1SZTA

Atomic structure of a thermostable subdomain of hiv-1 gp41
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of a thermostable subdomain of HIV-1 gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
total genus 28
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1sztA00
5KA5A 3WFVA 2EZOA 5HFMA 4N21A 5CMUA 1I5YA 2MK3A 3P30A 3B77A 5KA6A 4N23A 2EBOA 1K34A 2M7WA 4JF3A 4G2KA 1MOFA 1Y66A 3GWOA 3K9AA 2LP7A 3MHHC 1DF5A 1QCEA 1I5XA 4FK5C 3CYOA 2X7RB 3H01A 4E2LA 3M99B 2OT5A 1ENVA 1MG1A 1DLBA 1K33A 1QR9A 5HFLA 3B8NA 1EBOA 2EZPA 2P6JA 3B8MA 4FJCC 1QR8A 1DF4A 1JPXA 4JPRA 1JQ0A 4FIPC 1Y4MA 1F23A 3CP1A 5H9CA 4JGSA 3MHSC 5CN0A 1SZTA 1QBZA
chains in the Genus database with same CATH superfamily
3DGEA 1SQPH 5B1OA 5LMNO 5FPRA 2DYRC 3N2KB 4K3AA 4WFFA 4L87A 3K06A 4UCTA 4PA6A 1KC8W 3E8GA 2XAJA 3VQVA 2P5OA 2HFEC 1BHAA 2JJ1G 1A32A 1FD9A 5LMUO 2VQEO 5A2QN 5CA1A 3SPHA 3ZHVA 3U11A 1N8RW 4DV6O 1QVFU 1P4RA 1N34B 2VWKA 2PYLA 3OUSA 1K4DC 4QIWF 1SQGA 2V1DA 3K04A 4UCOA 2JGUA 2QDOA 2F23A 2YICA 4CS2A 2QWRB 3ABLC 2A3QA 4GX1A 4B7EA 1AILA 2ITDC 3D3QA 1IBMO 1J5EB 4J42A 1HNZB 1R3IC 5B5EZ 3RVYA 5C8YA 4ZBMA 4TQDA 3AEIA 5LBQA 3RVZA 2QSAA 5JVDB 3OT7A 3J81N 1ZSPA 4DR4B 4U3FH 3T4ZA 1F51A 1Q6IA 5LOVB 4JI7B 1OZ0A 1YVWA 4MTXA 4EFBA 3F7YC 1JX9A 3TXQA 2H94A 2EIKC 3I56V 2HP8A 1BQZA 5JJJB 4J80A 1WN7A 4G28B 1Z5VA 4LFBB 2Q9LA 1J95A 4JZ2A 5CMUA 2LQTA 3EVKA 1PL0A 2ZCEA 2ATKC 1J5EO 3K9AA 3RGBA 4LFBO 5CA0A 1M4UA 4LF8B 4NTYA 4YIOA 2UUCO 1H2NA 2Y69C 2Q69A 3STLC 3JD0A 1NTZH 3ASOB 2CTRA 1HR0O 4J10A 2EIJB 4TWKA 2ZR3A 1KB9F 1VF6C 5LXTB 1FJGB 5ITZA 4JI4O 4W4KA 2F43G 2RQ6A 5KMGA 2QJ1A 1XREA 1YITV 5KUMA 1Q3EA 1VEWA 1NTMH 1TUEB 3ZMTA 2Z3YA 4UCRA 1OCZB 1XL4A 1COWG 3ZRSA 3TETA 4ZHQB 4X8AA 4DV6B 1SKVA 3HB3B 5BY1A 5LYJA 3SPIA 4HAMA 4AILC 4QJFB 4KL1A 1EN5A 3T1YO 4FVMA 4O2BA 3E22A 4KXRA 2IBZH 3K0DA 1SQBH 1M1KW 4X65O 2KB1A 3EHBB 3G4SV 1GMGA 1W2BU 2QTSA 2P90A 4FK5C 2RN9A 3HR0A 1HW7A 1GH6A 1WAZA 3O9OA 5D5QA 4LWSB 3K5MA 4F4LA 3B8MA 2HHHO 1QR8A 4H33A 4X62O 1QQCA 5L3EA 2ADQB 2H3OA 2HVKC 4MVRA 5JCOA 1BSMA 2WLLA 4WF9V 2QEXV 1H8EG 3BY6A 1RM1B 1S72V 1B3QA 3RYIB 5EBWC 1TUBA 4LF4O 3ZHUA 3H9VA 2ZE8A 2WLJA 5IWAO 5JCOC 3OEHG 3L70H 4MTOA 4WFAV 4HNAB 2XNDG 2IJIA 4FIPC 3ZCCA 2UUAO 5LA6A 1AR1B 3G71V 3JD3A 1Z5WA 4B3TB 2Y0PA 3ZN1A 4IGGA 1CPYA 2ZNJA 2CUGA 3L71H 2VQEB 1U96A 2AW9A 5KUKA 3JD4A 3APOA 4BIZA 1YJ9V 1THZA 1SQFA 4ZKIA 1EFRG 4UVCA 4FMTA 3BEHA 4DR1B 2JK5C 4X1KA 3SGIA 5IYDO 1SESA 2DMXA 1G4YB 4NXMB 1I7FA 2EZPA 1FJGO 3P32A 2EIKB 3RYCB 5DECA 4I9QA 4KFMA 3FYIB 4DV5B 2W0FC 1MOFA 2M6YA 2YIAA 3HKCA 4Q20A 5JWPA 2OTJV 2VRZA 3LUTB 1KYOF 2DW4A 4WFHA 5IDJA 5EYPA 3RN4A 4MVZA 5CA3A 3EXAA 3G80A 4YJ2A 4A5UB 4X64B 4FLUA 5B66Z 1ZL8A 4K0KB 2D2CB 1Q6UA 2CK3G 2HKOA 4WFEA 3X2QB 4WFGA 2ZQMA 4I55B 4OXSA 2P06A 4FLWA 2CAZC 1AI7A 1JR9A 3F5TA 4WFBV 2F1MA 5KAIZ 3S3XA 1JFFB 4QPKA 4FLZA 3CRRA 1SZXA 3OEEG 3JCZA 1K73W 2BSKB 4IYHA 1G6UA 3LNMB 4JI6O 2EJRA 3AK1A 2Q0AA 4K35A 4PV1B 2IU3A 4LNUB 1CEZA 3L75H 4P2ZA 3ZRWA 5KHGA 4R7CA 4I4TB 4FM1A 5CA1B 3RWRD 1MSWD 1YSCA 4LWSA 3SPJA 3FB5C 2P4KA 3KG2A 1DTOA 2Q8VA 3DC5A 3ZHQA 2KKWA 4GKKO 3QO7A 4PHZA 2DOSA 2EZOA 2KSDA 3AG4C 4DO2A 3CWBH 1YXBA 5IT9N 3M8AA 5GONA 4JV5O 1MZFA 3GVMA 1LR1A 2GBOA 2X0LA 5IJ9A 2LGQA 4HZ3A 3JCUZ 2ARHA 3E86A 1IZ3A 1I5YA 5LP6B 4UXNA 4D6TH 1KP2A 4BIOA 4ABMA 1XMOO 5B1AC 4QE9A 1IBMB 3VQWA 3AG1B 4TQFA 4GZRB 3K3WA 2X6BA 2YIDA 3F5WC 4DV0O 1R6TA 2EILB 3FFQA 5EC1C 5KHHA 3QVNA 3WFVA 1GK9A 4U3JB 3CB2A 2UUBB 3OGCC 1AJNA 4HBNA 1XOUA 2QKSA 3RW0A 1QLNA 5B1BB 4JTAB 3LSQA 4B3MO 3UM7A 1K33A 3K5LA 2B1GA 2B1IA 1M93A 3CS5A 1EM1A 1Y74B 5C93A 2PYJA 4PDMA 4TUYB 3DSQA 4FLXA 1W0KG 2XTAA 3ZRXA 1JOYA 1VARA 3B40A 3ZEDA 1PV0A 4F6RA 5ITZB 1XQ8A 4IL6Z 2KG7B 2P67A 1HNWO 4TV8A 1K3EA 3ASOC 4CC5A 4LFCB 2XHBA 1FXKB 5FNVA 1N32O 4H0LB 1LNQA 2CE4A 4EB6B 1VIBA 2EX3A 2QTOA 2N05A 1AJQA 1B04A 1AI6A 3ETQA 1H2SB 1EN6A 3IGAC 2IU0A 2XUMA 1JVMA 3L73H 4X9QA 3ABMC 2D3OW 1OCZC 4JAAA 4J41A 1F4MA 2LFSA 1VQMV 2YXHA 1GTOA 2OCCB 2HJDA 1F23A 3LDEA 1VQ6V 3E8HA 3UQ8A 3QNEA 5EBLC 2BE3A 4LH7A 4YY3B 4X65B 2AHYA 2EBOA 4GKKB 1TUBB 3ZHSA 4K8ZA 4MVQA 2CGNA 4CS4A 4JTDB 3DC6A 5J2TA 1L0NH 2ZE7A 1HNZO 1V54B 3ZIAG 1JJ2U 4X66B 4Q6GA 4DR1O 5JVDA 4X20A 1MMMA 2CTPA 1GRJA 3JAKB 3MD0A 4MVOA 2E75B 4DRXB 1G1XB 3W7SA 4IYIA 2RMKB 3CHXA 4MVSA 4JF3A 3R65A 5IYZB 3VBBA 1HWYA 5D5PA 1ZWIC 2RNBA 1VQOV 4B3SB 1ZX3A 5B1NA 2FL4A 4DV3O 3SR2C 5BZBA 3A8TA 5BXZA 1GN6A 4LF5O 2ZNIA 4R50A 5BR8O 4IHJB 1I5XA 4MW3A 3AG4B 4DUZO 1YHQV 4LR3A 4PD4F 4Z2WA 4LFAO 4JI0B 2ZE6A 1M57C 3WG7B 4MW8A 4J11A 5B3SC 1XNRO 2GTAA 1ORQC 3J7AU 1WA8B 4N21A 5JH7A 1M56C 3RFRA 1KQSU 4AHCA 1Q6HA 2Q6AA 2UXBB 4O4HB 1V55C 1QCEA 2F66C 2ZKOA 1O9HA 2ADPA 5LP6C 1X59A 4JI5O 1HDJA 4LF6B 1DF4A 2G38A 3RYHA 1FFTB 3OW2U 5B1AB 1S76D 2YSUB 1L8DA 4YJ2B 3FKSG 4AQYB 4JZGA 4LCUC 5TISZ 1NR7A 4FZ1A 1AR4A 3FAVB 2WA4A 2PI5A 2Q4PA 1DK1A 1Y66A 2ZM6O 1JA8A 2IJHA 2PTMA 4O4LA 4KHPB 3BA9A 4DV2O 4I55A 2UXDB 4RAIA 5B1BC 2CTQA 4UCSA 2NR5A 4BIUA 1K5QA 4RQEA 3J80N 1P7BA 4JI2O 2UXXA 4L8JA 3JAWA 4X88A 5LOVA 1VQ5V 2BOCC 3MHHC 5LHGA 3UT5B 4LF6O 3M99B 2UU9O 4FM2A 2YS8A 3KCXA 1FXKA 1MA1A 5FNVB 4ZI7B 2DWDC 3FB7C 3ABLB 1JQ0A 3BAAA 3CXHF 4LNUA 1CP9A 1XEQA 2Q5ZA 2HLDG 1IBLB 1PKXA 1VF5B 4QPJA 4H37A 2Y0IA 2R72A 3BVOA 1BCCH 2ZXWC 1H2LA 2N74A 1M5IA 4OX9B 4C7UA 1GM7A 5GONB 2A7WA 4JI5B 1YTFB 4KP4A 4DUZB 3OTFA 1N36O 2B9ZA 3JALA 3ABMB 2JJ2G 4JI2B 3FD9A 4B3TO 3Q4HB 4O4JB 1YI2V 4LF5B 1IXMA 5LP6A 1NJIW 2DWEC 4X1IA 1XMQB 2WA3A 2QWOB 1N36B 1WPBA 4MT8A 4PDRA 2UUCB 4QGPA 2ZR2A 4UB8Z 5L3DA 4DXWA 3E83A 3A0HZ 4HYOA 5JJNB 2E3CA 5CBFA 2HEPA 2Q7HA 1O9GA 3RYCA 2GUZB 4FM0A 3OM3B 5EIBD 1VQ7V 2Y69B 3ZS8C 3W7XA 2A79B 2Y4TA 1WPXA 1IURA 1NVPD 2BTOA 5KHIA 1SS3A 3JARA 5IY5B 1Q8IA 3R66A 2QM8A 1HP8A 1EZVH 2UXCO 2EIJC 2PZSA 1ZUQA 3ETDA 2OWOA 2R9IA 3D3IA 4JAVA 2FB5A 2FYUH 2FMLA 1NI8A 1IDSA 3SYOA 1JMKC 2ILMA 4MS2A 1P7GA 1R6NA 3HKCB 3F7VC 3QG5A 3W7WA 4YJ3A 2ITCC 3CCEV 2X7RB 3ETGA 1AB3A 1I94B 2ETNA 2DN9A 5LHHA 4LF4B 1SQQH 1QHTA 3H1LH 3VOUA 3JATA 4B7KA 3N2GA 4F6RB 1F4NA 2EILC 4TSFG 5B3SB 1X4TA 4E2LA 4Z1VA 4B3RB 3D36C 4NKGB 1K97A 3LNNA 1Y6XA 2ZDIA 3ZX6A 1V55B 1SQVH 4G27B 2AXTZ 2JIZG 3B09A 5GTIZ 2Q67A 1FAFA 3IC9A 2RCVA 3CRQA 1DGSA 1N33O 4UVAA 1TVKA 4TV8B 1QVGU 4JYBA 1KUQA 2YIBA 3MDSA 4J7KA 2NN4A 3WB1A 4K8XA 1R73A 1HNWB 1GKFA 3BABA 3JSLA 4JI3O 1PM9A 2JS5A 4JYAO 2WSSG 4XDJA 1XMQO 4O4IB 4PI2A 3BPZA 2LFRA 1Q82W 1QLEC 2QE7G 3OMNB 1YJWV 4DR5O 3ABUA 4EEQA 2YC0A 4CH6A 1VQKV 5H5NA 3ZHTA 1VP7A 3TJTA 2E5LB 1SQXH 2W6IG 1LUVA 4GX2A 1PL4A 3SJBC 2IJKA 4D7TA 3OE7G 1SA0A 3SJAC 4DV4B 1N0NA 1YDXA 1N4CA 4PA7A 4LF7O 1IBKB 4UV8A 1YIJV 2LGWA 2WLIA 1QR9A 1FXHA 3GWKC 1AVMA 3K57A 2Q73A 1L0LH 1IBKO 1BZKA 4FFBB 2V4DA 2B5UA 1S5LZ 2RDCA 4N23A 3CEIA 1N34O 1WNSA 1WJZA 1GN3A 1GO3F 3UO2A 1WB7A 3CYOA 3CCUV 1TAEA 5LYJB 4EKWA 3RYFB 3OR7C 2JVDA 1KD1W 1KBHA 1KKCA 4MSWC 4ZIBA 3OTOB 5JH7B 4IHJA 2Z5UA 4JTCB 1JCHA 1K34A 1ZTEA 5KX5A 1E1QG 2PF4E 1L1FA 2HHHB 2UXCB 4FFKA 3A2FA 2AZ0A 2JEXA 4XDLA 2DYRB 3RYHB 4LF8O 2OIGA 4GX0A 1Y74A 4DK0A 4YHHO 1Y76B 4RQFA 2WAMA 1Q43A 3NXSA 2HVJC 2YEVB 3P3NA 4UV9A 3DXRA 4P9PA 4P9OA 2LJ2A 5EC2C 4I0XA 1VQLV 4QE7A 5IYCO 1E79G 4YJ3B 2HJFC 2GSMB 1WP8A 3G6EV 5J9PC 1BMFG 1GM8A 5DM6V 1EN4A 4I7ZB 3HKEB 2MW2B 1ENVA 2A06H 2OYQA 5K1XA 1M56B 3IJ4A 1KU9A 1EBOA 3I55V 4JV5B 4DUYB 3QO8A 1OCOB 3T1CA 1R3JC 2W6JG 3A0RA 4JAUA 4I50B 4MVMA 1IX9A 4DR2B 3STZC 4GCZA 4G2KA 4DUYO 2E76B 1XNQO 3AK3A 3ZMVA 2LW7A 4B3RO 1H38A 4DR6O 5JJEB 5L3CA 2Q7GA 4KHPO 3OUFA 5JQGA 4K0KO 3CMAV 2GTSA 2V7QG 3CJHB 1HR0B 2X6AA 3CCQV 2QR4A 5IJ0B 3JASA 3C3TA 1S77D 3P30A 4DV1O 2EIMC 1UJWB 1OCRB 4DV7O 1MABG 1AI4A 2F4VO 2OT5A 4ZI7A 3K59A 1AROP 4CH3A 2UU9B 4JYYA 4PA3A 3JALB 1FKAO 4MVUA 3Q4HA 4LF7B 4DR2O 3ASNC 3PJSK 3H1HH 4JI8O 2LO1A 1OCCC 3CD6V 4X1IB 2JRIA 3CCSV 3HKBA 4RWUA 5IYZA 5FPOA 1S5HC 4X62B 1PPJH 3KCYA 1NU1H 2GHYA 4B3SO 4NXMO 5AG2A 1QLEB 3OR6C 1Z2GA 3E35A 3K5OA 2E74B 2L6LA 1NBMG 2ZIOA 4DV1B 3ZRVA 1YTFD 4MTGA 3I5DA 3C90A 5CA0B 3ZJZA 4BW5A 1W0JG 2JGDA 2YXLA 1R1BA 4PA9A 3TK1A 2VQFO 3T1YB 5E79Z 2GV9A 4AI8A 3OAAG 4OPHA 1PD3A 2DE0X 3A0BZ 1CXZB 3AG2B 4WBNA 2IJJA 3ABKB 1JFFA 4O4HA 1U97A 1FS0G 4ICGA 1QNMA 4JYCA 4DW0A 4NTWA 1MZEA 1NTKH 1H2MA 2IH3C 4JPRA 3E8BA 3CCRV 5GTHZ 3H1IH 1SRYA 3K79A 4BW9A 1MSDA 4ZHQA 3APQA 2M7WA 5LGUA 1M9NA 3HKDB 5IE9A 4UUJC 3H01A 4JI6B 4CS3A 3UT5A 3WB0A 4DR3B 2F4VB 2EJ7A 1RM1C 1S0VA 3CSXA 2YI9A 4DV5O 3JATB 3N2GB 1YEWA 3NR7A 3ML0A 4ZOLB 1B06A 3JAWB 4GUNA 1XHZA 4UB6Z 2OCCC 3TXSA 4F6EA 1XDCA 1ZLZA 3L74H 1K4CC 2QWNB 1VF7A 3CRMA 2Y48A 3C3SA 3E2EA 1I08A 5IJ9B 1US6A 4O2AB 2DQ0A 1AP6A 4J9YB 2DYSB 1BGYH 2WLLB 5LGNA 1FFXB 1K7DA 4FPPA 4AQYO 1TVKB 3CCVV 1OCOC 2WLMA 4JASA 3GWOA 4UFZA 1NH2D 5EK0A 5LL6Y 2KQXA 2XAGA 3G6BA 2BTQA 4X89A 3CP1A 1R6KA 2LW1A 1VQ9V 3JASB 1FXVA 2ZIMA 5BR8B 5H6QA 4H44B 3CRCA 5K1PA 4YXWG 2CGOA 3G67A 3SDLA 4RO2A 2WLIB 3TGUH 4DR3O 3KKYA 4RUEA 3ZMZA 3RYFA 2EIMB 2ZM6B 1VQNV 4IIJB 2GUZA 2XOKG 2CDYA 3OD4A 4JI8B 2L35A 4PJ0Z 3B77A 4U7NA 3ZHRA 2PI4A 3FB6C 5KX5B 1TGOA 2EULA 4GX5A 2PGGA 1UPGA 3D8CA 2F93B 1XNQB 1XBLA 1VF6A 3H1KH 3QF7A 4QNHB 4TV9A 2EINB 1NS1A 1SZTA 4LP8A 4GT1A 4EB6A 4DV4O 1VQ4V 4I0XB 3T1HB 3X2QC 2VS0A 4JI1B 2R9RB 1SERA 3W7UA 4X1YA 2FKXA 1LUWA 1W59A 4EFEA 4OGQB 3CPWU 1MG1A 3CC2V 4MTFA 1XHXA 3JD1A 5CN0A 5CB4A 1K8AW 4H13B 1I0HA 5KAFZ 4UCVA 5F2VO 1H2KA 5LHIA 5KHKA 1XNRB 1ZL8B 4GKJO 2Y4UA 2LP7A 1DF5A 1Q5OA 1D5AA 2DQ3A 2VQFB 3TCUA 4OPAA 4LF9O 4IT5A 2X6CA 4FZ0A 4PDLA 4JI1O 2QM7A 5HFMA 3U0ZA 3HKDA 3FB8C 4O4JA 3UCSC 3BRCA 1FYJA 1YZBA 2ZD9A 3AG3C 1PNKA 2XAFA 1QU7A 2CTWA 3VQYA 3BFRA 2WLHA 1WB8A 1DLBA 1UFIA 3CC4V 4GLXA 2YI8A 4O4IA 1XUQA 4FJCC 4I50A 1NZ6A 5IJ0A 1R3KC 5GW7A 2F95B 3ABTA 1BE3H 1P84F 1Q7YW 2N04A 4JI0O 4WCEV 2CH7B 4XBFA 3N27A 2Z0AA 1GM9A 1Y4MA 1RP3B 5IYBO 5KLVH 5H9CA 3SYAA 2HR3A 3MHSC 1SA0B 3GB7C 5FL7G 4FFBA 2ZDIC 3T2MA 5LMNB 1WA8A 4DR7O 2HG5C 1NT2B 3IFXA 2DYSC 2JDIG 1Q86W 1N0JA 3CXCU 5LXTA 1S3JA 1OHHG 4PA4A 3ZMUA 1RSOB 1JPXA 3WB2A 3JD2A 4DYLA 1OCRC 3LDCA 4JGSA 3FYEB 3THOA 3K9SA 5KA5A 4X64O 1AI5A 4LH6A 5EIBC 5H2FZ 4NVPA 5BMVB 3S3WA 3N2KA 1M57B 3HPLC 3WG7C 3FAVA 2UXDO 3ASNB 3BA8A 3OMIB 3L9DA 4O4LB 4LFCO 1OCCB 4FLTA 4B3MB 1KECA 3B8NA 1P49A 4TOIA 4O2BB 1KKDA 1NVPB 2C2AA 4FLYA 1Y76A 3PN1A 4DR7B 3DXRB 4DR4O 2P4VA 1D5NA 4YIPA 2Q68A 3OMAB 1H2GA 3W7TA 2O57A 1FXKC 3BHPA 2QGNA 2RJZA 3E22B 1URFA 3CE2A 1I94O 1G8MA 1SF9A 2YXYA 3ZBHA 2YDEA 4NYKA 2WLKA 2XT9A 2P22C 1XMOB 5C8YB 1H8HG 1ROPA 2FTKA 2ZT9B 4U7OA 1SC5B 3MAQA 3JAMN 3K03A 2KG7A 1XL6A 2EINC 4JYAB 4Z1MG 1HNXB 4PI0A 3RT3C 2ODMA 4I9WA 3K5NA 5J2UA 3ABKC 1AP5A 2JEUA 5CB4B 2ZINA 3FX7A 4O2AA 1R3LC 2K1EA 1AR5A 4TT3G 4BR6A 3CJHA 3SYPA 4NB5A 3ZMSA 2QKAA 3RYIA 3LDDA 3VQXA 2P7TC 4DV0B 2WLNA 1XI1A 1M90W 4LFAB 3RBZA 2ZE5A 4J7JA 2NNUA 4HNAA 2IW5A 5HFLA 2ZXWB 2BCCH 2A0LA 1QBZA 2Q7EA 5DEDA 4CH5A 3D36A 3CMEV 5L3BA 4I4TA 1S5JA 1RFYA 3SYQA 4CBCA 5CBGA 2W0XA 1K5SA 3M7MX 3JARB 2WPDG 1OV9A 4RUFA 2OCHA 1WP7A 2BTQB 4BWAA 4DR6B 2VWJA 4JI4B 4X20B 1K9MW 2JS3A 3AG3B 4GYCB 3JAKA 1E1RG 1FFXA 4DRXA 2PY5A 3QO5A 2UUBO 3K0GA 1BL8A 3HKBB 3JSNA 1BS3A 1IBLO 3AG1C 5KHJA 3CCLV 4ASUG 2OTLV 2UUAB 4XDKA 4D7SA 3T4DA 1NR1A 5EZYB 3U10A 4J9ZB 4UVBA 1BHBA 1GN2A 4NXNB 3H1JH 4P30A 4CZZA 4TV9B 1PNLA 4JI7O 1NH2B 2YEVA 1B6QA 2A9HA 2AHZA 1EZJA 3B4SA 3E8FA 1OJHA 4X1YB 2QA4V 1JJOA 3HKEA 5KMGB 4DV7B 2QWQB 4FLVA 4IIJA 4PDVA 4WBNB 1TA8A 5BMVA 1YCIA 5CBHA 2K9PA 3BCCH 3OTOO 3KZIZ 3CCMV 1VQ8V 3IAYA 4J7ZA 4R6ZA 3QTCA 1NKDA 4JI3B 4UCUA 4DV2B 5DN6G 2P6JA 2XAQA 3JYCA 4BAYA 3WU2Z 5JQGB 4GKJB 3SPGA 2YIBD 4DR5B 4I5SA 4YY3O 5LA6B 4DW1A 4B08A 1T5EA 2QM4A 1KMIZ 4DK1A 2Q0OC 4R8CA 3P3PA 1SETA 2BSKA 4DV3B 3SPCA 2GDSA 3ICXA 3UO3A 2IM9A 2R70A 4CC6A 5H6RA 1IXBA 3K58A 5L3GA 2UXBO 3CX5F 4LC1A 4ZOLA 1PNMA 1BQ0A 1RPOA 3ZRWB 3T1HO 1BT8A 1V54C 1Y67A 3SYCA 2AZ2A 1N32B 1PP9H 2QKCA 4LF9B 3CRAA 5J2UB 2E5LO 4X1KB 1Q81W 4PELA 2NLJC 3L72H 1VQPV 2WWWA 4W4LA 2OIEA 1GN4A 2UXNA 1GAXA 1ZAUA 4KUMA 2MK3A 3AG7A 5KA6A 3CCJV 5EBMC 1IVSA 5J2TB 3OFNG 1YJNV 4NXNO 2PUSA 3IC7A 3AK2A 2JGDB 1AJPA 2BOBC 5LMUB 2H8PC 2R9AA 2QWPB 4OX9O 3DTUB 2IH1C 1D2DA 3ZN0A 3SJQC 1KP3A 5IY5C 3EFFK 5A9GA 2YUAA 2XAHA 3SJCC 3UKMA 4LBEC 4U3JA 1V9PA 2AGAA 1YF2A 2CH7A 3O65A 4YHHB 1FPOA 4E4EA 3LSUA 5L3FA 1VMGA 1RPRA 4NR1A 1F7YA 5EYPB 3LSSA 1N33B 1MNGA 4TUYA 5FLXN 1XILA 2DJVA 3OGIB 1NQTA 1WLEA 5E1AC 2XASA 4CH4A 5EZYA 4NTXA 4X66O 3AG2C 5IWAB 1K92A 1RSOA 3CC7V 3ETEA 5LGTA 1HNXO 1Q90D 3B2EE 3E89A 3K08A
chains in the Genus database with same CATH topology
3DGEA 2QM7A 5B1OA 3WFVA 5HFMA 1GK9A 2DYRC 4WFFA 4L87A 3K06A 3FB8C 3OGCC 4PA6A 1KC8W 1AJNA 3E8GA 4PA7A 2QKSA 2XAJA 4UV8A 2HFEC 2ZD9A 3RW0A 1BHAA 3AG3C 1PNKA 2JJ1G 2XAFA 5B1BB 1YIJV 1QLNA 4JTAB 3LSQA 3UM7A 2WLHA 2WLIA 3SPHA 1DLBA 1K33A 1QR9A 1FXHA 3CC4V 2B1GA 2B1IA 4FJCC 1N8RW 5C93A 1QVFU 1P4RA 4PDMA 1R3KC 3OUSA 1K4DC 2B5UA 4QIWF 2V1DA 1W0KG 5GW7A 3K04A 3ZRXA 3ABTA 1JOYA 4N23A 1Q7YW 3ABLC 1GO3F 2P67A 3CYOA 4WCEV 4GX1A 3CCUV 1K3EA 3ASOC 2ITDC 4XBFA 4EKWA 3OR7C 1R3IC 1GM9A 3RVYA 1FXKB 4ZBMA 1LNQA 1Y4MA 3AEIA 5IYBO 5LBQA 3RVZA 5H9CA 1KD1W 3SYAA 2HR3A 3MHSC 4MSWC 3GB7C 2QTOA 5FL7G 1AJQA 4JTCB 2Z5UA 3T4ZA 2ZDIC 1F51A 3T2MA 1AI6A 1JCHA 1OZ0A 4MTXA 1K34A 3F7YC 2HG5C 1JX9A 2H94A 3IFXA 2EIKC 3IGAC 2DYSC 2IU0A 1E1QG 1JVMA 2JDIG 1L1FA 3ABMC 3I56V 1Q86W 2D3OW 3CXCU 1OCZC 1S3JA 1OHHG 2JEXA 4XDLA 1F4MA 2DYRB 2LFSA 4GX0A 4G28B 4PA4A 3ZMUA 1JPXA 1VQMV 1GTOA 3JD2A 2OCCB 1OCRC 4RQFA 3LDEA 1F23A 3LDCA 1J95A 2WAMA 3NXSA 4JGSA 2HVJC 2YEVB 4P9OA 3FYEB 4P9PA 4UV9A 3E8HA 5EC2C 5KA5A 3QNEA 1AI5A 1VQLV 5EBLC 4QE7A 5IYCO 5CMUA 1E79G 4PDLA 1PL0A 2AHYA 2EBOA 2ATKC 1M57B 2HJFC 3HPLC 3WG7C 4MVQA 2GSMB 3K9AA 3G6EV 5J9PC 1BMFG 1GM8A 5DM6V 4JTDB 3ASNB 3OMIB 1V54B 3ZIAG 1ENVA 1OCCB 1JJ2U 1M56B 1KECA 3B8NA 1EBOA 2Y69C 3I55V 3QO8A 1KKDA 1OCOB 3T1CA 2C2AA 1NVPB 1R3JC 2W6JG 3A0RA 4JAUA 2Q69A 3STLC 3JD0A 3MD0A 4MVOA 4MVMA 3W7SA 3ASOB 4TWKA 2EIJB 4MVSA 4JF3A 3STZC 2ZR3A 2Q68A 3OMAB 1H2GA 3W7TA 4GCZA 4G2KA 1FXKC 3R65A 3VBBA 1HWYA 3ZMVA 2F43G 1ZWIC 1H38A 1VQOV 5L3CA 5B1NA 3OUFA 1G8MA 5BZBA 2WLKA 3CMAV 1YITV 5KUMA 1H8HG 1ROPA 2V7QG 1TUEB 3ZMTA 2X6AA 2Z3YA 4R50A 3CCQV 2FTKA 1OCZB 4U7OA 1S77D 1XL4A 3P30A 1COWG 3ZRSA 3TETA 3K03A 1XL6A 4X8AA 2EIMC 2EINC 1UJWB 4Z1MG 1OCRB 3HB3B 1I5XA 3SPIA 1MABG 4HAMA 4QJFB 4MW3A 1AI4A 3AG4B 2OT5A 4I9WA 1YHQV 1AROP 3ABKC 4PA3A 2JEUA 1M57C 3K0DA 3WG7B 4MVUA 4MW8A 5B3SC 1M1KW 1ORQC 1R3LC 3ASNC 2KB1A 3PJSK 2K1EA 4TT3G 4N21A 3SYPA 3EHBB 3ZMSA 3G4SV 1OCCC 3CD6V 1GMGA 1M56C 1KQSU 3CCSV 1W2BU 3LDDA 2Q6AA 2P7TC 1V55C 1S5HC 2P90A 2WLNA 1QCEA 4FK5C 1M90W 2GHYA 3RBZA 2NNUA 1QLEB 2IW5A 3OR6C 5HFLA 4F4LA 2ZXWB 3E35A 3B8MA 1QR8A 1DF4A 4H33A 1FFTB 3OW2U 5B1AB 1S76D 2A0LA 2YSUB 5L3EA 1NBMG 1QBZA 1VQ6V 3FKSG 3D36A 2HVKC 3ZRVA 4MVRA 2WLLA 4WF9V 2QEXV 1YTFD 4LCUC 1NR7A 4MTGA 3CMEV 5L3BA 1H8EG 3BY6A 1RM1B 1S72V 2PI5A 3ZJZA 4BW5A 1W0JG 1Y66A 5EBWC 3SYQA 2IJHA 4CBCA 4PA9A 5CBGA 3TK1A 1K5SA 2WPDG 4RUFA 2WLJA 3OEHG 4MTOA 4WFAV 3OAAG 2XNDG 1K9MW 1PD3A 2IJIA 4FIPC 3ZCCA 3AG3B 4RAIA 5B1BC 1E1RG 1AR1B 3G71V 3QO5A 4BIUA 1K5QA 3K0GA 3AG2B 3JD3A 2IJJA 1BL8A 4RQEA 3ABKB 1P7BA 2UXXA 3AG1C 3ZN1A 3CCLV 4ASUG 4X88A 1VQ5V 1FS0G 2OTLV 1CPYA 4XDKA 2BOCC 3MHHC 5LHGA 3T4DA 1NR1A 4JYCA 3M99B 4J9ZB 1FXKA 4UVBA 1BHBA 2IH3C 2DWDC 4JPRA 5KUKA 3FB7C 3E8BA 3JD4A 3ABLB 1JQ0A 1CP9A 4P30A 4CZZA 4BIZA 3CCRV 1PNLA 2HLDG 1YJ9V 1NH2B 1PKXA 1THZA 1B6QA 2YEVA 1SRYA 3K79A 4ZKIA 2A9HA 2AHZA 1EZJA 1EFRG 4QPJA 4H37A 2M7WA 5LGUA 4UVCA 2ZXWC 1M9NA 4FMTA 3BEHA 3E8FA 2JK5C 1GM7A 3H01A 4UUJC 5IYDO 2QA4V 1SESA 1YTFB 1G4YB 4KP4A 2EZPA 1RM1C 3P32A 4PDVA 1S0VA 2EIKB 3ABMB 2JJ2G 5CBHA 3ML0A 4KFMA 1YI2V 3CCMV 1IXMA 3FYIB 1VQ8V 2OCCC 2W0FC 1NJIW 2DWEC 1MOFA 4R6ZA 1NKDA 4MT8A 4Q20A 4PDRA 1K4CC 2ZR2A 2OTJV 4DXWA 5L3DA 3E83A 2Y48A 4HYOA 3E2EA 5DN6G 3LUTB 2P6JA 2DW4A 2XAQA 4WFHA 3JYCA 4BAYA 5IDJA 5CBFA 4MVZA 2DQ0A 3SPGA 4J9YB 2DYSB 2WLLB 4I5SA 5CA3A 5LGNA 3OM3B 1K7DA 1VQ7V 4FPPA 2Y69B 3CCVV 3W7XA 2A79B 4R8CA 1WPXA 1OCOC 2WLMA 1SETA 3GWOA 4JASA 1NVPD 3SPCA 5IY5B 2QM8A 1NH2D 2CK3G 5EK0A 2HKOA 4WFEA 3X2QB 4WFGA 5H6RA 2EIJC 2XAGA 2ZQMA 3ETDA 4OXSA 2R9IA 3D3IA 4JAVA 4X89A 5L3GA 1AI7A 3CP1A 4WFBV 4LC1A 1R6KA 1PNMA 1VQ9V 1RPOA 3ZRWB 3SYOA 4QPKA 1FXVA 1V54C 5H6QA 3OEEG 4MS2A 1R6NA 3F7VC 4YXWG 3SYCA 3W7WA 2ITCC 4RO2A 3JCZA 3CCEV 1K73W 2X7RB 3ETGA 2WLIB 1Q81W 3LNMB 4PELA 4RUEA 2EJRA 2NLJC 3ZMZA 5LHHA 1VQPV 2EIMB 1VQNV 2WWWA 2IU3A 2XOKG 2UXNA 3VOUA 1CEZA 4P2ZA 4KUMA 3ZRWA 2MK3A 3B77A 5KA6A 1F4NA 2EILC 4R7CA 4U7NA 5EBMC 3CCJV 4TSFG 3OFNG 5B3SB 1YJNV 2PI4A 3IC7A 4E2LA 3FB6C 1AJPA 1MSWD 4GX5A 1YSCA 3SPJA 2BOBC 3FB5C 2H8PC 3KG2A 1DTOA 1K97A 4QNHB 2ZDIA 3DTUB 1V55B 2IH1C 2EINB 4G27B 3ZN0A 2JIZG 1SZTA 4LP8A 2Q67A 1KP3A 3QO7A 4GT1A 3SJQC 5IY5C 3EFFK 2EZOA 3AG4C 4DO2A 1VQ4V 2XAHA 3X2QC 3UKMA 4LBEC 2R9RB 4UVAA 1SERA 3W7UA 1QVGU 4JYBA 5L3FA 2X0LA 3CPWU 1MG1A 4HZ3A 3CC2V 1R73A 1GKFA 1RPRA 4MTFA 2WSSG 4XDJA 3JD1A 5CN0A 3E86A 3LSSA 2LFRA 1K8AW 1Q82W 1I5YA 1QLEC 4UXNA 2QE7G 3OMNB 1YJWV 5LHIA 1KP2A 1NQTA 1WLEA 3ABUA 5E1AC 2XASA 2LP7A 5B1AC 1DF5A 4QE9A 3AG2C 1VQKV 1K92A 2DQ3A 3TCUA 3CC7V 3ETEA 3AG1B 2W6IG 3K3WA 2X6BA 5LGTA 3F5WC 4GX2A 2EILB 2X6CA 5EC1C 3E89A 2IJKA 3OE7G 3K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KA5 A;  3WFV A;  2EZO A;  5HFM A;  4N21 A;  5CMU A;  1I5Y A;  2MK3 A;  3P30 A;  3B77 A;  5KA6 A;  4N23 A;  2EBO A;  1K34 A;  2M7W A;  4JF3 A;  4G2K A;  1MOF A;  1Y66 A;  3GWO A;  3K9A A;  2LP7 A;  3MHH C;  1DF5 A;  1QCE A;  1I5X A;  4FK5 C;  3CYO A;  2X7R B;  3H01 A;  4E2L A;  3M99 B;  2OT5 A;  1ENV A;  1MG1 A;  1DLB A;  1K33 A;  1QR9 A;  5HFL A;  3B8N A;  1EBO A;  2EZP A;  2P6J A;  3B8M A;  4FJC C;  1QR8 A;  1DF4 A;  1JPX A;  4JPR A;  1JQ0 A;  4FIP C;  1Y4M A;  1F23 A;  3CP1 A;  5H9C A;  4JGS A;  3MHS C;  5CN0 A;  1SZT A;  1QBZ A; 
#chains in the Genus database with same CATH topology
 3DGE A;  1SQP H;  5B1O A;  5LMN O;  5FPR A;  2DYR C;  3N2K B;  4K3A A;  4WFF A;  4L87 A;  3K06 A;  4UCT A;  4PA6 A;  1KC8 W;  3E8G A;  2XAJ A;  3VQV A;  2P5O A;  2HFE C;  1BHA A;  2JJ1 G;  1A32 A;  1FD9 A;  5LMU O;  2VQE O;  5A2Q N;  5CA1 A;  3SPH A;  3ZHV A;  3U11 A;  1N8R W;  4DV6 O;  1QVF U;  1P4R A;  1N34 B;  2VWK A;  2PYL A;  3OUS A;  1K4D C;  4QIW F;  1SQG A;  2V1D A;  3K04 A;  4UCO A;  2JGU A;  2QDO A;  2F23 A;  2YIC A;  4CS2 A;  2QWR B;  3ABL C;  2A3Q A;  4GX1 A;  4B7E A;  1AIL A;  2ITD C;  3D3Q A;  1IBM O;  1J5E B;  4J42 A;  1HNZ B;  1R3I C;  5B5E Z;  3RVY A;  5C8Y A;  4ZBM A;  4TQD A;  3AEI A;  5LBQ A;  3RVZ A;  2QSA A;  5JVD B;  3OT7 A;  3J81 N;  1ZSP A;  4DR4 B;  4U3F H;  3T4Z A;  1F51 A;  1Q6I A;  5LOV B;  4JI7 B;  1OZ0 A;  1YVW A;  4MTX A;  4EFB A;  3F7Y C;  1JX9 A;  3TXQ A;  2H94 A;  2EIK C;  3I56 V;  2HP8 A;  1BQZ A;  5JJJ B;  4J80 A;  1WN7 A;  4G28 B;  1Z5V A;  4LFB B;  2Q9L A;  1J95 A;  4JZ2 A;  5CMU A;  2LQT A;  3EVK A;  1PL0 A;  2ZCE A;  2ATK C;  1J5E O;  3K9A A;  3RGB A;  4LFB O;  5CA0 A;  1M4U A;  4LF8 B;  4NTY A;  4YIO A;  2UUC O;  1H2N A;  2Y69 C;  2Q69 A;  3STL C;  3JD0 A;  1NTZ H;  3ASO B;  2CTR A;  1HR0 O;  4J10 A;  2EIJ B;  4TWK A;  2ZR3 A;  1KB9 F;  1VF6 C;  5LXT B;  1FJG B;  5ITZ A;  4JI4 O;  4W4K A;  2F43 G;  2RQ6 A;  5KMG A;  2QJ1 A;  1XRE A;  1YIT V;  5KUM A;  1Q3E A;  1VEW A;  1NTM H;  1TUE B;  3ZMT A;  2Z3Y A;  4UCR A;  1OCZ B;  1XL4 A;  1COW G;  3ZRS A;  3TET A;  4ZHQ B;  4X8A A;  4DV6 B;  1SKV A;  3HB3 B;  5BY1 A;  5LYJ A;  3SPI A;  4HAM A;  4AIL C;  4QJF B;  4KL1 A;  1EN5 A;  3T1Y O;  4FVM A;  4O2B A;  3E22 A;  4KXR A;  2IBZ H;  3K0D A;  1SQB H;  1M1K W;  4X65 O;  2KB1 A;  3EHB B;  3G4S V;  1GMG A;  1W2B U;  2QTS A;  2P90 A;  4FK5 C;  2RN9 A;  3HR0 A;  1HW7 A;  1GH6 A;  1WAZ A;  3O9O A;  5D5Q A;  4LWS B;  3K5M A;  4F4L A;  3B8M A;  2HHH O;  1QR8 A;  4H33 A;  4X62 O;  1QQC A;  5L3E A;  2ADQ B;  2H3O A;  2HVK C;  4MVR A;  5JCO A;  1BSM A;  2WLL A;  4WF9 V;  2QEX V;  1H8E G;  3BY6 A;  1RM1 B;  1S72 V;  1B3Q A;  3RYI B;  5EBW C;  1TUB A;  4LF4 O;  3ZHU A;  3H9V A;  2ZE8 A;  2WLJ A;  5IWA O;  5JCO C;  3OEH G;  3L70 H;  4MTO A;  4WFA V;  4HNA B;  2XND G;  2IJI A;  4FIP C;  3ZCC A;  2UUA O;  5LA6 A;  1AR1 B;  3G71 V;  3JD3 A;  1Z5W A;  4B3T B;  2Y0P A;  3ZN1 A;  4IGG A;  1CPY A;  2ZNJ A;  2CUG A;  3L71 H;  2VQE B;  1U96 A;  2AW9 A;  5KUK A;  3JD4 A;  3APO A;  4BIZ A;  1YJ9 V;  1THZ A;  1SQF A;  4ZKI A;  1EFR G;  4UVC A;  4FMT A;  3BEH A;  4DR1 B;  2JK5 C;  4X1K A;  3SGI A;  5IYD O;  1SES A;  2DMX A;  1G4Y B;  4NXM B;  1I7F A;  2EZP A;  1FJG O;  3P32 A;  2EIK B;  3RYC B;  5DEC A;  4I9Q A;  4KFM A;  3FYI B;  4DV5 B;  2W0F C;  1MOF A;  2M6Y A;  2YIA A;  3HKC A;  4Q20 A;  5JWP A;  2OTJ V;  2VRZ A;  3LUT B;  1KYO F;  2DW4 A;  4WFH A;  5IDJ A;  5EYP A;  3RN4 A;  4MVZ A;  5CA3 A;  3EXA A;  3G80 A;  4YJ2 A;  4A5U B;  4X64 B;  4FLU A;  5B66 Z;  1ZL8 A;  4K0K B;  2D2C B;  1Q6U A;  2CK3 G;  2HKO A;  4WFE A;  3X2Q B;  4WFG A;  2ZQM A;  4I55 B;  4OXS A;  2P06 A;  4FLW A;  2CAZ C;  1AI7 A;  1JR9 A;  3F5T A;  4WFB V;  2F1M A;  5KAI Z;  3S3X A;  1JFF B;  4QPK A;  4FLZ A;  3CRR A;  1SZX A;  3OEE G;  3JCZ A;  1K73 W;  2BSK B;  4IYH A;  1G6U A;  3LNM B;  4JI6 O;  2EJR A;  3AK1 A;  2Q0A A;  4K35 A;  4PV1 B;  2IU3 A;  4LNU B;  1CEZ A;  3L75 H;  4P2Z A;  3ZRW A;  5KHG A;  4R7C A;  4I4T B;  4FM1 A;  5CA1 B;  3RWR D;  1MSW D;  1YSC A;  4LWS A;  3SPJ A;  3FB5 C;  2P4K A;  3KG2 A;  1DTO A;  2Q8V A;  3DC5 A;  3ZHQ A;  2KKW A;  4GKK O;  3QO7 A;  4PHZ A;  2DOS A;  2EZO A;  2KSD A;  3AG4 C;  4DO2 A;  3CWB H;  1YXB A;  5IT9 N;  3M8A A;  5GON A;  4JV5 O;  1MZF A;  3GVM A;  1LR1 A;  2GBO A;  2X0L A;  5IJ9 A;  2LGQ A;  4HZ3 A;  3JCU Z;  2ARH A;  3E86 A;  1IZ3 A;  1I5Y A;  5LP6 B;  4UXN A;  4D6T H;  1KP2 A;  4BIO A;  4ABM A;  1XMO O;  5B1A C;  4QE9 A;  1IBM B;  3VQW A;  3AG1 B;  4TQF A;  4GZR B;  3K3W A;  2X6B A;  2YID A;  3F5W C;  4DV0 O;  1R6T A;  2EIL B;  3FFQ A;  5EC1 C;  5KHH A;  3QVN A;  3WFV A;  1GK9 A;  4U3J B;  3CB2 A;  2UUB B;  3OGC C;  1AJN A;  4HBN A;  1XOU A;  2QKS A;  3RW0 A;  1QLN A;  5B1B B;  4JTA B;  3LSQ A;  4B3M O;  3UM7 A;  1K33 A;  3K5L A;  2B1G A;  2B1I A;  1M93 A;  3CS5 A;  1EM1 A;  1Y74 B;  5C93 A;  2PYJ A;  4PDM A;  4TUY B;  3DSQ A;  4FLX A;  1W0K G;  2XTA A;  3ZRX A;  1JOY A;  1VAR A;  3B40 A;  3ZED A;  1PV0 A;  4F6R A;  5ITZ B;  1XQ8 A;  4IL6 Z;  2KG7 B;  2P67 A;  1HNW O;  4TV8 A;  1K3E A;  3ASO C;  4CC5 A;  4LFC B;  2XHB A;  1FXK B;  5FNV A;  1N32 O;  4H0L B;  1LNQ A;  2CE4 A;  4EB6 B;  1VIB A;  2EX3 A;  2QTO A;  2N05 A;  1AJQ A;  1B04 A;  1AI6 A;  3ETQ A;  1H2S B;  1EN6 A;  3IGA C;  2IU0 A;  2XUM A;  1JVM A;  3L73 H;  4X9Q A;  3ABM C;  2D3O W;  1OCZ C;  4JAA A;  4J41 A;  1F4M A;  2LFS A;  1VQM V;  2YXH A;  1GTO A;  2OCC B;  2HJD A;  1F23 A;  3LDE A;  1VQ6 V;  3E8H A;  3UQ8 A;  3QNE A;  5EBL C;  2BE3 A;  4LH7 A;  4YY3 B;  4X65 B;  2AHY A;  2EBO A;  4GKK B;  1TUB B;  3ZHS A;  4K8Z A;  4MVQ A;  2CGN A;  4CS4 A;  4JTD B;  3DC6 A;  5J2T A;  1L0N H;  2ZE7 A;  1HNZ O;  1V54 B;  3ZIA G;  1JJ2 U;  4X66 B;  4Q6G A;  4DR1 O;  5JVD A;  4X20 A;  1MMM A;  2CTP A;  1GRJ A;  3JAK B;  3MD0 A;  4MVO A;  2E75 B;  4DRX B;  1G1X B;  3W7S A;  4IYI A;  2RMK B;  3CHX A;  4MVS A;  4JF3 A;  3R65 A;  5IYZ B;  3VBB A;  1HWY A;  5D5P A;  1ZWI C;  2RNB A;  1VQO V;  4B3S B;  1ZX3 A;  5B1N A;  2FL4 A;  4DV3 O;  3SR2 C;  5BZB A;  3A8T A;  5BXZ A;  1GN6 A;  4LF5 O;  2ZNI A;  4R50 A;  5BR8 O;  4IHJ B;  1I5X A;  4MW3 A;  3AG4 B;  4DUZ O;  1YHQ V;  4LR3 A;  4PD4 F;  4Z2W A;  4LFA O;  4JI0 B;  2ZE6 A;  1M57 C;  3WG7 B;  4MW8 A;  4J11 A;  5B3S C;  1XNR O;  2GTA A;  1ORQ C;  3J7A U;  1WA8 B;  4N21 A;  5JH7 A;  1M56 C;  3RFR A;  1KQS U;  4AHC A;  1Q6H A;  2Q6A A;  2UXB B;  4O4H B;  1V55 C;  1QCE A;  2F66 C;  2ZKO A;  1O9H A;  2ADP A;  5LP6 C;  1X59 A;  4JI5 O;  1HDJ A;  4LF6 B;  1DF4 A;  2G38 A;  3RYH A;  1FFT B;  3OW2 U;  5B1A B;  1S76 D;  2YSU B;  1L8D A;  4YJ2 B;  3FKS G;  4AQY B;  4JZG A;  4LCU C;  5TIS Z;  1NR7 A;  4FZ1 A;  1AR4 A;  3FAV B;  2WA4 A;  2PI5 A;  2Q4P A;  1DK1 A;  1Y66 A;  2ZM6 O;  1JA8 A;  2IJH A;  2PTM A;  4O4L A;  4KHP B;  3BA9 A;  4DV2 O;  4I55 A;  2UXD B;  4RAI A;  5B1B C;  2CTQ A;  4UCS A;  2NR5 A;  4BIU A;  1K5Q A;  4RQE A;  3J80 N;  1P7B A;  4JI2 O;  2UXX A;  4L8J A;  3JAW A;  4X88 A;  5LOV A;  1VQ5 V;  2BOC C;  3MHH C;  5LHG A;  3UT5 B;  4LF6 O;  3M99 B;  2UU9 O;  4FM2 A;  2YS8 A;  3KCX A;  1FXK A;  1MA1 A;  5FNV B;  4ZI7 B;  2DWD C;  3FB7 C;  3ABL B;  1JQ0 A;  3BAA A;  3CXH F;  4LNU A;  1CP9 A;  1XEQ A;  2Q5Z A;  2HLD G;  1IBL B;  1PKX A;  1VF5 B;  4QPJ A;  4H37 A;  2Y0I A;  2R72 A;  3BVO A;  1BCC H;  2ZXW C;  1H2L A;  2N74 A;  1M5I A;  4OX9 B;  4C7U A;  1GM7 A;  5GON B;  2A7W A;  4JI5 B;  1YTF B;  4KP4 A;  4DUZ B;  3OTF A;  1N36 O;  2B9Z A;  3JAL A;  3ABM B;  2JJ2 G;  4JI2 B;  3FD9 A;  4B3T O;  3Q4H B;  4O4J B;  1YI2 V;  4LF5 B;  1IXM A;  5LP6 A;  1NJI W;  2DWE C;  4X1I A;  1XMQ B;  2WA3 A;  2QWO B;  1N36 B;  1WPB A;  4MT8 A;  4PDR A;  2UUC B;  4QGP A;  2ZR2 A;  4UB8 Z;  5L3D A;  4DXW A;  3E83 A;  3A0H Z;  4HYO A;  5JJN B;  2E3C A;  5CBF A;  2HEP A;  2Q7H A;  1O9G A;  3RYC A;  2GUZ B;  4FM0 A;  3OM3 B;  5EIB D;  1VQ7 V;  2Y69 B;  3ZS8 C;  3W7X A;  2A79 B;  2Y4T A;  1WPX A;  1IUR A;  1NVP D;  2BTO A;  5KHI A;  1SS3 A;  3JAR A;  5IY5 B;  1Q8I A;  3R66 A;  2QM8 A;  1HP8 A;  1EZV H;  2UXC O;  2EIJ C;  2PZS A;  1ZUQ A;  3ETD A;  2OWO A;  2R9I A;  3D3I A;  4JAV A;  2FB5 A;  2FYU H;  2FML A;  1NI8 A;  1IDS A;  3SYO A;  1JMK C;  2ILM A;  4MS2 A;  1P7G A;  1R6N A;  3HKC B;  3F7V C;  3QG5 A;  3W7W A;  4YJ3 A;  2ITC C;  3CCE V;  2X7R B;  3ETG A;  1AB3 A;  1I94 B;  2ETN A;  2DN9 A;  5LHH A;  4LF4 B;  1SQQ H;  1QHT A;  3H1L H;  3VOU A;  3JAT A;  4B7K A;  3N2G A;  4F6R B;  1F4N A;  2EIL C;  4TSF G;  5B3S B;  1X4T A;  4E2L A;  4Z1V A;  4B3R B;  3D36 C;  4NKG B;  1K97 A;  3LNN A;  1Y6X A;  2ZDI A;  3ZX6 A;  1V55 B;  1SQV H;  4G27 B;  2AXT Z;  2JIZ G;  3B09 A;  5GTI Z;  2Q67 A;  1FAF A;  3IC9 A;  2RCV A;  3CRQ A;  1DGS A;  1N33 O;  4UVA A;  1TVK A;  4TV8 B;  1QVG U;  4JYB A;  1KUQ A;  2YIB A;  3MDS A;  4J7K A;  2NN4 A;  3WB1 A;  4K8X A;  1R73 A;  1HNW B;  1GKF A;  3BAB A;  3JSL A;  4JI3 O;  1PM9 A;  2JS5 A;  4JYA O;  2WSS G;  4XDJ A;  1XMQ O;  4O4I B;  4PI2 A;  3BPZ A;  2LFR A;  1Q82 W;  1QLE C;  2QE7 G;  3OMN B;  1YJW V;  4DR5 O;  3ABU A;  4EEQ A;  2YC0 A;  4CH6 A;  1VQK V;  5H5N A;  3ZHT A;  1VP7 A;  3TJT A;  2E5L B;  1SQX H;  2W6I G;  1LUV A;  4GX2 A;  1PL4 A;  3SJB C;  2IJK A;  4D7T A;  3OE7 G;  1SA0 A;  3SJA C;  4DV4 B;  1N0N A;  1YDX A;  1N4C A;  4PA7 A;  4LF7 O;  1IBK B;  4UV8 A;  1YIJ V;  2LGW A;  2WLI A;  1QR9 A;  1FXH A;  3GWK C;  1AVM A;  3K57 A;  2Q73 A;  1L0L H;  1IBK O;  1BZK A;  4FFB B;  2V4D A;  2B5U A;  1S5L Z;  2RDC A;  4N23 A;  3CEI A;  1N34 O;  1WNS A;  1WJZ A;  1GN3 A;  1GO3 F;  3UO2 A;  1WB7 A;  3CYO A;  3CCU V;  1TAE A;  5LYJ B;  4EKW A;  3RYF B;  3OR7 C;  2JVD A;  1KD1 W;  1KBH A;  1KKC A;  4MSW C;  4ZIB A;  3OTO B;  5JH7 B;  4IHJ A;  2Z5U A;  4JTC B;  1JCH A;  1K34 A;  1ZTE A;  5KX5 A;  1E1Q G;  2PF4 E;  1L1F A;  2HHH B;  2UXC B;  4FFK A;  3A2F A;  2AZ0 A;  2JEX A;  4XDL A;  2DYR B;  3RYH B;  4LF8 O;  2OIG A;  4GX0 A;  1Y74 A;  4DK0 A;  4YHH O;  1Y76 B;  4RQF A;  2WAM A;  1Q43 A;  3NXS A;  2HVJ C;  2YEV B;  3P3N A;  4UV9 A;  3DXR A;  4P9P A;  4P9O A;  2LJ2 A;  5EC2 C;  4I0X A;  1VQL V;  4QE7 A;  5IYC O;  1E79 G;  4YJ3 B;  2HJF C;  2GSM B;  1WP8 A;  3G6E V;  5J9P C;  1BMF G;  1GM8 A;  5DM6 V;  1EN4 A;  4I7Z B;  3HKE B;  2MW2 B;  1ENV A;  2A06 H;  2OYQ A;  5K1X A;  1M56 B;  3IJ4 A;  1KU9 A;  1EBO A;  3I55 V;  4JV5 B;  4DUY B;  3QO8 A;  1OCO B;  3T1C A;  1R3J C;  2W6J G;  3A0R A;  4JAU A;  4I50 B;  4MVM A;  1IX9 A;  4DR2 B;  3STZ C;  4GCZ A;  4G2K A;  4DUY O;  2E76 B;  1XNQ O;  3AK3 A;  3ZMV A;  2LW7 A;  4B3R O;  1H38 A;  4DR6 O;  5JJE B;  5L3C A;  2Q7G A;  4KHP O;  3OUF A;  5JQG A;  4K0K O;  3CMA V;  2GTS A;  2V7Q G;  3CJH B;  1HR0 B;  2X6A A;  3CCQ V;  2QR4 A;  5IJ0 B;  3JAS A;  3C3T A;  1S77 D;  3P30 A;  4DV1 O;  2EIM C;  1UJW B;  1OCR B;  4DV7 O;  1MAB G;  1AI4 A;  2F4V O;  2OT5 A;  4ZI7 A;  3K59 A;  1ARO P;  4CH3 A;  2UU9 B;  4JYY A;  4PA3 A;  3JAL B;  1FKA O;  4MVU A;  3Q4H A;  4LF7 B;  4DR2 O;  3ASN C;  3PJS K;  3H1H H;  4JI8 O;  2LO1 A;  1OCC C;  3CD6 V;  4X1I B;  2JRI A;  3CCS V;  3HKB A;  4RWU A;  5IYZ A;  5FPO A;  1S5H C;  4X62 B;  1PPJ H;  3KCY A;  1NU1 H;  2GHY A;  4B3S O;  4NXM O;  5AG2 A;  1QLE B;  3OR6 C;  1Z2G A;  3E35 A;  3K5O A;  2E74 B;  2L6L A;  1NBM G;  2ZIO A;  4DV1 B;  3ZRV A;  1YTF D;  4MTG A;  3I5D A;  3C90 A;  5CA0 B;  3ZJZ A;  4BW5 A;  1W0J G;  2JGD A;  2YXL A;  1R1B A;  4PA9 A;  3TK1 A;  2VQF O;  3T1Y B;  5E79 Z;  2GV9 A;  4AI8 A;  3OAA G;  4OPH A;  1PD3 A;  2DE0 X;  3A0B Z;  1CXZ B;  3AG2 B;  4WBN A;  2IJJ A;  3ABK B;  1JFF A;  4O4H A;  1U97 A;  1FS0 G;  4ICG A;  1QNM A;  4JYC A;  4DW0 A;  4NTW A;  1MZE A;  1NTK H;  1H2M A;  2IH3 C;  4JPR A;  3E8B A;  3CCR V;  5GTH Z;  3H1I H;  1SRY A;  3K79 A;  4BW9 A;  1MSD A;  4ZHQ A;  3APQ A;  2M7W A;  5LGU A;  1M9N A;  3HKD B;  5IE9 A;  4UUJ C;  3H01 A;  4JI6 B;  4CS3 A;  3UT5 A;  3WB0 A;  4DR3 B;  2F4V B;  2EJ7 A;  1RM1 C;  1S0V A;  3CSX A;  2YI9 A;  4DV5 O;  3JAT B;  3N2G B;  1YEW A;  3NR7 A;  3ML0 A;  4ZOL B;  1B06 A;  3JAW B;  4GUN A;  1XHZ A;  4UB6 Z;  2OCC C;  3TXS A;  4F6E A;  1XDC A;  1ZLZ A;  3L74 H;  1K4C C;  2QWN B;  1VF7 A;  3CRM A;  2Y48 A;  3C3S A;  3E2E A;  1I08 A;  5IJ9 B;  1US6 A;  4O2A B;  2DQ0 A;  1AP6 A;  4J9Y B;  2DYS B;  1BGY H;  2WLL B;  5LGN A;  1FFX B;  1K7D A;  4FPP A;  4AQY O;  1TVK B;  3CCV V;  1OCO C;  2WLM A;  4JAS A;  3GWO A;  4UFZ A;  1NH2 D;  5EK0 A;  5LL6 Y;  2KQX A;  2XAG A;  3G6B A;  2BTQ A;  4X89 A;  3CP1 A;  1R6K A;  2LW1 A;  1VQ9 V;  3JAS B;  1FXV A;  2ZIM A;  5BR8 B;  5H6Q A;  4H44 B;  3CRC A;  5K1P A;  4YXW G;  2CGO A;  3G67 A;  3SDL A;  4RO2 A;  2WLI B;  3TGU H;  4DR3 O;  3KKY A;  4RUE A;  3ZMZ A;  3RYF A;  2EIM B;  2ZM6 B;  1VQN V;  4IIJ B;  2GUZ A;  2XOK G;  2CDY A;  3OD4 A;  4JI8 B;  2L35 A;  4PJ0 Z;  3B77 A;  4U7N A;  3ZHR A;  2PI4 A;  3FB6 C;  5KX5 B;  1TGO A;  2EUL A;  4GX5 A;  2PGG A;  1UPG A;  3D8C A;  2F93 B;  1XNQ B;  1XBL A;  1VF6 A;  3H1K H;  3QF7 A;  4QNH B;  4TV9 A;  2EIN B;  1NS1 A;  1SZT A;  4LP8 A;  4GT1 A;  4EB6 A;  4DV4 O;  1VQ4 V;  4I0X B;  3T1H B;  3X2Q C;  2VS0 A;  4JI1 B;  2R9R B;  1SER A;  3W7U A;  4X1Y A;  2FKX A;  1LUW A;  1W59 A;  4EFE A;  4OGQ B;  3CPW U;  1MG1 A;  3CC2 V;  4MTF A;  1XHX A;  3JD1 A;  5CN0 A;  5CB4 A;  1K8A W;  4H13 B;  1I0H A;  5KAF Z;  4UCV A;  5F2V O;  1H2K A;  5LHI A;  5KHK A;  1XNR B;  1ZL8 B;  4GKJ O;  2Y4U A;  2LP7 A;  1DF5 A;  1Q5O A;  1D5A A;  2DQ3 A;  2VQF B;  3TCU A;  4OPA A;  4LF9 O;  4IT5 A;  2X6C A;  4FZ0 A;  4PDL A;  4JI1 O;  2QM7 A;  5HFM A;  3U0Z A;  3HKD A;  3FB8 C;  4O4J A;  3UCS C;  3BRC A;  1FYJ A;  1YZB A;  2ZD9 A;  3AG3 C;  1PNK A;  2XAF A;  1QU7 A;  2CTW A;  3VQY A;  3BFR A;  2WLH A;  1WB8 A;  1DLB A;  1UFI A;  3CC4 V;  4GLX A;  2YI8 A;  4O4I A;  1XUQ A;  4FJC C;  4I50 A;  1NZ6 A;  5IJ0 A;  1R3K C;  5GW7 A;  2F95 B;  3ABT A;  1BE3 H;  1P84 F;  1Q7Y W;  2N04 A;  4JI0 O;  4WCE V;  2CH7 B;  4XBF A;  3N27 A;  2Z0A A;  1GM9 A;  1Y4M A;  1RP3 B;  5IYB O;  5KLV H;  5H9C A;  3SYA A;  2HR3 A;  3MHS C;  1SA0 B;  3GB7 C;  5FL7 G;  4FFB A;  2ZDI C;  3T2M A;  5LMN B;  1WA8 A;  4DR7 O;  2HG5 C;  1NT2 B;  3IFX A;  2DYS C;  2JDI G;  1Q86 W;  1N0J A;  3CXC U;  5LXT A;  1S3J A;  1OHH G;  4PA4 A;  3ZMU A;  1RSO B;  1JPX A;  3WB2 A;  3JD2 A;  4DYL A;  1OCR C;  3LDC A;  4JGS A;  3FYE B;  3THO A;  3K9S A;  5KA5 A;  4X64 O;  1AI5 A;  4LH6 A;  5EIB C;  5H2F Z;  4NVP A;  5BMV B;  3S3W A;  3N2K A;  1M57 B;  3HPL C;  3WG7 C;  3FAV A;  2UXD O;  3ASN B;  3BA8 A;  3OMI B;  3L9D A;  4O4L B;  4LFC O;  1OCC B;  4FLT A;  4B3M B;  1KEC A;  3B8N A;  1P49 A;  4TOI A;  4O2B B;  1KKD A;  1NVP B;  2C2A A;  4FLY A;  1Y76 A;  3PN1 A;  4DR7 B;  3DXR B;  4DR4 O;  2P4V A;  1D5N A;  4YIP A;  2Q68 A;  3OMA B;  1H2G A;  3W7T A;  2O57 A;  1FXK C;  3BHP A;  2QGN A;  2RJZ A;  3E22 B;  1URF A;  3CE2 A;  1I94 O;  1G8M A;  1SF9 A;  2YXY A;  3ZBH A;  2YDE A;  4NYK A;  2WLK A;  2XT9 A;  2P22 C;  1XMO B;  5C8Y B;  1H8H G;  1ROP A;  2FTK A;  2ZT9 B;  4U7O A;  1SC5 B;  3MAQ A;  3JAM N;  3K03 A;  2KG7 A;  1XL6 A;  2EIN C;  4JYA B;  4Z1M G;  1HNX B;  4PI0 A;  3RT3 C;  2ODM A;  4I9W A;  3K5N A;  5J2U A;  3ABK C;  1AP5 A;  2JEU A;  5CB4 B;  2ZIN A;  3FX7 A;  4O2A A;  1R3L C;  2K1E A;  1AR5 A;  4TT3 G;  4BR6 A;  3CJH A;  3SYP A;  4NB5 A;  3ZMS A;  2QKA A;  3RYI A;  3LDD A;  3VQX A;  2P7T C;  4DV0 B;  2WLN A;  1XI1 A;  1M90 W;  4LFA B;  3RBZ A;  2ZE5 A;  4J7J A;  2NNU A;  4HNA A;  2IW5 A;  5HFL A;  2ZXW B;  2BCC H;  2A0L A;  1QBZ A;  2Q7E A;  5DED A;  4CH5 A;  3D36 A;  3CME V;  5L3B A;  4I4T A;  1S5J A;  1RFY A;  3SYQ A;  4CBC A;  5CBG A;  2W0X A;  1K5S A;  3M7M X;  3JAR B;  2WPD G;  1OV9 A;  4RUF A;  2OCH A;  1WP7 A;  2BTQ B;  4BWA A;  4DR6 B;  2VWJ A;  4JI4 B;  4X20 B;  1K9M W;  2JS3 A;  3AG3 B;  4GYC B;  3JAK A;  1E1R G;  1FFX A;  4DRX A;  2PY5 A;  3QO5 A;  2UUB O;  3K0G A;  1BL8 A;  3HKB B;  3JSN A;  1BS3 A;  1IBL O;  3AG1 C;  5KHJ A;  3CCL V;  4ASU G;  2OTL V;  2UUA B;  4XDK A;  4D7S A;  3T4D A;  1NR1 A;  5EZY B;  3U10 A;  4J9Z B;  4UVB A;  1BHB A;  1GN2 A;  4NXN B;  3H1J H;  4P30 A;  4CZZ A;  4TV9 B;  1PNL A;  4JI7 O;  1NH2 B;  2YEV A;  1B6Q A;  2A9H A;  2AHZ A;  1EZJ A;  3B4S A;  3E8F A;  1OJH A;  4X1Y B;  2QA4 V;  1JJO A;  3HKE A;  5KMG B;  4DV7 B;  2QWQ B;  4FLV A;  4IIJ A;  4PDV A;  4WBN B;  1TA8 A;  5BMV A;  1YCI A;  5CBH A;  2K9P A;  3BCC H;  3OTO O;  3KZI Z;  3CCM V;  1VQ8 V;  3IAY A;  4J7Z A;  4R6Z A;  3QTC A;  1NKD A;  4JI3 B;  4UCU A;  4DV2 B;  5DN6 G;  2P6J A;  2XAQ A;  3JYC A;  4BAY A;  3WU2 Z;  5JQG B;  4GKJ B;  3SPG A;  2YIB D;  4DR5 B;  4I5S A;  4YY3 O;  5LA6 B;  4DW1 A;  4B08 A;  1T5E A;  2QM4 A;  1KMI Z;  4DK1 A;  2Q0O C;  4R8C A;  3P3P A;  1SET A;  2BSK A;  4DV3 B;  3SPC A;  2GDS A;  3ICX A;  3UO3 A;  2IM9 A;  2R70 A;  4CC6 A;  5H6R A;  1IXB A;  3K58 A;  5L3G A;  2UXB O;  3CX5 F;  4LC1 A;  4ZOL A;  1PNM A;  1BQ0 A;  1RPO A;  3ZRW B;  3T1H O;  1BT8 A;  1V54 C;  1Y67 A;  3SYC A;  2AZ2 A;  1N32 B;  1PP9 H;  2QKC A;  4LF9 B;  3CRA A;  5J2U B;  2E5L O;  4X1K B;  1Q81 W;  4PEL A;  2NLJ C;  3L72 H;  1VQP V;  2WWW A;  4W4L A;  2OIE A;  1GN4 A;  2UXN A;  1GAX A;  1ZAU A;  4KUM A;  2MK3 A;  3AG7 A;  5KA6 A;  3CCJ V;  5EBM C;  1IVS A;  5J2T B;  3OFN G;  1YJN V;  4NXN O;  2PUS A;  3IC7 A;  3AK2 A;  2JGD B;  1AJP A;  2BOB C;  5LMU B;  2H8P C;  2R9A A;  2QWP B;  4OX9 O;  3DTU B;  2IH1 C;  1D2D A;  3ZN0 A;  3SJQ C;  1KP3 A;  5IY5 C;  3EFF K;  5A9G A;  2YUA A;  2XAH A;  3SJC C;  3UKM A;  4LBE C;  4U3J A;  1V9P A;  2AGA A;  1YF2 A;  2CH7 A;  3O65 A;  4YHH B;  1FPO A;  4E4E A;  3LSU A;  5L3F A;  1VMG A;  1RPR A;  4NR1 A;  1F7Y A;  5EYP B;  3LSS A;  1N33 B;  1MNG A;  4TUY A;  5FLX N;  1XIL A;  2DJV A;  3OGI B;  1NQT A;  1WLE A;  5E1A C;  2XAS A;  4CH4 A;  5EZY A;  4NTX A;  4X66 O;  3AG2 C;  5IWA B;  1K92 A;  1RSO A;  3CC7 V;  3ETE A;  5LGT A;  1HNX O;  1Q90 D;  3B2E E;  3E89 A;  3K08 A; 
#chains in the Genus database with same CATH homology
 3DGE A;  2QM7 A;  5B1O A;  3WFV A;  5HFM A;  1GK9 A;  2DYR C;  4WFF A;  4L87 A;  3K06 A;  3FB8 C;  3OGC C;  4PA6 A;  1KC8 W;  1AJN A;  3E8G A;  4PA7 A;  2QKS A;  2XAJ A;  4UV8 A;  2HFE C;  2ZD9 A;  3RW0 A;  1BHA A;  3AG3 C;  1PNK A;  2JJ1 G;  2XAF A;  5B1B B;  1YIJ V;  1QLN A;  4JTA B;  3LSQ A;  3UM7 A;  2WLH A;  2WLI A;  3SPH A;  1DLB A;  1K33 A;  1QR9 A;  1FXH A;  3CC4 V;  2B1G A;  2B1I A;  4FJC C;  1N8R W;  5C93 A;  1QVF U;  1P4R A;  4PDM A;  1R3K C;  3OUS A;  1K4D C;  2B5U A;  4QIW F;  2V1D A;  1W0K G;  5GW7 A;  3K04 A;  3ZRX A;  3ABT A;  1JOY A;  4N23 A;  1Q7Y W;  3ABL C;  1GO3 F;  2P67 A;  3CYO A;  4WCE V;  4GX1 A;  3CCU V;  1K3E A;  3ASO C;  2ITD C;  4XBF A;  4EKW A;  3OR7 C;  1R3I C;  1GM9 A;  3RVY A;  1FXK B;  4ZBM A;  1LNQ A;  1Y4M A;  3AEI A;  5IYB O;  5LBQ A;  3RVZ A;  5H9C A;  1KD1 W;  3SYA A;  2HR3 A;  3MHS C;  4MSW C;  3GB7 C;  2QTO A;  5FL7 G;  1AJQ A;  4JTC B;  2Z5U A;  3T4Z A;  2ZDI C;  1F51 A;  3T2M A;  1AI6 A;  1JCH A;  1OZ0 A;  4MTX A;  1K34 A;  3F7Y C;  2HG5 C;  1JX9 A;  2H94 A;  3IFX A;  2EIK C;  3IGA C;  2DYS C;  2IU0 A;  1E1Q G;  1JVM A;  2JDI G;  1L1F A;  3ABM C;  3I56 V;  1Q86 W;  2D3O W;  3CXC U;  1OCZ C;  1S3J A;  1OHH G;  2JEX A;  4XDL A;  1F4M A;  2DYR B;  2LFS A;  4GX0 A;  4G28 B;  4PA4 A;  3ZMU A;  1JPX A;  1VQM V;  1GTO A;  3JD2 A;  2OCC B;  1OCR C;  4RQF A;  3LDE A;  1F23 A;  3LDC A;  1J95 A;  2WAM A;  3NXS A;  4JGS A;  2HVJ C;  2YEV B;  4P9O A;  3FYE B;  4P9P A;  4UV9 A;  3E8H A;  5EC2 C;  5KA5 A;  3QNE A;  1AI5 A;  1VQL V;  5EBL C;  4QE7 A;  5IYC O;  5CMU A;  1E79 G;  4PDL A;  1PL0 A;  2AHY A;  2EBO A;  2ATK C;  1M57 B;  2HJF C;  3HPL C;  3WG7 C;  4MVQ A;  2GSM B;  3K9A A;  3G6E V;  5J9P C;  1BMF G;  1GM8 A;  5DM6 V;  4JTD B;  3ASN B;  3OMI B;  1V54 B;  3ZIA G;  1ENV A;  1OCC B;  1JJ2 U;  1M56 B;  1KEC A;  3B8N A;  1EBO A;  2Y69 C;  3I55 V;  3QO8 A;  1KKD A;  1OCO B;  3T1C A;  2C2A A;  1NVP B;  1R3J C;  2W6J G;  3A0R A;  4JAU A;  2Q69 A;  3STL C;  3JD0 A;  3MD0 A;  4MVO A;  4MVM A;  3W7S A;  3ASO B;  4TWK A;  2EIJ B;  4MVS A;  4JF3 A;  3STZ C;  2ZR3 A;  2Q68 A;  3OMA B;  1H2G A;  3W7T A;  4GCZ A;  4G2K A;  1FXK C;  3R65 A;  3VBB A;  1HWY A;  3ZMV A;  2F43 G;  1ZWI C;  1H38 A;  1VQO V;  5L3C A;  5B1N A;  3OUF A;  1G8M A;  5BZB A;  2WLK A;  3CMA V;  1YIT V;  5KUM A;  1H8H G;  1ROP A;  2V7Q G;  1TUE B;  3ZMT A;  2X6A A;  2Z3Y A;  4R50 A;  3CCQ V;  2FTK A;  1OCZ B;  4U7O A;  1S77 D;  1XL4 A;  3P30 A;  1COW G;  3ZRS A;  3TET A;  3K03 A;  1XL6 A;  4X8A A;  2EIM C;  2EIN C;  1UJW B;  4Z1M G;  1OCR B;  3HB3 B;  1I5X A;  3SPI A;  1MAB G;  4HAM A;  4QJF B;  4MW3 A;  1AI4 A;  3AG4 B;  2OT5 A;  4I9W A;  1YHQ V;  1ARO P;  3ABK C;  4PA3 A;  2JEU A;  1M57 C;  3K0D A;  3WG7 B;  4MVU A;  4MW8 A;  5B3S C;  1M1K W;  1ORQ C;  1R3L C;  3ASN C;  2KB1 A;  3PJS K;  2K1E A;  4TT3 G;  4N21 A;  3SYP A;  3EHB B;  3ZMS A;  3G4S V;  1OCC C;  3CD6 V;  1GMG A;  1M56 C;  1KQS U;  3CCS V;  1W2B U;  3LDD A;  2Q6A A;  2P7T C;  1V55 C;  1S5H C;  2P90 A;  2WLN A;  1QCE A;  4FK5 C;  1M90 W;  2GHY A;  3RBZ A;  2NNU A;  1QLE B;  2IW5 A;  3OR6 C;  5HFL A;  4F4L A;  2ZXW B;  3E35 A;  3B8M A;  1QR8 A;  1DF4 A;  4H33 A;  1FFT B;  3OW2 U;  5B1A B;  1S76 D;  2A0L A;  2YSU B;  5L3E A;  1NBM G;  1QBZ A;  1VQ6 V;  3FKS G;  3D36 A;  2HVK C;  3ZRV A;  4MVR A;  2WLL A;  4WF9 V;  2QEX V;  1YTF D;  4LCU C;  1NR7 A;  4MTG A;  3CME V;  5L3B A;  1H8E G;  3BY6 A;  1RM1 B;  1S72 V;  2PI5 A;  3ZJZ A;  4BW5 A;  1W0J G;  1Y66 A;  5EBW C;  3SYQ A;  2IJH A;  4CBC A;  4PA9 A;  5CBG A;  3TK1 A;  1K5S A;  2WPD G;  4RUF A;  2WLJ A;  3OEH G;  4MTO A;  4WFA V;  3OAA G;  2XND G;  1K9M W;  1PD3 A;  2IJI A;  4FIP C;  3ZCC A;  3AG3 B;  4RAI A;  5B1B C;  1E1R G;  1AR1 B;  3G71 V;  3QO5 A;  4BIU A;  1K5Q A;  3K0G A;  3AG2 B;  3JD3 A;  2IJJ A;  1BL8 A;  4RQE A;  3ABK B;  1P7B A;  2UXX A;  3AG1 C;  3ZN1 A;  3CCL V;  4ASU G;  4X88 A;  1VQ5 V;  1FS0 G;  2OTL V;  1CPY A;  4XDK A;  2BOC C;  3MHH C;  5LHG A;  3T4D A;  1NR1 A;  4JYC A;  3M99 B;  4J9Z B;  1FXK A;  4UVB A;  1BHB A;  2IH3 C;  2DWD C;  4JPR A;  5KUK A;  3FB7 C;  3E8B A;  3JD4 A;  3ABL B;  1JQ0 A;  1CP9 A;  4P30 A;  4CZZ A;  4BIZ A;  3CCR V;  1PNL A;  2HLD G;  1YJ9 V;  1NH2 B;  1PKX A;  1THZ A;  1B6Q A;  2YEV A;  1SRY A;  3K79 A;  4ZKI A;  2A9H A;  2AHZ A;  1EZJ A;  1EFR G;  4QPJ A;  4H37 A;  2M7W A;  5LGU A;  4UVC A;  2ZXW C;  1M9N A;  4FMT A;  3BEH A;  3E8F A;  2JK5 C;  1GM7 A;  3H01 A;  4UUJ C;  5IYD O;  2QA4 V;  1SES A;  1YTF B;  1G4Y B;  4KP4 A;  2EZP A;  1RM1 C;  3P32 A;  4PDV A;  1S0V A;  2EIK B;  3ABM B;  2JJ2 G;  5CBH A;  3ML0 A;  4KFM A;  1YI2 V;  3CCM V;  1IXM A;  3FYI B;  1VQ8 V;  2OCC C;  2W0F C;  1NJI W;  2DWE C;  1MOF A;  4R6Z A;  1NKD A;  4MT8 A;  4Q20 A;  4PDR A;  1K4C C;  2ZR2 A;  2OTJ V;  4DXW A;  5L3D A;  3E83 A;  2Y48 A;  4HYO A;  3E2E A;  5DN6 G;  3LUT B;  2P6J A;  2DW4 A;  2XAQ A;  4WFH A;  3JYC A;  4BAY A;  5IDJ A;  5CBF A;  4MVZ A;  2DQ0 A;  3SPG A;  4J9Y B;  2DYS B;  2WLL B;  4I5S A;  5CA3 A;  5LGN A;  3OM3 B;  1K7D A;  1VQ7 V;  4FPP A;  2Y69 B;  3CCV V;  3W7X A;  2A79 B;  4R8C A;  1WPX A;  1OCO C;  2WLM A;  1SET A;  3GWO A;  4JAS A;  1NVP D;  3SPC A;  5IY5 B;  2QM8 A;  1NH2 D;  2CK3 G;  5EK0 A;  2HKO A;  4WFE A;  3X2Q B;  4WFG A;  5H6R A;  2EIJ C;  2XAG A;  2ZQM A;  3ETD A;  4OXS A;  2R9I A;  3D3I A;  4JAV A;  4X89 A;  5L3G A;  1AI7 A;  3CP1 A;  4WFB V;  4LC1 A;  1R6K A;  1PNM A;  1VQ9 V;  1RPO A;  3ZRW B;  3SYO A;  4QPK A;  1FXV A;  1V54 C;  5H6Q A;  3OEE G;  4MS2 A;  1R6N A;  3F7V C;  4YXW G;  3SYC A;  3W7W A;  2ITC C;  4RO2 A;  3JCZ A;  3CCE V;  1K73 W;  2X7R B;  3ETG A;  2WLI B;  1Q81 W;  3LNM B;  4PEL A;  4RUE A;  2EJR A;  2NLJ C;  3ZMZ A;  5LHH A;  1VQP V;  2EIM B;  1VQN V;  2WWW A;  2IU3 A;  2XOK G;  2UXN A;  3VOU A;  1CEZ A;  4P2Z A;  4KUM A;  3ZRW A;  2MK3 A;  3B77 A;  5KA6 A;  1F4N A;  2EIL C;  4R7C A;  4U7N A;  5EBM C;  3CCJ V;  4TSF G;  3OFN G;  5B3S B;  1YJN V;  2PI4 A;  3IC7 A;  4E2L A;  3FB6 C;  1AJP A;  1MSW D;  4GX5 A;  1YSC A;  3SPJ A;  2BOB C;  3FB5 C;  2H8P C;  3KG2 A;  1DTO A;  1K97 A;  4QNH B;  2ZDI A;  3DTU B;  1V55 B;  2IH1 C;  2EIN B;  4G27 B;  3ZN0 A;  2JIZ G;  1SZT A;  4LP8 A;  2Q67 A;  1KP3 A;  3QO7 A;  4GT1 A;  3SJQ C;  5IY5 C;  3EFF K;  2EZO A;  3AG4 C;  4DO2 A;  1VQ4 V;  2XAH A;  3X2Q C;  3UKM A;  4LBE C;  2R9R B;  4UVA A;  1SER A;  3W7U A;  1QVG U;  4JYB A;  5L3F A;  2X0L A;  3CPW U;  1MG1 A;  4HZ3 A;  3CC2 V;  1R73 A;  1GKF A;  1RPR A;  4MTF A;  2WSS G;  4XDJ A;  3JD1 A;  5CN0 A;  3E86 A;  3LSS A;  2LFR A;  1K8A W;  1Q82 W;  1I5Y A;  1QLE C;  4UXN A;  2QE7 G;  3OMN B;  1YJW V;  5LHI A;  1KP2 A;  1NQT A;  1WLE A;  3ABU A;  5E1A C;  2XAS A;  2LP7 A;  5B1A C;  1DF5 A;  4QE9 A;  3AG2 C;  1VQK V;  1K92 A;  2DQ3 A;  3TCU A;  3CC7 V;  3ETE A;  3AG1 B;  2W6I G;  3K3W A;  2X6B A;  5LGT A;  3F5W C;  4GX2 A;  2EIL B;  2X6C A;  5EC1 C;  3E89 A;  2IJK A;  3OE7 G;  3K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...