2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
4N4YB 4E9QA 1PZCA 2EIMB 3AZUA 1ZDSA 4GP4B 2CALA 2Q9OA 1NINA 4WKXA 3NJFA 2R7EB 1BXAA 1ASQA 1OCRB 2HRHA 1BYPA 4G70B 4AZUA 1ILUA 4NB7A 1J9RA 2IWEA 1KDIA 1SFHA 1AZCA 1AZUA 4E9TA 4W9ZA 4DP9X 8PAZA 3IN0A 3CVDA 3OQRA 1AAJA 2CAKA 5D4IA 1GS7A 4DP0X 1JOIA 2XX1A 1XMEB 3UACA 3QJUB 5E9NA 3X1FA 1AS7A 5B7MA 1KGYE 3G5WA 1AACA 1PAZA 5I6KA 3PCYA 2UXFA 3T6WA 2TSAA 3NSYA 2YAHA 3EH4B 2EIJB 1PF3A 2YQBA 2UXGA 3DIVA 3QPKA 4HCIA 3UGEA 2IDUA 3C75A 1KBVA 3OMIB 5B1BB 1W8EA 2HX8A 1W6WA 4HALA 1A4CA 3FU9A 4YSDA 2FT7A 2X88A 3CZUB 2IDQA 3GDCA 4KNUA 4E9WA 4AKPA 2IWFA 4K9JA 2FQFA 3PAUA 1B3IA 3WIAA 1NICA 4DP6X 2MRYA 3N2JA 2VSMB 1URIA 4YSAA 1IC0A 5I5IA 1NWOA 2YAFA 4CSPA 1NPNA 5F7BA 2WO2B 2HX9A 1JXFA 1JZIA 2H3XC 1BEXA 2YAOA 3NSFA 3PPSA 4BDVA 4DP1X 1WS8A 3T71A 2BP8A 5I26A 4AKQA 1OCCB 4BXVA 2HX7A 2YEVB 5B1JA 2BW4A 2E86A 2XXFA 1AG6A 2XXGA 2DWTA 1AANA 1DYZA 4E9SA 2CJ3A 5LDUA 1WA0X 1DZ0A 4BDVB 2XLLA 1PNCA 3AG1B 2BP8B 2LLNA 4BXSV 1AS6A 3X1EA 1NDTA 2NRDA 2P80A 5B7EA 2Q5BA 1L9SA 3NYKA 4A67A 2ZOOA 4BK5C 4KNTA 3S8GB 3DTUB 3T6ZA 3UAEA 2B3IA 1GY1A 2CBPA 2JKWA 4BWUA 3FT0A 2FQEA 2YAMA 3S8FB 4HHGA 3GXUB 3ABGA 1GSKA 2EIKB 2UX7A 2PPAA 1AIZA 5AFAA 2QDVA 4AKOA 1CYWA 3V9EA 4GYBA 5EHFA 1TU2A 2A3TA 2IDTA 3NP3A 3WNJA 2FJSA 3WKQA 1BQRA 3N55A 3U25A 2AVFA 1PZBA 2J56A 5I5JA 4G7RB 4GP5B 1ZIAA 5F7AA 3CDZA 1HAUA 4KO5A 2OJ1A 2BHFA 3TBCA 4G7QB 4HHWA 4BWWA 3FQ1A 3ERXA 3FSVA 3X1NA 1XB6A 4G71B 4JHUA 3WNIA 4JKNA 3AG3B 1M56B 3OM3B 1X9RA 3QJSB 1V10A 2GBAA 4UF7C 2PP8A 2UXVA 1L9OA 1PLCA 1QHQA 3TA4D 4UAHA 3CG8A 1WA2X 1OCZB 2WSDA 1CURA 3FPXA 2BP0A 4X4KA 1PCSA 1L9PA 3IEAA 1T5KA 4AI7A 4NERA 4YVNA 1PNDA 1GS8A 1AG0A 1PZAA 2XU9A 1IKOP 2BWDA 2IWKA 1WS7A 3FQ2A 2XV0A 1JZHA 1TKWA 4M3HA 3SBQA 1X9UA 2CUAA 3NP4A 6PCYA 1A65A 1NIFA 1JXDA 2BP0B 2I7SA 4PCYA 1JZGA 1BAWA 4HCGA 3JT2A 1A4BA 4F2FA 1EZLA 4GP8B 2HLEB 2IDFA 2DYSB 2YXWA 2AZAA 1JZEA 2QPDB 3FQYA 2OV0A 4HAKA 2GB2A 2JXMA 2FQDA 4KOCA 2BWIA 1AS8A 4E9XA 2GSMB 4A68A 1PY0A 2FTAA 2HXAA 1SF5A 2FNWA 1GW0A 2WO3B 2PP7A 5D4HA 3EHBB 4P5RA 2GHZA 3QQXA 2TSBA 3SBRA 4DPCX 2J5WA 4A2GA 3SBPA 3AG4B 1SDDA 4N8UA 1CYXA 4WTQA 1MG2C 2PCYA 2AZUA 3HB3B 4GXFA 5B1AB 3T9WA 1OE2A 3NJJA 1BQ5A 4TXVB 2PLTA 1IBYA 3FSAA 3FU7A 2B08A 2CCWA 4G72B 4W1TA 1SDDB 4F2EA 4QKTA 1NTDA 4QLWA 2PP9A 3ASNB 2P80D 1E67A 2YARA 4ZK8A 7PCYA 1E5YA 1RCYA 1TEFA 1ET7A 1XB3A 4Q8BA 4YSTA 3PLYA 5ANHA 2YAQA 4KO6A 4A2EA 1QNIA 1FA4A 4KOBA 1NIAA 2XWZA 1TEGA 3NJGA 3X1BA 4Q89A 5B1JC 2BO0A 1A4AA 1NZRA 2QDWA 3TU6A 1F56A 1KDJA 1AZBA 3PAVA 4UANA 1IUZA 1QLEB 1JVLA 4HCFA 5I6PA 5TK2A 3H4HA 3OD3A 3ABMB 5AZUA 1MG3C 1ET5A 2EILB 3NSCA 2FQGA 2BZCA 2PPDA 2VM4A 4PAZA 1HAWA 1SFDA 1HFUA 1AR1B 3UABA 2HRGA 1L9QA 3ABKB 1ETJA 3FS9A 4A2DA 3MBWB 2W8CA 4KO9A 1KCWA 2Y1AA 1IBZA 2YAPA 1V54B 3DKHA 5IY5B 2JFCA 3NJHA 2J57A 2ZXWB 3BVDB 1JVOA 1J5DA 3QJVB 1E5ZA 1ASPA 4RH4A 3UAAA 5A7EA 3NJIA 3IE9A 4GY4A 4L0PB 1M9WA 1MZYA 3TASA 2MTAA 3GYRA 3V9CA 4DP8X 1PLBA 3CDZB 1ZDQA 1ILSA 1NIEA 1M57B 2Y69B 1NPJA 2J55A 4YSPA 4DP2X 1ID2A 3FYIB 3NT0A 1UATA 4G7SB 1OF0A 3H56A 3QJRB 2XYBA 1PMYA 1E30A 2VN3A 2GC7C 2VSKB 3KW7A 3WKPA 2QT6A 2VW7A 1J5CA 3AW5A 2QPEB 2FT8A 2RACA 4FAAB 5I6MA 2YXVA 4DP7X 4KO7A 1MZZA 1GYCA 3IN2A 3NJLA 3UADA 1NIBA 1A8ZA 2VW6A 1N70A 4YSRA 3S3CB 1SJMA 2R7EA 1BQKA 1ZIBA 1ET8A 3QJTB 3NJNA 4A66A 1KCBA 4CSZA 3KW8A 1J9SA 1CC3A 3S3BB 2XVBA 4EF3A 1KYAA 4ENZA 3OMAB 5D4JA 3HEIB 2GIMA 7PAZA 5FC9A 1SHXA 4YSCA 2AFNA 1MDAA 2PPFA 3FU8A 3IBOA 1AOZA 4BWTA 1OE1A 2XV3A 5PAZA 3BQVA 1V55B 3H4FA 3JTBA 2YAEA 2EINB 4YSOA 2AANA 2I7OA 4P5SA 2PPEA 1YLBB 4HIPA 3ABLB 5I5MA 1J9QA 1PLAA 2W88A 1RKRA 1BYOA 3ZDWA 4YVUA 2H47C 1ADWA 1GS6X 3FPYA 1W6LA 3T6VA 3PXLA 3FU7B 2UXTA 1OE3A 3D12B 3FSWA 2IDSA 1FFTB 4MFHA 4M4RB 3QJQB 1WAEA 3MX0B 3SQRA 2XX0A 2OCCB 5I28A 3T6XA 4F7KA 3PAZA 3FSZA 1SNRA 1EHKB 2IH8A 5B1KA 4KNSA 1NWPA 1OCOB 3TBBA 2BW5A 4DP4X 5I6OA 2VMJA 2DWSA 1KV7A 1KBWA 4DPAX 3X1GA 1GY2A 3ZX1A 1RZPA 5PCYA 3NSDA 1FWXA 3WG7B 2IAAC 2UX6A 3X2QB 1ASOA 4FA7B 2DYRB 4E9YA 1E65A 3FYEB 1J9TA 2X87A 1I53A 3CVCA 1OV8A 2GI0A 2XV2A 3ZBMA 5I6LA 4A2HA 1SHWA 3L45A 3EH5B 9PCYA 1JXGA 2DV6A 2VM3A 4JHVA 2HZHA 2N0MA 4YSSA 2FWLB 2PPCA 4YSQA 3NJMA 1NIDA 1AZNA 2GC4C 4NAJA 2BZ7A 1N68A 3RYMA 1AZRA 5AKRA 2DY2A 3S3DB 2ZWNA 3AG2B 3OMNB 1JERA 5TK4A 4YL4A 3ZIYA 1WA1X 5I6NA 1GR7A 4YSUA 1AQ8A 4YSEA 1JZJA 3CVBA 6PAZA 4E9VA 3ASOB 1R1CA 2ZONA 4HZ1A 1L9TA 1VLXA 1CUOA 2H5UA 1JZFA 5B7FA 1A3ZA 1BXVA 1XB8A 1OOWA 1ZPUA 1ZV2A 4DP5X 4A2FA 4DPBX 2IH9A 1SF3A 2I85A 3EH3B 2PCFA 3NJKA 2VW4A 1RZQA 2XUWA 3WI9A 3EF4A 4AX3A 4E9RA 2FT6A 5B3SB 1L9RA 3AY2A 1BXUA
chains in the Genus database with same CATH superfamily
2P5EE 4AVKA 4N4YB 2JE8A 1JK8B 4PSRA 4PV9A 3LRLA 1EN4A 1G43A 2BNRE 4JDVA 2K7PA 3NGBC 4MDIA 5E6ID 1E8YA 4NUJB 3HCVA 3O2DH 1A32A 2F1AA 2Q87A 5HXMA 1AXTL 3ARXA 1YQVL 4DR1B 5BQDA 4DV3O 5E2WL 3RGVD 4F8LA 4IEFB 5GQBA 3V9FA 4JI3B 5HI5D 4JYAO 1U8LA 1RERA 5JA9A 4Q6KA 1AAJA 4NRYA 4W9LC 1GS7A 5C9KA 1Y66A 4GLRI 2AJUL 3OKMA 3UG5A 4HKBA 1JZDC 3VXME 1HWWA 4IS6B 3NFSL 3QIBC 1E3FA 1LYQA 4B7IA 4IK6A 5I6XC 5IOPA 1A5FH 2CGZA 1QLNA 3HRZA 5HI3C 3SJCC 4YHPB 1CFVL 1UGKA 3QHZH 1FNLA 1EFRG 1HYRC 1Q9WB 3C87A 1BHGA 2WQ8A 3Q4HA 4PSPA 2P3YA 4M8VA 3VYNA 4FE9A 1XR8A 2J1XA 4Z7UF 4GO6B 4PJDE 2G0LA 3BKML 4K3EH 4OLWL 2B77A 4YLQT 4G3YL 1U3HA 1KBVA 1MFAH 4QOKD 1A47A 4QRQB 1R1BA 5LGHL 1UQSA 4JDTL 4NO0A 1DQJB 2BPBA 4FL4C 3W5MA 1UUNA 2IV9A 3GDCA 1MW1A 3RJOA 5FF6B 5LNDA 1UACL 1XZ0A 3G6JF 2X40A 2GTAA 2E5LO 3BPCB 3TBYB 3ZN6A 1I9RH 2B4CH 1G7LB 1R75A 2DQIH 4H2AA 1JMXA 1NICA 2B5IB 3AS1A 3SN6N 2AJZB 2LO1A 4ORGB 3DI3B 2XWTA 4HWZA 4NHCL 1QSEE 1RJLA 4Y4FA 4XX1E 2GV9A 3NIFE 3N9GH 5H37G 1TOXA 4MB1A 5D2LB 1HESA 2WKGA 4GKLA 4U1IB 1OHZA 1JNNH 5E1AC 5FA3A 5MEQA 2FEEL 5A2JH 2GBVA 4HWEL 3S3PA 4GKZA 4PBWD 4F7PA 2BSDA 4JGSA 2OQJA 3MLVL 2VAAA 1TZIB 4U4IA 4FQPA 2E86A 3DTXA 4KITB 2NY6B 4JG1H 3O9OA 1KJ2A 4JPKL 1FQ9C 3ZT5A 9CGTA 3CHSA 3F6JA 5INCB 5JIHA 3DLQR 4IYKA 1WPXA 4M1GL 1JWMB 5C92A 4JZNA 3QZLA 1KENL 1UXWA 2J12B 3GSOB 3ARGC 4PJEB 4J7KA 3B5TA 1NGPH 1NDTA 4HEMA 1T2XA 2E7HA 1N0LB 1E7UA 2VWEC 4AH2B 4CS3A 3S6CA 3IB4A 3QO1A 1TGOA 1MAKA 1NM4A 3IKCA 2OTWB 3II1A 3Q6FB 3WL9B 2WXLA 5EO9A 2XWRA 3WUWG 2AHZA 4WF7A 2VERA 4LHUA 3GINA 4NUMA 1Q9KA 1WZKA 2YBGA 4JLRA 1MCJA 3BSGA 4KAQL 4XCYA 4OIFA 3MV9A 1GGUA 1JZ6A 2HJDA 2WSPA 3IVKA 3FFDB 2GJ6D 4OTXH 5D9SB 5EOTB 4X20B 1FKAO 2BIOA 1RY7B 4X7TA 5D1XA 5CFAA 1BQRA 3ARFC 3PUCA 4ADIA 1MRDH 3N50A 5DRWA 5EIBD 2ADIA 2UZIL 3MACL 4I18B 2Q8AH 3Q05A 2WQWA 1XBRA 4NKMB 2C4FU 2OJ1A 5EC2B 3W39A 4AEFA 1SXSA 3PWUB 2ZE6A 4BWWA 5CCKH 1NOAA 4QRRB 4D3CL 1WD8A 4MKMA 4XP9H 1KBHA 1M56C 2W0LA 3X1NA 4DGIH 4X4YA 2BC4B 1SQPH 1ZT7B 4H20L 3ZRVA 4JN1L 1MJJA 4G6JH 4UIKH 5AVVB 1KLFA 5DZOA 3LNEA 4WI7A 3ULVF 3F5TA 3O6FC 2ORBL 3LKSB 1G1YA 1I1CA 3F84A 1U8NA 2KH2B 3ZDZE 1JAEA 2Z8VC 4FFWC 3JASB 1JPEA 4OZ4A 5A3ID 1OCZB 3CPWU 4FNLL 4LRNH 2OA9A 3EYQD 4FMVA 4FZEL 3BIBX 4KI5C 5EUOA 4X4KA 1L9PA 4ZUWA 2WCSA 1PYWB 3LRGA 3VXSB 2A9HA 4ZPTB 3D09A 5FIEA 1PZAA 3AITA 1QVFU 1WS7A 1MPAH 5BR8B 4J6RH 5ADOL 4NP4H 5FLUA 3UJJH 4H44C 4QHKI 4YHLH 4YXKH 5C6WH 1CBVH 3PWNA 3REVB 3BQUA 3RWIB 2NW2B 4BKSC 4B08A 4UTBL 2F7QA 3FBKA 3MLSH 4BYHA 2O5NA 1MY5A 3HZKB 4PIBA 2QGDA 4XNUL 4Y5VB 3IJ7A 5AVSB 5DJ8A 1W0KG 3T4AB 1E6JL 4GI8A 4A2LA 5E00A 5EEVA 2GVYA 3QQ3B 3PFQA 5DMGC 1BS3A 1T2QL 5HVWA 4TUJA 1Z9NA 1TEYA 2AMUA 4DKTA 1E5AA 4LVEA 3FO9A 2AJSL 1W59A 1N7ML 2O30A 2QBWA 5B1BC 3SKNA 3UP1A 1M6UA 2NY6D 3SBRA 1DJYA 1I7RB 1HNFA 1X5LA 3SBPA 1CDCA 4DR4O 2XPGA 2DLHA 3Q5OA 4H8WC 5DQJA 2FBJH 3T1HB 3MUY1 5BVPL 3O4LA 5SWQB 2NLJC 2X4TA 1KFAH 3VXOA 3CFBA 1E4XH 4G72B 2BS8A 1NBYB 1CLVA 5LBVA 3TBTA 3KHQA 3CFNA 4LFCO 5DZLA 3LRKA 4Q2ZA 4BZ2H 5CEZL 1KULA 3S5ZA 4XRCB 1DEDA 4F9PA 4Z6AT 1BX2B 2ICEA 2Y1YA 4HS8L 2BTOA 5LA6A 5FFLA 4XMLL 1MHHB 43CAB 4Q8BA 3TF7C 3GXIA 5IIEA 1Z5VA 3TO4A 1PAMA 4JZGA 2VL5A 2ZX9A 5J06A 1J18A 4HKXA 1F45A 2UWEE 3AABA 3DPBB 3CSYB 4KX8A 1OGAD 5DD3H 2PCXA 4BIZA 3L4WA 2ZF8A 4RCAA 3ZE1B 3SSGA 5IK3A 4UTAL 5KMGB 3TU6A 3GZPA 5JOFA 5IB3B 2XETA 4WFED 4KRMB 4KHPO 1ZS2A 3S96A 3ABMC 5DMKA 4DUXA 1I3RA 3MBWA 1G94A 1QHTA 2D3JA 2FL5B 5TH2B 1RIVL 1HCVA 1IU1A 1SUHA 2QSAA 1NGZA 4XP4H 2UV3A 2PYEA 3KCYA 1EPFA 3CC1A 3QZWG 3UDWC 3UJTH 3ULSA 4F93B 5BXFB 2QQKH 4AMKH 5TDNB 2EKSB 1T7XA 1P4BH 2DMGA 3VXSD 5AALA 4MHHG 1QTSA 1ZCRA 2XCMC 2AC0A 2R4RH 1FFPA 4YO0B 4Z7QE 2R0KH 4RMSA 1JVOA 5JYMA 2PR4L 4ANVA 2DQGH 3C08L 4RFEA 3ABTA 2G9HA 2BVOA 5T1KA 1QI3A 5DYFA 2F7RA 5JPMB 2HRLA 1ETB1 4Q9QL 3IFPA 1CFNB 3OB0K 3PFUA 5HYSB 4NNPH 4M7JL 2QGEA 4PPTA 3GJFH 5AAMA 3V4VA 4LMQI 3FH8A 2OJEB 4PG9A 2QPFA 1RVFL 1OPOA 3QO0A 2Q68A 3WEXA 2JELL 1X59A 5BZZA 3TVMD 3BVTA 1PP9H 3ECBB 1PDKA 3UGXA 4NZ8A 3T08A 1J1OL 3L3JA 1I31A 3H56A 4V33A 4MVUA 1SHMA 2OLDA 4QLRA 3QHTC 3RTQC 1JDDA 1V7NH 1SQVH 2W91A 3CFIC 1F97A 3RWHA 2VLME 1FGVL 1FG9C 2VM9A 2NDFA 4U1SA 2OZ4L 3ARUA 3CLEL 2RACA 5AOJA 3UAJD 2A9AA 2Y7NA 2VLJB 4M8UA 1OAKL 4H13C 1AGFA 4KRPD 2I9LA 2BNQD 2O5XH 1NIBA 2R0LL 1GYAA 3QDGA 4YSRA 1KJ3L 2VRZA 4JFZL 4MRCA 2GSIA 1KZYA 1MXDA 4FXKB 5ESVA 5AW7B 1HI6A 1R3KB 4JHWH 3DC0A 4WHCA 1E1RG 1FFXA 1LTXA 5EV7A 3S34L 1O9ZA 3CX2A 4D7TA 4WGKA 3MBXH 5KHGA 1SLVA 1J9SA 5LG1A 4FYQA 4XN7A 1MELA 1UFUA 4Y2DD 1AR4A 3ZMEA 2GITB 4EF3A 4F8NA 1IBFA 4I89A 1DQDL 1O7DE 4X4XA 2DL2A 4HT1L 1HILB 3QIBA 4P3WA 3SQBA 3LIUA 4LLWA 2NNUA 2DM2A 1CCZA 5B3NA 1AOZA 5I30L 4XVSL 1QSED 4PV1C 1BP3B 3RUGB 3P2DA 2RMKB 5LG6A 1WA8A 4PCKA 3UERA 2FO8A 4X7EC 1A14H 5AVZB 1J9QA 3OSVA 5AVYB 5M7QA 3IC7A 2JTYA 4WTZA 4NQDE 5CD3A 2F19H 4XH2A 4JM2C 5ECGA 2RQ6A 5T3XH 1OAUL 1KY6A 3QUXC 1DJGA 1KBKA 2WZPA 5HPOA 3WEAA 3EGXA 1H8HG 1QSFE 4D0CB 1GMGA 5KHHA 4ELKB 4JQIL 3GK8L 1S7VB 5C07E 2IBBA 1CU4L 1MCRA 3TYFA 1EIBA 3I6SA 3DUUB 5I1HL 3U9UA 3NDYE 2OCCB 5MHSD 4X42A 5AW9B 5DI8A 5CZVL 3CU7A 3OEEG 3ARQA 4TSFG 2WBJC 5AEAA 3T6QC 3W38A 4KHXH 4PP2A 3K6SA 2Q69A 1C5BL 1D3CA 4ODUB 3S37X 3D39B 1HKLL 1R5VB 1U95A 3D2UB 4JI8B 2Q86B 4JTAB 2N74A 1E4KA 3KCPA 1FXVA 3C9NA 5EOQH 4BKTC 3C5JB 4MZIA 1AYRA 1MI5E 2ZUSA 5BZWB 1R3JB 3OR7B 3ARGA 3VACA 2QWNB 4P59H 5D1QB 5PCYA 2DYRC 1I7ZB 2VDNB 1NMAH 1X7QA 1PZ3A 1Q94A 2UXBB 1NFIB 1JNLL 3HG1E 2D7PA 5I66B 1YY9C 3MRNA 5FA4A 2Z1PA 2X87A 3O41B 5ALCL 2J25A 3JT0A 1XREA 1JYVA 1P1ZA 4JPWH 2XV2A 4O51B 2C1OA 3ZKNC 1KTCA 4A2HA 2WWWA 2XPZA 3QIUB 4Q9BA 5IBTL 5F7WC 1JXGA 4TSCL 1MWAB 2ITDA 2MCAA 1Q1JL 4YSSA 5IVZA 1QOKA 2VLJD 1M3JA 3WGVB 1PY4A 4FYTA 1NEPA 4TOYL 2VDRH 1KC5H 3MRKA 4FNSA 5DD1L 1NCBL 1UCBL 2RR3A 4JFXA 4M9PA 3F7LA 3VFNA 5I16A 4NT6A 5JHDB 2DY2A 3RYHB 3ARRA 1QKZH 3AG2B 5TD4A 3ULVC 3OMNB 1AQ8A 1HL4A 1FAKT 2XZQL 1JZ3A 2Y5QA 4Q6IC 1MFVA 1GGCL 4D0BA 3CCJV 4PJ9B 1I9JH 3MCLH 1HEHC 4LLDB 4PLJD 5J1AB 3BH9B 3SDXB 3MRGB 5HJDA 4P2YA 1G9ML 5IW3A 3VXPB 1G7HB 5I9QC 3UYPB 1NUFA 4HS3B 4PJIE 3LPOA 4U7MA 5J1TC 1SF3A 1YN7B 1ZHBB 3QWNA 4OM1L 1ZV5A 4N90E 1PGRB 2ZSWB 4LOUD 2VLLA 3D25B 3JVGA 4JQXA 4Z3EA 4X6CA 3QIWD 1AI5A 4LF4B 1Y18B 5E5MB 1INDL 2P8LA 4X6DF 4I3SL 4O9HH 2VXVL 4WFGE 5E4OA 1ROWA 3P9MA 2XTSA 4KKAD 4M8RA 3BKJH 5DO2C 5TGBB 4C47A 3L4ZA 4G6KL 1BM7A 1EFQA 2W07A 4RZCA 4G82A 3BPNB 4NXSA 2FGZA 2FJGB 1IGFL 1UZ8B 5I0ZA 4HUMB 5ENWA 3VFMA 4BD4A 3K71A 4NB7A 2Q9LA 2VJ0A 4GRWE 4J6IA 1FN4A 4YXWG 4E9TA 4R9HA 2DIAA 2BIHA 5C0DB 5LXGH 5MENE 3QUZD 4XO3A 1FAIL 1RUQL 3SBWC 2DLEA 5D4IA 1UM5H 5EBMC 2ENSA 3FB8C 1T04B 4MA7L 3KL0A 3DVNA 3UBXA 2HH0H 3QEUA 1C5DB 4GFTB 4KKRA 1U6AL 1AO7B 5GTIZ 3D2UD 3EH4B 2EIJB 2PXYA 3JTSB 4NQUA 5CIPA 5FGRA 5EZYB 3FQXA 4ILDA 1P7QB 2DL9A 3AXIA 4I3GA 3C6LB 2NSXA 3FRPB 3A4FA 1RMFH 2WKOA 2CR0A 2WOBA 2W0FC 4N5ED 4PM1A 5H2BB 2HX8A 4N6RA 1QFPA 4PJCE 5BCAA 4F7MA 4UNVA 3EXJA 3CFTA 4XO5A 3MRQA 2FZ3A 4A55A 3LD8B 4WAFA 1OTUD 4PRHE 5KHJA 3P2TA 4MWFB 4AKPA 4GEJA 1KCUH 4JPVL 3SPJA 2WZ6A 3MGOA 3QIUD 1GAXA 3K74B 3TJEL 1AIFB 4AL8H 4ODVH 1IBMO 2X09A 3QNYB 1KYDA 3PG2A 1W8OA 3EYSH 5C93A 4L18A 1SXNA 3MLYL 4E0RA 3VD7A 2COQA 2YLKA 4YJZL 2GUOB 1QFWL 5C9JB 5JHDD 3F7KA 3FB7B 4UM9D 1CXIA 4KK5D 1E43A 2MIZA 1AGCB 3VGEA 2VDMH 3FONB 5IFAH 1UH2A 4GQPH 3SCMC 1IZ3A 2HTKD 1K7DA 2JWYA 3E8HA 5HFLA 1GGBL 5E6RB 4QXTB 4L8DB 4O4HB 4X64B 4JO1H 1IO4C 2HJFC 2F54A 4N2AA 1MCHA 2ZP0T 3FKUS 1LK3H 2E8ZA 2WUBH 1Y74A 3UIYA 3DOSA 4FA8A 4KNTA 3DTUB 3MBED 4LDOB 3HHSA 2CBPA 3KPPB 4A7QA 2Z6FA 4LOEA 1W72H 1SN5A 1YHQV 1QUNB 1P7HL 4P0DA 1UEYA 4DVBB 4IRZH 3H3KA 1I8KA 4X9BA 4U3FH 2D3VA 2FX8L 4JPQA 4P2QB 3ABUA 3EGDB 5I15L 1GGIH 4UDUA 5F7DB 4XMTA 5I1KH 4ISVB 1KJMA 3QYNA 1DSYA 1D2DA 4Z7NB 1Z9PA 3GT6A 4R97C 1G87A 5J7CC 1NOFA 4QR7A 1RSYA 1IVLA 2BJML 2KUTA 3N55A 4BEIA 3CZSA 5JQ6L 4GRLA 2XI9A 3ZU8A 2FUTA 1A7QL 3EBAA 1OSYA 2Q8AL 2H8PC 3SZKC 2BHFA 1XTMA 2Q7AA 4NVPA 1JE6A 2BERA 1EVTC 5FK9A 4PMFA 1GZHC 2OFQA 4QHUA 1BA9A 1UWFA 5GRWA 1OALA 2ATKA 5KSBE 1X7SA 2YIBD 4IJ3C 5F7FA 1OJHA 3OPUA 2H3KA 3EOTH 1JNJA 2CE6A 1CVRA 1V5JA 2B3RA 1IGJB 4ETQB 4HJJL 5IROC 3RTQA 1N0NA 3AREB 1WA2X 2QVKA 4G5ZL 4TPRH 3S98A 3D0VA 3FPXA 1NPUA 1AO7D 5F9WB 3KWTA 3GZQA 2EIZB 4HC1A 3QVNA 1C08A 1P7QD 4PTUA 1S46A 1KCSH 1A2YB 3HKZA 5K1VA 3VWJC 5KAIZ 3O45B 2PUSA 4FS0A 3SBQA 2GKIA 3CWGA 3VFWA 6PCYA 4XPGL 2IBGA 1TVBA 1JFQH 5EO1B 2O5ZL 1XR9B 2F9BT 2C9UA 4KNQA 1TPXB 4KVPA 2YQ3A 3H6JA 3GD1C 3P54A 5D7LB 1DEEA 1GGTA 3ZY7A 1CGSL 1EJOL 2AGJH 2HUEA 2XVLA 4IOSD 1G9HA 2WM0A 1KY7A 1S7WA 3PP3K 1ZHNA 1JZEA 2B14A 1U0QA 3AUWB 3CXHJ 3ZXAC 1EDYA 3BX7C 4UBDC 2GB2A 3GUTB 1Y0LB 1YMHB 2UZPA 4H1LB 4O2BA 4M6OL 2N05A 5I1GL 1T1XB 5IMKB 1SF5A 2HN7B 4Y16A 1QSFD 4ZQKB 3S0PA 3RFZB 2PP7A 4HKJB 1J0IA 3ZE0F 3G6JA 4OV5B 1EFXB 1WDAA 1JRHH 4GG8B 3S48A 3DC6A 4ONFH 2GHZA 3QQXA 2TSBA 4WW2F 5DUPL 3EFFB 2PCYA 4NQCA 4Q56A 3LN4A 5F88A 4MHHI 4I9WA 3SYCA 3I3EA 4RUEA 2EZ0D 3M7FB 4GAYA 4JM2A 5LP6B 1JJ2U 4IGBA 2G38A 2CCWA 3G7TA 1YDPA 3U36B 2XFGB 1GMEA 3C60B 3T1YB 1MI5D 4ZXBC 1M2VB 3H42H 5JLZB 4O58L 1OK0A 1LUWA 3MODL 5CFHA 2FH6A 4GX0A 1O5PA 1DJXA 1F0LA 1TENA 3CEIA 2XTLA 1JJUA 4LARH 2AEQL 1UOKA 2P80D 3AU1A 1MCPL 3WO3B 4Z78A 1BGXL 1Q8MA 5L3CA 2DN7A 4P2QD 3KH4A 5HDBB 1IM3A 3G6BA 2EDJA 1LP9E 5LBQA 2HP4A 4KJWD 4XNYL 2WBJA 3RIFF 3DIFA 4XN2A 4HIJA 3SYOA 4FFYH 4Q9RL 1PKOA 3FT9A 4NZTH 5B1JC 2CH8A 3DJRA 3NCMA 3D4YA 3JWNE 3KPRE 2XVGA 3PAVA 4UANA 1U8JB 1JV2B 2CO6B 2FJUB 3OKOA 3ZDYF 4X4ME 4FDWA 3FFCE 1IX2A 1KB9J 2XN9A 2VCOA 4JI2B 1I1YA 2JB5L 3NA9H 5M94B 4UOZA 1MDTA 5FDWB 3ZPDA 1B4JL 4C59B 3M7OA 1D5BA 5DR5L 3HR6A 5HHQA 3D0LA 4ERSL 3ARED 3BVVA 4L8BB 2VE6B 2MHAB 1FRGL 43C9B 3QDHA 2HMIC 1I9EA 2EDRA 4AK1A 4YX2L 4F8OA 5MP6L 2HT4D 4FTVA 1M4KA 4FFZA 4IT5A 5INDB 1F5WA 2CZNA 2XWDA 2EO9A 2Z1KA 4LVNC 4L1BA 2Y7LA 3RDTA 4LCWB 5BRPA 1ASPA 2ZD9A 2V5TA 4JGUA 1MUJB 2VLKA 1DCLA 3CXCU 4YHZL 3ZDXF 4Z1PA 4XMPL 1CXLA 4OR1A 1J0ZA 3RYCB 2W9DL 3PPEA 2GTQA 5D7LD 3IDGA 4FHBD 4FQXD 4G2AA 3KLHC 1SOQA 3ZTJG 4ZOBA 1F2QA 1PLBA 2MH4A 3GRWH 4WFGD 2AW2A 3MLPA 3CDZB 3HJEA 4B3SO 1NFDB 3KNBB 2JGDB 1SDYA 1KPUB 4R4BB 3SGDH 2P8PB 1J5EO 1XGUB 3T4YA 1ZAUA 4PFEA 4XBPB 2ZE8A 4J9ZB 1BZOA 3Q13A 4EKXA 1OF2A 1Q86W 3QQNA 4XCFH 1OF0A 3QBTB 2DQTH 3SPVB 3MOBL 4JFQB 4Q6GA 2XIIA 3VCLB 2YPLA 4X80L 1HH6A 4XGZA 5MEND 1VGEH 3M8AA 4Z0BL 2LFEA 4NO5A 4FLXA 5FV1L 2QE7G 3QR1A 4KGJA 3LZQA 4HZLA 5I6MA 2DQ6A 2ZX5A 1D2OA 2VISB 1EBOA 4LBEB 3ZSTA 2ICWJ 4EUPG 4LFBB 4YDMA 3FC8A 2YSUB 1D9KD 3L3GA 4OQ1A 1ZTEA 1KLGB 1XMQO 1D5XA 4PY8J 1QSZA 5TF1L 1BQKA 4EIGB 2VC2B 3QJTB 3QG5A 1D5NA 1K33A 3BUYB 2ODIA 2V5MA 1HIML 5CJ5A 1A4JB 4LAQL 4IHJB 2YD9A 3AB0B 1HOEA 2X3AA 3CRMA 4N21A 2QTVA 4DUVA 5ISZA 2JIXB 1D5ZA 1DQLH 1T7WA 2ITCA 2P67A 4R6ZA 5EBMA 5KYNA 1KKDA 2B2XH 1DGSA 4TQEH 5G55A 5IQNA 4G8FA 3SDDB 1UYWL 4TRPL 4U1KB 3IGAB 1H8EG 4A6YA 4A39A 1ZXQA 3CJHB 4GXVH 3UM7A 1YNTB 1MDAA 3OHXC 4UT9L 4OX9O 3RWDA 1S9WA 4F6RB 3HG4A 5DYOA 3UOAB 3WUWB 4U1NB 1YYMH 4ODXA 4CN6A 1LO0H 1E9PB 5K1NA 5H2FZ 2WXMA 5KVGL 3CMGA 1XEDA 3ASWA 4MA8L 4XCNB 2EX3A 2UUAB 2DMBA 3BISA 3P3RA 1UZ6E 5LBGA 2W0FA 4TSBL 4CKVX 2FL4A 4PY8I 3W9DB 2YUAA 4CBPA 2ED9A 3N44F 4XO9A 5D7HA 1ZOXA 3BUTA 2WB7A 1T22B 4Y4KA 2YC1A 1J12A 3TS8A 5EZOL 3IFLH 3DK2A 3FCSA 3TV3L 2PTTB 1A6VH 3QJHA 4ICGA 3QXAA 1IGIL 3O3EA 1F02I 2P06A 1J0KA 3OGCC 3UZVA 3L2LA 3J07A 4LL9A 4ZPVB 5ACZA 2Y72A 5HYIA 2Q0ZX 4OKDA 3VI3F 2X4OB 4BK4A 5LGJA 3CH1B 2APFA 3Q43A 3KPSE 4AE1A 3MRJB 4JFVA 2A7BA 4ZUUB 2Q3AA 3TZVC 2WY3B 2BSKA 1OHHG 1F4WH 2GTWA 3FO0H 3IDNA 3LZPA 4HHAA 4TVPD 4YBQD 4ZT1A 4JFEE 5FUZL 3SHSA 4X6FB 2YSSA 1A7BA 2OR7A 4LWSA 5H9CA 1GM8A 1OLLA 4MXWL 1LE5A 3OLEA 3CCLV 4FQQA 2JJSC 1LK2A 2QHRL 4Q6YA 4G1MA 1N6VA 3TC9A 1OAZL 3QDMA 4Y5XB 2WWOA 1COWG 4LLYA 4Y2LA 4AEHH 3VTAA 2CO7A 4X7SH 2AV1B 3FQ4A 3V0VA 4WO4B 1WJ3A 4DV4O 4MAUH 2FWOA 3WFDL 4IYIA 1CXHA 3CBJB 3CFDA 3FU0A 3FRUB 5A6IA 3L9RB 2Z7YA 5SWSB 3UCRA 1DLBA 2EBOA 1Q7YW 3L45A 1FL3A 2XAJA 1N33O 1HXKA 4OXSA 4CH3A 1SY6L 2WINA 5D71L 1R4XA 2FATH 4AE0A 4JV5O 1HQ4A 1B0GA 1X4YA 2EXTA 4ORZC 1NIDA 1Z9SA 1AZNA 2VXSH 3RILA 4GAAA 4OZHB 2BZ7A 3B8MA 2JKNA 1K97A 4GAJL 4IDLA 5I1LA 5IFHH 3MR9B 1NT2B 1UT2A 5I6NA 3EYFA 1SQBH 3GJEB 5D2NB 5DHMC 2VKWA 4ZNCD 2W94A 1CBJA 4JGMA 4YDNA 3D48R 1IKNC 4EOWH 3RYFB 3UCSC 5FFGA 1MCWM 3HC0B 4BZ2A 1T20A 3UZEC 3SDDD 4G8GE 2V7QG 1JZFA 2C5DC 1DF5A 1G6RA 2P8MA 3B5HA 4I3RL 5IROA 3WIIH 4OCYH 3H53A 1M1XA 3L7EA 5CNHA 4D2NA 3L1GA 2Z35A 3GSVB 4IOIB 5DK3A 1Z5YD 3K80A 4S11A 4F2MB 4P3DB 4X99A 5IVXF 3A2FA 3E6HA 1VZIA 4AX3A 2NW3B 5FYLL 3GGWB 4OGQB 4WWKD 2V17L 1N32O 2D0FA 1L9RA 1ADQA 1F1GA 2PCFB 3C5SA 3ES6B 3H9SA 3NN8A 2A77H 4KXDA 4PJ7B 4QHNA 4ZBJA 5FX3A 3CPLA 2EIMB 4QRAA 4HXAH 3PQYA 1TTCA 4PRPA 3IDJA 4DV5O 1FJGO 4NRXB 2WXPA 2WAQA 5L8LB 1AB3A 5DZVA 1S0VA 4UCFA 2HRHA 1YQ2A 1NAMH 2OK0H 4PJBE 4EN3B 2IWEA 3I75A 1J48A 3CH8A 4HIEB 2X9WA 5E8EB 5F9DC 4I50B 2NUPA 5T3ZH 4EBQH 5F1SA 4HIXH 5LHIA 3QUHA 2WTPA 2XX1A 1S7TA 2A9CA 2BVQA 3BP5A 5CILH 3TESA 3IXAA 3QZPA 1P6WA 3I84A 2A6JA 2R69A 3N40P 2C26A 2HH0L 3QZWB 2GTZA 1T1WA 3ZJAA 3T6WA 5FHBH 1QASA 3SY0A 4ZMTA 1M4UA 3HFMH 3HI5L 4IU2A 4M48H 1JF1A 5CA3A 1XMOO 3FFQA 4HUVA 1L0PA 2H2PD 4M5ZL 3D08A 3B7SA 4M02A 3UGEA 1WEJL 2Q3XA 1MFEL 2XA8L 3N42F 4LVHB 1JPXA 5AAPA 4Z5RA 2ILMA 1JZ5A 1W8EA 1EBPA 2CO2A 2VDPB 3S97C 2DQHL 4KVCL 2EDLA 1MFDL 2LABA 4UB0H 4WO4D 4TQFA 2HLDG 4ZXBA 3ULUL 3MROB 4IMLA 3MLUL 2GEEA 2R56L 1DQVA 2CM5A 1PD3A 3HKDB 5KZCB 3FFCD 4DP6X 3EO1A 2G9KA 4S1SL 5I5IA 3HKBA 4OVUA 4F7EB 4AENA 4DKDC 2BOBB 1BEXA 3L4TA 1OCCC 3U30C 3QH3B 2GYSA 4BDVA 4B3MB 3VDCA 4R4FL 2F43G 1HQRA 2CHDA 1J95A 3OZ9H 5J6HB 2LT9A 2OXHA 5B1JA 2Y24A 5TDOA 1UASA 4N0UE 1AHWC 2JDIG 2CJSA 3DJSA 3X2QC 4X98B 4ZOLA 1EEYA 3HC3H 3B3IB 2KT6A 4ZFGL 4J3WA 1L7IH 3BXNB 5FECB 4BQ8A 4YAQB 2VN6A 5D6CA 4RDQF 3OR6A 4XBEH 2PCPA 1LR1A 1Z3GH 1USQA 4U7KA 4Y2NA 1LMIA 1LK3L 1D6VH 1VESA 3X1EA 1SBBA 4ENEC 5F0LB 3NYKA 4NXMO 5EU6E 3U0PA 2HVJB 2LTQB 2Z31B 1NGWA 4WTWA 1FO0H 5D7IB 3IK2A 3VYPA 2OMZB 5FYLE 1JPGB 1KT2B 3QPXH 3ZO9A 1S2EA 1I85C 4C56A 5DXWA 3DVGA 1MNGA 1E9OB 1SHSA 2PWDA 1YEIL 3WJLC 4JI4B 2P26A 2E75B 5EULV 3WYRA 1TDQA 4O2EA 4YE4L 2Q8VA 1C1EL 1CYWA 4WK2B 2CPCA 1U8HA 2IDTA 3QP3A 4RGNB 1TG8A 1QR8A 2KMWA 4F3FA 5DEFA 4LL1A 2JQAA 4PREA 5L8KB 3F7VC 2O93L 3T2QA 1A4KB 1GPOH 4MS8D 3BAEH 5JHLH 1GXEA 2V4LA 1F90L 3T0VA 4FN0A 4LF3A 5EMYA 3B2VL 3SPHA 1BYNA 4G71B 2F58L 3BVNB 4YZWA 3U4KA 4LQFL 3BPOB 3U4EA 4PJFE 1NL0H 1V10A 4PHXA 3DURA 5FYKL 4UOW0 4NNXA 4GMTH 4MQXC 1QBMH 3TA4D 1IVTA 4KY1H 4YGVA 1QLEL 5EA0L 4JJ5A 2WC7A 5CEXB 1KJ2L 2R0ZL 3MLRH 3ULUE 4YVNA 3MV8A 3MZTA 5CMAA 4ZOCA 3KJ4B 5EPMA 5TE7L 1JYNA 4PVLA 2BWDA 4MD5B 2WB1A 2P5WD 2WWKT 3E0GA 1G0DA 3Q8CA 4L05A 2OAAA 4D94A 2XACC 5ERWB 3ESMA 1JXDA 2EAEA 1KGXA 4JMXA 2B1HH 2MPAL 5ESQA 4KTDH 5JIKA 1MREH 2NT1A 3LCYA 2YBRA 4X6EA 1ONQB 4PYHA 3QAZB 2VITA 3EOAA 3EDDA 4L2LA 1XSOA 5D5MF 3TN0B 2HLEB 3IAYA 4IIQB 4S0HA 2DYSB 3G6EV 2APXA 1X5GA 1KECA 3B1TA 1MFBH 3OKNB 2FQDA 4FMKA 5IEHA 1M05A 4JKKA 3OHXA 5CBGA 2GJZB 4AYFB 3TTSA 1JVKA 2WO3B 4DWHA 5BPPA 1XGYH 1YC8A 2IH3B 3EOBB 4OUUB 4DR3B 1JRHL 2B15A 5IHWA 1IAII 1ZVYA 3AG4B 2YPVH 4D6TH 3SDCD 1KBPA 3KPSD 4Z3TA 1GRWA 4LZKA 4UINL 2RDCA 4KKQA 1FD9A 1GYVA 3E9TA 2Z31D 3CHXA 5JHMA 1CFSB 1PZ2A 4MMYB 3ROLB 5L3FA 3S9DB 1F3RB 2B8OT 3OGCA 4QKTA 1ZTXE 3SKJH 1LGVA 3FTSA 3VTMA 1RV6X 5KN5A 5MEPA 1T1ZB 3PJSA 4NCDA 3HPJB 2CIIA 5DGRA 4P46B 3MUUA 4U1HB 1YCIA 2X41A 2ZE0A 3G5YB 1JN6B 4DN3L 1GJIA 1QFOA 2H4EA 1XB3A 2XXCB 3HHMA 2P7TA 5F9JA 1H3GA 3X3FL 1TTAA 2UUDH 4OT1L 3TZVA 2N59A 5KVEL 1U58B 3STZA 4FFYL 5FYKE 4WF9V 1T03L 3RJDA 1A4AA 2MK3A 3WU2Z 3VFTA 3B7RL 3DGCR 1AGEB 2A6IB 4G8EA 4AK2A 3D52A 4YDVB 4F58L 4XWGL 3QQ9D 5GGRA 4LL4A 5GS0D 2WVTA 4X66O 5IM7B 3TNNB 1U42A 2G75A 3HS0B 2B0SH 4LCUA 4NZRL 4RDBA 1CL7I 3JAWA 2HR3A 2EIKC 2UUCB 2ZCKH 1JI1A 1AR1B 4NNYB 4H25B 4XMKL 3LHPL 3NESA 4NKIL 2H26A 4AJYV 4NX0A 3K6IA 3QUKB 5ELIA 1A02N 1P7KA 4KO9A 4G8GD 2WPGA 4OLZL 4P4RB 3TBWA 4P2RB 3CCHA 4EZKA 4QRSA 2ZXDA 1T5XA 1MSWD 5EU3B 3EIFA 5C09B 3BVDB 2R1XA 5J2TA 3FT3B 3VBBA 2EP6A 1J5OL 3MV9E 4JFFA 3GNMH 1CDYA 2UZXB 3TIDA 1AGDA 4PD4F 4YPGA 5EZJB 3QCVH 4GY4A 4DR7B 4DOHE 5JVDA 1YJNV 3FQRA 4L3AA 2Q20A 5D1XE 3PDDA 1IKFL 1IKNA 5TFSL 2MPVA 5DFVD 1E4HA 1MLBA 4GXUN 3TN0D 4I2XA 3UZEA 1IGTB 3UG3A 3ETBF 1F11B 4DP2X 5I0YA 1US6A 3BT2L 5FM5O 3ETTA 4UZGA 1UATA 4P23C 1RU9H 3W2DL 1HHIA 2RHEA 1MJUH 1ZL8B 4PGBA 2BDNL 1XGRB 3CN2A 3SO3B 1AQKH 2GUZA 3IF1A 2C9XA 2GC7C 1BFSA 1JHLH 3WXVH 5GSVA 3WN5B 4B3EA 1HDMB 1S7SB 4JI3O 5I74C 4ZFQA 2CHWA 2ZIOA 2CLRA 4JB9H 5F93C 2QR0B 5EUOE 4Y9GA 4DGWC 2FHCA 3ML8A 4FG6D 4X9FA 1YEJH 3EJTA 4BE5A 3HBQA 3S3CB 1CFQB 1ZIBA 1FGNL 25C8H 3L3KB 4OF7A 2JCCB 5KBPA 4A66A 4GW5B 5DD0H 2J8OA 3RQ3A 1DN2A 1GGYA 5KVEE 4NO3B 4TTDD 3P0YH 2P49B 4YMPA 1IT9L 4KKCC 1ES0A 5BO0D 1DUYA 4QDGA 2DJUA 1AJQA 1DFBL 2XNAB 5HYJA 3B9KA 4JRYB 5HHXH 5GJTH 1LMKA 4RVBA 4H88L 1F6AA 3WIHA 5DMYA 4B53A 3K6DA 3J81N 3GSNH 1V3MA 5IW6B 1QEWA 4MVMA 4K8RL 3BHBB 4J23A 4MVQA 3OWEA 3QPQC 4TKWA 3DYMA 3O11B 2Z8WC 4OZFH 5EZPA 3DXAB 5F3HA 4U3SA 4ECNA 2QZ5A 4MRBA 1HWYA 1AZVA 5F3BB 3N04A 1CG9B 1DO5A 4M4RA 2E56A 3IFOB 4YXLH 4MXVE 4TNWK 1AR1D 1UXSA 2KZ1B 4QNPE 1CICC 4HUXB 1FE8L 1FXHA 1T5WA 3O4LE 2H6PB 1Y6KR 2R2BA 5JPNB 2OI9B 3DROA 4JI1O 2AXFB 3IJSA 2IQ9H 5G2NA 1FNEB 2C34A 2B9BA 1XL6A 3ULAB 1JOYA 1URZA 4EB6A 4HJ0D 1DQQB 2NZ1A 4HUUA 1E3XA 4HJEA 2N3JA 4GSRA 3WEMA 4P2RD 5C8JA 3BGFC 1X4XA 5D5PA 4JPIA 4LH7A 5EU6D 4BIUA 2ZCEA 1YJWV 3I9PA 2JK5A 3L5WA 5FCUL 5D2LF 4HFUL 5C0FA 1WSST 2DEYX 2A74C 1AHWA 1AJ7L 1G9NC 2Z91B 4MCZB 4IM8A 5TDPB 3CFEB 3FO0L 4A7GA 3BP4A 1D7DA 5D1ZD 2TRHA 4PJGA 4KK6C 1E28A 5CWSA 1LO4H 1O9WA 1N0JA 1KIQB 4HIHB 4HH9A 3ZX1A 2DQEH 1FF5A 3MLXH 3MJ7B 4XTRC 4XN9A 1FNHA 5MEOB 2CG9X 4KZCA 4ODSH 4P2OB 4PJEF 1BBDL 5KANG 3RE0A 3D33A 5CCGE 4N9GB 4X7SL 4TTGA 4PB0H 3ZE2B 1GRJA 1LLAA 1I85A 3R7RA 3B4SA 4WDIA 1KPRB 5DJ2B 5SWZA 4ANKA 2C9QA 3TA3B 1INEH 4GUPA 1QRNB 3WJLA 3SGKC 3VDAA 3GEWB 1Y4MA 1I8MA 3VJ6B 4N26A 2X6AA 3KEDA 2FWLB 4WU7A 4JYBA 2B5UA 3M8OH 2WCGA 3MHZA 2YLHA 2APWA 1K6QH 3TWCH 4MJ5B 1WAZA 3IDMA 1UKTA 2NUTA 3F7VA 3SQOL 2R2EA 2Z93B 3PNWA 5LHHA 2X4RB 4MAZA 2FSDA 1TYJA 3F01A 1ZA3A 4HCRA 3G5ZA 3PWLB 4M9OA 1MIEL 4ODWA 5FUOL 3TBSA 1FZJA 4AZ8A 1YECH 4E9VA 3MRIA 3ASOB 1CD1B 2FIRT 1SYVB 4HK0A 4LLMB 2BTQB 3I2CL 4Y0GA 1VLXA 5BR8O 3BUQA 1YEEL 3MV7A 4HX1B 4PR5A 4U1JA 3S3JA 5LAXB 1WZMA 3I9GL 4JRYD 2X6MA 3WIIL 2R2HA 3NQKA 2ZUXA 2A9DA 4JDZA 5BOPA 4I0XA 4RFNC 3Q44A 3WFVA 1H5BC 4NKQB 1MW3A 3DXRB 3OAAG 1H8NA 5GGQL 4RIRB 4AMXA 4G7VL 1RZQA 4LEXH 1MF2H 1HYSD 4G43B 4RBPK 3J8F7 5DJ0A 5I8EA 3L95A 3LEYH 5KVDL 3DXAD 3V4UL 4LCYB 2VQ1A 3EFOA 3SKOA 4DSYA 1S5JA 5B5EZ 1EO7A 3QA3B 1XO8A 5I71B 1FZKA 4DW2L 4YDJA 5IHUL 3OKEA 3AZUA 1AZZC 2V7NA 4C4KT 1TO5A 5CA0B 4LSQH 1P84F 2Q9OA 1F1AA 4FABH 2FO4B 2W81C 1BXAA 4UCRA 1WNSA 1ASQA 2IAMB 3HN3A 3QDGE 4NUGL 4D9QD 4YEFA 2GFBA 5BMVB 4RNRB 1SZXA 3RL2A 4JFYA 3TFKC 1QR1A 1ZRUA 3DETC 2D03L 3EGSB 3IN0A 3T1HO 3CVDA 1VQ9V 3ZQWA 1U3HD 3B8NA 1WBZA 2MWCA 3CCRV 3TV8A 3VXMB 2KL6A 3K9SA 5KBMA 1RZ7H 4P57B 2ZUUA 2JKJA 4NO0D 5E9NA 4P48A 3O8XB 1CGWA 3EVKA 3BP7B 5GISL 1BEYL 4LKXA 1PAZA 1WN7A 2EJRA 1G5GA 1PIGA 5C0BE 1I9IL 3ABLC 5IUCA 2CO4A 1BHBA 3AVEA 1JGIA 3H8NA 2DAVA 3V5HA 4KMLB 4L9LA 5E6IC 3QPKA 4HCIA 3ISRA 4U2ZA 4LVOB 4F8QA 4BJLA 3GHEH 3MC0A 2OSLA 2QWOB 4KPHL 2DJ4A 4NJ9L 1A4CA 2FJHB 4N8VG 3I85A 1U8PA 3GMMA 4M5YH 3QRGH 3RGVC 1LDSA 3VI3A 4JVPA 1OB0A 4FG4A 1ZGLP 4B3RO 1IARB 4UWQB 1QWUA 2QEXV 1M2OA 4BSWB 1ZWIB 3H9VA 2BSSA 2CDGA 2DYPB 3PAUA 4PWHA 2E74B 2HKOA 1BJ8A 5HGHB 1XAKA 4TMPA 2WANA 1KB5H 4ZW5A 2XPYA 1MVYA 3DHPA 1JGEA 5JW5B 3O0RL 5GSRA 4FQLL 4FLTA 1Y6NR 4QCIA 2IPTH 2BP8A 5BS0A 1VQMV 4DUYO 2BW4A 3KVDD 1HNXO 3QULA 3LYRA 1I8AA 4PA3A 4K9EC 1RZGA 4NQVB 5DO8A 1QQCA 3LQAH 3K06A 4Z3HA 3ZE1F 4LLQA 4MYPA 4GX1A 2C1PA 1RPUA 2K9UA 3MQIA 4EEQA 1TQUA 4Z2WA 1PNCA 1SLUA 5I1IH 4QTIL 4FJ6A 3DMMB 1HZLA 4GLRH 4NBZB 4EUPB 4IKIA 3P73B 2R23A 4XBEL 4ZI8A 4L2YA 1L0LH 1RULH 2AXGB 3MNZB 4U1GB 3UAEA 4XCCH 4LDEB 1FO0L 3BUIA 3OKLB 2C7FA 4BWUA 3FT0A 3S8FB 1IC5L 2WQSA 2LW7A 3MYJB 2UVFA 5LBSH 1KBGH 5HHOB 1Q72H 4PGEA 4H8WL 1INQA 4BELD 5T1DL 1IBLB 2D9QB 4YHOH 4UOW1 4AKOA 5L2KA 3CCMV 1DLHA 2VDKB 3KLQA 4MCYB 3VXUE 1AXSB 1TU2A 4LEOA 5LXTB 3HE7B 4I1PA 5F8QC 4JI5B 5AKSA 4EZJA 5F7AA 1H2NA 2BY0A 1NCTA 1TNMA 3QFJB 2IAMD 2OL3A 3I6KB 5JHLL 4GYCB 3CVIH 3CN4A 4LNRB 1PG7H 1RZFL 1PL3A 4OD1H 1Q81W 4I9QA 2HFEC 3CBRA 2XAGA 1TSHA 1UHVA 3ZQ9A 5KBNC 3AADB 1I5YA 4GSQA 1NMBL 1AI6A 3RPKA 3DV4B 3P30H 3QQ4A 4BA0A 2XV6B 2DTMH 2ZUYA 4XZUA 3N2KA 4H0LB 3OG4B 4D8PB 4LBAA 5DWUH 4HAGA 3GSRA 3IU4H 4UUJC 1R5WA 3HI6L 3QZOA 5EIBC 3X17A 4KI5E 3ECWA 4QO1A 4OCXH 1IKOP 4W6YB 4QJ5B 5IJVA 3FQ2A 4UNTA 2VDNH 4XVTH 2R8SH 3B43A 2W80C 2R4SH 2EADA 3J2PA 4TUYB 1U91A 4KTEH 2ZJSL 2E6JA 3CZJA 2G2RB 2B16A 1V3LA 2DOSA 2DYPD 4G5AA 4LSTH 4K0KB 1T0NB 2L6LA 4HJIA 3VD0A 1MWAH 3LXCA 5I19H 1OB1B 1JPFA 1J8HD 3SOBL 1YITV 5A3IC 3QZNA 3T0WA 3GSWB 3EYQC 1JR9A 2PETA 3KYOA 4WUKH 2ZM6B 4D9LH 2HKAA 3CGTA 2DM7A 4XAKD 4PBVC 3X3GH 5DUBA 3F85A 1S8DB 1EMTH 5CSZB 3G6DL 3KJ6L 4NTXA 3F64A 3LKQB 3ARYA 1L1FA 4J10A 5FB8B 1ZMYA 3GMLA 4MJIA 5A2QN 5IWLC 1RP8A 3C6SA 3WDIA 1SDDA 4IIZA 4WW1B 4WBNA 1A1OB 3BVWA 1NA8A 3C2AH 5FW8A 3RUGF 2AZUA 2CLVA 5KAQG 4GXFA 3DMMD 1J87A 5BO1L 1JYWA 1CR9L 3D6GA 2QVTA 3D69B 1NCDH 3DNKA 2D31B 2B5IC 3GKWL 3WY3A 3JV4A 4GQ9H 4GBXB 3BP6B 8FABB 2XAFA 3FAVA 1EO5A 4G9FB 4NZJA 3WO4C 3E8UH 3LIZL 2Y0SA 3ML9A 4QLWA 3SKJL 4Z3IA 3OW2U 2CCLA 5HHOD 2A83A 3QEQB 1LO3H 4KH2A 4KQ4H 2YARA 5JMOC 4Y19A 4AQYO 2F66C 1TEFA 4FZ8L 4I48A 4RRPM 3VWKA 2NY6C 5C71A 3AROA 5J9PB 1FG2B 1FV1A 5IMMB 2A74A 2X2JA 3CZFB 4I5BA 3ECQA 3HE7D 1KN4L 1VB9A 3BWUF 4LQ1A 3FQNA 1IFHL 3F7RA 3GSQA 4POUB 2IF7A 4F20A 4UCVA 1IBGH 1WFMA 5FGCB 1VKXB 1N34O 1PKQB 3MCKB 3BZEB 4M6NH 4PELA 4NOBA 3W37A 5EEZA 1NUGA 4YHIB 2MKWA 4LLVA 3T65A 1QLRA 3MJGX 3OD3A 2AZ0A 1CWVA 1FSKB 2AQNA 3STLC 3KBPA 5GGSA 2VM4A 1T0MA 2BIIA 3H7BA 2AZ2A 5F44A 4WLCA 2F54E 4M93C 5T1KD 2FJFB 1RJZB 3NIGE 1L9QA 1ZLZA 4Y1AA 5IHZB 2LR4A 1S9KC 3UGUA 3SGKA 1N59B 4X0KB 2DJVA 3PS6A 4XXCC 1BREA 1T6WA 5HHPB 4JVUA 4I77L 2X6UA 4PJXB 4I18C 3JWOH 3QQDA 4GSXA 4DO2A 2MCPH 4L9DA 5G5DB 3TYGL 1FL5A 1QNZH 2BOCB 2FLBT 2XN1A 5D96B 3GI9L 5CEYB 4YHYB 1E5ZA 4LFAB 1UWXH 3RIAK 3EYOB 4M7LH 4E41D 4XR8C 3FTGA 4FCHA 2CUIA 2BS9A 2NY4B 3PV6B 1Q9LA 1ZSDB 3GNML 5TE6L 3VFSA 5KVFL 2QADB 1PW3A 3S88L 1AP6A 1DZBA 3E89A 3IDXH 3CQFA 1BWMA 1DVTA 1ND0A 5FCSH 1U8MA 4YDIL 5FGBC 2XOTA 5K9QG 4OGAD 4ZUTA 1KELH 3BHPA 4LF4O 2L7JA 3DC5A 3KXFA 4E2LA 4Z7WA 4K7PL 4L5FL 5HJGA 3SDXF 5H4YA 4DO5A 4O2CB 4YFLF 3PE9A 1HE8A 4OSUL 3CJJA 2DKSA 1REIA 4PCSA 4G6MH 3WKML 2XYBA 4U6HB 3WE1A 1H5BA 1KXTB 4L4TA 3CDFA 1K5QA 1U97A 3WTYA 4OB5L 3QEGH 2ZR2A 1LQBC 1B6UA 3B2DC 3QCUH 1F7YA 1TJHL 2FT8A 5KOVC 5SX5K 4MD0B 1PEWA 2P5PA 1K2DA 4OGXH 5D5MA 1R3LC 3HKFA 2I26N 5JUEH 1A8ZA 3LNFA 3IAPA 2LGWA 2WBKA 1JTTA 5C0BD 3T4AC 2IMNA 1HINH 3NCWA 2P43B 2MFNA 2X44D 4CS4A 4R26H 3VD3A 2BRQA 3CDGA 1TZGH 4G9FD 4ZW3A 3TVMC 4YDZA 1QFWI 4CH5A 5DD0L 1HX0A 5GTHZ 2EXWD 3V5KA 5JIIA 4H8QA 3HUJB 3BGMB 3QEQD 4M56A 2RBLA 2XVBA 4K3GA 4XC3H 3IGLA 4ZYKA 3RVTD 2AJXL 1QQDA 5D72H 4ZD3H 3EUUA 1MSPA 3GMOA 3H1LH 3ULVL 3UAJC 2IJ0C 3GXPA 3BVOA 3HA0A 3GIVA 3QNXB 1OAJA 1ZEAL 3LSOA 4XO8A 3PGCA 1AP2B 3QUYB 4Z7UE 3ARSA 2I24N 4KRPC 3GSNL 3OB8A 1OE1A 2G5BB 4K23L 5BRZB 3EG9A 4RZKA 3BFQG 1AMYA 1AVMA 2QV4A 1FDLL 4LAJH 5E6IA 2ICWA 5ETUA 1KEMH 5J13B 4DQOH 1FFRA 1JWUA 4B9CA 2ZOTA 4JFSA 1NCGA 1X5IA 3G6JE 4FG0A 4XMWA 1VGKA 5DJXA 5F7EL 4PA4A 1K5NB 3RGVA 4MGXA 4HQQL 2XN2A 4NQDB 3VFOB 4ZX6A 4Y2DC 4YXLL 3F6LA 4NQCE 1B0RB 2E9IA 5L4IA 3UX9B 1FH2A 2B1AL 3ZN0A 1RUMH 1GS6X 1GZPB 3IYLW 1P5VB 4C55A 3A6CH 2X9ZA 5DJYB 3HKEA 3VG0H 3FSWA 3QG6A 4M1DH 1JZ4A 4NN5C 2XWBA 4R83A 1WAEA 1QA9A 3OF6A 4IBTA 4RMTA 3PGFL 1MVFA 4EO5A 1HK6A 3RJQB 3UEZA 1WBYB 1N5AA 1G0YR 2FWUA 1WBXB 3CXFA 4QOKA 1B6QA 2IH8A 2NY4D 3BPLB 5B1KA 5I1CL 2V8MA 4KNSA 2Q1EA 5BW7C 4LF5B 1IB5A 2MCMA 4BZ1L 5CINH 3J80N 3A5VA 5DHVB 3BZFA 5TQ2H 1LO4L 3B6SA 2N04A 1IM9D 3FHEA 5GRYA 3RAJH 5D7JB 3VXUD 4CMHB 4JO4L 1QO3A 1KFGA 1NC2A 1MQKH 4PJ0Z 1YY8B 3BIKA 4M03A 1CEZA 4AJWA 2AQTA 2XTJE 3HOGA 3MOAH 4H1LH 4A6YL 4O2AA 1I1AB 1KQSU 5DDHB 2QQNL 1YEGL 5FGSA 1E65A 1GM7A 4LPVA 2ZR3A 2Q7YA 3FCBA 3KM1A 4KXCA 2HG0A 4OJYA 5D93C 1V9PA 2XN9E 2MOQA 2J20A 5F7KC 4FADA 2WQRA 1L7TH 4OF3A 3KZIZ 3H9HA 4JFOB 4MS2A 4UB6Z 5AG2A 1N6UA 5EZIH 3CFKA 1UEMA 3REWB 3GB7A 3M1OA 3PF2A 4JFPA 1N10A 4DKFH 5I17A 5G4NA 2KSDA 3N41B 1UADC 3V10A 5KHIA 4GX5A 5FO9A 5J2UB 2ZWYA 4FTVE 4P9HC 3S3SA 4Z7NF 3DX6B 2QGNA 2PYFB 1N9PA 3UZQA 3ULVE 1A7NH 4UMSA 6PAZA 1FFQA 1IL1B 3ZHQA 2APTA 1BHAA 3VD2A 3GXFA 1OY3B 4XN4A 3V6BR 1SEQL 1S3JA 3AMLA 3Q5TA 4IHOB 3UC0L 3JAKB 1SXAA 4NZFA 2V1DA 1K8IA 3GM0A 1FYJA 4X62O 3HZVB 3RU8L 1M90W 2HTLD 2GJ6A 5E1HB 3EH3B 4G83A 4MX7B 4P04A 5BRZD 4ZNEA 4WO0A 2AJYH 4RAVB 2YGQA 5E4AA 3WHE0 3UJIH 1Z5LB 4NUJA 5LUMA 2K8MA 5B3SC 2YPLE 3NZ8A 4APXB 3WB0A 4MJJA 4E9RA 3TT3L 4IEFA 2ODHA 4I87A 4YC2C 1QLFB 4PLJC 3RFRA 4GP4B 3MLWL 2X10A 5CBFA 2KLTA 2V6HA 1P7GA 4LSQL 4TL4A 3UL4A 4F5CA 4IS6A 5T1MA 1ZTMA 3KPOB 4GRWB 5GGVL 4APQB 3RT3C 5CKGA 5MERB 2PXYD 1FNSH 2X6VA 1L0QA 1H6UA 3IJ4A 1OAYH 3SYPA 3ZMSA 1Q9WA 4JANB 35C8L 3OQRA 1YMMB 2BFVH 3GQFA 4GKNB 4A7TA 4RQEA 5KJRH 1BECA 1GAFH 1IC4L 1QR4A 1UD8A 2NCMA 3MXVH 4LOUC 5DGQA 5F96H 1ZLSL 3QJUB 5ISZE 5EBWB 2E7MA 1KEGL 3QIWC 2DQCH 3IM1A 4U6YB 5E4EC 1PSKH 5B7MA 4N3UA 1C5CH 4MNQB 4QRQA 4TVPH 4A7SA 4DV1B 1K72A 4UT6A 4AIOA 1RHHA 1JA8A 3H3PL 1DQJA 4FXLA 4Z76B 4CC6A 4KKAC 5FF6A 3NSYA 5CJOH 4Z9KB 3TBYA 3BPCA 5TE4H 2DIJA 3DI2B 1AC0A 4MB3A 1H2GA 1CDUA 3ECVA 2ZKOA 2OP4L 4WTXA 3APOA 3C75A 1F6LL 1NC4B 4ZMOA 2AJZA 2NYYD 3B7TA 1F3DH 1CIDA 4ORGA 4GT1A 5K93A 4DV3B 1A0QH 4GX2A 1G6RL 2QSCH 4FVMA 1RZKC 1I1AD 3OAUH 3PL6B 3QUZC 2DTSA 5D2LA 2PO6B 2BSTB 4U1IA 5LN4A 4OFKA 4E9WA 2Q10A 4YHMH 4ZS6D 1C12B 3WV0A 1A3LH 3U1PA 4W6WB 3BAWA 2VSMB 1TZIA 1URIA 2A0LD 2RAMA 5EBLC 2UVEA 4FG2A 4FX5A 1KB5L 2DW5A 5H37H 4K94C 1JXFA 3PPSA 1UVQB 5HDBF 1II4E 5INCA 5ITBH 3ESNA 3G80A 4WJG3 1JWMA 5DEGA 2IPTL 2ODMA 1R3JC 3V0GA 3GSOA 2X53A 4WFBV 4FQJL 4WFHE 4HBCH 4PUBH 2AQ1A 1N0LA 4N5EC 4AH2A 2DWTA 2F15A 3BSZA 1SQMA 2ERJB 5AUMB 1E5BA 2AW9A 3DPDA 1UWGH 3Q6FA 3SYQA 1FHGA 4FJYA 2E5LB 4LPCA 3WL9A 4GZRB 5J57B 4UCTA 1IBKO 1OTUC 3WJJC 32C2B 2AQ2A 3STLA 4XPHH 3W81A 3RURA 3ZZLA 1SBSH 3FN0L 1RJYB 4LHJB 2KB1A 4BWAA 1WC7B 1RULL 4U7SA 4OGZA 4BK5C 2R69L 4X8AA 3X14B 4ZUSA 2QJ1A 2NPLX 3QDME 5D9SA 5EOTA 4X20A 5LOVB 4GRLD 1IMHC 1GIGH 4XXCA 4ZMWA 1NCCH 1CD0A 1EUTA 4LK4A 4I18A 4KK5C 3AT9A 4AGLA 4QHMB 3LQZA 4RLDA 2D2CB 4W6XB 3AXLA 1HOCB 4YHOL 5CZXD 2HTKC 1NGXB 2OMWB 4GYBA 1GTOA 2BC4A 1ZT7A 4O4YH 2PNDA 5AG9A 3WKQA 1ZHLB 1A7PL 3FOLB 5F3FA 4GMSL 3W9EB 4G7RB 3I6LD 3T0EB 3DX2A 1S9YB 1E9QB 1HAUA 2YC0A 3JARB 3LKSA 3M1BA 3WSQL 4M6MH 4ABVA 1T2JA 4XZ4A 4K8XA 1TVDA 1KP2A 1MJ7L 2ZXBA 1OGSA 1RK0B 3JASA 2CNYA 2G4GA 3MBEC 3CN3A 2H2SD 5D6DC 3WNIA 1A6WH 3WU1A 1RM1C 1NFDF 1O6VA 1X9RA 1YMMD 3VA2C 4A04A 3VXSA 3GZOA 4N3TA 4N2KA 4ZPTA 3PHQB 2PP8A 2UXVA 1IQDA 5E2UH 4N85A 3P30L 4JI6B 3G3LA 4QHPA 5C0RH 2NXZD 4HPHA 1ACYL 1OP3H 2YK1L 5ITFA 1YEKH 1CURA 5EUKB 4JO2L 3APDA 5F71A 3D3VB 1FVEA 4OD2A 3REVA 3RWIA 2NW2A 4DN4L 3CVHL 3IXTB 4RWUA 3IU4L 4WI5A 1QFUH 3QXWA 1R3LA 3HZKA 2ZDIC 3ESUF 2L8AA 3I50L 3N1GC 1FVCB 2IWKA 1Y1UA 5I5RA 4R0LB 4RMBA 5D70H 3N0PB 4JZJB 1ACXA 3T4AA 2YZ1A 4D0DA 1B88A 5L9DL 3HB3D 3IMUA 3PL6D 1JGUL 3H85A 3QQ3A 5H94B 4Y16D 2I60L 5HTSA 3UG4A 5HFMA 2AGAA 3MUGA 1AD9A 2Q7NA 1H3PH 3FB5C 3PQYE 4WU5A 2UUAO 4ABQA 3F58H 3MKKA 4QXGL 3O6KL 5IYZB 3CUPB 4J3OG 3NABL 5LO7A 1I7RA 4ZMZA 1BGYH 4KOCA 3GM8A 3UAJA 1O7DC 4JM4L 4TV9B 3C90A 5TQ0L 1RAMA 3BVXA 4R8WH 2R29H 2BNQA 5SWQA 1XCQB 4R5TA 1YNTF 2VJ8A 3QB7C 5AAWA 4YXHH 3I56V 3FD9A 2X2HA 4XXDB 4OCRL 3F3HA 1NBYA 4MA3B 3MRHB 4N8UA 1WHPA 5KA6A 1OPGH 1MG2C 5E5UB 3OJDB 3C2AL 5LNEA 2OYLA 1EAQA 1U8QA 4YN3A 3CC4V 1FJ1B 3LNNA 4Y2DA 1BX2A 2PLTA 2IFFH 1Q8IA 3CZKA 1K73W 5KJ7E 1U3ZA 1MHHA 43CAA 3V0EA 1PJWA 4AIEA 3ZKSD 4B7KA 1FZOB 5IT2H 2BNUB 2A4EA 2CTRA 3W7WA 3CK0L 2FYUH 4JZ2A 3DPBA 4F15B 1THAA 3UO2A 1CXFA 1E67A 1MJ8L 2XTJD 5KMGA 1B2WH 5IB3A 5EU4B 4B7EA 4KK8D 4MSWB 4LNUB 5E95B 4X5XB 4DR4B 4PGCA 4G1EB 5TH2A 2FL5A 5BW7A 3ATAA 4AGPA 1TEGA 3LHAA 2WPDG 2XQYA 2WKLA 4FNPA 5K1PA 1WE5A 2H3OA 1XF5A 2EZ0C 3MFFB 1G84A 4XPTL 4XP1L 4M6NL 3VQWA 1HU8A 2A06H 1VF7A 2YD3A 3SGEI 3FAWA 2DEWX 2MKLC 4AVIA 5BXFA 5I6PA 3ZHKA 1RUPH 2X6BA 5TDNA 4MNGB 5HYQB 2R51A 4CNIB 2YN3A 1A8JH 3LDCA 1TVKA 4GT0A 2OTUB 3ABKC 2QSTA 3VXNA 4YO0A 3WTSA 5D8JL 1AQDB 4XMXA 2IM9A 1L0YA 1TYRA 2X4PB 5LCVA 1ETJA 3Q8BA 1URFA 4KJWC 5E1IA 2P45B 1V7MH 3ETEA 3D3VD 3U4BH 4BH7B 5JPMA 4HMDA 5E2TL 5IY5C 1BG9A 2OPCA 1IGMH 1CFNA 1V54B 1GOHA 3BA8A 5HYSA 4C56E 2A79B 3OT7A 2VDPH 2OJEA 1JMZA 2XJKA 1SMAA 1KMIZ 2VDQL 2A1WH 2KLSA 4OZHF 4MDRA 4XP5L 3K4AA 3LXUX 3HG5A 3Q8FA 2OMTA 2YQ2A 5A7EA 3AS0A 3ECBA 5C97A 1MZYA 3IDXL 2VQ4A 5DK2B 3GYRA 1TMQA 3H1ZA 3LRHA 1N4CA 3QCTL 4HAFA 1OM3L 3SKUD 3TEXA 1M57C 2JQMA 4ES9A 3AREC 1KELL 4FXGB 3CMOH 4YSPA 2V3EA 2WJ5A 5E79Z 4QGTA 2Y6TE 2X4QB 5T3XE 1LO2H 4JO5A 4HV8B 2HT4C 1YIJV 2BE3A 2VLJA 3U83A 2NY7H 2X7RB 4N8VB 5K9JL 2WLZA 2CKBA 5CLZA 2CO1A 2P1YA 4X6DE 2OMVA 5DS1A 3FMGH 5FB8A 1AGBB 5AD0B 3L16A 3O6LH 1OSZB 1TETL 1XCXA 4FXKA 1R3KA 3WY4A 3WFZA 1EXUB 3LEVL 1NAKH 5ISZD 4ZTOH 5DHDA 2YXVA 3AWFA 4FQXC 1W0WB 4BRVA 5FHAL 3UADA 2C9RA 3EFDH 3HHRB 3OAYK 2B59B 1HN1A 3MV8E 2YD5A 3IGFA 2GITA 3QWOB 3KMDA 4PJ7F 1HILA 1KCBA 4HD9A 2IADB 1Z9LA 1TZGL 3X12A 4DGYH 4X5WA 3WFCL 1BVLA 5HDOA 2ATPB 1CC3A 1BXXA 1JV5B 3DGGB 4ZTEA 3HC4L 2W6IG 3NCBB 3KS0J 5HDWA 3RUGA 3S36L 1TFPA 2FIKA 3QIWA 3VQ2C 5ESAB 1XV8A 1RFDL 4KHTH 2F61A 4YDKL 4EXPX 2PPFA 3VW3H 4FQIH 3S37H 1MAMH 4GRMB 1D9KC 4WSKA 2QFRA 2J3SA 1V55B 2CWRA 2I5YH 4F2ME 5IG7B 4KFMA 4XNAA 2RQEA 1E6OH 3L71H 1NKDA 2A9NL 1ZGLB 3NPSC 3EJJX 1EO8L 2EYSA 2I7OA 4ZMNA 4M3JA 4OQTH 1NFAA 2C9VA 3D4GA 4O2FA 4UQIM 2WLIB 1GKEA 4B3MO 1NLBL 1S7VA 2VO8A 2H1XA 4OM0L 5CBEB 3QUZA 3QNEA 3KL5A 1PLAA 2D7QA 4JEGB 3LZFL 3DUUA 4UQ2B 2QMKA 1QHOA 3MRPA 5GZND 3ZR6A 1PBYA 3LKRB 1D5AA 4K5OA 1R33A 1O6SB 1I8LC 1ZANL 2OX5B 3A67L 2UXTA 4JI0O 2WZ0A 5A1AA 4PRAA 4BCZA 1JD9A 1VF5C 1WCBB 3PIQA 5D7SL 1M6OB 4HGMA 1R5VA 3D2UA 3MX0B 1AI1H 2Q86A 1OP5K 5JDJA 2N56A 3PNRB 3I3DA 1RZIB 1TR7A 3LSSA 3GJFB 3N6YA 1R3JA 2DQUH 2CRMA 3ECUA 3M17B 3L4UA 5D1QA 1VCAA 1I7ZA 3ARDB 1NFIA 1PZSA 5I66A 3NBNA 4Y4HB 2VQEO 5I6OA 1QP1A 3O41A 2IBZY 3WY2A 2QLVB 3PDOB 4OZIB 1BZ7B 5TQ2L 4JI4O 3BWAB 4X1YB 5G4OA 1SVZA 4O51A 1G4RA 1AVAA 4LP5A 4OJAA 5HHMB 4HEPG 2RMNA 3QIUA 3K5SA 3RWJB 1D5MB 1NR1A 2UX6A 3U7YL 5IEHB 1MWAA 1TA8A 3QISA 1T5EA 3UTTB 4W4LA 3O4OB 4XOEA 5L3DA 1JZ8A 3WIHL 1CFMA 4KXAA 1DL7H 5D7IF 3F8UB 4B5ZA 5FLVA 3UBXG 2YXHA 5CJBA 3VVWA 4BFRA 5JHDA 4LCIH 3RYHA 2HRPL 4UM9A 3P4OA 4ZFOA 4XP6L 2H32H 2WLJA 4J11A 1GSMA 2FGWL 3E83A 4X7DC 3H0TB 4YBQC 4XBFA 2DWXA 2PPCA 4OUOA 3N85L 1N64L 3QS3A 3SDAB 3R8QA 2HWZH 4PJAB 2FB4H 4LLDA 5J1AA 3DV6B 3G6AA 1K4DC 3SDXA 3MRGA 3ZZQA 4EFEA 4AYID 3MKGA 3EYUH 2UYLB 1G7HA 3UYPA 4N2GA 4HS3A 3K2KA 3WHE1 4EI5B 5A7BA 4X7CC 1NJ9B 2JVUA 1ZK9A 4JFFE 3TBVB 1ZS8A 4L8SC 1DSWA 1YN7A 1ZHBA 2AXJA 5D6DA 4ZSOB 3PWJB 4PA9A 2ETNA 2ZONA 1N6QH 1U3NA 4G7QB 4W9EC 3FAXA 3T4ZA 2ZSWA 3ZTDC 3D25A 2H5UA 2X7LB 1CLZH 4HSQA 4QRUB 3OE7G 2EDBA 1WB8A 3L6FB 5DMIL 2VXUH 1XB8A 5B7FA 1ZPUA 5E5MA 4I2XE 3T1FA 1EZSA 5T5FH 3K2UL 2ZAHA 4JY5H 1YAIA 2O6PA 2BVYA 3HPLB 5TGBA 4MBRA 1VQPV 4LGRB 1A21A 4U1MA 1EAOA 5E9DB 3APQA 1JNHB 2AJYL 3SE8H 1RHFA 3EAKA 3LPWA 4NGHL 3UJIL 2FJGA 2ZDIA 3N1MC 5K9KA 4DRXB 4XB7A 4HSAC 3X13B 5EORH 5C0DA 1F4YL 1R34A 2FEDD 4OI9A 1XEQA 4WUUE 1MQ8A 2AITA 4PS4H 3ZTNL 5KUMA 4XVUD 3SDDC 4DR3O 4QT5B 3FB5A 1GYWA 1NMCB 4XN5A 3MJ8B 4X65B 3LKPB 1M1KW 1ILUA 1P1VA 4GLXA 1TZAA 4IU3B 1J9RA 1WIOA 1C5DA 3TPUB 1FNSL 2PTVA 4JO8A 5J3HD 2FB5A 1AO7A 3KBFA 3JTSA 5DTFB 3ZE0E 1GKFA 1M5IA 3KDPB 4YWGH 4CVUA 4ODHL 1UZGA 2YFNA 1I8IB 1P7QA 3MXVL 3A4EA 2XJLA 2H9GB 4FM2A 4OLVL 1KGYE 2QKIB 1PSKL 3G5WA 4WWKC 5H2BA 1J8SA 2ZPKL 5HYJE 3IGKA 2ESVB 3U1SH 4HCRL 1OZTG 4O5LH 1V05A 4Z8FH 4OFQA 4B0MM 2YQBA 4FI6A 3HTLX 1KCKA 3FCGA 1Q6IA 2IDUA 3ETGA 5HHMD 4NAQA 1SVCP 2NSQA 2NTFB 1AIFA 4DZ8A 3FKSG 1MHCB 1UJTA 5T1LB 3D8CA 5CN1A 1KTDB 1Z32X 5F7YC 1DVQA 3A0OA 5GS3A 1YF2A 2VDRB 2FD6H 3FT4B 1MRCL 4LSVH 3KGTA 3QEHB 3PJSK 3F5WB 3FB7A 4IRSB 5C9JA 1QSFA 5KTEL 3W0WB 4NAMA 4R7DB 5JWPA 4BA8A 2WZAA 2D7MA 2X1XR 4LXFA 4H8PA 1M9SA 5A9GA 3U10A 4J3XA 1NEZG 4QXTA 4O4HA 3DA0A 4JO3H 3EO9H 2H2PC 2AV7A 2YEVB 4MASA 2Q0AA 2N7SA 5L0QB 2LGNA 4IMKA 1F58H 1DDHB 2WWNA 2CJ3A 2K4WA 3AFLA 3KPPA 1WA0X 3JWNC 4WO4C 4ZFFB 2VMDA 1FPTH 4DKAA 1KIRA 2O5YL 4ZBMA 2WCPA 5LYJA 4DEPC 2YXYA 4BXSV 1QUNA 3MRMB 3PGDB 2J43A 2DWEB 5E1GA 4DVBA 2ZOKB 1NVPB 2P80A 1G8MA 4JHAL 3THML 4P2ZA 4R7CA 1IBMB 1XGPB 2HT2D 3EGDA 4P2QA 3S8GB 2X2IA 3JZ7A 2JKWA 3BAKA 3TL5A 1BM3L 4Q0XL 5IKCB 3O3BB 5E9DD 4E42B 3MJWA 1JWSB 1WUNT 4NHUA 5T3XD 5GRVL 3KLAB 3R4DA 5CSBA 2X05A 5L3EA 1ROPA 3ZDXE 3P3UA 3U11A 1ZJBA 4JHZA 4V1DB 1V3KA 3V52H 4PJ8C 1T21B 2F53B 2XBDA 3NVQA 5I73C 4JJHA 5E5RB 4G42B 4TT3G 5KBKA 3T3MB 3D51A 1BFVH 1C16B 1JCHA 4ETQA 2JJTC 2AQQA 1MFUA 1R19A 3AREA 3FQ1A 1KYOJ 4H33A 1RK1A 1XB6A 3MV8D 3FUIA 3UMNA 1WIUA 3MRLB 2VN7A 2ZYSA 3T2PA 5E4IA 2R2CA 4ETYA 2Y5TB 4G8IB 2VXQH 2VIRB 4P5KB 5AQ0A 1AFVH 4J1UA 1M7DB 2MQCA 3MV7E 3O45A 2ZYIA 4U6VH 3L3DB 4UQBA 2AEPL 4GS7B 4R96A 1JPSH 2DD8L 1XR9A 3B9AA 4L1HA 5EO1A 2EIMC 1DVFD 5HHVH 5D7LA 2ADGA 2IANB 3CRQA 4FQXA 5DRNB 3P40A 1AG0A 1TQBC 2ADYA 3OVUB 5DD6B 4MS8C 3Q8AA 4ZAKB 1RFYA 1S7RA 3T2MA 2VH5L 3GMRB 4YNYB 1QWHA 4G28B 5E51A 4DV6B 1FLRL 2LQTA 3ISYA 1FFOB 4NWTH 2BP0B 3DK0A 1KIUB 4PIRF 3FCUB 1EGJH 2R0WH 2QDOA 2ZWZA 4OIIH 1Y0LA 1BAWA 1YMHA 3LMJH 4H1LA 2CK0H 2JCCF 1PU0A 3F6IA 3JQOB 4HCGA 4IRSD 2HN7A 4XE5B 4FJCC 2C3VA 1ML0A 4UNUA 1BIIA 1H3PL 4ZQKA 4HKJA 4DO6A 1QU7A 4F2FA 3RFZA 4HYOA 1S76D 2J44A 4OV5A 4KZDL 2XZAH 5AL8A 4N0CD 2VDMB 3E8GA 5CB4B 3GSXB 4WSJA 1PJ9A 2XSKA 3NTCH 4E9XA 1CT8B 1U8LB 1HP8A 2FTAA 4DIXA 1XNRB 4DVRH 4K7PX 3L3HB 2WOYA 1ZLWK 5IVOA 1SS3A 1IGCH 1H3WM 3R06B 1DDTA 4PWIA 5JIPA 5LP6A 2BCMA 4XVJH 3ESOA 3WENA 1EHLH 2FK9A 4P5RA 3U36A 5LWYL 3HRZB 3EJRA 3MLTB 4Z95L 1NDGB 5B1AC 1M2VA 1OARH 2NY3B 4NQTA 3S2CA 4DF9A 5JLZA 5JHAA 1CGUA 3JTTA 2FX7L 3OAZK 3R4RA 1XR8B 1JF6A 4TXVB 3VYOA 4H8HA 4OZFG 4PJCA 3OLIA 4QAWA 1Y6XA 5IGXH 4MLSA 3RWEB 3LVEA 2HKHH 1XOUA 3O2WL 4GI6A 4X9GA 3U82B 3QI9D 3VX1A 1I8LA 3L9EA 2BOBC 5EFIB 4KK9D 3KHOA 4OLXH 4POYA 3S4SG 1OAXH 3VI3E 4DFHA 1SMOA 3JZYA 1XQ4A 1OGTB 2WXHA 2P22C 1RIUL 4MVZA 3AWGA 3TEUA 1JV2A 1XWVA 2CO6A 2IDCA 1N5YL 1PLGH 1IIKA 2XWTB 1RJLB 4M7KH 1F4XL 5B1CA 3SDCC 1FA4A 1O75A 2YA0A 2ZG2A 2WN2A 3OKYA 5HHNB 3X1BA 5FDWA 4AUUA 5MEQB 4ZW7A 5BS0E 4IGGA 3MOQA 2OQJB 3E3QE 2E6QA 3S35H 2HVJC 5IT9N 2Z31C 2MTPA 2F23A 1QLEB 1TJIL 2VE6A 1XIWB 3DTXB 2MHAA 5AZUA 43C9A 5FYJL 1KJ2B 2QKSA 1ET5A 2EILB 2EYTA 5A2BA 3HMXL 2J88H 5INDA 3UEQA 4HWNA 5EOCJ 5EDXA 4JFFD 2EE6A 3BUBA 5I76A 4Y7MA 4LCWA 2PWEA 3FS9A 3ZE2F 2CU9A 4FP8H 1IAIH 3QO1B 3G08B 1VQ8V 3AAZB 3RYCA 1ED3A 5EO9B 3IC9A 4UAOC 2IAND 1IBZA 2NY2B 4JLRB 5GRUH 3SE3C 1IGML 1Z0MA 2WXNA 1HT6A 4WWPA 2ZXWB 4ZAKD 3KNBA 1J5DA 3HIZA 3QQ9C 4R4BA 1KPUA 3VUAA 5GS0C 2DDQH 2P8PA 4MJHA 5DJDA 1IAOA 1L3NA 1SA0B 2A1WL 4O02L 4ZDHB 3RP1A 3NSJA 5T33L 5L2KE 3WEBA 1CD8A 4L0PB 1FNFA 4K3HA 3OTOB 1J0JA 2H0EA 3D3QA 2CHNA 3SPVA 3QWQB 1QBAA 4MYWB 5DRWB 3RVVD 4ALAC 4AQOA 3MLZL 4JFQA 1WQVT 3VCLA 4FNTA 1K3IA 4PMEA 1VERA 3MYZA 4HH8A 3W39B 1D5IH 5F1IB 3RBSA 4K55A 2DI8A 4WUUD 1WWAX 2NTSP 5IMOB 3HZ3A 3LH2L 2R9RB 1G9NL 4UV7H 2K6YA 3A22A 3VGDA 1F00I 5H37A 1OAQH 1OKEA 5IVXE 2XZCL 4TVSa 1YNLL 3D4CA 1KLGA 1U8NB 2VN3A 1IVSA 2C3XA 2HG5B 4YIOA 4K3JH 1N4XL 3CWBH 1LHZA 2NY5H 3O6LL 3BUYA 4OZ4B 4MVBD 4WEBH 2NY3D