2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
3T71A 2FT6A 3T6XA 4E9WA 2ZWNA 3X1NA 3T6WA 4DP9X 3HB3B 1OCOB 4YVUA 1AG6A 4G70B 4Q89A 2JXMA 2YXWA 4EF3A 1FFTB 3V9EA 1A65A 1EHKB 1GW0A 2UXTA 2W88A 3IN2A 4BWTA 3X2QB 3UACA 3DTUB 3JTBA 1J5DA 2GBAA 6PCYA 2B3IA 1OV8A 3NYKA 4HAKA 2PP9A 8PAZA 2HRGA 3NJLA 3X1EA 2HX8A 1ILUA 2DV6A 2X88A 2PPDA 2RACA 3PLYA 1AAJA 3ERXA 4A2HA 2GSMB 1SFHA 2R7EB 4KO7A 3D12B 1NWOA 1ZPUA 1ZIAA 3KW7A 3WIAA 1M56B 2DY2A 1ASQA 4YSAA 4NAJA 1DYZA 2Y69B 3H4HA 4RH4A 2OV0A 2BWDA 2J56A 2IH9A 3T6VA 3WI9A 4A2DA 1PLAA 2AVFA 2VM3A 3CVBA 2H47C 1PY0A 1ET7A 4AKPA 5B1AB 3NSDA 4UF7C 2GC7C 2YAFA 3AG2B 3ZBMA 1SJMA 1UATA 2JKWA 1AZCA 4ENZA 1XMEB 3TBCA 1FWXA 2NRDA 2DWSA 3FU7B 2OCCB 4AKQA 3WKPA 1A4AA 2CJ3A 2XYBA 4L0PB 2YAMA 4E9YA 3QPKA 4E9QA 3QJVB 5F7AA 2UXVA 2I7OA 1JZEA 1ASPA 4CSZA 1QLEB 1AZUA 1J9TA 5B7FA 5D4IA 1JVLA 4M3HA 3S3BB 3NJFA 2TSAA 1MZYA 1PAZA 3PAVA 3NJHA 3OMIB 1MG2C 2IDFA 2EIJB 4KNSA 1KCBA 1ZV2A 5LDUA 3PCYA 3ZDWA 1W6WA 4YVNA 1A8ZA 1CURA 1AS8A 3QQXA 2IDTA 2BZ7A 1HAUA 2XLLA 3GDCA 4HZ1A 5I6PA 1JOIA 2PP8A 2WSDA 5AZUA 4KO6A 4A67A 2X87A 3SBRA 1NPNA 2FT7A 1WS7A 4DPCX 1AQ8A 3AG1B 1ETJA 1JZIA 1CYXA 3FSVA 2YXVA 2Q9OA 1MG3C 4W9ZA 3FPXA 1ILSA 1WAEA 3DIVA 2FT8A 2FNWA 2B08A 1SDDA 1ZDQA 2XXGA 5I6OA 2IAAC 2R7EA 3EHBB 3QJRB 2BO0A 2VW7A 3NP4A 3FT0A 2CUAA 1JZGA 4UAHA 3S3CB 4PAZA 2BP0A 4DP7X 3OMAB 2JFCA 1ZDSA 1IUZA 3ABLB 1MDAA 1NINA 1NTDA 5B1KA 1IC0A 2DYSB 1PZCA 4YSSA 3WKQA 4QLWA 4G72B 4KO9A 2UXFA 4HCIA 1BXVA 2HXAA 7PCYA 1OCRB 5ANHA 4FA7B 3UADA 1KCWA 4GYBA 1N70A 2DWTA 2HRHA 1PCSA 4N4YB 3ABGA 2BHFA 5TK4A 5D4HA 4A2GA 4YSQA 1NIAA 3FU7A 6PAZA 4BXSV 3S3DB 1E30A 5I26A 5I28A 3T9WA 2AFNA 1V55B 3AG4B 1SDDB 2CAKA 1BEXA 1KDIA 3EF4A 2TSBA 4E9SA 3FSZA 2BP0B 4AKOA 1AOZA 1XB3A 4YSPA 3BVDB 2A3TA 1GS8A 1ET5A 2CBPA 3NJMA 3QJUB 3NJJA 4HHGA 1BXAA 3OMNB 4DP6X 2VW6A 3WNJA 1JZJA 2QDWA 4F2FA 2VN3A 1OF0A 1JZFA 4A2EA 3T6ZA 2CALA 4GXFA 1AS7A 2ZONA 1WA1X 3KW8A 4GP4B 1NDTA 2GIMA 2IDSA 1TU2A 1AG0A 3FQ1A 2Y1AA 4DP0X 1QHQA 2EIMB 3QJSB 4F2EA 4YSUA 2PPAA 2YARA 1GYCA 1N68A 2HLEB 1HFUA 1SHXA 1BQ5A 1M9WA 2HX9A 4MFHA 4HCGA 4AZUA 2VSKB 3NJGA 1SF3A 5B1BB 1A3ZA 1BXUA 1L9RA 1JZHA 1AIZA 2YQBA 4KOCA 5EHFA 1YLBB 3UAEA 3N55A 3NJNA 1PMYA 3OD3A 5F7BA 1A4BA 3L45A 4A66A 3PPSA 3WG7B 4YSDA 2E86A 1ASOA 1E65A 1TEGA 1AACA 4JKNA 3UABA 2AANA 3NP3A 1X9UA 1NIFA 3X1GA 1FA4A 4AX3A 1XB6A 3QJTB 1W8EA 2MTAA 3CVDA 1BQKA 1V54B 3TU6A 2HX7A 2GB2A 2QT6A 3JT2A 2PPEA 3IE9A 4BK5C 2YAPA 2AZUA 2YAOA 3FSWA 1ADWA 1NIEA 1MZZA 2ZOOA 2YAQA 2UXGA 2IWFA 2IH8A 2VM4A 1CUOA 3X1BA 3OQRA 2PCYA 3H56A 1J9QA 1SNRA 1NWPA 4HHWA 2EINB 4F7KA 1AZNA 1VLXA 1I53A 2H5UA 3NJKA 2H3XC 3ASOB 3ABKB 1KGYE 3NSFA 2W8CA 5AFAA 3ZX1A 3FYIB 1OE3A 4P5SA 4AI7A 1ET8A 2IWEA 2XUWA 3GXUB 1NIBA 2P80A 4E9TA 1AR1B 1RZPA 2XU9A 3X1FA 4P5RA 1IBZA 1WA2X 2FQEA 2CCWA 3FU9A 1NICA 1J9SA 1L9TA 3AZUA 4M4RB 3IBOA 4TXVB 1R1CA 1E67A 2XVBA 1M57B 2BP8A 1EZLA 5PCYA 2J5WA 1ID2A 4G7RB 5I5IA 2QPEB 1L9OA 1DZ0A 2VMJA 1NZRA 1PLBA 2OJ1A 5B7MA 4G7SB 1SF5A 4KNUA 1TEFA 4PCYA 2BW4A 4YSRA 3NSYA 2I85A 3DKHA 2PP7A 1PNCA 3ABMB 2J57A 3C75A 1KBVA 4KNTA 3CDZB 1E5YA 4G7QB 2AZAA 5I5JA 7PAZA 4G71B 1BYPA 3ASNB 1JVOA 1JXFA 3FU8A 1JERA 3MBWB 3N2JA 4JHUA 4DP5X 1JXDA 2YAEA 4K9JA 5E9NA 1F56A 2Q5BA 5FC9A 2XV0A 4NB7A 4BWWA 4WTQA 1J9RA 3UAAA 3FQ2A 4A2FA 5TK2A 4E9RA 2EIKB 4NERA 1AS6A 1SHWA 2MRYA 1GSKA 5IY5B 3S8FB 2BP8B 5A7EA 4YSCA 4WKXA 4HALA 3NSCA 4BWUA 3IEAA 1A4CA 4ZK8A 2J55A 1KV7A 1T5KA 3BQVA 4YL4A 3AY2A 2ZXWB 1URIA 1CYWA 1AANA 4BDVB 2GHZA 3MX0B 5PAZA 2WO3B 2DYRB 2FJSA 3FS9A 2FTAA 5I6KA 2YAHA 4QKTA 3TA4D 2VSMB 3CVCA 3ZIYA 3AG3B 2XX0A 3FYEB 4GP8B 1L9PA 4GY4A 4DP4X 2VW4A 1W6LA 4E9VA 1GR7A 3FPYA 3H4FA 1SFDA 4YSOA 2PCFA 1XB8A 1BQRA 4YSTA 5I6NA 1PNDA 2BWIA 4KOBA 3WNIA 5I6LA 1ZIBA 1OOWA 2FQGA 2N0MA 2QPDB 2XWZA 4DP2X 4HCFA 5B3SB 2IWKA 3FSAA 4DP1X 2XV3A 2FWLB 1GS7A 3SBQA 3SQRA 3HEIB 2PPFA 1IKOP 3NJIA 4E9XA 3V9CA 4A68A 3QJQB 2LLNA 1GS6X 1QNIA 1PZAA 3GYRA 2PPCA 3G5WA 4DPAX 1BYOA 5D4JA 5I5MA 2XXFA 3CZUB 1RKRA 3EH5B 1OE2A 4N8UA 4X4KA 1X9RA 2UX6A 1L9SA 1GY1A 1JXGA 3TASA 1WS8A 4FAAB 2PLTA 1KDJA 2UX7A 1AZBA 1IBYA 3CDZA 2P80D 4KO5A 3PXLA 4BXVA 1PLCA 1PF3A 1OCZB 1CC3A 2QDVA 1L9QA 2FQDA 4CSPA 4DP8X 1OE1A 3UGEA 3AW5A 4Q8BA 3EH3B 2FQFA 4JHVA 1WA0X 2WO2B 1RCYA 3OM3B 1KBWA 1BAWA 1J5CA 5B7EA 2IDUA 3PAZA 4HIPA 1OCCB 2XX1A 3EH4B 3NT0A 3SBPA 2BW5A 2I7SA 3TBBA 1NPJA 1KYAA 2HZHA 1GY2A 9PCYA 2IDQA 1NIDA 4UANA 3S8GB 5B1JA 4W1TA 5AKRA 4DPBX 2BZCA 2GC4C 5B1JC 3PAUA 3RYMA 1TKWA 3CG8A 1E5ZA 2YEVB 4BDVA 5I6MA 4GP5B 3U25A 4YSEA 1PZBA 3FQYA 1RZQA 2XV2A 2GI0A 3IN0A 1B3IA 1HAWA 1V10A 1AZRA 2EILB
chains in the Genus database with same CATH superfamily
2ZE7A 4UU9B 1Y1DA 1NKGA 3FB7C 1OB1B 3R65A 3X1NA 4LFCB 1MNUH 2R9HD 2M8XA 4V11A 3UIYA 4BK4A 5IZ7A 4OB5L 1PD6A 4A5UB 3BEVA 2OTJV 4NKMA 4FFZH 5E70A 4A37A 4H2CA 4HKBB 1DLFH 4HQQL 3V4VA 5FAAA 3G6AB 5BO1L 3S8WA 2EDEA 2C3XA 5LXGL 3OB8A 1W91A 1PLGH 1B6QA 3JCUZ 4RQQB 4X1KA 3V7AG 1KXVA 1IBDA 4ZZFA 2BTOA 4KI5C 3KHOA 1OTTC 2YS8A 3KCXA 1KXVC 3GIZH 1PD0A 3O81A 3OUFA 4K0OA 3RYHA 2WQUA 4S10A 3EH1A 4NNPH 3D39B 5IB5A 3UKMA 1B90A 1MOEA 2XWJB 1EERB 3DO7B 2YIDA 1DBML 2OFQA 3D69A 5C92A 1IXBA 3L4YA 1NM4A 1XF4A 5B1CA 1JK8B 4U3FH 2J56A 1KPVB 4JEGB 4PJAF 1XHHA 2AVFA 1SLUA 3CVBA 3PP3K 4G9FE 2UY7B 3TT1L 5EIBD 3O3BB 3JWDH 4JDEA 3TT3L 1ET7A 5B1AB 1ML0A 3L3HB 2OAAA 2B15A 5F1OB 1RUKL 2DRUA 1BQLH 1GM8A 3M7OA 3Q8AA 2R9RB 1CICA 5JIDA 1J5HA 3MLYH 1GGCH 4B41A 2JIXA 3MRLB 1CICC 2VXQH 12E8H 3RWCB 2VXTL 1CLYL 3RWIB 3ZHSA 3MRJA 4JE4B 1RAMA 4XAKE 1HCFX 4PA3A 5DZ9A 2MQCA 2FEJA 2O93L 1U8KA 1PZSA 2E5LB 3WJJA 2QMKA 5KVGE 1AZUA 2X89D 4DV0B 2V2TA 4DV1B 2J6EA 1UCTA 3WJJC 1TJHH 3CE1A 5B7FA 3VD3A 2FX8H 4Q97A 5D1XA 1NC4D 4M3HA 2VDML 3VGDA 4DVBA 1JGVL 1YY9C 3OZKA 5D1XC 4LPVA 2EIJB 1WFTA 3IETA 3UO1L 4MD5A 5I8CA 3A67L 4U1GB 4A6YA 5L3FA 2J12B 1EBPA 1TO4A 2OMWA 3DRTA 1W6WA 1J5OL 5C0AE 2KBGA 3RVUC 5EBLA 2EDFA 3FZUD 1OGAA 4ZW6A 1CURA 5GZNA 2ICES 4X4YA 4PHZA 1XBDA 4NUMA 1HAUA 4V2CB 5GZNC 1RZGB 1K8IA 4LDCA 5I6PA 2WSDA 5AZUA 4N2BA 4NLHA 5HYIA 3FQ4A 4B9CA 1CFSB 1WS7A 1OHZA 2GG1A 2CLVA 1JZIA 1SJXA 4FP8H 3PYCA 3O9WA 3X2QC 3L8QA 1EH9A 2BE3A 5GTIZ 3LN9A 4JFQB 3ARGB 3O9WC 2E9WA 3QG6B 4F58H 3TJEH 3FHEA 2H3OA 1INDL 4HUMB 2X44D 3RWFA 4EDWL 4HMDA 5EIIG 3WY4A 5I6OA 4Z1VA 3GWKC 1SOXA 2F58H 2H3NB 4HD5A 1MJJA 3FT0A 5F89A 3GMPB 3D2UB 3HKDA 5BRPA 1DO6A 3C8HA 4MCYA 5LXVA 3OEHG 4MVRA 4OLYL 2B4CL 4IT5A 1PKQA 4B3TB 3GPSA 4H13C 3RLSA 3DXAD 2O5XH 3K2MC 3V95A 3OUSA 1I1AA 1KELL 1DUZB 5DMKA 5A2IH 2KI6A 4MZ3A 4Y4KD 3MFGB 3MJ7A 2PW2B 1I1AC 1LVEA 1S9XB 4Y2LA 4MZIA 2JKIS 3V9FA 1NCAL 1H9VA 5D9SA 2QVTA 2G9HB 1PX8A 4WENB 1HDMA 5M95B 3BRGC 5LN4A 4XVSH 4Z7WF 3RZCA 4EQ2A 4I9QA 4J4PC 1HILA 4LLMB 3TBSA 2Q7EA 4K7PH 3P4NB 3K6FA 3LSOB 3O4LB 3V5HB 3ZKMD 3A0RA 2IPTH 3UTSA 3T08A 1IRAY 5F71A 2MPVA 3HHRB 4UDUA 2ZNIA 4XMWA 1XXFC 1SDDB 1MEXL 3IXAB 4OQ1A 1CGUA 4CADB 1JL8A 1A7NL 2AMUA 2VUKA 2W9DH 5FF6A 5D96B 1RPRA 3VB8A 3CSXA 3CC7V 1UUSA 5KYYB 1YQ2A 3MRMA 4AQ1B 1I9IH 4KKLC 4LSRH 3CBJB 4PRAB 2A3TA 5K39A 5J13C 4FQJH 1G7MB 2KC0A 3QJUB 3KL3A 1F11A 2J43A 3MV8B 2P45B 1MAML 3QNYA 2X05A 4DV7B 5C93A 1Q8IA 5E6IA 1WFJA 3G6DL 4LL4A 4MTXA 5T3ZE 2P5EE 5F8RC 4U3SB 5E8PA 5E6IC 4CN1A 4XCEA 4UQ2B 5AVXB 2HJKB 1ACYL 3C9NB 4IJ3B 2ERJC 1JZFA 4K23L 4Z7AA 1M53A 2GFBA 2JJ2G 3K9AA 2ZONA 2NYZA 5IQLA 3HVDA 3KW8A 1F02I 1TVHA 4MAUL 1NDTA 4OCSL 4Y5XA 3WAKA 5GRWA 3ZKXB 1Y07A 2EDYA 2YLHA 1SXAA 2YSSA 3VXRE 2WQAA 1OZ0A 3MRIB 5H2FZ 3ASWA 5E08H 4O2EA 5DJ2A 2WTRA 1N9PA 3P77B 3BUYA 4OF5A 5FKPA 4QTHB 3SKJL 1PVHA 3NJGA 1ZPLA 3LQZB 2YQBA 1LMIA 3QFDB 5CN0A 5HDWA 1CDGA 4PVMA 1QBMH 4YSDA 1DDHA 4LKXB 3PHSA 3U83A 5B4MC 4U0RB 4XO5A 5FKAA 5BV7C 3H3BC 2EDXA 4X9QA 2OMYB 3UABA 3BH4A 1R73A 3OHXB 3LB6D 4S1RL 3FCTB 4N8VA 5LOVB 3KJ6L 4IU3B 4GT7A 1MSPA 1J1XL 4LEXL 5SWQA 4YDKL 1S8DA 3ARQA 2A38A 2X4NB 1QG3A 2VL4A 4NOBA 4QF1A 3M17A 5DJZB 4LFHG 1LEKB 3JT2A 3EVKA 3KEDA 4PJBB 1UWGL 2HPTA 1AKPA 3LRSA 3C6EA 4LFAO 3HKZA 4OVVA 4GS7B 3QIBA 4UNUA 4I8DA 3AFLA 3BUBA 4KKPA 4NQCE 5J4MA 4MLSA 3ZIAG 3QIBC 4MTMA 4JO2L 4NZTL 3VI3F 3LKQB 2GJJA 1NWPA 1GGBL 4K5NA 3MHSC 2EINB 4MWFB 2HLAB 2H3XC 1KNOA 5FWRA 5KHIA 3MRCB 4UCSA 1GC1L 4XCNB 2COQA 4ZFOA 4PR5B 5HPMA 2BSDA 5E2TL 4B3SB 4QRSB 2AKRA 5CEXA 3OKKB 1MIML 4RWHA 4MA7H 2Z0BA 3DOIA 2FQEA 1OF2B 5BMFH 5JIIA 2HKAA 4Z3TA 3AVEA 5IHLB 2R1YA 1LNUB 2J1ZA 4XPBL 5DHXB 4F7PA 5CZVL 3DX2A 5AOJA 3GI9L 4ZAKB 1JFQH 1FVCA 1R3HB 4JRYE 3S35H 1CMOA 4QYAA 5G5DA 4N9GA 5IBUG 5KS9B 3OE7G 4F7TA 5DJXB 1JD7A 3BKYL 1CE6A 4L8CA 5LGTA 4Y1SA 3SPVA 1AJ7H 1KIUB 4KVCL 4P46C 3WL9B 1JZ4A 2QV4A 4UTBH 2NZ9C 2PP7A 3BXNA 4IM8A 5I73C 4WHDA 2LQTA 2YICA 2J1YA 1P2CB 1SJEB 5BXZA 1T7YA 5I1KH 2F53E 4XNYH 5HI4C 5DS2A 1ZS8B 2DBJA 1PD1A 1FL6A 2DIAA 2VQ1B 1A6VH 4QHMA 4H26A 4UVCA 1GVIA 1Y67A 3QK0A 2NY0C 5B38G 3D4GA 1WD9A 1CIDA 3FTZA 5E9NA 3D3IA 4L8JA 5G4MA 5KZCB 4JGNA 1LO5B 1ZANL 2H1XA 1F51A 4GAGL 1S3KH 2EIKB 1SQBH 2D7MA 1PTZA 2VDPH 1SLWA 2HJLB 2VLKD 4NRXB 1M90W 5A3ID 4LASL 4JO1L 4HFWA 5EZLB 1S7TB 4PREB 5AALA 2HN7B 3O0RL 4F27A 3CRMA 3P54A 1RI8A 4WBNA 2V17H 3D08A 4AENB 4TUJA 5IK3A 1BSMA 5FCUH 1TKWB 5D7LA 1OT4A 1A1OA 2WVVB 3L2MA 4JO4L 3WU2Z 1DLBA 2BJML 2XTJE 1P69B 4UT6A 1PNLA 5DJ8A 3PP4H 4BA8A 5BO0D 4EUPB 4PJCB 1CEZA 4HFUH 1TZGH 4J3UA 2V37A 1C1EL 5T1JA 1LO3H 2OXGA 5C8JB 4OZIA 4NWUL 1PM9A 1QSFD 3V52L 1PNMA 3VUAA 3S5YA 3CCVV 5KUMA 3NABH 2HEPA 2P5EA 1P4RA 2EDTA 4LCUA 5AVWB 3GS0A 4X7FC 4HJEA 1WGVA 1SM3H 5IOPA 4LCUC 2D2CB 1JMZA 4L2YA 3C90A 2I32A 1NH6A 1OOWA 3W11D 5L2JB 2MH4A 2QPDB 2J73A 2WNGA 3L2LA 4C57C 5EEVA 4N0UA 5DS8B 4XBPB 1GS7A 3PV6B 2G30A 2WA3A 2XKSA 3L7EA 1IKOP 4JR9H 4K9EL 4LCVA 4MDIA 5DJDA 4Z76B 4PJ9A 4J7RA 4X6DB 2ZSWB 4PY7B 4WTZA 3OJ2C 3RHWK 4BFGA 4BK8A 5HP5A 4Q9QL 2XN9D 3D52A 3ETBF 4JFTA 2PPCA 1WP6A 4LE8A 4UDTA 5DUBB 4BEIA 5ICZB 1EEZB 1D9KB 3LEYH 2ZE8A 1BFTA 1U6AL 4G42B 4Y5VA 3VD7A 4YXLL 1OE2A 4Y5VC 1JHTB 2UX6A 1UXWA 1L9SA 1KJ2A 2VQFO 4UM8A 1KTLA 4I50A 4ZMNA 1MHEB 5BOZG 2GTWB 2C9SA 5F2VO 1RFDL 1MCOL 1ONQA 5ADOH 4ORGA 1AO7E 1GW6A 1BFSA 1LD9A 1A6TB 1JPSL 3EYSH 2VWKA 5CA3A 1RZ8A 2FO4A 4YJ2A 1G6RH 3G5YB 4YGAB 1JJUA 1OWRM 4UQAA 3F7KA 2EXYD 3BZ4B 3MBWA 4DP8X 2QWNB 3CFJB 3WDJA 5FOBB 3ARDA 2AXTZ 2RHEA 2IQAA 2Z7UA 3FB6B 3GIVA 1OK0A 4X6CA 1BFOA 5I15L 2VJ0A 3ARDC 3OKEA 1OCCB 1DJGA 2XA3A 2QADD 2XZAH 1VENA 2V2XA 3EJQA 1JMKC 5IWAO 4MW8A 3ULUE 2X1PA 4LPTA 2IDQA 3EYUH 3PL6D 1REIA 1XGYL 3M86A 4PWEA 1F6LL 3UG3A 1HZLA 4WWKC 4OU3A 3FFOA 1JFHA 3RYMA 2ZUTA 5DJ0B 3P4LA 1KTDA 2BY1A 3LMJH 2EYTA 4CVZB 3QUXD 3H9SA 1J9CT 4DJMA 3GLZA 5CBAB 3S98A 2FYVA 4K7FA 1A9EB 3IFOB 1DDTA 4EMZA 3GMOB 4J27A 2FZ3B 1RZQA 1P5UB 3A6OA 3AAZA 4JKPL 2FBRA 2VLRA 3DOSB 1M4UA 1A6ZB 1XGTB 3MNWA 5L4IA 1CG9A 1MY7A 5D70H 4HPYL 5E9DD 1HWYA 3AG3C 1OJHA 3WIFB 2KG7A 1MRFH 1YEKL 1AXSB 3F62A 4X7SL 3DDFA 5CD5D 4D9QE 1FNSH 3K2KA 4X7TB 2FR4B 3HIZA 3U9UB 1FJGB 4LVNB 4YHML 5DU7A 4HF5L 4UT7L 3OKOA 3UTZB 3GHEH 1CTNA 4P49A 4CMMA 3NOIA 1W0WA 1Z9SB 2NY7H 4XP4L 2G9KA 3DTUB 4FL4C 3QORA 4U05A 2JKLA 4Y4HD 5TE4H 2XWCA 4H8QA 1P7KB 2VZ1A 3BYTA 4EVNB 3QORC 4L1LA 2AQNA 4KWUA 2QDOA 5I74B 1SQVH 4R5XA 2ODMA 5ENWA 4Y1AA 3DUSB 3RTQD 3KYMB 3SOTA 3AK2A 4R7CA 5T1KA 1YVLA 1XL4A 1S7WB 5KMGA 1YCSA 3BSZH 3AGVA 5A7BA 4BW5A 3CC2V 3KPMB 3VMNA 2EULA 3BVVA 5C0AB 4LWSB 1I9RH 4XNZB 4YDLC 3QIWB 4DR4B 1CD1B 3GSVB 3C5XA 4JZNA 4XMXA 4WFHD 3GFUA 4DUZB 2WAQA 1FYTB 2Q8VA 3CN3A 1HWHB 4JX0A 4YMPA 4JHWL 1HSAA 3LEVH 1V7NH 2IH9A 2PYLA 1AR1D 2ORBL 3B2MA 4TVPE 4DF9A 1KEGH 1QKZH 1ZVSB 1DJSA 4JY5L 2KSDA 4JBSA 4BE6A 1GTOA 1W0VA 2CBQA 3P0VH 1SZTA 5ESVB 4P2OA 4FFBB 3U48A 4YK4C 1GOGA 4P2OC 2CO6B 2R2EB 3C3TA 5CUSL 5K1VA 3T04D 5IYBO 1E6OH 1PEWA 1U3NA 2QWQB 1K4DA 4OZGA 3SDCA 4U1HB 3HI6H 2Y07L 1FO0L 4E9QA 2ETNA 3I55V 3C2SA 1K4DC 1H8OA 1KN4H 3SDCC 1JZEA 2GJ6E 1T7XA 1QLRB 3V79C 4IRJC 5IMOA 1H2NA 1DQDL 3EHBC 5DF0A 1MRDH 1JVKA 3BWAB 4EBQH 4P9HC 4QTFA 3H1LH 1HXMA 1WJZA 4WCEV 4AEFA 3KDMA 3NJFA 3UCRA 3SJBC 3HJ0A 2VC2L 5IW1A 3IMWA 4HOZA 3KBEA 4WZ9A 4DR6B 1GMIA 3QAQA 2CKBB 3ZE1B 3EYOB 1IZ3A 3GT6A 4HJ0D 4ETQB 4N2OA 1BMFG 1FSKC 2JLLA 1WBXA 2EILC 5KS9F 3BZEB 1UWEL 1WZKA 2OX5B 2OLDA 2WZ5A 2IPUK 1YEFH 3HS9A 3BVXA 3S9DB 5I0DA 4XXWC 3W82A 4BQ8A 2RQEA 3WO4B 1TTFA 1GCYA 4WUKL 3HUJE 2FL5B 4M1GL 1KTKE 1P84F 1IFHH 5FXCH 5HHNB 3GXPA 4HT1H 4Y9GA 1BG1A 3DIVA 4IS6B 2B08A 3QQ4B 3L3DB 5IYDO 1S72V 3LS5L 1IO4C 5FYKH 1O5PA 1XL6A 3SGJC 4PLJD 4MVUA 4HU8A 5GS1A 5LCVH 5LXTA 2ESVD 1JGUH 1XH1A 5GS1C 1QO3B 3BQUB 3FN9A 5LHDA 4YXWG 2FX9L 2AQPA 4N0YL 1AO7A 2CR0A 2V5MA 4JI1B 1KGUA 4GIPD 3NMEA 4ZTOL 1E9QB 1A0QL 2FYYA 1MW0A 4HAFA 4WGKA 2C8NA 3QW9A 4A7GA 4KNQA 4FXGA 1ZCRA 3REWB 4JFEE 4QRPE 2OSLA 1N6QH 1XMWA 5KAFZ 3OKLA 4QLWA 4FXGC 5JH7A 4TQDA 2QVFB 3MJ8A 2JQMA 3LZFL 1ZVNA 2H0FA 3CCUV 1USQA 2X4PA 4ANXA 3GDBA 1H3PL 2EDHA 2FO1A 2Y1YA 2W60B 2J1XA 4PGCB 4HX1A 4PJCF 3BDYL 3ZHTA 4JI7O 3GRWL 3LPOA 2CPUA 1NIAA 5GXBB 3QDMD 4OTXL 4HDIA 4J3OC 4ZMLA 4W4OC 1YEHH 5H4YA 2F8OA 2A9ML 2LVEA 4KX7A 1INQA 5DFTA 3S5ZA 1YSOA 5GGSA 3TO4C 2GV9A 1F3JB 1Y74A 3OJDA 1AZZC 5I19H 3DX9A 3JV5A 3QDJB 5MHSE 3HE7B 4R90H 5EZOH 2BIMA 2V7NA 4EN3A 3GBMH 4GMSH 4Z7OB 2YPLD 3MA7B 1OAYL 3EGXB 3NGBC 3PQYB 1U8PB 4EI0A 3FT3B 2ZKHL 4ZI8A 1IEAB 3FO1B 4ONFL 5E94B 4JRFA 4UCFA 2JS3A 4YC2B 4PJGF 1C5CH 1GZPA 4G7VH 4JPQA 5DD1L 4JM0A 2ZCEA 32C2B 2AGAA 4UYQA 4QRRA 5I75B 1WNSA 5F70A 3LCYA 4EDXA 5J2UB 4NQCB 4KXDA 3ZY7A 1DFBL 1YAZA 4GUNA 3ZJAA 1AY1L 3HBPA 2H6OA 4X80L 2MNJB 4GI9A 2NY6B 4AQYB 2LLLA 4JHAL 1XZ0B 5T1LB 5DZVA 1WN7A 4N2NA 1YHPA 4N21A 3SSGA 4NI3A 2Q86B 1HHGA 2YRPA 4G43B 4OGYH 4MQXC 1K97A 1SHSA 3S3JA 4XE5B 3JT0A 1PY4A 4JI5B 2IXQB 4M43H 4DGVH 1XF2A 5ESQB 4Q9RL 2GVYA 2BY3A 3LS4H 1BVNT 1FLTX 5EB9A 3ARED 1SHXA 5DRXA 2YIBA 5AW5B 5IGXH 4TSBH 1NEZA 1FL5A 1U30A 1VQ8V 2Y3NA 3FU6A 3L5HA 5IQ9B 1J5EB 1IVSA 4BKLA 2EICA 3BAEH 4QD2E 1HC1A 4QRAA 4XNQA 1B6DA 4ZOLA 3MDJA 4L8SB 4YHZL 3CRCA 1E7UA 3QZOA 4L5FH 4N1CA 4PS7A 1A5FL 4HGMA 1TQCC 2OTWA 1A4BA 1MCPH 1QUPA 3TPUA 2XBTA 4JRYB 1QFWM 3JTSA 4PIRF 1B3JA 1BZ9B 4G1EA 5FDYA 1E65A 4HEPG 1V3MA 3PHQB 4GAJH 4F92B 2BHYA 3QWOA 5HYJD 4DV3O 1P1VA 4CS4A 2DYPA 2K7PA 2C1OA 1J0YA 4M3KB 3KS0H 5I0XA 2B20A 3G08A 4JO3L 1NDGA 3AXHA 3CX5J 4Z3JA 4DN4L 3BWUC 3M46A 1JZ7A 2F53B 4IIQA 3B3BA 3DUUB 3GMNB 4U1SA 3D8CA 1FDLH 3QQ3B 5ETUB 2VM9A 2UY6B 3IB4A 4N68A 2F5BH 2UZYB 1F97A 3FBQA 4FI8A 2IH1A 1S9VA 4P59L 2IH1C 1J05A 1TT6A 3HG5A 3IGAC 4UV4H 2B59A 2C7UB 1PAMA 4BFOA 1LR1A 3U4BL 1OE3A 1JBJA 3SQBB 2WSSG 1NDMA 2ZT9C 1Q3EA 3QWRD 4OCXL 2IWEA 2C1PB 2YGVA 3FQWB 4OLVH 1A7PH 1CTMA 4AQAB 4WI9A 1RZPA 3QTCA 1PPIA 5BR8B 35C8H 5TH2A 1VSCA 3MBXH 1EZUA 3APFA 1MFAL 4B27A 5IF0A 4JFWA 4I9XA 3FZUC 3LDCA 4ZNEE 5JW3L 1G1XB 1YNTB 5LWYH 3B8MA 2RA1A 2XTJB 1D7FA 2WBJB 3L70H 2E75C 3TZVC 1HYSD 1A1NA 5DLLA 1TA8A 4Y16B 1DANU 1TVBA 1A6WH 4YHLL 5F7EH 3L1FA 4LNRA 4PGDB 1SESA 1D6VL 5AZEL 5K69A 3LXUX 4PN6A 1G84A 5JLZA 4JF3A 5JW4M 1WFMA 1MCDA 4LLWB 4J3BA 2OM5A 3A4FA 3MACL 1TEFA 3QPXH 4I85A 5HSFA 1RHHB 3DURB 3H7BA 4RFNC 3CC4V 4IBUA 1PNCA 1VCBC 3LZPA 2B1IA 2HVJB 2CPCA 2QKIA 3NFNA 4NNYB 1T7WA 5E51A 1EIBA 3F2LA 4IJTA 4KDWA 3FO2A 1ORSB 2GK0B 4G7QB 3WIHH 5IJ0B 2IIJA 3E22B 4U4BA 2V3FA 4XI5C 2HRLA 1ES0B 5JORA 3D2TA 3ASNB 5KJ4A 4JDVA 2EE9A 5CILL 1K33A 3FU8A 3HKEA 1KXQE 3OSVA 4N1EA 5JXAH 4NKOB 4LHUA 1Z2KA 5AW1B 2ADYA 1YUKB 1E27A 2WA4A 3S88H 2IWGA 5CFHA 3MXVH 2Z8WC 3GSRA 5K9QI 2Z0AA 1HL8A 3CQQA 2BSTA 1MWAA 4FFYL 4ZPTB 3GSUA 2HWZL 2DW4A 4K8XA 1E4WH 1ZUQA 3P69A 4L1SA 5A40E 1GN4A 5IY5B 1OAJA 4NN5C 2Q6WA 2UXDO 3STBA 3OAAG 2YUWA 3OGIB 2UUBB 3BUQA 1U8QB 3DSFL 4GX0A 3EJUA 4LXFA 3GK8H 4UT9A 3SE8L 1U93A 2VLJE 4RFOL 1Q9WA 1L9NA 3BW9A 4IOSA 5AVRB 1HQRA 2WLZA 3WTUA 3JASA 2NX5B 1AANA 1DE4B 3K74B 3ULVC 1EFXA 3ZE1F 1DVFD 5DDHB 4XNDA 5JWPA 1IM9A 4PJIA 3CC5A 3MR9B 4BFKA 5IVOA 4AUUA 1G1OA 2GCYB 2Z91A 4HQQH 4X6BA 1HHHB 1SUHA 3KWXA 5BO1H 4OFYD 2Y5TA 2JQZA 2H32B 5HHOE 5LXGH 1G9NL 2Q20A 1UB5B 1IEBA 1N67A 4K3HA 5GGQL 2DKUA 5D5ME 3RY6A 3HAEH 4PUBH 3RY6C 4NQEA 5ABZA 4DR7O 2MOVA 5FHAL 2B3RA 3CVHA 4KOBA 3TVMB 5E8NA 4G80B 5E23A 3LXCA 2FQGA 1OPOA 1DBMH 4JFFD 4KJWD 1HCZA 1JNJA 1NANI 4XMLH 3TBVB 1XNQB 3VB9A 4XO3A 3WB2A 5FA4A 4RMWA 2F68X 2E7HA 3D18A 4MHHI 4G5ZL 3BSGA 3H42L 4ALAL 4J80A 1KG0B 4KI1A 2P8LB 5CR8A 3TT1H 3FOLA 5F88A 4X65O 3TT3H 4B3EA 2X12A 3WEXA 1RUKH 1E0OB 2VWEC 1OP5K 2XXFA 4F33A 4JM4L 1HEHC 3TH3T 1KTBA 3LRKA 2WN3A 1ZT4B 2IALA 3U46A 4L37B 3H9YA 3MV7E 1N59A 4MA1C 4KKAC 5HHXL 1AGBB 1R3JB 3K6IA 2VXTH 1CGWA 1NCDH 2PTUA 4WWID 4BXVA 1L6ZA 3D0VA 1FFRA 4IHJA 5C86A 1HR0B 4G8GA 3SPHA 1LO0H 2AK4E 2RB8A 2WXPA 2V2WB 1ZGLP 2Y7OA 3RTLA 1NGPH 2VDOH 2VERA 5CB4B 1S7QB 3SODB 4OSUH 5SWSD 1OCOC 3VG0H 3OBAA 3SPJA 1BAWA 4FQHA 1X5MA 2R1XA 4N0FB 4OZFH 5JW5B 5KSAD 1F1AA 3ETQA 4NBZB 1YECL 3MCG1 4X99A 1X4ZA 4YR6A 3LN4B 2BLFA 2VABA 1E5UI 2XNAA 4PGBA 5EBMA 3TBBA 3UO1H 4QOKE 4PWJA 1EAOA 3S8GB 5EBMC 3HFMH 4M5SA 3VFRB 1XH3A 2BP5M 3GXDA 5JVDB 4EI5C 2YBGA 2LJ2A 3DTXA 2KZ1B 5I1LB 3GSNA 1JPGA 5CINL 3DGCR 5C0JA 4MTOA 1EWHA 3VWJD 1BT8A 1BHGA 4BH7B 1MFVA 2A6KB 5JDSA 2C9QA 1H15A 3JYBA 2A6DA 3ATBA 5DD5L 1D5BB 4G6AC 4AEEA 3JQOB 5J3HD 5EZYA 3IN0A 3UZVA 1Z0NA 1QLEL 2A4ZA 2CLRB 4O2AB 1RHFA 2FT6A 4OGAC 2DL2A 2Q76A 1N8RW 1MF2H 4ZNEA 1FVDA 3ME0B 2VDLB 3O0LA 1UADC 4L8BA 4M6ML 4ZFGL 2EXWD 5E1HB 3VXPB 3GI8L 2IPUG 2EVHA 1K5SA 4OLYH 2A73A 2B4CH 4MS8C 4U7NA 2DQFB 1MW3A 5JTWA 3L3JB 2YQ3A 3KLQA 4R3SB 2DV6A 3OG4B 3MLRL 2ZX8A 3WN5A 3S5LA 2ZKXA 4FQCL 1G6UA 1ROWA 3D12B 3WN5C 3DHUA 2IFFL 4YNYB 3KW7A 1I8KA 2CUMA 4P2YA 3T2MA 2WIIB 4CZZA 4PRNA 5DD3L 3T4AA 4JVPA 5LBGA 1ITBB 3PWPE 4KTYA 3ZRFC 1H2GA 2P6JA 3QVNA 1TQBC 3LKRB 3T4AC 5JZ7C 1FI8C 5DZPA 1E6JH 3B9EA 5CCHE 2HFFA 2PWHA 2O57A 5KBPA 3U36A 5BS0D 2P47B 2Q7GA 4CBCA 4J5VA 1MEXH 2DW5A 3HUJB 5GZOC 2XAJA 4IOIB 3TEWA 1BPVA 3VWKD 3BKCL 4HLEA 3ZHRA 4YIPA 1CLOH 1QRKA 5E2VL 4U1NA 3OTOB 2JKJA 5IDJA 4NDMA 3FTWA 3LPWA 1X44A 1F3RB 4TUKL 3CH8A 4LT7A 1VQ4V 5E5LA 5FUCC 1IQWL 4OIIL 1FAKT 4BCYA 3OTFA 5HHQB 1ASPA 3E6HB 3VXSA 3TCXA 3MNVB 1K5WA 1KLUB 3TPKA 3AQZA 2YRZA 3QUZB 5CBFA 1ACYH 4DRXA 4AVHA 4K23H 2V9QA 2AERT 3BCCH 3F5WA 1J5IA 2DLIA 4ZIBA 1U8OB 3EOAA 3UO2A 4LCCC 3F5WC 1W8NA 3VGGA 1QBZA 1QACA 1KD1W 4XNBA 1EHAA 1YC8A 3C08L 1YNTF 1IFRA 2FJGA 4NI6A 3VXUD 1F42A 3QNXA 1P4LA 5HI3C 4YDVA 4LVHB 2ZXAA 3TN0D 2JKXA 3NCJL 5C08D 2NLJA 1WGOA 1R33A 3SE4A 2NUTA 2NUPB 2NLJC 5EYPA 2BC4A 1KF9B 1AS8A 4IEFA 1WFUA 4YIQA 3HG2A 4UINL 1Q86W 5D6CB 1F5WA 4JLRB 2FECI 2XLLA 5CEZL 3MRDB 1SKVA 2EJ7A 3ZGHA 4D0BB 1Z9PA 3HPLA 1QNZH 3ILQD 5D1ZB 4PJEB 3TL5A 5IFJB 4O4LA 3HN8A 3HPLC 1J95A 3OAUL 3W7WA 1EQWA 1QATA 3FUEA 5DFAA 4AMKH 1T1XA 4U6XB 3K2UL 5DR5L 5TQ0L 2FT8A 4RZKA 2A3QA 4LARH 5DUML 5FUZL 3LKPA 3D0AA 2Q2LA 2IAAC 4TNGA 1R5WB 2W81C 4JY4A 5EZJB 4S1RH 2R7EA 3OC5A 1O9WA 4PY8J 3SHSA 3KJ6H 4WI3A 3L1EA 1R3IL 2LV4A 1XHZA 4WO4B 3SKUD 4LEXH 1EFQA 4GO9A 4F37K 1VGKB 3LKSB 3O3UN 5C09E 3B5HA 4GQQA 5AYTA 5GS0C 5KVMC 4XN7A 3MC0A 1MKFA 4HZ3A 1A6PA 2ZF9A 4FNLH 4OCRH 2ENPA 5CGTA 2DYSB 3BC9A 4XPGL 1T1WA 1EZJA 3E8VA 4XAWL 3VRJA 2R4RL 3C5SB 1FC1A 1OALA 3QJFB 5EU7C 3CDGA 3CC1A 4UCVA 4NKIL 3ZW3A 5F6HI 3O8XC 1X5KA 3TEZA 4X88A 1GC1H 4GT0A 4N28A 4O5LL 3O45B 5IHZA 1N70A 2BTQB 4QOKA 3UTQA 3ZTJH 4N4YB 3GSQA 1SDYA 4NZRH 3MRFA 1KB5B 2DWEB 4JN1H 4TN9A 5CSZB 4FFZA 1MIMH 2WBWB 3O6FB 3MV9E 4CMHC 3MLVL 1OM3L 3BCDA 2GSIB 3CX5K 3LHAA 1FBIL 4K2UH 1W16A 3GSXB 4Q4EA 2CAKA 5GGVL 3VRIB 3IJYA 4XPBH 1T21B 5CZVH 3GI9H 1CFNA 4WQOA 4LNUB 3BABA 3CZKA 3ULUF 5IB2B 4YDNA 5D1QA 1GS8A 3P11L 5D1QC 2DIEA 5KANG 2EH7H 1CDCA 4IKNA 1U97A 4HHGA 5IV2B 5JPNA 1OP3K 5LGJB 1URZA 5EF2A 3WTSA 1OAQL 2YUAA 1AQDA 2N56A 4FLXA 2AJXL 4PJ8C 3FL7A 5CLXA 5JPNC 4F6RB 4QE7A 2JJUA 3D8MA 3NUKA 5JQGA 3DJTA 2CALA 4H25A 1I3GL 3B8SA 4H88L 1PJ9A 3JWDC 1SJHA 4GP4B 5FYKU 2HKHL 5HPOA 5FECB 5C9KA 1VQ6V 4MA3A 4C7UA 1Q0XL 3ARPA 3WFDL 5KYWA 2HTKD 3GGWA 1F41A 4KXZI 2Q3AA 2EIMB 2EYSB 4QCIB 1JF5A 2WWMC 2EP6A 4BFIA 5C9JA 2JWYA 2CR3A 3WAJA 3W7TA 2KKWA 2WWNA 3P0YL 1TAEA 1M9WA 1R6VA 4DFIA 2ALWA 2VZ3A 5E2UL 5CD3B 5INDB 1BXUA 3ES6A 1FCGA 4HPOL 4AHCA 5F0LB 4BQ6A 4CRPA 1QU7A 2FK9A 5LKNA 2Q7NA 1OHQA 3OT7A 4PYHA 3UAEA 4HKJA 2WWKT 2CJSA 4JO4H 3CFUA 5T5NF 4OY9A 3CZJA 4X42A 2BOBB 2BJMH 5DS1A 3LSSA 3L45A 4RFEA 1JJ2U 2J2ZB 5F8QC 1M6OB 4K3EL 5DRNB 1NL0H 3RGVA 4PP1D 3Q5TA 4XDJA 4JKNA 5IYZA 3RGVC 4Z9KB 3HHSB 5CN3A 2BCKA 1XB6A 3CLFL 3KLLA 4IRSD 4LGRB 3BYYA 2BIPA 4FA6A 1Q8MA 3C5ZA 1RPKA 2UXBO 3CVDA 1TVKA 1MCFA 2K3TA 5ESAA 3X17A 2N0KA 3C5ZC 3HA0A 4W9CC 5GGTH 2A83B 5DJCA 2OR8A 4HXBL 4NO0D 2XFGB 5L6YL 4HIEA 1P53A 2LW7A 1P7QA 3BPCB 2UXGA 4RDQF 1CF8L 2WLLB 3DIFB 5FGBA 2B5IB 1SQ2N 1SUJA 1GTNA 5FGBC 4Y2OB 2E74B 1M05A 2ZICA 3NJKA 1EPFA 4X4XA 5FNVB 4KKCC 5HJDA 5DI8A 4K9EH 2ZUQB 1KGYE 2D4DA 2AJ3A 3NTCL 5GONA 4N8VG 1YYML 4L05A 3RI5K 2PCFB 1TUBA 1TLKA 4MYWB 3THMH 1ETZA 3NA4A 3QEHB 1T1YB 3QQDB 1XVSA 1LQBC 1UFGA 1YY8A 3H1IH 4YXLH 4TL4A 3V6OA 2C9VA 1L9TA 2LTQC 1TVDA 5ITBH 4OLEA 2VLJB 5F7LB 3V6OC 3O6KL 2P8PA 1PG7X 1M57B 1M2OA 1RFDH 3UCSC 4GPVA 3BAYA 4A7SA 3SCMD 3RN4A 4L2LA 1JPSH 2NYYD 4X8JA 4POUB 5EC1B 2NW2A 2BS8A 3VH8A 4PBDA 4QT5A 4XTRD 5J06A 3PDOB 3PE9A 5HHOB 3HKFA 4R2GB 5A16B 4M8VA 3L3GA 3E6FB 1K4CA 2H1PL 4FFWC 3A24A 4GSXA 1T22B 5I15H 2FB4H 4A7QA 3DC0A 4AZ8A 5D5MB 2YGQA 3MLTA 2UXCO 1KBVA 4PRPB 1GGYA 2H4EA 5IMMB 4Y2DC 1QVGU 3HUJF 4OCYL 3GWOA 2HH0L 2IJHA 4FQXA 3VSUA 4HXAL 1XGYH 4P9OA 3CSYB 5F44A 2O30A 5AW9B 2P90A 4DWHA 3DOHA 3VFNA 4FQXC 3JZYA 4JRXE 4NN7C 1JVOA 2BIOA 1QSEE 2ENYA 3L17A 2JNZA 4NO5B 1VB9A 5I0ZA 2Q69A 3AABA 1UJWB 4J7JA 3BP5B 4QKXB 3UROR 4UTCA 1BD2B 4GI6A 5I18H 4JMXA 2GKIA 3IXTA 3IJHB 2XZZA 4JKPH 2CLZB 4CH5A 3BWZA 1NCBL 3B9KD 1TQSA 1BBDL 4G8FA 2FIKA 2IBBA 3QQ9C 4JREB 4HS8L 1WZ1L 3I02B 3AU1B 2P22C 2LAGB 3EDFA 3BPOB 4ZMAT 3RPIB 2W9LA 1T66C 4FMKA 4WW1B 3EJTA 3MV7B 2EEFA 4TUOA 4X20A 5EU6E 5EUKA 5C0CE 5DYOB 2AXFB 3LN5B 3JV6B 4W68A 4K8RD 5JIMA 4YHMH 3I5DA 4KK6C 2DDQL 3BAXA 3K5RA 2AK4B 3ZDYE 4JI6B 3RT3C 1Z5LB 1F4XL 1FNAA 2HUEA 3K04A 2HVKB 1Y0LA 1JDAA 2BVEA 2EDJA 1YEDB 4RWUA 2NNAB 4DP4X 1EZVY 1KC8W 2JS5A 3WS3B 4UQ3A 1AKJD 2PCPA 2R0LL 4GFXA 4A7TA 4JM2D 4U4IA 4PJEF 5BVJA 2X0LA 5MI0C 1HU8A 1T20A 4HH8A 1O7DE 4AE1A 1VFUA 1ZIBA 2N0MA 4FYTA 4JAMB 5KHKA 3NFSH 3JUZA 2XV3A 3N1MC 3W9DB 2H0JA 3T8VA 3KMDA 4JHWH 1VGEH 1S7SA 4TQHA 1WC7A 2NQCA 1GGTA 1RL1A 2X2JA 4JY5H 1GS6X 3ISRA 4U3XA 5ACZB 4GKOA 3NH7H 4YLCA 1HNZB 1AGCA 1MRCL 2C3VA 2KHAA 3EXJA 3K57A 3HMXL 4N24A 3U2JA 5BW7A 1SYSA 1IARB 4H1LH 3T8MA 1CBJA 2A6JB 2L7QA 3PDDA 3SE6A 4MMYB 4DYLA 1YN6A 1BSIA 2QEXV 3GJEA 2Y9RT 1U91A 3FCUB 1U8MB 1TPXB 4M6NL 3ABMC 1TNNA 3BX7C 4F8LA 1A22B 4TRPL 2VR8A 4X50A 1XF3B 1FO0H 5D93B 1WEJL 1C9SA 3EJYD 1G1KA 1IM3A 1ESOA 2D73A 4YDIL 4I88A 2X1XR 4AGNA 4Q8BA 5DQDL 1EZVX 4WTZG 3STLC 5EEXA 3Q2LA 5F93C 4E42A 4ECNA 4LF8B 1FGVH 2XWDA 1QEWB 4KK9D 2JE8A 3AB0C 5E1AB 4GUOA 1U3HD 4CGUB 1RZJL 3F7PC 3WV0A 4JKLA 4XHQA 1NKDA 1DLHA 3I3BA 2VLLA 4GBXB 5DHMC 5AUMB 2HFEA 2Y7NA 3PWPB 1XEDA 4NP4L 1XCTB 1KCSL 2HFEC 2XQYA 1UWEH 6TAAA 4LBEA 2ZKMX 3H9ZA 5DYFA 3TESA 5KUKA 4UTBA 3FQYA 4DK6A 2ZD9A 1R17A 3BA8A 2DYRC 1MJ7L 1JWUA 5LQBH 5E5UB 4U2YA 4M1GH 1D7CA 2XTLA 2MQGA 5AVZB 1AZRA 4UVBA 2Z4QB 3IPBA 5E4EC 3T6XA 1ODUA 2VRQA 3LS5H 4W70A 3T6WA 3IMTA 4G70B 1WIPA 2R8SL 5T33L 1JTTA 3W39A 2FX9H 2C7FA 2L3BA 1T5EA 3EIFA 2FGZA 3IN2A 4N0YH 3WE6A 5FO8A 1NSNL 1DZBA 3KCPA 3WBDA 1WWAX 5E03A 2VL5A 4ZTOH 4OGQB 2HRGA 3KL0A 4DTGH 3CH1B 3P3RA 1IGYB 1KLFA 2HX8A 4UB8Z 1OO2A 3LKOA 3NK4A 4FE9A 4K94L 4A2HA 1CDBA 2E46A 3ETDA 2YN3A 3WY1A 1B4JH 3G5XA 2WZPD 3E0GA 3QDGB 3FTGA 3AU0A 2V8LA 5JIHA 4G83A 4Y9CA 3ARFC 1TQUA 3CRRA 4O02B 4PDRA 1AILA 1ASQA 1OZUA 3L75H 4NAJA 3Q8FA 2WLHA 1IGFL 4WVRA 3V0WL 4XWGL 2ARJQ 2KKQA 1BA9A 4N20A 2ARHA 3K7UA 2CA3A 5FYJE 1LXMA 3WI9A 2YIAA 4PJ6A 1T0NA 2A9MH 2ARWA 1YJDL 3QEQE 3UZQA 2ZE5A 1VZHA 2BVPB 4H0HB 4LDOB 4WRLA 1UM6H 3NCWA 3GKWL 3ALPA 1OAYH 1JZ5A 4GX5A 3EFOB 4RLDA 4RVBA 2ZKHH 3BEVB 5FFLA 5JO5A 2CU9A 3GZQA 1T03H 3L71H 3H6AA 3FF7A 4I7ZB 5CJXA 2A9HA 1J8HD 1UWXH 5DD1H 5C09B 5I1AB 3OPUA 3QIUA 1W59A 4JFSA 5CJXC 4AYGA 5C07E 5GJTL 4HIXL 3ESUF 2FWOB 1RP9A 5HDBB 3EW3B 3EG9A 4NZJA 3VD0A 3RJOA 1UH2A 3LAFA 4E0RB 2CHWA 3JALA 3BP4B 5HXMA 3EFDL 4JHAH 1O6SA 2X42A 4GG8B 5IB5B 5KVGL 5JW4R 2XACC 2G5BA 3P02A 4KNSA 3G67A 3B56A 1I8LA 3NPSB 5MEOB 3IKKA 2ZAIA 5F7DB 4NO2A 3HZ3A 4E68A 4X66O 1HS6A 1I8LC 3QHZL 4Q9RH 2KYIA 2DJUA 4ZFOL 4J7KA 5EC2C 1G6RA 1M6UA 4PA6A 2BZ7A 2EE6A 4XN1A 4QXTA 4JDEB 3MV9B 2JJ1G 4U3CA 3KPLB 2X6CA 1DEDA 4DVRH 4FLOA 1JOIA 4WV1A 3DYPA 1IC4L 1WQVT 4YHHO 2X87A 3ARRA 4POZC 5KVDL 2Q87A 4WV1C 3NESA 1NPNA 5IMLB 3E3QC 4YHZH 5C7XL 5D5MF 1A5FH 2EEAA 1EK3A 2F54E 2PO6A 5D1ZI 2WGXA 4FTVA 2L7UA 3IVKB 5HHVH 3RHWF 2FNWA 2PO6C 2H2PC 2VQUA 3IS1X 3ECVA 1FRGH 1ZJBA 3QIWD 4CC1A 3LNIA 5EO1A 3UPRB 1K8DA 3KPSA 4KITB 1MFUA 2ZAHA 3OR7C 2Z8RA 3QJRB 4UZGA 3ZN6A 1WB8A 1G7QB 4JE0A 1FYTD 3QFJE 2VITB 4MDJB 2OMTB 3QZLA 4R7DA 3OMAB 3DMMD 3RYCA 1KP3A 4JO3H 5CBEA 1RMFL 1ZJAA 5D1XB 1HOCA 4Y9EA 2E6JA 2WQVA 1JYWA 4K3JH 3MKGA 2ZM6O 3KYNA 4DVBB 3IDXL 3PGCA 3U0TA 1DJXA 4GFTB 1FCCA 1OQOA 5I8CB 4MD5B 5CZXC 4JPVH 5JCOA 3TNMB 5J6HA 5K9OA 4NHUB 4DV6B 3QO0A 4JI8B 5JCOC 4J9ZB 3DRTB 3N44B 1R6TA 1B0RB 3UJIL 1UEYA 2ZWKA 4X4YB 3VFPB 5JOPE 2EO7A 4TTDC 1PYWA 5E7FA 5TDNA 1K8IB 3U82B 2X3CA 2PWGA 3PREA 1Q9KA 2HRHA 1GRJA 4Z2WA 1MSDA 4OCXH 3TM6A 1E2ZA 2CLVB 2ZJSL 1XD1A 3QRLA 4HEMA 1K5NB 5HVFB 4O51A 2FECL 1PQZB 4HJGB 5KEZA 5MENE 1CT8A 5JQ6H 2XVLA 4OZHA 5JW3H 4MB4A 4AIZB 4EEQA 2P5OA 1WTLA 3HBQA 4LFBO 5FYLH 1NCGA 4W9EC 2ADIA 4PB0L 5LAPA 3OF6A 2R51A 4ATWA 1FUNA 4S2SB 3BSZA 5J6SA 1R1BA 3HI1A 3KAAA 1D6VH 4TUYB 4PJHE 4KFMA 4L9DA 4GW5A 4LP5A 4H13B 3L3OB 4C4KO 2TRHA 3LRLA 3TWYA 1VF7A 1UOWA 3HE6A 3GUFA 4NRYA 2Y7LA 5EOCJ 7TAAA 3QRGL 2IADB 1IBKO 1MUJA 1RM1B 3EBGA 4PWFA 3SJVD 4F4LA 2BHZA 1QFHA 2HRPL 5FFOA 5D7IE 1M7DB 4JFHD 5SX5H 1WK0A 1KYDA 1A4JB 4S0HA 5KSUA 1JRHI 2R0KL 3UZEA 3BEWA 4GRMB 4P99A 1SETA 4DPRA 2RQ8A 2ZXBA 1TYJA 2IDSA 5AW4B 3UZEC 5AAPA 4LPWA 1AG0A 2WVUA 1THCA 4W9KC 4HVBA 1HILB 2E7MA 3B5GA 1QRNE 2QTVA 1GOFA 1F90L 1GJUA 3VYNA 3FQTA 1XGZA 4OKVA 2XWRA 1U92B 1F7YA 4L3AA 1E9PA 1GYCA 3UX9B 4U6TA 2PTVA 4XC1L 4FFYH 2VDKB 3U30B 4UDUB 3QUYB 1IGJB 2HWZH 4LRIA 3L3IB 4HCGA 1KKDA 4LRIC 3UG5A 1L9RA 1C8QA 4OW6A 4LEBA 1EXUA 5KTEL 3B7YA 2WMPB 1NFAA 4UBDC 4H44B 5AVYB 3F5TA 3RL2B 3RYFB 5H35A 2YC0A 1VIBA 3BVNA 2JI1A 5FLXN 3IJ9A 3T0XA 2ISDA 3VM7A 1CI5A 2DQHL 2DI7A 4LCYB 1U95A 4M7JH 4N9OB 3OX8B 1OP9A 3N42F 4HIJA 3WO3B 2K4AA 3VCLA 2ERJB 5D2NE 1EBAA 4X2UA 5CA1B 4KRPC 1KJ3L 2HHHB 2CO7B 3APNA 4I48A 5ID1A 2LP7A 1U8NA 3U10A 3KL5A 2EYRA 3MODH 1NEZG 2Z35B 2PPEA 1I9EA 2WYHA 4G3YL 2XJKA 4URTB 4DCQB 3I50L 2GUYA 4FLHA 3WMPA 1ADWA 3GM0A 5C07A 2GDSA 2WVTA 2YLKA 3AADB 3QDJD 4P2AA 5ELIA 5FHAH 3HE7D 5DRZB 3VQ2C 3ZTCC 1UFUA 4R8WL 3MRBB 3QHFL 5TGBA 5I1GH 4JRXB 2EDBA 1DVUA 3GEFA 4ODTL 3ZHKA 5E4IA 3IGUA 2WAHA 4HIQA 2TAAA 1ZV5A 2BSSA 3BUYB 1G7HB 2WB7A 4FTDA 4RAVA 5F6IC 2JJSA 5LCVA 2E7LA 4KROB 3ZHNA 3DGEA 4G5ZH 4R7NB 3ZZQA 5DUJA 4ALAH 4NTYA 4KKZA 4GW1A 2PYFA 4GEJA 3DHJA 3GXUB 3FHAA 3FXIC 2CQVA 4E41A 1AQKH 4Z1MG 1F1GA 4OF7A 3LDBC 4K07A 3MRRB 4P5RA 2NY6D 1VIWA 5BV7B 4JM4H 1S5HB 1FD9A 2RMKB 1Q43A 1S7RB 5T1LD 4M4RB 1F3DJ 5EU6B 3QULB 2M6YA 5C0CB 5HHXH 5EEUA 4LCWD 3A0HZ 4P5TD 3RY4A 3IF1A 5DHVH 1R3LB 4AXWB 4X8AA 1HKLH 2R39A 4G7RB 1SOSA 4X6EA 3KYKL 4KZDH 4J42A 2VMJA 1NZRA 1LM8V 2ZUXA 3T77B 3WJLA 4JAVA 3LRSB 1OTSD 1YUHA 1JYNA 3MN8A 5FM5M 3OB0H 3WJLC 4KHXH 4WK2B 1KXHA 4G6JL 1QUNA 2W07B 3QFJA 1KCUH 4YBLB 4MT8A 1MHHA 1TFPA 2AHYA 1IC1A 1RJYA 2E6QA 2PR4L 5DFWH 3X11A 1LILA 4JFUA 4IBYA 4B3MB 5IWLA 5TFSH 4WHYG 4LF6B 1UXSB 4M1DH 5AVSB 4CC5A 1TZ8A 3IKCA 3E83A 1FFOB 5HPMB 1UWYA 4U1KB 1AD9A 1AOHA 1SDAB 4RAHA 3CIAA 4KP4A 4WFFD 1MHCA 4U1JB 3BHPA 1EUUA 3E8HA 4LFCO 4QYOB 2WY3B 3DI2B 3UGXA 1NBZB 1S9WA 5L2KA 1TSHA 2A0LA 1MCJA 1SHWA 4N2EA 5DQJB 1INEH 3N1FC 2A0LC 3H2WA 2ITDB 4DGYL 2EDQA 5AVVB 5LBSL 1I1YB 1QLEH 4KUCD 3S8FB 3EO1A 3B2UD 2JB5L 4NKQB 5HDBF 4W9GC 4YSCA 4WKXA 5KSVA 3PABB 2W0FB 1KV7A 1SGKA 5E4OA 3CYOA 2ADGA 1CD9B 5LG6A 3EOBA 1BZKA 4RISL 4P46B 4LFHD 5DC2A 4OJYA 5KLVH 3WU1A 3D85D 5ALCL 3SKOB 5I73B 1KZQA 2IMMA 4B9PA 5J1SC 1LEGA 4MB5A 3UTTD 4LHUG 4JKWA 1CI3M 5TF0A 4H8VA 5HYSA 4JFPA 1BZ7B 1U3JA 3K4DA 2LR4A 4P9HL 1KPRA 3MLRH 4K7PY 1GR7A 5BUPA 1VQPV 3RPKA 4PG9A 5J89A 4FQCH 4QHMB 3VGFA 3NN8A 2DQIL 2WBJD 3BKMH 5D7IA 1M2VB 3R1GH 3L5WA 3RZWA 3GMQB 2V0AA 1Q1JL 2YGPA 5DD3H 3ZRSA 1JSYA 4XPAL 4XVUC 3UO8B 4CVXA 3ZYIA 5DK3A 2HT2C 1I7ZA 1AI5A 1I8UA 1Q9LA 2FRGP 4X62B 4C4UA 5I6XB 2P46B 2OWOA 1PZ3A 2YN5A 3QXDA 5D7LB 1A1OB 2VDNL 4DPAX 2E5LO 4GAAA 2K9PA 3UAJC 5C0ND 4DV0O 1VEMA 4DV1O 3LNEA 5DJ8B 4QY8B 5FPOA 3TGXA 4X4KA 2BNQA 3TEUA 5I17A 4EIUA 3T0EA 1DQQA 1NZ6A 3N44F 5ICXA 2ZX7A 1KDJA 4TUKH 4LU5L 4Y2NA 3T0EC 4CU7A 3O3DA 4MAYA 2Q5ZA 1IQDB 5H6QA 4Y4FB 2UYLA 4WFAV 4N8CL 4KY2A 4NZDA 3BE1H 3JVGA 5JXEA 3LVTA 3C5JB 1DQVA 5GRZA 2BOCA 3JVGC 3JATA 1FORL 1BZQK 1OV9A 1BJ1J 2E76B 2BOCC 1RQ5A 4K7PX 5J6GA 2IDUA 1QFWI 3DLQR 3RL1A 2ZNJA 4I4WA 3TA3A 4DKFL 4CDGC 3GB7A 2E6PA 3EBHA 3DXAE 4N3UA 5ISZA 3TA3C 3WMSA 4J6RL 3VGAC 3GB7C 3B6SB 2NX5D 1IC5L 2CDFB 2V9TA 2IAMA 5F0JB 3NVQA 3ZTDC 4EZKA 2R59A 1UZGA 3P3TA 4EZMA 5I71C 3NCJH 3MLUL 1NGXB 4DPBX 2W0XA 4NHCH 4L1DA 1YMMD 1ZL8B 3ULUL 3OGCA 4LLUA 4ABVA 2X4TB 2FX7L 1MXDA 4UINH 4LLVB 1RSOB 4ZDHA 2E3VA 3OGCC 2MSPA 3U2SA 1UA7A 1XSKA 3DVFA 3C8DA 1AD0B 1VFOA 1BQUA 5BMVA 1MI5D 4ODVL 1B06A 4CH6A 2WXOA 3PJSA 4JJHA 4PJFB 4NQDD 1KJ2B 1KJMA 2HTLD 3OAUH 4X64B 4B3TO 2QGCA 4MNHB 4IKJA 4UM8B 5J57B 1PG7L 5DA4A 3FAVA 3CTTA 3TJHD 2V3EA 3C6LB 3WIHA 4CH3A 2DWDA 5TQ0H 4J23A 3LH2L 1DSFH 3A6CL 2LU7A 2WUBH 2Y2YA 3L5XH 5DUMH 3T71A 2DWDC 1IAIH 2DBLL 3F58L 2R1WA 3ZT5A 1OM9A 1GXEA 1N26A 1RSYA 4JYAB 2OQJA 3N9GL 3S0PA 3ATAA 3BO8B 2H6PA 1A3RH 1WHOA 3QEUB 2MTPA 1LWHA 2FGWL 1A7OL 4IMKA 5T3XL 4HUUB 2XAHA 2R56H 8PAZA 4JZ2A 4FK5C 4XPGH 2JB6B 3II1A 4IMKC 3CSTA 1LEIB 1DQLL 4XAWH 1ILUA 4WW2B 4WWKB 4TSCL 2DOSA 1AAJA 4NKIH 2EE3A 1CBVL 1BMWA 5E5MA 3B4SA 2CNYA 5EA0H 1N5YL 4U6HA 4K15A 3V0HA 3CSBA 4FYRA 1HJBC 2R72A 2KLRA 3JAWA 1QTSA 1YQVL 4O5LH 4URKA 3H9SB 5JHDD 1OT2A 5FO9B 4K7FB 5CGMA 2CDGA 2D9CA 5C0GB 1M1XA 1DYZA 4OJFL 4JUTA 3EYFA 5FDWB 1Y6KR 1ZHLA 2OULB 1N7ML 4RGNC 5EDXA 4WEBL 1O75A 3TC9A 4DV7O 3RVYA 1AI1L 4CU8A 1PLAA 1PL0A 1JNNH 2AQSA 2GJZA 5EMYA 1TJIH 1KC5L 1PFOA 2JMRA 4D2NA 1PZ5A 4G6KH 1J86A 2KG7B 1KLGA 3F83A 5GGVH 5D5PA 2F54B 4AKPA 4ES8A 2P5WD 2AV7B 4TVPL 3HAEA 3VXMD 4A7VA 5I16A 4Z0BL 5AOMA 5T1MA 4GB9A 3QO8A 3S5LG 3AGWA 4I2XA 2V5TA 2R23B 4Y19A 2GUOB 3A4EA 4C56B 1WWCA 1JPFA 4ZW8A 3P11H 2D7TH 1JR9A 1UM5L 1XCXA 4G82A 2E7BA 1AP2B 4IIJB 2CRYA 1A6AA 3BAIA 4JI0B 3MRPA 4R50A 1DQIA 4M61A 1FZOB 5LDSA 1MJUH 2Y36H 2AJXH 5KBNC 2FLBT 2ICWA 3QAZC 2EACA 2ZWLT 4NX0A 5DHDA 1I3GH 4H88H 4YDLB 3IFLL 4RSYA 5IT9N 1ORQB 3BP6A 4R6ZA 3W2DL 3K6SA 1Q0XH 1ZV2A 1EJOL 5IQNA 2WXHA 4WI0B 4BGLA 1X5LA 4GRLA 2ZKWA 4WJ5B 2K0RA 1M7XA 1BVKA 2AZ0A 4D0DA 3PGFH 3ARUA 4U6VL 3V4PB 3JV4B 5CZKA 1WAZA 3FUHA 2QPUA 2XWTB 5L0QB 1N2RA 3NCYS 3S35X 1KIRA 4G7YH 3US1A 4UUJA 4FM2A 5E2UH 4G27B 1MCHA 4UUJC 3NZHL 4WF7A 3WHXB 1OAXH 5TE6L 5MENB 4HPOH 4U49A 2J25A 2VZVA 4KKBD 2Y7MA 3L7FB 3K1KC 4P2QD 4OZFA 4ZXBB 4RBPK 1IU1A 4PV1C 1LE5B 2YD0A 3LX9A 2C9XA 3ZN1A 1T3FA 3IDGA 1GTFA 3SDCB 1MG3C 3N04A 3MRHA 3DXRA 4K3EH 4KZCA 4U1MB 4AG4H 4PJHB 4M8QA 4IRJB 2GUZB 2XXGA 3X3GL 1JGEB 4GX2A 2JKTM 1QR4A 3EHBB 2W38A 3A0OA 4MBOA 4ZO9A 2P24B 3VM5A 4JDZB 3N50A 3ISYA 2ROYA 4WNSA 1LK2B 4DQOL 3FB8A 4O58L 1NINA 1BDYA 1U4EA 3MI6A 4DW2H 4HGWA 4B3SO 4ONHB 3FB8C 5L6YH 1R9FA 3DX7A 3WNLA 2IH3A 3KS0J 2HKFL 5FHBL 3L5IA 1CF8H 5I1IL 1JNHA 1FSKB 4M7LT 2IH3C 4KO9A 3GWJA 1WA8A 3MRNB 1P5VB 4ICGA 2EIZB 2K9UA 4AVKA 4HSQA 4KAQL 3ROOA 3H0TA 1QBBA 1MAJA 2VAJA 1MVUB 4WLCA 1HH9B 4HISA 4Y4KA 3QZWB 2VQEB 1YYMH 3KPRD 3NEOA 5LMNB 4LQ1A 3DO4A 4XPHL 5DQ9A 1S9KC 2FD6H 1MWAL 2I26N 3Q1EA 6PAZA 4M1CC 2FUQA 5IROA 1U33A 3B2XA 5EIVA 4FLZA 3KWTA 1ZAGA 3RGHA 5AW7B 2ARJA 2B4CC 5IROC 1OAZL 2VLKE 3IDNB 2OZ4L 2KS0A 3QO5A 1O7SA 1E2VA 1TR7A 2Y22A 2CGYA 4WFBV 1JWMB 2APBA 3O6KH 3KVQA 1FP5A 3TFKC 3ZZLA 4Q4IA 1YAIA 4UT9L 1KDIA 4X9GA 4BELD 4JJOA 4JFXB 4F93B 1AHWB 4IQHA 4GI8A 4AKOA 3BVDB 1AE6H 3ZOAA 3M6DA 2F5AH 2BMKA 1CU4L 2FYYB 1Y4MA 4QJFB 2WXRA 4LRNH 1WUZA 4ZUSA 1E7VA 4FNTA 4NQVB 4H2AA 4O4YL 3WLBA 2X7LB 1HHKA 3EUDA 5F1NB 1QSFE 4HXAH 4QO1A 5CO1A 3SY6A 5HI5C 3E8BA 1P6AB 4MJIA 1B4LA 3G9VA 2IPKA 4CU6A 4KTDL 3WNPA 1NU1H 1FS0G 1UJ3B 1A2YB 5GIRA 4L8DA 4QRFA 1ITCA 1OCWH 4HX1B 3HC4L 3S96A 1WHPA 1OGSA 4UM9D 3NJVA 1TO5A 3IFXA 3TBTA 4YSUA 1NUFA 2PPAA 1NJ9B 4HBCH 4ZZKA 1H3WM 4CBZA 1EMTL 3KPOB 1C16A 1U21A 3TO4B 3J2PA 4XOAA 4RZCB 5L9DL 3IDJA 1INQB 1KT2B 1SYVA 3CMOH 5GGSB 4V1DD 5DK0A 5SWZA 3VQYA 1Y74B 4AK1A 1WZ1H 4X9YA 1DF4A 1N0JA 5CLYA 1XGUA 2XN9E 4D94A 1KB5L 2VN5A 4DGIL 4OZ4B 2CMRL 1RP8A 3HN3A 2X4UA 5GSRB 1U58A 2E86A 1TEGA 4BSVA 1THZA 4RA0C 3VFSA 3HZKA 4MA8L 4ZPVB 5DHYB 4KH9A 2WYIA 2APTA 2WPGA 1OVZA 2NY5H 4YHYC 1F4XH 2DQCH 3L4CA 4FRWA 1Y76A 1ZE3C 4A2LA 2HFGL 3ZR5A 1KY7A 1YHQV 3FAXA 1BQKA 3S48A 5BQ7B 4GNKB 2VXUL 3KLDA 4ZUTA 2R0LH 4M8UA 5HYQA 2CR6A 1JV2B 3FFCB 3PU7A 3ZMSA 2OYQA 1KWKA 4X7DC 3A4DA 1E42A 3KXFD 5EEZA 1Q81W 2VDRL 5EU3A 1VCAA 5IB3A 3N2GB 1USZA 5DTFB 1FJ1A 1AZNA 2FSEA 4J28A 2A6IA 2RQ6A 3D6GA 2FEDC 4ODWA 3CBKB 4L4VA 1EM1A 2IBZH 1CCZA 2EKJA 1IGML 2QL1A 4LLDB 2ZDIA 3AWGA 1ET8A 2DQEL 1AGEA 3W9EA 1TQCB 1YXBA 2XU9A 3I75A 3HMXH 4PB9H 1IXMA 4G8EA 1WA2X 4R4BB 1C08A 3AMKA 4M48L 4TVUA 3WUWA 4PP2B 4WW2F 4NYLA 5IVZA 3H9HB 3IBOA 3V10A 2OW6A 5CEYB 4M6NH 4XHJD 3T2NL 3ZGIA 4AMXA 4OT1H 5CZRA 3CPWU 5E9DE 4LEOB 5FLVA 2C1OB 2XWBA 1WEJH 2FBJL 3ZKND 1OSZA 2VKWA 3G08B 2B77A 2VUYA 3FMGL 4C83A 2DM2A 1A3LL 3ESNA 1GC1C 4MXQC 4YDIH 5I8OL 3RVWD 3HKCA 3OR6A 5J11C 1YJNV 3L08A 1TTGA 4LGSB 5J7CC 4NAMA 2HP8A 3OR6C 2G38A 1JN6A 5B8CB 2JJWA 2W65A 3LXBA 3IDIA 3SPCA 3IT8D 3RNKB 3CPLA 4RMQA 4BFFA 3K2IA 1RZJH 4QHNA 3IGAB 3P40A 1BYPA 4F37F 5GRVL 1WZAA 4WFGE 2ZQMA 2B59B 1RUAL 3O4OC 4BK5C 3QUGA 1JXFA 2KDGA 5FUOL 3N2JA 3ZZ1A 1H3XA 1KCSH 2OI9B 3BZDA 4NENA 1NGWB 2ZXCA 4XNUH 4KZEL 2ZOTA 5FO2A 3VH8G 4HPHA 1FJGO 2NQDA 1NANH 2ZOLA 4DV5B 3FQ2A 2YC1A 5TK2A 5G4NA 4HIHB 2E9GA 4WFHE 1KGWA 4PV8A 5BZDA 3EXLA 1U8IB 4K3DL 3TZVB 3W0WD 2A9AA 3HJEA 3H54A 2Z93A 3WS6A 1D5XB 2F6AA 3BVTA 1T5KA 3D4CA 4AT6B 3IFPB 1AQHA 1QZNA 1RZIA 3A3YB 3ET9F 5K9KA 2E8ZA 3MX0B 1A7QL 4RFNB 3RRQA 1J10A 1H0DA 3CX5F 2LOEA 4TV8A 5DWUH 4Q56A 4FMFA 2OMXB 2Z31C 1NSNH 2X1OA 1Y66A 3C60D 2NXYD 4W9HC 5JR1L 2ZQKA 1JZ8A 3NFNB 4ENED 1IAKB 5GGUA 4KPHL 1K9MW 4DR4O 1TETL 1E3FA 1Q38A 3FO2B 1FNEA 3T1CA 3US0A 4DUZO 4OFQA 1LWJA 2YMXL 3HG1A 1KV3A 4HS3B 3SKMA 4E9VA 3CFBB 2IM9A 4K94H 4Q0XL 4JDVB 3DXAB 4FZ1A 5E0QA 2JTYA 1Z3GL 1M7IA 2BVYA 1Z9MA 5F0MB 3CCHA 2OSXA 4ZUUB 2YA2A 1L5GB 1G7LB 3DHMA 3P9LA 2JJVA 3I6GA 3GSRB 4ELKB 3VDCA 3QUKB 1U8LA 2BSTB 4PJHF 1IGFH 3HC2A 3EYQC 3SO5A 4XWGH 2X0UA 2FWLB 4JO5A 5BRZB 3RX5A 1A66A 2Q6WB 2HLFC 1RUQL 1F86A 3ESMA 4HUXA 3MOBH 1YJDH 4PRPD 2E47A 1Q9WB 3K6NA 4MASA 4WI6A 3CHQA 3U0PA 1B4TA 3D87B 5CU5A 2O6PA 5EPMA 3GKWH 1FL3A 1Y1UA 2BM3A 3NAAL 1PZUB 4RO2A 3QUMB 5IMKA 5C71A 3MLXH 1EEYB 3KWWB 3CDZA 2RR3A 4DR6O 4TWKA 4H5SB 4PMFA 3D50A 1E90A 3QCVL 1DK1A 3BGAA 4X6BB 4JFDA 4P5KA 3V8OA 2ID5A 2Y7SA 5GJTH 3C87A 4K9EC 2DTMH 2ESVE 1OE1A 4HIXH 2RGSA 3KJ4C 2OBGA 3E2HB 4OIFA 3WTWA 4TNEA 4L9LA 2WO2B 4NQEB 4KL1A 1E5AA 4AJ0A 4L4TD 3EFDH 1J0HA 4L9LC 5KVGH 4I3RH 1QWNA 5C0DB 2Z3FA 1FFPA 1PX4A 3FQNB 4W81A 5GSVB 4I0XB 3SDDC 1ZLUH 1A4KA 1AXTL 4W1TA 5FA4B 3ZMZA 4ZOEA 5AKRA 2PR9A 2DQ3A 3CHXA 3LH8A 5CJ8A 2ETWA 4F7CB 1IBGL 2AXWA 4DQAA 4PM1A 3ROLA 1NBVL 3WEXB 1XMOB 3FU5A 1KUQA 5IBLD 2GBTA 1PZBA 5C7XH 3G5ZB 4MA1B 3IU3A 4P4RB 3WXWL 4JI1O 3QDME 4G6FB 4M93C 1L6XA 3QUXA 1PLGL 1H2KA 2UWEA 4FQQB 3A21A 4YFLF 2H26B 4I55B 4F5CA 3CZFA 1W2BU 3UBFA 3RI5F 3GIZL 3RVXC 4X5WB 1WICA 3OD4A 4G8GB 4KK8D 1S7XA 5E24E 4YWGH 3AQXA 1OCOB 4NNPL 1YTFD 3B7TA 4XBMA 1GKOA 4BH8A 4J3OF 3GTVA 2EDOA 2YPLE 3CFTA 3N91A 3PV7A 4DEPC 2XQYG 4YBQC 3P73A 3KYAA 1JS4A 4HAKA 4MX7B 4JQXA 1RZ7L 1G4MA 4Y8AA 4EI5B 4ZQKB 4Q6IA 1EDQA 1J1OL 3KPPA 5G4OA 2VT0A 1QFWL 1BQLL 2IV9A 3UJIH 4PIBA 4ZS7L 1WT5A 2FJFA 1NOLA 5C0JB 2AHIA 1WT5C 1OSPH 3MLYL 1GGCL 4UOJA 4Z6AT 1NGZA 2J5LB 3WE1A 2VXQL 12E8L 4WFGA 2PYED 1M7UA 4HBQA 3I3DA 2CKBH 2IOOA 5BJTB 3RA7L 2ZJSH 3GSWB 5DMGC 5AD0B 1PPJH 2YRLA 2H1LM 2ITCA 2A9NH 2D8KA 5C0BD 3JAKB 2XPGB 4WK0B 2X9WA 1PY0A 1TJHL 2XYCA 4ZUWB 2ITCC 5JIPA 3Q3GA 4PB0H 4ZODA 4U1LA 4KMQA 2VMFA 1NPUA 3MQIA 2XG5A 4I18A 1HXYB 1RVFL 3MYJA 4GBXD 4I0CC 5CIPB 4K71B 1PU0A 4AQYO 4CW1B 4I18C 1FWXA 5B3JE 3BZFA 3B2UC 3QRGH 3A47A 2AXHA 5FO7B 3GUTA 2JGDA 4JI5O 5F7AA 3RKDD 4YS4A 2AJUL 4F2EA 5HYJE 3VA6A 1WAAA 4HCRL 3F7YB 4MVOA 5H9CA 1LP9E 1MFEL 3S5LB 4PV9A 3OAYK 3RIAF 5T3ZH 4Z7VE 3LEXA 5FK9B 2R0KH 5EU5A 4PU2A 1J5EO 3MGAA 4Z7UE 1TQBB 2Y72A 3HRZA 4H1LA 5DJAB 3KKYA 4N3TA 1MLCA 4R4FH 4FPPA 3EUUA 3HRZC 2Q3XA 2PW1B 1AGFA 3VX0A 3T4YA 1FO0A 5LNEA 4L1BA 4O2CB 4W9JC 3BGMB 4P3DA 4QGYA 3FO9A 2HT4C 3QXAA 1PIGA 1MZFA 4Y5YB 2AHZA 3BGFB 3WYRA 2PP8A 2VLKB 1FNGA 2H2SD 4O02L 5IQMA 3CD6V 1VDGA 3WOVA 5KTEH 1H9DA 2O26U 4U1NB 3RUGA 3DETD 1S78D 4JN2A 3FSVA 3OJMB 1T0OA 2OTUA 3QDGD 3O3EB 4FA8A 4P8QA 4WFED 1Z9OA 3NCMA 3TBWA 4MKMA 2WV3A 4H8WL 2XFXA 1KGIA 2DOCA 3KPNA 4XVSL 1KJ3H 1QHPA 3L95A 4YOKA 4NYKA 1VAHA 1C12B 4LCCB 3FRUB 3WJMB 4K7PL 2BNRB 4RWYH 1T2QH 4PRHD 1Z5YD 5AKSA 2IG2H 3L9RB 2IPTL 3KWUA 3JWNH 1QSFB 1BHAA 4IU2B 1TZAA 3MO1B 2ESVA 5F7KC 3JAMN 4J11A 3QNXB 4YXHL 5BR8O 2N05A 1T5XB 2WW8A 4RMRA 3QHFH 4G11A 1AVMA 1OANA 4PYGA 5CJQH 5D2LB 4ZMXA 3QO1B 3DYMA 4ODTH 15C8L 1RLBA 1FIEA 2W9DL 2VE6A 4FI6A 5EYPB 4IEFB 4YIQB 5FPIA 4PTTB 3D3VA 3U9PH 3D36A 4CC0A 1AIFA 1FN4A 1I9IL 4NAQA 2DH2A 3D36C 4KXZH 4XP5H 1TCRA 3G04A 4KI5D 1OTTD 3HPLB 4QRUB 1GZQA 4PI0A 1T4KB 4IHBA 4PJAE 5JOFA 3CGTA 5E99L 3UH8A 3HLAA 3VD9A 2XN9B 2P44B 3MNMA 4NZFA 3GMRA 2QVKA 4U7SA 1NCWH 4YZWA 3Q4HA 1GAXA 1BEXA 1Y6NR 1KFAH 2ZTBA 5IW6B 2P28B 1EJ6A 1SN2A 4R0LB 5KN5A 1YI2V 3KYKH 2I07B 1FV1A 2NTFB 4N23A 2PXYC 4YDJB 5DURD 5IJVA 5E08L 3NIGB 3HBZA 1JK9A 1X5ZA 4IBWA 1UWFA 4G6JH 3VXNA 2I9TB 5L4MA 2EXSA 2QQKL 4Q9BA 4X9BA 3QZPA 4MYPA 4FCAA 2L7JA 3O8XB 2Q8AL 5L8JB 1CICD 1BIIA 4ZHQA 2PR4H 2EDDA 2Y1VA 4HU2A 4TQIA 5ERWB 4W4KA 5JW4N 4HUCA 3T6ZA 2QADB 4QHPA 4ZO6A 4XZUB 5DVLA 1NUDA 1M42A 2FO8A 4YFLI 3H7LA 4DUYB 2UUBO 3CSFA 4K5MA 1H5BA 3FQ1A 3GSQB 4K3AA 4DZBA 3PL6B 4Z5RA 5LYJB 1H5BC 4HBNA 5DMIL 5DVMA 1URFA 4D0CA 4N2KA 4XCCL 4CMHB 1PBYA 1WTGT 4DXWA 5FGSA 4F9PA 4L23A 3RWHB 1IBLB 4E5XB 4JFFE 1YY9D 5D1XD 2HX9A 4GOSA 4GSQA 1UASA 3VX1A 3L48A 2BSRA 4HV8A 3FT2B 4MMZB 4AI8A 5LBSH 4AEIL 1N64H 1M9NA 1A3ZA 1CFNB 2JB5H 3RVUD 2CHXA 2P1YA 4ZW5A 3AREA 4X6FA 1I8IA 1OGAD 1XQ4A 4I0PA 4RISH 3OD3A 5GZND 4AGQA 5JHLH 1XFPA 1KWGA 5ALCH 3ZJZA 1JNLL 4HWNA 4N2LA 3JWOH 4PJ8B 1W72B 2Q7YA 3NP3A 1FA4A 2DPKA 4NC2B 4HJIA 4MDRA 3BVUA 3WFHB 3H2QA 4ZYKA 4FFKA 1XGPA 2MTAA 2G60L 1D5ZA 1GPOL 2YFNA 3MRKB 3O9WD 1XNQO 4MNGE 1I8MA 2VR4A 4LL9A 1V54B 3K71A 2HX7A 5JHAA 1E8YA 1VQNV 5D7HA 1B0IA 2DQIH 1NFKA 1EFRG 1MELA 3DPBB 3FUIA 3P1VA 1AGDB 1LP9A 2YAQA 3RTQB 2KLSA 3SJQC 2IH8A 4OQTH 1JPEA 1SNRA 1AI7A 1JE6A 1UB6A 1VZGA 4W4LA 4NC0B 4R5TA 2O5NA 3E8UH 3W56A 2WLYA 4EOWL 1JFQL 1RJZA 2CGRH 3FOMB 3ESVF 2Y48A 2ODHA 1JV5A 4XXDA 3NSFA 1EHNA 3VRLF 2EXTA 1I1AD 3ES6B 3SJCC 1HR0O 1EUTA 1KCVL 4AUJA 1AJ7L 3UBGA 5D8JL 4UTBL 3TIEA 2VH5L 2WQXA 1AR1B 4JFVA 4ODBD 5EU4A 3Q44A 3N0PB 3UTPD 4RFEB 3JSNA 3JTTA 2QJ1A 4F3FA 3FONA 1OZTG 4ZMYA 4J4PD 2GK2A 3RZCD 3CDFA 4KQ3H 2APSA 4WAFA 3KDPB 3MPCA 5I1KL 1IEHA 3QWRA 5GISH 1XF5A 3TIDA 3NZ8B 4S1DC 5EUOA 5HGHA 1A6VL 3D33A 5HHPB 2P7TB 4LL1A 1CWVA 3UTSD 4N8CH 2QPEB 2CO3A 3ILEA 3QNFA 1TVKB 2ED7A 4QRQA 3RWGB 1DTOA 5B39B 1CN4A 5I0VA 5GS2H 1PLBA 3L3KB 1BZEA 4UOZA 5FB8A 2YJQA 4LDLB 5GJSL 1S3KL 1U8CB 1VQOV 1M71B 1QA9A 2VDPL 3DKHA 1P7QB 4B5ZA 5F3HA 2J7LA 5E9AA 4KKLD 4AYID 1NGQH 2X70A 5IG7A 4UTAH 4GSDL 1HNXB 2WWKO 1A7RL 1EGJL 4DETA 2R29L 3GLEA 1IC5H 2H32H 5F7FA 4X4XB 1VF5C 1DBAL 4L3CB 4TQPA 3KPTA 2X7RB 3I84A 3MLUH 1DEEA 5E6ID 4DK3A 3ULUH 4CKQA 1XREA 5GONB 3LQAH 2FX7H 4UVAA 3CLWA 5ABDE 2ZUUA 3HNSL 4MKTA 3K5NA 1QQDA 1AH1A 4OM0H 1GKFA 3G5VA 1K7DA 1M4KA 1VADB 4MRCA 5DT1H 2JCWA 2LTQB 4NCC1 4ODVH 1YY8B 1TZGL 1K9TA 3V4UH 3NR7A 1QLNA 5DN6G 2EJ1A 1LO3L 2GT9A 3JUYA 4P2RA 2NW3A 3EOTH 1ETA1 4PJAA 4O4IB 5GRYA 3DGDA 3TBYB 4I4TA 3NABL 1N19A 3A6CH 5BS0E 5ALBH 4WU5A 3QO7A 4YEEA 1NGYA 1A14H 2EH8H 1BXXA 3FB5A 1IGTB 2JI3A 1SM3L 1CZ8H 2QR0A 1CYWA 3MXWL 3FB5C 3OEEG 2SEBA 3IJSA 3BN9C 3N9GH 4FXKB 1X7QA 2XQBL 3N27A 3UBXB 2FGWH 5EZIH 2LT9A