2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
3AG4B 3X1FA 4NERA 2I7SA 2IH8A 1OV8A 2PP8A 3IN0A 1AQ8A 3FPXA 5A7EA 1X9RA 4G70B 4EF3A 2DYRB 2UXTA 1A65A 3FYEB 4AKQA 2XV2A 4KOCA 1SF5A 3ZDWA 2PCYA 1ASQA 2A3TA 5I6NA 2YEVB 4DP7X 4E9VA 2PPCA 4DPBX 2CUAA 2YQBA 1E67A 1PAZA 3KW8A 5AKRA 2XXFA 2FQGA 4NB7A 1BEXA 1RKRA 2UXFA 2GB2A 3BVDB 3FU8A 3UADA 1SDDA 1GS6X 2YAMA 2QPDB 3HEIB 2DWSA 5B1KA 3NP3A 3SBQA 3T6VA 2N0MA 2BWDA 4HIPA 3PAUA 1GSKA 2JFCA 3FQYA 1W6WA 4WTQA 3KW7A 1RZPA 1SDDB 3FPYA 3WNJA 2VW6A 3AY2A 3ABGA 3UAEA 1AIZA 4YVUA 4GP4B 1A8ZA 4BWUA 3QJRB 3WG7B 2XXGA 4HAKA 5D4IA 4G7QB 3AG3B 4DP6X 1L9OA 1HAWA 1AAJA 4DPAX 2J55A 4G7RB 4A68A 4AKOA 4M4RB 3PAZA 1ZDSA 1V54B 2VM3A 3FU7A 2YAQA 3CG8A 4G7SB 2LLNA 3S8GB 4ZK8A 1PZAA 1ILSA 1MG3C 3DTUB 2Q5BA 4E9WA 3ABMB 3PLYA 1AG0A 2CAKA 2ZXWB 1MG2C 1WA0X 3GXUB 2H47C 1J9TA 2BZ7A 3NJGA 1N68A 1WS7A 5IY5B 3FYIB 2TSAA 3C75A 2NRDA 3H4FA 1AOZA 5B1BB 1ZV2A 3NJHA 3QJQB 4YSPA 3N2JA 2AZAA 3NSDA 3NYKA 3OMNB 1SF3A 4A66A 4DP4X 3OMIB 3H4HA 3FSZA 2H5UA 4YSRA 3TBCA 5B1AB 3TASA 4BXSV 4N8UA 1GY1A 2BO0A 3NSYA 1E65A 2UXVA 2PPAA 1GYCA 3PAVA 4RH4A 1AS6A 1W6LA 2P80A 3FS9A 4JHVA 2HRGA 5I28A 1SHXA 1AZNA 3QJVB 1ADWA 1JVOA 1OE1A 1BQRA 1JZEA 4L0PB 3FSAA 1NPJA 1KBWA 2J5WA 2BWIA 2FT8A 2HX9A 4A2DA 3IN2A 2EIMB 2VW7A 4P5RA 2XLLA 3BQVA 1TKWA 3H56A 4HCFA 4YL4A 3CDZA 3QJTB 5E9NA 2ZWNA 4G71B 4GXFA 2DYSB 2GBAA 2VSKB 2Y69B 1BQKA 1TEFA 1KGYE 4AI7A 5EHFA 1BXUA 2BW4A 2CCWA 4W1TA 3CVCA 4NAJA 3T6XA 3N55A 4KO6A 3U25A 3CDZB 1DZ0A 5B3SB 3D12B 4DPCX 2X88A 4W9ZA 1NWPA 1J9QA 1A4AA 1KDIA 3NJLA 2OJ1A 3L45A 1V55B 3AG1B 1KYAA 4AZUA 1L9SA 2HX8A 2YAFA 4GP5B 3EF4A 1PNCA 2PP7A 4HCIA 1SNRA 2VM4A 1ASOA 3MX0B 1GY2A 1JXGA 2HRHA 3IEAA 3AZUA 2VW4A 1NDTA 2IDQA 3OD3A 4HHGA 2XVBA 1ET7A 3NP4A 2EIKB 5AZUA 4QKTA 1ZIAA 2EINB 1J5CA 2CALA 3QJUB 3TU6A 2YAHA 1AR1B 1PCSA 4DP5X 1HAUA 1MDAA 2YAEA 2P80D 2ZOOA 3PPSA 2HXAA 3OQRA 2MRYA 1TU2A 4DP9X 3NJFA 2W8CA 2WO3B 2BW5A 1J9SA 1PLAA 3UGEA 1NICA 4CSPA 2JKWA 2BP8A 5I6MA 1AS7A 3NJIA 1JXFA 1AZUA 1ID2A 1JVLA 1OE2A 2VN3A 4KNSA 1NIAA 3DIVA 1CC3A 1PY0A 2E86A 5PAZA 1BAWA 5LDUA 4K9JA 4F7KA 1E30A 1ZPUA 3CVBA 2H3XC 1KDJA 3T71A 1SJMA 2DV6A 4N4YB 5F7AA 1JOIA 3CVDA 3WIAA 1OE3A 4BXVA 7PCYA 3AG2B 1CYXA 1WAEA 2XU9A 1N70A 2UX7A 4ENZA 4E9XA 1QHQA 3FU7B 3PXLA 4DP0X 1M9WA 1L9RA 1JXDA 1YLBB 2YAPA 3EH4B 3FT0A 2B08A 2FQEA 2TSBA 1AZBA 1NTDA 1PZCA 1XMEB 2AVFA 2DWTA 4KNUA 1L9PA 2J56A 2PPFA 2PCFA 4DP8X 1IBZA 1WA2X 2BZCA 2JXMA 2GSMB 3S3BB 1JZHA 2YAOA 4HZ1A 2I85A 1IC0A 4YSSA 1PLCA 1FFTB 4UF7C 4DP2X 4BWTA 4YSAA 6PAZA 6PCYA 2UX6A 2UXGA 5PCYA 1J9RA 1L9QA 3SBRA 4AKPA 3QJSB 1NZRA 2QPEB 3X1NA 4DP1X 1MZYA 4YSTA 2HZHA 1ZDQA 5B1JA 4FAAB 4MFHA 3S3CB 3ZBMA 1NINA 2FQDA 4HCGA 3AW5A 3JTBA 2YXWA 3ZX1A 4A2HA 1T5KA 3TBBA 3FQ2A 5B7MA 3NJMA 3OMAB 4X4KA 3UABA 3FU9A 3GDCA 7PAZA 1CURA 1BQ5A 1CYWA 4E9QA 1WS8A 5ANHA 1XB3A 2X87A 4F2FA 2FTAA 1FWXA 1JERA 4A67A 1NPNA 1NWOA 3NSCA 4A2EA 2EILB 2FT6A 2PPDA 1DYZA 4TXVB 1KBVA 2DY2A 4QLWA 2IH9A 2J57A 1A3ZA 4HALA 3UAAA 3V9EA 2PLTA 2FJSA 2XWZA 3IBOA 2QT6A 3HB3B 1X9UA 5FC9A 1JZGA 1W8EA 4E9RA 1JZJA 3ASNB 1GS7A 1BYOA 1KCBA 1AANA 1OCCB 1A4BA 2IDFA 2OV0A 2B3IA 4FA7B 3ERXA 4UAHA 3IE9A 2AANA 4YSEA 5B7EA 4YSOA 4YSQA 1I53A 3QQXA 3EHBB 4JHUA 5AFAA 3ASOB 3G5WA 1MZZA 1ZIBA 2QDVA 2Q9OA 3FSVA 1OF0A 2IWKA 3NJKA 4YSDA 2FNWA 1A4CA 1NIFA 1BXVA 3X2QB 8PAZA 4CSZA 1R1CA 2AZUA 2IAAC 1KV7A 5I6PA 5D4HA 1AG6A 4JKNA 5B7FA 2HX7A 2VMJA 2XUWA 1NIBA 4GYBA 4P5SA 1PNDA 4PCYA 3DKHA 4BDVA 4BK5C 4Q8BA 2XV0A 2GHZA 3NJJA 1TEGA 2HLEB 1OOWA 1CUOA 2IDUA 1SHWA 4Q89A 3CZUB 1FA4A 2XV3A 3NJNA 4KO9A 4YSCA 2R7EA 1ET5A 2BP8B 1EHKB 4BDVB 1KCWA 3ABLB 3X1GA 5I6LA 3ABKB 1PZBA 1XB8A 3GYRA 3NT0A 2GIMA 5D4JA 5B1JC 1L9TA 1SFDA 1J5DA 1QNIA 4E9YA 4KNTA 5TK4A 1URIA 3FQ1A 2EIJB 1GR7A 2R7EB 2IWFA 3WI9A 1OCRB 1OCZB 1V10A 4HHWA 5TK2A 5I26A 1PMYA 1QLEB 1XB6A 3S8FB 5I6KA 1GS8A 3S3DB 5I5IA 1JZFA 3SBPA 1B3IA 1ILUA 1AZCA 1EZLA 2Y1AA 2YARA 2XYBA 4UANA 4YVNA 1RCYA 1NIEA 1VLXA 3EH5B 2MTAA 4BWWA 1F56A 2BP0A 1BXAA 2FQFA 1SFHA 2IWEA 1WA1X 2RACA 9PCYA 4GY4A 2WSDA 3WKQA 2AFNA 2IDTA 4G72B 4A2FA 4KO7A 2WO2B 4AX3A 1UATA 2XX1A 2BP0B 3UACA 3JT2A 1PF3A 4F2EA 4GP8B 4KOBA 2GC7C 1NIDA 5I6OA 1IKOP 1E5YA 3NSFA 3OM3B 2QDWA 1BYPA 2FWLB 1IBYA 3X1EA 2GC4C 3WKPA 3X1BA 1AACA 3EH3B 3WNIA 1ASPA 1M56B 3SQRA 5I5JA 2FT7A 4E9TA 2CJ3A 3T6ZA 1PLBA 1HFUA 3PCYA 2CBPA 2IDSA 3V9CA 1OCOB 2PPEA 4YSUA 5I5MA 2W88A 1GW0A 1E5ZA 3T6WA 1JZIA 4A2GA 2I7OA 1M57B 3TA4D 3FSWA 4KO5A 3QPKA 4PAZA 1ET8A 3ZIYA 2PP9A 2XX0A 1AS8A 2VSMB 2YXVA 4WKXA 2OCCB 1RZQA 4M3HA 3RYMA 1IUZA 2BHFA 3T9WA 5F7BA 2GI0A 4E9SA 2ZONA 3MBWB 1ETJA 1AZRA
chains in the Genus database with same CATH superfamily
3ESPA 2JJ1G 4NERA 1MQKH 2DQGH 2I7SA 5KHJA 4TTDD 4X1IA 5MENB 1NPUA 3HUJB 4XN9A 3ZDYB 1P2CB 3QDGA 5HVHB 3SQBB 4ZMXA 2ATKA 3DX4A 4YBLB 1OB1A 3Q0HA 4KPHL 4LR3A 1CI3M 15C8H 2H3NA 1A65A 2DJSA 2Z93A 3IDIA 3VH8G 2AABH 4MNQA 3L71H 5I75B 1GN3A 1S7RB 4D8PA 1S5HB 4Q0XH 1A6TB 3TN0C 1NFKA 3IDXH 4LLYA 4HWZB 2AW9A 5CBHA 4TF4A 1PAZA 2CLZA 3LNEA 2YK1L 3D85D 1S9VB 5MEQB 4FFKA 2GEQA 3TNMA 4PI2A 2N74A 3UH8A 2GB2A 2GJ6B 4K7PH 3IS0X 3S3SA 3ZKXC 4F1ZA 4NC0B 3J8F7 2FJGB 3UG4A 1B9ZA 4IIJB 2O6EA 2HG5A 1FFNB 2J2ZA 2GTZA 4RISH 3DURA 4HGMA 1ORQC 1BX2A 4Y4KB 1X9QA 2YXYA 3VXRB 4DK6A 3WDHA 4WW1A 4X65O 3ZTNL 1GSKA 2PWGA 5I8EA 1Q0YH 1U8JA 2GVYA 3T8MA 3NDYE 4FMKA 3L5IA 1MREH 2R29A 2G38A 4KQ3L 1MW1A 5L3DA 1NEZG 2W9DH 2P5EE 1PG7L 3X14B 4FVMA 1KJMA 3SBWC 2AXGA 4V1DE 3N2KB 1GIGH 4JJ5A 4R4BA 4LCWE 4Z7WE 4KU1A 4UIMA 3MZGB 1MUJB 2YD5A 4HIHB 1HAWA 5DRXA 4AG4L 1MI5E 3TEWA 5MEOA 4XOCA 1KCKA 2OW7A 3J07A 1J1OL 4XBMA 3QUKA 1V54B 1IC7L 5KVGH 4QF1A 2YAQA 4E41D 4KHXH 4WW2C 3RNKA 2O5YL 3DDGA 1BVKB 2AJXH 1MG3C 1T7WA 2PI5A 4PA6A 1HX0A 2D7PA 4GB9A 4W9LC 4XNXH 4LLDB 2HLFC 2FGWH 2YIAA 2FBRA 2Y7QA 3PDDA 4UT9H 1L0LH 1H5BB 2W9EH 1EWHA 2F8IA 2XASA 2Q86B 4KKZA 2A7WA 1JK9A 3B8SA 1WS7A 2EYSA 2Y07L 5K1PA 3K0WA 2ENPA 3FYIB 2ZJSH 4NXSA 5DFVC 2Q87A 1IKFH 2NRDA 4PS7A 1GSMA 5SWQB 4TNVF 3GIVA 1OANA 2DYRC 3ZOAA 4L4VB 1TITA 4DR1O 3G6BA 5CN1A 1XGTA 4K0KB 3BH4A 4GNKB 4ODTH 1CS6A 2OXHA 5DSCB 1TFHA 4GEJA 4GRWH 3OMIB 3UEZA 2IH3B 4UAOB 3CB2A 1MVUA 2HVKC 4RO2A 1YUHA 5D71H 1AO7E 1NEUA 2B2XL 1I4FA 3PWPD 3QUXC 3GSRA 3QZOA 3APNA 3BEVA 1X6LA 3V4PH 1I8UA 1W15A 2VN4A 4XOBA 3NSYA 1JYXA 3E3QC 2UU9B 3FCUB 4TL5A 1NGWB 5HHVH 3FB5B 5L2KA 1R5IB 3DUSB 5DD1L 5IW3A 1XF3B 4JPKH 3DSFH 1UZ6E 3QJFA 4OGZA 1U8IA 2XN0A 3Q6GH 1FNFA 3CHRA 4TRPL 3V0EA 1EZVH 1JVOA 3IDYB 2NY3D 2DI9A 3E7JA 2CDGA 3QI9A 1Z9MA 2ESVA 3DBXA 2QGNA 2FDBP 1OHQA 1XCTA 2UVFA 4IRJD 4EXKA 3QHZL 4JFHE 2VW7A 3RZCD 1G0YR 4Q58C 5LMNO 1KLUB 3VDCA 3M99B 1MFBH 5E8PA 1DJIA 2ZM6O 5FYLH 4JAUA 4DR4O 1Q86W 4FTVD 2ZPKL 4CAGA 1SUHA 2D7OA 1T03H 4OT1L 4FIPC 2GTSA 1GJUA 3SGEI 3WDIA 1YEHL 3ZGHA 2BOCA 2QVFB 1DR9A 4UUJA 4I9WD 5DMYA 3P1VA 3OWEA 2OMXB 4AC2A 2A5UA 4UBDC 1CPUA 3O6MH 5LGJA 3CQPA 1LO4H 1B04A 4P8QA 3ZTJG 3ABMC 5C6TL 1NFIB 5KYWA 1LVEA 4P4KC 1MVYA 4Y5VC 3V0VB 1YMHA 3DGDA 5GISH 4RIRB 2NY6B 5EBMC 4I48A 43CAA 5LP6B 1D6EA 4LSQH 1J5OH 3R66A 1FBIH 3LNGA 5F6HJ 5B1BC 3BH8B 4IW4C 3L6FA 1NDTA 4F24A 4TULH 4ZOBA 5K39B 5JIQA 3RIAK 1NC4B 1BMGA 5D1ZD 5FL7G 3T2PA 2E76B 3WS3A 4BK4A 3NP4A 4I0PA 1B2WH 1F6LL 2DJMA 2XHBA 1MXDA 2BIMA 2XXCB 3T1FA 1HAUA 3CCHA 4RRPA 4QHPA 2NLJC 5D5PA 4DP9X 1R5VA 4HOWA 3F7PC 3OKNA 4J28A 2ZNXA 3T4AA 1XV8A 2DKSA 2VN7A 3BFQG 3P4MB 2BE3A 4PV9B 1CFSA 3QH3B 2FO8A 2VN3A 4IKJA 2WA3A 4BIZA 3MRNB 4YGVA 5HHXL 1GZHA 1A5FL 4IBSA 1L6ZA 2E86A 3GGWA 3D39E 4CU6A 3IETA 1ND0A 4DUZB 1J9CT 5BRZA 1PV0A 3RA7H 4XE5B 1ZLSH 3T71A 5EO0B 2P06A 3H2QA 1EEUA 4PVNA 1H8EG 4R90L 1AHWC 1FNEA 4LZKA 1Y1UA 2ZUYA 3B1TA 3AROA 5DK0A 3K80A 5F7LB 1MSPA 3T0BA 1CVSC 1IO4C 5FUZL 4WNJA 1PL4A 2V4LA 5CLYA 2PXYC 3UZQB 4PEEA 5IOPB 4DJMA 1UFGA 1HXMA 3E8VA 4FQXB 3MREB 3U6XA 3FH8A 4G6JH 3O65A 4JBSA 4YE4L 3RDTB 3P69A 1IBBA 4EVNA 3VQLA 3C8KA 5ID1A 2ZYHA 3ARWA 3ZW3A 2V5MA 3BWAA 3N1PC 4DTGL 1AZBA 2C5DC 3L48A 4LIQE 3O9OA 3D05A 1WISA 2YIBA 3ARYA 4KNUA 4LVOB 4M9OA 4UQ2B 5HGDA 5J9PB 2J56A 3FOLB 3FSOA 3FN9A 3QIUD 3T8VA 1IBZA 3KVQA 2JXMA 4WI2A 4X62B 1H0DA 1KXQA 5INCA 2FJHB 4N0YH 1N6UA 1PLCA 4QXGL 3OAWA 4LSVL 4MXQD 1BQHA 2JGUA 5CMAB 4FZ8L 4RGMB 1P1VA 3D51A 3SDXB 1M3IA 4QO1A 4EZLA 2UXDB 4DAGH 2OMZB 2F1AA 3GXDA 3UPRB 3H6JA 2QZQA 3QORD 4HF5L 3VMOA 4ZFZA 1EBAA 3QO1A 4L4TD 3NBNA 4TQPA 4HUVA 2RNBA 3EFDH 2VZSA 3WLWD 2BOBC 1HTYA 4QXTA 4DH2A 1N36B 3WAJA 3QXWA 2F8XC 2D3VA 1LTXA 2EX3A 1XX9C 4GRMA 2WIIB 3ZRWB 4EN3B 3CHQA 4J7RA 3QYNA 2B8OT 4U1GC 1HW7A 1SEQL 3JTBA 3V2AR 3TBBA 3BWSA 2IH1A 2K6YA 4KDWA 4JY4B 2GFBB 4A6YB 5EUOF 1D9KD 4OZIA 3GSOB 1HOCA 3ML9A 3ROOB 2OSWA 5LHDA 3NGBB 3TP4A 5I17B 2WBJB 1BVZA 4NQCE 1VGEH 1YEDB 2H26B 2WVSA 3U6RB 2DN7A 1EAJA 3AB0B 1QR9A 2UWEE 4U6VL 3KGRA 3T8XA 3UTSD 2Y06H 1G7MA 2JJWA 3ZU8A 3ABLC 2ORBL 3ZHQA 2O30A 5IJ0B 3MRKB 4N85A 3ABKC 1CZ8L 4QRPE 3WHE1 1KCSL 3VWJB 5DFAA 4R26L 5DVOA 3W3BA 3CXHJ 2EXTA 3WN5B 2EILB 2EEXA 3QCTL 2W94A 2R0WH 1MELA 3F6LA 3UAAA 1U2YA 3ETBF 1OCZC 4H1LB 2K3HA 4WI3A 3UTTE 1FG2A 4EUPH 1OO2A 3NIGF 4J4PA 5D1QD 1XGZA 3VG9C 3WLBB 4APXA 4CMHB 4F6EA 1W8EA 1U8LA 3AS2A 5TE6H 2LW1A 1YAIA 5B3JE 3SKJL 2AI0H 2XNAA 2YJLA 4AMKL 4QRRA 4DN4H 4FA7B 3K74B 3SJCC 4XTRD 4UYQA 4JDEB 4N8VA 3GF8A 4FNRA 4WWKB 5JQ6H 4JGMA 1QEXA 4YSOA 5KANI 3H2PA 3WJLA 5HHME 4DV6O 5SWSA 2DQEH 3EJSA 4CW1B 4EDWH 4DXWA 1NGPL 4XAWH 3EO9L 1ZIBA 1BJ1H 1T0NB 1OF0A 2BJML 3ZS8C 5B21A 4PUBL 2YUWA 3FQTA 3BQUB 3WKMH 1IEAA 3V8OA 1UWEH 3DJ9A 3QNYB 4OF3A 5IBTH 2XWRA 3R8QA 3VFUB 1UACH 2D7QA 2FLBT 4ONHA 3UL4A 2WAMA 3QEQD 4OF0A 2CA3A 2B0SL 4Z3EA 1T83C 4NO0D 3QFJB 5GS0C 4A39A 4PFEA 2CPUA 4YHKL 3JV6B 1WZ1H 3VRIB 2UXCO 2Q1EA 5JPMC 5H4ZA 3FTWA 1CUOA 4OZGB 1A3LL 5C0IA 1JPFA 1BD2D 1JZ4A 1ET5A 1JGVL 1WZAA 5FV1L 3AXHA 5GS1B 3JARA 4Z7QF 1FVEA 3JUZA 4L37B 5C0GB 1XR8A 4HU8A 2XWJA 3APOA 4YBHA 5T1JA 5K9JH 3ZQXA 3ABUA 2Z31B 3FQ1A 5AUMA 2CBMA 5I1DB 2XNDG 4W6WB 5GW7A 1VGKA 2AEQH 5GGSA 4HH9A 2BNRE 5D72H 1IIKA 4FF9A 4UVCA 2CO6B 5A1AA 1ZE3C 2ROXA 5I6KA 1NCBL 2Q7AA 4S1SH 5ALBH 1R0AH 3JWNC 1E2WA 5KYXB 4YNYA 4FJ6A 2JKTM 4RFNB 1B3IA 4G9FB 5J8OA 1RZKL 4HCRL 3HTLX 4AYSA 1I7TB 3BXNB 2EVGA 4N2OA 5EBWA 5ENWB 2BVPB 3G6AB 2IJ0C 3POCA 5L8LB 2BCKB 5JDSA 4XP9H 4HOMA 1RSYA 4WUKL 3S4SA 3T2LA 5DA4A 1TGOA 2A0LD 2EH8L 2QHRH 1PLGL 3O2WL 4L5FH 5I1JH 2OSLA 4Z7UB 4O2CB 4ZFFA 3PQYE 1MH5B 4OSUH 5T1LB 2XFGB 4Y1AD 3VGHA 2ZWLT 2DQFB 4JGNA 3SGKA 1ZWIA 2V5RA 1G7LB 1N5YL 3LHPH 3BY6A 1Z9OA 4PSRA 2VDPH 2A1WL 2G5BB 1TVHA 3W0WD 4R97C 2LP7A 3BN3B 2AERT 2ITDA 5DEZA 3K6NA 2A7BA 3C2SA 5JVDB 3VM7A 4Z6AT 2RH0A 3PAYA 5DYOA 3V4VH 5IJ9B 4F27A 3KLHC 3BHPA 1NCDH 1N59B 4FG6D 5K1VA 4B3VA 2DIEA 1VARA 1GYUA 1JGUH 3DX6A 3L8QA 5F1KC 2IPKB 4HHAB 5ITFB 4NCC2 4X4ZA 2HT4D 1DJYA 4KAQL 4NN6C 2WJ7A 3KXFB 4MJ6A 1KJVB 1OLLA 4KFZC 3GRWH 2QQKH 1AP5A 1H6UA 2IGFH 2WXRA 1U8KB 5HYQA 5I30L 2WQUA 3LZPA 4NB5A 2CJ3A 3ARFA 4ANVA 5LJYH 5I1LB 3VSTA 2WLLB 3VCLA 4RZCA 2IDSA 2WZPD 4M3KB 1QP1A 4B9ZA 3BAEL 5IB5A 2AQ1A 4OX9B 1BBDL 3L3HA 4Z7WA 5IQ7H 3LHAA 5JXAH 2V4DA 4HX1B 4PJ8B 2C9VA 4CVXA 1WLHA 4QR7A 1MI5A 3HJEA 3KPMA 3LKSB 2WQRA 3KPQB 2OTUB 2FEDD 3EGDA 3IVKB 3LDDA 2DLTA 4P5TC 5EK0A 4NKDB 1TPXB 3QGVA 4HBCL 2VQ4A 2DH2A 4FLXA 5C71A 2WMPA 3OAZK 3MBWB 3TYGH 1AZRA 2R69L 4C54A 4DCQA 1YTFD 1FPTH 3NMEA 4M43H 4IRSD 1HNZO 3UG5A 5CKAA 3E35A 4DR7B 1K9MW 1SDAB 1PZ5B 3GMPB 1G4YB 5LMUB 2FLMA 1JNHB 1I7UB 4MJIE 1KJ2L 1NDGA 3DETC 4Z7OE 2Z5UA 2ALAA 5H37A 5EU5A 3OLEA 4KOCA 3MCKA 5EF2A 3NA4A 1AJPA 1XXFC 2HJFC 2ZUVA 1OZ0A 2BSED 2DQHH 4DV4B 2O6CA 2YQBA 1FDLL 5L2JA 3F65A 1UXSA 3ZMTA 2H3NB 2Z93B 3IDIB 1K92A 2ZR2A 4K8RL 4KWUA 5F93C 1AO7A 1OAZL 1XWVA 2ZSVA 3EYVA 2HKFL 3BVDB 4D8PB 2X4OA 2J71A 3L5WA 4BCZA 4XNYL 4BFEA 3F05A 3FC8A 4LLYB 1SDDA 3QG7H 4WEBL 3RHWF 4W93A 1WB7A 1KJ2B 2CLZB 2R29L 4OCYL 1Q94A 5EBLA 1JVMA 5T8IA 3TNMB 3LKNA 2X7LA 2Y5TA 1I3VA 1YN7A 1Z9PA 3GSXA 3ALXA 4AQ1A 3K0YA 2HG5B 4IOFC 1TR7A 2J2ZB 3BKCH 4M7ZC 3BISA 3DURB 1QA9A 3JVGC 3QVAA 4G9DB 5I8KH 2LLGA 1HIML 3P40A 5D7LE 5EZPA 4AC4A 3CXHK 3W7TA 2DQIL 1B06A 4WW1B 4FLOA 4Y2DB 3KLLA 1U8JB 4LE8A 4YFLF 3QK0A 2NQCA 4JO8A 3JZ7A 1Q6IA 1JBJA 2NY4B 1F1DA 4WJG3 1FGNH 4JFOA 2HG0A 3IFNL 3ULUC 1BDYA 2ZUWA 1AAJA 3F5WA 3MGTA 3E8UH 3O81A 3WO4B 4DQOL 4JJ5B 2X2HA 4R4BB 5IMMA 3HZVA 1PZAA 3SPGA 5DRXB 3SPCA 2CDEA 5MEOB 5I15H 4HAGA 2A6DA 5IYDO 1KELH 3LPOA 3QUKB 2HPOA 3MCLH 4Z9KB 1CBVH 2H47C 4WHDA 4JI1O 3D6GA 5GGTL 3RNKB 1EHLH 2B4CC 1LQSR 2K0RA 3O6LL 3UROR 2XPZA 4TQIA 1IAIL 4LRIC 4O58L 2QGBA 2YQ2A 2X89D 2XZAL 5I18L 1OPOA 3OZ9L 1YSOA 2VB5A 4HJ0D 3AY4C 3O4OC 4PWIA 4D94A 1TTCA 4JMXA 4PRHE 1MF2H 2EYSB 2GTAA 2ZKHH 3W5MA 5C92A 3CE2A 1YMMB 2PYFA 3I50L 4GLRI 4NN5C 3ELAT 4K07A 1KCRL 2PW2A 5E1AA 1XGTB 3H1JH 4XVTL 5CZVH 2DOSA 3HW7A 2ZOUA 2Z64C 3P2BA 3O2DH 4ZUVA 1KFGA 1MVUB 1YUHB 4ZFGL 1I4FB 4DKFL 5MI0C 3GSRB 4IBWA 3BEVB 1UFIA 1R1BA 4BRVA 4FKEA 1ZTXE 2CSPA 5T3XE 1RUQH 2L3BA 3KWWA 3HAEH 3KL0A 5L2KB 3MXVL 2HTKC 3ZE0B 3QJFB 4PD4F 1GH7A 2JIXD 1U8IB 2YLHA 1OARL 4J42A 3D39A 1J8HE 1AGCB 4F9PA 4WW2B 1ACYH 3BQVA 3RVTC 4LLVA 5JHDE 3H56A 4MKTA 4QHNA 4YQXH 1LDSA 3SE4C 3KCPA 4R50A 1P9MC 2CDGB 3QI9B 3US0A 5E9NA 4KVNL 2ESVB 5LUMA 1GC1H 3IJEA 1XCTB 5GRUH 3UP1A 2E9JA 2HA1A 1OSYA 2LVCA 3GKWL 2QFRA 5ES4B 4LFBB 5IT2L 2ERJB 3SJAC 3T0EE 4YC2C 4DUYO 5EO1B 1MFAH 3MRBA 5E8PB 4GKKO 3FO9A 1NFDF 3D12B 4U0QB 1U58A 3GMMA 4MBOA 1TO4A 2BY3A 1VZIA 5DQDH 3DTDA 4GAFB 1RUML 3NJLA 1QBZA 2YRZA 4KJQC 1GN2A 3DO4A 4RX4D 2BOCB 5LQBH 2X2UA 4JYAO 2IQAA 4UUJB 1SNRA 2WKOA 5DEDA 1NOFA 5LGJB 1GY2A 3POHA 5ABAA 3HN8A 3BCFA 1KMIZ 4W4OA 5KYWB 2IAND 1WO2A 1YMHB 1LMKA 3MRIA 5KBPA 1I8AA 3CIQA 2IPTL 4PRBB 4I48B 1JDAA 1D6EB 4M7JH 4X9GA 2EINB 3HE6A 4GG6F 3S97C 1J0KA 3N1GC 2PR4L 4H20L 4MXVF 5C6WH 4PG9B 2NY1B 4H0HB 1LO3H 4PBVC 4X5QA 4JQVA 1TU2A 3GSQB 1SEBA 4JKLA 4NENB 5D2LF 4EKXA 5F6IB 3AQZA 3C9NA 2E7BA 1ODUA 1X4TA 3VXUD 2J43A 5FGCB 3SDLA 2EAEA 4WWNA 3CCHB 4TNWF 3ROLB 3RYHB 3DIVA 4FNUA 3MOBL 1R5VB 5E9DD 4CU8A 1PY0A 2DIJA 4XVJH 3GNML 3OKNB 3ILEA 4H0IA 3KPSD 4JRXD 4MNGB 3LZNA 3T4AB 3UPAA 1I8MA 1BS3A 1QFWL 2ZKMX 3L1OH 3O6FA 5CKGA 1Z66A 1QBMH 4XPGH 1CFSB 3NCMA 2BNQD 3UAJD 4R3SB 1WFUA 2E5LB 4NFCA 4YGVB 3GUTA 1VP7A 3I02B 3R1GH 3WIAA 1MCOH 5I1EH 4PJDF 5ECGA 3IETB 1CGSH 4GQPH 1QWUA 4Q2ZA 1WAEA 4PLKC 4QRPA 3CBJB 5BRZB 4MDJB 4ADJA 2CM6A 4APQD 4Y5VB 1MSDA 2WLZA 2KKWA 5JW4R 4FZEL 4BBWA 5EBMB 4OZFH 5TH2A 1TJHL 1HHIA 1YLBB 3PWLB 5HDBF 3WIHA 2CUHA 2FZ3A 3SDYH 3UTTA 1W80A 5DK0B 3NR7A 5GJTH 5B3SC 3ECBA 1HN1A 3AITA 4GW5A 2IV9A 1PY9A 2E6QA 2ZXBA 1VJSA 2JB5L 5BZBA 1AY1H 1HXMB 1L7TL 1AVMA 5CEZE 3RX9A 2R9AA 4U33A 4HG4J 5ID1B 3C8KB 1E5CA 1RMFH 1KCLA 2VUYA 5D93C 1C1EL 1YPZF 1QHTA 3BWAB 3GM8A 1O5PA 4FRWA 4RNRA 2KBGA 2SODB 4Z0BL 1R34A 3BPLC 5HGDB 3CJHB 2NYKA 4ZO7A 1BF2A 4NHUA 6PAZA 4HWEL 3B5GA 1TQVA 1BFSA 3RX5A 3HRPA 1GZPA 1G8MA 4DVBA 4D6TH 4UTAH 1H0DB 5INCB 2XG5A 4Z7NB 3QO0A 1RSFA 3AVEA 4GSUA 4I3RL 4NXNB 1BQHB 1V7NH 4IGBC 1MIMH 3NFNA 1HNWO 3QPQC 4QO1B 3U10A 2NT0A 4PBXA 4GQ9L 1MRDH 3AGWA 3HPLA 2WAHA 5E2TL 1XTLA 1KFAH 5BY1A 3TO4A 3QO1B 2JLLA 1MPAH 4HUVB 5EC1C 1U3ZA 2AAAA 4QXTB 3FH5A 3L5XL 3EDFA 2CKBL 5IB2A 3FQ2A 5L3FA 1C5BL 4MVMA 5GTHZ 2OYMA 4ZW3A 4GRMB 1DE4A 2AHIA 1UZ8A 3JWDH 2LVEA 3TH4T 2F18A 2NNCA 2BIIA 5AVYB 1FJGO 4AQYO 1CYWA 2BCMA 2GY7B 4EI5A 2IH1B 4L1HA 3WSQH 3FBQA 1LXMA 1H3PL 1KTKE 1HOCB 1ZGLM 3MLRL 1O9ZA 4YGAB 3OZLA 2ADFL 2FB5A 4Y16C 4KQ4H 3AG2C 1RUPL 1M53A 5D9SB 1EFRG 1G7MB 2WSKA 2Y6SC 2VWKA 4UMGA 5D7JC 2ODHA 4JHBA 4QUOA 3HZYA 4GAGH 5D7IA 3RVUC 3ZE1B 5KHIA 5FC9A 4JGUA 3UCRA 2FWUA 2VDNH 1LNUB 5IYZA 1GMIA 4K2UH 1US6A 1L6XA 3CBKB 3K1KC 1MJ7H 5D7HA 3L4CA 1A4BA 3R0MA 4LHUA 5C2BH 2B3IA 3PQYA 4X7SH 1Q3EA 1KPVA 3GHPA 1U8LB 3UBXA 2IO5A 4GX2A 4DERA 2NUPA 2X4RB 1TZIB 4I4WA 3K4DA 1Q9WA 2YEQA 2BOBB 2XNAB 1P1ZA 1CFVH 4QRRB 4XBGB 2DPKA 4GI6A 1HDMA 2Q7YA 5JUEL 4N8VB 4OQTA 5BRPA 5JHLL 4DEUA 5DRWA 2DW4A 1AG6A 4CZZA 2C1PA 4K8ZA 1JYVA 1GN4A 4KC3B 3UEQA 2O1AA 3R19A 3Q1SL 5ADPL 1HXYA 3IKCA 1O9HA 5A2FA 1IEAB 2R59A 3QQDB 4JZOA 5HVGB 4EOWH 1EJFA 4XAKE 2GHZA 4ZSOA 3KPNA 1QLEL 5JCOC 3VWKD 2G75A 1OOWA 3UP6A 4KY1L 3CZUB 4ONHB 4H88L 2CO4A 1U3JA 1EERB 1EHKB 5FO9A 3ABLB 3TFBA 5BZWA 3OC8A 4A7UA 3S96A 3ABKB 1NMBL 2M7WA 4H26A 4DZBA 1IBDA 4N28A 3JWOL 4K8XA 4ZS7H 1T0PB 1EAPA 4J2XA 1WEJH 5C0IB 1JPFB 2MTPA 2EIJB 2YLKA 3NIFE 4YDVA 1OCZB 3JARB 1E27B 1DCEA 2ZP0T 5ISZB 4NO5B 4YX2L 1QLEB 3H3BC 3VG9B 1CCZA 1XR8B 3C5ZA 5DMIH 4LL4A 3CDGA 2VISB 3CUPA 4MQTB 1KGUA 4ZMOA 2APWA 5HDRA 4NWUH 5AUMB 3SBPA 1IBGL 1RJYA 3ETTA 5IROD 3O2VH 3N0AA 2VQEO 4KI5E 1VGKB 5E2JA 4BA0A 4HH9B 3G6JA 5IESL 2NY0C 5MEND 1MHHA 1JRHI 2DD8H 1BAFH 4UV7L 4YDIH 4R8WH 5GJSL 5B38A 4YNYB 2MTAA 5BMFL 4AIXA 2FQFA 4M1DH 4MJIA 3G5YB 4GY4A 2BTQA 2YFOA 2G2NA 4G72B 4WHCA 1AVAA 1VADA 1OCCC 5EBWB 2DI7A 3VM5A 3RFZC 3B7TA 5JDSB 3VQVA 1JTOA 2WVTA 3FONA 4FD0A 4GBXA 4KTYA 4RMBA 3A4FA 3S4SB 3UACA 4GP8B 4Z3IA 2OSLB 4QRAA 6TAAA 2GJ6D 4ZFFB 5I6OA 5EWIH 5FFOA 1NANH 3HLAA 1ZWIB 4LF8O 5JPMB 3DX8A 1Z3GL 4ESKA 4GAJH 4MAZA 3RUGF 3VXRD 4PJBA 1RP3B 2KC0A 2ITDB 2Q8VA 3EH3B 4UINL 4XMLL 4G8IA 4OFYA 2OMVA 5E8EB 4G11A 2R9HD 2EUVA 5DYOB 3CPLB 3TBVA 4GT0A 2QE7G 2HN7A 4AYEC 5C09B 1I1FA 2X4NA 5D7LA 3PCYA 3STLC 3DX6B 5DWUL 5LN8A 3FCGA 4BRJA 1XI1A 4A63A 1H3VA 3K8LA 4OFKA 4MJ6B 3QAZC 1F58H 2YC1A 1T20A 3WENA 3N06B 3T6WA 1ITBB 3KVPA 3AEIA 3ARFB 4WF9V 4A2GA 2PYED 1U3HD 2ADGA 5I71B 4AEHL 3MLXL 3VCLB 2JEXA 5CXPA 1YG9A 3SY6A 3V0WH 5LYJB 4WKXA 1WP7A 3LEVH 1FLRL 3L3HB 5IB5B 4JG1L 1HYSD 4S0SD 1OCRC 2CXGA 3D34A 3HIZA 1GH6A 1QU7A 4NAMA 3BSZH 4LDLB 2GI0A 2F4VO 2ZIDA 3CFUA 3ATAA 1NM9A 4JPWH 5F7BA 5DGRA 1YSCA 5HY9A 1CXEA 4HG4K 3KPMB 5KAQG 5BO0D 3X1FA 2X4PA 5EF1A 4PRDA 4OJAA 3W56A 3EGDB 3UJIL 1TFPA 2PP8A 2O4EA 3MNZB 4MW3A 2CRMA 4M93B 5BV7C 3KG5A 2OS7A 2WMPB 4G70B 5FUOH 4R97B 2R23A 4DCQB 2R2HA 5L3CA 4Y9EA 1AZVA 4L4VD 1D2OA 3M17B 2HRPH 4IBLT 2MH4A 4FFBA 1K34A 1E3FA 5DJ2A 4DYLA 1KGIA 3PP4H 4JN1L 4PRHA 1SM3H 3D1MC 4QHUA 1NDGB 1NBYB 3F7KA 4CA4A 5EU5B 3DMMC 5DZOA 4U6YA 4MMZC 1F13A 4H7VA 1EHNA 3RBGA 3EXLA 1L9MA 1OAUH 3CDYA 3GLZA 1YNTB 3DVGA 3UM7A 4X6CA 2CGRH 5MHSE 3BP5A 4N9GA 1S7TA 4KK8C 1NGYA 3IU4L 4WTWA 5L2JB 3IM1A 5I73C 1P4UA 1UXSB 3DXAD 1JHKL 2AQPA 1SMOA 1MEXL 2ZSVB 4QDGA 3RWGA 4P9HH 3L5WB 5AYQA 3G3LA 1GGYA 1QSED 3FFCE 1SDDB 4FQLH 3P2DA 1IGFL 5JR1L 2BINA 4LXFA 4MA3A 4OJDH 1M56C 1Q94B 4WK2B 4TQEL 2X7LB 4NRYA 2Y5TB 1QW8A 1YN7B 3QDJE 3GSXB 4YDLB 3I84A 4AQ1B 3VGAC 1VQMV 2QR0A 3GJEA 1ZX3A 5JYMA 1J8HA 1OQOA 2HUHA 3VUAA 5SX4I 4JZJA 1MFNA 5CGYC 3BDXA 5JHDA 1N34O 4ICXA 5KHGA 1G6UA 2VAAA 2YZ8A 4G7RB 5HHOA 1XGQA 4XNMA 2XIBA 2BVYA 2IWGA 4O2FA 3FO1B 2AF2A 3OXSB 1S3KH 2LU7A 4PH8A 3QDAA 2IAMA 3P3NA 1AR5A 3DIFA 2N3JA 5ALCH 4ZK8A 2FBJL 3B9KC 4JFFA 4JI4O 4JE4B 3F5WB 1H3WM 3G04A 5BZDA 2VDRH 3MGTB 4YFLI 5EA0L 4B08A 2HJFB 3U0TA 1Y76A 5IMMB 1DO6A 2NZ9D 2WUBL 3HE7D 4FG0A 4FP8H 3S36X 4AGNA 1TENA 4YHHB 3HZVB 2YJQA 4JKPH 3C87A 5IW6A 2CDEB 1NH2B 3O3AA 1S6NA 2NY6D 1VAHA 4HOXA 1KWGA 2N59A 5KTEH 5DYFA 4PJHA 3VE0A 5JYLA 3N2JA 3EJUA 5D2NE 2YEZA 4Q6IC 5B4MC 3O6KH 4NTWA 2NZIA 5H4YA 1Y6KR 5BVPL 4X0KA 3MTXA 3CZLA 4DZ8A 1M71A 4J3BA 4P3CH 4B9PA 2UZIH 1FC2D 43C9A 4O4IA 4N2IA 1PZDA 4RH4A 5KVEH 1W0JG 4G43A 4Z78B 4WFGA 1GKOA 2A06H 1K4DC 1U95A 5CA1A 2PYFB 3FL7A 4XH2A 2PW2B 2AJVL 3MRRA 4XN2A 2GUYA 1K3EA 5E1AB 1S9WA 5J1AA 4PDRA 3GTTA 1XSKA 2HMID 2ITCC 2ALWA 2F53B 4JUTA 1JZEA 4N6RA 4OD3L 1IGJA 3H1HH 2B4CL 2EDJA 2Z0AA 2ZX7A 3FNKA 3BUIA 1RUAL 1E5UI 4CN6A 3AGVA 1JD7A 3BYTA 3QXAA 1HH6A 3CVHH 3WEXA 4UTBA 1BF5A 3RAJH 3CRAA 4LGSB 3KWWB 2AGJH 2OQJB 1D2PA 2Y7NA 3VSVA 4MHHI 4NQEB 1QZNA 2BSRA 4EFEA 4KUMA 2N7AA 3P0YH 1JE6A 4ZI7A 1TEFA 4H8WC 5B1OA 2JCCF 2VXVH 1KPUB 3D39B 4FFYH 4W1TA 1DBBH 2ZWSA 3D8MA 4RQQA 4QHNB 5EF3A 3KCPB 3IFPA 4Y5XA 3K81A 4FQXD 3IJEB 1A7QH 4WI8A 5LLIC 1QBLH 1KTJA 3PGDB 2VITA 4AYID 2GJZA 2D9CA 2VSDA 1TSRA 3C12A 4P06A 4FE9A 1KXTA 3MRBB 3K8KA 1IAOA 4TS6A 1CGYA 1NVPD 3FO9B 2EO1A 4OJCA 5J6GB 3GMMB 2C9PA 3LNNA 5IY5C 4KPHH 2A9ML 5KANG 4NI6A 2EZPA 5F89B 3ISRA 4HAFA 4WBNB 3F85A 2QADD 4MB1A 5CINL 2R0KH 3NEOA 4MDRA 4Q9BA 4IDLA 4XCNB 2IQAB 1BIIA 1J87A 1ZKAA 2XG4A 5J12C 5DF0A 2YK1H 2GSGA 3RVYA 1DTUA 4Z0XB 3RWDA 1KYFA 4JM0A 5IJCC 1AR1B 1M2VA 2E27L 3MRIB 4B5EA 4DVRL 2C2AA 4I77H 1TIUA 2A73A 2ZOOA 3I3EA 1T5WA 1A1OA 2AJ3A 2OM5A 2WVVB 2KS0A 4GRLC 4MASA 5LG6A 4OZHB 1B0GA 3HE6B 4V11A 1BLIA 4Y19E 3ZTNH 4MS2A 2LAGB 2CAZC 4ZMTA 5KVDE 1DLHB 1ID2A 3FUEA 4Q97A 3REVA 5DUPL 1UVQB 1TU2B 4KQ3H 4JI3B 1SEBB 3LX9A 1DVQA 3PJNA 2ZOLA 4XB3A 3C9NB 1PG7H 4HBQA 2WBJD 4IEFB 4BGDA 1CYGA 4PJEF 3HZMA 1MCKA 4J41A 4LFAB 3ORJA 4LBEC 2ZOTA 4DKTA 3U7WL 1E5AA 1UOKA 1G84A 4OCRL 3WIHL 2WXOA 4AG4H 4C4KT 3GPSA 2D3JA 2E7MA 1I8MB 1ETB1 3ATEA 1N70A 3O6FB 4D7TA 1J1OH 1OP5H 1IC7H 1OT1A 1ZT1B 1PKXA 3LIZA 3FO0L 4LSUL 3GUTB 4YHML 2O5YH 5EFIA 2V2WB 4QJFB 4JM2D 3U0PA 1RLBA 1SVBA 4QRPB 4DUXA 1PKOA 2KI6A 1WA8A 4PRAB 4K3AA 3MO1A 2FQEA 3GIZL 4NJAL 3K9SA 4H4NA 3SYQA 5TH2B 1HHIB 3RZWA 2FZ3B 3B6SA 4FYRA 3FFDA 3UTTB 2Y07H 3T6QC 3KWXA 1YYCA 2BZCA 4WWKD 2VGLM 3HB3C 2EABA 1JZHA 3GWJA 4YIOA 4RDQG 4TUJA 5I9QC 4PJCF 5LNDA 1PJWA 4KI1A 4N26A 1CXZB 3INUL 1RIVL 3MLPA 3ARBA 1MFMA 1XD0A 4P0DA 3IRCA 3BQUD 3Q13A 3HG1E 1N7ML 2FB4L 2B2XH 4L8BA 1GYVA 1FORL 3KE0A 2WXHA 3ETBJ 3MRDA 3VGFA 4AVKA 4D0CB 4NHUB 4FAAB 1A3RL 2I32A 5DD1H 3U0WL 4ZIBA 3FT2A 5GS2D 5CNHA 2XG5B 3QO0B 3BZDA 3CVIL 2GY5A 4TRPH 1T5KA 4J3OF 3HKFA 1UA6L 1MCCA 4O2EA 5DCCA 3SPHA 3NFNB 3PUCA 3S3WA 2AZ2A 2K3TA 4F3FA 1Q0XL 2K9UA 3V79C 1QTPA 2CUGA 3OMAB 4JRYE 2BFGA 3SKOA 3HPLB 4MAYC 3TO4B 4FABL 5HPMB 2CK0L 4MVOA 3F5TA 5LHGA 2BC4A 1OM9A 4MS8D 2L7UA 4LQFL 3KPTA 1XGUA 1O7DC 3SGIA 2UXNA 1ZLEA 1DE4B 3FCTA 1UZ8B 4Y4HD 1JERA 4PP1C 3HKDA 1T2XA 4A2EA 3ETGA 2ZPKH 1EN6A 1BQ0A 1DCLA 4IJ3C 3D4CA 4EI5B 1UWFA 4OT1H 4TSAL 2WLJA 1G6VK 3IAPA 1E1RG 1YEHH 2WSSG 5KS9E 2LABA 1IBKO 3TVMA 1JPTL 5KVGE 3TH3T 2G3XA 1YJWV 4LH6A 2QWRB 3RGBA 4JFQB 2G0LA 2XN9E 2C4FT 4NZJA 3ASNB 3ZDXB 5ISZD 4NBYB 5J4MA 5C6TH 1R3LC 3M1CA 1BMFG 1F4AA 4TN9A 2D9QB 4G8GE 4K5PA 5DFTA 3V6OE 3I9AA 4OV6F 3HZYB 4M1GL 5D7IB 4I7ZB 2VDKB 1VFUA 4PLJD 5IYZB 4DV1B 3BD4A 3QUYA 4GINA 3MBEA 5IHLB 2JTYA 3G5WA 3NIDF 1E3XA 1T1XA 4TSCL 4LHUB 4F7CA 4YSDA 3PQYB 1SXCA 2FNWA 3CZSA 5I5RA 2MQCA 1GPOL 4JI2B 2NX5D 3LS5H 2NUPB 4GRWE 5HJ3A 3MRCA 5DFWH 1U4EA 2MQ0A 1P1ZB 4PU2A 4TYUA 2DBLL 4ISVB 1HDMB 4NWTL 5F96L 2Q7YB 4LCUC 1IC5L 2DWYA 1JTPA 3ZMSA 2H6OA 3KZ8A 2XV0A 1F2XK 5DRWB 3SGJA 1NGQL 3RVXC 5H2FZ 1RPOA 2P90A 1TEGA 1U3YA 2VIRB 3T65A 1PD3A 1JMXA 4OFVA 2C1PB 4G42A 3JAKA 4E42A 2BP8B 4N2CA 5FYKD 3MN8A 4R0LA 3T77A 4BE5A 3RIFF 4JZOB 3H85A 5HHXH 1NCAL 1WFMA 3KPNB 4ZSOB 3RY4A 1A5FH 3MUHL 3NCXA 4JFXA 5FOBA 3CZJA 4PJ8D 1TOXA 1URIA 5EPMA 4B9JA 5FO9B 1VMGA 4FXGA 2YPKA 4H26B 4DZBB 4R90H 5EORL 2EE6A 4G27B 1GS8A 4PG2C 1EAOA 1O6TA 3EZJB 1WAAF 1K8AW 5FUZH 5FYLE 1QPPA 1G43A 1EX0A 4WHTA 4PS4L 3BPCA 5J11B 2DTML 3CDGB 5G4MA 1VLXA 3H9SD 4YE4H 5I1IL 3EH5B 5CAYB 1Z5YD 5I76A 1RJYB 3TLRA 3CAFA 4DTGH 2H2SD 1J05A 2VKXA 3G6JB 4JQIA 2HFTA 1E5BA 2F5BL 5I0VA 4WVRA 5B38B 1IKNA 3TZVD 1K5NA 4MJIB 3Q9QA 4Z7OB 4KOBA 5HYJE 3I75A 3B5HA 4OD2A 4FERA 1QSFD 2BTQB 4B7IA 1F41A 3B83A 4QXGH 4LSVH 1VADB 1OTSC 1ZJBA 2Q0OC 2FWLB 4FZ8H 3BZEA 1PX3A 4CJ0A 2PO6A 4GBXB 2L8AA 3WJJC 2JI3A 3QO5A 3UZEC 1I8LC 5D96C 2Q6WA 1TNNA 4FXKA 4HF5H 5JO5A 1BGYH 4TVUA 4KFMA 4OIAA 1H2GA 3DNKA 2XN1A 4FNSA 3QRBA 5EIIG 1M4KA 3HLAB 3DX1A 2FGZA 3FFCA 3DX8B 3JV4A 3WY1A 4K8RD 2PF6A 3ESMA 1NI8A 4B53A 4PJBB 1B90A 3V7AG 4ZKIA 3MOAL 5IV2A 4JN2A 2YICA 1SEQH 3G6DL 1YY9C 3GBLA 4F8NA 4WFED 2KYIA 3PFUA 1OCOB 2PPEA 4OCWL 5IWAB 4Y2DD 3AU0A 4N2HA 4YSUA 3TBVB 3ARRA 4MZIA 2W88A 3VYPA 4PTTA 2HN7B 3SO3B 1I1YA 2V3DA 4W4NA 5KOMC 4H1LH 4NT6A 2I7OA 2V7NB 2X4NB 4BSWA 5CN0A 2XIDA 1CFQA 4S0HA 2Z4QA 4BFJA 4BK8A 4ABMA 1AMYA 4U6VH 2IF7A 2YC1B 4JDZB 1T20B 2VXQA 3U36A 4ZRGA 4ALAL 1FL6A 2ORBH 1HZHL 3DUHA 2ADGB 4KK6C 1S77D 2PCXA 2A38A 2VZ3A 1CZ8H 2WQWA 1KCSH 4R26H 3WNKA 4Z3GA 5B3NA 3QCTH 2J44A 3TN0D 2ATPB 4RAUA 4PRIA 1S46A 3LQAC 4U3CA 4UXNA 2ZSWA 4YMPA 4P2OC 5IQOA 3BEWA 4PJ6A 3N6YA 2BSSA 2VZ1A 3LDCA 1ASQA 3SKJH 4YHLL 1AXSA 4KKLC 5FGBA 4AMKH 2UUBO 2VUOA 3V5HA 4ZMQA 2ODIA 3G6EV 2APBA 1YMMD 5KJRL 5GS2H 4XN8A 1D5MB 1N33O 3F7YC 5GRWA 1NGPH 4WO4A 3EO9H 5EUOA 2WANA 4FFBB 1X7QB 2BJMH 3NZHH 3A22A 4J27A 4PUBH 4QHUB 2HB0A 3TEYA 3RKDC 4Y7OC 2MQGA 3V5DA 1NLDL 1T0MA 1K5WA 4U6YB 5EB9A 1CGVA 5DVNA 3HNTL 1DLBA 1D6VL 3PAUA 4HIPA 3DVGB 4X6CB 2OT5A 1RZPA 2B0SH 4QE9A 5L4FA 3WB2A 2VNCA 3FJTA 4FPPA 4YHKH 2A74C 5L2KD 2ZIMA 1G1KA 1U41A 2VR5A 4WUUA 3WFVA 1KBKA 4G28B 1A3LH 5JHMA 1ESOA 3H1LH 1S2EA 5DZLA 2AJZA 1JGVH 3QNFA 4MA3B 2XVKA 2HTLC 3L54A 4KX8A 4Q52A 2ARJA 1CE1L 5G55A 5INDA 1G7HA 3QO7A 4NRYB 2C26A 4KRPC 3P3PA 3DOSA 4E41E 2HLFD 4LEXL 2AMGA 1GJWA 2QR0B 4C47A 4QHLA 1F4YL 1J8HB 4U0RC 4ZQTA 4JZJB 4TV8A 5IQ9A 3QFDA 5DFVD 3HG4A 1F0LA 2Z8WC 2VAAB 5HHOB 1NCBH 3NFPA 1XGQB 4G5AA 4XNMB 4E9WA 4XP1L 2EDRA 3VI3E 4OW6A 2BERA 2VWJA 1WA0X 2IAMB 3EO0A 2Z0UA 3DIFB 1RZKH 4HCRH 4JFFB 3O0LA 4PD4J 4OF6A 4D2NA 2KLRA 1BSMA 2VRZA 4X2UA 3QUXD 5FX3A 1A3QA 5BJTB 3G04B 2AC0A 3H4FA 1AOZA 5DS1A 5C08A 3U0TB 4PV1C 4WUKH 1Y76B 3D3VA 3O2WH 4UQEA 1PLGH 2BVEA 1BL8A 3FU3A 5IW6B 1DFXA 3MHSC 1MNUL 1F00I 1N5YH 3B2VL 4HD5A 3OR7A 2A1WH 5D7EA 3NEEA 4PJHB 3UYPA 4K94L 1V3KA 2QJ1A 5F44A 2YEZB 2AXTZ 4TUYA 1AS6A 2P80A 2NR5A 5I1GL 3OAUL 4FEMA 4X0KB 2ZNIA 2DDQL 3CC2V 1M71B 1FUNA 4FADA 3PHQA 4KZDL 2PTMA 3WYRA 4B3TB 43C9B 3VGAB 2ILMA 4PJ7B 1MHEA 4Y19A 4DV5O 4KAQH 2A4CA 5FFGA 4KTEH 5CA1B 3PPEA 2I26N 4B9CA 5I30H 4XH2B 2P1YA 1WTLA 3MRRB 3OHXC 4BZ1A 1S9WB 1HWGB 1YNKL 4Q4EA 3SCMC 4G80A 1E6JL 4P5RA 4R6UA 2K4WA 1CDUA 3B9KB 4N6RB 5GZOA 3F62A 3BAEH 1FLTX 1MLBA 1BBDH 4KVPA 4W6XB 5KSVB 3AG3C 3EDKA 1OKEA 5KHHA 3TF7C 3QXAB 3WEXB 4UBDD 5JPNC 2B5IC 4I1RA 5ABDE 3F6JA 3C3TA 4LP5A 1G7JA 3P4OA 4I9WE 3K5SA 4JDVA 1ZVNA 2BSRB 1FNAA 4UB0L 3TT1L 4LLAA 4R4FL 4ZI7B 3HKEA 5T3XL 3VRJA 2R69H 2Q0AA 3BGAA 4RQQB 1AGFA 3D07A 1DL7L 3FB7A 2WLKA 1V55B 1E50A 3IFPB 2IADA 4Y5XB 1L9SA 1N0XL 3HRZC 2Z6FA 5FGSA 4AJVA 2PP7A 1FSKB 1KV3A 1NBQA 4ADGA 1F4HA 1KJ2H 2VITB 2GJZB 5H6QA 1VFMA 1JQ0A 2XOTA 1KXTB 3D25A 2BXYA 1WITA 3SSGA 1Y67A 1IAOB 3ZMUA 3CH1A 4KXDA 2O6FA 2IDQA 3OR6A 4L5FE 5JMRA 1FDLH 2VRKA 1OIOA 2BS9A 3UC0L 1PNMA 2FK9A 2PUSA 4K8RH 1OAZH 2F6AA 2HKFH 1HSAA 5I0XA 4XNYH 4TT3G 4WEBH 3MA7A 2Q9LA 1BIIB 2WKLA 2XG4B 3PPSA 4L05A 3MJGX 2R29H 4OCYH 2GSGB 2CRYA 2PTTA 4KQ0A 3C8HA 2QKIC 3RHWK 2IU0A 4AEFA 2JKWA 1M2VB 3JD2A 5FA3B 5ID0A 2A73B 4P2RB 3RTQC 3U30C 1T5WB 2P8PA 4OUOA 2XWCA 3LUTB 2GIYA 1KQSU 3K0GA 4LLMA 4U2ZA 4EIZC 2ITFA 1HIMH 7CGTA 4JRYA 3O8XA 3QWQB 4MRCA 4K9JA 5PAZA 4F7KA 1NC2A 2DQIH 3QWNA 1M7IA 1DQDL 3RQ3A 4NN7B 2PXYD 5AB1A 2RQ6A 3REVB 4NGHL 2NXZC 3OSKA 2ZCHL 2ED7A 3EBIA 3F01A 2ZOLB 1PW3A 2X9YA 3IFNH 4F2MA 1U2CA 3T09A 3TX4A 3VXOB 5JHAA 3TA3A 3BUBA 4DQOH 5FNVA 4AQEA 4K7PX 1HEJC 2AXHA 5K9KA 2QSCL 3NPZB 1ZAGA 1QW9A 3PP3H 5KS9A 2J8UF 5AW8B 2HSIA 4XC3L 2WN3A 5C9JA 1ED3A 4URKA 4G8EB 3MA9L 4LPVA 4FLVA 1AMXA 5GGTH 1WH0A 4ZAKA 3V6OA 4C7UA 2O72A 4G8GA 3O6LH 3U0PB 1SYSA 2CPCA 1IAIH 1R9FA 3KS0J 4O58H 4KBPA 1WA8B 2VLKA 4MD0B 3MO1B 2XZAH 2W0PA 2I85A 3OZ9H 4FLSA 5I18H 4KVCL 3Q05A 5KSAA 3RVWC 5CJXC 1WWCA 3T1HB 2JNZA 3B6SB 4GRLB 3FFDB 4L4TE 2QDOA 3I50H 4TUJB 3RB5A 1KCRH 4FI7A 3VOUA 2CK3G 1MLCA 3D30A 1XXDC 4FLQA 4XVTH 4AVIA 4KZEL 4TVPD 4PWGA 4L1TA 3ARBB 4MMXC 5C93A 1PD6A 5B1JA 3LSOA 4X0NA 3CFKA 4WENB 3V4PA 4ZFGH 4DKFH 1NINA 1GRWA 4XVOA 4PGJA 4L8BB 3P3UA 2Z1PA 4HCGA 5GGVL 4AYFA 1BZ8A 1UT2A 3MRDB 1OZUA 1QQDA 3DJTA 1FQ9C 1DQLL 4Z76A 2E4TA 1E2VA 3K3WA 3V0GA 3MXVH 3FT2B 2J3SA 1LMIA 3DX9A 4G7VL 3K59A 1OARH 2YMTA 4Y7MA 1QNMA 4W9JC 2XA8L 4GIPD 4F58H 4O2EB 1C12A 1IM3A 2NYYC 1RPKA 2JF1A 4F3FB 2AV7A 4PD4K 5EN2A 3CEIA 3P3SA 3SKOB 4KVNH 2OULB 3BVXA 3ZSSA 5H8DA 3SDCA 3FQXB 1NJIW 1BVLB 5EC2C 3ZRVA 2VL4A 2BC4B 3GKWH 2ZWZA 5IT2H 1MDTA 2I07A 3DO7A 1XGUB 4ZD3L 3SDDA 3BVUA 3NQKA 4K5OA 1VACA 2ZOWA 3HB3B 4DV6B 1TQTA 4AIEA 5I9QB 3EFOA 4PB0L 3HKDB 5SX5H 3OHMB 3W37A 3NRPA 1ZS2A 2DB8A 1KP2A 1RUMH 2K6WA 3KPLB 4RSYA 3TVMB 4JYCA 5K9QI 3SKNA 1J18A 1EZVX 4OCXL 4YSQA 4JHAL 1MZZA 2P22C 3EIFA 5GS0D 4R8CA 3VB9A 4C56A 3ZKNC 4ZX4A 1I1RA 2IPTH 3CPWU 3KJ4B 5D4HA 3QEQE 3ALPA 4PMFA 1OP3H 1M93A 4J8RA 1DVFC 5EH1A 3ILDA 2P26A 5TJWK 1RJLA 1T1XB 4C58B 2PR4H 2PYLA 1RZJC 4H20H 1N3NB 3I55V 1ICTA 3QS3A 2W80C 1MY5A 2EP6A 1TCRA 4GT7A 1L3NA 4MAYB 5E6IA 2R4RL 1R6NA 5HJ3B 5C09D 3IYLW 1COWG 2YUAA 4ANXA 2FX8L 1T5XA 5DC0A 2R7EA 3DK0A 4AQ8A 3O41A 4JTAB 1NFDA 4TUUA 3U7YL 2WQXA 1Q4NX 1OTUC 4IBUA 4ES8A 3E6HB 3MOBH 2DWDC 3T65B 4E9YA 3ARFD 2JKLA 2QM7A 1KTDA 3JAKB 3GNMH 4E42B 1BPLB 4AE0A 5T33L 3RWCA 3WOVA 1QFWH 3CFIC 3P2TA 3UMTA 4C59B 2IALA 3T77B 3HKBA 1QRKA 2DMHA 5I26A 3OG6B 5AL0A 3S8FB 4RLDA 1R47A 3JSNA 3D0VA 5KBMA 4G8FA 3L9DA 1TMQA 5FXCH 1ILUA 4FXGB 4PWHA 1J0IA 5J6SA 3HS0C 2YPKB 3KM2A 5JORA 4KXCA 5G5DB 1ZT4A 4FZEH 1R33A 5EV7A 1TJHH 1OTTC 4QRSA 4WNQA 2FUQA 4YXKL 2VS0A 4BWWA 1J86A 5AALA 3WEAA 2P8MA 4LRNL 9PCYA 1T3FA 4H0LC 1V3JA 2JB5H 2MCMA 1USZA 4LH7A 4WHTB 1L7TH 2NXYC 3BPCB 4XMZA 1RPUA 3D85A 4DOHE 3KLHD 1RP9A 1QRNE 5CSBA 1BG1A 1VQ7V 2JKIS 1KB9K 2HJKA 3TYFA 1C1EH 1IFGA 2R56L 3IAYA 4LCUB 2XBZA 2AJYL 2YSTA 4FZ0A 5I0YA 2YN5A 2ZQMA 3E6FA 3Q2NA 3WFHA 1AHKA 3AUWB 4HWEH 2ZP9A 5EZYA 3UMNA 3NN8B 1AACA 2CNZA 4OD2B 4ONGL 1ZS8A 3AT8A 4BH7B 1G7PB 4NUMA 3ZX6A 4I3RH 4TV3A 4EI0A 1HKFA 2OXGA 1NTKH 3DHUA 3BZEB 4X66O 3GC3A 4XO8A 2PO6B 4KXBA 1FNGA 2B16A 4GQ9H 4RWYL 2Q6WB 4J3TA 3L9YA 2EDQA 4FXKB 5E2TH 2NUTA 4EPSA 5JO5B 3VMNA 3V9CA 3BT2L 2UXBB 4P5TD 1N64L 3L5XH 5ELIA 2CKBH 4RFOL 1HKLH 1UOWA 3JV4B 4PJGE 2O5XL 4MHHG 2BP3A 5JXEC 2VXQL 4X9FA 2LW7A 4HOZA 2EUXA 3VXNA 2DQJL 3LRHA 3SE3C 4JN2B 1WFNA 4QEGA 4EEQA 1PCXA 4QRFA 1TDQA 3RI5F 5IV2B 5FO8B 3MCYA 5DUBB 4X6FB 1FHGA 3MLVL 2VDML 1RZFL 4PTTB 1I1YB 4E9SA 1H3PH 2QV2A 3EGSA 4NT6B 1JWUA 2GPZA 3DETD 4Q4IA 3MLRH 4BSWB 1AD9A 1CFQB 3FQUA 4OCNC 2Z4QB 2ADFH 3WMQA 3MV8B 1JI1A 3ALWA 4CC4A 1RUPH 2ADIB 2L0DA 3U36B 1FL6B 5GZNC 1JPEA 3RBSA 3E0GA 1NH2D 3CZKA 5BQDA 2FIKB 3T5WA 3TOPA 3KPPA 3CCRV 4EUPA 1OGAD 2HVBA 1W0WA 2P46B 2VDMB 2Z7WA 4JW3A 3DTXA 3VD2A 4PRIB 3HPJA 4TVPH 4LC1A 5AL8A 3PWPA 1LK2A 4WI0B 2ZSWB 3BLKA 2FQGA 5D96B 3BEWB 3TJHD 2LJ2A 2BSSB 2ZAHA 5JJEB 3MRFA 4PGCA 1AXSB 2QVIA 4IOFD 1NAKL 3RYIA 1P7HL 4HAMA 3V5HB 4EXPX 3GSUA 1BFOB 5JUEH 4PJXE 3TF4A 4YDJA 5JHLH 3PNRB 1BZKA 1N4XL 3E83A 1TUBA 1PS3A 1X5XA 4U7NA 1XGPA 1U4FA 4WO4B 4WFHD 3QCUL 3CFDB 5EUOB 1MW3A 5ADPH 3Q1SH 2F53D 4BFRA 3BKYL 3FTYA 3K71A 4PGDA 1XBLA 4D9QE 3LQAL 4R83A 3CC7V 1T0MB 3PGCA 4IRJA 3UQ8A 3ARZA 1QLRA 4WFFE 4KY1H 3RNQB 2A6JA 3RZCA 2CE4A 4H88H 4HS6A 3CZEA 3HI5L 2G9HA 5H35A 3B4NA 2GSIA 1MJJA 4HA1A 3LV3A 3AWEA 5DJ0B 1EZJA 2ZX5A 4BKSC 4NQED 1NMBH 1TTBA 3EYOA 4NQSB 2HAZA 3BJ91 3AAZB 3JWOH 4FTVA 1IC4L 4WUUB 5EF0A 3ZKSD 4WU7A 3AS0A 2F58L 2CUMA 5CN2A 1M57C 1SYVB 4OGQB 1IAMA 2AJZB 1WLEA 2ZXEB 3AXLA 4POYA 4MVUA 4ELMF 1D5BA 2ARJB 4YX2H 5AB0A 1G7HB 1JXJA 1A66A 4P2OB 3QJOA 1QATA 1UJ3A 2WKGA 4L48A 3DOSB 3H53A 3RL2B 3BOVA 4DUZO 1IBGH 4JO5A 1BZDA 4NSKA 1FXKC 5IESH 4YHOL 3ATDA 5IQ9B 3CC4V 1AI4A 4UV7H 3NFPB 5ABZA 5J13C 3TEXA 5BMFH 3F7YB 4OGAD 5GJSH 4NR1A 1Q6HA 2P24A 1C5DA 4Y2NA 2N7SA 3OJDA 5IVXE 2YRLA 1SF3A 5D1ZA 3RE0A 4UM9D 1JRHL 3WV0A 1QWHA 3EBGA 3ZEDA 2FO1A 1XEQA 5B1AB 3VDBA 4LQ1A 4ZX3A 3P30L 5C08B 4HUUA 4JCLA 2CJSA 3D3VB 2E6PA 1T7YA 3OUSA 4QNPE 2UXVA 5IVNA 3GBDA 3CZFB 2ICWJ 1ZSDA 4RZKA 3FS9A 1FAFA 4JHVA 2X9WA 4JTDB 4XBPA 3UO8B 1JYNA 1Z3GH 3OR7B 1X7SA 1JJOA 1EO8H 3UYPB 1NCCL 4Z7QB 4UINH 1TG8A 3SEPA 1KMGA 3RWRD 4TUYB 1HQRA 3RVTD 5LAXA 3V4VA 1EGJL 2VCOA 4GW4A 4F93B 1Q0EA 4KRPB 1H3GA 3HNVL 1VFOA 2BWIA 3QUML 4NQTA 3IPFA 2UXDO 3PHQB 5ETUB 4XCCL 5C86A 4F91B 4JFED 4JPVL 4DUYB 1ZVSA 5DWUH 5T3ZL 1EXHA 3GRWA 4Y19B 4GKKB 3K2KA 1EVUA 1N36O 3TJTA 3MRGA 3AQDA 1HNYA 2R0LL 2G3MA 4IYIA 2V7HA 4AEHH 4BR6A 2CCWA 3MLXH 4PR5A 1DANU 1I75A 3Q5TA 4XCEA 4NAJA 5BQ7A 4KJQD 3AM8C 2WAQA 2FYYB 3PWUA 1QFOA 2ZOKB 3QUMB 3ETDA 2X12A 4FQ1L 4DPCX 2FX9L 2C9QA 1ZLWH 4PV1B 3QXTA 2R15A 4L18A 3K2MC 5H9CA 1A4AA 3O3BA 4PJFF 5H37H 1P4RA 3UJIH 2HKHL 3QIUA 2YAFA 4ZFOA 3NRQA 2AZ0A 3U25A 2WNXA 1ASOA 2BSCA 4ZZKA 3IFOA 2IANE 5AYUL 3VRJB 3KCXA 3VFPA 1JXGA 2EDHA 2PGGA 1AGFB 2YN3A 3G5VA 1BBJB 1HHHA 1N5AA 4LVHC 4B7LA 4DEPC 2IADB 5CSZA 2OLDA 5DHMC 1X3DA 3LN5A 1AI6A 2D0GA 4HHGA 4JN1H 3FTXA 3VXME 5I0DA 3QORA 4K7PL 4J12A 3ISYA 4L4TA 5IJDC 1O9VA 3D25B 1JNJA 3TU6A 3U1SL 1H8OA 3CH1B 3OR6B 2BM3A 4YO0A 3IU4H 2ZX9A 3BMWA 5T1KB 3WS6A 3E8GA 1JHKH 3UJJL 2XTJE 1IGYA 1MEXH 3ZN1A 3SCMB 1HSAB 5CEXA 1U0QA 5E9DE 5JW5B 1TJGL 3MA7B 1D9KA 1IGFH 5DUJA 2FE0A 4KNSA 5JR1H 3KPSE 4JRXE 2PTTB 4TQEH 1F3JA 1YIJV 1X5AA 2WLHA 4EB6A 1DEEA 4F8QA 2BNQE 3WO3B 3WUWG 1Y4MA 1OW0A 1VF5C 2WBXA 3CVBA 3UTSA 3K5NA 3LDBB 5ID0B 1K3IA 2J1WA 5DMKA 3V4UL 3DSNA 5JZ7C 2P8PB 4LLMB 1TJXA 4XN4A 2CTRA 3RWJA 4JI0O 1H3XA 4JRYB 4QE7A 4L87A 3O8XB 4OCLC 2V9UA 2Q73A 1H9VA 2L6LA 1NC2B 3CSGA 4G3YL 4K55A 5CJBA 4RUEA 1M7IB 2XU9A 4JRFA 4KHXL 2P9RA 5CU5A 3BPNB 1A14L 5D1QA 2FBJH 2M83A 1R19A 3AUVA 2CZNA 2ZWKA 4F2MB 2V6HA 4IIQA 4UZSA 4IBZA 1LWJA 3FF7A 2XZQL 5EA0H 1CFBA 3TA3B 3APQA 5FNVB 1RPQA 4AQEB 1K97A 1PKQB 2DWTA 2WUBH 1HDJA 1L9PA 4B41A 5K9KB 2YSSA 3AT0A 5KS9B 3H9VA 5FOJA 1MFEL 1LEGA 1LP9F 5IVOA 5AWNL 5C9JB 5GGQL 4IGBD 4PJ9C 4A04A 4ZAKB 5TDOA 3ZHLA 2ZE7A 1SYSB 3X17A 3I6KA 5BVPH 1BOYA 2QKIB 1IGCL 1HNXB 2GT9A 2VLKB 2EXWD 3HCVB 3H7BB 2D73A 3QEQA 4DP1X 4BE6A 1Y18A 3KVDD 4ETQB 4Z8FL 5KSAB 4NO0A 5K9OA 3RTQB 4P2ZA 1WPXA 4OGXL 1YN6A 4R7VA 1T66D 2BDNL 4AITA 1CE6A 3OE7G 1SLUA 4XHJC 3BLBA 4AQYB 1BD2A 1UD2A 2AJVH 3OGOE 1MLCB 4WK0B 1PX8A 3O2DA 3QDMB 3QIWC 4WY7L 4XRCA 3ZX1A 1IE4A 1UXWA 4KROC 3D4GA 2F1BA 3LSOB 4OD3H 5T5NF 5HHQA 3CFKB 2B4CH 5IQNA 1Z5WA 4UVBA 4GSRA 1ZSPA 4LF7O 3QG6B 2V2TA 1RUAH 3ZZ1A 4U4BA 4R5VA 4AYFB 3HAEA 2XETA 4NKOA 5KMGA 4HIEA 4Y16D 5D7KD 1BQ5A 1QQDB 4RMVA 1AZZC 4Z76B 2JEUA 2Y6SD 5D7JD 4JO1L 3QUHA 3RVUD 3Q01A 4E9LA 3N41F 3S5LG 6FABL 3THOA 1FWXA 5F2VO 2GAZA 1KBGL 3RPIA 3TL5A 1FZOB 3K2UL 3T3PE 2LFGA 3VJ6A 3N1MC 1L1FA 1C12B 1MCLA 4JE0A 2EE2A 4XE0A 4IKIA 5CD3A 2AV7B 2QFPA 4M56A 5EN2B 1JUFA 1UT9A 4N2KA 3BKML 3QXVA 4HV8A 2QT6A 1Q72L 3T0EC 1IBMB 4E9RA 3THML 4JI6O 3SDCB 2A0LA 1LO4L 1T6BX 2XQYK 4MQXD 3CFTA 3LD8B 2I07B 4I88A 3DO7B 1KCBA 5AAMA 3PU7A 4RVBA 4Y1AA 3SDDB 3NCWA 1VACB 4PS3A 4Q6GA 3LVEA 3EFOB 1JGEA 1RI8A 2VYRE 3W0WA 4H13C 2A9MH 2BP5M 3R18A 3GS0A 1TVDA 3OPUA 2XWEA 4V2CB 4LF9B 1L4IA 3BUTA 5CINH 4ZTPL 1W59A 1KIRB 4AOFA 1B6UA 1JN6A 5CWSA 4WNSA 1FZMB 4J2QA 3SKNB 3FULA 1KV7A 2GK2A 4X50A 2AEPL 4BQCA 2XUWA 4MDIA 3CX5F 4R2GB 2DJ4A 1DLFL 4A38A 1O7VA 1PNLA 1ZK5A 1X5MA 4KDTC 3ARDC 4WV1A 2E27H 4DVRH 4C56B 4DV4O 3LZQA 2UYLA 5KVEE 2D2CB 4J8RB 5M95B 1CXIA 2AXFB 3K5OA 2XQYA 2WZPA 1RJLB 3DSQA 3NJVA 4X98A 4BV1A 2ICWA 3SY0A 4GJTB 1KCVL 1ID5I 4LSSL 3VD9A 3PJSK 1T7XA 2LU4A 2OBGA 4RSVA 3QB7C 5E1IA 5DUPH 4BZYA 4QNHB 3VBBA 5E6IB 3UTQA 4PJGA 1D5RA 1ZHLA 3ZMRA 1OWWA 2CO3A 3UG3A 2VQEB 2R7EB 3N3EA 3O41B 4YWGL 2NN4A 1NFDB 3BUPA 2RCVA 1P4IL 3LYRA 3K0DA 1A8JH 2R2EB 4FA6A 4ZZFA 2HKOA 3U7WH 4OCRH 3WIHH 3B2XA 3P0VL 2RQ8A 2GBUA 3RWCB 3HUJE 1QVGU 4UV8A 4IRSA 5E99H 2IALB 5MENE 3JYCA 2OW6A 2WXQA 1KXHA 3PNWA 4KMQA 2Y1AA 1RZJL 3FO0H 4LSUH 5J56B 4YHMH 3IJSA 3RP1A 3D0VB 3I3DA 4G8FB 5KA6A 3GRGA 1WZMA 4AL8C 4KITB 3IB4A 2PWDA 5DJAA 4F7EA 4OZFA 2XPYA 4PS8A 5JORB 3GIZH 4NJAH 2BSEA 5AOKA 2OMTA 1ZT4B 4LF8B 2JGDA 1AI7A 3WKQA 4F1SA 3PJSA 3C60C 3NJXA 4WNQB 1DVFB 2GJ6E 4AIZB 1JHTA 1U8PA 3ZT5A 4HPHA 2P8MB 4B9IA 4IK6A 1T3FB 2CR3A 3FBKA 1N4CA 3ESOA 3JD0A 4BWAA 3INUH 1RIVH 3E1ZA 3IMWA 3IWVA 3D85B 3EOYG 3QUZC 1J48A 3VXRE 4DAGL 4U1HA 1P7BA 3BD5A 3FU5A 2HFEA 1N7MH 2FB4H 2GC4C 2HJKB 3BGFB 4PJEA 4GKJB 3KH4A 1K3ZA 3GMRB 4M6ML 1M7DA 1FORH 1Z7JA 3N50A 4QXVA 1PJ9A 4IIZA 4OH2A 4AW7A 5BW7A 5KEZA 4LNRA 2XWBB 3E6FB 2EYTA 1A3RH 4X1YA 4N0UA 4NC1E 4UTAA 3ZL2A 2PN5A 3NPSB 1L5GA 3U0WH 1HFUA 2B1OA 1ZS8B 3CVIH 1L0XA 2AV1A 4X9YA 5KSBE 1UA6H 2OXGB 4PJDB 1HINL 2F4VB 4H8QA 5JMOC 1BGXL 3OUFA 2ED9A 3AADB 1Q0XH 5K1NA 5EEZA 2GBVA 1E2ZA 1FNGB 2E74C 2I25N 2LGNA 4FABH 1AC0A 3D87B 2CK0H 2VXTL 3HS0B 3CRQA 3BGMA 5HDBB 3ZHNA 2G60L 4CILA 3DIDA 1RZQA 4LQFH 4TLUA 3VI4F 4RAVA 4JLRA 4NRXA 1UADC 5D5MF 1DQIA 3T9WA 5DJCA 3QNZA 3VXNB 4PJCA 5BZZA 3SPVB 4MMYA 1RAMA 1OY3B 5HHOD 2JJSC 3GPEA 1DP0A 4NPKA 4EIBA 1AQ8A 1XF2A 4LLWA 2N1TE 4TSAH 1NUGA 4LP8A 3VFGL 3W7XA 2NY7L 3EGSB 2DWEC 1E8YA 1JPTH 1YPZB 2LO1A 2ZUQC 3L81A 2X89A 3FRPG 4L4VE 1AD9B 3FQUB 3DMMD 2BY2A 3EVKA 3MJWA 2CR0A 1JX9A 2H8PC 3ETEA 1TZHA 5FW6A 3UBFA 9CGTA 3SGEH 5IVXA 4P04A 4PRNA 1ZJAA 4M1GH 2IPUG 3GXMA 1S7WA 3QJHA 3R7QA 2OTWA 4QTIL 1LLAA 4CDHA 4L3CA 1S78C 3KL5A 4EUPB 1V3MA 1W0WB 4QCIB 2RQEA 2WTRA 1S9XA 1KXVA 3DXAE 4TSCH 1ZT7A 3HPJB 3BFOA 3PWPB 3EJYC 4KRNA 2WXFA 2DAVA 1JMKC 4O4LA 1GPOH 5E51A 3OKEA 4A7GA 4PIBA 4KDVA 3GXPA 1SHMA 5EZLA 3MRFB 5GGVY 3SE9L 1F6FB 4C4UA 5CLWA 2YD7A 2EJ7A 3RYIB 2DBLH 2BIHA 5EOQL 4AQOA 3UYRH 3GSUB 4LMQI 1N34B 4NWTH 5CGYD 1IC5H 4YDJB 5F96H 3ZLQC 2JIXA 2OX5B 5FGRA 2J21A 1NGQH 4DR3B 3QJRB 1I94O 2OMUB 3VD3A 4HKXA 4JL1A 1GMGA 3K71B 5JOPD 2NY3B 3ZUCA 4TM9A 1LNQA 2CGYA 4QHMA 4JI4B 4PGDB 5HXMA 1L9OA 3B9KD 1EHAA 1H15B 3PGCB 1NCAH 1SJVA 1BZEA 4OZ4A 1QLRB 2AQQA 4A68A 1G0DA 3RZCB 4HS6B 2G9HB 3GLDA 3FU7A 5H35B 3VFWB 5J3HC 2GSIB 4GKZB 5D72L 2LLNA 1MJJB 3LV3B 1V9PA 3S8GB 2CO1A 4TNGA 3EYOB 2CIIA 4FTVB 3G7TA 5EORH 5A2CA 2HYMA 1DDTA 1G5GA 1OPGL 5IF0A 3ECUA 3WNOA 3AXLB 1VQLV 4RX4A 5B4MD 1I8KA 1D5BB 2IBGA 3NJGA 4U1LA 1NA8A 4PS4H 1UJ3B 2CGZA 3CNKA 2DTMH 2J4WL 4Y5YA 3Q5OA 5I1IH 3TETA 4MRBA 1YYLL 3BP4B 5CJQL 1XQ8A 1TQUA 2QQLL 5DDHA 2IANA 2VO5A 4OSUL 3NVQA 3IXAA 4NSKB 1WRFA 3E1F1 5T5FA 2B1IA 2F5BH 3IPBA 1MRCL 4NC2B 5T1MA 4ENEC 1JWMA 3GXNA 3MNWA 4LL1A 5HHPA 4YSRA 3D2UB 1C5DB 3R8BB 1U8HA 3OJDB 4I4TA 3C09B 1H2MA 4IHJA 5KX5A 1R3JC 2NDGA 1NH6A 2GJRA 5EEUA 3VDAA 3IGUA 5A2AA 3Q5YA 3RT3C 1UD5A 4J3WA 5AOZA 3TEZA 2E75C 4HUUB 2H4EA 3QYMA 2FHBA 3FX7A 5CUSL 3VXUA 2W91A 3BAYA 1ZSDB 2P7TA 4UFZA 2DF3A 4JFZL 2QELA 4OFDA 5E9DA 4CNIA 2YUXA 3FCBA 2AKRA 4TQFA 1KF9B 4P2RD 1WAAA 3N9GL 3MGOA 1UM4L 3L4UA 1XR9B 4JRXA 2VQUA 3WHE0 4M29A 4HXAL 3MOAH 1HVXA 3G6DH 1BCIA 3V4VB 5B22A 3UAJA 3WG7C 4OCWH 4NXNO 1UH3A 3C08L 4HS8L 1VEPA 3V95A 5JXAL 4GW4B 3RURA 3RYCA 1XO8A 5HVWA 2E5EA 1CDBA 2OCHA 5GHWL 4X99B 2M8XA 2M1KA 1OSPH 2BW4A 1ZVSB 4APQA 4E5XA 1E4HA 4GUOA 3CVCA 3CV5A 3FQ4A 2L4OA 1X5KA 2A9DA 2NR6C 2X2IA 4B60A 3LH8A 1OF2A 4AGQA 1YCIA 2C3XA 3MRGB 3UERA 4OAWA 4ALAH 4ZFOL 1HZHH 4H0GA 2Y1ZA 4JEGB 2V7HB 1FPOA 4YHYC 3GFUA 2H3KA 4XCEB 1CDHA 5BQ7B 3FB6A 5TF0A 2ZXWC 1RUKL 3BSZA 3PWUB 2DQUL 4JI5O 5B8CA 4M03A 2ZG2A 3K91A 5T1DL 3HBGA 5K9QG 4GCZA 3RWFA 5HGAA 3LQZA 1A0QL 3DGGA 2DQTL 4FQIL 3MRPA 4X80L 3O3BB 1FNHA 3VQYA 4YHLH 3QIUB 3SDXE 4GQQA 4QY8A 3RUGB 4ZFOB 4GRLD 5AW3B 3UO3A 3AREC 4P46A 4N22A 5DMJB 5AZUA 5KUKA 3VFPB 3ZPDA 2AXJA 2OYLA 5KJRH 2Y4UA 1N5AB 1L6PA 2CALA 3G5VB 4NIKB 4AYGA 4L8SC 1M6UA 3JYBA 3LN5B 3WBDA 2GW5A 5E5MA 3HG2A 1X6NA 3CU7A 1N67A 2VXSL 4LCYA 2MRYA 4DR2O 1NCNA 4L1SA 3QORB 3ZRCC 1ZA6A 1VEOA 4X5LA 1NLDH 2A83A 5CU9A 1E4KA 1L0NH 5ILTL 3HNTH 4X9IA 1D6VH 2XWTA 2J8HA 1WZLA 5I8KL 4IDJL 4YO0B 1JVLA 3CHXA 1NIAA 1NMCC 5AZ2L 1GCFA 4GT1A 3U0ZA 1NKGA 2DN9A 3S98A 1IGYB 5A16A 1BG9A 3BKJL 1RFDL 5CEXB 1HJBC 2CCLA 4CH3A 1IVTA 1F4WL 1D9KB 3FKUS 3ZIMA 4MXWL 5E8DL 5CMUA 2M6YA 3BZFA 4OUUB 1CE1H 1F3JB 5C07B 4EB6B 3ULUF 5C70A 4HBNA 1QR1B 3FOMA 3GSNL 3UTSB 3MNDA 4LEXH 4ANWA 1OK0A 1RXLA 1AQHA 1F4YH 2CDFA 3DSNB 2EH7L 1JXDA 2WQVA 4K9EC 2FHFA 2XKSA 5LGUA 2J88L 1SJXA 3HB3D 4M5ZL 3EH4B 4XP1H 5FIEA 5KBLA 3T4ZA 2APXA 4WF7A 2CJUL 1ZHNA 1CB4A 2I5YL 5D1QB 2LTQC 1PY4A 1UQSA 2NW3A 3S34H 4RFEB 3RFRA 4IIQB 1F8TL 4MD5A 4U6TA 2YPLB 4A37A 4X9BA 3BYYA 3VA6A 2QVKA 1IC0A 4YSSA 4UZGA 1B4RA 5DHDA 4DFHA 1K4CC 2LW3A 1FL3A 4BWTA 2HT3C 2YSSB 4YSAA 3MRHA 1SXSA 4PY7A 3DJSA 3OT7A 1FGVL 1MNUH 5D2NC 3B2VH 3V6FA 1VCBC 1RHHA 4G6AC 1PZ2A 2QPEB 1XZ0B 2EIKC 4HIIB 5I6XB 3B9VA 4K94H 3L3GA 5IHBA 4I18A 4W68A 4Z1MG 5K93A 4H8HA 4IM8A 3VWKA 3I6KB 3OAUH 3EYQC 4OZGE 5HYJB 3SE6A 2CU9A 3X2QC 4N2GA 2DDQH 2GT9B 4MAYD 2YI8A 1VF5B 2VLRD 1Y18B 2B7DT 3BHBA 1UD3A 4KZDH 5K9OB 4GXVL 5C8YA 4BFNA 4P57A 3K9AA 1YN6B 2WNWA 4ZUTB 1ZRUA 1W8OA 1CE6B 3B2EE 3WGUB 1JNLL 3RTLA 3DPDA 1BD2B 4Y9FA 1TTGA 4F37F 4OBSA 1ZXQA 4XRCB 4G2KA 1I8IA 1YNKH 1UXWB 2CH7A 2K1MA 5AVSB 1E6JH 2OWOA 1R3IL 2JQAA 1P7QD 3HR0A 4ZW5A 5HHQB 5TISZ 2X0WA 3D18B 5GRUL 3RPKA 4DUWA 4Z5RB 2ZXQA 2V2TB 1EZSA 3RY6C 3QULA 2VLMD 5IROA 4HIEB 2FT6A 4G9FE 3VGGA 2CGOA 2GJPA 5D6DA 4NM4L 1P2CA 3L3OC 3NACL 1VPOL 3RPIB 3TT1H 4HH8A 3E9UA 1JZGA