2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
3TA4D 1EHKB 2H5UA 4YSEA 2GIMA 4GP8B 2ZONA 2J5WA 1UATA 3GYRA 4HHWA 1GR7A 2H47C 3U25A 3X2QB 2VN3A 2UXFA 3ABKB 1BXAA 4A67A 3HEIB 1KCBA 2XV0A 3CVDA 1WA1X 9PCYA 4HAKA 4E9SA 1ZPUA 1AZBA 2PP9A 3CZUB 3T6ZA 4NB7A 2PPEA 2Y69B 2VSMB 1AZUA 4L0PB 1ZIAA 2FNWA 4DP4X 3NJIA 2JKWA 3JT2A 1XMEB 3CG8A 5I5JA 2GI0A 5IY5B 4YSUA 3UGEA 1NIAA 3OMIB 3OQRA 5ANHA 2B08A 3H4HA 4F7KA 3ZX1A 4BK5C 1J9SA 1PZCA 2VSKB 1HFUA 1MZZA 1AS6A 3ZBMA 3UACA 3FYEB 3QQXA 1NIEA 2YAHA 2GSMB 1GY2A 2BP8B 3NP3A 3JTBA 3UABA 3OMNB 1AZRA 5F7AA 4BWWA 2P80A 2HLEB 3X1BA 4DP6X 2AVFA 1X9RA 2FQEA 4UAHA 3ASOB 5PCYA 2Q9OA 2BWDA 5B3SB 2FTAA 4BXVA 2HRGA 1FFTB 5FC9A 1AQ8A 1PCSA 1T5KA 2VMJA 1SHWA 2IDFA 3NSCA 2VW4A 4G7QB 4F2FA 2XYBA 2XUWA 1TEGA 3AG4B 3NJHA 1JZIA 1W8EA 2R7EA 3FU9A 2W8CA 3X1EA 1SHXA 1VLXA 1OCOB 3WNIA 2IAAC 1KDIA 1BQ5A 2Q5BA 2PPCA 2VW7A 1OE1A 2EIMB 1IUZA 1ZV2A 3WIAA 1TKWA 5F7BA 1DZ0A 4ZK8A 3NJNA 5I6OA 2EINB 2VW6A 3PAUA 1J5DA 2X87A 2GC7C 1N68A 2EILB 3UAEA 2YXVA 4Q89A 5AKRA 3FQYA 1PLBA 3NSYA 2CCWA 1AS7A 1KBVA 2GHZA 5B7EA 3PAZA 1WA0X 3AY2A 4BDVB 3NJFA 2DWSA 3S8FB 3PLYA 2PPFA 2YAQA 4E9QA 1SFDA 1E67A 1J9QA 2HZHA 3NYKA 1X9UA 1V55B 3NT0A 2J55A 1W6LA 3WKQA 2R7EB 1NWPA 4CSPA 1NZRA 4TXVB 2UXTA 1AZNA 3FPXA 1OOWA 2ZXWB 1ADWA 1PLAA 3AG2B 3NJLA 1QHQA 2FQFA 3EH4B 4GY4A 2DWTA 3EHBB 3AZUA 3WKPA 4A2HA 3V9EA 4BWTA 1WS7A 2FJSA 2YQBA 4A2GA 4YSTA 1AANA 4P5RA 1AIZA 4KNTA 2UX6A 4YSCA 2RACA 2QPEB 5B1AB 1HAUA 3IBOA 2HX7A 1PNDA 4EF3A 3DIVA 3FU7A 4DP9X 3OM3B 2IDSA 2IWEA 4DP8X 1GS8A 1SFHA 2HXAA 2CJ3A 3MBWB 3T6WA 5D4IA 4FA7B 3BQVA 1MG2C 1PMYA 2OV0A 3BVDB 3ERXA 4JHUA 4W9ZA 5B7FA 5PAZA 3WNJA 2HX8A 3IN2A 3V9CA 1JXDA 3S8GB 5EHFA 3N2JA 1GSKA 4E9YA 1OCRB 5I28A 3UADA 1ET5A 1MDAA 1SF3A 2I7SA 4UANA 1AAJA 5I6PA 1BYPA 3KW7A 4KOBA 4UF7C 4A2DA 5D4HA 2IWKA 1NWOA 4ENZA 4G72B 2YAOA 1OE2A 5I6MA 1V10A 3TBBA 1URIA 3AW5A 5B7MA 1PNCA 3FSVA 1CUOA 1GS7A 3SBPA 4HZ1A 6PAZA 4KO9A 1JZGA 5LDUA 4X4KA 3FPYA 4PAZA 1AOZA 4KO5A 3QJSB 4YSAA 1GY1A 1ZDQA 3KW8A 4KOCA 7PAZA 3PAVA 3X1FA 1I53A 1NDTA 2XV3A 1AG6A 4AKOA 1FWXA 3H4FA 1AZCA 1IBZA 4PCYA 3SBQA 1J5CA 3UAAA 4GP5B 1KV7A 3FSAA 2DY2A 3FS9A 1HAWA 4G70B 5B1JA 1JZJA 8PAZA 4FAAB 3S3CB 1PZBA 2LLNA 1GS6X 1QLEB 2EIJB 3FYIB 1BXVA 2HRHA 2DYSB 1R1CA 2YEVB 1BQKA 2AANA 2QDVA 1M57B 2W88A 4YVNA 2A3TA 4BDVA 1M56B 1L9QA 1NIDA 1IKOP 3T6VA 2XX0A 2CBPA 3AG3B 2BZ7A 2OJ1A 4N8UA 5I6NA 3HB3B 2NRDA 1NPNA 4N4YB 3FSWA 1CYWA 1IBYA 3RYMA 1AR1B 4AZUA 2IWFA 4YSRA 1BYOA 2I7OA 4P5SA 1SJMA 3PPSA 4HCIA 4RH4A 2GB2A 1A3ZA 1E30A 2AFNA 4YL4A 3CVBA 1OCCB 1F56A 2PCYA 3NSFA 2I85A 1AG0A 4AKQA 3EF4A 2WSDA 2AZAA 1J9TA 4NERA 2EIKB 1XB6A 3NJJA 1ASPA 1OF0A 3FU8A 2FQDA 4G7SB 1CYXA 4DPBX 2DV6A 4YSPA 2PPDA 4AI7A 2BP0B 1A4BA 4F2EA 1A4AA 3GDCA 1ZIBA 3AG1B 1NTDA 1L9SA 1ASOA 5B1BB 5AFAA 1NICA 3QJVB 4JKNA 5TK2A 4KO6A 3GXUB 2UXVA 2GC4C 4DP5X 1WA2X 2N0MA 1NPJA 1L9OA 4E9WA 1ID2A 2BHFA 4Q8BA 3OMAB 4CSZA 4M3HA 1JZFA 4DPCX 2X88A 2YAFA 2MTAA 5B1JC 1GW0A 1JVOA 4YSSA 1JXFA 2ZWNA 4DP0X 1MZYA 5I6KA 3NJGA 2BP0A 2FT6A 2PLTA 2IDTA 1A65A 1SDDB 1BAWA 1XB8A 3NJKA 1MG3C 2YAEA 4KNUA 5AZUA 2VM3A 3FQ1A 4E9TA 2IDQA 1CURA 4A66A 3PXLA 2CALA 3TU6A 1ET8A 2BO0A 4HCFA 1DYZA 3PCYA 1KCWA 4QKTA 2MRYA 2OCCB 3T9WA 3NSDA 1OE3A 3ZDWA 4AX3A 3L45A 3QPKA 5E9NA 3G5WA 1A8ZA 1M9WA 3EH3B 2BP8A 2CAKA 2J56A 3D12B 2QPDB 1SF5A 1W6WA 4A2FA 4G71B 2PCFA 3DKHA 2IDUA 4NAJA 1NIFA 2BW5A 2XXGA 3S3BB 2UXGA 2IH8A 2XLLA 3TASA 5I26A 1BQRA 2QT6A 1ZDSA 1A4CA 3FT0A 4G7RB 1E5ZA 3CVCA 4E9VA 1RZPA 3FSZA 2UX7A 1ASQA 3N55A 5B1KA 2BWIA 4GXFA 4WTQA 2XWZA 4DP2X 1QNIA 1JZHA 4BXSV 1BEXA 4M4RB 4HALA 3H56A 3ASNB 3IE9A 1PY0A 3CDZB 1AACA 4JHVA 4AKPA 2DYRB 1KGYE 2GBAA 4GYBA 3IEAA 1L9PA 2XVBA 1KDJA 2ZOOA 5TK4A 1L9TA 3FQ2A 3X1GA 4HIPA 1NINA 4A68A 2FWLB 2TSBA 3TBCA 5D4JA 3OD3A 2VM4A 2PPAA 1SDDA 3QJTB 3WI9A 3X1NA 2IH9A 2PP7A 4QLWA 1N70A 3WG7B 1ILUA 1WAEA 3QJUB 3CDZA 3ZIYA 1RZQA 2XU9A 1AS8A 3QJQB 2QDWA 3IN0A 3QJRB 4YVUA 1PZAA 3SQRA 1E5YA 1SNRA 2BW4A 2WO2B 1IC0A 3S3DB 4K9JA 3NP4A 1ETJA 7PCYA 2YAMA 2YAPA 4KO7A 2XXFA 2FT8A 4HHGA 4KNSA 2YARA 3MX0B 1PLCA 1KBWA 2B3IA 5I6LA 2TSAA 1B3IA 1WS8A 1EZLA 1PAZA 6PCYA 5A7EA 1FA4A 1JOIA 2E86A 1V54B 1PF3A 4GP4B 4YSDA 2JFCA 2YXWA 3NJMA 2P80D 5I5IA 2Y1AA 1JXGA 1TU2A 1ET7A 1E65A 2FQGA 2HX9A 4W1TA 4E9RA 2XV2A 1KYAA 4YSOA 4DPAX 1YLBB 3T71A 5I5MA 3C75A 1OV8A 2J57A 2FT7A 3ABGA 4DP1X 1RCYA 1ILSA 1BXUA 3FU7B 3DTUB 4A2EA 3ABLB 1NIBA 2BZCA 3T6XA 1JZEA 3SBRA 1OCZB 2JXMA 4DP7X 4BWUA 2XX1A 3EH5B 1JERA 4E9XA 1L9RA 2PP8A 2WO3B 2CUAA 1J9RA 1XB3A 2AZUA 1GYCA 4WKXA 1TEFA 2H3XC 1CC3A 4YSQA 4MFHA 1RKRA 3ABMB 4HCGA 1JVLA
chains in the Genus database with same CATH superfamily
3TA4D 4GRMB 4PV8B 4GP8B 3FHAA 2WGXA 4UM9D 3ZJAA 4BV1A 4F9PC 5J06A 5L88L 2QWRB 3NR7A 1DJHA 4PJ5A 2QHLA 1AHWC 3MRGA 4O02H 4MS2A 4MYWB 2HPTA 3MXWH 3D51A 3RZCA 3NESA 3ZE0F 1TZIB 2H3KA 2XAQA 4HDIB 1S5HC 1UD5A 4IOSD 4LEOB 3L2MA 3X2QB 3NTCH 1NFDE 4ZOEA 4YX2L 1JXJA 1VGEL 2X1XR 4BFFA 2Y7QB 5IV2A 3RHWK 1BHGA 4UT6L 5E94B 2LW7A 4UT9H 1Z5LB 1I82A 5IQ9B 1UM5H 1QSED 4D0CB 5DR5H 4XVJL 4R2GB 2RAMA 5AW3B 4L4VE 4EJ1C 4JY4B 3S3SA 2H32B 1D9KD 2C7UB 4DK5A 3D9AH 4EB6A 2WXKA 3CFKB 1GSMA 4Q6YA 4WI2A 3VYNA 4DP4X 3BGFC 4X6EB 4OCWL 4WTZA 3BZ5A 2FGZA 2JTDA 3BRGC 3COOA 3FUIA 4C57C 2W6IG 4EI0A 4MMXA 1LDPL 3B6SB 1UD8A 2ZOLB 3H4HA 4IK6A 1S9KC 3F7PC 1I1AB 3CHSA 2DQUH 3ZBMA 1VKXB 5KN5A 3ARFD 2YD5A 4ZZFA 5T1KB 1A9VA 2IH3A 3SN6N 4OZ4A 4QHUB 2NY2D 3SKOA 2ENJA 1AO7B 3UZVB 3VXTA 1RIUL 4JZ2A 4M43H 1N12A 4KKCC 5DUPL 2GY5A 4X98B 5MEOB 1ZA6B 1CVRA 5HGDA 1UVQB 1XTLA 3ARZA 1JZ7A 1MRCL 1YUHB 3N43B 3NFPB 2AZ2A 2JI3A 4J8RB 1RZFH 4ZOAA 1HEZA 2UUCB 1EPFA 4ZI7B 3UJJH 3HS9A 3FAVB 5DMGD 1AP6A 3HN3A 1J1PL 2VIRB 1G84A 1XGYH 2EKSB 4J6IA 1GIGL 3P73B 2ZX8A 4DAGL 5F93C 2XKUA 3ETBF 3NJHA 2PTTB 3TBSB 3HE7C 4F9LC 2ARJA 1UA3A 3O4OB 4JI4B 3HS0C 4EXPX 1QR1B 4LVEA 1KNOA 3EYOB 3PQYB 1PZ5B 4JREB 4TF4A 1ODAA 1OE1A 1TQUA 3FTUA 1DQQA 3WXWL 3DSNA 3APFA 3B77A 5F7BA 5HFLA 5DK2A 1DEDA 3NRFA 3PAUA 3QIWC 4ZO9A 3T1FB 4J9ZB 3DO3A 5A6MA 4JYAO 5D71L 4LDOB 3RWRD 5D7IE 2K8MA 1L6ZA 1WA0X 4MZ3A 4H1LB 3S8FB 3T8XB 4LCIH 1IO4C 2Y07L 2HVKB 2YAQA 5CCHE 3PQYA 1SFDA 4E9QA 4IQHA 4CVXB 4PJGB 1YEEL 4G8IA 1JWMA 1LEIB 2WYZA 5L7XH 4FQCH 2LU5A 1KP2A 2X6MA 2X41A 5INCA 1LO4L 3VXSB 5KSAC 4TNVK 2DQJH 3HKFA 1GGCL 3L3DB 3OHXA 4C56D 2FQFA 3EH4B 4K0KB 1OGAB 4WJ5B 5C6PB 3OJVC 1JGUH 4DYLA 1FGVL 2EO7A 4BWTA 3LKOB 4ZFOL 5CEZH 3CJHB 1TU2B 5E4EC 2ZOWA 5HGDB 4HIJB 3W0WD 3U9PH 1R6TA 4DO6A 3DV4B 5K9KB 1BFVL 3H1IH 1P84K 4OCLC 4XNYH 2P8LA 1Z6JT 5L3CA 1L9MA 3K03A 1K4DC 2DQIH 1UOWA 5GSRB 5C0FA 4QXVA 1UKTA 4O02A 5KYNA 3QULA 4UIMA 1AY1H 3ERXA 1TQVA 3GT6A 1CICA 4NCC1 3L4ZA 2VXSH 4ZIBA 3M1BB 1JXDA 2B5IC 1ZLWK 1M7DB 3W9EA 3PYCA 4UUJC 3EJPA 3G9VA 1SPDA 2F19L 3SGEI 1MCWW 2EYTA 1BGXL 2Y7MA 3K6FA 3PQYD 2VH5L 2EACA 3I50H 5IOKA 3CHRA 2C1PA 4F3FB 4GAYB 2PXYD 1UHVA 4JDZB 3RTLA 4ENZA 1L3NA 2OS7A 1B6DA 4V2CB 2LW1A 4KTEL 2BIOA 3DRQB 1URIA 4XTRC 5GS3A 1HW7A 1KEMH 1HR0O 2FATL 3P9MB 4P4RA 1QSZA 2Y69C 4PN6A 3FCUB 1KJ2B 5F89A 5KVGH 1XHXA 4UM9B 3HC3H 3KH3A 3W3BA 1F4XH 2XA8L 2XJLA 2Z35A 1S3JA 3MKGA 4A37A 5I1GH 2QM8A 1N0LA 3VI3E 5JXAL 2Q1EA 1NGXA 5C92A 3KW8A 4XN4A 4ES8A 1MFDH 2H6PA 5E6ZA 1VF7A 4KP4A 4DV2O 4XTRD 3WFDL 4EI6A 3WTTA 1PX4A 4PJAE 3FTGB 1T0OA 2NW3B 4LMQE 2LE9A 2CJUH 3FUEA 4P4KB 4JFPB 2WSSG 3BABA 2BSBA 3QQNA 5DD6A 2DM4A 3MTXA 5G5DA 3V4LA 2FUTA 5KBLA 1ZA3B 3ISYA 2YPKA 1VF6A 2FJFA 4GKNA 3QDAA 4K3JL 4MD0B 4OD1H 4Q6IA 8FABB 3RTQA 4GAGL 1AR1C 2V1DA 4LSSL 1N6UA 2Y1ZA 5ACMA 1UZ8B 1SBBA 2V4LA 4FXTA 2R4RL 3GMNB 4X1YB 3AFLA 2ZPKH 3AT9A 3DK2A 1N32O 4M48H 3MMEA 3OHXC 5CEZE 3SDDA 1CL7I 5EU3A 3QI9B 3CC5B 3OAAG 1NPNA 4G6FD 3ZVVA 4PWGA 3QCVL 2QR4A 1JVMA 3HE7B 5FCUH 4M7KL 4R4BA 1INEL 3UXFA 3ZZ1A 4R2GD 2V37A 4FP8L 2JKNA 1H19A 4ODSL 4Y5XB 1MJUL 2YPVL 3SDDB 3O81A 2DQTL 4M5YH 2X7RB 1B4RA 1PKXA 4G83A 2LFRA 4J3BA 4UCUA 3AU1B 3CVBA 2EEAA 3QRLA 4FNRA 4PJ9A 5DU7A 3T0XA 1C1EL 5CLWA 1EO5A 2LFEA 2OQJB 2RQEA 1HSBA 2WZ6A 3GMMB 2BSRB 2QZQA 1Q94A 3NH7L 4AG4H 2P5WE 1T3FA 4O2AA 1HH9B 1OF0A 2D0FA 2CO2A 4S0HA 3B4NA 5JR1L 3RKPA 3VWJA 4Y1SA 2LGWA 2E46A 5LMUB 2ATKA 1IC7L 3GXIA 1KB9F 1BBJB 5I5RA 3L5WA 2CIIA 3Q8AA 5GHWL 1IGCL 1K8DB 3C5JB 3E8VA 2X12A 1D7FA 4UB6Z 4KGLA 1R5IA 2X0LA 1UYWL 2ZE0A 5C07B 3ZKXB 4AW7A 3WENA 5DGRA 1QLRB 2OA9A 1SN0A 2LHAA 2N0MA 4BZYA 3IJHB 1IT9L 4E9WA 1ID2A 2JB5H 3AXHA 4M7LL 5DC4B 4LSTH 3C9NB 4X6FB 3UPRA 2ZNWA 2OMWB 1HXMB 3JT0A 3VNYA 2YAFA 1UQSB 3ALXA 4LLUA 4LOUD 1KB5B 1AGCA 2FLRT 4RX4D 2P3YA 5AALA 3TA3D 1G9NH 2FH6A 4LWSB 3UBXB 2D7TL 4X89A 1HESA 3L1OL 1Q90D 5E4EB 4H8HA 4NN5C 2F4VO 4MA1B 3ET9F 2YAEA 8CGTA 1OTTC 1OTSD 5LGKA 2I07A 4F27A 2IO5A 3QJXA 4R97B 5CCJA 1HNZO 1LK3H 2IDQA 2W5PA 2Z7UA 3LD8C 5JPMC 3QHFH 4ZPTA 4TNWK 3GXNA 4IIQA 3UP1A 2V5YA 4OM1H 1R9FA 2FBJL 1OPGH 4FFTA 1OB0A 3IF1B 3PWVA 3NZ8A 4UIMB 2JEXA 1MNGA 1JS4A 4JRXE 4IK7A 3FFDB 4XXWC 5DEGB 3NSDA 4JDEB 5F1KC 1FZJA 4X66O 2JKXA 1RVFH 4MA3A 2EZOA 1OP3H 2C9XA 2O5YH 3QO7A 1A8ZA 1JHKH 1M9WA 2ZF8A 2B4CL 2ZSVB 3EH3B 3RIKA 3V0EA 2VLKA 3FCSA 3P0VH 3FT2A 4OIAA 5J12C 4KK9C 4RFNC 4YGVB 3RKDC 2F54B 1A1MB 5ESAB 1MHEB 1P6AB 1AHMA 2VAAA 5LGJB 2FE0A 5FNVB 1XO8A 4HKZA 1I94O 1MSPA 2R9AA 5KVFH 1SQMA 4PRAA 5KTEL 1Z32X 3FF8A 3O9WB 4X42A 1RZPA 3MRDB 4WHYH 1W0YT 5FYKH 3REWA 3KLHD 3FB5A 3F5WC 5EC2C 1HWGB 5B1KA 3TZVD 3ESUF 2BWIA 3ARUA 4R9HA 5IMLA 1E4WH 4WTQA 2CHZA 2IAND 4OGZA 1VQ9V 2BINA 2NY1C 5AW7B 4NBYB 2XKNA 3K6SA 3IGFA 4TL4A 5FGBA 1FV1B 4HHAB 2AJZA 5L2JB 3BDYL 4AVIA 4LLYA 5DR5L 3CDZB 1WISA 2BNQD 2UUAO 3D30A 4TVPH 4M62H 4UQEA 5SWSD 3MX0A 1P49A 3CSGA 1KDJA 1KTJA 1MCQA 4ZUTA 4NC1C 1G6RH 4OKDA 1VQ6V 3LEXA 2OSLB 1T04A 1YMHB 3OD3A 3ZN0A 1E9PB 3PWUA 5CSZA 2VC2H 5FO2A 5IBTH 4B3VA 4RSVA 3ARGC 4Z78A 1NKGA 1TZHB 3VFOB 4YIOA 1SDDA 1P84F 1DBAL 2R69L 3CN3A 2AQTA 4M1CC 35C8L 1I85C 4S1RH 5FA4B 1JK9A 1ILUA 1F02I 4GG6E 3OWEA 3RGBA 4A63A 4B08A 4KVPA 4GMSL 1HHKA 3CRQA 4EFBA 1EZUA 1PBYA 4IT5A 4XBEH 3RVXC 2P6JA 3E2EA 2WO2B 2EECA 3GJFB 4D7BA 2A0LA 1MNNA 3PN1A 5EO0B 5C1MB 4WW1A 3ARWA 4KDTA 5GW7A 3KVPA 1VQ5V 3VWJD 4YHOH 4WCYL 5AG2A 5I30L 1TQWA 2ODMA 1F11A 1B4LA 4MW8A 1CK0L 1Z9OA 2ADIA 1TZIA 3PXHA 4WWKB 3RJOA 4WKZA 3LS5L 3MRHA 4JFFB 1N2RA 4KUCF 4FQXD 1THAA 5C07A 2VLRA 3APDA 3H6JA 4FNUA 1KN4L 4GPVA 5AVUB 4IW4C 1HSAB 1WEJL 1ADQA 3E35A 1DUZA 2IH3B 4ZD3H 2CIIB 3AWGA 1OSZB 2OMVB 3LNEA 4NIKB 2FJHA 1JXGA 3NEXA 2FWOB 1C8PA 5CF3A 1H8OA 4MVMA 3UJTH 4NWTH 3U2SB 3MZGB 4YDIH 1KTLA 5C0BD 3Q13A 3KL0A 3TEZA 3K2UH 3D3VD 3GWJA 1FFPB 1EAOA 1ORQC 3TBYB 4KPHH 2YFNA 4J23A 3ETQA 2W60B 4YHLH 2ESVD 5DJDA 4XX5A 3UTTD 4L4VA 2E27H 5LDSA 2MOQA 3GWOA 3UKMA 5L6YL 3MV9D 4E9XA 4LSRL 1LL1A 4ZUSB 3ZZLA 3NG5A 5JIHA 1H2KA 2EH7L 4LU5L 2MFNA 4FQJL 4R7LA 2OTPA 3Q5TA 5IB3A 2HH0L 4LFHG 2PGGA 2GBUA 5JOFA 1TTBA 3V6FA 3QDJD 4U0RB 4LF9B 4XPAH 1JVLA 5CKAA 2WAHA 1DVTA 2OW7A 2HG5A 1LO3H 4KHPB 1DSFH 2OZ4L 1AD9A 3D39E 3MFFA 3THMH 4FXLA 3S36L 2WO4A 1CLVA 4OJFL 1GR7A 1MRDH 5HJ3A 1NCAL 4I9XA 4N2CA 1LNQA 1U33A 3ARTA 3PFQA 3FULA 4ZUUB 1OSPL 1T03H 3EG9A 1FGVH 4B7KA 4B3EA 1U8LB 4P4KA 1ZPUA 1X7QA 1IBLO 2HTLD 3DPBB 1RJYA 3FQRA 5L4JA 2IFGA 3WNKA 2TAAA 4FLXA 1EAQA 1TQCC 3IKCB 4YLCA 2H6UA 4UINL 3JT2A 4XNYL 3L1EA 4TVPD 4MJ2A 3APQA 2D7NA 2CDEA 3C09C 1TVHA 1QAWA 3UDWA 2WLNA 3HC4H 2EUZA 3UBHA 2HR3A 4JHZA 1AY1L 2B08A 2CGYA 1AGDB 4KXZI 3LRGA 1SLVA 4M1CD 4PW3A 4JAMB 2EVJA 3FO0H 4KK5C 3RL2B 3N04A 1VA9A 1DVYA 4G8GE 5D1ZD 2UY6A 5DD5L 3VCLA 3W5MA 3VXPA 1KXQE 4MAYD 1S9VA 1UFUA 3E0GA 2HP8A 4PW9A 5J9PC 4P9HC 2XI9A 5FYLH 2ICWI 3OMNB 3EFFA 4ELKA 2HLEB 4DKEL 4NRXB 1A1NB 4UOJA 4YHKH 1QEXA 1YF2A 4NQXA 5B3SB 2R27A 4KJYA 4ODTH 5ANMA 3M1BA 4YHNB 1CP9A 4DR4B 5KVFE 3F58H 3WFBL 4AIXA 4LF7O 3SDXA 4CZZA 4QRUA 1XXFC 2F74A 4KKAD 1SOSA 2C1OB 3QR1A 4Y9BA 1IE4A 2HFTA 3QO1B 5E8EB 1W8EA 4UTBH 1UJ3A 4O2FA 4OIIL 1F51A 4P30A 1BJ1J 1NMAL 4KQ0A 5AOJA 4E5XG 4FFYA 3AXIA 4MTGA 2BIIA 1XX9C 1I1CA 3CH8A 3H3PH 2XCMC 3N0AA 4P2RD 1W72L 1A5FH 1WBYA 2NX5B 3WDIA 5HGGS 3NCWA 1OB1B 1KEGL 3PQYE 3G5ZA 1MMMA 4ZK8A 4ICWA 4QRTB 1JNNL 2Y5TB 3CVHH 2P8PB 1QFHA 2F68X 3L3DA 5JHDE 3ZRFC 3QIBA 5AKRA 2R4RH 4GW5B 4YJ2A 1DLFH 3WUWA 3K5NA 3U6RA 1WVZA 2VL5B 4JVUA 1MI5A 3BC9A 4WV1B 1XH2A 2NZ9C 1XIWC 4JQIA 3E7JA 4PG9B 2WD0A 3VVVA 4BDVB 1S78D 1K3EA 1R1BA 1IKNC 4GFTB 4YBQD 5MI0C 1EFXD 3QO8A 1BZEA 3D85B 4ODHL 1JMZA 4DGVL 5D5QA 3D3VA 3MJ7A 4FLVA 1ZMYA 4L1DA 4OGYL 4JFUA 4DOHB 3QUGA 3A67H 1IC4H 3PJSB 4AENB 3F3HA 4KMTH 1G9NC 1A7OH 3K5LA 2R2BA 4R0LC 1KD1W 1ADWA 1A3RL 1WJ3A 5INDB 5E1AC 3IDIA 3IWVA 4LSUL 2GUYA 5A6LA 4YHMH 3BPOC 4EZLA 1AANA 3QUMA 1L7TL 2GSIA 3BKYH 1WCBB 4Z7VE 4RO2A 4TSAL 1CJYA 1YN6B 5I1DB 3SGJC 3EBHA 5BRZB 5C71A 4PP2A 2QPEB 3IMBA 1E6JL 3GJFH 4JAVA 4NZUH 4TTDD 3BUPA 4HH8A 2KZKA 5B4MD 4JG5A 4PJCF 4QCIB 3EYSL 3GSRA 3KWUA 4BFKA 4N3TA 2V8MA 5GONA 1EEUA 3LH2L 3BRDA 1DVUA 4LPTA 2OAAA 4OFDA 4UCSA 2X44D 3VFRA 2MTPA 3U46B 2Q8BH 1ZY9A 1AXTL 2DB8A 3HUJA 3UAJA 1R3IH 4N0YL 5IKCA 1MCRA 4ZMZA 3KJ6H 3TCTA 4PG9A 2V5RA 5I8KH 1IJ9A 1BJMA 3MA9L 4ABVA 2HRPH 3CZKA 1UZGA 1SF3A 5CSGA 1UVQA 3FRUB 4UANA 2FYYA 1AAJA 2XWEA 5MEOA 3HHRB 4NYKA 1QWHA 4HU8A 4LCCA 3BJLA 2IWKA 3MR9A 2DWEC 1D2PA 4QRRA 4FLOA 4IS6A 1NGZA 3MLVH 3MLXL 4JY6A 4XXDB 5I6MA 1V10A 3TBBA 4UZGA 2RMNA 5LNGA 4AYFA 4UMGA 1RFYA 3DX0A 2DIEA 2F53D 1UACH 2Z8RA 5DDHA 5EUOE 3T0EB 4OM1L 4PJ5D 3QHZH 1RZ7H 4Z7VA 3US0A 1RSYA 3A22A 3O6KL 1KB5H 4QYOA 3ZUCA 2PXYB 1O6SB 3UX9B 4KOCA 2MKWA 1VQKV 2YEZB 4QNPE 1VQPV 1A1OB 4N1EA 1A4JB 3BCDA 4UTBL 2FYVA 5E00B 4CDHA 2F74B 1JJUA 2BP3A 5SX4H 4Y9EA 4KRNA 5AW5B 1CR9L 4KRLB 2ZXWC 4YK4C 4LLQA 5FAAA 1OP5K 1MAJA 2FEEI 3IXTA 4QTFA 2XXCB 1CGSH 5B1JA 3US9A 1JZJA 5FGBC 3L54A 3HUJF 3E8BA 3BP7A 3DETC 2X1QA 3GINA 4FAAB 5KG9B 1ZLSL 3JQOB 5GRVK 2WOYA 3B8SA 4N2FA 4X65O 1TVKB 3N9GL 3OTOB 3O65A 5CIPA 1OZTG 1S9VB 2XAJA 1AE6L 4PJAB 3KLLA 2CIKB 4WSGA 3SY0B 4ZAKA 2NRDA 4XOEA 3VE0B 2HVJA 2R23B 4V1DD 3UG3A 1MCKA 5LGUA 4QXTA 4XB3A 5T3XH 3VI3B 2YOCA 5I18H 1EHLH 1L0QA 3CYOA 2VQFB 3CFQA 1VQNV 4YSRA 4BAYA 2I7OA 4YZFF 1HNYA 3HMXA 1OTUD 4KXZH 5GIRA 3S88L 2UWEA 5EBLB 1WB8A 2QQKL 3BIBX 3FCTB 2I5YH 3KXFB 4M62L 4Q6IC 3LKNA 3MV7B 1P4BH 3QZMA 3RY6C 1XVSA 1A3RH 1AG0A 3QWOB 3DVIA 4RDBA 1J9TA 2VMEA 4FG6C 1YZBA 3NJJA 3K8MA 4NN7C 3RDTB 2BCMA 4K7PL 4N87A 3S7GA 4X5RA 2AJYH 4KX7A 3X3GH 2DV6A 5A2QN 4L4VD 3ILQD 4WV1C 3GSQA 3P2TA 4XNXH 3L8QA 3OGIB 1XV8A 5DMIH 2IADA 2X6BA 4Z0XA 1U2YA 1BG9A 2A2QT 2YUVA 4YWGH 3OKYA 1KJ3L 4NPYA 3S35L 2JMRA 2X4TA 1I3GL 1SKVA 5FO8A 2UXVA 1KCRL 1V7ML 5DSCB 1JN6A 4G2KA 3AG1C 5CA1A 3WFCH 4NJ9L 2P52A 5JOFB 5I9QB 2JVUA 2VO8A 1JL8A 4AK2A 2H7WA 4TQHA 4CC1A 5K9QI 3NCCB 1DSYA 4YXHH 1D5NA 1CDGA 3PJLA 4GX1A 1QRND 5EBGA 5B1JC 4IBSA 1HN1A 4KH9A 3MA9H 2YRBA 3DO7A 1M2VA 3GGWB 4NNYA 3OKOA 5ITBH 1F4WH 1U3HD 1CXFA 1I3RA 2F6AA 3V7AE 1O9WA 2E74C 3QNZA 3ABMC 5I0YA 4MD4A 3T2LA 3ZSTA 4OSUL 1M7UA 2Q7YA 3ULVE 5LMNO 1QR4A 2B4CC 3ROLB 1T7YA 3UIYA 1MG3C 3O6FA 4FADA 4ZJ9A 1R3HA 2WVTA 1JAEA 2K9UA 1MSDA 2IWGA 4J4PA 1KP3A 1FG2A 2JJSC 4MDIB 3U10A 1IBLB 5L8LB 4K8RH 2CK0L 4HJEA 4M5ZH 1UACL 2OMVA 3BHBA 1VFMA 4FXKC 4S1QL 4PJGE 5D4QA 4F7EB 5T3ZD 1OP5H 4PJCA 3OXRA 2NTFA 3OLIA 1IFHH 1UT9A 3HBPA 4O2EB 3S9DB 2VWEE 3CE2A 5F0MB 1XOUA 2QKSA 1ICTA 3E6HA 4MA8L 1XNRB 4MTOA 4CSSA 4LCCC 3PL6D 4NUGL 5HPMB 3WGVB 3RYHB 2ENQA 1MOEA 5LQBL 3ARFB 4PP1D 2ZCKL 4A2FA 4HIEA 1NC4D 3D33A 3NZHH 4JI3B 2BRRL 3L08A 5K33A 2XWJB 5IY5C 2NY3C 4M5TA 2ROXA 3CPWU 3S5LB 4LESA 1ZHLB 3ZUNC 1ZLSH 4D9RD 1W59A 4FD0A 5T1DH 4Q9CA 5LNDA 1A6VH 4RNRB 4MA7L 4X9BA 4E9VA 1YI2V 2Z92B 2OMYA 3JAWA 4Z7QB 4Q0XH 2XWJA 3RZWA 1IKFL 2PCPB 2W9DL 3P4MB 1H8EG 1AXIB 5DGQA 3BI9X 2DJVA 3SOBL 3QXTA 3VB8A 4PRHE 3VFOA 1JZHA 2F1EA 2RTTA 4FHBD 4P46D 1S7TA 5K93A 3SGJA 3JWDL 3UO1H 5E79Z 5FL7G 3L3OA 1ORSB 4JR9H 5D55A 4QJ4B 3LEXB 7TAAA 1PD3A 4XCYA 4YXKH 4YDLB 3ZE2F 4Y7MA 5LBGA 3LEYL 1RULL 3QQDB 2YEVA 3AEIA 5CA0B 2DD8L 2EDJA 4FL4B 4PI2A 4JKPH 4XNDA 2QQKH 2XQBL 4LF9O 2Q3AA 4C56E 5TK4A 3UTSD 4BZ2L 4I1NB 3WLWC 3RWJB 3SJVB 3EW3B 3B7YA 1NFDF 4JHAH 2JIXB 3OKMB 4TUYA 4CC6A 4YDMA 3SDXE 3WTWA 5CP7B 1BA9A 3D3VB 1H2MA 3MJ7B 1MUJB 3HC4L 1S76D 5HHOA 3S37H 1VFBB 1Q6HA 1KIUB 2J43A 5HD8C 2VDOL 2AJYL 5IF0B 3QJTB 5L3DA 3FO0L 3FTZA 5C09D 1MCWM 1HQ4B 5KS9A 3ZRXA 3OJDB 3VAEA 5J9PB 5KSAD 4RGOH 1UA6L 4TUYB 1CGYA 4YJ2B 4YY3B 2Y6SC 2ZX6A 3UP6A 1RZQA 4J2XA 2AXFB 4RBPK 1H0DB 1OWWA 3QIUB 2A9MH 3QJRB 3VFTB 2VLRE 5EN3A 4AVHA 4YEFA 2J8UE 3H55A 4C7UA 2DJUA 4O51B 3AAZA 1LO5A 1P4LB 2ZXEB 3FB7B 2J6WA 2V3FA 4XCEB 4X8XA 2ZUWA 3VD2A 3FT2B 4GFXA 5JQ6L 1M56C 3UERA 4ODTL 1NR7A 1UOKA 1UKQA 4N0CC 4IIZA 2PTUA 3IMWA 3BD4A 3GIZL 4TVPE 3MRQB 4Z0XB 4DEPC 5EU4B 3UC0H 4DEUA 2YOAA 3IDYC 4OGAC 2OJZH 1K85A 3VXMD 3ULUE 5C0CD 2YI8A 1E9OB 2OT5A 4NXSA 4DV1B 4KITB 3MJ8B 1K4DB 2PR4H 4A6YB 3F6JA 1MWOA 4XN5A 1YEKH 4F8NA 4MAUL 4AK1A 4B3SB 1HT6A 1KYAA 3CTTA 1IAOB 2WXLA 4AQ8A 1OV8A 3K3WA 1CLZH 4FQ1L 4JI0B 3FU7B 1BBDH 4L29B 1WIPA 1ZK5A 5AQ0A 1TFPA 5HPMA 4QGTA 4ZXBC 5T5FL 3V4VA 4G82A 4OB5H 3GMQA 4ILDA 1CS6A 2XX1A 1QI4A 2X2IA 3UAJC 4U0RC 4RUFA 2R23A 5I15H 4TUOA 2ZAHA 4XVOA 2AZUA 1I1RA 1YMMB 3ASOC 1IGML 4WK0B 4Y2DD 3U1SH 1A21A 3JWOC 3RIFF 2EEBA 3EVKA 4FNSA 1EJOL 3IS1X 1OCZC 4J1UA 1EHKB 1YQVH 2XFXA 5E5MA 2UWEE 2V4DA 5GHWH 5IYZB 5D6CA 4E2LA 2KZWA 2NX5D 4G9FE 3T65A 3HZYB 5FKAA 3M8AA 1UATA 5EZOL 3PP4H 1SXCA 4P2RE 4JEGB 1RUQH 4X80H 5DHYB 4OZFA 1A7OL 1DDTA 3ILDA 2P22C 5F3FA 5JW4N 2DQ0A 3PWLB 4OD2A 4K8XA 4HZAA 2E76B 5JA9A 3B2DC 1PD6A 3WEXB 4X4YA 1JSYA 3D18A 4UT9A 3TCLB 3CFEB 3KVDD 2DI9A 2NTSP 1NEZB 1O0VA 2FIKA 3ASWA 4QOKA 3UO8B 2EJ7A 5D2NE 3RLSA 1G1OA 2A6KB 3EO9L 4X5QA 3ROOA 4O2BB 1DBKH 4DN4H 1T1WB 3RGVC 4A38A 1EQWA 1JGEA 1M42A 4ANVA 5ANHA 5JW5A 4UV8A 1J9SA 4ADJA 4ZFZA 4UUJB 1YN7B 4KI5F 2OSXA 4JKMA 1WZLA 3B7SA 1A3LH 3FYEB 1HC1A 1LYQA 2IBBA 5ECJE 1F0LA 2B16A 4WF7A 1TTFA 5KYUA 3CH1A 3I6SA 2VXVL 4PG2A 1O5PA 1KTBA 5FHAL 5AKSA 2CO6B 5HYFA 3C8KA 3JTBA 5BV7B 3G4SV 3RTQB 2EDRA 3MRRA 5EBMB 3U46A 1P4IH 2B2XH 2NPLX 4MKMA 5AL0A 3BVTA 5K1NA 1MRFH 4JO8A 1PX8A 3BXNB 1KJVA 3O0RH 5JQ6H 3T2NL 3CGTA 3PGFH 4PBWD 5HDWA 1F00I 4ZX3A 2VMJA 1YAZA 2ZCLH 5EU6B 4PCSA 1S78C 2N59A 3OKKB 1TZGH 4HYOA 2YK1L 3O8XB 4JY5L 5HGAA 4FQCL 5C08A 2LR4A 2AJXL 1T5XB 1G9MH 4MBRA 4F7CA 4IDJH 4XDKA 4OZHB 2W8CA 3DSQA 1AKJB 2ODHA 3VQVA 1F2QA 5E9DE 3QUMB 4LP4A 1RURH 3CCQV 1P5UB 3T0VA 3MCKB 1R47A 4MQXC 1NC2A 2R56L 5GRJL 2LQTA 4MMZB 5FO9B 1E1QG 2OK0H 4KDTC 3VRJA 1DZ0A 4NTYA 1JZ5A 5KVEH 3IXTB 1K6QL 3UT5A 4XE0A 4Y5YC 3QUZC 2AI0H 5TDOA 5I2IA 4OZHE 5E9DB 3LKRA 1K34A 2JEUA 2IPTL 2DLGA 4L18A 4GRWB 4U3FH 1NH6A 3T6QC 5CBEB 5K9OA 1K5NB 3IFOB 5AB2A 4RQQA 2BXYA 2CH7A 2RQ6A 2R39A 4QYOB 2WNKA 3TV3H 1HQRB 3OKLA 3QZOA 2O1AA 3UDWC 3MJWA 2HJLA 4W6WB 4PDRA 1CLCA 4H2AA 3QIBB 4LRNH 3PRZA 1U8CB 1D5XB 3ATFA 1OEZW 2DWYA 4N1HB 2R7EB 6TAAA 1INQB 3PUCA 2QFRA 5BJTA 3ETEA 3O0LA 1DJZA 3VXNB 1FXVA 5CLXA 2WLKA 1EUTA 1PQZB 5F71A 4OLWL 5AWNL 1I7ZB 3FTVA 5J2TB 4K4KA 5GSVA 4YIQA 3FT4B 4PA7A 3E9UA 1CLOL 3DBSA 4NNXA 4YSTA 3TWCL 4BK5A 4GKOA 5LAXB 1BMZA 1QVFU 1FL3B 1WFJA 1DE4B 2ZX5A 5D7JA 5DZPA 5ADPL 1NVPD 4B27A 1WBZB 2ZINA 5F6IC 5J8OA 3LH8A 2UX6A 2ZE8A 1J0ZA 2OTUA 3MGAA 4BFJA 4X5XB 4YSCA 5KYYA 3ULVF 1HAUA 4KMLB 5EEWA 3BH9A 2HG5C 3BYTA 2UUBB 3C5ZC 3LDEA 2ROYA 3C6EA 4QAWA 2JRIA 2FGWL 5DJ2B 5EEXA 5D2NB 3C6LB 3B9KC 2E9WA 4HIIA 1GS8A 1SFHA 2W0FB 3W7TA 3HZ3A 2Z8SA 3K80A 3BVDB 1A1NA 2F54A 1UZ6E 4HEME 3GWKC 3V2AR 4MCMA 3TPUB 2XT9A 4Y5VC 4PRNB 2LGNA 3S8GB 1G4RA 5KYYB 4XMPH 3MQIA 5EUOA 3X3FH 4L5FL 3VM5A 2UXBB 3RWFB 1QNZH 4ENED 2H0EA 4H8WH 1ORQA 4GRWF 4L3ED 3F84A 4OLUH 5HYQA 3T1FA 3GI9L 1TEYA 3KBEA 2EE2A 3LTVA 4LVOC 2O5XL 1T80A 2JGDA 4G72B 4P9HL 5DK2B 3IF1A 3PWVB 4AUJA 4DFIA 1PL3A 3T0AA 2DMBA 4ORGA 5DFVC 2EVGA 1P4RA 5SWZD 2Z8WC 3RWIB 3S96B 5SWSB 5FCUL 1SQGA 1QLFB 4K8RL 5LYJB 3CCLV 3FO9B 4ZS6C 4Q9RH 3VSVA 3KR3L 1BZDA 3U36B 4IOIB 1ETA1 1J8HD 4KXDA 1K3ZA 1XEUA 5JOPD 3UBXI 1YIJV 3HG1A 3ELQA 3BVWA 3QRBA 1CTMA 1HDJA 5FYKE 1Y18B 4PRPA 3WFHA 4Y16D 2X9YA 3TT3L 4BH8B 2G3MA 1J5CA 1MJJB 2CK2A 2D31A 1XGRA 4M56A 4PJBB 2AEPL 5C0EA 3OR7A 1VIBA 3C87A 4P4KD 5I19H 1HXMA 5KAIZ 2JQMA 4OJEH 5C0BE 4LCUC 3UC2A 4MCZB 3S3CB 2I27N 3BDBA 4NENA 4I13B 1VFUA 3MLYL 3DGEA 4D8PA 1KC5H 2LLNA 3F01A 1QLRA 5IBUG 1BZQK 3DYMA 3H9HA 4N90E 2NNAB 4WK2B 4DR5B 3ZHRA 4YDJB 5DFWH 1HNXO 4HUWB 1T4WA 4GXUM 1PZ3A 4M6OH 5IROD 2X9WA 4FLSA 2XG4B 4Z9KB 3HB3B 1B6QA 2N4IA 1QSVA 3HRZB 2L6LA 4M7LH 4LSTL 4OCSL 3BW9B 2QTEA 1MHHB 2J1WA 1I1FB 4DCQB 2OMNA 4OPAA 5C8YB 2VABB 5ANMB 4P5SA 4JR9L 3GBNH 1NCDH 4L9LA 4OZGF 3QSKB 5DUJA 2IH1A 3L7FB 3G6DH 2QWOB 1DVXA 1U42A 4AYBA 1E30A 2AFNA 3R0NA 3V4PA 4CN6A 5I6XB 2DQMA 3CRCA 3BW9A 3NSFA 5AOKA 4AGOA 3HNVH 5B3JF 1DFBL 4UNVA 4QWWD 2EO9A 4KX8A 2V7NA 1MCSA 1YJDH 4U1IA 2AZAA 3SE9L 1CF8L 4Z1MG 5T8IA 4Z0BH 3RDTD 1A6TA 3UO3A 3ABZA 5EZIL 4TQFA 4BR6A 1HP8A 4FFZL 4UAOC 1PG7W 5IGXH 1OCCC 5D6DC 5JLZB 2GAZA 1FXKA 4AEHL 1A4AA 3TS8A 3WL9B 2VKWA 1ZIBA 1NTDA 3M99B 2X42A 1QUNA 1ETZB 1KG0A 4Q2ZA 4DN3H 5MERA 1Q9OA 1UZ8A 1JZ2A 3UO2A 3UJIH 3SYCA 3CFBA 5KX5A 4LLVA 4N5EC 3N41B 2YHGA 1S2EA 3FTYA 2IJHA 3ZXAC 3L9DA 4Q20A 4DPCX 3HNTH 2VQEO 5DO8A 3RVTD 3HS8A 3S2AA 1NCHA 4X0NA 4BQ6A 4PJCE 4MNQA 2DQDH 3PGDA 4PWJA 3IKKA 1H3GA 5ITZA 1LVEA 1Q9LB 5H6RA 3GI9H 1SDDB 1XB8A 2B5UA 4BSVA 5AB9A 1F58H 2IGFL 1G7HB 3RDTC 3JWOH 4KRPD 2X7LA 2N1KA 2W9LA 1UPGA 1AQDA 1OQOA 5T3XD 1WC7A 2APXA 1KJ2A 2DJSA 1F42A 2BPBA 3ZT7A 1MW3A 1T6VN 4NBZB 3LCYA 4QRFA 4JLRA 1TVDA 1SEBA 4DGVH 4JNXA 5GGTL 2MPAH 5JO5B 3SDDD 2NXZB 3CRRA 3QORA 2P43B 3D36A 3WXVL 3ILPB 2NXYC 2R51A 3LHPH 1HHJB 1FF5A 5L2JA 4BKSC 1N6VA 1N3NA 2AW2A 4Z1VA 2XETA 2XC8A 2BP8A 4QRQA 2L3BA 2ITDB 4NQCE 2VWJA 3QDMA 1W0WA 3BKYL 4MW3A 32C2B 1N4CA 3U1SL 3DC6A 1ND0A 2VR7A 3N1FC 4UDUB 4AQAA 3O3AA 4NC0B 1I4FA 3G6JA 2FJHB 2ED6A 5GZOD 4L37A 2Z0AA 5GS0C 4M7ZB 1DE4A 1NKOA 1PCXA 1ZSDB 1KENL 1SMDA 5ALCH 1H9DA 4PFEA 4PJEA 4Y9CA 4YEEA 2C3XA 2H3NB 3N6YA 5TH2B 5IJDC 5HDBE 5IMOA 3V0FA 5L3BA 1OWRM 3MU3A 4XP6L 3B1UA 2Q8BL 4A04A 2D9QB 1SQVH 1CU4H 4LDCA 4HALA 4U6YA 4ISVA 1MCFA 3SKJH 1DDHB 4OUUB 2KSDA 3JAMN 2R1XB 3I2CH 1A6ZA 5E8OB 3EBAA 4YMPA 1JV2A 1I4FB 3G6JB 1NAMH 1G1YA 2E7DA 3IRPX 1AO7D 1DN0B 2LW3A 3M7FB 3R18A 1TVBB 4NUJB 2JS5A 2E47A 3ULUF 4HIPA 5BXFB 4QO1B 2YXHA 4EBQL 1KTCA 4PJGA 5I66A 1ZGLP 1SN5A 3EZ8A 3B2VH 4G8GA 3P3TA 4ZMYA 4B7EA 5F1IA 2E0PA 4NTXA 1M71B 4FFZH 4PRDA 1XNRO 4MVQA 5TPWH 4KH2A 5E9DA 5SX5K 3AS1A 3CC2V 4UVCA 4ZOLA 3M6DA 1ZRUA 4YHLL 4G6KH 1S7VA 3MV7E 4JZJA 3LZOA 4ZSOB 2YICA 1QQDB 2P4KA 2QDWA 4XN1A 2R69A 3QXAB 2M1KA 2FKXA 1CE1L 3DURB 1SNRA 4NIYE 1NCUA 5AW8B 1Y74A 4ELME 4RRPM 4HAGA 1OT4A 4LLMA 5B1BC 1CGSL 3S3DB 3R4DA 2AJZB 5F0PB 4KY1L 3T1HB 3DSNB 3S5ZA 2NOYA 2QSAA 5KHIA 1X3DA 1GKFA 2N56A 2YARA 3RYIA 4NQDB 5IHZB 1C7SA 3KYNA 1LO3L 1PS3A 3HZKA 1SOQA 4OFIA 3MKKA 4WWID 1E8ZA 5EOCJ 2H8PB 3K1KC 1IM3B 1L8DA 4EQ3A 43C9B 3H3KA 3MRDA 3QQ9D 1ND0B 4XPGH 5F9DC 4IDJL 4LAJH 1MOFA 1GM9A 2P80D 4LLVB 5LNEA 1WFOA 1FAFA 5FNVA 2BOCA 1OAYH 4E41A 4PCTA 2YWYA 3LZLA 4J8RA 4HJGA 4N86A 5GRJH 3VXSD 3TJTA 1VZIA 2XY1A 1GXEA 3SDCA 1QSFB 2Y7OA 2IG2L 1IEHA 4YGVA 3C90A 3OPZH 1N3NB 5LKNA 2O93L 5CILL 3E8GA 2OWOA 4Z7WA 1ILSA 4I5BA 2WUCL 4X6CB 4BW9A 1NBZB 1DQVA 2GKIA 4YHIA 1I7UB 4AGLA 4BWUA 2IBZH 1U97A 5C0AB 1U8CA 3T0EE 1WC7B 3ZDXF 1DBJL 1VKXA 1FP5A 2AK1H 2G3XA 1S7RA 2JJTA 2YO3A 3KVQA 4HUXB 4XVUD 2NSXA 5L0QC 5JW4Q 2AF2A 1GZQB 1BVLA 1PYWB 1R3KA 2VDNL 4B3TB 4PJHF 4P9PA 4YSQA 3KKYA 3ZCCA 1NEZA 2DJ4A 4EOWH 5CBHA 3L7FA 1CDYA 4NKIL 4X99A 4WO4C 4YWGL 1AP5A 4HQQH 4FLHA 2CLRA 2BTQA 2HJFA 1QEWB 1KCRH 4LASH 5BQDA 1ZANL 2I9TB 3G08A 4DGYH 3G5VB 2R4SL 1CU4L 1RZIB 2F1BA 5BZXA 1OV9A 3WB0A 1KCBA 1LD9B 2M8XA 4K3EH 4XNZB 5DRXB 4HGWA 5CLYA 4EMZA 2YLHA 3IM1A 3GZPA 2Y69B 3Q9PA 4HU2A 4LVNB 1FHGA 3B9KA 4K73A 1IFRA 1BJ1H 1H3PH 2J8HA 2AK4E 5C08B 2NY0B 3KPRB 3OR7B 3AB0B 3HI1B 4JDTH 4NO5A 1VACA 4PVBA 4M6AA 4WFEE 5LXVA 4GO8A 3W81A 1DJGA 2WWNA 4U1IB 5E2VL 3U6XS 3G08B 4PJ6A 3L81A 4ODVH 4U05A 2VSKB 1MZZA 3JV4B 4DW0A 2RCVA 5TPWL 1L6XA 3UTPD 4XH2B 5SWZB 2F4VB 2OYQA 2QGEA 2C9SA 1NCCL 2YXFA 4LF8B 1T7ZA 4FDWA 1PY4A 3W9EB 3WG7C 3UTZA 2FATH 4QF1A 3RG1C 3NP3A 2YXMA 3TO4C 3ULVD 4NLAA 1CE1H 1H8SA 1ZOXA 4HOWA 1UM4L 2O5XH 4P9HH 3KGUA 4ZMNA 1RUMH 5HHNB 1JCVA 3PHOB 3ZMEA 4BXVA 5JORA 1MZFA 4KY1H 3PNRB 1C08B 4JRWA 4ODHH 1WO2A 5AAMA 1T5KA 4XMLH 2RIKA 4WFFE 3EXAA 2D0GA 3BKJL 5E6IC 3SDYL 1V3MA 3NSCA 1EHXA 4PJ9D 3CC5A 3A6CH 1TSHA 3DRTB 3IAQA 1M1KW 1RXLA 5IQNA 3S3XA 4PJ8D 4RLDA 5CN2A 2FIKB 4EZKA 3VI4E 3U79A 3FBQA 1GH7A 2G4GA 1GZHC 1BZOA 3UCQA 6FABL 1VJSA 3EO0B 3QRGH 1CFNA 4GKJO 4EKWA 1UD6A 5LA6B 3WIAA 1YTFB 3CDCA 4D9QD 5DD6B 1E28B 1UXLA 1FBIL 4M8RA 1WH0A 2UXCO 1J5DA 4U0QB 1T1YA 2LOEA 3AREA 1WBZA 3H01A 2YXVA 3BEVA 4BZ2H 3IGLA 5FKAB 3C09B 2P48B 2UUCO 4L1BA 1YYML 1NLDH 1U6AL 5AOZA 4JV5O 3FQUA 5D7KD 3PAZA 5DVPA 5C0IB 1Z2GA 5IEKA 3O3EA 2A77H 4BWAA 5D72H 3RWJA 1I7ZA 3GKZA 1DVFA 1ZV5A 4NKOB 5F89B 2VDNH 3KL5A 3ZKSD 3ALWA 5I8KL 2WA3A 1NUNB 3QQDA 4L3FA 4PJEF 3CSBA 1C1EH 1XCQA 3BA9A 1UCBH 1W6LA 5FM8A 2ADGB 3O2DL 5EBWA 4HK3J 3ARYA 5E1HB 1AZNA 4ADGA 4AMKL 3BQUB 3Q1SL 2HJLB 4QLRA 3P2BA 2OXGA 1IBKB 4EN3B 4G8GB 4WY7L 4WWPA 4JRYB 4DO4A 4R3SB 5BUPA 3HZMA 1QTSA 5J2UB 5BVJA 3GXTA 2FLMA 3L4TA 1I9RL 3D87B 4YDZA 2F1AA 3BN3B 2EYRB 3O2VH 5GGVL 3FOMA 4L8JA 2RACA 2PF4E 1K5QA 1B0RB 5BZBA 1BFTA 3S5LA 3UTSE 4HWUA 1A6ZB 3WS3A 4XNQA 2X3BA 5EZJA 5DK3A 1D6EB 4FXGC 5F7FA 1IJNA 1MCNA 3N1GC 3QIUC 2IDSA 4LB8A 1NMCB 1VCAA 4WUKH 4XX1G 1AKJD 1E3ZA 2HXAA 5ILTL 3OZLA 4PRPD 3O45B 3KS0H 4WO4B 2VLRD 2VDLL 4WGWB 3MCKA 3EYVA 3QRFM 1YITV 1NVPB 4WTZG 4L9DA 3G5XB 5HGBB 2CJUL 3E6HB 1C7TA 4F7CB 1DL7L 3BAWA 4K5MA 5F8QC 3N2JA 4K7PY 2YBRB 5LOVB 3DLQR 4FZ8H 4K3JH 1ECZA 2IW5A 1PTZA 2VXUL 3OXRB 1YEFL 3VRIA 5B1OA 4W70A 4R7VA 4Q56A 1I9IH 2ERJC 4GLRH 3D39B 3JTSA 4Y4HA 3WHE0 4MJ5A 4UQIM 1WQVT 5D4HA 3GUTB 3EXJA 3DXRA 3N41F 3U11A 1P1ZA 4PYGA 2DDQL 1X5YA 5FM5M 3V5HB 2HHHO 2ITDA 1BP3B 3KMDA 3QIBD 4TOYH 4JN1L 4G9DA 5IQOA 1JFHA 3MA7B 1WWBX 4ZW8A 3QCVH 1A9BA 1VADA 2NY6B 5CB4B 3BPCA 1ZLEA 4R7DA 5GGTH 4AVKA 4RUEA 1CFVH 1M05A 4YSAA 4YXWG 2Y36L 2Y7SA 3LHPL 1XBLA 4S10A 3F5TA 3QORB 4PJHB 4WWOA 4E5XB 3N43F 2ID5A 3TIDA 2J5LC 5AKVA 4BZ1L 2R9HC 4X7TB 4XBGB 5EN2A 3CSTA 2XOKG 4PCYA 5ESQA 1F23A 2NNFA 2Z7YA 3T3MB 3A6BL 1N32B 4CU8A 5BS0A 3OXSA 4A7GA 4NJAH 3X3GL 4G7VL 1AKJA 2HFGL 1I0HA 1G7HA 1JGDA 4BE6A 3EJRA 4AM0A 3MRMA 3P4MA 1CBJA 3MJ9H 4PV9A 1CFQB 4PR5A 1QCEA 2Y5QA 5GRUL 1ZLDA 5B1AC 3Q05A 1GKEA 3SYQA 4QHNA 2L8AA 3AREC 1U8OB 5DWUH 1FNLA 2IOOA 1RH8A 5HHQA 4HC1A 5DD1H 2BS9A 2EDNA 5JQGA 3H1KH 3QZWG 1ZJAA 2FNBA 2JCCE 1IBKO 3F7QA 1KT2A 1CYWA 4RWYL 1IBYA 3BKCL 5A9GA 2DS4A 2NW2B 4LPCA 5HI5D 3UFIA 3VYOA 4YBLB 1JFFA 1FH2A 1T0MA 4PDVA 3MROA 4OW6A 4XNMA 4J42A 2K7PA 4OT1L 1MWAH 3PPSA 2EO1A 2YC1A 1BVZA 3VOUA 3S34H 1KYOJ 4YY3O 1LE5A 1A3ZA 2WAQA 1UWXK 3KPMB 3MRJA 2NR5A 5C09A 4AC4A 2QQLH 2RFXA 3CFIC 1M1SA 5DS8B 1ES0B 5IB4A 2ZG2A 2ZCHH 2I85A 3F5WB 3I3EA 4GG8A 4M93C 5EC2B 3VXTB 5IWAO 2EIKB 2CIKA 3QC6X 3SY0A 4F7EA 4LVHC 1JTTA 4K5LA 3PGFL 2GJ6E 4P3DB 3N1QC 4BE5A 3DX6B 1NMBH 2XZQL 3BKMH 3QFJD 4L29A 2BLFA 3RB7A 2WLIB 1A4BA 1T2QH 2PW1A 4TL5A 4F2EA 3A21A 1ITBB 4X0KB 3U0PB 4FQXC 3CFEA 4AZ8B 4D0DB 4L9LB 4JB9H 1YDPA 1QRNB 2WSKA 4Y9FA 3TIEA 3OKOB 5DUMH 2B15A 5C0CB 3KCYA 1F4MA 4WCYH 2R29A 3QJHA 5KVGL 1R3JC 3DUHA 4Z7WE 1UB5B 2QPSA 4NDMA 4ONGH 3VO0A 2NXYD 4AY0A 3LS5H 1FYTE 1YDPB 3VGHA 3RVXD 1HNGA 1KBKA 4RISL 5EIQA 4HF5H 3T65B 1JVOA 5CSBA 3REVB 3CBKB 3DVGA 3K71A 3ILQC 1B9KA 1NC4B 3V6ZB 5E99H 1JPEA 3RN4A 4NPYB 3DC5A 4NP4L 5DHEA 5GGUB 4HCRL 1S3KL 1SUJA 4YS4A 3BX7C 4KJPD 2I26N 2ZWKA 4OD1L 4UCVA 1L6PA 4CW1B 5GZNA 2AJUL 3GSQB 2IAMD 1T1XA 4KKZA 4WHTA 3NIFB 1NCJA 2PO6A 3K9SA 4U1JA 4ZXBA 1H0DA 5JH7A 1RLWA 3CIQA 4P2OC 2K6YA 3O2DA 3KJ4C 4QY8A 2J72A 4NPKA 3VM7A 1SLXA 3P11L 2BNRA 5BZWA 4BYHA 1PNKA 1A25A 5I1CH 2F23A 5D7LD 4TRPL 3CFUA 2NW2A 5LCVA 3WIHL 4IGBB 1IAIM 1D5BA 2VDNB 4XWOD 3M88A 4WU5B 1ACXA 1I85A 2P5EB 2WTPA 5GGTA 2CAKA 4AQZA 4Z7NE 2DWXA 4K23L 1XR9A 4X4XA 3K3QA 3S2CA 3RL1A 1U21A 2CO7A 3PIQA 2BW5A 3VI3A 2G75B 1E9OA 1T5WA 4KDVA 4LPVA 4WI8A 5BUGA 3QEQD 1O75A 1TYEB 3TASA 5D1XC 4XP5H 3CFJA 2J6EH 7FABH 3IJEB 5JPMA 1EM1A 4JI5B 3CZEA 4P46B 1V05A 3VQXA 4KKBD 1ORSA 4KTDL 3RYFA 3STLC 3KPQA 1UM6H 2DYPD 3ZTNH 5IMMA 3QNXB 1YEDA 4L8SC 2HT2C 5GRWA 3RHWF 4U3CA 4QHKJ 4WAFA 2JB6B 4HKXA 2R2HB 4L23A 1P2CB 3VMPA 3QGVA 2F66C 1CFSA 5K39B 4NM8H 4OT1H 4I0PA 5HJGA 5JOEA 1EANA 2A79B 2UVFA 3D6GA 4RAVA 2CU9A 5CB4A 1XF2B 4Q4IA 4JFDB 3GRWL 4U1HB 3T0ED 1LQBC 4AV5A 5D9SB 4IYHA 1ZK9A 1L9TA 1O6SA 3MJ9A 2JK5B 1F18A 4FABL 1V8HA 4MX7B 5AW9B 2XPZA 3FAXA 2A4CA 1OZ0A 4Z3HA 3HPLA 2EDFA 1M57C 3RILA 5CGMA 3FT4A 2LLGA 4E41D 4JO3L 3X17A 4JM2F 2CCLA 1CDIA 2XZZA 3EFOB 2VISB 1K4CA 3KWTA 1ZHNB 2PP7A 4P8QA 2VLLB 1OD9A 3QAZB 3HI5H 2JNZA 4KPHL 3TJHC 4Z7OF 4L3EE 1LK3L 2WGNB 3IN0A 3L5XH 5JQHC 1T6BX 2ZOUA 4PJ9C 4OPHA 1PZAA 2RCSH 3VNZA 1IIIA 2BVTA 3IVKA 3RVTC 3O45A 5MHSD 1AD0A 1U3HB 4FQIL 3NP4A 4B7IA 3OAZK 2R8SL 5MEPB 4N5ED 4KO7A 4OGQC 1BQSA 2HVJC 4KNSA 1F1AA 4RISH 3ULVC 1GM7A 2ZR3A 4Y4FB 1B3IA 4CL7A 3NTCL 4CJ0A 4YFLF 2EYRA 1W15A 4WEMB 4B9KC 2EIZB 4HPOL 1FA4A 3PP4L 1JJ2U 3ZMVA 3WIIL 5LVEA 1RUQL 4X80L 3PABA 3GZKA 3SO5A 4JRYA 5MEPA 2Z93A 3BN9C 1MQ8A 3QJFB 4N25A 3E89A 1KEGH 1ZGLA 1FL6A 2QDOA 1YAIA 3EADA 1BVOA 1GMIA 2VR6A 3L95A 2UU9B 2UUDK 2VYRE 2XV2A 4IIJA 5GRZA 2IF7A 1GC1H 4N0FA 3T71A 1N64L 1CT8A 5JHMA 3CLEL 1MH5B 3KPPA 4XBMA 3ABGA 3VXPB 1WFUA 2F53B 3LV3A 4FXKA 5DMKA 5JPMB 4P5KB 3R7RA 3T6XA 3LPOA 3BZ4B 3BZFB 1UUNA 2EE6A 1U30A 1SY6A 3RDTA 1M6OB 4X4XB 3SE9H 2Q67A 3GXPA 4TS6A 5HHMB 1XIWD 5T33L 2RD0A 4K94H 4AH2A 2VDMB 4GRLC 3ZYJA 1OF2B 1U8MA 4RMSA 3HR6A 4UBDD 1KXTA 1SVBA 2P06A 3ZPDA 3H6AA 3K4AA 3SQBA 4OZHF 2VDKL 2VZ3A 2H45A 1O7SA 4YN3A 2VO5A 4BZ1A 4GBXB 5HHOD 2DWEA 3IFNL 2E7LC 1RJZB 5DHXB 3MYZA 4OJAA 3RURA 4HLZG 3L9RA 4ZMLA 5K5YA 1Y07A 3UJIL 3PP3K 2LABA 5DFAA 3PU7A 3KPOB 4LFCO 3ES6A 4OCMC 4UM8A 3IRZA 1FN4B 5D6DA 4OFPA 3ROOB 2JJ2G 4DAGH 4YHYB 1Z2KA 5IMMB 4HAKA 4DUZB 4AYDC 3P1VA 3C5ZB 3MUGB 1FJGO 2H0FA 4H26A 4RWUA 3HHSB 4P46A 4HV8A 4HBCL 4FFKA 1W0KG 2FNWA 2BVPB 3LXAA 5HYIA 3KPNA 3U7YL 3ZMRA 2P90A 3KM2A 3TX4A 5CZRA 3RVVC 4F8OA 3BP6A 1TKWB 4WEBL 3ZHNA 4UOQA 2VDLH 3U30C 2OZNA 3RWEA 1PZCA 1H3TA 1HFUA 2HFEA 1YYLH 4D3CH 3QPXL 3U4BH 5G2NA 1QRKA 3GRBA 3QG6B 4NT6A 3TO4B 1TJHL 3T0BA 3LRHA 2P44B 5D1ZC 15C8H 1S4IA 1UWEH 3DVFA 4HK3N 1N9PA 1FYHB 4HFWA 1P6FA 3SKNB 4J1UB 1I9IL 4WNSA 4PUBL 1EN5A 1JZDC 3KXFD 4ENEC 1J86A 4HJ0C 5IB2B 3T8MA 4I9WD 4AI8A 4QXTB 4XXDA 5FGCE 4JE0A 1DJYA 1T1XB 1YEEH 3ASOB 3CN1A 1TQSA 1XIWB 3X13B 3B8MA 1MW0A 1Y6NR 3E2HB 3EJTA 4NO2B 1TXKA 1NEPA 5IVXE 5IHBA 5B8CC 3BY6A 5CJBA 5TQ2H 1FAKT 5D7IB 2D3NA 1FVDB 2WBJA 4OGYH 3OD4A 4PRPE 1HYSD 4N9OB 3D0LA 2Z93B 1ZGLB 1H3WM 1DHKA 5D5ME 1N5YL 3SGDI 3N1MC 2KG7B 4L0YA 5G4OA 3WY3A 5DC9B 4JFEB 4CN1A 4JFOB 6CGTA 1KCVL 4PB0L 3TN0A 4NN5B 4ACPA 1RERA 3TWCH 4GH7B 4GSQA 3W11C 3ZO0A 4NP9A 4OCRH 1NCWH 3QEHB 3DJTA 1CI5A 5I6OA 1SXBA 1I7TA 1GJIA 3CFCL 2GC7C 3NABH 3P0YL 4FHKA 5J89A 4WEEA 1ONQB 3HA0A 3SPCA 5GRUH 2D7OA 3EGDA 3UPAA 5I0DA 1N6QH 4LF7B 1SY6L 3CXCU 1E9PA 2VDPL 5CSZB 4BSVB 1ZAUA 1C8QA 3GUFA 4KXCA 4PJDB 4DVRL 3F64A 2VLJE 5T5FA 5ESQB 3LQAL 3IFXA 1RQ5A 2WXHA 4NQQA 3IJ8A 2F19H 3WHE1 3MNZA 2G0KA 1LO5B 3B40A 3D09A 4FHJA 1IEAB 2BDNH 3TLRA 4KWUA 2PYEB 1N19A 1V55B 3QYMA 2D3LA 3TZVC 3RQ3A 3GK8H 3IDXH 3ZDYE 1KYDA 2DM3A 3V10A 2WK2A 3QZBA 4FOMA 2X38A 5KS9B 1AO7E 2ED9A 4FN0A 2CD0A 5B39B 4GY4A 2ZCHL 5IVXF 3HUJB 2EBOA 4H0GA 4KRMB 1WS7A 4OD3L 5FPOA 5HXMA 1P84J 2D4FA 2JQAA 1RSOA 3CMEV 1RUKL 1OT1A 3AK2A 5ACLA 1MLBA 3ZMUA 4IRSA 4PPTA 5MENA 4ZYKA 4GI6A 3D06A 3UIZA 1LNUB 4F1SA 4OF3A 1CFQA 1P0SE 5L7XL 3ZHLA 5EB9A 1PNDA 2EXYD 3WFCL 4GG6A 4XMKL 2P26A 3RVUD 2F5BH 4JQXA 5LWYH 2C5DC 4N2LA 1WCBA 3C08L 3FCSB 3NPSC 4QRBA 4A2MA 2E59A 5LHDA 4IIJB 2EULA 4AOFA 3WFBH 4JRXA 1EZJA 2BFVL 4P5TC 3OG4B 5BRZD 1RM1B 2B7DT 3SBWA 5AVWB 1GHFL 4R0LA 3UPCA 3WJLC 4DIXA 3CFJB 5I0XA 2YC0A 2EJ1A 1U8JB 2HT2D 4JFYA 5E8EA 1NFDB 3AMKA 3QUZB 1NUFA 4Z3TA 1BZ8A 1JF6A 4RNRA 1MDAA 3CX5J 2OM5A 5BXZA 2OYPA 1FC1A 4PA6A 4DR7O 1SYVA 2CDFB 3ZTDC 1K8IB 3KW7A 4UU9A 1VADB 4HC1L 3ARBB 1D5BB 3U0ZA 1QPXA 2NLJA 1IBBA 5E4AA 4BM7A 3MO1B 1AHWA 3MV9E 3Q06A 3DOSB 5C3IA 1MJUH 1VP7A 3ARFA 2DQTH 3FRPB 4NI6A 3TVMD 1TTCA 2ISDA 4ETQB 2VR8A 2FX7L 2J1XA 2GJZA 5IWLA 2VKXA 3IPFA 3TONA 1YECL 4MJ5B 4B9CA 2YPVA 1NANI 1YNLH 6PAZA 5D7LB 5JW3H 3S3JA 2ADFH 2X4NB 5FKPA 4K55A 1XCWA 4ZUTB 3R8BB 2NTFB 7PAZA 1K4CB 3A0BZ 4W9KC 5IYDO 1OARH 4W4KA 2DQCL 4K8RD 5L2KB 5BVPL 2QJDA 1WBYB 2B0SH 4GINA 5TE6H 3PDGA 4UVBA 1JK8B 2RB8A 3REVA 4NQEB 2OPCA 4KV5F 4E9LA 5HYSG 5D1XB 1DO6A 4PJXA 1UJ3B 2YSTA 4K71C 4QYAA 3C5JA 4LH7A 4LC1A 1X6NA 5L4MA 4ZO8A 1P7QB 3AREB 5IFAH 3N50A 4GYCB 1QVOB 1I3RB 2J6EL 1R1CA 5JPNC 3LKPB 2G2RB 1CCZA 3AQDA 1XAUA 1N4XH 5J1AB 4KK9D 5FCSH 4PRAB 1IKOP 2XX0A 4JPSA 3CSXA 1I3GH 2R1WB 5BMFL 2DJMA 2OIGA 3GB7A 4TSAH 4F7TA 3KYMB 3OC8A 1KPRB 3U4KA 4BA0A 3FOLA 5I8EB 1UD3A 4NXMB 1KY6A 1RULH 4UWQB 2OSWA 5JW4R 1DANT 2R70A 4HXBL 3ECBB 2O5ZH 3QDJB 1BYOA 2Z1KA 3UBGA 1IARB 4DZBB 4ETYA 1ZHKA 1SA0A 3M8OH 4FTVD 4MHHG 1XDCA 1OSYA 1PU0A 2V2WB 2OL3A 2HKFL 2XTAA 2X09A 4APQA 3N2GA 5EH1A 3MI6A 4BCZA 4C59B 2QKCA 4MHHI 4UV4H 1PKQA 1FPOA 3B8NA 3EF4A 3I84A 5AVSB 5LXGL 1OTSC 4X6BA 1TCRB 1TAEA 4LAQH 4AQ1A 1XR9B 3DGGA 1NDMA 1QI5A 3Q8BA 2KQMA 4AM0Q 3JVFC 3P3PA 1BQHB 1S7UA 3PHQA 5CJXC 4PGBB 1TPXC 3AT8A 3JALA 3B3IB 1F3DH 3DI3B 3L6FB 2KLTA 3GMPA 2XVGA 4MYPA 3RX7A 4YR6A 3ORJA 5E56A 1JYXA 1PGRB 2R29H 3AM8A 3TZVB 1G7LA 3LQZA 3MVSA 4HWBA 2MQGA 2E7BA 5E23A 3WAKA 4NO5B 5I16B 3BEWB 2MOGA 2ZCKH 3B9EA 3MLUH 1LO4H 2OJZL 1JPSL 4WBNB 1QKZL 2DQJL 2QSVA 2PWGA 4OZGB 4G43A 4GUPB 4KKRA 1AD9B 1FLRH 2Y24A 3QUMH 2Z35B 1FNEB 4NQTA 1V5JA 1F11B 4I50A 2G5RA 3J27A 3N1PC 3R66A 1HS6A 2OFQA 2PLTA 3RFZC 3BAIA 3WDJA 4ZHQA 3FZUC 3FFCA 4MA7H 1TETH 2WINB 4O4IA 1FFQA 3DC0A 3PP3H 5CWSB 2H0PA 3O2WL 2EC9U 1FVEB 1CQYA 3ZHKA 1ZHBA 3K4ZA 4ODXB 2NN4A 5CCKH 1XR8B 3OB0K 5JUEH 3UTZB 5ISZE 3B37A 4TTGA 5I74C 1RZKH 1JK9B 2WQWA 5SV4A 5J11C 1AFVH 5IB5B 2YIAA 1KFGA 1FFPA 1USZA 2KH2B 4D9LH 2R59A 2VC2L 3K8LA 3TC9A 2WLIA 5C0AD 1VCBC 3ZDWA 3WKYA 3T0EA 2G9HB 4AX3A 3L45A 1NM9A 4EXKA 5KLVH 2X40A 3ZK0A 4HJ0D 2XG4A 4IKLA 1W6WA 5GSRA 3U2IA 2UZYA 3GI8L 3QDGA 5F1NA 5EG6C 4D9QE 1TUBA 1VERA 2IDUA 3LYRA 4HZ3A 4TQDA 1LP9E 4K07A 4GBXC 3H9HB 4GX0A 5AVZB 3ZL1A 3QJZA 2C9VA 3RWHA 5EK0A 3K0WA 4Z6AT 2QT6A 3QUYC 4P07A 1WITA 4WWKA 1E2ZA 5FPRA 3W37A 1VFOA 3EJJX 2QV4A 3G5YA 1NAMB 2OTJV 3CHOA 5HI4C 1X5ZA 3FSZA 1UGNA 3FZUD 3CX2A 2A0LC 5CBAB 1F6LL 3L3GA 4Z7OE 5D5MB 5F7EL 2J88L 2A9ML 3VD5A 1MJJA 3HE6C 4NM4L 3RY4A 3I9GH 1HNFA 4PLKC 3TL5A 5GONB 4J6RH 3TCXA 3TEXA 2X6CA 1G1XB 1BIHA 3SCMA 5HHQB 1DCEA 3B9DA 2H8PA 3UTTE 5DQDH 2UZXA 3RX5A 4B3SO 2JK5C 4ZD3L 3J80N 2AEIT 3ARGB 3WN5C 4JGMA 3IGUA 3P9LB 2DYRB 1E8YA 2GG1A 4I2XE 4CRPA 4JL2A 2H2SD 4LLWB 4AIEA 5FUCE 1NGXB 2CBOA 4ZZKA 4DUYB 3BQUA 2EDTA 2DDQH 2F0CA 5DI8A 5KOVC 3RBGA 2E4TA 3U48A 3KPLA 1S7RB 5HPOA 3QFDB 1OO2A 3IDIB 1B4TA 3TN0C 3OJ2C 2JI1A 1WZAA 5E1AB 3QDGE 1KF9B 3JYBA 4X7SH 4MXQC 3B4SA 2XPGA 3E9TA 3FU0A 2A6IB 3JZ7A 3EFFK 3WG7B 1OW0C 2QWPB 2UZIL 2JVDA 3DJZA 3CDZA 3H9SE 4PGEB 1U3HC 4PI0A 2DTMH 3OAUL 1G4YB 4ATTA 5KZCD 4YVUA 2OMUB 3SZ6A 2YN5A 4HZLA 1FG9C 3PWPB 3VMOA 2WMPA 4S1SL 2QTSA 4JBSA 4NQVA 3Q6FA 1BHBA 1A6UH 3BISA 3ZDXE 2FT8A 3V4UH 2NY6C 4OQTH 5B38G 1FNGB 1B9ZA 2GT9A 2IANB 5I6LA 4NKIH 3QUML 2AGJL 4S1RL 2TSAA 5GS0H 1L0NH 1YQVL 5KHJA 3VRIB 5LQBH 2R1XA 4TSBL 1IM3D 2PCXA 5JMOC 1H15B 4L8DB 4Z7VF 3EBGA 1I8MB 1T4KA 4GS7C 4LASL 1EZVX 1OB1A 3V0WL 4O5LL 5IJ0A 4GKSA 2L7JA 1NOAA 4QRPA 4DR2O 1RPOA 4BFEA 3APNA 1KXVA 2F7PA 4NQDD 4RWYH 5KSVB 1TU2A 1Y7VA 5C2BH 1XUQA 2WNGA 4P9OA 1DLHA 1HZKA 4WO4A 1IGCH 1TENA 4QXGL 4IU3A 3U9UA 1FNHA 5H94A 1R4XA 5F9OH 4JZJB 1VDGA 4OZ4B 4ZSOA 3ASNC 1D5XA 4YE4L 2CLZA 4I9WE 3NQIA 1Q3EA 2X4OA 3G80A 1OLZA 2UXDB 1QA9A 1A32A 1VPOH 2XVKA 1T89C 3W57A 5IIEA 2UUAB 1UH4A 4PSPA 1E43A 4YDNA 3CWBH 3LXBA 4HH9A 4N2NA 1MKFA 4ANWA 1AIFA 2FEJA 4BFRA 1HKLL 2VERA 4W9LC 3JSLA 5IBUB 1XR8A 3G71V 2NXZD 1UWFA 3BUQA 3MCLH 1PD0A 4O4LA 3LNDA 4QHLA 5FGSA 4H1LA 5GISH 5DHVB 5TDOB 4YSEA 1J0IA 4DR7B 1KTRL 3ILPA 5FLUA 1M3IA 2AABH 5DA0B 3IYLW 2UY6B 5KVDL 3MV8B 2J5WA 3V0HA 1B90A 4G3YH 2R9IA 1N8ZB 2HWZH 1GGIH 4FQHB 4I48B 5HI3D 5CGBA 1SVZA 1XMOO 1LUVA 2FHFA 4RBPH 1X4YA 2VN3A 2F7IA 3WLWD 2H26A 4JAAA 5DEDA 1BXAA 5D1QC 4BINA 4CSTA 3ABUA 4WVRA 2FBOJ 3IMUA 4IRJD 2EDKA 1K2DB 3MRGB 4QRAA 2K3TA 4ZQKB 2OIEA 1KZQA 2LT9A 1Q6IA 3PGDB 2XWTB 2IQ9H 1J8RA 3BKJH 2WLJA 5K9JL 1R3LB 3QFJE 5DMGC 2O6CA 4MXVE 4NXMO 3P77B 8FABA 2O4EA 2VGLM 3FJTA 3G5VA 1ZIAA 5SWQA 4C4UA 3SKMA 1YY9C 2F5BL 5HDLA 5C0ND 1Y1DA 3S36H 4F57L 4PBXA 1AR4A 2RGSA 1WV7T 2Z3YA 1U58B 3APOA 3DX7A 3FT3B 3PF2A 4GQRA 4XE5B 3QUXA 2GJ6D 2BSRA 2YMOA 1JNNH 3PREA 3FW6A 3BDXA 3C8KB 2W65A 1BFOB 1QFWI 5HVHC 4B53A 4X7SL 1TJIH 4GUOA 4NYLB 1BVLB 1PYWA 2ERJB 1NBYB 4F2MB 4YQXH 5KWYC 4TRPH 2PWHA 2X6UA 4JX0A 5CZVL 3WFEH 1XT5A 3PV6B 4HAMA 4O58L 5FK9A 1XSOA 4MRCA 1X9RA 2V9TA 5PCYA 3QR2A 3X14A 1IQDA 2KI6A 4MJIA 1N36O 2Z7WA 4GAYA 4S1SH 5T3ZH 4F8PA 4CGTA 2C4XA 1AQ8A 4QAMB 4A5UB 2ZOLA 2HSIA 3T4AB 4N0UE 4WTWA 1F4YH 2Z91A 2G2NA 3OFNG 4JUTA 1U8NB 3RY6A 4F2FA 2V7QG 2FAUA 1YEWA 1TEGA 3AG4B 1NGQH 3DX7B 3FT3A 2V8LA 3DVNB 2A0LD 4M5SA 5LB1A 3V4PH 3VXRE 1ZA3A 2DQCH 2C7UA 2XIBA 4K7PX 3U2SA 5B39G 2P7TA 1ZWIB 4Y2DA 3FTGA 3ZE1E 1IAKB 5GGRY 4BBWA 2EIMB 3HI1A 3VGAB 4AQEB 1UEYA 4XVSL 4ZW3A 3JD2A 5GGVH 2X4PB 5MI0B 3CFDB 5F6IB 4PGDA 4OCYL 1S8DB 3N91A 1GN6A 4WKZB 4ECNA 4XHJC 2X70A 2EILB 1CG9B 3AVEA 2WWKO 4Q89A 5ICYB 1KC8W 5BOJA 3E2HC 2Q7HA 3FUDA 3KJ6L 1BZ7A 1NM4A 4LCWB 5DRXA 3BEWA 4J4PD 1MREH 3ABLC 1XF3B 3OAWA 3E22A 3MLTB 1D7BA 5AYUH 4ZOLB 3TGUH 1GZPA 2BSSB 4DFHA 2OTWB 3D36C 5DHVA 2BX5A 4FMTA 5AEAA 1A7QL 5HFMA 2HTKD 3L3IA 4JFTA 2NZ9D 2VSCA 2FHBA 1QEWA 3NT0A 2CLVB 3HKCA 3HNVL 1IZ3A 3QVNA 3PHSA 3CS5A 1ROPA 4N28A 2DYSC 3MO1A 3CFMA 1DZBA 1KYOF 2VDMH 4DV0B 1DSWA 3IMRA 4AGMA 2YWZA 1C12A 1SYVB 2CDFA 4QGPA 1GGIL 4X88A 5IM7B 1B6UA 1LEGA 4Z78B 3IGAC 3A6OA 2RBLA 4TLKA 4HUXA 5KSUA 3WKPA 1K4DA 3HC3L 2YQBA 5F7DB 3CVIL 4JN1H 4P5RA 5E2UH 1T20A 2OMZB 4PWIA 2EZ0C 3SGDH 2X4RA 1VQLV 1I08A 2XWCA 3LJ3A 4Y4FD 4F6RB 4AL8C 2JWYA 4BKLA 4P2QB 1P7HL 1GTFA 2HMIC 5EZPA 3MNVA 4K3AA 1TR7A 5FW6A 5AYQA 4FQJH 1R75A 3RAJH 2IPUK 4G80A 1NGWB 4YDLC 2E8ZA 3OM3B 3ECBA 5C0CE 4E0RA 4KKAC 3CJHA 2R29L 2CJ3A 3FQWA 1KPRA 4C54A 3QHTC 1BSIA 5E5LA 3HNSL 5B7FA 4PWFA 1RHFA 4L87A 1WHPA 2AEPH 1A47A 2IANA 3HKEA 2V33A 4YJ3A 4S2SA 2IAMA 3VXSA 1ECYA 2WXRA 3IAPA 3TXQA 3UTSA 1JD9A 3EYQC 3JWOL 4UQ3A 3HI6L 2OTUB 4PW4A 5E4IA 5LYJA 3FO9A 1V3JA 3CD4A 5C93A 1NWOA 3MUZ1 3CCVV 1MHCA 4R7NA 4UT9L 5CJQL 3WLBB 3ZDZF 5HYJA 4G1MB 3CBJB 3HR5A 3AW5A 2W59A 3II2A 1Y74B 2X9XA 2ICES 4F91B 5IROA 1OJHA 3QG7L 1ANUA 3DXAD 3V5KA 1I31A 5I76B 3I6LE 4KI5D 3UZEC 4QHUA 5E1AA 3FPYA 4OIFA 2V3DA 1T20B 1UWGL 2OMZA 3CMOL 4OCWH 1FO0A 3II3A 1X5AA 3QJSB 1MCIA 3T1WA 3BQUC 2IOIA 5EOQH 3WIHA 2UY7B 4K7PH 3P2DA 1AG6A 3EGDB 1LDPH 3MGOA 4FMFA 3OKEB 4RGNC 3O6ML 3UTTA 5AVRB 3V79C 2QVMA 2VCOA 4WFHA 1J5IA 2L7EA 3EOTH 5LGHH 4OM0H 2FHCA 1GW6A 3BVUA 1MNUL 4TM9A 2XN9E 3VXUE 1KENH 3E8FA 4PLJD 1SUHA 4EB6B 3M45A 4ELMF 3L3IB 3GPEA 1IQWL 3T4YA 3L4XA 4U1KB 5C9JB 2EKSA 4APXA 3CFTA 5KS9F 2HRHA 3STLB 1IT9H 3C6LD 4D0CA 3QUZA 3L9EA 4PRIA 3VD3A 3PPEA 4A55A 5D7JB 4YXHL 2CBPA 4MT8A 1DDHA 3FU6A 3OX8B 2ZD0A 2OMWA 3VGEA 1ETZA 1KG0B 3CC7V 4NOBA 4Q2ZB 4X6DF 3FUNA 1FJ1B 2ZAIA 3C8DA 3DX9B 1EHAA 5IOPA 3H9SA 3P3YA 3IJHA 4OZHA 1EXHA 2IWFA 1E2WA 1PQZA 5H2FZ 1JMKC 1QUPA 3EO1B 4DESA 2G5BB 4X6CF 1A6TB 1YCSA 3F65A 4LFCB 1JHLH 4W4NA 1B06A 2CGRH 5EIIB 3GHBH 4RFOH 5KN5B 4I85A 2ATKB 3VFPB 4JI6O 4B5ZA 5CFHA 3QHFL 4NNPL 3T09A 2GBTA 2QLVB 2ETWA 4W9IC 2R0LL 2DN9A 1O5DT 3O6LH 3BH4A 3QDMB 3UEZA 1HK6A 1E27B 3JAKA 3MLPA 4L5FH 5D93B 2EYSA 2AEWA 3E3QC 3FAWA 5K9OB 2F7OA 4NKMB 4YSPA 3CIAA 4P49A 3DDFA 2FWSA 1FSKB 1LDSA 1Z0MA 3KYKL 1U91B 3NFNA 3D25A 3NZHL 3OLDA 4K5NA 2PYEA 3U0WL 4IYKA 4DP5X 3KLAA 3QI9C 4QIWF 1A0QL 1BD2E 1WA2X 4PGJA 5FO9A 1CBVL 5FUCC 1WP7A 5JWPA 1J0JA 1KCVH 1OALA 4ZG1A 3STZB 4O4HB 1JTPA 5IHHA 4LGRB 3NSXA 2ZYIA 1IM9D 4LRIA 4LQ1A 3GSWB 2F08A 1LHZA 4LHQB 4UM8B 4OQTL 5A2CA 1DEEB 1BXXA 5DMIL 3EDKA 3SOBH 1RHHB 3K72A 3QUXB 3Q3GB 3GSNB 4I55A 2VMCA 4YNYB 4PJ8A 3DPDA 2AJ3A 1N36B 3BMWA 2CGNA 1VZHA 1U93B 5D8JL 1OAZL 3WNOA 4DO2A 4P4KC 2NNUA 3KM1A 3ARGD 4HT1H 3VJ6B 4M3KB 2DMXA 3ZZQA 4KXRA 4N26A 2CRMA 2EC8A 4Y16C 3IJYB 1UH3A 4YPGA 2CO4A 4JHAL 1QUNB 2DOCA 3LH2H 5E5MB 4ORGB 4G8EA 1UWGH 1E6OL 3ESNA 3L71H