EJ7 A;  2DN9 A;  4K8X A;  1VF6 A;  2ZR3 A; 
#chains in the Genus database with same CATH homology
 1KEC A;  1M57 B;  5B1O A;  2KB1 A;  1K4D C;  1H8H G;  5CBH A;  2FTK A;  1Q7Y W;  4LBE C;  3B77 A;  1KD1 W;  1K8A W;  2P67 A;  5KA6 A;  1NVP D;  2JJ2 G;  1NR7 A;  2DYS C;  3ASN C;  2QTO A;  1PL0 A;  2P90 A;  3UKM A;  1YTF D;  3ASO C;  3T1C A;  4GX1 A;  4MW3 A;  2YEV A;  5B1B C;  1V55 B;  3TET A;  1DLB A;  2B5U A;  2DWD C;  2C2A A;  3SPJ A;  1UJW B;  1SES A;  2B1G A;  3CCM V;  3ZMZ A;  2X0L A;  1VQM V;  4QIW F;  1K4C C;  4MVR A;  3E8G A;  1BHA A;  4XDJ A;  3K03 A;  1VQ8 V;  3AG1 B;  2ATK C;  2NNU A;  1M90 W;  3JYC A;  1ROP A;  5EC1 C;  2XAS A;  3DGE A;  4QJF B;  3RBZ A;  5HFL A;  4KUM A;  5B3S C;  1FXV A;  1XL6 A;  3CC2 V;  1K9M W;  4UVA A;  3E35 A;  1KC8 W;  3CP1 A;  3FB5 C;  2QKS A;  1GKF A;  4BIZ A;  3K3W A;  4UV9 A;  3ZJZ A;  1E1R G;  2R9I A;  2IJI A;  3NXS A;  4N21 A;  1AI5 A;  5H9C A;  3ZIA G;  1K73 W;  4TT3 G;  3TK1 A;  3F7Y C;  4P30 A;  3CYO A;  1WPX A;  3LNM B;  3G4S V;  4MSW C;  2ZD9 A;  4MT8 A;  4QE9 A;  2EIM B;  1F4M A;  3AG4 C;  1OCO C;  5H6Q A;  3RW0 A;  3FB6 C;  2IU3 A;  4GT1 A;  4MVM A;  5CA3 A;  2HG5 C;  3ETG A;  1W0K G;  1MG1 A;  4RQF A;  3MD0 A;  4PA6 A;  1H8E G;  4XDK A;  5L3F A;  1K3E A;  2ZXW B;  2D3O W;  2XAQ A;  2WLK A;  3TCU A;  4J9Z B;  1RPO A;  4BW5 A;  1YHQ V;  4JYB A;  3JD2 A;  4MTG A;  4MVQ A;  5L3B A;  5IYC O;  1YIT V;  4RQE A;  3CCE V;  4LC1 A;  3F5W C;  2EJR A;  1BMF G;  1FXH A;  3E8H A;  3CCL V;  2X6B A;  3K08 A;  1K97 A;  4BIU A;  1PKX A;  1RM1 B;  2YSU B;  2OT5 A;  3ZRW B;  1GK9 A;  4HZ3 A;  2WLN A;  1VQ5 V;  3ABT A;  3T4D A;  1H2G A;  4JAU A;  2EIN B;  4RAI A;  1K33 A;  1PNM A;  2EIJ C;  1VQO V;  4G2K A;  4CBC A;  1P7B A;  1XL4 A;  1DF5 A;  5KA5 A;  3OAA G;  3LSQ A;  2JK5 C;  2JEU A;  2IU0 A;  3WG7 B;  1Q82 W;  4EKW A;  3IFX A;  1JVM A;  3P30 A;  5KUK A;  3HB3 B;  4MTF A;  3E89 A;  3OR6 C;  1FXK B;  5CN0 A;  1K5Q A;  2JJ1 G;  2XAF A;  4PDL A;  5L3E A;  1G4Y B;  1AI4 A;  2WLL A;  1R73 A;  1V54 B;  2W0F C;  4UV8 A;  1L1F A;  1VQ9 V;  3ZMU A;  1QVG U;  3CD6 V;  4FK5 C;  4WCE V;  4QPJ A;  3BY6 A;  2Z3Y A;  1VQ6 V;  2V7Q G;  1B6Q A;  3FYI B;  5L3D A;  4XBF A;  3X2Q B;  4I5S A;  2Q69 A;  1NH2 D;  2B1I A;  2H8P C;  2IJH A;  1DF4 A;  1SZT A;  3OEH G;  3GWO A;  3OMA B;  3I56 V;  1DTO A;  4Q20 A;  2QA4 V;  5L3C A;  3M99 B;  1V55 C;  3SPC A;  2JIZ G;  1E79 G;  1Y66 A;  4PDM A;  1PD3 A;  3A0R A;  2BOB C;  3T4Z A;  4MVS A;  4QPK A;  1Y4M A;  2JDI G;  1M56 B;  3LDC A;  1CEZ A;  4FIP C;  1CPY A;  1OCR B;  3ZRX A;  5HFM A;  5IY5 C;  1W0J G;  3T2M A;  1R3K C;  3SYA A;  3IGA C;  1YSC A;  3CCQ V;  2DWE C;  3CC7 V;  4E2L A;  4TSF G;  3ABL B;  2JEX A;  3FKS G;  3OGC C;  4H33 A;  3SYQ A;  1YJW V;  3RVZ A;  4J9Y B;  2Z5U A;  4MVU A;  3ZN1 A;  1S0V A;  1ENV A;  4P9O A;  5B1A B;  2DYR B;  1KQS U;  2OCC B;  1S72 V;  3VOU A;  1FS0 G;  1NVP B;  1OCZ B;  1ZWI C;  3FB7 C;  4ZBM A;  3E86 A;  4JYC A;  2MK3 A;  2Y69 B;  2WLM A;  1YTF B;  1AJN A;  2EIM C;  5FL7 G;  3OMN B;  3ZMT A;  2AHY A;  5H6R A;  3PJS K;  3SPG A;  4GX2 A;  2LFR A;  2WLH A;  3MHS C;  2A0L A;  1QR9 A;  2ZXW C;  5EBW C;  4KP4 A;  1FFT B;  1VQK V;  4X89 A;  3OM3 B;  2EIK C;  3STL C;  1RPR A;  3EHB B;  3CCJ V;  2OTJ V;  2CK3 G;  3LDD A;  3ZMV A;  1R3I C;  2HJF C;  4MTX A;  4JAS A;  4XDL A;  4WFA V;  1Q86 W;  1VQ7 V;  4Z1M G;  2LFS A;  4I9W A;  3W7T A;  3K0D A;  1ARO P;  4PA7 A;  4ASU G;  2X6C A;  3OEE G;  1PNL A;  4LP8 A;  4UVB A;  1RM1 C;  2EIL C;  1SRY A;  1GM8 A;  2Q68 A;  2P6J A;  3K0G A;  1COW G;  1EZJ A;  4PDV A;  2UXX A;  2EIN C;  3HPL C;  1GTO A;  4G28 B;  1IXM A;  5B3S B;  2IW5 A;  4KFM A;  2LP7 A;  2QM7 A;  3ZRS A;  1I5Y A;  1F51 A;  3W7S A;  4TWK A;  2DQ0 A;  2WWW A;  5IYD O;  4MVO A;  1R3L C;  2OTL V;  1K92 A;  3AG2 B;  2X6A A;  1WLE A;  1QBZ A;  5EC2 C;  5DM6 V;  1AJP A;  1PNK A;  3ABM B;  3UM7 A;  4QNH B;  3RVY A;  1TUE B;  3E83 A;  1V54 C;  3GB7 C;  2X7R B;  1HWY A;  1OCO B;  3AEI A;  1LNQ A;  3CMA V;  1GMG A;  4PEL A;  3ZRW A;  2P7T C;  1OHH G;  1SER A;  4WFG A;  1M57 C;  3AG3 B;  3QO7 A;  4G27 B;  4DO2 A;  4OXS A;  2HR3 A;  1QLE B;  3B8M A;  3E8B A;  2IH3 C;  5CBF A;  4RUF A;  4MVZ A;  2K1E A;  2PI5 A;  2WLL B;  1OZ0 A;  4UXN A;  3JCZ A;  3SYC A;  1R6N A;  1M56 C;  1JQ0 A;  2WLI B;  4GX5 A;  4YXW G;  2GHY A;  3W7X A;  4WFB V;  5GW7 A;  3DTU B;  4F4L A;  3CCR V;  4GX0 A;  1QCE A;  2ZR2 A;  4JGS A;  1OCC B;  5CBG A;  4JTD B;  3OMI B;  1N8R W;  1JCH A;  4MW8 A;  3CPW U;  4LCU C;  1JX9 A;  4WFF A;  2IJK A;  3WFV A;  1K5S A;  2EIJ B;  3ABU A;  1S76 D;  3ABK B;  4R50 A;  1ORQ C;  3D3I A;  3ML0 A;  2DYR C;  3JD4 A;  2HLD G;  5EBL C;  2OCC C;  1I5X A;  5B1A C;  4WFE A;  3ETE A;  1NQT A;  3OR7 C;  1SET A;  5J9P C;  3AG1 C;  5LGN A;  3P32 A;  4JTC B;  2Y69 C;  2YEV B;  5BZB A;  1NBM G;  3E2E A;  2AHZ A;  1VQP V;  2Y48 A;  3OE7 G;  4PA9 A;  3B8N A;  5EK0 A;  2ITD C;  5EBM C;  4WF9 V;  1KKD A;  5IDJ A;  2GSM B;  4RUE A;  3LDE A;  2NLJ C;  4P2Z A;  4QE7 A;  3D36 A;  3OFN G;  2DW4 A;  3OW2 U;  1KP3 A;  2WAM A;  2A79 B;  5LHH A;  3CXC U;  2QE7 G;  5LGT A;  5E1A C;  1QVF U;  2DQ3 A;  4MTO A;  4JF3 A;  2QEX V;  2W6I G;  3STZ C;  3R65 A;  2H94 A;  3FYE B;  4R6Z A;  3E8F A;  1NJI W;  1QR8 A;  4PA4 A;  1VQL V;  4FJC C;  2R9R B;  1P4R A;  2DYS B;  1S77 D;  3ASN B;  2IH1 C;  3LUT B;  1GM9 A;  2IJJ A;  3ASO B;  5IY5 B;  3SYO A;  2UXN A;  2EZO A;  5B1B B;  5LHG A;  1AJQ A;  3CCS V;  2WSS G;  3CCU V;  2XOK G;  2EZP A;  3ZRV A;  2HVK C;  5LBQ A;  4X88 A;  1THZ A;  2HVJ C;  4H37 A;  1QLN A;  4L87 A;  3SPI A;  2HFE C;  2V1D A;  3I55 V;  4JTA B;  3MHH C;  3CME V;  1NR1 A;  1M1K W;  3AG2 C;  2PI4 A;  1EFR G;  3ZMS A;  3ABM C;  4X8A A;  5KUM A;  3SPH A;  3K04 A;  3SYP A;  2Q6A A;  3QO5 A;  4PDR A;  3VBB A;  3KG2 A;  3JD1 A;  4JPR A;  5LHI A;  1YJ9 V;  1R6K A;  4UUJ C;  2ZQM A;  4MS2 A;  4U7N A;  3WG7 C;  1JOY A;  1MOF A;  2M7W A;  2WLJ A;  3ZN0 A;  1CP9 A;  1BHB A;  5LGU A;  2ITC C;  3AG3 C;  3BEH A;  2EIK B;  4UVC A;  1FXK C;  1QLE C;  4RO2 A;  1F4N A;  1YIJ V;  3AG4 B;  5CMU A;  2F43 G;  1MSW D;  2ZDI C;  2XAG A;  1BL8 A;  3ETD A;  3SJQ C;  3F7V C;  3X2Q C;  2HKO A;  1GM7 A;  1KP2 A;  1G8M A;  2EIL B;  2XAJ A;  1YI2 V;  3QNE A;  4R7C A;  1VQ4 V;  1GO3 F;  1M9N A;  1VQN V;  4U7O A;  4HYO A;  1OCC C;  1AI6 A;  4DXW A;  2WPD G;  1EBO A;  1J95 A;  3W7U A;  1W2B U;  4BAY A;  2XAH A;  1AI7 A;  2Q67 A;  4FPP A;  4PA3 A;  4WFH A;  3ABK C;  4CZZ A;  2QM8 A;  3LSS A;  4FMT A;  1K7D A;  3H01 A;  4ZKI A;  3EFF K;  1JPX A;  5B1N A;  1F23 A;  2XND G;  3K9A A;  5DN6 G;  1JJ2 U;  1OCR C;  3CCV V;  2W6J G;  3IC7 A;  4HAM A;  1Q81 W;  3G6E V;  4JAV A;  5C93 A;  1FXK A;  5L3G A;  2EBO A;  1AR1 B;  3ZCC A;  3OUF A;  3K79 A;  3ABL C;  3QO8 A;  3JD3 A;  1MAB G;  1H38 A;  3CC4 V;  3JD0 A;  3W7W A;  4R8C A;  3K06 A;  1E1Q G;  2A9H A;  5IYB O;  2ZDI A;  1R3J C;  4GCZ A;  2WLI A;  3OUS A;  4P9P A;  3G71 V;  1K34 A;  1S5H C;  1YJN V;  2BOC C;  3FB8 C;  1NKD A;  1S3J A;  1OCZ C;  4N23 A;  1NH2 B;  2ZR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...