2EILB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eilB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eilB02
2BO0A 2AFNA 4HIPA 3ERXA 1OF0A 2JKWA 2MRYA 2AANA 3ZDWA 2YAFA 3FS9A 4YSOA 3ASNB 3FT0A 3X2QB 3JT2A 1KGYE 1PY0A 3FQ1A 5B1AB 1JZGA 2YXVA 3AZUA 3GDCA 3H4FA 2X88A 4GP4B 2GI0A 1J9RA 2CBPA 3UGEA 3AY2A 4ZK8A 1F56A 1ASQA 2EIJB 3S3DB 3NSDA 5B7EA 2AZUA 4KO9A 4DP4X 3H4HA 1JOIA 1SF5A 5I26A 1AANA 3QJVB 1NIBA 4JHUA 2EIMB 4HALA 4Q8BA 1JXDA 1WA2X 4Q89A 3FSZA 3QJTB 1A65A 1W6LA 5B1BB 3CG8A 1TEFA 1RZPA 5B1JA 1ADWA 3UADA 3SBRA 1WAEA 3T6VA 3OMIB 4BWWA 1CYWA 4DP7X 1ETJA 2ZONA 4YSSA 2BW4A 1WS7A 4ENZA 1IBZA 1NWPA 3SBQA 4DP5X 4AKQA 1V54B 1BXUA 3T6XA 4F7KA 2YAEA 2UX6A 1NWOA 1MG2C 2YAPA 2GC7C 4HHGA 5LDUA 1QHQA 4BK5C 1DYZA 3EH3B 2YEVB 1KDJA 2VW4A 1L9PA 1V55B 1PNCA 2PLTA 2UXTA 1N68A 3T6WA 5TK4A 2IDTA 2R7EB 3NJNA 1CURA 3TA4D 2W8CA 1ZDSA 4GXFA 3FU7B 1ZDQA 2WSDA 2H3XC 2BZ7A 4HCIA 4HAKA 3UAAA 1BXAA 2IDSA 3FU7A 1OE1A 3CVBA 5D4HA 4E9QA 2J57A 2UXVA 1CC3A 1ID2A 1X9UA 3EHBB 4AKPA 1UATA 2TSBA 1JERA 2UX7A 2YXWA 4E9SA 4EF3A 4E9TA 3CDZB 2HXAA 2DWTA 4M3HA 3RYMA 4UAHA 3X1NA 2BWDA 1KBWA 1AS8A 1AACA 1RCYA 2QPEB 1XB6A 2VW6A 3CDZA 2XU9A 5I6MA 2IDFA 2GSMB 3X1EA 1GR7A 1PF3A 2OCCB 4KO5A 3AG2B 4RH4A 3AW5A 1NPJA 4UF7C 4KNUA 1NIEA 1XB3A 4N8UA 2PPAA 1IC0A 3N2JA 3NP3A 2DYRB 3DKHA 1GS8A 4QLWA 1IKOP 3S8FB 3QQXA 4YVUA 2EIKB 1A8ZA 1GY1A 4KNSA 1BXVA 1V10A 3X1FA 3S8GB 1BYOA 1ZIBA 4X4KA 4AKOA 2IH9A 1WA0X 2BP0B 3SBPA 1OCOB 1M57B 5TK2A 2PP8A 5I5JA 4PAZA 4AX3A 1PNDA 2XV3A 4N4YB 3QJSB 2IWFA 3PAVA 4BWUA 2GHZA 2J5WA 4A2DA 5AFAA 1SHXA 5I28A 2AZAA 3ABMB 3S3CB 2MTAA 3ZX1A 4JKNA 2E86A 2CCWA 1NIFA 1BQRA 1OE3A 1MG3C 4W1TA 3FYIB 2J56A 3NSCA 1BQKA 3JTBA 1YLBB 2WO3B 3FQYA 1ASPA 4G7RB 4CSZA 4BDVB 2VSKB 2XX0A 4DPCX 1ILSA 2GC4C 3PAUA 4L0PB 1PZBA 4QKTA 4BDVA 3S3BB 2FNWA 1NDTA 2LLNA 3UACA 6PCYA 2BHFA 1KDIA 2HX8A 3EH4B 5I6LA 1ET7A 2RACA 2YAQA 5D4IA 4NERA 3WKPA 1JVLA 3ZBMA 1ET5A 1PMYA 3DIVA 3NT0A 3QJUB 4E9XA 1E30A 1A4CA 2H5UA 1A3ZA 2CJ3A 1AR1B 4YSUA 3UAEA 4E9RA 3MX0B 1OE2A 1BYPA 1CUOA 2IDUA 2GBAA 3IN0A 3NSYA 5EHFA 2NRDA 3KW7A 1JZJA 4G7QB 1JZHA 2HZHA 2JFCA 2I85A 5A7EA 4PCYA 1HAWA 3TBBA 5F7BA 3FPXA 4DPBX 4GP8B 3GYRA 4TXVB 5F7AA 1AG6A 1URIA 4A66A 7PCYA 2DYSB 4HHWA 1TU2A 1J5CA 2FJSA 3CVCA 2J55A 1ILUA 3G5WA 2XX1A 1OV8A 3HB3B 1AZNA 1AQ8A 1BEXA 1KYAA 2R7EA 1XMEB 2VSMB 3PPSA 3NJIA 4HZ1A 2VM3A 4GY4A 3PCYA 1BAWA 1EZLA 4E9WA 1N70A 1KCBA 2UXGA 1PZCA 1PLAA 4DP2X 1J5DA 4P5SA 4A2FA 2FQEA 4JHVA 5FC9A 3ABGA 1HAUA 2W88A 4WTQA 5B7MA 3OMNB 1AAJA 1NICA 3V9EA 3UABA 1SNRA 1GS6X 4GP5B 3NJMA 2B08A 4UANA 3FU8A 5IY5B 2HRGA 1JXFA 2PPEA 2PP9A 4YSCA 1MZZA 3FSVA 4YL4A 2HX7A 2BZCA 3OQRA 1NTDA 2QPDB 1GW0A 3WKQA 3NJKA 4F2FA 1WS8A 4DP1X 1NPNA 4CSPA 3IE9A 2QDWA 1E65A 2BP8B 3FSWA 3AG4B 3EH5B 4YSDA 2QT6A 1SF3A 5I6OA 3NJJA 2Q9OA 4KNTA 3L45A 1OCZB 1J9TA 3WG7B 2CALA 2Q5BA 2XXFA 2FT8A 2XYBA 2PPCA 3PAZA 2EILB 5I5MA 3IBOA 2PP7A 2FTAA 1ZV2A 1A4AA 2FQFA 2AVFA 2DV6A 3U25A 2VW7A 3QJRB 5B1JC 4YSRA 4A2GA 2DWSA 3BQVA 2N0MA 2XVBA 4AI7A 2B3IA 2BP0A 3V9CA 3QPKA 2GB2A 4KO7A 3NJHA 1AZRA 1T5KA 1AZBA 4BXVA 3FSAA 8PAZA 1SDDB 1L9TA 2IDQA 1QLEB 2FT7A 2ZOOA 1DZ0A 2XV2A 1AOZA 1ZIAA 3T9WA 1SDDA 9PCYA 1KBVA 3ABLB 4KO6A 3HEIB 4M4RB 2I7OA 4E9YA 4MFHA 1KCWA 2VM4A 1HFUA 3N55A 4FA7B 2XV0A 3BVDB 5AKRA 2YAHA 1AZCA 1RKRA 1SFHA 3FPYA 1MZYA 2I7SA 3CZUB 1OCCB 3NP4A 4YSQA 1PLBA 2IAAC 1RZQA 4HCGA 1KV7A 3OM3B 2Y69B 1FWXA 1FA4A 1XB8A 2YAOA 2FWLB 1PAZA 3X1BA 1GS7A 4G7SB 3ASOB 1J9QA 2BWIA 2P80D 4NAJA 5AZUA 1SJMA 3FYEB 2TSAA 2FT6A 2GIMA 1W8EA 1E5ZA 4KOBA 1EHKB 4WKXA 4A2EA 1CYXA 3X1GA 4A67A 2ZXWB 3KW8A 3TBCA 2VMJA 2XUWA 2HX9A 2OV0A 1AIZA 1ZPUA 1E5YA 1JVOA 3MBWB 3FU9A 5I6NA 4G72B 1WA1X 1NINA 1TEGA 2ZWNA 1W6WA 4P5RA 5I6PA 4DP8X 2PCYA 5D4JA 5I5IA 2CUAA 3NJLA 2DY2A 4G71B 4NB7A 4BWTA 1L9QA 1B3IA 1PLCA 3D12B 2YARA 3NJFA 2IH8A 4G70B 1M56B 3OD3A 5E9NA 3WI9A 5B7FA 1JZEA 3OMAB 4E9VA 1VLXA 2XWZA 1SFDA 5PAZA 3WNJA 4DP9X 3FQ2A 1NIAA 1JZIA 2FQDA 3H56A 1PZAA 2YQBA 3ABKB 2HLEB 3NJGA 4YSPA 1BQ5A 4W9ZA 1AZUA 1L9OA 4DP0X 1OOWA 2IWKA 4BXSV 1L9SA 4A68A 1GYCA 3CVDA 2PPFA 4F2EA 4A2HA 4YSEA 1I53A 3WIAA 3IEAA 2XLLA 4DP6X 3GXUB 1J9SA 2BW5A 3NYKA 5I6KA 4AZUA 3TASA 1NZRA 2UXFA 2Y1AA 1AG0A 1E67A 4YVNA 1L9RA 2PPDA 1OCRB 2VN3A 3EF4A 1X9RA 3T71A 2EINB 1GSKA 1A4BA 5B1KA 3AG3B 2HRHA 4FAAB 3NSFA 2FQGA 2P80A 3PLYA 2H47C 6PAZA 5ANHA 2BP8A 3SQRA 4YSAA 4K9JA 3C75A 3PXLA 3T6ZA 1GY2A 1TKWA 1M9WA 3IN2A 3DTUB 3ZIYA 1AS7A 1IUZA 1NIDA 1FFTB 1R1CA 2CAKA 2IWEA 2XXGA 3WNIA 1MDAA 3QJQB 1IBYA 4HCFA 1SHWA 4GYBA 2QDVA 1PCSA 5B3SB 1JZFA 3TU6A 7PAZA 4KOCA 2JXMA 1ET8A 2X87A 5PCYA 1JXGA 3AG1B 1QNIA 2WO2B 1AS6A 2YAMA 2PCFA 1ASOA 4DPAX 2OJ1A 4YSTA 2A3TA
chains in the Genus database with same CATH superfamily
2DLGA 2ZIOA 4UQ2A 4WFFA 5IE9A 2A73B 3UZVA 2XZQH 3OF6A 1C5CL 3GSRA 4WU5A 5LXTA 3QDGE 4AL8C 4H33A 4JREB 5E6YA 3SDAC 2OZ4A 1JGIA 4JJOA 3TVMC 4PJ7A 1JUFA 1ND0B 4AYEC 4BZ2H 4K8RD 4QXUL 1QD0A 3W7WA 5D1ZB 2HVKB 3NQKA 3OKYA 4ELMB 1BFTA 1UM5H 3K72A 4MNGE 3BGFB 3Q7JA 4X6DE 2ED9A 3RWGB 5KHGA 4JR9L 4AM0B 1VF6A 2AERT 1KUQA 2L7UA 1KPRA 1MXGA 3S3DB 2DYPB 4N2DA 2AXGA 1UFUA 2ZXQA 1FPTL 3A3YB 1G6UA 2XRAH 3INOA 4PJEA 2L04A 5HGBA 4O51B 1GIGL 3S34H 1T22A 1YECL 3JWOH 1Y18A 4Z2WA 1MA1A 1HWHB 1NGQH 2BOBC 5GRWA 3QJVB 2CA3A 2HPOA 2ZT9C 5AL8A 4N0YH 3VXQA 5JPNA 2XT9A 1JRHL 2YPKB 2EIMB 1TG8A 4H8HA 2KC0A 1FZJA 3QCUL 5BS0D 4X1YA 1DQQB 3QFDB 3K71A 2D31B 4J28A 5F89B 2HFEC 2D03L 1TEFA 2EULA 3I2CH 2O5YL 2R9RB 1CIUA 2FHBA 2FX9H 3TO4B 5GS2H 3OMIB 2K1MA 2H1LM 1M71B 4FF9A 4JCWA 2DN9A 4PGEA 1T7YA 1T1XB 3HI6L 5FDWB 3T6XA 5H5NA 1ZCRA 1J0IA 43C9A 4Q4IA 4AVIA 5KVEH 1PZSA 2Q0OC 4GRMA 3RU8L 5C08B 3MO1B 4R5TA 4WI4A 1BFSA 4FFVD 1J48A 4F4LA 2ZM6O 3NZ8B 2ZP0T 4Y4HA 5IOKA 4K71B 3UAJA 2GHWB 5CJQL 2QWNB 2GY7B 1EFXD 3DURB 3T4AC 1XO8A 1CLYL 4DEPC 1YY8A 4LHUD 3HZMB 3AS0A 3MJ8A 2HG5B 2ZUSA 2H2SD 5HYSG 3IU4L 1OQOA 2WQWA 1C1EL 3KLLA 2EZOA 4MXVE 1GC1L 1ORQB 5FUCC 1TJHL 4E4EA 4XX1G 5D2NE 3PDDA 2CO1A 5LA6A 4KKBC 4KH2A 4ZNEA 1JPEA 1BGYH 1U8KB 3P3TA 1OARH 3KNBB 2ETWA 3HBGA 5ALCL 5ALBL 3E35A 3RX9A 4KRMB 1SBBA 1WFJA 3ULSA 3UTTA 1LNQA 1F4HA 2LW1A 4NXMB 1F8TH 2DKMA 3P54A 1JPGB 2EO9A 4MAUH 4POZC 1DJHA 1QLFB 5T1MB 3ARQA 5MEQA 2W80C 3M99B 3O6FB 1KCVL 4P4RB 5AVVB 3QO0A 2XETA 3IRPX 4PJBA 5E2VL 5E1QA 1MXDA 3DV6B 5CEYB 1RCYA 3D34A 2IPKB 4ANWA 4Y5VA 5TE4H 4LFBO 1YNKL 3EGDB 4LEXL 5CBEA 4XDJA 3GBEA 3MNWB 4DKTA 1ZWIC 1WK0A 3KL3A 3BZ5A 3OKMA 1FLRL 4J7JA 3VSUA 1HDMA 2NTFB 2MIZA 2B59B 2KZ1B 3CJHA 1M7IA 4R7DA 2QJ1A 2DYRB 4GUPA 1KCRH 3S8FB 3AU1A 2GAZB 2Y7OA 3DWTA 4KNSA 1A8ZA 1QG3A 3QJFB 3OXSA 2BDNH 5IVXF 3CC4V 5F7DA 1SOKA 4LF9B 4OGAC 4U33A 4MVUA 4XWGH 1YIJV 2YI8A 3HAEH 2AJUH 5CBAA 4PRHA 5ESAB 3DTDA 5HHXL 3IJYB 3UZEA 4BE5A 3REWB 3SYOA 3S96A 2IO5A 4KMTL 4OD3H 1HYSC 3IFNL 1BFOA 4BWUA 4QHKI 5KSAA 3AK3A 3DMMD 4NPYA 5B8CB 4BZ1L 5JH7B 1M56C 2VR3A 3GM8A 5EA0H 2J2ZB 2OL3B 4JI4B 3QUZC 2MTAA 2ZUWA 1QEWA 4JY6B 4S0HA 3JALA 1MWAH 4PLKC 4XNUH 4EI6B 1OV9A 2VABA 3QIWD 4U6TA 5I6XC 2XWBA 1UWXK 3ARED 1DUZA 3PV7A 5BQ7A 1EZSA 1XEDA 2WYTA 2E0PA 3E8VA 5CNHA 2IH3A 1OL0A 3O9WA 3MRFB 3BRCA 3N27A 5LQBL 3FQYA 4JI0O 5E95B 1E4WL 4PB0L 2RMKB 4LF5O 2R2BA 2ID5A 2NZ1A 5I19H 2NT0A 1DBBL 3HVNA 4JGMA 4NQDE 5F93C 4ADJA 5IOPA 2CXKA 1I7FA 4RSVA 1MI5A 1IMHC 3FB8C 4GO6B 4X5XB 3KDMA 3S3BB 3ZK0A 1NDTA 5EIVA 1X59A 3E38A 1T0MA 2OMNA 1X5FA 1E27B 3UACA 4P46B 3BGMA 4IOFC 1SLVA 1XV8A 1QR9A 1I75A 5JJEB 1MJ7H 1OAYH 1P5UC 2FUQA 1PX4A 3P4LA 4GJTB 4LASL 4PB9L 4I3RH 4FL4B 4AQ1B 4KKCD 4AV0A 1NGXA 2R0ZH 5EO1B 3D39E 3Q2WA 2EVGA 3N44F 1AR1B 1L9MA 4LIQL 4U6HA 4DW2L 1CJYA 2RCVA 5C3IA 1BBDL 4G8GD 4M02A 3PG2A 4OD1L 2ENQA 4QOKB 1JI1A 3QUXB 1VFOA 2JFCA 4EKWA 4G7QB 5A7EA 1N0NA 5HDRA 4L4TE 2AQNA 4N0RA 2YZ1A 1YVWA 5AYTA 4Y1AB 4YC2B 4F2ME 3JUYA 3NZHL 4KU1A 2K6YA 4ODWA 7PCYA 1AG6A 3J8F7 4JZOB 4R4FH 4EIBA 1MFAL 4NM8L 1JHLL 2APVA 3K0WA 4BZ1A 3H9SD 4IDJL 1S7VA 1B4JH 1AP2A 5AW0B 2HT4D 1L7IL 4H1LA 4PG2A 3H1LH 5B39G 2WTRA 5KBDA 4GZRB 3MRPB 4OKVA 3IFOB 1CFTB 2P44B 3TXSA 1RUQL 4Z7OF 5B3SC 2VDLB 1QFUL 2VQUA 2Q68A 2XZCH 2VAAB 4LZKA 3WLWD 5KVGE 3ZHDA 2MNWA 4XCFL 3DX7A 1ONQA 5I1CH 5E4EC 1ZS8B 2DQFB 3RFZC 4LKXA 1DEEA 4HPOL 2P4KA 1QBML 5B1CA 5T8IA 3US1A 2CLRA 4X6CA 1TJIH 2RQ8A 4R4BA 3UO1L 1T0OA 5HHQB 3TF4A 4MD4B 4GFTB 3CQFA 1Z5LB 4NQEE 3L2MA 4HUWB 3WTXA 1TYEB 4G9FA 4XVTH 2EEAA 3EOAA 4LRNH 5B1AC 4JPKH 4TSBH 3NESA 4MAYD 3UPRA 4F2FA 2QPDB 1BECA 4MBRA 4D0BA 2WXMA 2DQDH 1MCOL 4XGZA 1HKLL 3CC2V 5I0ZA 3ULAB 1GN6A 1MHEB 5HBBA 4MMZB 5JYLA 4YSDA 3TYFA 5T3ZD 5TQ2H 2YFNA 2W0XA 4YWGH 5GSRB 3VXUA 5CD3A 4G9DA 2V0AA 4HZLA 1SJEB 4PVNA 2FLBT 1DJSA 4LRIC 3DUSA 2EILB 2VJXA 4K35A 3FB5C 4HJ0C 1SQVH 1ZV2A 5F6IB 4PJDF 2AVFA 1GHFL 4GS7C 3HJEA 1J8HB 4RISL 1T5XA 4LLYB 2F2HA 5F1OB 3RL2A 1R3JB 4G2KA 2DWSA 3PN1A 3O2DH 5SWZE 5IB5A 1MNNA 3VWKC 4ODXA 5B1BC 1FH2A 4J10A 3INUH 3HR0A 3WY4A 1CFSB 2ZUUA 2BP0A 4J3BA 5T33H 3T3PF 4AIXA 1HJBC 3OXRA 3QPKA 4OV5A 1YUHB 2PO6C 4L3CB 4IS6B 5A2AA 4PRIB 5BPPA 5CGYD 4CU6A 5EN2A 2PR4L 4OCYH 3RN4A 4JKLA 2ZOOA 4Z7WF 4TNEA 5AD0B 3NFNB 4CZZA 4OCWH 4M5ZL 4Z7VF 1LO3H 2J8HA 4I3SH 1WT5A 1CPYA 4UBDD 4U6XB 2NSXA 3FRPA 1M3JA 1XSIA 2R1YA 3QAZB 2N1KA 1Q9OA 4AEFA 1SFHA 4MDIB 4PRAA 5BV7C 4XTRD 4JI4O 4NKDB 5HHOE 5B22A 1U8HA 4QTHB 4XNZB 2EECA 4OIIH 4HEME 5FCUH 4LLDA 5DJYB 3EO9L 4JX0A 4OVVA 5SWSB 4KKQA 4JQXA 1ZEAH 3C08L 3QNYA 4CN1A 1XCTB 2Q86A 4LVOB 3V52H 5GS3A 5F72S 2ADJB 1NMCB 3S4SB 4WDIB 1RPKA 4U0RC 4PLNC 4APQD 4OKDA 5IT9N 1NI8A 1XCWA 3VXNB 1QSFE 1ZVNA 3KJ4B 4PJAA 3IXAB 2PGGA 2HN7A 1NC2A 4L5FH 3RZWA 3KG2A 2K8MA 2MFNA 2P5EB 3MBWB 4BH7A 1O5DT 3WJJC 4JI7B 4AENB 7TAAA 1TEGA 1FF5A 1THCA 1ZAGA 4LP8A 2CCLA 3UP1A 1HCZA 4ZUSA 3MX0A 2VWJA 5D4JA 3T65B 1QSED 3GBNL 4XO5A 1ZTXE 4KRPC 3E83A 1VQPV 1NCWL 5IVXE 3NN8A 3DOIA 3OZLA 5C6TL 2YARA 4Q0XH 1XNQB 1EBPA 2C3XA 5D7JC 3STZA 3VYNA 1CGUA 3GZQA 2OIEA 1GIGH 2CUHA 2SEBA 5B1NA 5PAZA 1KLGA 1E7UA 2DQTH 2COVD 3ZU8A 1LWRA 3AXLA 4LSRH 3V0VA 5CJOL 1VHPA 3IJ9A 3QWQB 3C87A 2W0FA 3MA9H 3SY0B 4W9ZA 1AZUA 4JMXA 1YMHB 5EIIB 2X10A 4UT6H 2IWKA 3GK8H 1J5EB 3HAEG 3GXFA 3APNA 1QO3A 4RDBA 4X9YA 5HJBA 4APXA 2AGAA 1EN4A 3ZHTA 1FZKA 1N12A 4TQFA 4YNYB 2F53E 4Z95L 1HQRB 1YHQV 2RA1A 1RZJH 4HGWA 4MQXC 5CUSH 3M8AA 3I9IA 2VT0A 4I48A 4AZUA 2DWYA 1HDJA 1ROPA 3C3TA 4XPAL 1TZHB 1VMGA 2CLVA 3N44B 2E7CA 4XO9A 3HI6H 1E67A 2QLVB 2ICCA 2A2QT 3UTSA 3SB3A 1JZ2A 1BT8A 3CV5A 3ABMC 3B6SB 4HWBH 1XBLA 1UT2A 4OR1A 2QTOA 1B0IA 2FL5A 1AGEB 4OTXL 3KYKH 1JOYA 4IBZA 4K8XA 1QQDB 2YUAA 2H47C 4B9JA 2DOCA 4JPQA 1DLBA 4PU2A 1GGIH 2P4AB 1OWRM 4IDLA 4YHZL 3ZMZA 2QVKA 3CPLB 3FHEA 4L9LB 2ORBL 4HKZB 4D3CH 4RCAA 5L3GA 3EKCA 3S3JA 4AQEB 1AB3A 3JATB 1G6RH 3LKOB 4HLJA 2CXGA 4N26A 1X5HA 1LO4H 1EJFA 3MPCA 2VNCA 3CZFB 4FZ8H 1WFTA 3QNFA 3VFVA 4K3DL 4E2OA 1CGSH 4R7XA 4CC4A 1U2YA 5C7XL 2OR7A 1EZJA 1Y74B 5IBLD 4X99A 5D1XA 2Y3AA 4KTGA 2OMWA 5H6QA 1SZTA 1CI3M 1JXGA 1JI2A 2OI9B 2X42A 4M7ZB 3V6FB 3T0VA 5LHIA 4L18A 2YN3A 3PWVB 4FXKA 4F5CE 1ASOA 2OCJA 3B43A 1I8IB 4PREA 5F0PB 4N2GA 1RPQA 1EA9C 4GI6A 3EFFA 2YAFA 4YSOA 3RWJA 4Z7OE 5CIPB 2VLJE 3W3BA 2X4QA 4B08A 4F6EA 1CFVL 1PQZB 3HG3A 1YNKH 4LEXH 5CILL 5DGQA 2XTJB 2UVEA 4HLZH 2DQIL 3NFSH 4JG0H 1KGCD 4PJXA 1LDPH 5AW9B 4M6NL 5EZLA 1J9RA 2OMTB 2EDQA 3MMEB 2CBPA 4C7UA 4ZFFA 1F56A 2OYQA 3EJYC 1S7WB 2D7QA 4KO9A 1CDJA 5IV2B 1MCIA 4PELA 2IAMB 5IVNA 2R70A 4GKNA 1JOIA 3KWTA 1PG7L 1WP7A 1DJWA 3RWEA 3GVMA 4K5MA 4PH8A 1M1XB 1OD7A 2A1WH 3FB6B 5E2UH 3FDWA 1BDYA 1CIDA 1KUMA 5HHMD 3QG7L 4L3EA 1RPUA 5HHXH 1P7QD 2WXHA 3AT9A 5C6WH 5CSZB 2AXFA 5J6GB 1WBXA 2IFGA 4FJZA 3S5LA 1WA2X 1VFUA 1RLWA 2WBJD 4HUXA 2RMNA 1RZPA 3EGSA 4RRPG 3DVFA 1X5AA 4UQ9A 3EZ8A 5AVTB 5CCHE 2JWYA 2OXHB 3CDCA 3UJTL 5HGDA 5L4JA 1CLOH 3OC8A 1QFHA 2P90A 1KIQB 1MW1A 1RURL 5D9SA 4PJDE 5EBWB 3QDMA 2NY7H 2EYSA 1F90L 2PCPB 5HHPB 3GIVB 35C8L 4N25A 4IRSB 3J7AU 1Q0YL 1YZBA 1KLFB 3DX9B 2IW5A 1Z66A 2AVGA 4P5MB 3PNWB 3WFEH 1IJNA 4PJ9C 2IWGA 2O4EA 3T3PE 2X4SA 4XX1E 4PB0H 2VXTH 3LKPA 4XDKA 4DZ8B 4YSCA 3Q01A 4JHZA 3G04B 4J7RA 5IFAH 4U1MA 1H3TA 2WVSA 3GMNB 1FL3B 2Q69A 4Z7WE 3SDDD 5LAXA 4FP8H 5E6RB 3L54A 5J9PC 1MRFL 4FQLH 4OX9B 1F02I 4Z7VE 2B1IA 2GIXA 1MLBA 1BBJA 2Z35B 4JVPA 3ESPA 4WU7A 4AY0A 5T5FH 1Y4MA 1IBDA 5TE6L 2W0PA 4G6ML 5LXGH 1LXMA 4X88A 3CFDA 3G5VA 5JW4M 5JHDA 4BJLA 4WI0A 4N8PA 3N2GB 3BZ4A 4TLSA 3TCLA 4DW2H 4G6FD 4ESKA 3ATEA 5I71C 5EEUA 4EN3D 1IFHL 1NFDF 1A0QL 3QIBC 3VRIB 3ARBB 1B88A 5MEPB 4B9YA 2CR0A 1SXCA 3BPOB 4GO9A 3NZHH 1U8LB 5HYJB 1HHGA 1UADC 5DZOA 2DWTA 4OPAA 4OZIE 1U4EA 2JQZA 3K3QA 4KP4A 3QP3A 3MRMA 4UIMB 1B0GA 3MBEA 5AW5B 1PFCA 2PKDA 3M1BA 5CF3A 2GDSA 1HXYA 2EDJA 5JOPD 3KYNB 5C0BB 3QARA 1JWMB 4JFOA 5C8JB 3B2XA 2K45A 3KG5A 3QEQB 1MHPH 1QFUH 3A6CH 4ZHQB 3L3OA 2ZKYA 1AFVH 3BP5B 1XHXA 2Y36H 1XGTA 2H41A 2VH5L 2YS4A 3NP3A 3OTTA 4G42A 1MUJB 2XBTA 3QQXA 5HTSA 4QLWA 3MROB 3LQMA 3UH8A 3MDJA 2KMWA 2VWEE 1HH9A 4JRXB 2UXCB 5DEFA 2XJKA 3FB7A 1ZIBA 3HG1B 3UBHA 3JCUZ 5F0MB 1SRYA 2CCVA 1IGIL 4AIOA 4EKXA 3IMWA 3ZE0E 4BW9A 3IGAA 3L5JA 4Q6KA 1RZGB 3X3FL 5L0QB 4NENA 3U36B 3ELQA 2V2WB 4U3SA 3BAEH 3C6SA 1HC1A 3GO1L 3AS3A 4NXKA 3U10A 5DUPH 4TV8A 4RVBA 1E9OB 3VD5A 4JQVA 2WQVA 4O2CB 4JFYB 1OP3H 1MCOH 5E23A 5C0JA 3CGTA 1R5VA 4HVBA 4OT1L 1GGBH 1JPFB 2VLKB 1Y07A 3ARUA 3BOVA 2BY2A 3MRCB 1B04A 4JJ5A 2VR9A 3WUZA 4HS3A 3WUWB 2C9PA 5I75C 4XZUB 1ZPLA 1SOXA 1YEEL 3QULA 4IW4C 1L6ZA 3NSCA 1N2RB 1IBHA 4KRLB 4OV6F 4CVZA 4ZMLA 3JTBA 3KGSA 2P9RA 4JTAB 1RJZA 3CXHF 3ZMSA 5L8JB 5T1DL 4PW4A 1KFGA 1OCWH 4JZGA 1E42A 3E2HB 4B7IA 4LCCC 4YIQA 2F54D 3MUZ1 3UZQB 2A74A 2HMIC 4I77L 2YD5A 5H4YA 3GZOA 4HJSA 5AB1A 4BDVA 5FWQA 3TYGH 3F5WC 2Z8VC 1F4XL 3QEUA 4LCWA 2A5UA 2J88L 5I6LA 3CFBB 2QDOA 4R7NA 3BAJA 4NERA 1I9RL 2KQMA 3LQAL 4UUJB 5AW8B 2UUDH 3QJUB 2F68X 2MCPH 5HI5D 2P52A 2C9QA 1BZ9B 4NWTL 3J27A 1YMMB 3GB7C 2ADFH 3MV9A 4BGLA 4KJPD 1CUOA 5GGSY 5EBLA 4E68A 3K03A 3IN0A 1HNGA 1ZE3H 3BXNB 2J1XA 4LBEA 4PYHA 4UAOC 1KIPB 2PI5A 2BNQB 4M5TA 2W60B 1YJNV 4MMYA 4HLEA 1A02N 1S9XB 1SJHB 5LL6Y 5C09D 2DQCH 3Q8FA 3RGHA 2XKNB 2C9UA 1IJ9A 4MA3A 5E6UB 2AKRA 3BE1H 2X2UA 3RVTD 3VI4F 2R51A 4LF7B 4WK0B 4WLCA 1RL1A 4DV7O 3L7FB 4W9EC 1BQLL 2BCCH 2MQGA 3D36A 3B7YA 1BX2A 4DV4O 4GAJL 1F6AA 3RYFA 5H37H 5EH1A 1EEYA 4KVPA 4NCC1 2NY0D 1JMZA 3C2SA 2N4IA 5LCVL 1SA0A 3DJ9A 3NCEB 2QQKH 1RJLB 4LB8A 5FM4A 2H9GA 5EZJB 3G08A 3VFMA 3FUDA 1ZLEA 3CPUA 2CDFB 3NAAH 4OAWA 2UXGA 5FUZH 5FCSH 1GYWA 3G6DL 1EMTH 5JCOA 1IIKA 1YHPA 2CMRL 4MJ5B 2C4FT 5BO1L 1NL0H 5C07E 1P84F 3KPSE 1QNMA 3QR2A 5DS2A 3VGAC 1MH5B 3QYMA 5IQ9A 3CFIC 2FIRT 1DL7L 3NJMA 3QH3B 2ZSVA 2LJ2A 1NCWH 3X2QC 1SVBA 4HLZG 4JLRA 1SZXA 4HEPA 2OSLA 3FHQA 1GN4A 4NO0D 2YI9A 5FIEA 4FZ1A 1TFHA 2CGZA 4K23L 2EH7L 5D8JH 5L2KB 3WHXB 1NH2D 2CHDA 5E6SB 1UUNA 2J21A 3NJKA 3QZWA 1Z5WA 1KXQA 3CSXA 3DHUA 1K5WA 2IOOA 4MJ2A 3AG4B 1RVFH 1TZIA 1DLFH 4G83A 3KZ8A 3VD9A 1JZ6A 2E7LC 4XDLA 4JUTA 4WW2F 3OKOB 2WTOA 3FXIC 3QCVH 4XXDA 1X9QA 5D6CA 2IFFH 5FM5O 1TUPA 2BS8A 1S78C 3GSOA 2EUXA 1KIUB 3G6JA 1XHZA 3IBOA 3J2PA 5KVEE 4Q7DA 3LRSB 1KEGL 1FXKB 2W07B 2AABL 1DE4A 4JK0D 4P9HH 2P49B 3MA7B 5EC2C 4V2CB 4JG9A 3MRBA 3EUDA 4XXWC 4E5XA 2N0MA 4XPAH 4AI7A 5HSFA 3QZNA 3HB3D 4K5PA 4KTDH 3TEYA 1U3YA 2XQBH 1FE8L 2BS71 1RIHL 4XVSL 1S76D 1ZHKA 3IPEA 4Q6IC 3DROA 4OGQB 1IGYA 4M62H 5IMOA 5LCVA 4I2XA 4BKSC 1YG9A 2J8UA 5GXBB 2DZEA 2PXYD 3OAWA 1XDCA 2ED6A 4XC1L 4Z7UB 3HPJB 4ZODA 2DPKA 4UCTA 3AAZA 3F5TA 5F7YC 3VFRA 3OAAG 4YDMA 4KVCH 2KBGA 3BP7B 3UMNA 2PWGA 4YHZH 2AJ3B 5GIRB 5IB1B 3T4YB 2H1PL 4GW5B 1A7QL 3ECBB 5AALA 4HJGB 2G5RA 4WFEE 5DJAA 5C0RL 1RY7B 4LU5L 3BH9B 2R56L 3RW0A 3O2VL 4PW3A 1NFDE 1TQCB 1JTTA 2AV1B 5BZWB 2MQCA 4Q4EA 1L1FA 1G7HA 3RHWK 1PNMA 2HT3D 3ZL1A 2XWEA 3P11L 3MDSA 3OAZH 4NHUA 3PREA 5C7XH 2BWIA 4KAQH 5KVDL 4NC2B 2BVEA 3PL6C 2Z31D 5KTEL 5JIIA 3R1GL 4UTBL 3DX1A 2FT6A 1UXSB 4S1DD 5CBHA 3CCMV 1U36A 2J6WA 1JIBA 1INEL 2NY4B 4WI5A 4JI5O 5HYQB 3E6FB 3IMVA 3FC8A 4PWIA 2VLRA 3VQYA 3TBTB 1OSPL 4ZI8A 1HH6A 1CICA 1F3DH 4GMTH 4G72B 1WA1X 3LS5H 1KGUA 1W6WA 4F7TA 3DARA 4BSJA 5I5IA 3EDEA 2OR9H 1EZVX 2DQIH 2HPTA 1QACA 4JM4L 4MA1B 5BCAA 1DVZA 1NOLA 2FLRT 4M6ML 2UUAB 5F97E 4GX1A 5GS1B 1UFGA 2XY2A 4RZKA 4J6RL 4TNVF 1GYUA 3TZVD 1S5HB 1IM3A 4ZXBB 1QR1A 1T3FB 2R23B 1N4CA 2WZ5A 2A0LA 4Q58C 3B4NA 1K4DA 4KBPA 3H1HH 1U3HD 2VITA 3KPPB 2Z0UA 3EDFA 3S37H 4M93C 4V1DB 5IHZB 2JH2A 3UAFA 3VFUA 4OLZL 5KSBA 2FQDA 1FL5B 3BX7C 4GT7A 4IYKA 3FT9A 4GX2A 1S9WB 3F7VB 3KWVA 3QFGA 3B2DC 1ZHLA 3FT3A 1I5YA 4MKMA 2BSRB 5E8EA 3TV3H 2YLKA 4Y2DC 5DRWA 4F93B 1PZ5B 4UM9B 2GTWB 2CAZC 2Q6WB 1QLEL 4D0CB 1NM4A 5JORA 3VXTB 4LFHD 3RJOA 3VXPA 3UJTH 1D9KD 3RI5K 5BY1A 3B4SA 4I50B 1IAMA 2VDKB 2K3TA 2FECL 3BSZH 1FL6B 5EYPB 3AK2A 3QUMH 3VWJC 2A9HA 1F90H 3GSUA 3KJ6H 4Y4FD 5F9OL 4FFYL 1WFMA 2YSTA 5CGTA 4I4TA 2ZR3A 2B39A 1KFAL 4LSPL 4NRZA 1PY9A 4MW3A 2XN9B 3FUFA 4P04A 4E41D 1D7FA 3JTTB 4K94C 2YK1H 1PTZA 4Q2ZB 1JK8B 4NI6A 1UD8A 3WXWL 5EPMB 3RZCD 1H38A 3RYCA 1GTFA 4YHNB 2BY1A 4OI7A 4PBXA 2Z92A 3SKJL 4TUOB 3TFKC 1IE4A 3VRJB 5E2WL 5C0CD 1M9WA 1CTNA 1AGDA 4CVXA 4OF5A 4DPRA 1X6NA 1IBBA 4X98A 3SKMB 4PM1A 1MDAA 1OPGL 4BGDA 5EUOF 4B7LA 2DQ0A 4TQDA 4S1SL 3DOHA 1A47A 2F08A 5DZ9A 3D4ZA 3AB0C 4HIEB 4EI5A 2Y7QA 4NKOA 7PAZA 4X62B 2DIEA 5FV1L 2FHFA 2EZ0C 1XNRB 2B7DT 2WAMA 5PCYA 1G7JB 5KVFL 3VI4E 5F3HA 3DBSA 5HJGA 5CA1A 2ADGB 3EBHA 1EJ6A 4P2OC 5HGAB 3RB5A 4I0XB 2UY6B 2N7SA 5D2NC 5BS0E 1T2QL 1FYTB 4UU9B 3GPEA 3PUUA 4R0LB 3NK4A 1X7SA 4PJIF 4EZLA 3U0PA 5D1QD 3RYIB 1EFXB 5GONB 4QRRD 1KCUL 4F92B 3FT0A 4ZMVA 1H6UA 2A73A 4Y8DC 1I7TA 3RQ3A 2FDBP 4IRZH 4ZS6C 3L9DA 2IBZH 1XVSA 3QB7C 1JNHA 2YPLB 4FFYA 4MYPA 5IK3B 3T8MA 5H37G 1ESOA 4H40A 4WW2B 5D1ZA 1EH9A 4KH9A 1F1AA 2HVKA 2CPUA 3ECVA 3ZMRA 2LFRA 3P69A 4KTEL 5E6IC 3EHBD 1LVEA 3IFPB 1Z1WA 2HVBA 5FF6B 1ZMYA 5KYUB 3CCQV 1OSZB 2JJWA 2R9HC 3LNEA 3HMXL 3TOPA 5J12B 5I18L 1I4FB 2P24A 3UTQB 1R6TA 1LK3L 2F1AA 2VXQL 4TOYH 3CZJA 4A37A 4ZAKB 1K73W 5K9OB 3H9YA 5I1GL 1NLDH 5AG8A 2XG5A 4Q89A 1OP5H 4Z3GA 1U6AL 2CLZA 2Y0PA 2BNRA 5D5QA 3DGDA 3FQTA 1NOAA 1I9JL 4JFZH 2Q7YB 3GSNL 4F37K 5EEZA 1E7VA 4JW3A 3EW3B 4FADA 3ULVD 1DQQA 1EAJA 4XBFA 3NK3A 4XODA 2XTSA 2XWTB 4JO4H 2A7BA 2WSKA 5F89A 2CJTA 2ZUQB 1CXKA 4DR1B 5EOCJ 1TVKB 2WXPA 2XJLA 1FGNL 1D7DA 1TITA 1TJGL 2E56A 3LD8B 3WKML 4YE4L 2APFA 4D9QD 1JP5A 1JGEB 3MV11 5T3XD 4UV8A 1I1CA 3CBJB 3GKWH 3ESMA 5EO0A 4XCNA 3OHMB 5E1AC 1QHQA 4BK5C 3OD4A 2OMXB 1AY1L 1SUJA 4DV5B 2EE0A 3GHEH 2NY1C 4ODUB 4WO4D 3QO5A 3MO1A 1REIA 1OSYA 1KULA 2YIDA 1PJ9A 1T7ZA 3ZHRA 5GZNA 4CADA 1K5SA 3M86A 3NZ8A 4MTOA 3QDJA 2NLJA 1LUVA 2BTQB 4RAVB 3TBSA 4ZO6A 4QT5A 1KB9F 2X9YA 3DURA 4JFQA 4QCIB 3HR6A 5I8OL 5C2BH 1PPJH 1XTLA 3QWNA 3MV01 5DS8B 2J88H 3ZN1A 3BD4A 2WSDA 1K97A 1KBKA 3HZMA 1N0XH 2BSTA 3RY5A 3SE3A 1PEWA 3QUGA 5DHYB 2FSDA 3GBLA 1BXAA 3HC0B 4LH6A 4MJID 1OE1A 2X3BA 3CVBA 3MV7B 3FQUB 5D7IE 5EFIB 5EZOH 4NQSB 2UXVA 1ORQA 4O58H 1UUSA 1QFWL 3TA3C 2J12B 1X9UA 1O6TA 1UWXH 1K9MW 1YEFL 4ZUTA 3AREB 4ZOLA 4IJ3C 2QELA 1U8KA 2VXQA 4HUNB 4WFHD 3CSFA 1A64A 2QV2A 3KNBA 1AGBA 3PP4H 4PJFF 2C26A 5DYOB 1ZV5A 3NIGF 2DW5A 1J9CT 1E4KC 1QVOB 1R17A 4KDVA 4L5FE 4WUUD 1CDYA 1HHHB 2QPUA 5ITFB 1A7PH 3VJ6B 4CA4A 3GSNA 1G7PB 1YJDL 4RAUA 2N04A 1BD2D 1JPGA 1G0DA 3EG9B 3VTAA 5C0FA 2C9RA 3MLUL 3O6FA 4MA8L 2EH8L 1INQB 3G6AB 3LN9A 3ASOC 1NBZB 2ZG3A 3T0BA 3B7TA 3DV6A 1WVZA 2DTSA 2QV4A 4I18B 3RVUD 3VFTA 4MD0B 1KYOF 2WVUA 4URTB 4OFDA 4UF7C 2JCCF 5EIBC 4GX5A 4WKZB 2UV3A 3D6GA 4LLAA 1QAWA 3L3JB 1BVZA 1HNZO 3Q5TA 4I88A 2NTFA 2A9CA 4P4KA 3RVWC 2B59A 2ZKMX 5JUEH 4FERA 2E8YA 2CQVA 3S8GB 2P7TB 2D2CB 3SOTA 4WWKC 4JGNA 5LGHL 1HINL 2GFBA 3ILQC 2A83B 4P9MH 5E2JA 3WSQL 5JXED 1DL7H 1JFFB 3ZMVA 1R9FA 3BAYA 3NABL 5D93B 1M57B 5L3CA 1VAHA 5L8LB 4JO2H 3FKSG 4HSCX 3HC2A 2WY3B 4MB4A 3CIAA 3D4GA 3CUPA 3ZUNC 3R06A 3E7JA 4KUZL 3GLEA 1JSYA 4BQ9A 1EK3A 1IBMB 3IJYA 2AI0H 3H9SB 4TPRL 4ALAC 4QIRA 5F2VO 2J5WA 1SHXA 2BINA 5I28A 3GRWH 1T4KB 3MTRA 4PJ8B 5FYJD 4L4VD 4G8GE 3VGHA 2QM8A 4LF8B 5B8CA 2YBRA 5CO1A 1BQRA 1OE3A 3ARGC 4FQQB 1N26A 1IO4C 2GV9A 4JY6A 4AUJA 2XOKG 2QKIC 3V0HA 4KZCA 3E8HA 3PWPB 2FWSA 2X7RB 3WIHH 1DSWA 3N42F 5EUOB 2YXMA 5KHKA 4DGYH 3CS5A 4U3JA 3EFFK 1WWCA 3PAUA 2EEFA 3H55A 4NXSA 2CA4A 2FSEA 1FE8H 3SDCD 1HCVA 4JPRA 2P42B 4GAGH 3WS6A 3ZTCC 3QYCA 3VFPB 1IAIL 5E0FA 3ROOB 3U9PH 4X4ME 1QBZA 4MAYB 4ZW8A 1MSWD 3GTTA 5ID1B 4JB9L 4X5XA 4GKJB 5SX4H 4N8CL 2JJUA 3BIAX 1KF9B 1EAPA 3L2NA 4YSUA 2XWXA 4GG6A 1UASA 4AQ1A 4DVBB 3RUGB 3NSYA 1FBIL 3KW7A 3KLAB 4LT7A 5EO1A 5BW7A 4DR1O 2HZHA 4JRYE 3OGOE 4LU5H 3N0PB 4XXCA 3ZDXB 4ACTA 4DH2A 2IGFL 4HJEA 1UT1A 4NQQA 1S4IA 3QUXA 1ENVA 4EDXB 3L3GA 1G7IB 1TYRA 4Y1AA 2XX1A 4DO6A 1E8XA 2AV7A 1S3JA 4DV5O 4TVPL 3R1GH 4NKQB 1G9MC 3OWRA 4UTBH 5ESQB 3QPXH 3F7YC 3KS0H 4KUMA 2FGZA 2NY3C 5T3ZE 1BJ1J 3RY6A 5F7WC 2XIIA 4Z7QF 2QQLH 2X38A 4HZ1A 1INEH 2VDRL 1JFHA 4GY4A 4LR3A 1WZ1H 2PTTB 2FZ3B 4HJUA 3FQXB 3HI5H 4I89A 3MYZA 3TNMB 4OZFH 3IFOA 4N68A 2VAAA 3DHJA 2DOSA 1U8JA 4FVMA 2XFGB 4D7TA 1L5GB 3MQIA 1ZS8A 5FECB 1RP8A 2DQFA 3F7QA 3L5HA 5AEAA 3D69A 3OHXB 3G5ZB 4P2ZA 4M6MH 5CSGA 4JVUA 3UX9B 2C3VA 1NSNL 4ZQTA 5JA9A 3HKCB 5FOBA 5BQDA 4UT7H 4HIXL 1DEDA 3U4EB 4MD4A 3CZNA 1Z5LA 4GEIA 4BFIB 4HF5H 1WS8A 3RL1B 1K4CB 4BEIA 1ZD6A 2ZCEA 3O0RL 4AV5A 4APQB 1GTOA 1X4TA 4BIKA 1TKWB 2FYVA 4HOWA 3NEXA 4Y4KC 1VQ7V 5JHLL 2ADPA 5L88H 2FT8A 2OZNA 3VACA 1FPOA 1ZGLB 2PP7A 4KJYB 3J80N 1A4AA 3I5DA 4A7GA 5AKTA 1K8IA 4AYSA 1NCJA 4GAFB 1SJEA 1YEGL 3W39B 3JWDH 2LFSA 4A2GA 2IPTH 3ULUD 4JFED 4TSAL 1OAXL 1T80A 1JV2B 4YHIB 4N28A 4BRVA 3SPGA 4HK0B 5D7LD 3KYOB 3VA6A 2X9XA 4NGHH 4QE9A 4AL8L 4BXVA 3FSAA 3HNTH 3V0WH 2CKNA 1CFSA 1Q1JL 2DM7A 5MENA 3QE5A 5GGVH 2GJZB 4CC5A 4PJFB 5ECJE 4D7BA 4IS6A 4PRIA 3GKZA 3T9WA 1IBMO 2FX7H 5MI0C 3D4YA 2I7OA 2R4SH 3BAAA 4MFHA 2VM4A 4YMPA 3N55A 4MDJB 3NFNA 4M3JA 3B2MA 5E2WH 4C56A 1QSEE 5EORL 4OCXH 4R26L 4U6XA 3ZW3A 3CB2A 1N0LB 4IQHA 2CG9X 3ECQA 3NIDE 4JQIH 2JIXA 2OTPA 5D71H 1KOAA 5CB4A 1FWXA 4PJ5B 3L5WB 4BD4A 2OSYA 1FDLH 1KZQA 2AEPH 1GS7A 1F4YL 3RURA 5K1PA 5KOVC 1DLHA 4N6RA 1BCCH 5L9DH 1ANUA 5DJYA 1YYCA 3NIGE 5AZUA 3TEWA 5AVUB 2AJZB 3FHAA 1OT1A 4PSRA 4LLWB 1N3NB 2CSPA 2YZ8A 4IIQB 4MNQB 3QI9A 2WBXA 2YICA 3L7EB 1XCTA 4XNXL 3ZKXB 1OP9A 5JHLA 4JANB 2ADJA 1Y66A 3CN4A 4WDIA 1EVTC 5F9WB 1RM1C 2NYYD 4R3SA 1T2QH 2C3HA 2WQXA 5CN2A 3HUJB 2ZCHL 4MCMA 3EJRA 4KV5E 4XOCA 5DUML 2A6IB 5JIMA 1LWJA 4HFUH 3IXAA 2CO4A 3JTSA 1DVQA 2JCCE 4NEHB 3N2KA 2PCYA 1SBSL 2VIRB 3MBWA 5JO5B 2CUAA 2KZBA 1N34B 4AENA 5GSVB 1KG0B 3CH1A 5G4MA 5J13C 1ED3B 1WGOA 3QQ4B 2HFGL 1T1WB 2HJFC 1BAFL 1K7DA 1FG2B 2DWDB 1OW0C 3H9HA 4O4IA 1D6EA 1VZIA 1J95A 1CLZL 2ZOWA 3PGDA 4JZ2A 1XDTT 3UBXI 2IQAB 4WFFD 2EYTA 5FYLD 3OF6D 1L7TL 4C8XA 1G9NC 3SYPA 3N42B 3HMXH 4G2AA 1R3LB 3PABB 1LK3H 4YHML 1GAFL 4YK4C 3W9DA 3WY3A 2ZUXA 1JAEA 4TT3G 3S36X 2GABA 5DJCB 1FCCA 3CVDA 1M7DA 4F8NA 1I9JH 3D3VE 4FQJH 4U05A 1YMHA 4Z3FA 3WFHB 4GI8A 2XLLA 4AWJC 1FFPB 4K7PH 4HPYH 2FHCA 5DN6G 1U95A 3TEZA 1V5JA 2MOGA 5B5EZ 2COQA 3QK0A 2UU9O 1WF5A 4JNXA 2LU3A 4IT5A 2ZDIC 3C2AL 1TJGH 3BN3B 1BW8A 1OCRB 2DLTA 1HIML 3LNHA 2FJGA 2UWEB 5FW6A 1RIVL 1FO0L 4M8VA 1AY1H 2LO1A 2QHLA 3ATBA 3CNKA 2P80A 3DXAE 2XAGA 3B6SA 3BEWB 5D70H 3VUAA 4B60A 4MS2A 3EO0B 1ZLVH 4DKFH 3BSGA 2X1OA 2QWRB 1RSYA 1XT5A 1NGPH 1MDTA 1RZFL 3MV8E 4PI2A 4GNKB 4Q9CA 3JVGA 5HHMB 4K9JA 3ARPA 4N6QA 5CINL 4IHOA 2OMVB 1QQDA 3ZOAA 1VPOH 4HGKC 5AYUH 2CM5A 1DANT 5DQ9B 1TCRB 3ZIYA 3JAKB 2J1KA 4HUVA 1I3RB 2YUXA 1NIDA 2IVFC 3BI9X 2JKJA 2WBJB 3CPLA 2Z93B 4L9LA 4MB3A 3RVXD 4X4XB 2R1WA 2YD2A 3JATA 1U8OB 4X1IB 2HJLB 1EGJL 1XD1A 3HRZB 3LKOA 1VEOA 1RFYA 4I55B 2JGDA 1ADQA 5EF2A 1VA9A 2VQEB 3KCWA 2HR3A 2GJ6A 3CCSV 4Y4HD 4QJ4B 3FCUB 4KOCA 3UAJD 4IOIA 5I76B 5JW4N 3P9LB 3ARSA 4MQ7A 4UMSA 2JTDA 4X2UA 1LDSA 3DDGA 3DGGA 1AGFB 2XASA 4DPAX 1HNYA 5MHSD 4EI0A 2XXMB 4BQ8A 1ZVSA 1FVDB 5AVRB 5E79Z 4DR4B 3IAYA 3PWVA 5CLWA 1T04B 4Z7QE 1MRCL 2F95B 1I8IA 1BIIB 1A7RH 2WCSA 3ASNB 2QQNH 1LLAA 3BCDA 5LYJA 5C0GB 3K8LA 5B66Z 3KLSA 5KBNC 2EH8H 3OW2U 1Q38A 1U8CA 3AUVA 3BDYL 4LOEA 3WB2A 5HFMA 4XB3A 3GDCA 5HI5C 1X5IA 3PP3H 1AIFB 2JEUA 2K70A 5F1SA 1Y7VA 3UTTD 3SE6A 1KELL 2CBMA 2WGNB 4PWFA 1KTCA 2CIIB 2A9MH 5AZEL 4B9IA 4G6FB 2CBQA 1FO0A 1MABG 4DK6A 2CGNA 3I50L 3MMEA 3NH7H 1CXIA 4OZFG 4EN3B 4GKSA 5LGHH 2XYCA 2OMYB 3WSQH 1BCIA 2ILLA 5I26A 3ZZ1A 1J5IA 4M48L 1YY9C 2IAMA 3IETB 3GJEB 2Q3XA 2UVFA 3D48R 2EEDA 4DUXA 4JPWL 4PY8I 1MY5A 1SHSA 3I02A 1M1XA 2VWEC 1DVXA 1TQSA 4FQIL 5A2FA 1Q5OA 3QGVA 4GFXA 3EBGA 4YL9A 3SR2C 3RNQB 4PTUB 3JBG7 5CSZA 1P4LA 3O6KH 4IMKC 4QTIH 4OCSL 5DJ0B 5JVDB 1FXHA 3MODH 4E42B 1LNUB 2W5PA 5KG9B 2O6PA 1AILA 4KZ0A 2W6JG 1U3NA 2RB8A 1N34O 1BOYA 1OTSC 5C0AE 1KIQA 4ABUA 1HKFA 4M7JL 5EBWA 4PRHD 4JYYA 2XG4A 1I7RB 4XCEA 1SQPH 1SLWA 2H26A 4F3FB 1MG2C 3O4LE 2PCPA 3L9YA 1R3IH 3ZE2E 5CU9A 1EO7A 4KPHL 4AYFB 1CDIA 4HJJH 3OUFA 1J1OL 4DN3L 4IRSA 5D2LF 3QRFM 1KLFA 3DX9A 3BMVA 4HKJB 3ZDZB 5DI8A 1JGDA 4G5ZL 4N86A 5KSAD 3ARFC 1KJMB 1IZKA 2FKXA 2XN0A 3D08A 3K1KC 5DU7A 3BPCB 1Z9SA 1IC5L 4FNUA 1SDYA 2AEQH 3LSOB 3G04A 4B27A 1G9HA 2BCMA 1YPZB 5KANI 1CL7H 1HI6A 3G5YB 3GMNA 3MGAA 4BSVA 4POYA 1WAAE 3B3IA 1CE6B 1SXZA 2QFRA 4XPFH 1CDBA 4WV1B 1K8AW 1IQDB 2HKFH 2BZ7A 4IBQA 1JGLH 2WXQA 3MUY1 4TQPA 1J18A 2DEYX 3LZFH 5DHDA 3O9WD 4U1IA 5KSVB 3LKSB 3BA8A 5GS0C 4FYSA 2Y24A 2DWEC 2EKJA 4TULH 3TH3T 3N2GA 3JD3A 2K78A 2WXGA 3U9WA 1UATA 3UTZB 4X8JB 4YZFF 1JERA 1F6LL 1UB5A 2H94A 1MPAH 1MI5D 3ARBA 2LTQC 1P1ZB 3K1DA 1S7UB 2JQMA 2XA8L 3MBXL 4I13B 4NQVB 3MACH 1CGWA 4JAMB 3MLSL 4QRPB 3KXFA 1ULVA 2BXYA 2MQ0A 2X9WA 4JL1A 2YRZA 1QHTA 3LMJH 2F54B 3ZRXA 3OB8A 2OXGB 5HYJA 2QPEB 1H19A 4PG9A 2OZ4H 3SGDH 5KUKA 1UB6A 4UIMA 3IJ8A 3IDGB 2E3VA 4Y5YB 3AG2B 3BVXA 5I15L 1RZ7H 1S3RA 5IVZB 1ZGLP 3N50A 4R83A 2J25A 5GRVL 5C8JA 1G43A 2HKHH 1SQFA 1UJTA 2X1XR 3OZKA 3MLXH 3SKNB 4BFRA 4UUJC 1SJXA 1JVMA 4UT9L 3BP5A 1V10A 3ETTA 3X1FA 4HQQL 1FAIH 1ZL8B 1VQ5V 3B9KB 5FA4B 2P5OA 1A66A 2O61B 3F2LA 4LGPB 1P7HL 3QF7A 1NPUA 1PL3A 1OCOB 4JRXA 2EICA 2BTOA 2C9AA 5IROA 5C09B 1R24B 2ZE0A 3VDAA 3RFZA 4LHJB 1FVEB 4XR8C 1RZGA 1IVSA 1HR0O 1NBQA 3GNML 3P73B 1RZIA 4R7LA 1BHAA 2NXZC 3AC0A 4YJ2B 5BV7L 2G2RB 2F8XC 4HWZB 2FR4B 3WCYA 1SRDA 3FO1A 3O0RH 4XNYH 2G60H 3JZ7A 5K9JL 4YHHB 4O2CA 4JFYA 3ZX1A 1C5DA 5KSUB 1C12B 3RWFB 5FKPB 2YPVL 1PDKB 3AMLA 3VMNA 4F91B 1OANA 5IJBC 2F7QA 1XMWA 4M6AA 2J56A 3PAYA 1H15A 2DN7A 2WSSG 4FM2A 2IBBA 3WUWA 2NY2D 4G9FD 4P57B 3A5VA 3HG2A 3RDJA 4YEFA 4FABH 4AG4H 1DBKL 1N2RA 1DF5A 3L4ZA 3LH2L 2VMCA 4LRIA 2DD8H 1FQ9C 4ERSL 4PIRF 2GUYA 2JE8A 5D96B 1OM9A 4Z7NF 1A1MB 1M4KA 4QKTA 1GSMA 3OKNB 1HNFA 3V6ZA 5FO7B 3RGVC 1B6DA 4AL8H 1LK2A 3VXUD 5HHNB 4P9PA 3OPUA 3STLC 1NH2B 5BUAA 4U7NA 2VL5B 3EJCA 3VWKA 1X5GA 5DURD 1ET7A 2RACA 2YAQA 4XNQA 3WN5B 1MZEA 4FLUA 1RJYA 2IQ9H 3Q48A 4DK0A 3MRLB 5J5EA 2B4CC 1GM7A 3B8MA 1OEZW 2WWKO 1U8MB 3O3UN 5DJXB 3ZQ9A 5J8OA 3VXSE 4A7QA 1VADB 3AG4C 2NNFA 2YD7A 4XMWA 5T1KB 4P3DA 1AKJB 5EORH 1BVKA 1C7TA 2BVOB 4J1UB 4ENEC 1BZ9A 2QHRL 4HK3J 2FATH 3BESR 1YMMA 3QZMA 5I17B 1VGKA 2UYLA 4P49A 3BXNA 5DJDB 4RWYH 1HEHC 4F9LC 1EXHA 4XBGA 3POHA 1S9XA 5FYJU 1F4YH 5SWQA 2FJSA 4FMTA 3HB3B 3CLEH 3GMRB 2XKNA 3C9NB 2E9GA 1I3GL 2PW1A 5E1GA 1D5MA 2FGWL 3L1EA 1WCQA 1M7UA 4W70A 3RX8A 1ITCA 2EXTA 4W9FC 1KXTB 5IQ7L 2RFXA 2R7EA 4JN2B 4XNXH 1EEZB 1FC2D 3WMQA 4J2XA 1BEYL 3FU0A 2X4OA 2CHZA 4R6UA 4YGVA 1ZLSL 2H8PC 4NKMB 1N33O 3WB0A 1UURA 1JDAA 1HILA 2BK8A 4P2RA 1UTDA 1ORSB 3GHBH 1K5QA 2DMXA 1OWWA 3EDDA 3FUHA 2Z5UA 4PGJA 5EZJA 1T83C 2BVPB 2WBKA 4Q56A 1L8DA 1TUEB 3AMKA 5CR8A 2OMUA 5ICXA 2OSWA 4OLUH 4Z0BL 3F6LA 5FKAB 1YEHH 4MJ5A 4ONGL 3P0VL 1S7SB 3WJJA 3EBIA 4A7SA 3O2WL 2KPWA 1LTXA 1NBYB 1BIHA 5CFHA 4Y16A 2AQRA 3EXJA 1RULH 3UFIA 3K0DA 1CLZH 4FNPA 4LC1A 3QH3A 1NC2D 4TV9B 4ZI7B 5BNXD 3ZHQA 5DK0B 1VFMA 2VXVH 3TEUA 1F2QA 2R29H 3WFCL 2Z31B 4HCRA 1X9LA 3D3QA 3LPGA 2EDEA 2G38A 2QT6A 1UCBH 2VLME 4YHMH 3K2UL 3LZQA 4Z77B 3NCBB 3K81A 1K92A 2AW9A 2YS8A 2MPAL 4AE1A 3TIEA 4WWID 3OKOA 2VW7A 2FO4B 1CXLA 1CL7I 5B1JC 1S9VA 3BW9A 1KIUA 1NCCL 5E4IA 2JKTM 1JWUB 2MK3A 1YEIH 1V3MA 3LRSA 4HIIA 3TT1L 4Z0XB 1RU9H 3K5SA 1IGFH 2EDFA 5D2LE 1WB8A 1QLRB 3ZXAC 1A7OL 3TZVB 3NJHA 5L4MA 1TPXC 2EXWC 2PCFB 4JKWA 4UQIM 1ZLWK 3ZO9A 4AQYB 1L9TA 3C60A 3JQOB 4RFEB 1QKZH 1AHWC 4HHAA 1OM3H 4FI8A 4G43A 5EU6A 3PQYA 3W2DH 1NAML 2P46B 3PIQA 1KCWA 1MNUL 2F8IA 4F20A 3TESA 4XHJD 2R69A 3F6JA 4MJ6A 4Z7UA 1F23A 2BWQA 2DQUL 3ICXA 1UOLA 2XV0A 4M8UA 4UV7H 2YAHA 4LPXA 4YHHO 1NCOA 3WE6A 4Y5XC 4DFHA 4OJYA 1V7NL 3WO3B 1UOWA 1U8PB 3NP4A 5HYSB 3I9GH 2AJ3A 3E8UL 5E8DL 3T4YA 3O8XC 3UTSD 3ZTNH 4IIZA 4CJ1A 4HJGA 5C92A 1P4IL 2VZSA 1G7QB 4YZFE 2FJUB 4PP2B 4Q6YA 1J9QA 2QM7A 2KI6A 4XHQA 3VFWB 5CLYA 4AW7A 1JCVA 3P30L 1LILA 1JHTA 4Y4FB 3CDGA 2ZCLH 4ZMPA 1XIWB 3TXAA 3T09A 2D7TL 1IC7L 1UJ3C 5B38A 1MLCB 3QUHA 4Y7MA 5M95B 3BKJL 1E4XI 4E41B 1MCEA 1CT8A 2BHYA 3F01A 4NUMA 3BUIA 3CX5J 2UZYB 2OV0A 2Y5QA 4GCZA 1AIZA 1ZPUA 3FQWB 4XMLL 3FU9A 1MRCH 1DDHB 5HYQA 5DVOA 1CFBA 4B3RO 5DS1A 3TBTA 3WJLC 3D0AA 1IKNC 4FEMA 3MYJA 4K2UH 3MKGA 4YBHA 5C0CB 1XGUB 1KB3A 1BMGA 1GGTA 4AEHH 3Q6GH 1I31A 5D1XD 3EGXB 3ZKMC 5LKNA 3UBXB 2I9TB 1F45A 4NQXB 3V0DA 1S7XB 4TL4A 1BA9A 4PVLA 3NJFA 2WJ7A 4KVNH 5D72H 5F3BB 3OD3A 4DR2O 4G82A 2EDTA 3GWJA 3I50H 5SX5H 4HUKB 1E3XA 5GRXG 4MA7L 1S5HA 3FQ2A 4L29A 4XPTL 1NAMA 1TTFA 4MB1A 4MVZA 4KX9A 5FUOL 2XVLA 4JGJA 1HX0A 3HC4L 3MVSA 1YCSA 2VDNB 3P4NB 4N90D 4Z7NB 5IHZA 1CTMA 2X2YA 3SGIA 4JJHA 4JZJC 1S9WA 4FFVC 4FQIH 5CP7B 4R84A 4KROC 2JV6A 5D1QB 4QRRB 1PZ5A 2VDML 4UM9A 1KCSH 1Q9LB 2BJMH 1GJWA 3D0LB 3GSWA 4GIOA 4XC3H 4ADIA 4KZEL 3ZQWA 3T0EE 3T1FB 2E4FA 1X4YA 1XGZA 4JAUA 1QWNA 2DJ4A 3S9DB 2H2SC 3QQNA 1L9RA 5CLZA 3CWBH 1FL6A 2QQQA 4M7JH 3TTSA 5CBFA 4L3ED 2QSAA 1GSKA 4GUQA 4DN3H 5B1KA 5L3FA 2RR3A 3D2UB 5KS9F 2X4TB 3CFKA 3NSFA 5ID0A 4C54A 2XIDA 1JMXA 1JRHI 4G5ZH 2XN9A 3CCUV 3T8VA 1TCMA 4C55A 5I73C 3JTTA 3KR3L 5IF0B 3V10A 4M7KL 3KPRA 4B97A 4D8PA 1UWYA 2Q87A 4Q2ZA 4J42A 1WGVA 4G59C 2NW2A 4LF6B 2P5WA 3QDMD 4PJ9A 5E5LA 4Z1PA 3H42L 2K7PA 3W81A 3OAYK 5F44A 1UT9A 4N0UA 3BT0A 2A6DA 4I1RA 5DTFA 1ODUA 1XCXA 4TLUA 4XNMB 4O2FB 4XP9L 5E9DB 2XTLA 1E2VA 1D5NA 1UD2A 1BAGA 4OZGF 1RPRA 3BAIA 1WE5A 1I8LC 2HLFD 1U8NB 1EN5A 4I85A 2WIMA 4ORGB 2X87A 1S9YB 3OR7C 3OGCB 5DMIL 2F8VA 4JPSA 1AS6A 4KJQC 3FD9A 2A77H 5ANME 4KDTC 5DD6B 4TNWK 1I8MB 4B3EA 4F33A 4AGLA 3BKYH 1UJWB 1G7JA 3MLSH 2AJSH 3KWXA 2LR4A 5DVMA 3DNKA 1AC0A 2FEDC 1SQQH 2ADGA 2WZAA 1ZA6B 3ZPDA 3W82A 4F57H 2UY6A 4ZS7H 5ADOL 5JHDD 1GMIA 4HP5A 1FYTA 4UU9A 2YRLA 2DYSC 3IJSA 3M1OA 3NFPA 3I56V 4B7KA 1A6ZA 1OP4A 2L7QA 4LH7A 5GONA 3HTLX 2V5RA 3LIZL 3P9MA 3MLPA 2X88A 4GP4B 2Y4TA 2LT9A 5CSBA 4JO1H 3ULUF 1MW2A 5LP6C 2A99A 4UINL 5ACZA 1ASQA 5I2IB 3M17B 1EDHA 2WLHA 2G9HB 2WNWA 3DMMC 2YPLA 3HFMH 3EBAA 3EYVB 3LV3A 5IK3A 4DN4H 4MJIB 3BYYA 3BFOA 4K0OA 2HCZX 1CR9H 3H4HA 4HQQH 1FCGA 4JDVB 1E43A 3MBED 3IFPA 3A8TA 4J7KA 1HL5A 2VR6A 3QIWC 4NN6B 1VKXA 4K7FA 1MHHA 3AREC 4JFDA 2C34A 3UBGA 1JTOA 3S3XA 5DYFA 2Y7LA 4YQXH 2BRQA 2NQCA 3DYPA 1OSZA 4FTDA 4HC1L 4TNFA 4YE0A 1Q9WA 4J2QA 4E0RB 2C8NA 1I4FA 3UTQA 2O72A 3F7LA 3RP1A 4DKAA 4RDQG 5GISH 4ZAKA 1BD2B 3VI3E 1QLNA 4MX7A 1UM4H 3U6RB 1JS4A 1WJZA 4GQPH 3BH8A 2EJ7A 4YSSA 2Y2TA 4KI5E 3RVYA 3DPDA 1NWPA 2C7UB 2YPVH 3LH8A 3V4VL 2J71A 1NM9A 4IIJB 1TXKA 3A67H 5GRYA 5IDJA 4GX0A 4GB9A 1TVKA 1W72L 4PD4J 2XKUA 4WFHE 5F7UA 5CN0A 1OCZC 3PHAA 1K8DB 1QW9A 3BZFB 1RZJC 4WUUE 3HPLC 1Q7YW 1MHCB 3KEHA 3CHRA 3ZVVA 2B1GA 3FFOA 3PFQA 5IFJA 2EACA 3V5DA 2BRRH 4OFQA 5A2KH 3T6WA 3WKNA 4ODUA 1SUHA 4DT2A 4XBPB 1SMDA 5C71A 2VZOA 1TETH 5IWLA 1ZDQA 1JWSB 1M53A 4M29A 4NT6A 3VFSA 5E9AA 3N1FC 5IEKA 5IIEB 1OO2A 1CEZA 3OT7A 3ECUA 4HCIA 1RIUH 4N2NA 4D7SA 2IMMA 5DS8A 1Y6KR 5EMYA 4ETYA 1LMIA 2J57A 3F5WA 4L4VB 3SDXB 2JS5A 5KYNA 2H3OA 4EFEA 5DHYA 4FYTA 1RUAL 4A6YL 4PV1B 3FL7A 3FOMB 3MV7A 4PY7B 2AK4B 4X66B 2CK0L 2XT1B 2EEBA 3JCZA 5JA8B 3LSQA 1I3UA 4E9SA 2PYEE 4HC1A 2NSQA 4LDCA 1IBGH 2PTVA 5E56A 4LCWD 1WJ3A 3I6KA 5CGBA 2ZXDA 3TPUB 5D5PA 5F7NC 4CRPA 2ZNJA 2C9XA 3NCCB 4DAGH 3X1NA 1F13A 4GMSH 4PJ7F 4Q74A 3ZKQD 3MU3A 2ZTBA 3PHSA 4U4IA 3NIFB 4FTVA 3LEXA 4W9HC 4FKHA 3CCEV 1G7PA 3MV9D 2VO8A 2KQXA 1DBJL 2ZICA 4LDEB 4PR5A 2Q7HA 5FYJE 3V4VA 4BKTC 3EG9A 5DSCB 2WA4A 2H7WA 1XB3A 4LF6O 2DQJH 3Q2LA 1INQA 3G6AA 4YBLB 1W72A 1JBJA 1TQBC 4PJEF 5D7SL 3V79C 3B09A 1R0AH 4MD0A 1HEZB 1YYMH 1JPXA 2IG2H 1WV7T 3ML0A 3P4MB 3CMAV 4LVHC 2QZ5A 4PBDA 4WKZA 4Z0BH 4XNAA 1WWWX 5IW1B 1UXWA 1E40A 3L3JA 1P5VB 2ZP9A 2Y22A 1NLBH 4L05A 4Y8AA 3V4PL 2V2TB 2C3GA 3D18A 1RK1A 3IT8D 3EJPA 12E8L 1YEDB 4RIRB 2GHZA 4M5YH 5MERB 2HP4A 4X80H 4N2AA 2OS7A 4L1SA 5KS9B 3CYOA 3X14B 4KK5C 4YDLB 3K2UH 2ETNA 3S3CB 3T77B 4XP4L 4LSTL 1H3PH 4W9LC 3RB7A 3ZO0A 5HPOA 5CGYC 2CBOA 5TGBB 1ACYL 1T4KA 4HUUA 5F0LB 3RIFK 1PZDA 1E5AA 4PJ8A 3ABKC 2H6PB 5HVHB 1HNXB 3QISA 1H9VA 4JFFE 3H1KH 4KXBA 3U1PA 3U30B 1U0QA 5GGQH 4FQQA 3NSJA 5FYKH 2G30A 4IRJC 1FV1A 2OJZL 5DVKA 2VSKB 1KEMH 3TT1H 3PWPA 1MFNA 4OZGB 3FSOA 3BLBA 4RGOL 1BP3B 1LP9A 2WW8A 3HKBA 3MGOB 4FKEA 2BC4A 1OHHG 1A6AA 2I9LA 3TT3L 4EUPH 2EZPA 2FNWA 1MWAB 1GMEA 2A6KA 2P8PB 4RGMC 5EC2A 3WNMA 1HHJB 3V95A 4KKZA 4UXNA 3W1ZA 4P5TB 5A3IC 2Y0SA 4R6ZA 4NO3B 5LMNB 2NXYB 3FZUD 4RNRA 3AXHA 3QQDA 5EV7A 5I9QC 5JQ6L 5EU5B 1TQVA 2RCSH 1ZLUK 5FHBL 3AG3C 1WA8A 5ID1A 2RBLA 4X8XA 3L5XL 3IF1A 5IB3B 3A21A 3QWOB 3ESNA 1V7NH 2GQHA 1EIBA 1EO8L 3V4PA 3UIZA 4AK1A 2HFFA 2Q7GA 5E8DH 1WUNT 3Q44A 1VQMV 1IC4H 2ADIB 2BERA 4DPBX 5LG1A 1P4IH 3P3SA 3QXDB 1OT2A 4PJBF 4ADGA 3VGFA 2GK0B 4JI1B 2NY6B 3GBMH 3HLAB 2O1AA 4B95C 2B1AH 5DMKB 3P30H 1IGTA 2Z6FA 4XVUD 4AH2B 2BMKA 3NRFA 5EF3A 2UXDO 4HZ3A 1HT6A 1FNEA 5CHNB 5ISZA 3ZDYF 1BEXA 3O3EA 4FM0A 1KYAA 3ARYA 1H2KA 3PPSA 3NJIA 4HUCA 4BCYA 5D5MA 5ESQA 5A16B 2EX3A 1JK9B 3CE2A 3AT0A 3IDXL 2KQNA 2PI4A 3T04D 3FUNA 3N43F 1KLUA 4LCUC 4PGCA 1PV0A 1IGML 4N5ED 5IMKB 3R19A 2V33A 5G5DB 2VDOB 1IXBA 3MJ7B 3EFDL 3FQXA 2V17L 2VJ0A 3LPFA 3TNMA 3WBDA 2OK0L 1HAUA 3JXAA 3DIDA 1S7QA 4JFEE 4P5KA 1CD0A 3RHWF 3UABA 2QVTA 3BAXA 2D3JA 2OX5B 3O81A 2ZKHL 2AEWA 4K94L 5D7LE 1OAZL 3MLYL 1KTLA 2AJYL 2IH1C 4BCXA 4Q6GA 3VQ1C 1L5GA 4YY3B 3OB0K 3V5KB 5GHWH 5FECA 3FAWA 5DLLA 1SOQA 4FLWA 2X4UA 3OHXA 3U83A 3Q3GB 3IS1X 2BZCA 1FIEA 2VLRD 3O65A 4FIPC 1NFIB 3CVHB 3Q05A 1CICD 2J73A 3HKCA 2K6ZA 3GSQA 2NUTA 5LAPA 4HOXA 1L0XA 2B1HL 3U4EA 3TN0B 3GXDA 5CMAB 4KNTA 4RBPH 3QDGA 3WFVA 3U2SA 4LFAB 4XCCL 2NTSP 4NQCB 1RK0B 3VAEA 1SGKA 2DL2A 3S0PA 2JKSA 2F58L 4BYHA 2OCHA 4MNGA 2HKOA 3MLVL 1IM3D 4X6DA 1CWVA 3FAXA 4OM0L 1ZK5A 1ZGLA 2A0LD 2B5UA 4WK2B 2H6OA 1BVLA 2VS0A 4KJYA 4NDMB 2ROYA 2V4LA 4QRQB 3ET9F 1XFPA 4Y2DA 1KYFA 1A1OB 1NCDH 1KN4H 3IDJB 4Z1MG 2ZAGA 4JO3L 4I0PA 2ZX9A 2Y4UA 1QFPA 3WXVL 2K9UA 4NP9A 2V3FA 1I8UA 3TCTA 4OF8A 2WLZA 1V7MH 1I94B 2PWDA 4UQ2B 3UZVB 3VWJA 4U7OA 1M05B 4WU5B 3THML 1SEQL 2OMZA 5F6HJ 5IBLC 3L1OL 3DIFA 4M7KH 5A2LH 5JTWA 1GZHC 3DLQR 4PJ7B 5AKRA 1Q94A 3N3EA 9CGTA 2V3EA 5L8KB 1RKRA 2DI9A 2Q8BH 1W80A 1FN4A 3K72B 3H42H 4CMHB 4X7FC 1N19A 3B2VH 1JE6A 3T0XA 4MDJA 1ZS2A 2NNUA 1CDCA 1NCGA 1UG9A 3OM3B 1ZANL 2JK5C 2Y69B 1KPRB 2WA3A 5FGCB 5FO8B 4ZOAA 3T8XA 1HNXO 2B2XL 2AXGB 3TGXA 4KHXL 1V3LA 5HGBB 3H54A 1KXVA 1M7XA 4FQ2L 4PJ5A 1E8WA 2XQYG 1Y18B 5FYLE 2E75C 4BHUA 1T20A 1UD4A 1OAUL 1Z9LA 1S5JA 2HUHA 4FFTA 5JPNB 4IMLB 4A2EA 1Q0XL 3X1GA 1BM3H 1FZJB 4X1YB 3GLDA 3A4EA 4AJVA 2V37A 4IIQA 4MNQA 3K71B 4RGND 5HXMA 4M3KB 1A25A 2BOCC 4ZOEA 2VE6B 5LG6A 4YXKH 4X6CF 1H8OA 5DLMH 4P5RA 3HUJA 5DA4A 3Q1EA 1JF1B 5EU3A 4DP8X 4PJEE 2A6IA 1BF5A 3LIZH 5D2NA 4EI5D 4PGEB 5A6LA 1P53A 4UVAA 5JQGB 5B3NA 4N8VG 4QPJA 1HVXA 5IW6A 2VIRA 4O4JA 3L4TA 3L3DA 4N5UA 3KAAA 3MAQA 1KG0A 5SV4A 3E86A 1QI3A 2F7IA 2OCCC 3OMAB 1IC1A 1T1WA 3LVTA 1FG2A 2DWDA 3ZE1F 5KYWA 3L75H 4QXGL 3MNDA 2BX5A 4LLMB 1ZX3A 5JNYA 4K4KA 3DO3A 4D9LL 5DJZA 1WITA 4JI1O 3OLIA 1PKQE 3WKYA 4DTGL 1RI8A 1DJZA 3QHTC 1I9IL 4NZTL 1K34A 4QAMB 1YY8B 5E6IA 3MJ8B 4UDUB 4POUB 4PJGB 1OOWA 5TFSL 1L0YA 4XI5D 1UWGL 3WFDL 1WH0A 1QWUA 3CCRV 1NMAL 2FD6H 1KMIZ 1WFOA 4X64B 4M1DL 5D1ZD 2Y9RT 4PS3A 5AUMA 5LA6B 4MVMA 2BW5A 4KKNA 3HE7A 3OVUB 2ZXEB 4LQ1A 5I6KA 3ISWA 3MCG1 3SDDC 4R96A 4Y89A 1UQSA 2BFVH 1XGRB 2KT6A 3F3HA 3H7LA 5E6ZA 3WFHA 3VQMA 2W9DH 1NKRA 4IM8A 4YVNA 1LO5A 2PPDA 4JM2C 1DFXA 5L3DA 2QKAA 5IWAO 1HN1A 2AAAA 1RD6A 3QRLA 1DCEA 2YOAA 1KC5L 3WGUB 3EFOA 1SETA 1Z9NA 5H2BA 2BNRD 5CEXA 2UWEA 3QO0B 1QQCA 5I8KL 4G7YL 4J3XA 4M56A 5KA5A 5IBUB 1D5XA 2Q0ZX 4UCUA 4F37F 2HRPL 3LEYH 3BEWA 4FFZL 5DDHA 4TQIA 4ZNEE 5CBEB 1NOFA 4MVQA 2QPSA 1WHOA 2VUOA 4BK5A 3OKMB 4ELKB 4MCZB 2CO3A 3R4RA 1HDMB 3OAUL 4EUPG 1M7IB 1S7TA 4R7DB 5JZ7D 1CLVA 3UTTE 5DQ9A 1TCRA 3GQFA 5KVGL 3KPLB 5I1JL 1Z9OA 3OXSB 3B40A 2D7PA 4GSDL 4X1IA 1YN6A 2HJLA 3HRZA 4XWOD 1HL4A 4A6YH 4RQEA 4I55A 4PJBE 4UV4L 3F00A 1EJ8A 2CK0H 4X6EA 5CBAB 2YAMA 5GZND 4FLQA 3MCLL 3QDJD 4MZ3A 2P22C 1NH6A 3P9LA 4YSTA 15C8L 3WHE1 3ELAT 4MRCA 3S96B 3IFXA 3ZDYE 1BFOB 4NNPL 1WPCA 2JKWA 3BH4A 4GRWB 5KSAB 4NPYB 3FUKA 2HKAA 1FVDA 2BFGA 5CJBA 5DHVH 1KGYE 1JNNH 4R97B 1T04A 4BIUA 1PY0A 2APTA 1QEWB 4H13B 2QR4A 1XGYL 3JALB 2PCXA 3L4YA 1BIIA 1E4KA 2YWYA 3ETBJ 2VABB 4ZNCD 3KVQA 1RPOA 1UACL 3V5HA 3OJMB 1F3DJ 4QF1A 4P2AA 3VH8A 5BQ7B 2QZQA 1SM3L 3LNNA 4PRHE 3CN1A 3C09B 4ONOA 2ZE6A 3O9WB 3V4UL 4L4TA 3A22A 5BZBA 4JMNA 4F2MA 3F12A 3DETD 2R2BB 3H53A 4NZRH 3GM0A 3Q5YA 4OSUL 4W9CC 2ICEB 1AXTL 3OJDB 1UM6H 1N7ML 1XUQA 4UOQA 1H8EG 3E6HA 3AT8A 5H35B 3TH2T 2IPUK 1MI5B 3O6FD 1R5WA 2KSDA 3MRRA 2OMYA 3BDXA 5DT1L 4F7PB 1EN6A 2JMRA 1KN2L 1N5AA 3QZOA 4CH5A 12E8H 3FFCB 3O45A 4HYTB 1QPPA 4WWKA 3LSSA 3MOBL 3PGFH 1LO2L 3FT4B 3N40P 5ADPL 1NGXB 1QFOA 2DLFH 1BPLB 4KY1L 3T6VA 2CTPA 4U6HB 2P6JA 4P4KD 3ILPA 1XXFC 1TMCB 2G5UA 3POCA 4PTUA 4LSTH 1UCTA 5JHMA 2GT9A 5TH2A 4TQEL 2K7QA 2QWOB 3A0RA 5JVDA 4XN2A 3VTMA 4AKQA 4OLVH 4L9DA 1ZAUA 2PNDA 5CCGE 1SQ2N 4OJFH 3WEBA 1OOAA 1ID5I 3REVB 2PTMA 4U2ZA 1NWOA 3CXFA 5E99L 4JI6O 4ODWB 4XMUA 4K0KO 4J41A 3ESUF 3GMPA 1CK0L 3Q9PA 4YHYB 2FYUH 4F8TA 3AJ7A 1OTTD 4GG6B 4KJPC 4F3FA 4MVBC 3VFGL 4RGOH 4AYFA 1S7VB 4S11A 4ZZKA 2DMGA 3ARGA 3RVZA 1PNCA 4JV5B 1FG9C 4H1LB 1C5BH 3H7BB 5K9QG 4UOW1 4TUUA 4ZW6A 4HISA 1OCOC 3ALPA 4OKVB 3UYRL 4DSYA 2E5LB 4EDWH 1KGWA 4LCYB 1NUDA 2UZPA 2ESVE 4L1BA 3BPCA 1ONQB 2E74B 5JQ6H 1YPZA 2BSSB 5E24E 2IBZX 1DEEB 3G4SV 4K8ZA 3FCGA 3MLWL 5GGRB 3OPZL 5FLVA 2VDQH 1CC3A 2X7LB 3KZIZ 4WV1A 4U1KB 4X6CB 5EZPA 3IGLA 2NY0C 1DVFB 3VQVA 1C8QA 2AJXH 3MAWA 3C6LC 2FCBA 1EFQA 5KSVA 1ML0A 1OALA 4ES8A 2P8MA 2YXWA 5DD5L 1ZTXL 4G9FB 2YXHA 3EOAB 5GRJH 4P59H 3UTZA 3BYTA 4AGPA 3T2OA 3LQZA 4KGLA 4D0BB 1P1ZA 1RQ5A 1GL4B 2BWDA 5FYKU 1AJQA 4XGZB 5I0XA 3UTPD 3ZE1B 2ZJSH 1TVBB 4PJXF 1GJIA 4NZUL 4QRPA 1MFCH 5DZJA 3TYFB 4X7SL 2B5IC 4PBVC 3GIZH 3P0YL 5CD3B 4J11A 3VXUB 4BR6A 4G9DB 4HZLB 4KO5A 2NMSA 2W9LA 2O6EA 4WWOA 1QYGH 3DUSB 4MNHA 5DURB 4R90L 4ZMQA 3SQOH 4D9RD 3BAKA 3ARRA 4NTXA 4TRPL 3WL9A 3QUXD 4O02L 3F7YA 3RL2B 4GXUN 4XP5L 3EFDH 5IVZA 1UA3A 2HTKD 2OK0H 5IBTL 1FZMA 1BREA 1H3GA 4ODXB 4Y1AD 3SKNA 2ZKHH 1BZOA 3MUHL 3QC5X 4QPEA 2BP0B 2AJYH 4FZEL 3NSXA 3OXRB 4A7TA 4OV5B 1HE7A 5DHMC 3B9KA 2O61A 5DZVA 5I5JA 2Z4QB 1XR8B 4ZFGH 1KBPA 1F58L 5EN2B 3W37A 1SYSA 2WLNA 1AROP 3CK0L 1R24A 3ETQA 1FVEA 2PR9A 4D6TH 3SIKA 2B1HH 1AMYA 4G5AA 5F71A 5CEZH 3P73A 2R2EA 3FRPB 4LLQA 2AZAA 1GN3A 1A7NH 1AC6A 4NPJA 1WLHA 5EBMB 4HWZA 4L1DA 1Q9OB 1R5IA 2F18A 4PRAB 4XCCH 4XP6L 3UYOD 2FR4A 1U8HB 2PXYC 2HJKA 4W1TA 2ITEA 4L3FA 2W0LA 1X6LA 3RWFA 3IMSA 1PDKA 3MLVH 4LLDB 2WXJA 4KFMA 3GRGA 4OM0H 3K57A 3QNYB 2WLJA 1PGRB 2CKBL 4Y4KA 4JGSA 3FT2A 1QRNE 2Q86B 5IHWA 5EZYB 2J5LC 2Y07L 3IPFA 1CDGA 4XNBA 2X5PA 4KK9D 3VM7A 5LMUB 4JTCB 2VAJA 3N1PC 4XPBL 4JYBA 1US6A 4PJAB 1A1MA 1NC2B 1XEQA 2HT3C 3EDJA 1G4YB 4WEEA 4FXGB 2E4TA 2J4WL 3WGVB 3WIFA 3BN9C 3ZBMA 3RPIB 3THMH 3W11C 4O02A 1J86A 5HHNA 1A4CA 1VF5B 2IJ0C 4Q9QH 4XN7A 4ZUSB 2X6CA 3MX0B 4DQOH 4G8AC 5JJNB 3MRLA 5EHFA 2F53A 3RWCA 2D9QB 3APMA 3I3EA 4TVPD 3OKEB 5DJXA 2Y2YA 3RX5A 3SE9L 4RQQB 2X05A 5ILTH 1HQ4A 3NN8B 5T1KA 1AKJA 1ZANH 3MUGB 4S0TD 1Q8MA 2BSEA 2BVOA 2ITDB 5C0ND 3STZB 1URIA 4FOMA 4CNIB 1G9NL 3CN2A 3BVOA 5MEND 2SEBB 1AYOA 4M1CC 2ZF8A 1KLGB 4PRID 5IJ9B 3AXLB 5CD5D 3RBGA 3V0VB 3WDIA 3VW3L 4TS6A 4OH2A 1FGVL 3D2TA 4P3CL 1JN6A 4I0KA 4AXWA 1M6OB 3C9NA 3TJEH 4NO5A 4C56D 1V27A 3FO2A 4JFWA 2GJRA 3DSFH 3KCPA 1OHZA 1BAWA 1QNZH 1KXTA 2ATKC 1U3HC 1YSCA 2JIXD 4YHLL 2BY0A 2NY5C 3QQ3A 4A2FA 4NBZB 1KNOB 4Q9RL 3NJXA 4NKMA 3OLEA 1W0KG 5B7MA 3WS3B 3UEZA 5B3JF 1JGUH 3GFUA 4MVOA 5DXWA 3GI8L 4JY4A 3UTSB 2PTUA 3QI9D 5DFVC 4AMWA 3ZJZA 4G8EB 5EC1C 4LWSA 1D9KC 2HX7A 4F5CA 2FL5B 4QXGH 1I85C 2G3NA 1IFRA 1QR8A 4D9LH 4UOJA 3QR1A 3T2NL 2QGNA 1OW0A 4S0SD 4UB0L 4X8CA 4TV9A 4ZI7A 1SF3A 4U1GB 5DK0A 4ANKA 1XCQA 5I6OA