1SZTA

Atomic structure of a thermostable subdomain of hiv-1 gp41
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Atomic structure of a thermostable subdomain of HIV-1 gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1sztA00
2OT5A 4FIPC 1Y4MA 3CYOA 3K9AA 5KA6A 1JPXA 3CP1A 1MOFA 1EBOA 1QCEA 1K33A 5HFLA 3MHHC 1DLBA 2LP7A 4JGSA 4JF3A 1Y66A 3MHSC 1ENVA 2M7WA 4FK5C 3H01A 1QR8A 5CMUA 4N23A 3WFVA 2MK3A 5H9CA 2EBOA 2EZOA 3B77A 2X7RB 3GWOA 4N21A 1DF5A 5KA5A 4JPRA 1I5XA 3P30A 4E2LA 3B8MA 1MG1A 1JQ0A 1QR9A 3M99B 1QBZA 4FJCC 1K34A 1I5YA 1F23A 2P6JA 3B8NA 5CN0A 4G2KA 1SZTA 2EZPA 1DF4A 5HFMA
chains in the Genus database with same CATH superfamily
2AZ0A 3QVNA 2CGNA 3H1JH 4QNHB 2ZM6B 4X66B 4JI0O 2ITCC 3MD0A 1IBMO 1GKFA 2ODMA 3J80N 3L75H 2Q7EA 3ZN0A 5LP6A 1R3LC 2UXDO 5CBGA 2QR4A 1Z5WA 4LFCB 2JGUA 2BTOA 4B08A 1AI6A 3VOUA 5JWPA 1OCCB 1M9NA 2DQ0A 3EVKA 1NZ6A 5EK0A 1FPOA 1TA8A 3R66A 1XDCA 3BA8A 3T1HO 4UCRA 5H6RA 4H37A 2Q7HA 2LGQA 1WLEA 2EJ7A 3JALB 3APOA 3E8BA 2R9RB 2HHHB 1HNWB 1S5HC 1TUBA 3HKEA 2CH7A 4P2ZA 3CP1A 4AILC 4NXNB 4GX1A 3VQVA 3KKYA 4X9QA 2WWWA 3D36A 4JYYA 4GKJB 1YJ9V 3RVZA 5IYZB 5LA6B 3SR2C 1S76D 1GM9A 2FKXA 2OTJV 1XL6A 1OZ0A 2EIKC 2GBOA 5EC2C 3IC9A 3HKDA 2HVJC 1RSOB 5KHKA 1KKDA 4GKKB 1TVKA 5IYDO 4O2AB 1Y66A 2AZ2A 2UXXA 2JGDB 2A79B 5A2QN 2CTPA 2Y69C 1F51A 1NT2B 4HAMA 4UV8A 2LW7A 4X66O 3J7AU 2PF4E 5LOVA 3ZHRA 1QVGU 1H2GA 4KL1A 3JATB 4X65O 1JFFA 4GT1A 3RWRD 2CTQA 5KHJA 1EFRG 4O4LA 2PYLA 3FYEB 4QE7A 2DYSC 4CH6A 4MS2A 1K8AW 4X1KB 1R3JC 4LNUA 1O9GA 3ABUA 2UXBO 5KX5A 1QLEC 2CAZC 2ZE5A 4J41A 2LGWA 2FMLA 4DK0A 2JJ2G 1VQ8V 5AG2A 4FLYA 1NH2B 3SPIA 4C7UA 1HNWO 1K4DC 4CBCA 3N2KA 5IJ0A 5KUMA 1S0VA 2HLDG 1HNXB 3M8AA 2JS3A 4DO2A 1PL4A 5CA1A 4TWKA 3AG3C 1M57B 3EHBB 4JYBA 1S5JA 3ZBHA 3SJBC 1MZEA 5H9CA 2XHBA 1GAXA 4KHPB 5DN6G 4TUYA 1WPXA 4EKWA 2YXLA 3B8NA 5B1AB 3B09A 4DV6O 3E83A 4I55B 4DV1B 5C8YA 1ZLZA 3NXSA 4JI7O 1XNQO 1JJOA 5CMUA 4JI2B 1AI7A 2GHYA 4CZZA 3JAWA 1SQQH 2YC0A 1QHTA 2DE0X 3CD6V 3JSNA 2ZNJA 1IBKB 5JQGA 3K79A 2GUZB 3G67A 4XBFA 3ZMTA 2JVDA 1FFXA 1S72V 5JH7B 1BQ0A 3BABA 4X20A 2W6JG 4DR3B 3ABLC 1JQ0A 1KU9A 2H8PC 2X0LA 4PHZA 4X62B 5EIBC 5FPRA 3DC5A 1M1KW 3KCXA 3ASOC 1Q43A 3SPHA 2WLMA 3THOA 1R3KC 4O2BB 3B77A 4FLWA 4JPRA 2E76B 1VMGA 1ZWIC 1K73W 4WCEV 1PNKA 3D3QA 2Q67A 2CK3G 4O4IB 4OPAA 4P9PA 1Y67A 1FXVA 1NTZH 2QM8A 4RUEA 3C3TA 3W7XA 1BHBA 3HKCB 2GSMB 2P90A 5JJEB 4U3JA 1XMQO 3OEEG 2RN9A 1IXMA 5CA0A 4FZ0A 4JI4B 5LMNO 2ADPA 1V54C 4DV5O 2PY5A 1D5NA 3STLC 5LYJB 3UO3A 3Q4HA 3W7WA 3K58A 3MHSC 5IWAB 4UVBA 1AB3A 3SYOA 5J9PC 3CJHA 4DR7B 4B3RO 2XTAA 4ZOLB 3AG7A 4F6RA 4PA9A 1L8DA 4GCZA 1SERA 1DK1A 3F5WC 1WP8A 4JASA 1FXKB 3IGAC 3T1YB 1B06A 3AK1A 2EBOA 3DXRA 1WPBA 1SESA 4H13B 1HWYA 4IGGA 2EINB 4K35A 5IY5B 3ABKB 3TK1A 2XOKG 2YEVB 2AXTZ 1QNMA 3G80A 2B5UA 1GRJA 4W4KA 4KFMA 1I7FA 1FKAO 2IJHA 3AG1B 4X64O 1OCRC 1M93A 4UCTA 4LF9O 2HJDA 3T4ZA 2W0FC 1WB8A 2DYRC 2RMKB 2IU3A 5JVDB 4FM0A 2QTSA 3CCQV 1Y76A 2QTOA 1RFYA 1LNQA 3OR6C 3QO7A 5JJNB 3IC7A 3FB8C 1BSMA 3BCCH 3ZHVA 1BGYH 5BMVA 1Q82W 4LP8A 1NJIW 2P5OA 1VQ6V 1TGOA 2WLLA 1OJHA 1VARA 3ETDA 2QA4V 3ZN1A 1A32A 4ZHQB 2BSKA 3K57A 4K8ZA 1G1XB 4CS3A 4FFBB 4LF7O 3LSUA 1K5QA 1Y6XA 4WFAV 2Q5ZA 1JMKC 1V55B 4KP4A 5LA6A 1Q5OA 4QGPA 1XI1A 1I08A 4DV4B 5LL6Y 3BFRA 4LF6B 1RSOA 3UT5A 2ZXWC 2DQ3A 2EIMB 4RUFA 2EILC 3E8GA 4O4JA 3L72H 2PYJA 2GTSA 5ITZA 1GO3F 2DOSA 3TXQA 2Y0IA 4WFEA 2QE7G 4JAUA 4DYLA 3ZHUA 5K1XA 2Y48A 2HG5C 3CRQA 2ZDIC 1P4RA 2IU0A 4G28B 1I94B 2IH1C 3JYCA 2VQFB 1QVFU 4ZKIA 1KB9F 3LUTB 1VQKV 5IJ9A 4MVSA 2CTRA 4JYAB 3B2EE 3AG4C 1XREA 2HVKC 1EZJA 3CRCA 2VWKA 5B1OA 5LXTB 2MW2B 3N2GB 4JI8B 3CXHF 5DECA 3LDEA 4ZI7A 4R50A 4PA7A 2DWEC 3AG2B 1N32O 4PD4F 4IIJA 1H2NA 4FVMA 3HKBA 3OE7G 2IJJA 2ZQMA 1DF5A 2HKOA 5L3DA 4GX2A 4CS4A 4MVMA 1BE3H 1CPYA 4CH4A 1PKXA 4K0KO 4GZRB 1OCCC 1VQPV 5CB4B 2GDSA 4DRXA 3OGCC 1BS3A 1Y74A 2F1MA 3U11A 4OPHA 2X6AA 1QU7A 4MTXA 1SQBH 4HNAA 3DGEA 1MA1A 2ZXWB 1E1RG 1HW7A 4DV4O 2RQ6A 2EILB 2OIEA 1AR1B 4LF6O 2RCVA 1F23A 4O4HB 2Y4UA 2WLKA 1R6TA 2Y0PA 1N34O 5KUKA 4I55A 1GTOA 2YXYA 4Z1MG 3PN1A 3OUSA 3ETEA 2R72A 1XQ8A 5EYPA 2YS8A 1US6A 2HP8A 3TGUH 2KG7B 3GB7C 3RYCA 1N0NA 1DF4A 2VQFO 1XMOO 1HNZO 3ZMZA 3K9AA 1AILA 3QO8A 1VQOV 2UXCB 4R7CA 4LCUC 1TUEB 1NR1A 3SPCA 1PM9A 1K92A 3SJAC 4PA4A 4JI5O 4GX5A 3OW2U 1FJGB 4J42A 4EFBA 2ZR2A 5K1PA 2JDIG 1U97A 1JVMA 3LNNA 2B1IA 1P7BA 3SGIA 1SQGA 4TV8B 3LDCA 4MTGA 3ABMB 1PNMA 3K3WA 3SDLA 2X6BA 4I4TA 2FL4A 2AHYA 4FLVA 1YVWA 1VP7A 2RDCA 4B3MO 1H2KA 4OX9B 4MSWC 4DR1B 2F95B 4YHHO 4NXMB 4N21A 1ZL8A 4UVAA 1YDXA 2YDEA 3UKMA 3P30A 3H1KH 4J80A 2Q6AA 2IW5A 2Q73A 2V7QG 2EIJB 2NN4A 1XHZA 4YJ3B 1XNRB 5LMUB 1MOFA 2G38A 4J7JA 2DWDC 1Q8IA 3CWBH 4TQDA 1W0JG 3CCMV 2YIBD 3U10A 1YJNV 1H38A 4UVCA 3L73H 3AK3A 1VQ9V 3ZRSA 3E8HA 1M57C 4JI1O 3X2QB 4A5UB 5LYJA 4AQYO 4FLTA 1XHXA 1YJWV 4X1IB 4KUMA 2QWQB 3ZRWB 4GYCB 4I7ZB 4JTDB 5B1AC 1YIJV 1K9MW 2ZM6O 2UUAB 4BW5A 1XILA 1VQ5V 1FAFA 4G2KA 4PDRA 1OV9A 1J95A 2EX3A 3OUFA 3CCEV 1K3EA 1Q6UA 5FLXN 5FPOA 1N33B 2Q7GA 2HEPA 4WBNA 4LFCO 3JCUZ 2BCCH 4QE9A 2EZOA 1F4NA 5LGTA 1M5IA 2JK5C 4P30A 3TETA 4B3SB 4DUYB 3E86A 5D5QA 1VQLV 3VQWA 4BIOA 1IXBA 1Y4MA 2ZNIA 4NXMO 1RPOA 1VF6C 5GTHZ 3C90A 2FB5A 2HHHO 3CC4V 4DV0B 2IM9A 4DR2B 5GONA 4H0LB 4FM1A 2Q8VA 3CB2A 4NXNO 2Z5UA 2N74A 3JASA 3P3PA 3JAKA 4GKJO 1PNLA 1XEQA 5EC1C 5C93A 1VF5B 1VQNV 1N36B 2V1DA 1KBHA 2A7WA 3B4SA 3IFXA 4GKKO 4LF8B 5BR8B 4LF4B 4YJ2B 4X1YA 4I5SA 2BTQA 4IYIA 3CYOA 3STZC 3WG7B 3MHHC 2JS5A 4B3TB 4JF3A 4OGQB 4JI3B 4RQEA 5KAIZ 5B1BB 4XDJA 1MG1A 4DR6B 2UUCB 3ZMVA 4EEQA 3BEHA 3OMNB 4JI6B 4TV9A 4IYHA 3BPZA 2Q68A 2IJIA 4DUZB 4FFKA 1QR8A 3SPGA 4IT5A 4B3SO 1SA0A 1SRYA 1WA8B 2IBZH 1FS0G 3E22B 2WPDG 3NR7A 4I0XB 1VQMV 2UU9B 4FJCC 3HPLC 5IE9A 4AHCA 1PD3A 1H8EG 1FXKC 2L6LA 3CXCU 4DV0O 1JX9A 1N4CA 2Q69A 3ETQA 2RNBA 3SYQA 5EBWC 4CC5A 5LP6B 5LHGA 3LSSA 5IYBO 4IHJA 1HNXO 4UCUA 1G4YB 1W2BU 3B8MA 3DC6A 4H44B 4PDVA 4DK1A 1UJWB 2WLIB 1PL0A 2F4VB 2EINC 5IY5C 2VWJA 3OTOB 3ABKC 2VRZA 4DR4B 4KHPO 1GM7A 5LXTA 2F66C 3ZMSA 1E1QG 3RYFA 3UCSC 2CDYA 2ITDC 2P4VA 1SF9A 1BL8A 4WFHA 3K9SA 3G6EV 2VQEB 2BOCC 2XAJA 3AG1C 1VEWA 1NKDA 4DV1O 2LFRA 4NYKA 2E75B 5A9GA 5EZYA 4LFAB 3HB3B 3M99B 1TUBB 2HJFC 3HKEB 2CH7B 3ZIAG 5CN0A 2ZCEA 2BOBC 2PI5A 4ICGA 4EB6A 4JI2O 3I56V 5KMGA 1JR9A 4JZ2A 1I0HA 4UCOA 3VQYA 3I55V 4JV5B 4OXSA 2ZD9A 3CC7V 1IBKO 3ICXA 3RYIA 1YZBA 2OIGA 5KHHA 1JJ2U 4J9YB 3BY6A 1XUQA 2QKCA 1YSCA 3K5NA 3HKDB 2YIAA 1SQFA 2P7TC 1HR0B 1CEZA 4DV7B 1TVKB 2OTLV 4DXWA 1ORQC 3RBZA 5KA6A 4IL6Z 4DR3O 5J2TB 1L1FA 4LF5B 3OGIB 2QDOA 1KP2A 2ZDIA 4YY3B 1V55C 3W7SA 2DJVA 5LOVB 4X62O 1IX9A 5E79Z 3E35A 1L0LH 1JFFB 3R65A 1AR5A 4NTWA 1NVPD 2KKWA 1R3IC 4BWAA 3UQ8A 1GM8A 4O4LB 1RPRA 2CGOA 5CA3A 3D3IA 3PJSK 2EIMC 5J2UA 3MDSA 1GN4A 2LP7A 4LNUB 4U7OA 3ETGA 1H8HG 3OEHG 1BT8A 5DM6V 2EJRA 1BMFG 5KX5B 4UCSA 1J5EB 2H94A 4FPPA 5H6QA 3ML0A 2ZE8A 4L8JA 2XAHA 4Z2WA 3U0ZA 1YEWA 1AVMA 4TV8A 2F93B 4PV1B 2YI9A 4TSFG 4X8AA 4FLXA 1MNGA 3FKSG 4UB8Z 4JI4O 1B04A 1EN6A 3JD2A 3JAMN 3N2KB 4BIUA 3LDDA 3CCUV 5IJ0B 1YITV 4UCVA 2XASA 5BY1A 3G71V 3QF7A 2L35A 2QM4A 5CA1B 1SZTA 4JV5O 5IWAO 2YXHA 3JALA 2CTWA 1N0JA 3WB1A 1KECA 3AG2C 1KKCA 1W59A 3FX7A 3FYIB 4CH5A 4DR7O 4ABMA 2UXNA 4J11A 3DSQA 2GV9A 1G6UA 3RVYA 1NU1H 5IYZA 4CS2A 2QEXV 2EZPA 2R70A 4LF5O 3T1YO 4JAAA 1BHAA 4TOIA 4JZGA 3ZRVA 2QWNB 3RFRA 2IJKA 1N8RW 2N05A 3JAWB 2WA4A 3JD1A 4O2AA 2YIDA 2JEXA 3ZRWA 2JGDA 3WU2Z 5JQGB 2UUBB 1YF2A 4NVPA 5H2FZ 3FB5C 1I5YA 1RP3B 4CH3A 1H2MA 3BHPA 1EN4A 3BRCA 5DEDA 1FFXB 3JATA 1ZX3A 4NTXA 2WLJA 4FM2A 4X20B 2P06A 1GN6A 1OCOB 5KAFZ 2Q0AA 2XAGA 1KMIZ 1RM1B 3ZJZA 4GLXA 2Q0OC 4B7KA 2PI4A 4X1KA 3M7MX 2NLJC 2ZR3A 1F7YA 3OT7A 4D6TH 2KB1A 2LFSA 4JTCB 1WP7A 1JPXA 3WB2A 3ZHSA 3ABTA 3AEIA 1NVPB 1SQXH 5LHHA 3FB7C 4N23A 4PELA 1KQSU 4JI0B 2X7RB 3SJCC 1CXZB 1AI5A 1IBMB 1QQCA 4J7KA 3ABMC 1W0KG 1YCIA 2WSSG 4MVQA 2YUAA 4H33A 4RAIA 2UXDB 1Q81W 2R9IA 1EZVH 4UFZA 2DW4A 3ZX6A 3JD3A 3FFQA 3OM3B 4U3JB 2PUSA 4TQFA 4NB5A 5CA0B 3L70H 4LWSB 4YIPA 1WB7A 5KA5A 2QGNA 2EIJC 3N27A 1T5EA 3CC2V 4LC1A 3T1HB 2D3OW 3A2FA 1MZFA 1L0NH 2NNUA 3Q4HB 2ADQB 1BZKA 1JA8A 1EN5A 1Q3EA 5CBHA 5L3GA 2XAQA 5FNVB 4MW8A 3KG2A 4JTAB 3CJHB 2GTAA 3CPWU 1M56B 1GH6A 4LFBB 3SYAA 1JCHA 4F6RB 2OYQA 5EBLC 3FAVB 4MTOA 4LH7A 3SPJA 1I94O 3X2QC 3CMEV 5CBFA 4PDMA 2V4DA 2GUZA 4JYAO 3OMIB 3H01A 3DXRB 1F4MA 1QLNA 1X4TA 1WA8A 2ZIOA 1VF6A 2ZE6A 5JH7A 3S3XA 4JI8O 2ZKOA 2LO1A 3KCYA 3L9DA 3I5DA 3G4SV 3CS5A 3FD9A 3EFFK 4R6ZA 4JGSA 3K0GA 3G6BA 5L3CA 2QWPB 1S5LZ 5B5EZ 4TT3G 4X65B 2QWRB 3KZIZ 3UM7A 1X59A 1MSDA 4O2BA 1WNSA 2W6IG 2LW1A 1Y76B 2WLIA 2UXBB 4WFFA 3OFNG 1R1BA 4J10A 4O4IA 4B7EA 2QKSA 3FB6C 5LGNA 3E8FA 4BIZA 5BMVB 1MMMA 3HKCA 5B3SB 2WLLB 3T2MA 3ASNB 3ZHQA 4FLUA 3K03A 2Z3YA 1PV0A 4ZBMA 2BSKB 3CRAA 3GWKC 3L74H 5IDJA 4FZ1A 4LFBO 2OCHA 4HYOA 1Q86W 4RWUA 4L87A 2OCCB 4PI0A 1XL4A 3LSQA 2UXCO 4ZOLA 3UT5B 3WG7C 1OCZB 2F23A 2QJ1A 1MSWD 3CX5F 3JSLA 1FJGO 2HR3A 2WLNA 4DV6B 5B1BC 4GX0A 4O4JB 3E2EA 3TCUA 1FXKA 5IT9N 4JI7B 2B9ZA 5FL7G 5J2TA 5ITZB 4DW0A 3W7UA 4FMTA 1NR7A 3QNEA 1XNQB 3APQA 1QR9A 4NR1A 2PGGA 3BVOA 4MVRA 4QPJA 3RYHB 4OX9O 4DR1O 1S77D 5H5NA 2ZE7A 3DTUB 4E4EA 1GMGA 3F7VC 4MVOA 2M7WA 1D2DA 5IJ9B 2OWOA 1E79G 2YEVA 2MK3A 1KD1W 3C3SA 3MAQA 3GVMA 3CHXA 3GWOA 5D5PA 3HR0A 1ZSPA 2WAMA 1K7DA 1THZA 5GTIZ 1XNRO 1DTOA 4PA6A 1CP9A 4DR5B 5LMUO 5EBMC 5E1AC 3RN4A 3T1CA 1YHQV 1B3QA 4ZI7B 5LP6C 4P9OA 3LNMB 4IIJB 5JVDA 3SYCA 3HKBB 3K06A 4PDLA 2JJ1G 3H1IH 3QO5A 5LGUA 1SQVH 3CMAV 1AP6A 3A0HZ 2JIZG 5JJJB 4DRXB 1URFA 1NI8A 1Y74B 4QIWF 2A3QA 3ZHTA 5HFMA 2X6CA 2H3OA 2EIKB 4K8XA 3P32A 4HNAB 1BQZA 1G8MA 4AI8A 1VIBA 4ZHQA 4YIOA 2UUAO 1P84F 4BR6A 4FFBA 5KLVH 3WB0A 2Y69B 1QBZA 5EIBD 1ROPA 2P6JA 2ILMA 2Q4PA 1N33O 1XMQB 4I50B 2PZSA 3D36C 3K0DA 5LMNB 4X88A 1NTMH 5IYCO 2N04A 5EYPB 2R9AA 4MVUA 3JCZA 4DV5B 1P49A 2QWOB 3JD4A 2A0LA 4DUYO 2DYSB 2XUMA 3QTCA 2KSDA 3JARB 5GW7A 1Q7YW 3O65A 1FD9A 3JD0A 3RYCB 1COWG 4BAYA 1HDJA 1QLEB 4UB6Z 4DV2B 4B3RB 3K5LA 4DR2O 2YI8A 1H2SB 4DR5O 2O57A 4PJ0Z 2ZIMA 2WA3A 2VS0A 1LR1A 2FTKA 1GK9A 4DW1A 4I4TB 4QJFB 4Q6GA 1N36O 4X89A 4G27B 2NR5A 1ENVA 3AG3B 3N2GA 1AI4A 5LBQA 1ZL8B 4LF8O 5BR8O 4LF4O 5B1NA 5KHGA 3TJTA 3T4DA 4DV3B 3D8CA 4QPKA 1KC8W 1WN7A 4B3TO 1R6NA 4JI3O 1MABG 1YI2V 3QG5A 4X64B 5KHIA 3A8TA 5CB4A 1QCEA 3CSXA 1K4CC 1Q90D 4LF9B 3CRRA 3OR7C 3W7TA 4DR6O 2UUCO 4FLZA 1FYJA 4LWSA 1JOYA 4JI6O 4XDKA 4Z1VA 3O9OA 2ZINA 3B40A 2ZT9B 4DUZO 1IURA 4HBNA 1P7GA 4O4HA 3CEIA 5HFLA 2Q9LA 2IH3C 4ASUG 1GN2A 3BAAA 2UU9O 5FNVA 2K1EA 3ZS8C 4DV2O 1ZTEA 1TAEA 3TXSA 2QM7A 2XT9A 4LF7B 4PI2A 3ABLB 4LH6A 3FAVA 2KG7A 4WBNB 1EBOA 4NKGB 3K5OA 3AK2A 2P67A 2ETNA 1SQPH 3WFVA 4UV9A 2KQXA 2RJZA 3CCRV 2F4VO 3ASOB 3K59A 3OTOO 2D2CB 1B6QA 4DR4O 3IAYA 3OMAB 3UO2A 2K9PA 4W4LA 5B66Z 1SZXA 4I9WA 1O9HA 3F7YC 1IVSA 3H1HH 1PPJH 3ZRXA 2VQEO 4MTFA 3F5TA 1OCOC 1RM1C 4DV3O 1AROP 4LFAO 4U7NA 2BE3A 5GONB 1WJZA 2CE4A 4XDLA 4D7TA 1IBLB 5L3BA 2AHZA 2W0XA 1SC5B 3JASB 3JAKB 4F4LA 3L71H 2P22C 4RQFA 1Z5VA 3A0RA 1Q6IA 4FIPC 4MVZA 1V54B 2CUGA 1DLBA 4YJ3A 1XOUA 3A0BZ 2Y4TA 3OTFA 1NBMG 3RT3C 5L3FA 3CCLV 1UPGA 4TUYB 1XBLA 4YXWG 1KP3A 3RGBA 2E3CA 4BW9A 2JRIA 4DV7O 1HR0O 1I5XA 5JCOA 2LQTA 1ZAUA 4X1YB 1N32B 1K97A 2A9HA 2BTQB 5C8YB 1S3JA 1AP5A 1BCCH 1OHHG 1R73A 4D7SA 1LUVA 3OD4A 3ZMUA 2DN9A 4YY3O 3SJQC 3CCVV 4K0KB 1YTFD 1HP8A 1NQTA 2HFEC 4WF9V 4CC6A 1SKVA 4X1IA 1PP9H 3CRMA 1AJNA 2YSUB 2YICA 1GN3A 3K08A 3VBBA 2EULA 3VQXA 2A06H 4MW3A 2OT5A 4TV9B 1Q6HA 2M6YA 1NS1A 3SYPA 1J5EO 4UXNA 1SA0B 2F43G 1NTKH 1N34B 1H2LA 1M56C 1IZ3A 1V9PA 1UFIA 1Z2GA 1AJQA 2E5LB 2E74B 1K34A 1KYOF 4K3AA 1AJPA 1OCRB 4J9ZB 1D5AA 4HZ3A 4Q20A 3RYHA 2DYRB 1IBLO 1FXHA 3E89A 4IHJB 1VQ7V 3ZCCA 1XMOB 1HNZB 4I9QA 3IJ4A 2ATKC 1IDSA 1VQ4V 4E2LA 2XNDG 1AR4A 4R8CA 3OAAG 1YXBA 2WLHA 3BA9A 2AW9A 4JI5B 4JAVA 5TISZ 3K04A 2DMXA 3RYFB 1K33A 1K5SA 3CCSV 3EXAA 3RW0A 4PA3A 2B1GA 4FK5C 5F2VO 1EM1A 1KUQA 4UUJC 2Z0AA 5LHIA 5EZYB 1DGSA 4NTYA 2P4KA 1WAZA 4F6EA 4B3MB 1SS3A 2PTMA 4EB6B 3J81N 1SETA 4U3FH 5KMGB 4YHHB 2AGAA 5BZBA 4RO2A 3H9VA 4YJ2A 1VF7A 2C2AA 4GUNA 4LBEC 3RYIB 1ZUQA 1U96A 5JCOC 2FYUH 2UUBO 4JYCA 5B3SC 4WFGA 3CCJV 3K5MA 3ASNC 3S3WA 4LR3A 5L3EA 2QKAA 1R6KA 4KXRA 1M4UA 3P3NA 1FFTB 3ZEDA 4EFEA 4I50A 4ZIBA 3CE2A 2LJ2A 2E5LO 1M90W 2QSAA 2YIBA 1LUWA 4WFBV 4JI1B 3H1LH 2OCCC 5BXZA 4MT8A 2JEUA 4J7ZA 4AQYB 1YTFB 2XAFA 3E22A 3JARA 1OCZC 1NH2D 4I0XA 5J2UB 2ARHA 3AG4B
chains in the Genus database with same CATH topology
1YHQV 3I56V 4QNHB 4P9OA 2ITCC 3LNMB 2ZXWC 3MD0A 2DQ3A 3SYCA 1GKFA 3I55V 2EIMB 4RUFA 4OXSA 2ZD9A 3K06A 2EILC 3CC7V 4PDLA 3ZN0A 3E8GA 2JJ1G 3QO5A 5LGUA 1R3LC 1JJ2U 4J9YB 3CMAV 3BY6A 5CBGA 1YSCA 2PI5A 2JIZG 1GO3F 2P7TC 4QIWF 1CEZA 5HFMA 4WFEA 2OTLV 4DXWA 1ORQC 1AI6A 2QE7G 3RBZA 4JAUA 3VOUA 2X6CA 2Y48A 2HG5C 5KA6A 2EIKB 1OCCB 1P4RA 2ZDIC 1M9NA 2DQ0A 2IU0A 3P32A 5EK0A 4G28B 2IH1C 1G8MA 3JYCA 1QVFU 1L1FA 4ZKIA 1KP2A 3LUTB 2ZDIA 5H6RA 1VQKV 1V55C 4MVSA 3W7SA 4H37A 1WLEA 3AG4C 3E35A 2Y69B 1QBZA 1ROPA 2P6JA 3E8BA 2R9RB 3R65A 2HVKC 1NVPD 1R3IC 1GM8A 1EZJA 1RPRA 1S5HC 3K0DA 5CA3A 3D3IA 3PJSK 2EIMC 4P2ZA 5B1OA 4X88A 3CP1A 5IYCO 4GX1A 2LP7A 3LDEA 4R50A 4U7OA 3ETGA 4PA7A 1H8HG 2DWEC 2WWWA 3AG2B 3D36A 3OEHG 3JCZA 4MVUA 5DM6V 2EJRA 1BMFG 3JD4A 1YJ9V 3RVZA 3OE7G 2A0LA 2DYSB 2H94A 2IJJA 2ZQMA 1DF5A 4FPPA 5GW7A 1Q7YW 2HKOA 5H6QA 5L3DA 3ML0A 4GX2A 3JD0A 4MVMA 1GM9A 1COWG 1CPYA 1S76D 4BAYA 2OTJV 2XAHA 1XL6A 1OZ0A 1PKXA 2EIKC 1OCCC 1VQPV 5EC2C 1QLEB 2HVJC 3OGCC 1KKDA 4TSFG 4X8AA 3FKSG 5IYDO 2X6AA 1Y66A 3JD2A 4MTXA 2UXXA 4BIUA 3LDDA 3CCUV 3DGEA 2A79B 2ZXWB 1E1RG 1YITV 2Y69C 1F51A 2XASA 2EILB 4HAMA 4UV8A 1AR1B 3G71V 2FTKA 1GK9A 1F23A 1QVGU 1H2GA 1SZTA 2WLKA 4QJFB 5KUKA 4GT1A 1GTOA 1KECA 1EFRG 4Z1MG 3AG2C 4X89A 3FYEB 4G27B 3FYIB 3OUSA 4QE7A 1ENVA 2DYSC 3AG3B 3ETEA 4MS2A 1K8AW 1AI4A 2UXNA 5LBQA 1R3JC 5B1NA 3ABUA 3T4DA 3RVYA 1QLEC 4QPKA 1KC8W 3GB7C 2QEXV 2EZPA 1DF4A 1R6NA 1MABG 1YI2V 3ZMZA 1BHAA 3K9AA 3ZRVA 2JJ2G 1QCEA 1VQ8V 1K4CC 2IJKA 3QO8A 1N8RW 1VQOV 1NH2B 4R7CA 4LCUC 1TUEB 3OR7C 3W7TA 1NR1A 3SPIA 3SPCA 1K92A 3JD1A 4PA4A 1K4DC 4CBCA 2JEXA 4GX5A 3ZRWA 3OW2U 2ZR2A 1JOYA 2JDIG 4XDKA 1JVMA 2B1IA 1P7BA 3FB5C 1I5YA 5KUMA 1S0VA 3LDCA 2HLDG 4MTGA 3ABMB 1PNMA 3K3WA 4DO2A 2X6BA 2AHYA 4TWKA 3AG3C 5HFLA 1M57B 3EHBB 2WLJA 4JYBA 2IH3C 4MSWC 4ASUG 1OCOB 2XAGA 1RM1B 5H9CA 3ZJZA 4N21A 2PI4A 4UVAA 3UKMA 2K1EA 5DN6G 3P30A 2NLJC 1WPXA 2ZR3A 2QM7A 4EKWA 3B8NA 5B1AB 3ABLB 2Q6AA 2IW5A 2V7QG 2EIJB 3E83A 2KB1A 2LFSA 3NXSA 4JTCB 1JPXA 1MOFA 1EBOA 3ABTA 3AEIA 2P67A 1NVPB 5CMUA 5LHHA 1AI7A 2DWDC 3FB7C 4N23A 3WFVA 4UV9A 4PELA 1KQSU 3CCRV 2GHYA 4CZZA 3ASOB 2X7RB 1AI5A 1W0JG 3CCMV 3CD6V 3ABMC 1W0KG 1YJNV 1B6QA 1H38A 2WSSG 4UVCA 4MVQA 3OMAB 1VQ9V 3ZRSA 4I9WA 3E8HA 3F7YC 3K79A 4H33A 4RAIA 1M57C 1Q81W 2R9IA 3X2QB 4XBFA 2DW4A 3ZRXA 3ZMTA 4MTFA 1OCOC 3JD3A 3OM3B 1RM1C 1AROP 4U7NA 1S72V 1YJWV 4KUMA 3ZRWB 4XDLA 2W6JG 4JTDB 5KA5A 5B1AC 5L3BA 1YIJV 2AHZA 3ABLC 1JQ0A 1K9MW 2EIJC 4F4LA 3CC2V 2H8PC 4LC1A 4BW5A 1VQ5V 2D3OW 2X0LA 4G2KA 4PDRA 4RQFA 3A0RA 2NNUA 1J95A 4FIPC 4MVZA 3OUFA 1V54B 3CCEV 5CBHA 1K3EA 1DLBA 5L3GA 1M1KW 2XAQA 3ASOC 4MW8A 1NBMG 5L3FA 3KG2A 3CCLV 3SPHA 4JTAB 2WLMA 1R3KC 4QE9A 2EZOA 3B77A 1F4NA 4YXWG 1KP3A 3CPWU 1M56B 4JPRA 1I5XA 3SYAA 1JCHA 1ZWIC 5LGTA 5EBLC 1K97A 2A9HA 4MTOA 2JK5C 1K73W 3SPJA 4P30A 3TETA 4WCEV 3X2QC 1S3JA 3E86A 1PNKA 1R73A 1OHHG 3CMEV 1VQLV 2Q67A 1Y4MA 5CBFA 2CK3G 4P9PA 3ZMUA 1RPOA 1FXVA 3SJQC 2QM8A 4PDMA 3CCVV 4RUEA 1YTFD 3W7XA 3OMIB 3H01A 1BHBA 1NQTA 2GSMB 2HFEC 1F4MA 4WF9V 2P90A 3CC4V 1QLNA 3OEEG 1IXMA 1AJNA 2YSUB 3K08A 3VBBA 2Z5UA 1V54C 4MW3A 2OT5A 3STLC 3G4SV 1PNLA 3SYPA 5EC1C 4UXNA 3W7WA 5C93A 3EFFK 4R6ZA 4JGSA 3K0GA 2F43G 3MHSC 5L3CA 4TT3G 1M56C 4UVBA 1VQNV 3UM7A 3SYOA 5J9PC 2V1DA 3IFXA 1AJQA 1K34A 2W6IG 1AJPA 4PA9A 1OCRB 4J9ZB 2WLIA 4GCZA 1SERA 4HZ3A 4I5SA 4Q20A 3CYOA 3STZC 3F5WC 2DYRB 4JASA 4WFFA 3WG7B 3MHHC 3OFNG 1FXKB 1FXHA 3E89A 3IGAC 4JF3A 1VQ7V 3ZCCA 2QKSA 3FB6C 4RQEA 5LGNA 3E8FA 5B1BB 4BIZA 2EBOA 2ATKC 1VQ4V 4XDJA 5B3SB 2WLLB 2XNDG 4E2LA 1MG1A 3T2MA 3ASNB 4R8CA 3OAAG 2WLHA 3K03A 2Z3YA 4JAVA 4ZBMA 1SESA 3ZMVA 3K04A 1HWYA 3BEHA 3OMNB 2EINB 5IDJA 5IY5B 1K33A 1K5SA 3ABKB 3CCSV 3TK1A 3RW0A 2XOKG 2YEVB 4PA3A 2Q68A 4HYOA 2B1GA 4FK5C 2IJIA 1QR8A 1Q86W 3SPGA 4UUJC 2B5UA 1SRYA 5LHIA 1FS0G 2WPDG 4KFMA 4L87A 2IJHA 2OCCB 1XL4A 3AG1B 3LSQA 1OCRC 1VQMV 1SETA 4FJCC 3HPLC 1PD3A 5BZBA 4RO2A 2W0FC 3T4ZA 2DYRC 1H8EG 2IU3A 3WG7C 1OCZB 1FXKC 3CXCU 3CCQV 1MSWD 2QTOA 1JX9A 2Q69A 2C2AA 5EBWC 4LBEC 2HR3A 2WLNA 1LNQA 3SYQA 5B1BC 3OR6C 4GX0A 3QO7A 3E2EA 3IC7A 4JYCA 5LHGA 3FB8C 3LSSA 1FXKA 3TCUA 4WFGA 5IYBO 5B3SC 3CCJV 5FL7G 3W7UA 3ASNC 4FMTA 1G4YB 1NR7A 3QNEA 1W2BU 5L3EA 3B8MA 1Q82W 4LP8A 1QR9A 1NJIW 4PDVA 1UJWB 1R6KA 2WLIB 1VQ6V 2WLLA 1PL0A 4MVRA 2EINC 3ETDA 4QPJA 5IY5C 1S77D 2QA4V 1FFTB 3ABKC 3ZN1A 3DTUB 1GM7A 1GMGA 3F7VC 1M90W 4MVOA 1E1QG 2M7WA 3ZMSA 2ITDC 4WFBV 1BL8A 1E79G 2OCCC 2YEVA 4WFHA 3G6EV 2MK3A 1K5QA 2BOCC 2XAJA 2JEUA 3AG1C 4MT8A 4WFAV 1NKDA 3GWOA 1KD1W 2WAMA 1K7DA 2LFRA 1THZA 1YTFB 1DTOA 2XAFA 1CP9A 3HB3B 1V55B 3M99B 4KP4A 2HJFC 1OCZC 5EBMC 5CN0A 5E1AC 3ZIAG 1NH2D 2BOBC 4PA6A 3T1CA 3AG4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT5 A;  4FIP C;  1Y4M A;  3CYO A;  3K9A A;  5KA6 A;  1JPX A;  3CP1 A;  1MOF A;  1EBO A;  1QCE A;  1K33 A;  5HFL A;  3MHH C;  1DLB A;  2LP7 A;  4JGS A;  4JF3 A;  1Y66 A;  3MHS C;  1ENV A;  2M7W A;  4FK5 C;  3H01 A;  1QR8 A;  5CMU A;  4N23 A;  3WFV A;  2MK3 A;  5H9C A;  2EBO A;  2EZO A;  3B77 A;  2X7R B;  3GWO A;  4N21 A;  1DF5 A;  5KA5 A;  4JPR A;  1I5X A;  3P30 A;  4E2L A;  3B8M A;  1MG1 A;  1JQ0 A;  1QR9 A;  3M99 B;  1QBZ A;  4FJC C;  1K34 A;  1I5Y A;  1F23 A;  2P6J A;  3B8N A;  5CN0 A;  4G2K A;  1SZT A;  2EZP A;  1DF4 A;  5HFM A; 
#chains in the Genus database with same CATH topology
 2AZ0 A;  3QVN A;  2CGN A;  3H1J H;  4QNH B;  2ZM6 B;  4X66 B;  4JI0 O;  2ITC C;  3MD0 A;  1IBM O;  1GKF A;  2ODM A;  3J80 N;  3L75 H;  2Q7E A;  3ZN0 A;  5LP6 A;  1R3L C;  2UXD O;  5CBG A;  2QR4 A;  1Z5W A;  4LFC B;  2JGU A;  2BTO A;  4B08 A;  1AI6 A;  3VOU A;  5JWP A;  1OCC B;  1M9N A;  2DQ0 A;  3EVK A;  1NZ6 A;  5EK0 A;  1FPO A;  1TA8 A;  3R66 A;  1XDC A;  3BA8 A;  3T1H O;  4UCR A;  5H6R A;  4H37 A;  2Q7H A;  2LGQ A;  1WLE A;  2EJ7 A;  3JAL B;  3APO A;  3E8B A;  2R9R B;  2HHH B;  1HNW B;  1S5H C;  1TUB A;  3HKE A;  2CH7 A;  4P2Z A;  3CP1 A;  4AIL C;  4NXN B;  4GX1 A;  3VQV A;  3KKY A;  4X9Q A;  2WWW A;  3D36 A;  4JYY A;  4GKJ B;  1YJ9 V;  3RVZ A;  5IYZ B;  5LA6 B;  3SR2 C;  1S76 D;  1GM9 A;  2FKX A;  2OTJ V;  1XL6 A;  1OZ0 A;  2EIK C;  2GBO A;  5EC2 C;  3IC9 A;  3HKD A;  2HVJ C;  1RSO B;  5KHK A;  1KKD A;  4GKK B;  1TVK A;  5IYD O;  4O2A B;  1Y66 A;  2AZ2 A;  2UXX A;  2JGD B;  2A79 B;  5A2Q N;  2CTP A;  2Y69 C;  1F51 A;  1NT2 B;  4HAM A;  4UV8 A;  2LW7 A;  4X66 O;  3J7A U;  2PF4 E;  5LOV A;  3ZHR A;  1QVG U;  1H2G A;  4KL1 A;  3JAT B;  4X65 O;  1JFF A;  4GT1 A;  3RWR D;  2CTQ A;  5KHJ A;  1EFR G;  4O4L A;  2PYL A;  3FYE B;  4QE7 A;  2DYS C;  4CH6 A;  4MS2 A;  1K8A W;  4X1K B;  1R3J C;  4LNU A;  1O9G A;  3ABU A;  2UXB O;  5KX5 A;  1QLE C;  2CAZ C;  2ZE5 A;  4J41 A;  2LGW A;  2FML A;  4DK0 A;  2JJ2 G;  1VQ8 V;  5AG2 A;  4FLY A;  1NH2 B;  3SPI A;  4C7U A;  1HNW O;  1K4D C;  4CBC A;  3N2K A;  5IJ0 A;  5KUM A;  1S0V A;  2HLD G;  1HNX B;  3M8A A;  2JS3 A;  4DO2 A;  1PL4 A;  5CA1 A;  4TWK A;  3AG3 C;  1M57 B;  3EHB B;  4JYB A;  1S5J A;  3ZBH A;  3SJB C;  1MZE A;  5H9C A;  2XHB A;  1GAX A;  4KHP B;  5DN6 G;  4TUY A;  1WPX A;  4EKW A;  2YXL A;  3B8N A;  5B1A B;  3B09 A;  4DV6 O;  3E83 A;  4I55 B;  4DV1 B;  5C8Y A;  1ZLZ A;  3NXS A;  4JI7 O;  1XNQ O;  1JJO A;  5CMU A;  4JI2 B;  1AI7 A;  2GHY A;  4CZZ A;  3JAW A;  1SQQ H;  2YC0 A;  1QHT A;  2DE0 X;  3CD6 V;  3JSN A;  2ZNJ A;  1IBK B;  5JQG A;  3K79 A;  2GUZ B;  3G67 A;  4XBF A;  3ZMT A;  2JVD A;  1FFX A;  1S72 V;  5JH7 B;  1BQ0 A;  3BAB A;  4X20 A;  2W6J G;  4DR3 B;  3ABL C;  1JQ0 A;  1KU9 A;  2H8P C;  2X0L A;  4PHZ A;  4X62 B;  5EIB C;  5FPR A;  3DC5 A;  1M1K W;  3KCX A;  3ASO C;  1Q43 A;  3SPH A;  2WLM A;  3THO A;  1R3K C;  4O2B B;  3B77 A;  4FLW A;  4JPR A;  2E76 B;  1VMG A;  1ZWI C;  1K73 W;  4WCE V;  1PNK A;  3D3Q A;  2Q67 A;  2CK3 G;  4O4I B;  4OPA A;  4P9P A;  1Y67 A;  1FXV A;  1NTZ H;  2QM8 A;  4RUE A;  3C3T A;  3W7X A;  1BHB A;  3HKC B;  2GSM B;  2P90 A;  5JJE B;  4U3J A;  1XMQ O;  3OEE G;  2RN9 A;  1IXM A;  5CA0 A;  4FZ0 A;  4JI4 B;  5LMN O;  2ADP A;  1V54 C;  4DV5 O;  2PY5 A;  1D5N A;  3STL C;  5LYJ B;  3UO3 A;  3Q4H A;  3W7W A;  3K58 A;  3MHS C;  5IWA B;  4UVB A;  1AB3 A;  3SYO A;  5J9P C;  3CJH A;  4DR7 B;  4B3R O;  2XTA A;  4ZOL B;  3AG7 A;  4F6R A;  4PA9 A;  1L8D A;  4GCZ A;  1SER A;  1DK1 A;  3F5W C;  1WP8 A;  4JAS A;  1FXK B;  3IGA C;  3T1Y B;  1B06 A;  3AK1 A;  2EBO A;  3DXR A;  1WPB A;  1SES A;  4H13 B;  1HWY A;  4IGG A;  2EIN B;  4K35 A;  5IY5 B;  3ABK B;  3TK1 A;  2XOK G;  2YEV B;  2AXT Z;  1QNM A;  3G80 A;  2B5U A;  1GRJ A;  4W4K A;  4KFM A;  1I7F A;  1FKA O;  2IJH A;  3AG1 B;  4X64 O;  1OCR C;  1M93 A;  4UCT A;  4LF9 O;  2HJD A;  3T4Z A;  2W0F C;  1WB8 A;  2DYR C;  2RMK B;  2IU3 A;  5JVD B;  4FM0 A;  2QTS A;  3CCQ V;  1Y76 A;  2QTO A;  1RFY A;  1LNQ A;  3OR6 C;  3QO7 A;  5JJN B;  3IC7 A;  3FB8 C;  1BSM A;  3BCC H;  3ZHV A;  1BGY H;  5BMV A;  1Q82 W;  4LP8 A;  1NJI W;  2P5O A;  1VQ6 V;  1TGO A;  2WLL A;  1OJH A;  1VAR A;  3ETD A;  2QA4 V;  3ZN1 A;  1A32 A;  4ZHQ B;  2BSK A;  3K57 A;  4K8Z A;  1G1X B;  4CS3 A;  4FFB B;  4LF7 O;  3LSU A;  1K5Q A;  1Y6X A;  4WFA V;  2Q5Z A;  1JMK C;  1V55 B;  4KP4 A;  5LA6 A;  1Q5O A;  4QGP A;  1XI1 A;  1I08 A;  4DV4 B;  5LL6 Y;  3BFR A;  4LF6 B;  1RSO A;  3UT5 A;  2ZXW C;  2DQ3 A;  2EIM B;  4RUF A;  2EIL C;  3E8G A;  4O4J A;  3L72 H;  2PYJ A;  2GTS A;  5ITZ A;  1GO3 F;  2DOS A;  3TXQ A;  2Y0I A;  4WFE A;  2QE7 G;  4JAU A;  4DYL A;  3ZHU A;  5K1X A;  2Y48 A;  2HG5 C;  3CRQ A;  2ZDI C;  1P4R A;  2IU0 A;  4G28 B;  1I94 B;  2IH1 C;  3JYC A;  2VQF B;  1QVF U;  4ZKI A;  1KB9 F;  3LUT B;  1VQK V;  5IJ9 A;  4MVS A;  2CTR A;  4JYA B;  3B2E E;  3AG4 C;  1XRE A;  2HVK C;  1EZJ A;  3CRC A;  2VWK A;  5B1O A;  5LXT B;  2MW2 B;  3N2G B;  4JI8 B;  3CXH F;  5DEC A;  3LDE A;  4ZI7 A;  4R50 A;  4PA7 A;  2DWE C;  3AG2 B;  1N32 O;  4PD4 F;  4IIJ A;  1H2N A;  4FVM A;  3HKB A;  3OE7 G;  2IJJ A;  2ZQM A;  1DF5 A;  2HKO A;  5L3D A;  4GX2 A;  4CS4 A;  4MVM A;  1BE3 H;  1CPY A;  4CH4 A;  1PKX A;  4K0K O;  4GZR B;  1OCC C;  1VQP V;  5CB4 B;  2GDS A;  4DRX A;  3OGC C;  1BS3 A;  1Y74 A;  2F1M A;  3U11 A;  4OPH A;  2X6A A;  1QU7 A;  4MTX A;  1SQB H;  4HNA A;  3DGE A;  1MA1 A;  2ZXW B;  1E1R G;  1HW7 A;  4DV4 O;  2RQ6 A;  2EIL B;  2OIE A;  1AR1 B;  4LF6 O;  2RCV A;  1F23 A;  4O4H B;  2Y4U A;  2WLK A;  1R6T A;  2Y0P A;  1N34 O;  5KUK A;  4I55 A;  1GTO A;  2YXY A;  4Z1M G;  3PN1 A;  3OUS A;  3ETE A;  2R72 A;  1XQ8 A;  5EYP A;  2YS8 A;  1US6 A;  2HP8 A;  3TGU H;  2KG7 B;  3GB7 C;  3RYC A;  1N0N A;  1DF4 A;  2VQF O;  1XMO O;  1HNZ O;  3ZMZ A;  3K9A A;  1AIL A;  3QO8 A;  1VQO V;  2UXC B;  4R7C A;  4LCU C;  1TUE B;  1NR1 A;  3SPC A;  1PM9 A;  1K92 A;  3SJA C;  4PA4 A;  4JI5 O;  4GX5 A;  3OW2 U;  1FJG B;  4J42 A;  4EFB A;  2ZR2 A;  5K1P A;  2JDI G;  1U97 A;  1JVM A;  3LNN A;  2B1I A;  1P7B A;  3SGI A;  1SQG A;  4TV8 B;  3LDC A;  4MTG A;  3ABM B;  1PNM A;  3K3W A;  3SDL A;  2X6B A;  4I4T A;  2FL4 A;  2AHY A;  4FLV A;  1YVW A;  1VP7 A;  2RDC A;  4B3M O;  1H2K A;  4OX9 B;  4MSW C;  4DR1 B;  2F95 B;  4YHH O;  4NXM B;  4N21 A;  1ZL8 A;  4UVA A;  1YDX A;  2YDE A;  3UKM A;  3P30 A;  3H1K H;  4J80 A;  2Q6A A;  2IW5 A;  2Q73 A;  2V7Q G;  2EIJ B;  2NN4 A;  1XHZ A;  4YJ3 B;  1XNR B;  5LMU B;  1MOF A;  2G38 A;  4J7J A;  2DWD C;  1Q8I A;  3CWB H;  4TQD A;  1W0J G;  3CCM V;  2YIB D;  3U10 A;  1YJN V;  1H38 A;  4UVC A;  3L73 H;  3AK3 A;  1VQ9 V;  3ZRS A;  3E8H A;  1M57 C;  4JI1 O;  3X2Q B;  4A5U B;  5LYJ A;  4AQY O;  4FLT A;  1XHX A;  1YJW V;  4X1I B;  4KUM A;  2QWQ B;  3ZRW B;  4GYC B;  4I7Z B;  4JTD B;  5B1A C;  1YIJ V;  1K9M W;  2ZM6 O;  2UUA B;  4BW5 A;  1XIL A;  1VQ5 V;  1FAF A;  4G2K A;  4PDR A;  1OV9 A;  1J95 A;  2EX3 A;  3OUF A;  3CCE V;  1K3E A;  1Q6U A;  5FLX N;  5FPO A;  1N33 B;  2Q7G A;  2HEP A;  4WBN A;  4LFC O;  3JCU Z;  2BCC H;  4QE9 A;  2EZO A;  1F4N A;  5LGT A;  1M5I A;  2JK5 C;  4P30 A;  3TET A;  4B3S B;  4DUY B;  3E86 A;  5D5Q A;  1VQL V;  3VQW A;  4BIO A;  1IXB A;  1Y4M A;  2ZNI A;  4NXM O;  1RPO A;  1VF6 C;  5GTH Z;  3C90 A;  2FB5 A;  2HHH O;  3CC4 V;  4DV0 B;  2IM9 A;  4DR2 B;  5GON A;  4H0L B;  4FM1 A;  2Q8V A;  3CB2 A;  4NXN O;  2Z5U A;  2N74 A;  3JAS A;  3P3P A;  3JAK A;  4GKJ O;  1PNL A;  1XEQ A;  5EC1 C;  5C93 A;  1VF5 B;  1VQN V;  1N36 B;  2V1D A;  1KBH A;  2A7W A;  3B4S A;  3IFX A;  4GKK O;  4LF8 B;  5BR8 B;  4LF4 B;  4YJ2 B;  4X1Y A;  4I5S A;  2BTQ A;  4IYI A;  3CYO A;  3STZ C;  3WG7 B;  3MHH C;  2JS5 A;  4B3T B;  4JF3 A;  4OGQ B;  4JI3 B;  4RQE A;  5KAI Z;  5B1B B;  4XDJ A;  1MG1 A;  4DR6 B;  2UUC B;  3ZMV A;  4EEQ A;  3BEH A;  3OMN B;  4JI6 B;  4TV9 A;  4IYH A;  3BPZ A;  2Q68 A;  2IJI A;  4DUZ B;  4FFK A;  1QR8 A;  3SPG A;  4IT5 A;  4B3S O;  1SA0 A;  1SRY A;  1WA8 B;  2IBZ H;  1FS0 G;  3E22 B;  2WPD G;  3NR7 A;  4I0X B;  1VQM V;  2UU9 B;  4FJC C;  3HPL C;  5IE9 A;  4AHC A;  1PD3 A;  1H8E G;  1FXK C;  2L6L A;  3CXC U;  4DV0 O;  1JX9 A;  1N4C A;  2Q69 A;  3ETQ A;  2RNB A;  3SYQ A;  5EBW C;  4CC5 A;  5LP6 B;  5LHG A;  3LSS A;  5IYB O;  4IHJ A;  1HNX O;  4UCU A;  1G4Y B;  1W2B U;  3B8M A;  3DC6 A;  4H44 B;  4PDV A;  4DK1 A;  1UJW B;  2WLI B;  1PL0 A;  2F4V B;  2EIN C;  5IY5 C;  2VWJ A;  3OTO B;  3ABK C;  2VRZ A;  4DR4 B;  4KHP O;  1GM7 A;  5LXT A;  2F66 C;  3ZMS A;  1E1Q G;  3RYF A;  3UCS C;  2CDY A;  2ITD C;  2P4V A;  1SF9 A;  1BL8 A;  4WFH A;  3K9S A;  3G6E V;  2VQE B;  2BOC C;  2XAJ A;  3AG1 C;  1VEW A;  1NKD A;  4DV1 O;  2LFR A;  4NYK A;  2E75 B;  5A9G A;  5EZY A;  4LFA B;  3HB3 B;  3M99 B;  1TUB B;  2HJF C;  3HKE B;  2CH7 B;  3ZIA G;  5CN0 A;  2ZCE A;  2BOB C;  2PI5 A;  4ICG A;  4EB6 A;  4JI2 O;  3I56 V;  5KMG A;  1JR9 A;  4JZ2 A;  1I0H A;  4UCO A;  3VQY A;  3I55 V;  4JV5 B;  4OXS A;  2ZD9 A;  3CC7 V;  1IBK O;  3ICX A;  3RYI A;  1YZB A;  2OIG A;  5KHH A;  1JJ2 U;  4J9Y B;  3BY6 A;  1XUQ A;  2QKC A;  1YSC A;  3K5N A;  3HKD B;  2YIA A;  1SQF A;  2P7T C;  1HR0 B;  1CEZ A;  4DV7 B;  1TVK B;  2OTL V;  4DXW A;  1ORQ C;  3RBZ A;  5KA6 A;  4IL6 Z;  4DR3 O;  5J2T B;  1L1F A;  4LF5 B;  3OGI B;  2QDO A;  1KP2 A;  2ZDI A;  4YY3 B;  1V55 C;  3W7S A;  2DJV A;  5LOV B;  4X62 O;  1IX9 A;  5E79 Z;  3E35 A;  1L0L H;  1JFF B;  3R65 A;  1AR5 A;  4NTW A;  1NVP D;  2KKW A;  1R3I C;  4BWA A;  3UQ8 A;  1GM8 A;  4O4L B;  1RPR A;  2CGO A;  5CA3 A;  3D3I A;  3PJS K;  2EIM C;  5J2U A;  3MDS A;  1GN4 A;  2LP7 A;  4LNU B;  4U7O A;  3ETG A;  1H8H G;  3OEH G;  1BT8 A;  5DM6 V;  2EJR A;  1BMF G;  5KX5 B;  4UCS A;  1J5E B;  2H94 A;  4FPP A;  5H6Q A;  3ML0 A;  2ZE8 A;  4L8J A;  2XAH A;  4Z2W A;  3U0Z A;  1YEW A;  1AVM A;  4TV8 A;  2F93 B;  4PV1 B;  2YI9 A;  4TSF G;  4X8A A;  4FLX A;  1MNG A;  3FKS G;  4UB8 Z;  4JI4 O;  1B04 A;  1EN6 A;  3JD2 A;  3JAM N;  3N2K B;  4BIU A;  3LDD A;  3CCU V;  5IJ0 B;  1YIT V;  4UCV A;  2XAS A;  5BY1 A;  3G71 V;  3QF7 A;  2L35 A;  2QM4 A;  5CA1 B;  1SZT A;  4JV5 O;  5IWA O;  2YXH A;  3JAL A;  2CTW A;  1N0J A;  3WB1 A;  1KEC A;  3AG2 C;  1KKC A;  1W59 A;  3FX7 A;  3FYI B;  4CH5 A;  4DR7 O;  4ABM A;  2UXN A;  4J11 A;  3DSQ A;  2GV9 A;  1G6U A;  3RVY A;  1NU1 H;  5IYZ A;  4CS2 A;  2QEX V;  2EZP A;  2R70 A;  4LF5 O;  3T1Y O;  4JAA A;  1BHA A;  4TOI A;  4JZG A;  3ZRV A;  2QWN B;  3RFR A;  2IJK A;  1N8R W;  2N05 A;  3JAW B;  2WA4 A;  3JD1 A;  4O2A A;  2YID A;  2JEX A;  3ZRW A;  2JGD A;  3WU2 Z;  5JQG B;  2UUB B;  1YF2 A;  4NVP A;  5H2F Z;  3FB5 C;  1I5Y A;  1RP3 B;  4CH3 A;  1H2M A;  3BHP A;  1EN4 A;  3BRC A;  5DED A;  1FFX B;  3JAT A;  1ZX3 A;  4NTX A;  2WLJ A;  4FM2 A;  4X20 B;  2P06 A;  1GN6 A;  1OCO B;  5KAF Z;  2Q0A A;  2XAG A;  1KMI Z;  1RM1 B;  3ZJZ A;  4GLX A;  2Q0O C;  4B7K A;  2PI4 A;  4X1K A;  3M7M X;  2NLJ C;  2ZR3 A;  1F7Y A;  3OT7 A;  4D6T H;  2KB1 A;  2LFS A;  4JTC B;  1WP7 A;  1JPX A;  3WB2 A;  3ZHS A;  3ABT A;  3AEI A;  1NVP B;  1SQX H;  5LHH A;  3FB7 C;  4N23 A;  4PEL A;  1KQS U;  4JI0 B;  2X7R B;  3SJC C;  1CXZ B;  1AI5 A;  1IBM B;  1QQC A;  4J7K A;  3ABM C;  1W0K G;  1YCI A;  2WSS G;  4MVQ A;  2YUA A;  4H33 A;  4RAI A;  2UXD B;  1Q81 W;  2R9I A;  1EZV H;  4UFZ A;  2DW4 A;  3ZX6 A;  3JD3 A;  3FFQ A;  3OM3 B;  4U3J B;  2PUS A;  4TQF A;  4NB5 A;  5CA0 B;  3L70 H;  4LWS B;  4YIP A;  1WB7 A;  5KA5 A;  2QGN A;  2EIJ C;  3N27 A;  1T5E A;  3CC2 V;  4LC1 A;  3T1H B;  2D3O W;  3A2F A;  1MZF A;  1L0N H;  2NNU A;  3Q4H B;  2ADQ B;  1BZK A;  1JA8 A;  1EN5 A;  1Q3E A;  5CBH A;  5L3G A;  2XAQ A;  5FNV B;  4MW8 A;  3KG2 A;  4JTA B;  3CJH B;  2GTA A;  3CPW U;  1M56 B;  1GH6 A;  4LFB B;  3SYA A;  1JCH A;  4F6R B;  2OYQ A;  5EBL C;  3FAV B;  4MTO A;  4LH7 A;  3SPJ A;  1I94 O;  3X2Q C;  3CME V;  5CBF A;  4PDM A;  2V4D A;  2GUZ A;  4JYA O;  3OMI B;  3H01 A;  3DXR B;  1F4M A;  1QLN A;  1X4T A;  1WA8 A;  2ZIO A;  1VF6 A;  2ZE6 A;  5JH7 A;  3S3X A;  4JI8 O;  2ZKO A;  2LO1 A;  3KCY A;  3L9D A;  3I5D A;  3G4S V;  3CS5 A;  3FD9 A;  3EFF K;  4R6Z A;  4JGS A;  3K0G A;  3G6B A;  5L3C A;  2QWP B;  1S5L Z;  5B5E Z;  4TT3 G;  4X65 B;  2QWR B;  3KZI Z;  3UM7 A;  1X59 A;  1MSD A;  4O2B A;  1WNS A;  2W6I G;  2LW1 A;  1Y76 B;  2WLI A;  2UXB B;  4WFF A;  3OFN G;  1R1B A;  4J10 A;  4O4I A;  4B7E A;  2QKS A;  3FB6 C;  5LGN A;  3E8F A;  4BIZ A;  5BMV B;  1MMM A;  3HKC A;  5B3S B;  2WLL B;  3T2M A;  3ASN B;  3ZHQ A;  4FLU A;  3K03 A;  2Z3Y A;  1PV0 A;  4ZBM A;  2BSK B;  3CRA A;  3GWK C;  3L74 H;  5IDJ A;  4FZ1 A;  4LFB O;  2OCH A;  4HYO A;  1Q86 W;  4RWU A;  4L87 A;  2OCC B;  4PI0 A;  1XL4 A;  3LSQ A;  2UXC O;  4ZOL A;  3UT5 B;  3WG7 C;  1OCZ B;  2F23 A;  2QJ1 A;  1MSW D;  3CX5 F;  3JSL A;  1FJG O;  2HR3 A;  2WLN A;  4DV6 B;  5B1B C;  4GX0 A;  4O4J B;  3E2E A;  3TCU A;  1FXK A;  5IT9 N;  4JI7 B;  2B9Z A;  5FL7 G;  5J2T A;  5ITZ B;  4DW0 A;  3W7U A;  4FMT A;  1NR7 A;  3QNE A;  1XNQ B;  3APQ A;  1QR9 A;  4NR1 A;  2PGG A;  3BVO A;  4MVR A;  4QPJ A;  3RYH B;  4OX9 O;  4DR1 O;  1S77 D;  5H5N A;  2ZE7 A;  3DTU B;  4E4E A;  1GMG A;  3F7V C;  4MVO A;  2M7W A;  1D2D A;  5IJ9 B;  2OWO A;  1E79 G;  2YEV A;  2MK3 A;  1KD1 W;  3C3S A;  3MAQ A;  3GVM A;  3CHX A;  3GWO A;  5D5P A;  3HR0 A;  1ZSP A;  2WAM A;  1K7D A;  1THZ A;  5GTI Z;  1XNR O;  1DTO A;  4PA6 A;  1CP9 A;  4DR5 B;  5LMU O;  5EBM C;  5E1A C;  3RN4 A;  3T1C A;  1YHQ V;  1B3Q A;  4ZI7 B;  5LP6 C;  4P9O A;  3LNM B;  4IIJ B;  5JVD A;  3SYC A;  3HKB B;  3K06 A;  4PDL A;  2JJ1 G;  3H1I H;  3QO5 A;  5LGU A;  1SQV H;  3CMA V;  1AP6 A;  3A0H Z;  2JIZ G;  5JJJ B;  4DRX B;  1URF A;  1NI8 A;  1Y74 B;  4QIW F;  2A3Q A;  3ZHT A;  5HFM A;  2X6C A;  2H3O A;  2EIK B;  4K8X A;  3P32 A;  4HNA B;  1BQZ A;  1G8M A;  4AI8 A;  1VIB A;  4ZHQ A;  4YIO A;  2UUA O;  1P84 F;  4BR6 A;  4FFB A;  5KLV H;  3WB0 A;  2Y69 B;  1QBZ A;  5EIB D;  1ROP A;  2P6J A;  2ILM A;  2Q4P A;  1N33 O;  1XMQ B;  4I50 B;  2PZS A;  3D36 C;  3K0D A;  5LMN B;  4X88 A;  1NTM H;  5IYC O;  2N04 A;  5EYP B;  2R9A A;  4MVU A;  3JCZ A;  4DV5 B;  1P49 A;  2QWO B;  3JD4 A;  2A0L A;  4DUY O;  2DYS B;  2XUM A;  3QTC A;  2KSD A;  3JAR B;  5GW7 A;  1Q7Y W;  3O65 A;  1FD9 A;  3JD0 A;  3RYC B;  1COW G;  4BAY A;  1HDJ A;  1QLE B;  4UB6 Z;  4DV2 B;  4B3R B;  3K5L A;  4DR2 O;  2YI8 A;  1H2S B;  4DR5 O;  2O57 A;  4PJ0 Z;  2ZIM A;  2WA3 A;  2VS0 A;  1LR1 A;  2FTK A;  1GK9 A;  4DW1 A;  4I4T B;  4QJF B;  4Q6G A;  1N36 O;  4X89 A;  4G27 B;  2NR5 A;  1ENV A;  3AG3 B;  3N2G A;  1AI4 A;  5LBQ A;  1ZL8 B;  4LF8 O;  5BR8 O;  4LF4 O;  5B1N A;  5KHG A;  3TJT A;  3T4D A;  4DV3 B;  3D8C A;  4QPK A;  1KC8 W;  1WN7 A;  4B3T O;  1R6N A;  4JI3 O;  1MAB G;  1YI2 V;  3QG5 A;  4X64 B;  5KHI A;  3A8T A;  5CB4 A;  1QCE A;  3CSX A;  1K4C C;  1Q90 D;  4LF9 B;  3CRR A;  3OR7 C;  3W7T A;  4DR6 O;  2UUC O;  4FLZ A;  1FYJ A;  4LWS A;  1JOY A;  4JI6 O;  4XDK A;  4Z1V A;  3O9O A;  2ZIN A;  3B40 A;  2ZT9 B;  4DUZ O;  1IUR A;  4HBN A;  1P7G A;  4O4H A;  3CEI A;  5HFL A;  2Q9L A;  2IH3 C;  4ASU G;  1GN2 A;  3BAA A;  2UU9 O;  5FNV A;  2K1E A;  3ZS8 C;  4DV2 O;  1ZTE A;  1TAE A;  3TXS A;  2QM7 A;  2XT9 A;  4LF7 B;  4PI2 A;  3ABL B;  4LH6 A;  3FAV A;  2KG7 A;  4WBN B;  1EBO A;  4NKG B;  3K5O A;  3AK2 A;  2P67 A;  2ETN A;  1SQP H;  3WFV A;  4UV9 A;  2KQX A;  2RJZ A;  3CCR V;  2F4V O;  3ASO B;  3K59 A;  3OTO O;  2D2C B;  1B6Q A;  4DR4 O;  3IAY A;  3OMA B;  3UO2 A;  2K9P A;  4W4L A;  5B66 Z;  1SZX A;  4I9W A;  1O9H A;  3F7Y C;  1IVS A;  3H1H H;  1PPJ H;  3ZRX A;  2VQE O;  4MTF A;  3F5T A;  1OCO C;  1RM1 C;  4DV3 O;  1ARO P;  4LFA O;  4U7N A;  2BE3 A;  5GON B;  1WJZ A;  2CE4 A;  4XDL A;  4D7T A;  1IBL B;  5L3B A;  2AHZ A;  2W0X A;  1SC5 B;  3JAS B;  3JAK B;  4F4L A;  3L71 H;  2P22 C;  4RQF A;  1Z5V A;  3A0R A;  1Q6I A;  4FIP C;  4MVZ A;  1V54 B;  2CUG A;  1DLB A;  4YJ3 A;  1XOU A;  3A0B Z;  2Y4T A;  3OTF A;  1NBM G;  3RT3 C;  5L3F A;  3CCL V;  1UPG A;  4TUY B;  1XBL A;  4YXW G;  1KP3 A;  3RGB A;  2E3C A;  4BW9 A;  2JRI A;  4DV7 O;  1HR0 O;  1I5X A;  5JCO A;  2LQT A;  1ZAU A;  4X1Y B;  1N32 B;  1K97 A;  2A9H A;  2BTQ B;  5C8Y B;  1S3J A;  1AP5 A;  1BCC H;  1OHH G;  1R73 A;  4D7S A;  1LUV A;  3OD4 A;  3ZMU A;  2DN9 A;  4YY3 O;  3SJQ C;  3CCV V;  4K0K B;  1YTF D;  1HP8 A;  1NQT A;  2HFE C;  4WF9 V;  4CC6 A;  1SKV A;  4X1I A;  1PP9 H;  3CRM A;  1AJN A;  2YSU B;  2YIC A;  1GN3 A;  3K08 A;  3VBB A;  2EUL A;  3VQX A;  2A06 H;  4MW3 A;  2OT5 A;  4TV9 B;  1Q6H A;  2M6Y A;  1NS1 A;  3SYP A;  1J5E O;  4UXN A;  1SA0 B;  2F43 G;  1NTK H;  1N34 B;  1H2L A;  1M56 C;  1IZ3 A;  1V9P A;  1UFI A;  1Z2G A;  1AJQ A;  2E5L B;  2E74 B;  1K34 A;  1KYO F;  4K3A A;  1AJP A;  1OCR B;  4J9Z B;  1D5A A;  4HZ3 A;  4Q20 A;  3RYH A;  2DYR B;  1IBL O;  1FXH A;  3E89 A;  4IHJ B;  1VQ7 V;  3ZCC A;  1XMO B;  1HNZ B;  4I9Q A;  3IJ4 A;  2ATK C;  1IDS A;  1VQ4 V;  4E2L A;  2XND G;  1AR4 A;  4R8C A;  3OAA G;  1YXB A;  2WLH A;  3BA9 A;  2AW9 A;  4JI5 B;  4JAV A;  5TIS Z;  3K04 A;  2DMX A;  3RYF B;  1K33 A;  1K5S A;  3CCS V;  3EXA A;  3RW0 A;  4PA3 A;  2B1G A;  4FK5 C;  5F2V O;  1EM1 A;  1KUQ A;  4UUJ C;  2Z0A A;  5LHI A;  5EZY B;  1DGS A;  4NTY A;  2P4K A;  1WAZ A;  4F6E A;  4B3M B;  1SS3 A;  2PTM A;  4EB6 B;  3J81 N;  1SET A;  4U3F H;  5KMG B;  4YHH B;  2AGA A;  5BZB A;  4RO2 A;  3H9V A;  4YJ2 A;  1VF7 A;  2C2A A;  4GUN A;  4LBE C;  3RYI B;  1ZUQ A;  1U96 A;  5JCO C;  2FYU H;  2UUB O;  4JYC A;  5B3S C;  4WFG A;  3CCJ V;  3K5M A;  3ASN C;  3S3W A;  4LR3 A;  5L3E A;  2QKA A;  1R6K A;  4KXR A;  1M4U A;  3P3N A;  1FFT B;  3ZED A;  4EFE A;  4I50 A;  4ZIB A;  3CE2 A;  2LJ2 A;  2E5L O;  1M90 W;  2QSA A;  2YIB A;  1LUW A;  4WFB V;  4JI1 B;  3H1L H;  2OCC C;  5BXZ A;  4MT8 A;  2JEU A;  4J7Z A;  4AQY B;  1YTF B;  2XAF A;  3E22 A;  3JAR A;  1OCZ C;  1NH2 D;  4I0X A;  5J2U B;  2ARH A;  3AG4 B; 
#chains in the Genus database with same CATH homology
 1YHQ V;  3I56 V;  4QNH B;  4P9O A;  2ITC C;  3LNM B;  2ZXW C;  3MD0 A;  2DQ3 A;  3SYC A;  1GKF A;  3I55 V;  2EIM B;  4RUF A;  4OXS A;  2ZD9 A;  3K06 A;  2EIL C;  3CC7 V;  4PDL A;  3ZN0 A;  3E8G A;  2JJ1 G;  3QO5 A;  5LGU A;  1R3L C;  1JJ2 U;  4J9Y B;  3CMA V;  3BY6 A;  5CBG A;  1YSC A;  2PI5 A;  2JIZ G;  1GO3 F;  2P7T C;  4QIW F;  1CEZ A;  5HFM A;  4WFE A;  2OTL V;  4DXW A;  1ORQ C;  1AI6 A;  2QE7 G;  3RBZ A;  4JAU A;  3VOU A;  2X6C A;  2Y48 A;  2HG5 C;  5KA6 A;  2EIK B;  1OCC B;  1P4R A;  2ZDI C;  1M9N A;  2DQ0 A;  2IU0 A;  3P32 A;  5EK0 A;  4G28 B;  2IH1 C;  1G8M A;  3JYC A;  1QVF U;  1L1F A;  4ZKI A;  1KP2 A;  3LUT B;  2ZDI A;  5H6R A;  1VQK V;  1V55 C;  4MVS A;  3W7S A;  4H37 A;  1WLE A;  3AG4 C;  3E35 A;  2Y69 B;  1QBZ A;  1ROP A;  2P6J A;  3E8B A;  2R9R B;  3R65 A;  2HVK C;  1NVP D;  1R3I C;  1GM8 A;  1EZJ A;  1RPR A;  1S5H C;  3K0D A;  5CA3 A;  3D3I A;  3PJS K;  2EIM C;  4P2Z A;  5B1O A;  4X88 A;  3CP1 A;  5IYC O;  4GX1 A;  2LP7 A;  3LDE A;  4R50 A;  4U7O A;  3ETG A;  4PA7 A;  1H8H G;  2DWE C;  2WWW A;  3AG2 B;  3D36 A;  3OEH G;  3JCZ A;  4MVU A;  5DM6 V;  2EJR A;  1BMF G;  3JD4 A;  1YJ9 V;  3RVZ A;  3OE7 G;  2A0L A;  2DYS B;  2H94 A;  2IJJ A;  2ZQM A;  1DF5 A;  4FPP A;  5GW7 A;  1Q7Y W;  2HKO A;  5H6Q A;  5L3D A;  3ML0 A;  4GX2 A;  3JD0 A;  4MVM A;  1GM9 A;  1COW G;  1CPY A;  1S76 D;  4BAY A;  2OTJ V;  2XAH A;  1XL6 A;  1OZ0 A;  1PKX A;  2EIK C;  1OCC C;  1VQP V;  5EC2 C;  1QLE B;  2HVJ C;  3OGC C;  1KKD A;  4TSF G;  4X8A A;  3FKS G;  5IYD O;  2X6A A;  1Y66 A;  3JD2 A;  4MTX A;  2UXX A;  4BIU A;  3LDD A;  3CCU V;  3DGE A;  2A79 B;  2ZXW B;  1E1R G;  1YIT V;  2Y69 C;  1F51 A;  2XAS A;  2EIL B;  4HAM A;  4UV8 A;  1AR1 B;  3G71 V;  2FTK A;  1GK9 A;  1F23 A;  1QVG U;  1H2G A;  1SZT A;  2WLK A;  4QJF B;  5KUK A;  4GT1 A;  1GTO A;  1KEC A;  1EFR G;  4Z1M G;  3AG2 C;  4X89 A;  3FYE B;  4G27 B;  3FYI B;  3OUS A;  4QE7 A;  1ENV A;  2DYS C;  3AG3 B;  3ETE A;  4MS2 A;  1K8A W;  1AI4 A;  2UXN A;  5LBQ A;  1R3J C;  5B1N A;  3ABU A;  3T4D A;  3RVY A;  1QLE C;  4QPK A;  1KC8 W;  3GB7 C;  2QEX V;  2EZP A;  1DF4 A;  1R6N A;  1MAB G;  1YI2 V;  3ZMZ A;  1BHA A;  3K9A A;  3ZRV A;  2JJ2 G;  1QCE A;  1VQ8 V;  1K4C C;  2IJK A;  3QO8 A;  1N8R W;  1VQO V;  1NH2 B;  4R7C A;  4LCU C;  1TUE B;  3OR7 C;  3W7T A;  1NR1 A;  3SPI A;  3SPC A;  1K92 A;  3JD1 A;  4PA4 A;  1K4D C;  4CBC A;  2JEX A;  4GX5 A;  3ZRW A;  3OW2 U;  2ZR2 A;  1JOY A;  2JDI G;  4XDK A;  1JVM A;  2B1I A;  1P7B A;  3FB5 C;  1I5Y A;  5KUM A;  1S0V A;  3LDC A;  2HLD G;  4MTG A;  3ABM B;  1PNM A;  3K3W A;  4DO2 A;  2X6B A;  2AHY A;  4TWK A;  3AG3 C;  5HFL A;  1M57 B;  3EHB B;  2WLJ A;  4JYB A;  2IH3 C;  4MSW C;  4ASU G;  1OCO B;  2XAG A;  1RM1 B;  5H9C A;  3ZJZ A;  4N21 A;  2PI4 A;  4UVA A;  3UKM A;  2K1E A;  5DN6 G;  3P30 A;  2NLJ C;  1WPX A;  2ZR3 A;  2QM7 A;  4EKW A;  3B8N A;  5B1A B;  3ABL B;  2Q6A A;  2IW5 A;  2V7Q G;  2EIJ B;  3E83 A;  2KB1 A;  2LFS A;  3NXS A;  4JTC B;  1JPX A;  1MOF A;  1EBO A;  3ABT A;  3AEI A;  2P67 A;  1NVP B;  5CMU A;  5LHH A;  1AI7 A;  2DWD C;  3FB7 C;  4N23 A;  3WFV A;  4UV9 A;  4PEL A;  1KQS U;  3CCR V;  2GHY A;  4CZZ A;  3ASO B;  2X7R B;  1AI5 A;  1W0J G;  3CCM V;  3CD6 V;  3ABM C;  1W0K G;  1YJN V;  1B6Q A;  1H38 A;  2WSS G;  4UVC A;  4MVQ A;  3OMA B;  1VQ9 V;  3ZRS A;  4I9W A;  3E8H A;  3F7Y C;  3K79 A;  4H33 A;  4RAI A;  1M57 C;  1Q81 W;  2R9I A;  3X2Q B;  4XBF A;  2DW4 A;  3ZRX A;  3ZMT A;  4MTF A;  1OCO C;  3JD3 A;  3OM3 B;  1RM1 C;  1ARO P;  4U7N A;  1S72 V;  1YJW V;  4KUM A;  3ZRW B;  4XDL A;  2W6J G;  4JTD B;  5KA5 A;  5B1A C;  5L3B A;  1YIJ V;  2AHZ A;  3ABL C;  1JQ0 A;  1K9M W;  2EIJ C;  4F4L A;  3CC2 V;  2H8P C;  4LC1 A;  4BW5 A;  1VQ5 V;  2D3O W;  2X0L A;  4G2K A;  4PDR A;  4RQF A;  3A0R A;  2NNU A;  1J95 A;  4FIP C;  4MVZ A;  3OUF A;  1V54 B;  3CCE V;  5CBH A;  1K3E A;  1DLB A;  5L3G A;  1M1K W;  2XAQ A;  3ASO C;  4MW8 A;  1NBM G;  5L3F A;  3KG2 A;  3CCL V;  3SPH A;  4JTA B;  2WLM A;  1R3K C;  4QE9 A;  2EZO A;  3B77 A;  1F4N A;  4YXW G;  1KP3 A;  3CPW U;  1M56 B;  4JPR A;  1I5X A;  3SYA A;  1JCH A;  1ZWI C;  5LGT A;  5EBL C;  1K97 A;  2A9H A;  4MTO A;  2JK5 C;  1K73 W;  3SPJ A;  4P30 A;  3TET A;  4WCE V;  3X2Q C;  1S3J A;  3E86 A;  1PNK A;  1R73 A;  1OHH G;  3CME V;  1VQL V;  2Q67 A;  1Y4M A;  5CBF A;  2CK3 G;  4P9P A;  3ZMU A;  1RPO A;  1FXV A;  3SJQ C;  2QM8 A;  4PDM A;  3CCV V;  4RUE A;  1YTF D;  3W7X A;  3OMI B;  3H01 A;  1BHB A;  1NQT A;  2GSM B;  2HFE C;  1F4M A;  4WF9 V;  2P90 A;  3CC4 V;  1QLN A;  3OEE G;  1IXM A;  1AJN A;  2YSU B;  3K08 A;  3VBB A;  2Z5U A;  1V54 C;  4MW3 A;  2OT5 A;  3STL C;  3G4S V;  1PNL A;  3SYP A;  5EC1 C;  4UXN A;  3W7W A;  5C93 A;  3EFF K;  4R6Z A;  4JGS A;  3K0G A;  2F43 G;  3MHS C;  5L3C A;  4TT3 G;  1M56 C;  4UVB A;  1VQN V;  3UM7 A;  3SYO A;  5J9P C;  2V1D A;  3IFX A;  1AJQ A;  1K34 A;  2W6I G;  1AJP A;  4PA9 A;  1OCR B;  4J9Z B;  2WLI A;  4GCZ A;  1SER A;  4HZ3 A;  4I5S A;  4Q20 A;  3CYO A;  3STZ C;  3F5W C;  2DYR B;  4JAS A;  4WFF A;  3WG7 B;  3MHH C;  3OFN G;  1FXK B;  1FXH A;  3E89 A;  3IGA C;  4JF3 A;  1VQ7 V;  3ZCC A;  2QKS A;  3FB6 C;  4RQE A;  5LGN A;  3E8F A;  5B1B B;  4BIZ A;  2EBO A;  2ATK C;  1VQ4 V;  4XDJ A;  5B3S B;  2WLL B;  2XND G;  4E2L A;  1MG1 A;  3T2M A;  3ASN B;  4R8C A;  3OAA G;  2WLH A;  3K03 A;  2Z3Y A;  4JAV A;  4ZBM A;  1SES A;  3ZMV A;  3K04 A;  1HWY A;  3BEH A;  3OMN B;  2EIN B;  5IDJ A;  5IY5 B;  1K33 A;  1K5S A;  3ABK B;  3CCS V;  3TK1 A;  3RW0 A;  2XOK G;  2YEV B;  4PA3 A;  2Q68 A;  4HYO A;  2B1G A;  4FK5 C;  2IJI A;  1QR8 A;  1Q86 W;  3SPG A;  4UUJ C;  2B5U A;  1SRY A;  5LHI A;  1FS0 G;  2WPD G;  4KFM A;  4L87 A;  2IJH A;  2OCC B;  1XL4 A;  3AG1 B;  3LSQ A;  1OCR C;  1VQM V;  1SET A;  4FJC C;  3HPL C;  1PD3 A;  5BZB A;  4RO2 A;  2W0F C;  3T4Z A;  2DYR C;  1H8E G;  2IU3 A;  3WG7 C;  1OCZ B;  1FXK C;  3CXC U;  3CCQ V;  1MSW D;  2QTO A;  1JX9 A;  2Q69 A;  2C2A A;  5EBW C;  4LBE C;  2HR3 A;  2WLN A;  1LNQ A;  3SYQ A;  5B1B C;  3OR6 C;  4GX0 A;  3QO7 A;  3E2E A;  3IC7 A;  4JYC A;  5LHG A;  3FB8 C;  3LSS A;  1FXK A;  3TCU A;  4WFG A;  5IYB O;  5B3S C;  3CCJ V;  5FL7 G;  3W7U A;  3ASN C;  4FMT A;  1G4Y B;  1NR7 A;  3QNE A;  1W2B U;  5L3E A;  3B8M A;  1Q82 W;  4LP8 A;  1QR9 A;  1NJI W;  4PDV A;  1UJW B;  1R6K A;  2WLI B;  1VQ6 V;  2WLL A;  1PL0 A;  4MVR A;  2EIN C;  3ETD A;  4QPJ A;  5IY5 C;  1S77 D;  2QA4 V;  1FFT B;  3ABK C;  3ZN1 A;  3DTU B;  1GM7 A;  1GMG A;  3F7V C;  1M90 W;  4MVO A;  1E1Q G;  2M7W A;  3ZMS A;  2ITD C;  4WFB V;  1BL8 A;  1E79 G;  2OCC C;  2YEV A;  4WFH A;  3G6E V;  2MK3 A;  1K5Q A;  2BOC C;  2XAJ A;  2JEU A;  3AG1 C;  4MT8 A;  4WFA V;  1NKD A;  3GWO A;  1KD1 W;  2WAM A;  1K7D A;  2LFR A;  1THZ A;  1YTF B;  1DTO A;  2XAF A;  1CP9 A;  3HB3 B;  1V55 B;  3M99 B;  4KP4 A;  2HJF C;  1OCZ C;  5EBM C;  5CN0 A;  5E1A C;  3ZIA G;  1NH2 D;  2BOB C;  4PA6 A;  3T1C A;  3AG4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...