2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
2FNWA 4GP5B 4BDVA 4DP8X 2FQEA 3DTUB 1EZLA 1GYCA 2YQBA 3OMAB 1RZQA 4JHVA 3GYRA 3EHBB 2HLEB 1GY1A 2FWLB 2VW6A 3TBBA 2OCCB 2IWEA 3ZIYA 2B3IA 3QJQB 5D4HA 4E9TA 4BWTA 2IDSA 4DP4X 2CALA 2XXFA 1ET7A 2ZWNA 5B3SB 3NJJA 1CC3A 4PCYA 3JT2A 2NRDA 2DY2A 1A3ZA 4YSTA 1CYWA 3CZUB 3QQXA 4BXVA 2DYRB 3T9WA 4YSEA 5A7EA 4HAKA 1A4BA 1PLCA 1FWXA 3GXUB 2PPFA 4HHGA 2UX7A 1QNIA 1L9OA 2WSDA 2QDWA 1AZRA 2TSBA 4ZK8A 2P80D 4PAZA 3ZBMA 5B7EA 3H56A 3OD3A 2GBAA 4G7QB 3FSVA 5I6NA 1WA0X 1SHXA 3FS9A 1SF5A 1BYPA 4A2GA 1AG0A 4A2DA 2BP0B 2XYBA 2HRGA 4N8UA 2XX0A 4YSRA 2BWIA 1M9WA 4BK5C 1A65A 1JXGA 2AANA 1PZCA 2AVFA 4E9SA 3QJVB 1OF0A 4KNSA 4DPBX 2GI0A 2VM4A 3IBOA 4K9JA 1SFDA 1AANA 1J9TA 2Q5BA 3EH3B 1BXAA 1PLBA 4WKXA 3BQVA 2QPEB 5ANHA 3GDCA 4CSPA 3X2QB 1OE2A 2MTAA 2GSMB 2BW5A 2MRYA 4KO9A 3UACA 2IWFA 1ASPA 3X1NA 2X87A 3S3BB 1SJMA 1N70A 1ZDSA 5B1KA 5I5MA 4AX3A 4GP8B 2IDUA 2QPDB 1ET5A 1MZZA 1B3IA 3UAAA 5TK4A 1GS8A 2BWDA 4YL4A 1JXFA 2I7OA 4N4YB 3FT0A 2J57A 3QPKA 2XVBA 4G7RB 1JZEA 1MZYA 2QT6A 2PPDA 2I85A 1OCOB 2YAEA 1BQRA 2JXMA 3DKHA 4M4RB 1KDIA 3IN2A 3CDZB 4X4KA 3QJTB 2BZCA 3NJIA 1NINA 4E9WA 2Q9OA 2EIMB 6PAZA 4L0PB 2YEVB 2FT6A 2AZUA 7PAZA 1AS7A 1JXDA 2EIKB 2EINB 1AZCA 2VN3A 5EHFA 2XX1A 5AZUA 5AFAA 1F56A 2DWSA 1T5KA 2YAOA 4DP2X 1IUZA 1J9SA 4AKQA 2UXTA 1JVLA 3FU7B 2H5UA 3IE9A 8PAZA 1HFUA 1KDJA 3N55A 1GS7A 1QLEB 1AZNA 2PPCA 4YVUA 3KW7A 2H47C 1JZHA 3ZX1A 1JZJA 3OM3B 4YSAA 1KCWA 3ERXA 3FYIB 2R7EB 3FQYA 1W8EA 2HX7A 1JZIA 3TBCA 4BDVB 1CYXA 2RACA 3X1EA 2QDVA 1GW0A 5E9NA 4DP9X 2VMJA 4DPAX 2CJ3A 4DP0X 2UXGA 2BW4A 3H4FA 1DYZA 5I6LA 2HX9A 2IAAC 4KO6A 2PCYA 4UAHA 2UXVA 2YAQA 2ZONA 2XUWA 3V9CA 4W1TA 3NJLA 3CVCA 1MG2C 1BXUA 1L9TA 1ZDQA 2PPEA 1MDAA 2PCFA 1V10A 4DPCX 1NIEA 2W88A 5FC9A 5F7AA 1BEXA 1A8ZA 2YAHA 2IWKA 1AZUA 1KV7A 1NIAA 4Q8BA 3T71A 4A2FA 2HRHA 2N0MA 2XV0A 3NJKA 3HEIB 2DWTA 3JTBA 3H4HA 2PP7A 3PAZA 3ASNB 1A4AA 4YSPA 1L9SA 1AQ8A 4A2EA 4DP5X 1YLBB 4E9VA 4HZ1A 1L9PA 3HB3B 1KBWA 3QJUB 3TU6A 9PCYA 1TU2A 3CVDA 2VW7A 5PAZA 1WS8A 2GC4C 2IH9A 5LDUA 1GS6X 1BQ5A 3BVDB 3TA4D 2GC7C 3FSAA 5I6OA 2VSKB 3FYEB 1PMYA 2BHFA 1XMEB 2BP0A 3U25A 3ABLB 2HX8A 2AZAA 2HXAA 2XXGA 1PZAA 1FA4A 1EHKB 1OE3A 2A3TA 4HCGA 1TKWA 3IEAA 1J5DA 3MX0B 4BWUA 2XLLA 2B08A 3T6ZA 1XB3A 2WO2B 4KNTA 1PCSA 2AFNA 2CUAA 1ZPUA 4GXFA 4QLWA 1WS7A 1SDDB 5I5JA 3X1BA 2FTAA 3X1FA 2ZXWB 1AACA 4BWWA 3PLYA 2JKWA 3UGEA 1AIZA 1IKOP 1IBZA 1V55B 1NDTA 1OCZB 3PPSA 1IC0A 3OMIB 4HCIA 4UF7C 2BZ7A 3MBWB 1CUOA 5I6KA 4E9XA 2UX6A 3NJGA 4QKTA 1ET8A 1XB8A 5IY5B 4FAAB 2EILB 2VW4A 3WKPA 3D12B 1JZFA 3EH5B 2BP8A 4P5SA 1OOWA 2GIMA 4G71B 1BYOA 1NICA 4E9YA 1ILSA 2IH8A 3UABA 4GYBA 1ASOA 2GB2A 4AZUA 4E9RA 4EF3A 1WAEA 1ADWA 2FJSA 1W6LA 3AY2A 1ASQA 4HIPA 1OCRB 5B1JC 1E5YA 1KYAA 3AZUA 5TK2A 1KBVA 2CAKA 3WG7B 2FT8A 4CSZA 2TSAA 3AW5A 1SFHA 1PY0A 2EIJB 1V54B 4AKOA 2PP8A 3UADA 3ABGA 2PPAA 3NJHA 4UANA 4GY4A 3NJFA 4Q89A 3AG3B 3OMNB 3EH4B 4P5RA 4F2EA 1BAWA 1RZPA 2XV2A 1A4CA 5I28A 1NIFA 2UXFA 4A67A 1AG6A 3NP4A 5I6MA 4KNUA 1TEGA 3FPXA 4G7SB 4A2HA 2J5WA 1M56B 4AKPA 3KW8A 2DYSB 1E30A 1JVOA 1NIBA 3FSWA 1CURA 3FU7A 2OJ1A 2OV0A 1KGYE 4YVNA 4NAJA 1QHQA 1XB6A 3ABMB 2VSMB 4MFHA 2FQFA 2YAPA 3FQ1A 1E67A 3V9EA 2I7SA 4DP6X 2VM3A 3FPYA 7PCYA 2JFCA 3PXLA 4A66A 2IDFA 1FFTB 1AS8A 1E65A 1ZIAA 4NB7A 4YSCA 3N2JA 1PF3A 3NP3A 2YXWA 3PAVA 4RH4A 1ZV2A 1AOZA 1J9QA 1GY2A 1L9RA 1PAZA 1RCYA 1WA2X 1PZBA 1SF3A 5D4IA 3CVBA 3S8FB 2P80A 2Y69B 3OQRA 3L45A 3ABKB 1BXVA 4AI7A 3C75A 1BQKA 5B1AB 3SBRA 1UATA 1SNRA 4E9QA 3EF4A 3AG1B 4YSOA 4YSQA 4A68A 1JOIA 1M57B 4M3HA 3SBQA 4YSDA 3DIVA 3UAEA 3G5WA 2YARA 1PNDA 4KO7A 2CBPA 2PLTA 2YAFA 4DP7X 2XWZA 4JHUA 1MG3C 3NYKA 5AKRA 1ETJA 3S8GB 3NSYA 1NPJA 1RKRA 1I53A 1WA1X 2FQDA 3NSDA 4G70B 5B1BB 3AG4B 3WI9A 1PNCA 2IDQA 5B7FA 4BXSV 1JZGA 1TEFA 3NSCA 3WKQA 4G72B 5I26A 2CCWA 1SHWA 1AAJA 1R1CA 3ASOB 5PCYA 4F2FA 3QJSB 3IN0A 6PCYA 4NERA 1GR7A 4YSUA 1J5CA 4WTQA 2W8CA 3NJMA 3SBPA 1N68A 2YAMA 4KO5A 1NIDA 1NWPA 3AG2B 3WNIA 3FQ2A 2LLNA 4KOBA 2DV6A 4TXVB 2J56A 3WNJA 3WIAA 4F7KA 3QJRB 1PLAA 2J55A 1NZRA 2GHZA 4W9ZA 4YSSA 1NPNA 1DZ0A 1KCBA 3CG8A 1J9RA 4DP1X 3PAUA 4HALA 4KOCA 1IBYA 1OCCB 2FT7A 3CDZA 1JERA 3S3DB 3NSFA 3RYMA 3X1GA 3NT0A 2IDTA 2H3XC 5I5IA 1ILUA 1NWOA 3FU8A 3TASA 3SQRA 5D4JA 1HAWA 3NJNA 4ENZA 2XV3A 4FA7B 1E5ZA 2HZHA 5B1JA 2FQGA 2ZOOA 1ID2A 1X9RA 1X9UA 3FSZA 1OV8A 1L9QA 1GSKA 3T6VA 3ZDWA 2XU9A 5B7MA 5F7BA 2Y1AA 3FU9A 2X88A 1AZBA 1OE1A 2R7EA 4JKNA 3S3CB 2BO0A 3T6XA 3T6WA 4HHWA 1HAUA 1URIA 1NTDA 2BP8B 2YXVA 2E86A 5I6PA 2PP9A 2WO3B 4GP4B 1W6WA 4HCFA 1AS6A 1AR1B 1SDDA 1VLXA 1ZIBA 3PCYA
chains in the Genus database with same CATH superfamily
4MTMA 1MHPL 1JUFB 4J1UA 4O2AA 4IEFB 5DVLA 5I6XC 2ZKOA 4Y2LA 5AOZA 5K93A 4ICGA 3H85A 4WW2A 1ZGLM 1RK1A 1EMTL 1KXVC 4PJIB 2G38A 5DEFA 1B06A 4M00A 1I3RB 3FT4A 2YD7A 1PLGH 4K35A 4PJCF 1UH3A 3WS6A 4B3MB 1OW0A 1T4KB 2ROXA 4BUHA 5FO9B 1Z0NA 3QZBA 1T2QH 5K59E 5FUCC 4N2CA 5L3BA 3W7SA 3K2KA 5B1CA 4QF1A 1R33A 4PJBA 1S3RA 2HTKD 1F97A 3K8MA 3QRFM 2A79B 1FH5L 1KG0B 3MJ9L 2J1ZA 4IU2A 4OCNC 3W2DL 3ZHFA 4MJJA 1TQCB 3IMSA 2EYRB 2VWEE 3DV4A 4GW1A 4NQTA 5EPMB 5T8IA 4PP2B 1DBKH 3KH3A 4OZHE 3JCUZ 4YE4H 1I1AD 3FX7A 1R73A 1K85A 3RHWF 3BYYA 4GEJA 5C9KA 3II3A 1JF1B 2GUZB 1IFHL 2F0CA 5F72S 2J25A 1QEWB 2BVQA 3HPJA 3TNNA 2HKAA 3QDJB 2CLVA 4AMKH 5GJSH 3CZKA 1BVLA 2Y7SA 1FUNA 2Y7QB 1DJSA 1EAQA 2AK4A 3M07A 2X4RB 3MOQA 4HK3J 1KC8W 1EZVH 3QUXD 4IHOB 4G43B 3MODL 4X62O 4ABUA 2I07B 1RJCA 1NOLA 2F58H 3MROB 4NFBA 4RUFA 2OMUA 1GAXA 4NN5B 1H2NA 4TLTA 4UT9A 1OANA 4OCLC 1AXTH 4KHXL 5H2BB 4AVIA 4GKSB 4LARL 4A2DA 3CMAV 2F7PA 3AK3A 5FR3A 4LF9B 4FLRA 4I55A 1Y1DA 2R56L 4NUQA 3LN5B 1OF0A 3D05A 3AY4A 4JQIA 5EB9A 3B6SA 2FNBA 3T0EC 4CU6A 1SFDA 4GLRI 1EEYB 2AJYL 1CEZA 2WMPA 4XZUA 4B9CA 4GG6A 1QX1A 1UJ3A 3TFBA 5E5UB 3SJVD 3RL1B 2HMID 2W6JG 2HPOA 2ZQMA 4HKZA 1FGVL 1NC2B 1VF5B 3T8XB 2VXQH 2DLTA 1S76D 4GNKB 3BUQA 1PGRB 3E6FA 3EYVB 1T04B 2P06A 5DJZB 3FCTA 3EJPA 3ROLA 5EZOH 4YJ2A 1HL8A 1U3YA 2EDQA 3EOTL 3P9WB 2LW7A 3ZCCA 4NO0B 5F1IA 1JZ2A 5DJYB 4AL8H 4YDIL 3UO1H 4WEEA 4AQ8A 3WHXA 4ZTPH 2ATPA 1ANUA 4JG1L 5D2NB 2CK3G 2FSEA 3WMPA 3HZ3A 3ILPA 2L7JA 1WBZA 1ZHBA 1TCRB 2XVLA 1G6RL 1YJDH 4M7KH 3PN1A 1M7DA 4PJ7E 4BQ8A 3QH3B 2YA2A 1R3KB 1XQ8A 1RURL 1D6VL 3PNWB 4FXLA 4ZNEE 1NCIA 4EAEA 1NOFA 2ITCB 1ZVNA 3VI4A 4UQDA 2VXSH 4NTXA 4U6VL 4JHAH 3JWOL 3V4VH 2F54E 4X4KA 1ZGLB 5L4FA 4LF7B 2WLLB 2H0FA 1BD2E 1JFQH 1W0JG 2IWGA 2PXYA 1BX2B 2R29H 3QJTB 5CZXD 5GGUA 4AV4A 4DPRA 4UM8B 2AXFB 4E9WA 1RULH 4RGNC 1QRNA 4LFCO 2EIMB 3B7RL 4PVLA 4ZMAT 1E40A 3KPNA 3D4ZA 5DS8B 3H1IH 3CFBB 1OL0A 1DJXA 5I18H 4JCWA 1JS4A 1DEEB 2DKUA 4NNPH 4QXWA 1MNGA 4BELD 2EINB 1IC4H 4HZLA 4I0PB 5JH7A 4LAJH 2XX1A 3MRDB 3HZYA 5AFAA 1MSWD 2IOOA 5JLZB 4QYOB 4DZBA 3QHFH 4W9LC 2AHZA 1RZIA 5C8JA 3OWRA 1DQQB 1X4XA 3D50A 1EZUA 4JYAB 2X6BA 2RGSA 2BE3A 3WNNA 3QIBB 4UI2A 2A1WL 5CIPB 5JYMA 4N2FA 3AB0C 4PRNA 2CH8A 3DVGA 3EFFB 3RB7A 3OZ9L 3RGVD 4X83A 3F8UB 3DVFA 1JZHA 3FQRA 4L3CB 4Y1AE 1ZT7B 2G9HB 4KK5D 3DPDA 2DD8H 4Q7DA 5D72L 3CN0A 3TF4A 4U4IA 2VDQL 1HINL 2E9JA 3B6SB 2KC0A 3UT5A 4DRXB 2A1WH 3FOLA 1B6UA 5D7JB 4G9FA 1P4RA 3GDBA 5D4QA 5ABAA 1R47A 3V0WH 1VB9A 5JDSA 5HGAB 1IBMO 3FK3A 2C3XA 4Y8DC 2Q5ZA 2R51A 4L8DA 1DVTA 2UXVA 4E2LA 4F58H 1Z1WA 4HWEL 4CA4A 3KVQA 4X1IB 5F7UA 3AFLA 2Q7EA 2J43A 3NJLA 3O2VL 4NQEE 1RSFA 4YZWA 2HVKB 2WJ5A 1V10A 4LSRH 2VR5A 1L4IA 2VDOB 5SWZD 2FX7H 3W9DB 5IESH 2EVHA 1UJTA 1R75A 3NGBC 3VWJB 1FNLA 4WO4C 4I0CC 4JPRA 5T1MA 1S9YB 3F5WC 5KUMA 1EVTC 3TNMB 4K3GA 4X8JB 3C6LC 1Y1UA 2N0MA 5CD5D 4PJ7A 3IGFA 3R4RA 1CCZA 1ZK9A 3QXTA 4OD1L 1LHZA 1Q0YL 1JPSH 3PDOB 4ZYKB 4N8CH 3SDYH 3CSGA 4DP5X 1E7UA 4YFDB 5G4OA 4P2YA 2GTQA 1Z3GL 1FPTH 3HB3B 2YUAA 4DKTA 3LB6C 1YJDL 2VL5B 3GJFH 1SY6L 2FB4L 4MS2A 2ZYSA 3CFIC 2KQMA 4XP9L 3QDAA 3ZTNH 4AYEC 1I9JH 3GB7A 5E8EB 3DYPA 3FYEB 1V9PA 1MCOH 2FVNA 4IMKA 4UNTA 4Q20A 1R24B 2CLRB 2X4UB 3T4YA 1VEMA 3IGLA 4NJAL 4UT7H 4X9FA 4EDXB 1KLGB 1W0WA 2Z65C 4JJ5A 2WXQA 2YD5A 3HZYB 3RGVB 1UEMA 3VA2C 4QTHB 1NBMG 2MQ0A 3C6LB 3UTSE 4N0YL 3O8XA 1SETA 4ZTEA 2CR3A 3WL9A 1S5HC 5E6IC 3MRHB 3UIZA 2BFVL 2PWFA 3T6ZA 5EDSA 5HHOA 3CE1A 1WPBA 3CSBA 4M9OA 2DI9A 1RK7A 5IB3A 3QZLA 4UQEA 4LL1A 5D5MB 4MNHA 1RP3B 4HEPG 1NBVH 4ZAKD 5EZLA 1KYOJ 3N0PB 3APOA 5DWUH 4AE1A 4Y5YB 2AJSL 3STLB 4YXKL 1TTAA 4WI2A 3TBWA 3GS7A 3NA9L 1ZVSA 5E7FA 4ZW7A 2W38A 1OAQL 5I74B 1PFCA 4B3MO 2LAGB 2CO2A 3TVMD 4XXDA 3EH5B 3MV9B 3E9UA 2KZWA 4JUTA 1E5CA 1Z66A 1G84A 5D7IA 1M2VA 3VXUB 3RIKA 5GS0H 5F1SA 1KTDB 1AJ7L 4HIXH 3FO2B 4KK6D 2IH8A 1B0IA 3D7PA 2CO6B 1MHEA 3T2QA 4LF4O 3GSVA 2LQRA 4G1EA 4BV1A 1XTLA 4D0DA 2Z1PA 2ZXGA 3SGJA 4F91B 1U8NA 1J1XL 1RZJL 4HWBH 4DUZB 1LP9A 1N3NA 1KYAA 1NEPA 2DLIA 3TIDA 5DYOB 1F6LL 3ZRVA 1MRDH 5CZKA 5C0AA 5IROA 1HHJB 4G59C 4YX2H 1FH5H 43CAA 3B09A 1F58H 4OJCA 3UH8A 4JFDE 1B2WH 3BVOA 3QEQE 4JV5O 3AMLA 4HEPA 4BFGA 3HKEA 4ZW8A 2UXFA 3GI9L 3P0YL 2YMTA 2Q6WB 2LTQC 2AEQH 4HXAH 2UZPA 5DZOA 1O5DT 3GGWB 5E2VH 2W5PA 2WV3A 3HR5B 4G7SB 4A2HA 2IANB 1D5MB 3CQQA 3ES6B 3WNKA 2OV0A 4QCIB 1F6AB 4NI3A 1MJUL 3PXJA 5DJDA 4JM2F 1I0HA 1FKAO 4DR4B 3Q8EA 3QUHA 3MUUA 3PGCA 1I8IA 1SLVA 5ETUA 4JL2A 2YBRA 3V9EA 4CC1A 1UWXK 3B5GA 7PCYA 1GKFA 2QQLH 4E5XB 4AJVA 1UENA 1NBVL 1YXBA 4HKJA 5FNVA 4KXZI 3QS3A 4BH7B 2L8AA 1PAZA 2B20A 4K3DL 4PG2C 2DMCA 2P22C 2R27A 3MACH 4OV5A 4QY8A 4HJIA 4HJSA 3K71B 5DS1A 3S8FB 4Q6KA 2MPAL 2ARJA 1IBKO 2F2HA 3NR7A 3IJHB 3L45A 3RGBA 4XBMA 4K07A 2ITDA 3AQZA 5L88L 3C75A 3FUJA 3P0VH 4MDRA 1OTUD 5LMNO 3T3PE 1HNWO 4EN2A 5D6DA 3U7YH 3LV3A 1UH4A 4GRLB 1E2ZA 1HH9A 3HG1B 5AD0B 3CUPB 1U8CA 3D2UD 5F1NA 5LAXA 3AGWA 1M9SA 4U2ZA 4LLAA 4CKQA 4KO7A 4R6ZA 4OSUL 4JHZA 3K0YA 1MCOL 5ALCL 3K9AA 4G1MB 4JZJA 4UINH 5BW7A 2JGDB 4UCOA 3GMLA 2OT5A 1K92A 2B8OT 4JAAA 2ZUQB 5D7IB 2ZWLT 1MXGA 1KEGH 3TGXA 3SJBC 1Z3GH 2VKXA 4BFIA 4KKPA 2VIRB 4E42A 2VQFB 4CH5A 2NNXA 2W0FA 2P4KA 2EAEA 1CT8A 2NNCA 2VDPL 2WAQA 3K1DA 4MNQD 4HAMA 1B9ZA 3DMMD 2APBA 5HVHB 5B21A 1GZPA 1AAJA 4LBEA 3O9WA 1AFVL 1N18A 2DN7A 1H2GA 2WIIB 4LU5L 2ZX9A 3ARUA 4CU8A 1GR7A 1G7PA 3DIDA 1RUAL 4H1LB 4B7LA 1N68A 3MV8A 1SKVA 3OAUH 1AGDB 1QUNB 5CZVL 3B37A 4LHUG 5CEXA 3WNIA 2I5YH 3WCYA 3ILDA 2LLNA 3MOBH 1CGVA 3NQIA 4TXVB 3CHSA 5C0NC 4CN1A 5HHME 1NAMA 4WUUB 1SXSA 4FKHA 1A1OA 2Q0ZX 2AQ1A 1AGFB 1QABA 1UZ8A 2J55A 4Y2DB 4XVTL 1FGNH 2P49B 5IYDO 4DV3O 3AS3A 1TTCA 2X09A 3HC3H 3L5HA 3HI5L 3ZN6A 4EZKA 2VYRE 2VN6A 4RWUA 3IJ9A 4GUCA 4WW2C 5JOPE 1G6RH 1T7XA 1IBYA 3RUGA 4N90E 3NA4A 1N34B 3CH8A 4ZOCA 1NCJA 1UCBH 1NFIA 1S7TB 2VR9A 3NH7L 4B50A 3JARA 4BSWA 4RQEA 4XT1C 3B9DA 3TZVD 5A7BA 4DUYO 3RB5A 4WFEE 1QMUA 4M8QA 1M1KW 2WWKT 2EUWA 5FL7G 4JFQA 2QEJA 2Z4QB 4APQD 2ZICA 3NJNA 4MRCA 4MQ7A 1HESA 5DFAA 3K71A 3UBXI 2E5EA 1BF2A 7FABH 4S1SH 5HDQL 1KNOB 1KGXA 3HE7D 4ABMA 2WXJA 1OHHG 4NRYB 3TK1A 2IQAB 4FLZA 2VUOA 4P23B 3RL2B 3GWOA 1QA9B 2Y1AA 4XWGL 2CTPA 2L35A 1OE1A 2ZOKA 3L3OA 1QRKA 2HT3D 5CILL 1JXJA 1U2CA 4AYFA 3S37X 4B97A 1JHKH 4MLSA 3S35H 4MA3B 1MLCB 3M17A 2YKKA 4XNAA 4X9BA 5CR1A 4UOW0 4W4OC 4JASA 3IJ4A 2RJMA 4HYOA 5IFAH 3BWSA 4MA8H 2F58L 1FIGH 3VO0A 2HLFD 1HI6A 3D2TA 5FW7A 1CGWA 3WO4C 5DHVH 2OIGA 1I31A 3N06B 1L5GB 5GJSL 2K6YA 4KUCF 4B5ZA 1CDCA 1DQML 1H2SB 4L4VA 1OO2A 3UO3A 3GYRA 4OFYA 1I9IL 2HLEB 3Q05A 2C3VA 4PJAA 2E5LB 2FWLB 3HMXH 2VXUL 3HOGA 3L17A 4QKXB 4ZFFA 2G2NA 3C6SA 5KW9H 4OF0A 4FABL 5BUAA 4TQPA 3ELQA 3N42B 5EMYA 4H20H 1ZX3A 4LAQH 2ZT9B 2UXCB 4M4RA 2DKMA 2KG7B 3G5ZB 3PIQA 4LRIC 4Q6YA 2XFGB 4QWWC 4L1BA 5D1ZD 2EDMA 4DUZO 2HTLC 4TUUA 4DEWA 5JQ6H 1EXUA 4H0HB 4QRPB 1NC4B 4K8RL 2G3ZA 4AYGA 2YDEA 3ZDZB 4XO9A 3CZUB 5JW4N 1J05B 5DZJA 4P5KB 5DD3H 3VG0H 1PKXA 3QJZA 2VDLB 1K9MW 1VEPA 1JVMA 1GW6A 4PS4H 1JTTA 4ALAC 3LQMA 3GMQA 2JJ1G 4G80B 5F3HA 5I76A 3CPLB 2HP8A 1I7RA 4KTEH 1T5WA 2MPAH 4BHUI 3RNKB 4QRUA 4KMTL 5EZYB 4PG9B 1V5JA 1UT2A 3LQAC 3VFRB 1SOKA 1TQTA 2ZT9C 3QORA 4M5YL 4XNUH 5D6DC 1KGCD 2BP0B 5KG9B 4DUVA 5CSZA 3ECVA 3IF1B 3NZHL 3AAZA 4QDGA 1M9WA 43C9B 4JJOA 3NFSL 4NRZA 2RCSH 3GTTA 5DO2D 4AQYO 5CHNA 4QPJA 4BFKA 1FL6B 1SOXA 4JZJC 5BW7C 5L7XH 3IFLL 4U0QB 2FR4B 5DZ9A 4IGBB 4S1RL 1HYSC 2MH4A 4ONOA 1DO6A 2VM9A 5EN2B 2AJVH 1WGOA 3WFVA 1F3DJ 1R4XA 4G6AD 4R7VA 5D71H 3SQBA 3U36B 3U9UA 4Y19B 1RPUA 5IQOA 3NPSC 4YR6B 4XPBH 2MRYA 1R3JC 1DQJB 5L2KA 2OCHA 3KGRA 4HQQL 2X87A 4MD0B 4DV2B 5E9DE 1SJMA 3QIWB 1KT2B 2B15A 1CDGA 3UAJA 3S4SG 2OJEA 2OXHB 2QQQA 4IL6Z 3K91A 4YXWG 5FCSH 3Q1EA 3LHPL 2HWZL 4NOBA 2UXBB 4Z77B 1JGUH 4LCUA 4FFYH 3SDCD 1BJMA 2BWDA 4YL4A 2ADGB 3KPSB 3QPKA 2FK9A 3MKGA 2Y72A 2YWZA 5DRNB 4CC0A 1SZTA 5I6XB 3RE0A 4FTVE 4EB6B 3VD0A 2NW3B 2Y3AA 4GXVL 5GSVA 4I1RA 5FHAH 3SJVA 3JAWB 4ZFZA 3NCMA 1ZV9A 1FAIH 1WHOA 2VISA 3ARED 5CSBA 2RMNA 2G9KA 3HLAA 5I9QB 2EDDA 1BECA 2ERJC 4DKAA 1ZTXH 3ZJAA 4P2AA 5FDYA 4J11A 4MA8L 4RIRB 4XMPL 3HC0B 1EHXA 4IRSA 3BRGC 2NY6C 5EN3A 2EIKB 5HVWA 1Y4MA 3L72H 3O3EA 3UEQA 5AVZB 4MJIE 4YHYB 1Y07A 4HK0B 1LNQA 4Z1MG 1FYJA 1RP8A 4MNQE 2CRYA 4IGBD 1F4WH 1HNWB 3OJDA 2NY0C 3INOA 2ZXEB 2XN9B 5DVPA 1LDSA 1Q43A 3LZNA 1PKQE 2VR3A 2EX3A 2X70A 1KGWA 2ARWA 2IJKA 4S1SL 3OV6A 1WWCA 5BXZA 5HHVL 5EUKB 4J3OF 1A6AA 1F4YH 1E8ZA 1FNHA 4YHIA 2A9MH 3H3PL 1M5IA 1AP6A 4JFXB 4XNBA 2ORBL 4C56B 4LK4A 4U7OA 3ZX1A 1WO2A 1ZHLA 3LS4L 1QHTA 2CDEA 1FNSL 1M53A 1KCWA 4ORGB 3E2EA 2FO4A 4JFUA 3LN5A 3FQYA 3K5NA 1G9MC 5LUMA 4PYGA 2AJXH 2QWRB 1E3XA 2C9RA 1AD0A 4L4TE 3TBCA 3FH7A 3TT1L 2DMKA 5DVMA 5IWAB 2X53A 3H9SA 2HKOA 1Z9SA 2DQUL 4PJEB 4QOKE 2ZKHH 4KRPB 5D1QB 1ML0A 4DCQB 3UTSD 3FDWA 2IAAC 1WA8A 5ITZA 4H44C 1MXDA 4P07A 1TZ8A 2EH8H 3T3MF 1JAEA 3BPCB 3IS0X 3RYFA 1D3CA 3HI1B 4ZT1A 2Z8RA 3RWJA 4FFZH 3VRIA 3ZTEA 2V2TA 4DPCX 4GW4A 1INDH 1VA9A 4X66B 5LDSA 4JS7A 2UZXA 1XREA 3WS3B 4OUOA 4JRYE 4HJ0C 5FC9A 2Z64C 1ZOXA 2B0SL 3ILPB 5GW7A 2OK0L 4GUPA 3H54A 5JHDE 2Y6SD 3RYCB 1S7XB 4WKZA 1KIQA 3L8QA 3T71A 3JALB 4QHKJ 2IPKB 3U9PL 3IDYB 2Q6AA 1QR9A 3BAAA 2VZ1A 3FAWA 1ZCRA 3K8KA 1I1AA 1I8KB 1XAKA 4GKJO 2E9GA 2D9QB 2X4NB 4XWGH 2EBOA 2KB1A 4BFFA 3CX5F 3T4ZA 1MLBA 3V5KB 1MCCA 3LXAA 2CIKA 5DD1L 4OZHF 5CA3A 1UWYA 3QISA 3O81A 2W9LA 2XZAH 2XFXB 3FCBA 3SPJA 3KYKL 2PKDA 3QZMA 4FHBD 4QOKA 4I4TB 3QUXA 1TMQA 2HG5C 2QL1A 2WQAA 2IPUK 4AYID 2WPGA 4BA8A 1G94A 2BTOA 2VKWA 2ZX7A 3F5WB 1LEIA 3O3BB 5GS1C 4LLYA 4PJCE 3OJDB 3JWNE 1EZSA 1ERNA 2IAMD 5IFJA 1A02N 1U6AL 1ZS2A 1XZ0A 1KECA 2MEJB 4OJDH 5ANMB 2XLLA 4XRCA 2C3GA 2NY3B 2A74B 5KX5B 2LJ2A 2WVVA 5KVGE 3V0GA 5JQGA 3QZNA 4K5LA 4MQXD 2KLTA 3GMRB 1BZOA 4JRXB 2ZXWB 1T04A 3L9RB 1G6UA 1T6BX 2F4VO 1AIZA 4UF7C 1N12A 1NANH 2VLJA 3NN8A 4RAIA 4Y5VA 1A66A 3P4NA 1IAKB 4BFJA 4E9XA 3GSRA 3NJGA 5E4OA 1GGBH 2QA4V 5GS0D 2WGXA 3SY0A 1RUAH 1BEYH 3L71H 4HFUL 1DVSA 1W72L 4J6IA 5TE7H 3MCLH 3IDIA 2GIMA 3ZK0A 4RNRB 4B95C 2QPFA 1P2CA 4W68A 2X3CA 3L5XH 3DHPA 4DEUA 5GONB 1OGTB 1NL0L 1WAEA 4D0BB 1YMMB 4LLUA 3RWCA 1ASQA 1QBLH 4NNXB 1INQB 4GW4B 1NA8A 4Y4KB 1PYWA 2G4GA 3ULSA 1YNLH 1K5WA 1CBVL 5FX3A 2EE9A 3UBXA 2PXYD 1KBGL 5F7EH 3U6RA 4I18A 1L0QA 3G6DH 1JUFA 4J1UB 1MCPH 2QSTA 3RWEA 3BX7C 2G5BB 1BREA 2XV2A 3IMTA 3OAYK 2R69L 4GKNA 3HZMA 2NX5E 3D3VB 3ZKNC 4F2ME 4KH2A 3LQZA 1S7RB 1U3JA 4JRYB 3WOVA 4DR3B 2VLLA 4WI0B 1OSZA 4MWFB 3WXVH 1J5OH 1CICC 1E30A 5DJ6A 3OXRB 3WAKA 1RZ7L 4PJGF 4AUYA 4IBTA 1LNUA 3Q43A 3VXOA 5IBTL 3HN8A 2F18A 4R4NC 3QNYA 4HCRL 5J7CC 2CLRA 1KXTA 3L4ZA 4YSCA 2EYRA 3RGVA 4RH4A 1BHGA 3HNTL 1AXTL 4KHXH 1WCQA 2AXTZ 3CLEL 4YHHB 2VWEC 4HWZA 1G4MA 4NTYA 3IDGA 5BZWA 2EVIA 1U95A 2FH8A 4LVNB 5KANG 4CH4A 2Q8AH 1GGIL 3FN9A 3ZN1A 3CCQV 4XNQA 3QAZC 5KAQG 3OAWA 3L3GA 2R9IA 4PU2A 4I5BB 3QI9B 5DRXA 1M57B 2JDIG 4RGOH 1X5LA 1IAMA 3BZDA 1DLBA 2NT1A 3P0GB 5HVFB 1OAZL 1U8JA 2YAFA 1CGSH 2EZ0C 1DN2A 1U92A 2DIBA 3PJNA 1S9YA 4JDVB 2AI0L 4J3OD 4LZKA 2EXSA 2ATKA 4YLCA 4U6HA 1YNLL 2DTSA 1S6NA 4LCWB 2HFFB 1HOCA 4G70B 1S5LZ 1J95A 1O7SA 2EC9T 4ZYKA 3DX8A 1IVLA 4N3TA 4O51B 5C6TH 5H35B 5AAPA 2FLBT 1R1CA 2G0LA 4Z7UE 4YMPA 4JPIB 4KY2A 4Y4FA 1OSPH 3OKMA 3O3DA 3L9DA 2X4TB 1KJ2H 3ARZA 3QT2A 3ZZQA 5F7MC 2W8CA 4WWPA 5ISZB 3CCEV 4Z7WB 4J12A 4IRZA 2MMXA 4JI2B 3Q2NA 3W9EA 1BCCH 4U49A 2PO6A 1R24A 4DR3O 2ZX8A 3QS2A 3ILEA 3MRGB 5IGXL 4WEBH 3U83A 1KLGA 1W0WB 3ATBA 5JZ7C 3LJ3A 4DUWA 4EEQA 2DWDB 3SO3B 2UUDK 2CKBB 5AZEL 2BDNL 5EO0B 4DV0O 4W9ZA 3ZXAC 2HKFH 4X0NA 1LE9B 5I30L 4YZFF 3KPLB 4A2MA 3L4WA 4GSQA 3FFOA 3I9GL 4L3AA 1XV8A 5EBGA 4Z3JA 5C3LD 5KVDE 1AY1H 2XRAH 1DN0B 3B9KA 4WU5B 5DJDB 3FULA 4YEFA 1PG7H 2D7NA 1JR9A 1LVEA 4WTZG 3QUZD 3S88H 1IKNC 2CBOA 4ZHQA 4NKMB 1ONQB 3L3IB 4HPYH 3RYMA 4NWTH 3QUKB 3EG9A 4UM8A 4V2CB 2G3MA 4U3HA 2DJUA 2BX5A 1RHHA 2EADA 5C08A 1IIIA 3MV8D 1V7NL 1CTMA 1ILUA 5CM1A 3EJZC 3TBWB 1AGBA 1JV5B 3VRLE 1AKJD 1F3RB 1MWAA 1I5YA 2YD2A 3QO5A 1RIVL 1U8OB 1U95B 2NR6D 2YXYA 4HZLB 3T8MA 4FA7B 3WTSA 1R5WA 5CKAA 4JGUA 5JNYA 4S1QL 5H37G 1X9UA 3FSZA 5DTFB 2X9YA 4WBNB 3NPSB 5AW8B 3VWJD 4MXQC 1M1SA 2EDHA 5J9PC 3TVMA 5K5YA 2K70A 2UY7B 4HJ1A 1UADC 2X88A 5MEQB 4F2MB 3VFGL 3MRBB 2HPTA 4B3TB 2IADB 2BTQA 1HSAA 1I4FA 3A67L 3B2VL 4WJG3 4XNZC 5FEBA 3WFZA 4XX1E 3SE8H 4MSWC 5B3SC 2VE6B 1UKTA 2BP8B 3WLWD 4B27A 2C9QA 5I6PA 1LE5A 3QZWA 4NXNO 2C9AA 3MXWH 1BBDL 1SDDA 2E76C 3C9NB 4CS2A 4LFHD 4WWKC 5C2BL 2WBJD 1VADB 2V2WA 2E59A 2O5YH 4XMUA 2OMBA 5C0AD 4GP5B 4OCWL 2GUOA 4G8GE 2V0AA 1F4NA 3UG4A 4HVBA 1MDTA 2FQEA 1J88A 3CMOL 3EH2A 5DJ0B 5GGRB 2XTLA 4BKLA 5FYKH 1X5FA 4B7EA 4BUGA 2ZUQC 4DV4O 3UC0L 2PUSA 5L4JA 1YYLH 3D25A 2X9ZA 4ZS7L 7CGTA 3V79C 4GI9A 3BLPX 3C5ZC 4AV0A 1EA9C 1Q72H 2YJLA 5J3HC 2APVA 5CEXB 4IYKA 2IDSA 2PTTB 3WY2A 5L4IA 2CALA 5JHBA 4HIEB 1E42A 3EYOA 3E22A 3QXDB 4MB4A 1LP9E 1RP9A 4OQTA 1TVKB 5IT9N 3FO1B 2BHZA 4M93B 3VXUE 3DX9B 4JI4B 2QVFB 3EOTH 4CNIA 1NEZA 4F6RA 1YYML 3IETA 1RVFL 3RDTB 1J7VR 2V5RA 3OZ9H 4JVUA 3QQXA 4MMZB 3QQ3B 1B2YA 3MBEA 2GUYA 3SGIA 1XEQA 5M95B 3H7LA 1L1FA 4K8XA 4C8XA 5MERA 1E5BA 1X4ZA 1IJ9A 3WJJA 4D9RE 1DN0A 4WU5A 4C7UA 4DV6B 2RQ6A 5LG1A 1SUHA 3EADA 4DH2A 2ZWYA 4L4VD 4NKGB 3DDFA 4OFYD 1KB3A 3BVTA 3H56A 2GITB 4ZD3L 1AQKL 3JARB 4MB1A 3K2IA 4HW6A 4OF8A 4GRLA 3EXAA 4PRPE 4YZFE 3KDMA 4ORZC 5I6NA 1ZXQA 2NY4C 1IGCL 1KYOF 3CUPA 1OAUH 3EDKA 5F1NB 4QRTB 4PS8A 1HZHL 1V3MA 1FGNL 3AWGA 4RRPA 4P4KB 5G5DB 5T5FL 3ARRA 4F1ZA 5HJDA 5FYKL 2NY6D 3VB9A 5KBMA 3JD1A 4NZJA 4DR7B 3HR6A 3R65A 5EZJA 4E9SA 5CFHA 2HLFC 2GABA 1S72V 1ZL8A 3F62A 4LF6O 2A38A 1A64A 3RFRA 4Z7UB 4TV8A 1BBDH 3MLRL 4ZUSB 3U2SA 1CU4H 2VIRA 4LDCA 4E42B 4KJQD 1FXKC 1YEFL 2HLAB 1JX9A 3KCPA 4K7PH 3GDCA 3S3XA 2XTJE 1CL7I 3RVUD 2OW7A 4PJ5B 2JJUA 5EU6A 3A67H 4M7JL 5HP5A 2ENYA 2V6HA 1WGVA 1AIFA 3CSYB 2K9FB 1NH6A 1ZA6A 1UKQA 4NN6B 4QHKI 5DFVC 2X6MA 3BJ91 2EE2A 1NC2D 2AJ3A 1TA8A 1MUJB 3HG1D 3SB3A 4IYIA 3DVNA 4G8IA 1JF6A 4NXMB 4WFBV 3SYAA 4I3RH 4AX3A 4TNWK 5C8YA 32C2B 3L7FA 4KKZA 5DJ0A 1WZAA 1QFUH 1RIVH 1ZRUA 4GG8A 2AJUH 4X80L 4HS6A 4Y2DA 5B8CA 2A77L 4B3SO 1SYVA 4F9PA 4MQTB 4AIXA 1UWEH 1YSOA 3II2A 4A39A 2QT6A 2HRPH 1U93A 2OSLA 4YDMA 3VE0A 1RUQH 1K4DA 3V0HA 1GPOL 3U7YL 1U3ZA 3QPQC 5FGBC 2XV6B 3AB0B 3SE3C 5TD4A 2AK1H 4M4RB 3OLDA 3IN2A 1NFIB 5B22A 5EG6C 3K7UA 1BZ9B 2W1NA 1IAOA 1WC7B 4KKCC 1SXNA 4R9HA 1G7JB 3I55V 5H94B 4HUWB 3B1UA 1NCNA 2V3DA 1ODUA 4HH9B 5L3CA 6PAZA 1U0QA 4F6RB 3IETB 4E2OA 4WHTB 1BGXL 3L4CA 3QZWG 2VXVL 4UTCA 3DSFL 4KRNA 1JXDA 5E4IA 4ETYA 3LSOA 3DSFH 2XY2A 2QSCL 1H2KA 2QQLL 4GLRH 4M5YH 5HGDA 3MRNB 1KENH 1JI1A 1N33O 3ETGA 2QTOA 5K9KB 1JI2A 1CL7H 3AABA 1IUZA 4G80A 3FCSB 1MJUH 2PWHA 3A4DA 3FU7B 1A7OH 4QRUB 2GJ6B 4HKXA 5T1KB 1JRHL 2XSKA 1RUQL 5GXBB 3L4UA 3JZ7A 5AKVA 4H0IA 2KDYA 5IJKA 1FZMA 3NGBB 4KI5C 3VWJC 4FA8A 3LSUA 5AAMA 4DVBA 3ARQA 4JE0A 4XHQA 2R7EB 4YO0B 5GGTH 5IB5A 4TV8B 1ZE3C 3L6FB 2EKSA 1OP5H 5EU6E 4LCCA 2ZSWB 3ZSSA 4HBCH 1MJ7L 2HJFA 3HHSB 4XVUD 1IBGH 3UJJL 3H01A 4HWBL 3V4LA 2LV4A 3GBLA 5E1HB 4ZDHA 4KO6A 4UV7H 1KIPB 4TULL 4PJHF 4AG4L 1RM1C 1DQMH 2IPUG 1ADQL 4JPVL 5F2FA 3PP4L 1P7HL 4DGVH 1Y6NR 4YE0A 3QNXA 2VLRA 1HVXA 3V7MA 1DSYA 3NEOA 4FQIL 3QBTB 1DFBL 2FBJL 2L4OA 3QXAB 2IWKA 3BEVA 3MV7B 5DMGC 4QHNB 4H25A 3B4NA 4CDHA 2A6DB 5HDBE 1IIKA 4M6ML 2GBOA 4J9YB 5FYJL 3QIWC 4FGMA 4M1GL 2Z0BA 3SDDC 1E27B 4FFWD 1YEGL 4W6WB 4JGNA 1CT8B 1BIHA 3VFWA 2QKAA 2IIJA 5CILH 1GZPB 2Z7ZA 4L4VE 1Q9OA 3L9YA 3ZOAA 2OW6A 1AR5A 5HBBA 3MN8A 1RMFL 1KB9J 4NJ9H 2RR3A 4X6CE 5GISH 1HNGA 3PY9A 4TTDD 4F7MB 4D7BA 2AERT 3N1QC 2AXWA 5I6OA 2VSKB 3HC2A 3QIWD 5H2BA 2MCG1 2G60H 4LP5A 1DGSA 2VO5A 1KULA 1WNSA 2CGNA 5F7LB 5T5NF 4FZEH 4ZO6A 1GVIA 4X4XA 2J8UA 2HVJB 3QORD 1VACA 4LKXB 5ACMA 2CH7B 4HEME 4XP1H 4FQCL 1SHMA 1AH1A 3HMXA 2V1DA 3ZL4H 1JHTA 1UT1A 1UOWA 1J5DA 3S36X 4X9GA 4X64O 1KKCA 1R17A 2W9EL 5B39G 2J3SA 2WO2B 3D08A 3KVPA 1SA0A 4JY5L 1IQDB 1P7KA 4H33A 1X5ZA 4CBCA 1BD2D 3SYOA 4QRSB 1BMZA 4WHDA 3BEWB 4M8RA 4HJEA 1NDTA 2UYLB 3TC9A 1IC0A 4WWKA 2WNXA 1FL5A 4WUKL 5IYZB 2A73B 2CBQA 4OI7A 4NWUL 1W72H 2F53E 5TGBA 2YC0A 1LK3L 4DV4B 2A4CA 2BSEA 2EIBA 3SCMB 5IQMA 1GGBL 3BE1H 5IESL 1YNTB 1XTMA 5KSAB 1A3RH 1MIMH 3VTMA 1KNOA 1J0YA 3ZKXB 4UTAA 2B2XL 2GCYA 3I9IA 1CLCA 1A1NB 4E9RA 4F27A 1QATA 2E0PA 4OZGA 2FBRA 3MHZA 3AY2A 1TITA 3MRFA 4XVSH 3CLFL 5EF3A 3ZHUA 4U1HB 3WG7B 4CSZA 1MEXH 2H45A 1XD1A 3SE3A 1FG2B 2DWDC 2R2HB 3R1GL 1U6AH 1L9NA 2CXKA 2ZNIA 2ITEA 2GBVA 1HN1A 2RCVA 1AYRA 3D18B 4J3WA 5GRVL 1CLZH 4OF7A 5CCGE 4N2IA 1XH1A 3L70H 1BAWA 5AW7B 4KKCD 3VGFA 4FQ1L 5KSUB 3D3IA 2YC1A 4L4VB 2FJHA 3IB4A 4NO0D 1P5UC 3HMWH 3MV7E 1ZHKB 1JVOA 3MA7B 1IXBA 3ARFB 3UZEC 1SQFA 2JCCB 2IJHA 2R1XA 4NAJA 4UCVA 3MRIA 3VSUA 2GSGB 1XMOB 1HHKA 2JJWA 2AHIA 1DQLL 1A4JB 2HN7B 2HTLD 3UEZA 3PJSB 3EYUH 4CMMB 4F8QA 1I8UA 3C60A 4OGYL 5FIEA 3WNOA 5KYWB 2E7LA 1TPXC 4NC1C 4OGAD 1YPZB 3AG4C 4ZAKB 5FGCB 2FATL 3DARA 4N6QA 5ANMA 2P5PA 5FLUA 3B5HA 5DFVD 2FR4A 1CE1H 1A7PL 4O2FB 1TYEB 4PQXA 1X7SA 3OKNB 4QYAA 1BXVA 2ICEA 2GBTA 1NLDH 2DQEL 1P7KB 4NT6A 1UATA 3FQTB 2HTKC 2GYSA 2WXHA 5LMNB 3F7PC 4N8PA 3QEUA 4X1IA 3CFKB 4DIXA 1K5QA 1ZSPA 3V52L 5HYQB 5KVDL 5CJXC 1SZNA 2HVKA 3QORB 3BZ5A 3CZEA 1FL5B 5IJ9A 2Y23A 1TO4A 2FEEL 4CL7A 3NRQA 3GJFA 2CDGA 1M7IB 3PHOB 5K39B 3SE9L 2ZCKL 4K94C 2VDKH 4PV8B 3SKMB 3UTTA 4AL8L 3OJMB 4HC1A 1IGIH 2D03L 2ICWB 5DD6B 3GVMA 4PJ8D 2P7TA 3IDMA 2N56A 4HSCX 1THCA 3K03A 3BPOC 3B34A 5E8DL 4J3BA 2NUTA 3ZKSD 4DAGH 1F2QA 1LTXA 2H7WA 3IMWA 4WW2B 4AJ0A 4HGKC 4JREB 5C0CE 2DJSA 1SHWA 4HF5L 3ABKC 4D8PB 1L0LH 1WZ1H 1XBLA 2DQCH 4JFEB 4QRAA 3IN0A 4KK6C 2JKIS 3GSWB 1CD0A 1T4KA 2VL5A 4FXKA 1KCRH 5KSVA 4E41A 1JBJA 3U1PA 1BPVA 3D3VD 4DGWC 2FHBA 2XZZA 2BSKB 1AI1L 3H42L 3KD4A 3D69B 4MMZC 3QUXB 4UQ9A 4JTCB 5LGTA 2WNKA 1XT5A 3FB7A 2DS4A 4F7KA 4Z77A 3P11H 5IEKB 3BAEH 4WI9A 1NZRA 2X3AA 1ID5I 4HISA 4IK6A 1GXEA 2Q4PA 2BIIA 4A37A 2FD6L 1CXHA 1JNJA 5FYLE 2LHAA 1J9RA 5E00B 4HG4J 3QSKB 1AI1H 3H42H 4Y2NA 2WCSA 1NT2B 4KOCA 3L16A 1RZ7H 3RGHA 5DR5L 4B9ZA 4P5TA 2ZUWA 3I3BA 3K08A 3JSLA 3CDZA 5EZLB 5SWZE 2AK4B 1K8IB 2J72A 3B2UD 1T1ZB 2Z1KA 2F7OA 1IFHH 1YZZA 2VLJB 2BIHA 4HDIB 3BZFB 4H8WL 3HNVH 4KI5D 5D93B 1DZBA 2WLZA 3VFNB 2OR8A 1NMAH 3P4LA 2X1PA 1JGUL 3G6DL 1AI4A 5AG8A 1XCQA 2EABA 1I9JL 1JWSB 5LA6A 3UP6A 2W0KA 1BZ7A 5DVKA 2NMSA 3DOIA 4XN7A 1OPGH 3APFA 1H15B 4IHJA 5EIIG 2D7PA 3TN0D 4XZUB 3IDNB 4CJ0A 3BFWA 3ARDA 1K5SA 3TV8A 1CPUA 3UTQA 3LZOA 4HZAA 3OZKA 5FK9B 4ACTA 1N3NB 3LNDA 3QUZA 4RX4A 1VZGA 4PP1C 1A7OL 4H0GA 1MFDL 3GI8L 1WZMA 5CP3H 3ULSB 4PJDE 4L4JA 3UBXB 4X4MA 2FWSA 1K4CA 3GZKA 3S37H 4MBRA 4W6YB 2XIBA 1WBYA 4PV9B 4WQOA 4BSVB 2WQSA 4I0XB 2NXZC 1IXMA 1IAIH 2NSQA 3IU4H 4QRRA 2AV7B 2CU9A 3JATB 4WI0A 3LNNA 2XPGA 2VXVH 2HSIA 1KN2H 3HR5A 3I6LE 4YHLH 2X2JA 2FJGB 2CGOA 3IMVA 3K6IA 1T89A 1GY1A 4MDIA 3Q06A 3FQXA 3EDJA 1LWJA 4KGJA 4A7GF 3RYIA 1XF3A 3SJVE 1ZLWK 3VACA 4PWEA 1PD3A 3TYGH 2H1LM 5D70L 3HMWL 1CC3A 4FQ2L 4OBRA 3ULUF 1KXTB 5JW4M 4KZEL 3DXAD 3T1HB 2R4SL 2UZXB 4JFPA 1VCBC 5GGUB 1TF4A 3FHEA 2EP6A 2DY2A 2XQYA 5KBKA 3NRPA 4ZBMA 1I1AC 5KZCD 2NY5L 2WM0A 4PJCB 4AW7A 3COOA 4JFFA 3KYNA 4MA1C 4MB5A 3UROR 4DJMA 1ZANL 2P26A 4KHPO 1Q38A 4JFYA 4LSVL 4Q14A 4HNAB 1U58B 3VXSD 5DA0B 2DJVA 1GN4A 5FHBL 4ZUWB 3R1GH 4WW1A 3EZJB 5CMAB 2DKSA 4CS3A 1IBLB 4F9LA 4UCUA 4OJYA 4PWJA 3LN4A 1NCWH 2APTA 2XTJC 4ZMLA 4ZMXA 3EBAA 3A22A 5BS0A 4PRNB 3CSXA 3B77A 4X62B 1I82A 1IC4L 4OGXH 3MRMA 4JY4A 4XO3A 1OB1A 5DSCA 5FF6B 4DNLA 5LGKA 2R23A 5BZXA 1SF9A 3J2PA 1U92B 4GPVA 4NUGL 4JDEB 4CSSA 3MJ8B 4P4KD 1FO0A 4LF9O 1G5AA 2QQKL 3VJ6A 1E4KC 3EO1A 3O2WL 4AOFA 4JN2A 5I73B 3Q01A 4Y4KD 5DHVA 4P0DA 1KCSL 6TAAA 2R83A 3B8SA 1H15A 5DECA 1XZ0B 1R6KA 4PJ5D 5GGVL 2LT9A 2KZ1B 1XGTB 4R90L 3FQUA 2CA3A 4M1CC 1W16A 1KB5B 4PA4A 1YMHA 3MO1A 4P46D 4WGWB 3QDJD 5DWPA 2G5RA 1D2OA 2FEEI 2MTAA 2Q86A 2UU9O 2BERA 2VE6A 2BJMH 3CXFA 3D0LA 3X12A 5IV2B 4O5LL 3P77A 1M4UA 1TTBA 2A0LA 3QDHA 2XPYA 4M7ZB 4Z7IA 2DLFL 2Y2YA 1QWUA 4Z7WA 1SQBH 2ZXCA 4YPJA 4Z2WA 2ZG2A 3X1NA 2XKUA 4J4PC 2XPZA 4JG1H 1IAKA 4I13B 4LEEA 1OLZA 3KPRE 1WF5A 4GZRB 2L04A 2E76B 4BGLA 1JXFA 5K9QG 2FCBA 1SEQL 2FJGA 2JQAA 1LGVA 3NIDB 4PGCA 2V5MA 4RNRA 3STBA 2WOBA 5CS7A 4RFOH 3T3PF 3DGGB 3UPRA 4WCEV 3SDCB 2EXYC 4DR5B 1UD3A 3A0BZ 5K33A 1OCOB 4ODVL 3WKML 2NYKA 4MJHA 1KEMH 2R69A 4G8EB 1JMXA 4NJ9L 1HEJC 5EU6D 4R7NB 5HYEA 3PL6D 5BVPL 1OAXL 1Y76A 2KZBA 3MAWA 1LEGA 5HJBA 1A6ZA 1C7TA 1MCBA 3VYPA 3BHBA 5BUPA 1IBLO 1BFOB 2BVPA 5H6RA 1J1OL 1YYLL 3V6ZA 3N85H 5C08D 4UILH 4M48H 4KXDA 4R6UA 3VXMB 3UZQA 5LNGA 3FTGB 4Y5XA 4ZUWA 4M5TA 2LGQA 3S5ZA 2YPKA 4KRPC 1INEH 3DYMA 2DWSA 3QQDA 1M7XA 1Z9OA 2NR6A 3MRJB 1T5KA 4WNQB 4YHPA 3J8F7 4NRYA 3FHQA 3O2WH 3EO0B 4FQXD 3RFZC 5DJXB 2UY7A 4P9HC 1FXVA 3VGGA 1Q6HA 1TVHA 4F2MA 1DVZA 2XN2A 4Y1AA 2A06H 2X1OA 4XO8A 5I1GL 1G1KA 3LEXA 5AB2A 2HT3C 2CHXA 1FRGL 5IF0B 2PPCA 4YVUA 2MOQA 3CC7V 1JZJA 4KJYB 2V5YA 4D3CH 1V27A 3AWFA 1AYOA 3EO1B 3HE7C 4TVPD 1DVQA 4G5ZH 1XNRB 4CUCA 4MMXB 4OFDA 1NTMH 3T2OA 4TL5A 4S1QH 2XQYG 3KXFB 1DBAH 2Q3ZA 2VT0A 4WJKB 3K72A 4NZTL 5DO8A 3VH8G 5CD3B 5LMUO 4IRJA 2XIIA 4FN0A 2P5WA 4JMXA 5IWAO 1VESA 3P2TA 5JMRA 5FB8A 2NX5D 1XVSA 2HUEA 3B3BA 3MV9A 2BRRH 4HIJB 4NBZB 5I16B 4B5EA 3CK0L 5F9DC 4DR2O 4LSPL 1EVUA 4P2QB 3T08A 4CDGC 1HCYA 2ADIB 3CSYA 4GRWF 4O2AB 1S7VB 4OUUA 4O4JA 1WISA 2PYJA 4FLOA 1A22B 4GAGL 2PTTA 4YLQT 4YXHL 3S88L 2HJLB 1BXUA 4X65B 3FUKA 3MNWB 2LVEA 2F08A 1MHCB 1N7ML 1FFXA 2YMOA 3EW3B 2KUTA 1MREL 2V5TA 4JO1H 4RMTA 3JWOC 4WHYH 5DRWA 2WBJC 32C2A 4PFEA 4XTRC 3DX9A 3RA7H 2QM7A 1N9PA 1UURA 1YUHB 4NQDA 1EX0A 1KENL 4Y16B 4MB3A 3IYLW 4J2QA 1KBHA 5KAQF 4FMTA 3DXAB 5FYJU 1XGPA 2V7HA 3FRPB 3HJEA 2FIKA 4K7PX 4PJIE 4NS0A 2CO4A 1LO0L 1IFRA 3IM1A 5JUEH 1OF2B 3U0WL 2DQJL 1L9SA 2KT6A 1AO7E 5E03A 4LSQL 2ENJA 3JD4A 1HSBB 2GITA 1KGUA 2IH9A 4I48B 3C2SA 1QR1B 4N87A 4LSSH 4PWHA 5K9QI 1O6TA 2WXPA 3DRTB 2WKGA 4DV7O 3MMEA 4Q9RL 3VFRA 3DHMA 3L9EA 5G5DA 5ACZB 4KZDH 1DJWA 2BP3A 3TPUA 4XDKA 1XR8A 3NCJH 4ANUA 3T8VA 2BP0A 2ZE5A 1UWEL 1B3JA 1DLHA 2AABH 3MZTA 2OULB 3F3HA 4MJ6B 3BVWA 5DQDL 4I2XA 5GPRA 1Z5LA 1JNHB 3U1SL 1GMEA 1BQHG 2HX8A 5AOJA 4GG6E 2AZAA 1XMQO 1ODAA 2XQ0A 5BO0D 1QFUL 5IHZB 1GMGA 2WCGA 1F1DA 4A2LA 5BV7B 2J44A 3VYNA 1VIBA 2HLAA 2FECL 4JG0H 1MW2A 3GHBL 3RJQB 4JFHD 2E3VA 1BPLB 4IBYA 3K81A 3LQAL 5GGRY 4KRLB 1YECL 1TLKA 3HMXL 3LKOB 3WY4A 3KPSD 1XF2B 4P9HL 4BWWA 2WLNA 1QFWL 9CGTA 5B3NA 5FKPB 3UCRA 2X4OA 2N0KA 5AD0A 1JYNA 1FO0H 2F5AL 1F02I 1ZSDA 2Y5TB 5HJ3B 3QIWA 1QLRA 1NBCA 5D1XE 1U4FA 4TSAH 3K72B 2A3QA 1NC2A 1KIRA 5IW6B 2OJZH 2YI8A 3CZJA 1T1XB 1B4JH 1KLUA 1NLBL 1IM9A 4LSDA 1KP3A 4M02A 3CB2A 3UAJC 5I1EH 4PPTA 4HPOH 2B1IA 4FJCC 4OKVB 2K78A 5DRNA 5A2KH 5IT2H 2ADIA 4FX5A 4YBLC 2ZR2A 3QHZH 1S5HB 1NCHA 4LH7A 4Y2DD 4CGTA 4E9YA 3FRPG 3H9HA 3HZVA 4PJBF 4AZUA 4XB7A 4Q2ZA 1HHIB 1KPUB 3GLAA 4LLWA 1BMWA 4FMKA 1TCRA 3FBKA 2DQFB 4G8FB 1HKLH 4EEEA 3ARGD 3AZUA 1CQKA 1TJIL 1E6OH 3QXAA 5EOTB 3WKMH 4JO4L 1AP2B 4BH8B 4BQCA 1GOHA 3C9NA 2YUVA 5H2FZ 3UMTA 3OX8B 2H2PD 4H8QA 3NJFA 3WS6C 1Z5VA 1TT6A 3MLVL 4P5RA 1P6FA 3BGMB 1MFAH 4LMQI 2PMZA 4IDLA 1A1OB 1XGUB 2H32H 3G04B 5MI0B 5ESAB 2ID5A 2WWOA 5CA1B 3M88A 4OVUA 5I8CB 1F18A 1KTBA 3L4YA 1BZKA 4KAQH 4YBLB 3FU7A 1DEEA 3S3PA 1QYGL 3KLLA 4KKAD 3EGXB 1ZWIA 4MFHA 4AGOA 4ILDA 4JR9H 2YHGA 1E5UI 4EJ1C 4B9JA 4P4RB 4KX7A 3CCJV 2EE0A 1CTNA 2AQSA 1NH2B 2I7SA 4LOUC 4UB0H 1YJDC 1MF2H 4C56A 4DP6X 5F8RC 5B39A 4ISVB 3MBEC 5GGSY 1SC5B 1AS8A 3LKPA 4HOWA 3VM5A 5LXGH 1PF3A 3PAVA 4GRWB 1ZV2A 1KF9B 3FUEA 3UTPE 3IGAC 5IJVB 2J1YA 2EEXA 3AADB 5CIPA 4BIOA 1NGPL 1PZBA 4WNSA 5INCB 5IIEB 3KKYA 1CE1L 2HFEC 2ZOUA 2PGGA 4XMLH 3MXWL 3CRCA 5EC2B 1ZT7A 2G9HA 3PQYB 1IBKB 4BW9A 1WAAA 2BVOA 3BP6A 3LKOA 3OPZL 4U7KA 3BRDA 4OGZA 4QIWF 3AG1B 4KKRA 1D7BA 4MVUA 3UT5B 4DRXA 1OTSC 1CPYA 3G5YB 3E9TA 3BEHA 4MD5A 3GRWH 4BK5A 5CGBA 4ZMPA 1MI5D 5BJTA 2JMRA 5ID1A 1DJGA 4Z7QB 2FAUA 2XWZA 3T0EA 4O2EB 1MG3C 3VXUD 4OZIB 3BWUC 3QNFA 1P49A 1WSST 3BJLA 3BFOA 1K2DA 1BAFH 4FHKA 3G6JF 5EOCH 2OP4H 4YDLC 3C60D 2XDHA 5F7HA 3DGDA 4YXLL 3BO8A 5B7FA 3KWWB 1HP8A 1F2XK 4GSDL 3RTQB 5LLIC 3KGTA 1TEFA 3NSCA 3TN0C 1W15A 4J8QA 4X5QA 3RX7A 3UTTE 2X6VA 2FSDA 4K71C 4JPKH 5LMUB 1MLBB 4OCRL 1OCCC 4H13B 1UXLA 1XAUA 4TVPH 5T1MB 3TBTB 4NWTL 4KROB 25C8L 1MFCL 4NEHB 2VRAA 3S5LB 5L6YH 1K3EA 1UM6H 2HUHA 5JYLA 5GRUH 5IMMB 5EOTA 2ZM6B 1HL5A 1YYCA 2E74B 4F8LA 1BVNT 4ZNCD 3ARBA 1JMZA 4YHKL 1AVMA 2BDNH 1CO1A 1LO2H 4WFFE 1BVZA 1SBSL 4TUYB 2UVEA 1SN5A 3N41F 2XICA 5EA0L 4AM0Q 3RWFB 5KSUA 1IGJB 5E8EA 1NPNA 4M1DL 1JA8A 1KCBA 4PY7A 5I1CL 4YGAB 1UVQA 3BKCH 2H32A 5TDPA 2A74A 1W59A 1YI2V 1ETA1 2FT7A 1T0NA 4XH2B 2H2SD 1EEZA 3FB8A 4C83A 1A3LH 1BQLL 3BUTA 5D1XA 2QLVB 5BXFA 1DQTA 2J6EL 2F53A 1TETH 1CG9A 4PG9A 5I5IA 3GI9H 4WWKB 4K55A 2HHHO 2O6FA 3A24A 3FU8A 3I6LD 4JGJA 1QSFE 5AW5B 1QFWM 2KHAA 4HWUA 5AW1B 2HJDA 4X7TA 5AW2B 1F58L 1AR4A 1X7TA 1XIWA 1SJEB 3IFNL 4NB5A 3N43F 1DR9A 5E5RB 1YQVL 1WFUA 1X9RA 4NHUA 3QYMA 5FGSA 1YEJH 5SWZA 1T7ZA 4P2QD 2XWJA 4Z95L 1TNNA 3V4PA 4QEGA 1EN5A 3JAMN 3AS0A 5F9OL 5HHMD 3S3CB 3T6XA 4F1SA 1SLWA 3QAQA 5C0GA 3T77A 1TYJA 1VQMV 1DDHB 2I32A 4D9RD 4PJ8B 4NQVA 2ICWI 1YHQV 3CN3A 2YZ8A 3BSZH 3H0TB 5HDLA 5HI3C 4LFAO 2DIJA 4YHOL 2CO7A 4JMNA 2DQHL 3IAPA 3VFTB 4WFHE 3RLSA 3GSVB 4G1EB 4D0DB 2WGNB 1P4IH 2WANA 2A5UA 4FZ8H 4ODHL 2FD6H 4X7CC 2CJSA 2ADJB 4OM0L 5HHNB 5IOPA 1JGDA 3E8UH 2AJSH 5DYOA 3VNYA 1CFBA 3ABTA 5SV3A 2EIDA 4RGMB 1ZTXL 1BG9A 3HKBA 2CKBH 1W2BU 3HNSH 5IMMA 1FJ1B 5EBMC 5D4HA 1U3NA 5E1QA 2UUCO 5CR8A 3ARDD 4AGQA 5BNXD 3MOAL 5IVXB 2Q73A 3OTTA 2K8MA 3WXVL 2ITDC 1RSOA 2ZDIC 5IVZB 3HLAB 3OJ2C 1F13A 3PJSA 4I85A 2N1KA 2ZIDA 3GRBA 4QHNA 4IU3B 4DW2L 3FW6A 4I77H 3VXTB 3AU0A 4UQCA 3WO4B 1WUNT 3WUZA 4ZAKA 2B4CC 1FZJA 1E27A 2J8OA 2VN4A 2YGQA 3GXUB 1PM9A 1RSYA 4FEMA 4O2FA 2V4DA 2C9XA 4WTWA 5IZ7A 4KXZH 4UIMB 2ICEB 1NJIW 1C5BH 3K6DA 4LCIH 5I0YA 5HHMB 4I5BA 4L5FE 4IOIA 3F7YC 2IANE 4Y9GA 2KBGA 4DT2A 4U1SA 1BF5A 4G7QB 4RWYL 2DAVA 5EBMB 3HE6A 4HUXA 3NCJL 3MQIA 4XAKD 1BYPA 4MS8D 2JS5A 1TJHL 1AG0A 3CFDA 4LEOB 1PZDA 4ODUA 3E8VA 5B4MD 2DN9A 1CGTA 1KTJA 1N0XH 2XX0A 1AOHA 3H6AA 4BE5A 1A6WH 3VNZA 3QDGA 3FB5A 2J8UB 4PRBA 1EBAA 3ZIAG 4H37A 5FYKD 2VM4A 2Z34A 3M1CA 4JFFD 3P4OB 3SGKC 1LO0H 1DSWA 4JY6B 5JUEL 3UTTD 3EH3B 2IBZH 1O5PA 3AS2A 4HIIB 4ZPVA 5M7QA 1JWUA 3ZDYF 4CSPA 4LVHC 4O4HB 2HG5A 3O0LA 4Y4FB 5LHHA 2BY0A 2FJFA 1FFOB 3NQKA 4PA3A 2AEOA 1E4HA 1OHQA 2IWFA 4EN3B 4C47A 1MW0A 5SX5H 5GRUL 4QNPE 3CVHA 3FQWB 4G8AC 3RWJB 4QWWD 2PO6B 3UYRL 2J4WH 2YSTA 1MFCH 2WZPD 2E5LO 1Z9PA 1HCVA 1T7YA 3ASNC 1EGJA 2EYTA 4KTDL 5K1VA 3UC2A 4I3GA 3UTZB 4AV5A 3MNVA 1AGEB 4WFGA 1JRHI 1JOYA 1ZY9A 3CAFA 3TV3H 4ADIA 1T5XB 2GCYB 4F9LC 4HUCA 4AYBA 3BP5B 3BVVA 4TOIA 4ZSOE 2VSCA 1QI5A 2B1HL 5E2TH 4ADGA 1H0DB 2Y06L 1O9HA 2KMWA 1KYDA 2E27H 2WYHA 1UM4L 4JANB 2EKJA 4JF3A 1E9PA 4ACPA 3CMGA 3NJIA 4ALAL 1NINA 4BFNA 5BR8B 1OM3L 4P5TD 1IU1A 3DV4B 3CX5K 5JPNC 1LILA 5E79Z 2K4WA 3H2WA 4FNRA 3AM8C 2Q0OC 4LFHG 5I1GH 5J11C 4GX2A 1G5GA 4L5FL 2Z0UA 3EJCA 1M6UA 2VN3A 2R4RH 1Z5HA 2OA9A 4GQ9L 4MMYB 1U3HC 2W65A 3IMBA 1BAGA 3JWDH 1VQ9V 3F58H 1INEL 3VQYA 3ECBA 4WUKH 3MSPA 4XGZA 5E9DD 1Q9LB 3HCVB 5SX5K 2XTSA 1I8AA 1ES0B 2R8SH 1NAMH 2YRLA 5LXGL 3RURA 3OAYH 5EORH 4EUPB 4Z7QF 4F15C 2ZOTA 3OTFA 4NM8H 5JQGB 4U6XB 5EZIH 5F97E 1QR4A 5FF6A 4RAHA 5FUOH 3MREB 3X17A 4WK0B 3PL6A 3DWTA 4JDEA 1EZVX 2W94A 4P23A 3TP4A 3SBWC 4RX4D 4MSWA 4D2NA 1K4CB 4R5TA 4ZI8A 2OZNA 1J8HB 1EEYA 4HGWA 4CZZA 5EIIB 4XVJH 1U8PA 2AJXL 1YDPB 3NUKA 5E1AC 1ICTA 4RFOL 1GW0A 3TX4A 2PYFB 3HHRB 4LQ1A 4ZXBB 2BW4A 1HH6A 2FZ3B 4U1MB 1FDLL 3JV0A 4PJ6A 4DV2O 2FJFB 3PDDA 3NCFB 3OJVC 3C8KB 4TYUA 1EANA 2AQTA 1N8ZA 3RYIB 1XF3B 4F8NA 1KD1W 2ZONA 1CK0H 3HS9A 5DF0A 4J2XA 5HGBB 3V9CA 1GIGL 2ZAGA 3QUML 3DK0A 5KBPA 1M1XA 4D7SA 5F1IB 4IIJA 2P52A 5IEHA 1AKPA 4OF5A 4FL4C 5AG9A 2NY2B 4QXGL 3VMOA 4UT9H 5FYLH 2ZINA 5LCVA 4EI5D 4HH8A 4MNGE 4JB9H 1PX3A 3H9YA 3QIUC 3VW3H 1NGWA 4Q6IA 4MT8A 2HRHA 1TVBB 3F7VB 2YGNA 4R8WH 2R8SL 3HKZA 4ONFH 5EO9B 1G0DA 5FYJH 4B9KC 5IB4A 3RJOA 4P05A 3A23A 2P5OA 2FBJH 3SDXB 1KC5H 3AEIA 1L9PA 5KOMC 5PAZA 1SDAB 4JKKA 4XCFH 1EZVY 3O9OA 4QNHB 2EXTA 4UDTA 1ROWA 2WZ6A 4O58H 4NPYB 4YBQC 1I3RA 1UUNA 5CN3A 5I2IB 3HE7A 3TWCH 3SPVA 4PJDA 5DJ8B 1AFVH 1RAMA 5KVFL 3BW9A 3HFML 4P2OA 5DMGD 4TL4A 3LDDA 4LDOB 2ATAA 3ICXA 3S5YA 4QRBA 1Y66A 1VP7A 4IIQC 2W65B 4OCMC 3ISWA 3TZVC 1HW7A 2HWZH 3V6BR 2QMKA 1RZIB 4CBZA 3QJFB 3N04A 4EDWL 4I0PC 3FT2A 5ESVB 5GJTL 3VAEA 3D0VB 3UBXG 1QBBA 1FXHA 2YIAA 3MGOA 4EUPA 4HFWA 2R29A 4RISL 4NZUL 4PJ5A 3U1SH 4URTB 4JPQA 1ZEAL 2QVKA 5CHNB 3KLKA 4KVNL 5IV2A 1RFDL 1Q9KA 3GBMH 1IE4A 5JHDA 3RFZB 1P4BH 4IEFA 3QDJA 3W11D 1GGCH 3AC0A 1MN4A 1CFSB 1T1ZA 5C93A 5CP3A 2E4FA 4V1DE 1L7TL 5AYTA 3TYGL 2YA0A 2EIJC 5CUSL 1W0VA 2A0LD 4HDIA 3DVNB 3LNEA 4G8IB 4OI9A 4C54A 1RK0A 4HGWB 2GG1A 4KI5E 1WG3A 5EIIA 5L7XL 5CD3A 4M7LL 2Y7MA 3R7RA 5IY5B 1SQMA 3JD3A 5TFSH 3MTXA 1ZLVK 3QRGL 2YRPA 1URFA 1HH6B 4U1MA 1PL0A 1HU8A 5ERWB 4BZ2H 3BHPA 1D5RA 4KROC 1AQHA 2L0DA 1BZDA 1VQOV 2EJ1A 1PW3A 1RIUH 3HBGA 1TMCB 4NZDA 5D1ZA 1NICA 1U93B 1MAKA 4LHJB 2X0WA 3RU8L 3DO7B 1II4E 5C0BB 2XXMB 3V0FA 1UKSA 4XCEB 4GW1B 1XD0A 4DEPC 4G9FE 4P59L 4W9DC 1EJOL 3D34A 4HIPA 4P3CH 3N9GH 3KPSA 2X40A 2PYEA 3V5HA 2MCMA 3OLGA 1KBVA 3KJ6H 3LNGA 2CAKA 4R3SB 5GGQL 4KHTL 5B38G 4EB6A 1MW1A 2WBXA 3PNRB 1COWG 1KGCE 3GXTA 4LSPH 3NJHA 3MRGA 4MQSB 3W7WA 1WHPA 1N2RA 4RISH 4RWYH 1A4CA 1PKQA 4WEMB 3VCLA 2FX9H 2NY7H 4W9HC 4HSQA 1IGTA 1MG1A 3AM8A 3X3GL 1IGML 3FPXA 2JKNA 3MXVH 3OTOO 1M71B 4Y1SA 5KLVH 2FUTA 3FQXB 4I48A 3DRTA 4GUOA 4JN1H 3N44B 3QH3A 5I1KH 3ABMB 4HK0A 4XAWH 1XHHA 2DTML 4I77L 2V8MA 5DQ9A 5AEAA 3S4SA 5ACZA 4L3EB 3ULVE 4Y1AD 4U1IA 3MNZB 3HFMH 2X4UA 2MCPL 3T4YB 1JE6A 3SN6N 4ZPTA 1NCUA 2J88H 1E65A 4NB7A 1HX0A 1WWWX 3N2JA 4K7PL 1RHHB 1YG9A 3ZHTA 2Q76B 5L3GA 4Q4EA 5C08B 5GS0L 4MTOA 1TZIA 1G6VK 1MWAB 3OSVA 2G30A 5FO7B 3MLSH 4R4ND 3CCRV 5ICZA 5L2KD 5D7SH 1D9KD 3AWEA 2OTLV 3D0VA 3E6FB 3E7JA 4G3YH 4FTVA 2JI1A 1GN6A 4FRWA 3W5MA 4IK7A 3MJ9A 2NPLX 2WXMA 2GTWA 1SVCP 1Q9KB 2MTPA 2HMIC 4OM0H 1KCVH 3MV9D 1PZSA 4FQXC 4U3CA 2DMGA 3MBXL 1P4IL 2FSEB 3PWUB 4FZ8L 3SSGA 2B9ZA 5CA0A 1O9VA 5AALA 4AGNA 3VSTA 2HAZA 3VVWA 2UXBO 2JELL 1ACYH 3NIDF 4F93B 4JI3B 1IBBA 3E6HA 3NYKA 5FPOA 1T1XA 1XCTB 3FU5A 5DC9B 4N20A 3KR3H 2A6DA 3B5TA 5TDOA 3ARSA 1I53A 1FORL 3CFMA 4HT1H 3VXRD 8CGTA 1A7QL 4AZ8B 1KTDA 4JW3A 3ZHRA 1H3PL 2Y1VA 3GWJA 2BNRB 3LEVL 3HB3D 3R4DA 2DQIH 4Q2ZB 2VZOA 3HRZC 3QJSB 4MJIB 5AVQB 4OIIH 4P2QE 1ECYA 5D7JA 5GS1A 5IQ9A 3JALA 2FRGP 3WU2Z 2DDQH 3HBPA 5ADOH 1OT1A 5CD5C 4QMEA 5AAWC 3LKRA 5CWSB 2X4SB 5BMFL 1X5AA 5C0AB 1NWPA 3I6GB 5L9DL 3CZFA 1O7VA 2D73A 43CAB 2V17H 5FUOL 3ATFA 5B38B 4KOBA 4YHZL 2BM3A 3QCTL 3EOYG 5HI5C 3QB7C 4IGGA 1E8YA 2QDOA 2FLMA 1ZPLA 2M1KA 2OTPA 2PYLA 2BK8A 3WTWA 4NZFA 1CFVL 4YHNB 2EEDA 1QPKA 1I3GL 3KPRA 3CG8A 4LPTA 1TZHB 5BZDB 4XE5B 4QCIA 1LM8V 3NIGF 4IMLB 1UJWB 5TF1L 3MLWL 4OLUL 5K1XA 1XSOA 3C3TA 1JTOA 2CPCA 3O3BA 1H6FA 2PI4A 3MVSA 3X1GA 4HWEH 2VZVA 3PUUA 3VXSB 3BEWA 1C7SA 4G9FB 5EFIB 3WFDH 3LPWA 1CZ8L 3KYOA 4OX9O 4WFAV 1VCAA 2EDEA 4KK5C 5HGAA 3P3YA 4NNYA 4FM0A 4ENZA 4LMQE 4NENB 2FQGA 3TOPA 4JM4L 3GEFA 5JOFB 2PTVA 2XUMA 3NXSA 3OKYA 1ZLVH 4OCRH 1ZANH 5D2LF 1BHAA 5D55A 1L9QA 2Y7LA 4KQ3L 5JIKA 5L3DA 4D7PA 4CGUB 3ETDA 4KQ3H 3W57A 3KCPB 3T6WA 3GUTA 1IM3A 2YPLB 3BT0A 5J4MA 3WTTA 1TKWB 3PV6B 3DA0A 3KYMB 5AL8A 5IW1B 5IF0A 4ZUTA 5GSRA 1CDIA 3K5RA 3VD7A 4OXSA 2QWPB 2EDTA 2WO3B 2BS71 3PDOA 4AH2A 2VITB 1AS6A 5DJAB 5H5NA 3JTTB 4LIQL 4F20A 2KL6A 3BH8A 2MSPA 4FG0A 4NAMA 4Z8FH 4TQDA 4K3DH 2Q1EA 4NNXA 2KKWA 2EDJA 3L7FB 4PVNA 3WEAA 4DP8X 4YS4A 3UG5A 3K79A 4WJ5B 4QHLB 1A9EB 2WXFA 4PJ0Z 4QOKD 1IAIL 2VNCA 3IU4L 3QR1A 4OJFL 2YZ1A 3MDJA 1UACH 1KQSU 1AD9B 3HC4L 4P2QA 1ZHKA 3CDYA 1N59A 2WQVA 1LLAA 2IWEA 2YS8A 1BFTA 2VMDA 2JCCA 4E9TA 1GC1H 4WSKA 3US1A 5F21B 1G9NL 1XO8A 4APXA 4LASL 1XXFC 4IMKC 2HH0L 2QJ1A 4A6YA 4L1LA 3KL5A 2G3XA 4MZ2A 5DU7A 4PJXF 5LGYA 3U4AA 5KHHA 1EV2E 1OKEA 2O93L 1RURH 1U8LB 1A3ZA 5GRJH 2B14A 1E4XH 2IH3B 2GHWB 4I50A 4KK8D 3TIDB 2MQ3A 2GBUA 1H3UA 2WKLA 1FFRA 3VXOB 1KMGA 2DQUH 5F88B 2JCWA 4MNHB 2DM4A 3U79A 2PPFA 5DD5L 5FKAB 4TVPE 1QNIA 1CICD 4LCWE 3ZL4L 5I1DA 2WA3A 1X5KA 1OAKH 5C7XL 3VGHA 4RUEA 1NGXA 1OAZH 5B7EA 2OS7A 5BXFB 2GBAA 3BVUA 4AHCA 5EZPA 5HYQA 4HKBB 5A9GA 2KQNA 2JLPA 3KYOB 3HR0A 3LH2L 4X6CB 2PXYC 1TJIH 1WP7A 3GJFB 5HFLA 4GMTH 5IJ0B 3D9AH 1XGZA 2AANA 1MI5A 2G2RA 2JELH 1XEUA 3N91A 4EKXA 1ADQA 4R2GB 1S8DB 4K3EH 1M05B 5CZXC 3CCHA 4L18A 4XP6L 5T5FA 1A2YB 3LZQA 4ADJA 5JXAL 4Z18A 2X6UA 4KKLC 1T5EA 1PLBA 1KPVA 4RFEA 4WKXA 2RNBA 1P84J 2IQ9H 3AQYA 4P2OC 4F6EA 4XN1A 4P9ML 4QY8B 4AL8C 5LXVA 4KJWC 2L7QA 4Z3EA 2ZSVB 4X6BB 1HOCB 4N86A 2LQTA 1EGJL 3SODB 1JCVA 1TG8A 3O8XC 5DJAA 4NFCA 1CB4A 2WXIA 2KPNA 4XBPA 3GMMB 4DVRH 4Y2OA 1A5FH 2WWNA 1E4XI 1N5AA 1SQXH 4GP8B 3CVHL 2J88L 1QFWH 2QPDB 4X88A 3PABB 3WFBH 1U8CB 4EXKA 3ZTJH 3OWEA 1FE8L 5D1XC 4UV7L 1T6VN 4B60A 5ES4B 5JDJA 4XVOA 3FT0A 4HPHA 2J57A 2LAAA 4GI6A 3F6JA 3NZSA 3W9EB 3CSTA 5HSFA 4UZGA 4JE4B 4ZFOL 5IOKA 3DX3A 1KLFB 4LNVA 1YITV 5LO7A 5KTEH 1CBVH 1KXQA 4XMZA 1F0LA 1HHIA 3JT0A 1T0NB 4DR5O 4LLWB 3SDXE 3X3GH 5KYXA 4UZUA 5BCAA 1RJYB 3CDZB 3FO0L 3KLAB 1G7LB 1OT2A 4C55A 3T0EE 2VDQB 2GKIA 5E4AA 2FL5B 3QWRD 3KPTA 1KELH 3VXTA 3BAYA 5MENB 4X6EB 1SXBA 1G7PB 1H2LA 3BIAX 2PABA 4Z7VB 4J10A 3NK3A 1X4TA 5EUOF 1Q6IA 4S1RH 4XXWA 1XOUA 3LV3B 2WPDG 4CH3A 4XCCH 1F56A 4I5SA 4R97B 1ZS8A 3P3UA 1R5IB 4TM9A 2ZOWA 2RCSL 1ITCA 2BIPA 1QNMA 2VR7A 3FXIC 4LP8A 3RU8H 5I76B 1R5VB 2ZXWC 2VQ1A 1OD7A 1YA5A 3F84A 4PI0A 2LW3A 1XI1A 1DCEA 2VR4A 1HFUA 3NCBB 3O0RL 3ZE1E 2OL3B 3PYCA 2GTSA 4O4YH 2WINB 1IQDA 2Y7NA 4H2CA 3HG3A 3VI3A 1RJLA 5JW4Q 3ZY7A 1V8HA 2Z0AA 1S7WA 3OHMB 1FSKC 1BHBA 4NRZB 4DN3H 1C9SA 2VAAB 2DW5A 3ZMTA 5J11B 4GAGH 4X7EC 2CBTA 3L3DB 5IIEA 2Y1YA 2XY1A 4FQ1H 4MAYB 2XOKG 2VMJA 4LFBO 2AKRB 4R97C 2XHBA 2H3NB 3MFFB 5SWSA 4J3OH 4DK6A 5J57B 1CE6A 3BUYB 3IU3B 3L4TA 4F7CB 2M7WA 3HB3C 5I71B 1UOVA 1SXCA 4UOJA 5E9DA 1HEZA 2HG0A 4GKZB 3PP3K 4O4IA 3BT2L 5B1OA 1XZWA 2UUBO 2GEQA 3FF8A 2ZP8A 5TE6H 5DEJA 4YFLF 4DV1O 1AGFA 1UZ8B 3IXAA 4PJHE 2VDMB 1QWNA 2VQ4A 4W9KC 4Z23A 3S96B 2I60H 4LCYA 1KTRL 3GRWA 1A8ZA 3AMKA 2KI6A 5IMOB 3UMNA 5LN4A 1AZUA 1NIAA 2B5IC 4IU3A 3MNVB 4G6FD 2WCPA 4CADA 2E75C 4LRIA 3BO8B 4MS8C 3OVUB 2G4EA 3U9PH 2YFNA 5J6HA 3EYOB 3QXDA 3OT7A 2QGDA 3PAZA 4RVBA 2CD0A 1HWGB 3SPCA 3O45A 1AQ8A 4PRPB 4H26B 1AKJA 5E2WH 1LK3H 4UVAA 4WF9V 1JN6A 3QJUB 1FNGA 1MW3A 2Y1ZA 2Y4UA 3CVDA 3GHEH 4W70A 4X9HA 1B0RB 2ZUSA 1T6WA 2PR4H 4UU9A 1P4LB 1RZJC 3FQ4A 4FYRA 2VJ0A 1WJ3A 4DKDC 5D96C 1BVOA 2Y6SC 1JDCA 2W0FC 1LL1A 2YD8A 2Q7GA 3B8NA 3HE6D 1GAFL 1LO3H 1DTUA 3RWGB 2NCEA 3A6BL 5LCVL 2F43G 4CMMA 2XXGA 1FA4A 5J2UA 4GJTB 2KG7A 3G5ZA 4W9IC 4RQQA 4GBXD 2XN9A 4N2BA 1NDGB 4YLBA 4WU7A 1QPPA 2QTVA 2OXGA 4TQFA 1F42A 3PPEA 4MA3A 4B3TO 3AK1A 1U2HA 3QEQD 1ZLZA 3ZYOA 2IU0A 3FQUB 3KLQA 4ZQKA 1JTPA 3ARDC 3WIIH 4R0LC 2ZF9A 5AZ2H 4TLKA 3SZ6A 3HA0A 3X12B 4FNLH 3U48A 12E8L 3EXLA 3ZKMC 4Z7UA 4PYHA 5DJZA 3T2NL 4GUNA 5BZBA 1YSCA 4NSKB 3JYCA 4JDTH 1VSCA 2O26U 4X7TB 1CS6A 1YDPA 3MCKB 1ET8A 3H9SB 2P5EB 1T7WA 4B9PA 3KHQA 3UTZA 2WZPA 4TNVF 4FFKA 4RQFA 5HI3D 1UZ6F 2Z93A 3QUYA 4HCRA 5AYQA 3SGKA 4FS0A 4ZMWA 3LD8B 2R15A 4KV5E 4M6MH 4GKKO 2X4PB 1S9VA 4WFGD 5J2TB 4X6FA 4S10A 2Z92B 3LIZL 3RWRD 4U7NA 4Z0XA 3O6KH 4Z7OF 2JVUA 4BZ1A 4NQVB 1Q9WA 2OI9B 4NX0A 1RK1B 3IK2A 3KEDA 5FYJE 3SY6A 2FT8A 4J80A 3U36A 3U9UB 1RJZB 1FC1A 1QRNB 2XG4A 3RYCA 3MGAA 2EIJB 1NOAA 4WUUD 1S7UA 4X20A 3THML 2AC0A 3RVWC 4XAWL 1OM3H 4DV6O 3LQAH 4OU3A 2HEPA 3GSNB 5IB4B 3AREC 1QG3A 1ZK5A 2C34A 1BZ9A 1DBKL 5E1GA 3O45B 2NNAB 1KJMB 3IJ7A 3KHOA 2EDWA 3QQDB 2WWKO 2WN3A 3QZOA 5TE6L 4KK9C 4L37A 4PSPA 4XOBA 2W0XA 2G5UA 1DQQA 4HJUA 4AQAA 1QQCA 4QE7A 4IJ3B 1NIBA 4QTIH 5HHPA 3MLUL 4PP2A 1MRFH 4OT1L 1CURA 1TVHB 4L3ED 4X0KA 4EKJA