1SZTA

Atomic structure of a thermostable subdomain of hiv-1 gp41
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
b'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Atomic structure of a thermostable subdomain of HIV-1 gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1sztA00
1MG1A 2M7WA 2EZPA 4FIPC 4G2KA 3CP1A 2EBOA 3H01A 3P30A 3WFVA 4JPRA 1QR8A 1K33A 4N21A 4JF3A 1ENVA 3B77A 5CN0A 1MOFA 3CYOA 2OT5A 2EZOA 4E2LA 5H9CA 1JPXA 5CMUA 1Y4MA 1I5YA 1JQ0A 1K34A 1DF5A 4FJCC 5HFLA 5KA5A 1QR9A 3B8NA 1QBZA 4N23A 3MHSC 1EBOA 2P6JA 1I5XA 3B8MA 3K9AA 3GWOA 2LP7A 1F23A 3M99B 3MHHC 5HFMA 4JGSA 5KA6A 1QCEA 2MK3A 4FK5C 1SZTA 1DLBA 1Y66A 1DF4A 2X7RB
chains in the Genus database with same CATH superfamily
3CS5A 4DR6B 1Q82W 5J2TB 5IYBO 5BZBA 1Q8IA 1IZ3A 1R1BA 1BE3H 3CC4V 2LQTA 3THOA 1IXBA 4MVSA 3ZJZA 2OCCC 3ABMC 2IU3A 3RN4A 3LDCA 4P9OA 4ZI7B 5ITZA 5JH7B 1FXHA 2DYRC 2VQEB 4MVUA 3JARB 1H8HG 1N4CA 2KB1A 3E35A 5E79Z 3E8GA 4X20B 4NXNO 1HDJA 3ETQA 1K3EA 1KUQA 4UVBA 4YJ2A 3U10A 4K35A 2H94A 4TSFG 3H1HH 3FB7C 1OHHG 1WJZA 4UFZA 4JTCB 1E1QG 3F7YC 3RBZA 4ZHQA 4JZGA 5IJ0B 2ZE5A 3CCVV 3OUFA 4FLXA 1HP8A 3ASOB 4LF4O 3E22A 5L3FA 1YI2V 1XMQO 4QJFB 3CPWU 2HG5C 1M90W 1PM9A 3AEIA 1P49A 3PJSK 2QM8A 2GBOA 5CA0A 3QF7A 2N74A 5EIBD 2V7QG 4UCRA 1VQ7V 2CH7A 4DK1A 2LFSA 3BABA 4JI1O 3K9AA 1BHBA 1F23A 4OX9B 1CPYA 2YXHA 2QWOB 4TUYA 4TV9A 4YHHO 1XL4A 4DUZO 3K0GA 2LO1A 2R9AA 2IW5A 3FB6C 1UJWB 5IYDO 2UXDO 2HKOA 2ZCEA 4JAUA 5CN0A 3JSNA 2XAQA 2A0LA 1WP7A 2QE7G 4AILC 3JALB 1VIBA 3OR6C 4H33A 4K8XA 2L6LA 2WLLB 1Y66A 3BAAA 4IHJA 2BSKA 4BW5A 4NXMB 2F4VO 1TA8A 3E89A 1NVPB 1YJ9V 2ZR3A 4DR5O 1RPRA 3J7AU 3RYIB 1JMKC 3ZN0A 4HNAB 1U96A 2NLJC 1Q6IA 3WB1A 1CXZB 3M99B 4CH5A 1ZUQA 5IJ9B 1Y67A 3RVYA 4MT8A 1K8AW 3APOA 4X66B 3APQA 1DTOA 1J95A 4PELA 1PNKA 3N2KA 4PA4A 1E1RG 3ZHUA 3S3XA 5C8YA 2PUSA 3TK1A 4DV2O 4PA6A 1EBOA 3VQVA 3E2EA 4EKWA 3IC7A 5B66Z 4DV6O 2DW4A 2H8PC 5C93A 1S5JA 1JR9A 3E8FA 2X0LA 2P22C 4P9PA 4TT3G 1UFIA 2EINB 4DW0A 2F43G 1VP7A 1TUBA 4I9WA 1DLBA 3TXQA 2IU0A 3ZN1A 1YXBA 1JJOA 4ZBMA 1TUEB 4EB6A 3IJ4A 5B3SC 3EFFK 5EZYA 1YVWA 4R50A 3B2EE 4O2AA 5KHIA 3HKEA 3A8TA 3ZMZA 2IJKA 2Y69C 3RYHA 1OCOC 5L3EA 2RN9A 1I94B 1XMOO 1Q6HA 1RFYA 3MDSA 5L3GA 3RYCA 5LL6Y 4U7OA 4KHPO 1WPXA 2JGDA 4B3SO 1S77D 4B3TB 1B04A 3L72H 4JI6B 4DR4O 4LBEC 3S3WA 2Y0IA 4HBNA 2DMXA 2UUCB 1VARA 5FNVB 2RQ6A 1FS0G 2FKXA 4PA9A 1QLNA 1WP8A 2DE0X 1IBMB 3L70H 2YXYA 3ZBHA 4XDKA 1OCZB 3ZMTA 4JASA 4J80A 3CRCA 3WU2Z 4MW3A 1J5EB 3SYPA 1QR9A 3B8NA 1X59A 2HR3A 3CEIA 1QQCA 1VF5B 2CTQA 4PHZA 2E5LB 1PPJH 2ZT9B 4O4IB 3VQWA 1XMQB 3LDDA 2YIBA 3MD0A 4DRXA 1G8MA 2ZD9A 4UCOA 1DF5A 1FXVA 4D7SA 3A2FA 3UT5B 3AG4B 5LGUA 4NTYA 2QTOA 3CX5F 3L9DA 1MZEA 1HW7A 1TGOA 1M9NA 2QM7A 1ZLZA 3X2QB 4JI1B 3T1HB 1WNSA 4PA7A 1WA8A 4BWAA 3OMIB 2RNBA 3ML0A 4JAAA 5LGTA 3CCEV 3OUSA 2DQ0A 1P84F 2WLIB 4GKKO 5CMUA 3H9VA 3OR7C 5IYZB 2Q7GA 1FXKB 4X65O 2HJFC 1OCCC 2WA3A 2IBZH 3MHSC 3D3QA 4DR3O 1NBMG 4DR6O 2XAHA 5EBWC 5IY5C 1RM1C 4IIJB 3JD1A 2AHYA 2B5UA 1QVGU 4WFHA 4DR5B 4NVPA 4RWUA 2NNUA 1YJNV 4LF6O 4YIOA 1NR1A 2FTKA 2ZM6B 3H1JH 3ZIAG 3EHBB 3K9SA 3P3PA 1GN4A 2Q5ZA 1AP6A 4W4KA 1BZKA 4WFEA 1TVKB 5LOVB 5LHGA 2YIDA 5EYPB 3JD0A 1W0KG 1M4UA 3D36A 3UO2A 2VQEO 4WFGA 2CTRA 3E8BA 4RAIA 5H6QA 1MZFA 3SYCA 1VMGA 1IVSA 4IYHA 4NTWA 2A9HA 2EIKB 1GM8A 5IDJA 1HNXB 3GWOA 4C7UA 4JTAB 1PKXA 4J9ZB 3FYIB 4HYOA 5J2UB 3B4SA 3BY6A 1VF6C 4I50B 5E1AC 4UCUA 2CGOA 1V54B 3DXRB 5KX5B 4UUJC 4FJCC 2UXNA 1XILA 1KP3A 2Q73A 1OCRC 2RCVA 3ABLC 1I0HA 3AG2B 3CJHA 1XNRB 4TQFA 4JV5B 3F7VC 1VF6A 2M6YA 2UUBB 2PZSA 1DF4A 4KFMA 1EM1A 1QHTA 1NKDA 4DW1A 3OTFA 3WG7B 1NU1H 1O9HA 3JYCA 2PTMA 1LUWA 1R3KC 1AJQA 1S5LZ 2ZE7A 1BQ0A 4QIWF 1UPGA 2N05A 3K59A 1NT2B 3U11A 3E83A 5FPOA 1SQVH 4LWSA 4OX9O 3SPGA 2Q67A 1SETA 1N36O 1SF9A 3GVMA 1IURA 2EIMC 5BMVB 2FMLA 4J41A 3CCLV 1XMOB 3VBBA 1COWG 2KQXA 1YF2A 3WB2A 3ZRWB 2BTQB 4DK0A 1ZL8B 3SGIA 3W7UA 4KHPB 1G6UA 1OZ0A 5HFLA 2MW2B 1BT8A 3OM3B 3G6BA 4B3SB 1Z2GA 3K0DA 3DC5A 2QA4V 5LMNB 2CTPA 3BEHA 1AJNA 2YUAA 1YJWV 3CC7V 2RMKB 1N8RW 4NR1A 1THZA 1JFFB 3C90A 3CP1A 2YEVB 4NXMO 4O4LB 4H44B 2GTSA 1IBKB 4PD4F 1URFA 2KKWA 4GX2A 2LGQA 4PDLA 4GYCB 4I0XB 2RDCA 1VQ9V 3K5OA 3CB2A 4IGGA 4ABMA 4DV7O 3ICXA 3ZMVA 5H6RA 5J9PC 4MVMA 1MNGA 4X9QA 3T1YB 3ZMUA 1P7BA 3O65A 5LHHA 4X66O 3OT7A 1XQ8A 4X1IA 1E79G 5K1XA 5GW7A 3JAKA 3OGCC 4WF9V 4I4TA 2L35A 2QEXV 3N2GA 2VQFO 1ZTEA 4TQDA 2C2AA 3K5NA 2ZNIA 2DQ3A 2UXBB 4I7ZB 4F6EA 4DV4B 2JS5A 1NI8A 5B1AC 3SYOA 1QR8A 5ITZB 4FVMA 5JWPA 4X1KA 3T4ZA 5CA3A 4MW8A 1N0NA 3JD2A 4O4JA 4B7KA 4CC6A 1QLEC 3ETEA 4JI5B 2UU9B 2OCCB 1F51A 5CA1A 3ABMB 4X65B 1NH2D 3LSSA 5F2VO 1FFXA 4YJ2B 3H1IH 2DYRB 5BY1A 3TGUH 3P30A 3QG5A 5JQGA 3C3TA 3LNNA 2B9ZA 1YITV 3W7TA 3L75H 1I08A 3CCMV 2F95B 4ZHQB 1HR0B 1FJGB 4JYYA 4LF6B 3AK2A 1FKAO 2P7TC 2WLMA 1I94O 3QO7A 4AQYO 3L74H 1GM9A 4CS4A 1FFTB 2ILMA 4B3TO 5CA0B 4JI6O 4LFAB 3PN1A 5KHKA 3CC2V 5H2FZ 2CH7B 2UUCO 3T2MA 5JCOC 5BXZA 4J7KA 4TUYB 4TV9B 4GKJB 2G38A 1IBMO 4AHCA 2P4KA 1IX9A 3ABKC 1R73A 4ASUG 1GK9A 2ZR2A 2QGNA 3HKBA 5GONB 4GX0A 1M57C 4I55A 1J5EO 5JCOA 3FFQA 1VEWA 1BGYH 1TAEA 2RJZA 3JAMN 3DC6A 4RUFA 2E5LO 1KD1W 3A0BZ 1QU7A 2MK3A 2YSUB 4IHJB 2LFRA 2BSKB 4K8ZA 1MG1A 1Q5OA 3NXSA 3H01A 3AG7A 5EC2C 2PY5A 2O57A 4QNHB 1KMIZ 5L3BA 2WLKA 4IT5A 2EZOA 2ITCC 4LH7A 2WWWA 2GDSA 4JTDB 3TETA 2IJHA 1MABG 4X89A 2Q69A 4EFBA 4G28B 1XHXA 3EXAA 4X64O 3T1HO 1BCCH 3SYAA 5D5PA 3AG1C 4CS3A 1N36B 1H2SB 2Z0AA 2EJRA 2IH3C 3HKCB 2UUAB 4OPHA 1VQLV 1WPBA 3N2KB 2OWOA 3ZMSA 1GMGA 1YDXA 4B3MB 1QCEA 2PGGA 5LBQA 3OGIB 4YY3B 2XT9A 4LF8O 2A79B 4DV1B 2EBOA 3K08A 1AR1B 3ASOC 3CWBH 3OTOB 1HWYA 3W7XA 3J80N 1KU9A 3DSQA 1KYOF 1L1FA 4K3AA 1QVFU 1YZBA 3G80A 4WFFA 1MMMA 2ZM6O 2QM4A 5CB4A 4TWKA 4TV8A 2ZXWC 4DV7B 1TUBB 3B09A 1B06A 3CE2A 2WSSG 4JPRA 3L71H 4EB6B 4G27B 4I9QA 1XBLA 1YSCA 2A7WA 4O2BA 4WBNA 2K1EA 1WAZA 4Q20A 4O2AB 1NQTA 3HKEB 2DOSA 3JSLA 1HNXO 1GN6A 2VQFB 4MVZA 1H2KA 4MTXA 4TOIA 3CCRV 3P3NA 3RYHB 1R6TA 1Y74A 4X8AA 3OEHG 3UKMA 2Y4UA 1AI6A 2HEPA 2EX3A 2JGDB 4ZOLA 2CGNA 3ASNB 1IDSA 1M93A 2GSMB 2Y69B 1OCOB 3SYQA 4UCSA 4UCTA 1XNRO 5JJJB 4DR2O 4JV5O 2GUZA 3AG3C 2UUBO 5CBFA 3SR2C 1YHQV 2QWNB 1ZX3A 1EN6A 5DEDA 2WLJA 1D2DA 4D7TA 1SQBH 1M56C 1JPXA 1PL0A 2Y4TA 4HNAA 1XL6A 4GX5A 1NTMH 2P6JA 3GWKC 2ODMA 4MTFA 5LP6C 2ZQMA 1MSWD 2NR5A 3ZEDA 5L3DA 4DXWA 1FD9A 3SJQC 4CH4A 1K73W 4AQYB 4QE7A 1BQZA 4DRXB 1ZAUA 2QKCA 2IJJA 3Q4HB 1CEZA 3JAWA 3FAVA 4RQFA 5LMNO 5LP6A 2OYQA 1JOYA 2OTLV 4CS2A 3QO5A 5JVDA 1NZ6A 5BR8B 2EULA 3CXHF 1WA8B 1AI5A 1R3JC 3UQ8A 5LYJA 2EINC 4JYAB 4LP8A 1IBKO 4NKGB 3B40A 1JCHA 1AP5A 1NH2B 2K9PA 3STZC 3FKSG 3T4DA 3CCUV 2QWQB 4QGPA 3OFNG 3W7WA 4EEQA 2P06A 2YDEA 4GT1A 5HFMA 3AK3A 3T1YO 2LGWA 3C3SA 1N33B 4UCVA 4LNUA 4MTOA 1K5SA 4FLUA 1F7YA 1D5NA 2B1IA 1HNWO 4PJ0Z 4B3RB 2E74B 3KCYA 2UXBO 3JASA 5IY5B 5KMGA 1RM1B 3RYFA 5DECA 1YTFD 2AZ0A 4DV4O 1D5AA 1GAXA 3O9OA 4X64B 1R3IC 5FLXN 2R9RB 2JJ2G 2Q0AA 1RSOA 5JJEB 2YIAA 2PI4A 4F6RA 4FLTA 1PD3A 2DYSC 4GX1A 3ABTA 3RVZA 1OCZC 4JI5O 2UU9O 2X6CA 2A3QA 2DJVA 4UVAA 3P32A 5IYCO 1GM7A 1Z5WA 1VF7A 5KAFZ 4RUEA 2XTAA 1XDCA 4LH6A 3CMAV 4RO2A 4LF8B 2OTJV 4UB8Z 3H1KH 2CE4A 2YXLA 2HJDA 3JATA 1HR0O 1FJGO 5KA5A 4J11A 5LA6A 4JAVA 4FZ0A 3CJHB 2ZNJA 1EZJA 3AG4C 4FK5C 3WFVA 1MSDA 1VQKV 1XUQA 3VQXA 1OCRB 3CYOA 4JI3B 4D6TH 5IT9N 4J7JA 4LFAO 4FFBB 1AB3A 3J81N 2KG7A 3F5WC 4LWSB 4FM2A 4GKJO 1Q43A 5KHJA 3A0RA 4MTGA 4JF3A 3ZHQA 2BCCH 4QE9A 5KLVH 4BAYA 3HB3B 4DV5O 2EIMB 1Y76A 1XI1A 2LW1A 1U97A 3RW0A 4J7ZA 4DR2B 4O4HB 1SQPH 1LUVA 4ICGA 5KAIZ 1WB7A 3G67A 2EILC 4MVRA 4PDMA 2ARHA 1V9PA 1ROPA 2EIJC 1KECA 2JS3A 3D8CA 4RQEA 1SERA 2VWKA 3RFRA 2FYUH 3M8AA 4FMTA 2PF4E 3FYEB 3CRRA 3K06A 3SDLA 2QWRB 1SQQH 4GCZA 4FLWA 1DK1A 5JJNB 4DV0O 5L3CA 5LOVA 1SZXA 1PNMA 3DTUB 4X1IB 1Q6UA 3AK1A 2UUAO 4DO2A 2UXCO 3JAKB 4I4TB 3RT3C 1HNZB 4K0KO 5KHHA 3N2GB 4CH6A 4U3JA 4B3MO 1NS1A 4CBCA 1V54C 1YIJV 3K04A 4CC5A 4YY3O 2JDIG 4J42A 4DV1O 3AG2C 2ZIMA 1MA1A 3TJTA 1YCIA 1Q7YW 4X1KB 3SJAC 4P2ZA 4BIZA 3OTOO 2H3OA 3IFXA 2E75B 4O4JB 1M5IA 5DN6G 2CTWA 1VQOV 3RGBA 3OD4A 5CA1B 1AJPA 3EVKA 2ETNA 2AGAA 5B1AB 1GH6A 1K97A 1FFXB 3D3IA 4LFCB 4JI0B 2X7RB 1H2GA 3UCSC 5JQGB 3HKDA 3I55V 3G6EV 3SJBC 1HNWB 1H2NA 2Q0OC 1F4MA 2N04A 1H38A 2QWPB 3I5DA 5A2QN 5B1NA 3QNEA 5FL7G 1H8EG 4J9YB 2PI5A 2PYJA 4FFKA 2BOCC 2XNDG 5KUMA 5BMVA 3JCZA 2QDOA 4H37A 3CRQA 3R65A 3KG2A 1JA8A 4YJ3A 2QR4A 1ZL8A 1Y4MA 5EBLC 1KP2A 3IAYA 2HP8A 5K1PA 4DUYB 2FL4A 4PA3A 2QJ1A 1ZWIC 3UM7A 2B1GA 1NR7A 1LR1A 1PV0A 4LF9B 2YEVA 1P7GA 4E4EA 1N0JA 1Q90D 4X1YA 3HKBB 3BRCA 3OW2U 4I55B 5B1OA 4DR7B 4LFBB 2JIZG 1AR5A 4JZ2A 5GTIZ 3ABKB 2D2CB 4Z2WA 1ORQC 3ZHVA 5LGNA 2OIGA 3E22B 4XBFA 4OGQB 3HR0A 2VWJA 4DR1O 1AR4A 1M57B 5GTHZ 3CRMA 1GO3F 4LC1A 3ZRSA 1V55C 3B77A 3L73H 4XDJA 5AG2A 1YTFB 3M7MX 2DWDC 5B1BC 1SA0A 4DYLA 2Y48A 2V4DA 1WLEA 4PI2A 1BMFG 2GHYA 2AW9A 3LSUA 2XAFA 1DGSA 1S76D 3W7SA 5BR8O 3LDEA 2CK3G 2NN4A 1XNQO 1PNLA 2CDYA 1NJIW 2Q9LA 4JYAO 1W2BU 2VS0A 1KKCA 2Q6AA 4DV3B 4UB6Z 2VRZA 4NTXA 2AHZA 3OE7G 4QPJA 2W6IG 3AG1B 3ZCCA 3TCUA 2IH1C 5LXTA 3LSQA 5TISZ 4DV5B 2XHBA 4JI7B 1EZVH 2EJ7A 1N33O 1KBHA 4MS2A 4FLYA 5A9GA 3BA9A 5J2TA 1K9MW 1GN2A 2Y0PA 3G71V 4JYBA 1K34A 4B3RO 3MAQA 4F4LA 4L8JA 1T5EA 3UO3A 5CB4B 3ZS8C 4TV8B 2W6JG 2P5OA 4FLZA 4YIPA 4DV0B 1CP9A 2PYLA 4ZI7A 4O2BB 4WBNB 1N34B 1S3JA 5JH7A 2ZXWB 1I5YA 4BIUA 4WCEV 2UXCB 1EFRG 3CSXA 3JARA 5C8YB 4K0KB 4N23A 1BHAA 2LW7A 4JI8B 1K4DC 1Y74B 4X20A 5KA6A 4FPPA 2AZ2A 3I56V 3A0HZ 2OIEA 4ZOLB 1L0LH 5GONA 1W59A 3HPLC 1US6A 2F1MA 5H5NA 2P4VA 3RWRD 1S5HC 2GV9A 5IJ0A 1VQ5V 2OCHA 2GUZB 3K58A 3MHHC 4J10A 4GUNA 4Q6GA 4KUMA 1RP3B 2WPDG 2BTOA 1IBLB 2ZINA 3JCUZ 1VQMV 4JI3O 3CRAA 3LUTB 5EZYB 4H13B 4JI4B 3AG3B 2HVKC 1QBZA 2ZKOA 3K3WA 3B8MA 2HLDG 1XHZA 4MVOA 4JGSA 5FPRA 2GTAA 1FYJA 1AVMA 3IC9A 5B3SB 3CCJV 3RYCB 1M56B 4G2KA 3OEEG 3FX7A 1B6QA 2JEUA 1Z5VA 3HKCA 1A32A 1FPOA 3JAWB 3FAVB 1LNQA 5LP6B 1JJ2U 4R7CA 5JVDB 4X62B 4A5UB 3JALA 4U7NA 4L87A 2HHHB 2WAMA 4LF7B 1KKDA 1FAFA 2YI9A 3ZX6A 2WLLA 5LYJB 3SPHA 2Q7EA 3BCCH 4U3FH 4EFEA 1MOFA 1R6KA 2QSAA 3JD3A 1SQGA 5LMUB 4KL1A 1KB9F 1N32B 1SQXH 4UXNA 3RYIA 3CD6V 5EBMC 3FB8C 4KXRA 5IJ9A 2BOBC 4NB5A 3KCXA 4LNUB 1WB8A 4DR1B 4BIOA 5KHGA 4GLXA 2UXXA 4FLVA 4I5SA 1HNZO 4JI2O 3K57A 3JASB 2A06H 5KMGB 3ASNC 3RYFB 4R8CA 2ZIOA 1BS3A 3SPIA 2YC0A 3CMEV 3ZRXA 1YEWA 4AI8A 2F66C 4PI0A 1XNQB 2EZPA 1RSOB 4F6RB 4Z1MG 4N21A 5CBHA 1RPOA 4P30A 3K5MA 1EN5A 4WFAV 1QNMA 4PV1B 3CCSV 3OAAG 2Q68A 2QTSA 2WA4A 4LF5O 1XREA 4LFCO 2YI8A 4B08A 4NXNB 2DYSB 4JI0O 3SJCC 5EK0A 4FM0A 3CXCU 4UV8A 4IL6Z 2W0FC 4IYIA 4E2LA 1VQNV 1VQ6V 3JATB 1OCCB 1KQSU 3ZHTA 5LA6B 2F93B 2HFEC 2XASA 1P4RA 3NR7A 5H9CA 4LF4B 3BHPA 4GZRB 1K33A 2QKAA 4X88A 3H1LH 3QO8A 5B5EZ 3BVOA 3Q4HA 4DUYO 2KG7B 2ADQB 2Q4PA 2P67A 1W0JG 1BSMA 4Z1VA 1PP9H 5IWAO 5FNVA 1AILA 4YHHB 4LF9O 2XOKG 4DUZB 2XAGA 1SS3A 1PL4A 1B3QA 1H2LA 3OMNB 3QTCA 1NTZH 3FB5C 2ATKC 4HZ3A 4DR7O 4PDVA 4LFBO 2UXDB 2XUMA 4JYCA 2LJ2A 1Y76B 3KKYA 1AI4A 4LR3A 4FM1A 1K5QA 5KUKA 3R66A 3E86A 4OPAA 2W0XA 1L8DA 4PDRA 1XOUA 3DGEA 4O4IA 2ADPA 4R6ZA 2F4VB 3X2QC 1BL8A 2JRIA 4ZIBA 3ABLB 2E3CA 4YXWG 1SC5B 3D36C 2E76B 3UT5A 1VQ4V 1SQFA 3QVNA 2R72A 3LNMB 3IGAC 1L0NH 4QPKA 1JX9A 3ETDA 2ZDIC 2EILB 1Q81W 1FXKC 1S0VA 4LCUC 2EIJB 4WFBV 1GN3A 1K92A 2R9IA 4XDLA 3K79A 4DV3O 3K03A 3F5TA 2BE3A 2WLIA 1Q3EA 2IJIA 1IXMA 4NYKA 3STLC 2HVJC 4W4LA 2ZDIA 4U3JB 2Z5UA 3CHXA 5IYZA 1Q86W 1FXKA 2ZE6A 4DV2B 4BW9A 4JI7O 1S72V 2CUGA 1SZTA 4UVCA 2YICA 4DV6B 2V1DA 1WN7A 1SRYA 1AROP 4IIJA 5DM6V 3CCQV 1GRJA 2WLNA 4FZ1A 5EIBC 3WB0A 3E8HA 1H2MA 2ITDC 3N27A 1NVPD 2X6AA 3OMAB 3ZHSA 1R6NA 3K5LA 1Y6XA 3HKDB 2EIKC 4HAMA 2JK5C 1TVKA 1R3LC 5EYPA 1N34O 2OT5A 3BFRA 1M1KW 2Z3YA 3ETGA 1O9GA 4FFBA 4JI2B 3BA8A 4MVQA 3JD4A 3VOUA 4JI8O 1GKFA 3ZRVA 4UV9A 5CBGA 2F23A 2CAZC 2KSDA 3GB7C 3VQYA 4YJ3B 5LHIA 5J2UA 4I50A 2P90A 2YS8A 1OV9A 1XEQA 3WG7C 3DXRA 5KX5A 2QKSA 1KC8W 4DR4B 3BPZA 1SESA 5EC1C 2D3OW 1I5XA 1AI7A 4O4HA 4LF5B 3FD9A 1IBLO 4X1YB 3G4SV 1VQPV 1QLEB 2JGUA 4JI4O 1SKVA 3TXSA 2ZE8A 1JQ0A 5IE9A 4KP4A 2JJ1G 2DN9A 3ABUA 4CZZA 2FB5A 1NTKH 1G4YB 4CH3A 1EN4A 3SPCA 2LP7A 2M7WA 4FIPC 1OJHA 1I7FA 1ZSPA 2WLHA 2Q8VA 1ENVA 1F4NA 3ZRWA 1SA0B 1JVMA 2XAJA 2BTQA 3KZIZ 1VQ8V 4X62O 2YIBD 2AXTZ 2R70A 2JEXA 2HHHO 4LF7O 1GTOA 3ZHRA 1V55B 4OXSA 5IWAB 3T1CA 1JFFA 1K7DA 5B1BB 4O4LA 2Q7HA 1G1XB 4MSWC 3U0ZA 5D5QA 4H0LB 5LMUO 4GKKB 1N32O 1K4CC 2DWEC 5LXTB 4I0XA 2X6BA 4B7EA 4BR6A 2JVDA 3SPJA 2IM9A 4DR3B 1X4TA 4ZKIA
chains in the Genus database with same CATH topology
4KUMA 1Q82W 1NKDA 2WPDG 3WG7B 4MTOA 1K5SA 3JYCA 5IYBO 5BZBA 1VQMV 3LUTB 1R3KC 1AJQA 4QIWF 2B1IA 3AG3B 2HVKC 1QBZA 3E83A 3CC4V 5IY5B 3K3WA 1RM1B 3B8MA 2HLDG 3SPGA 2Q67A 1SETA 4MVOA 4JGSA 1YTFD 4MVSA 3ZJZA 2OCCC 1R3IC 2EIMC 5B3SB 3CCJV 1M56B 3ABMC 4G2KA 3CCLV 2IU3A 2R9RB 3VBBA 2JJ2G 3LDCA 4P9OA 3OEEG 2PI4A 1B6QA 2JEUA 1COWG 1PD3A 2DYSC 3ZRWB 4GX1A 3ABTA 1FXHA 2DYRC 3W7UA 3RVZA 1LNQA 4MVUA 1OZ0A 1OCZC 1H8HG 5HFLA 3OM3B 2X6CA 3K0DA 1JJ2U 4R7CA 2QA4V 4UVAA 2KB1A 3P32A 3E35A 3BEHA 4U7NA 1AJNA 3E8GA 4L87A 5IYCO 1GM7A 2WAMA 1KKDA 1YJWV 1K3EA 3CC7V 1N8RW 4RUEA 2WLLA 1THZA 3SPHA 4UVBA 3CMAV 3CP1A 2YEVB 4RO2A 2OTJV 4GX2A 1MOFA 2H94A 1R6KA 4PDLA 3JD3A 4TSFG 3FB7C 1OHHG 4JTCB 5KA5A 1S0VA 4UXNA 1E1QG 3F7YC 3RBZA 1VQ9V 3CD6V 4JAVA 3ZMVA 3CCVV 5EBMC 3OUFA 5H6RA 1EZJA 3AG4C 3FB8C 5J9PC 4MVMA 4FK5C 3ASOB 2BOBC 3ZMUA 5L3FA 1YI2V 1P7BA 4QJFB 5LHHA 3WFVA 1VQKV 3CPWU 2HG5C 1M90W 2UXXA 1E79G 3AEIA 1OCRB 3CYOA 4I5SA 5GW7A 3PJSK 3OGCC 2QM8A 4WF9V 2QEXV 3F5WC 2V7QG 1VQ7V 2C2AA 3ASNC 2LFSA 2DQ3A 4R8CA 3K9AA 1BHBA 3SPIA 1F23A 3CMEV 3ZRXA 1CPYA 1XL4A 3K0GA 2EZPA 3A0RA 5B1AC 3SYOA 1QR8A 4Z1MG 2IW5A 3FB6C 4N21A 5CBHA 1UJWB 1RPOA 4MTGA 4JF3A 3T4ZA 5CA3A 5IYDO 2HKOA 4MW8A 4JAUA 4P30A 5CN0A 4WFAV 3JD2A 2XAQA 3CCSV 4QE9A 2A0LA 1QLEC 3ETEA 3HB3B 4BAYA 3OAAG 2QE7G 2OCCB 2EIMB 1F51A 3ABMB 3OR6C 4H33A 2Q68A 1NH2D 3RW0A 2WLLB 3LSSA 2DYSB 1Y66A 5EK0A 2DYRB 4BW5A 3P30A 3CXCU 4UV8A 2W0FC 1YITV 3W7TA 3E89A 2EILC 4MVRA 1NVPB 4PDMA 2ZR3A 1YJ9V 3CCMV 1RPRA 1ROPA 2EIJC 4E2LA 1VQNV 1VQ6V 1OCCB 1KECA 1KQSU 3ZN0A 4RQEA 1SERA 4FMTA 2NLJC 3FYEB 3K06A 2P7TC 2WLMA 2HFEC 2XASA 3M99B 1P4RA 4GCZA 3QO7A 3RVYA 5H9CA 4MT8A 1K8AW 5L3CA 1K33A 3DTUB 1PNMA 1GM9A 1DTOA 1J95A 4X88A 4DO2A 1FFTB 3QO8A 1Q81W 4PELA 1PNKA 4PA4A 1E1RG 3CC2V 3TK1A 4PA6A 4CBCA 1V54C 2P67A 1EBOA 3T2MA 3E2EA 1W0JG 1YIJV 4EKWA 3K04A 3IC7A 2JDIG 2XOKG 3AG2C 2XAGA 3ABKC 1Q7YW 1R73A 2DW4A 2H8PC 3OMNB 4ASUG 5C93A 4P2ZA 1GK9A 4BIZA 3FB5C 2ATKC 4HZ3A 2ZR2A 4PDVA 3IFXA 3E8FA 4JYCA 2X0LA 4GX0A 1M57C 5DN6G 4P9PA 1VQOV 4TT3G 1AJPA 1AI4A 5B1AB 1K5QA 2EINB 4RUFA 2F43G 1K97A 1KD1W 3D3IA 5KUKA 4I9WA 2MK3A 2YSUB 1DLBA 2LFRA 2IU0A 3ZN1A 3E86A 2X7RB 1H2GA 1MG1A 3NXSA 3H01A 4ZBMA 1TUEB 5EC2C 4PDRA 3DGEA 4R6ZA 3I55V 3X2QC 3G6EV 1BL8A 4QNHB 5L3BA 5B3SC 2WLKA 3EFFK 2EZOA 2ITCC 4R50A 3ABLB 2WWWA 4JTDB 4YXWG 3TETA 2IJHA 1VQ4V 1MABG 3LNMB 3IGAC 4X89A 2Q69A 1F4MA 4QPKA 1JX9A 4G28B 3ETDA 1H38A 3ZMZA 2ZDIC 2IJKA 2Y69C 2EILB 1OCOC 3SYAA 1FXKC 3AG1C 3QNEA 1H8EG 5FL7G 4LCUC 4J9YB 5B1NA 5L3EA 2EIJB 2PI5A 2BOCC 2XNDG 5KUMA 5L3GA 3JCZA 1K92A 4WFBV 2R9IA 4H37A 4XDLA 3K79A 3R65A 3K03A 2EJRA 3KG2A 2IH3C 4U7OA 1WPXA 1VQLV 2WLIA 2IJIA 1Y4MA 5EBLC 1IXMA 3STLC 1KP2A 1S77D 3ZMSA 2HVJC 4LBEC 2ZDIA 2Z5UA 1GMGA 1Q86W 1FXKA 4PA3A 1ZWIC 1S72V 3UM7A 1FS0G 1QCEA 4PA9A 1SZTA 2B1GA 4UVCA 5LBQA 1QLNA 1NR7A 2A79B 2EBOA 2YEVA 3K08A 1AR1B 2V1DA 4XDKA 3ASOC 1SRYA 1OCZB 1AROP 3ZMTA 5DM6V 1HWYA 3W7XA 4JASA 3CCQV 3OW2U 2WLNA 5B1OA 4MW3A 1L1FA 1QVFU 3SYPA 2JIZG 3E8HA 4WFFA 1QR9A 3B8NA 2ITDC 2HR3A 4TWKA 3ABKB 2X6AA 1NVPD 2ZXWC 3OMAB 1R6NA 1ORQC 5LGNA 4XBFA 2WSSG 2EIKC 4HAMA 1M57B 2JK5C 4JPRA 4G27B 1R3LC 3LDDA 3MD0A 1GO3F 4LC1A 3ZRSA 1V55C 1YSCA 3B77A 4XDJA 1YTFB 1G8MA 2OT5A 2DWDC 2K1EA 2ZD9A 5B1BC 1M1KW 2Y48A 2Z3YA 4Q20A 1DF5A 1WLEA 1FXVA 3ETGA 1NQTA 3AG4B 5LGUA 2QTOA 4MVQA 1BMFG 3JD4A 2GHYA 2XAFA 3VOUA 1S76D 4MVZA 3W7SA 1M9NA 1GKFA 2QM7A 4MTXA 3LDEA 3ZRVA 4UV9A 5CBGA 2CK3G 3CCRV 3X2QB 1PNLA 1NJIW 4X8AA 3GB7C 4PA7A 3OEHG 3UKMA 1W2BU 3OMIB 3ML0A 5LGTA 3CCEV 2Q6AA 1AI6A 3OUSA 5LHIA 2DQ0A 2P90A 2WLIB 5CMUA 2AHZA 3ASNB 3OE7G 4QPJA 3WG7C 2W6IG 3OR7C 2GSMB 2Y69B 1OCOB 1FXKB 3AG1B 2QKSA 3SYQA 3TCUA 2IH1C 3ZCCA 1KC8W 3LSQA 1SESA 2HJFC 1OCCC 3MHSC 5EC1C 2D3OW 1I5XA 3AG3C 1AI7A 5CBFA 1NBMG 1YHQV 2XAHA 5EBWC 5IY5C 4MS2A 1RM1C 3JD1A 3G4SV 1K9MW 2WLJA 1VQPV 1QLEB 2AHYA 2B5UA 3G71V 1QVGU 4WFHA 1M56C 1JPXA 4JYBA 1JQ0A 1K34A 1PL0A 4KP4A 2JJ1G 2NNUA 1YJNV 4F4LA 1NR1A 3ABUA 4CZZA 1XL6A 4GX5A 2FTKA 2W6JG 1G4YB 2P6JA 3ZIAG 3SPCA 2LP7A 3EHBB 4MTFA 2ZQMA 1MSWD 2M7WA 4FIPC 5L3DA 4WFEA 4DXWA 3SJQC 5LHGA 1K73W 4QE7A 1CP9A 2WLHA 1W0KG 3JD0A 1ENVA 1F4NA 3D36A 2IJJA 1S3JA 3ZRWA 1JVMA 2XAJA 4WFGA 1VQ8V 1CEZA 2ZXWB 3E8BA 1I5YA 4BIUA 4WCEV 4RAIA 5H6QA 1EFRG 3SYCA 4RQFA 1JOYA 2JEXA 4N23A 2OTLV 2A9HA 2EIKB 1BHAA 3QO5A 1GM8A 5IDJA 1GTOA 1K4DC 3GWOA 5KA6A 1V55B 4FPPA 1AI5A 4JTAB 4OXSA 1PKXA 4J9ZB 1R3JC 3FYIB 4HYOA 3T1CA 1K7DA 5B1BB 2EINC 4LP8A 3BY6A 3I56V 5E1AC 4MSWC 1JCHA 1NH2B 3STZC 3FKSG 3HPLC 3T4DA 3CCUV 1V54B 1K4CC 4UUJC 4FJCC 2DWEC 2UXNA 1KP3A 2X6BA 1OCRC 1S5HC 3ABLC 3SPJA 3AG2B 3OFNG 3W7WA 1VQ5V 3MHHC 4GT1A 5HFMA 3F7VC 4ZKIA 1DF4A 4KFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  2M7W A;  2EZP A;  4FIP C;  4G2K A;  3CP1 A;  2EBO A;  3H01 A;  3P30 A;  3WFV A;  4JPR A;  1QR8 A;  1K33 A;  4N21 A;  4JF3 A;  1ENV A;  3B77 A;  5CN0 A;  1MOF A;  3CYO A;  2OT5 A;  2EZO A;  4E2L A;  5H9C A;  1JPX A;  5CMU A;  1Y4M A;  1I5Y A;  1JQ0 A;  1K34 A;  1DF5 A;  4FJC C;  5HFL A;  5KA5 A;  1QR9 A;  3B8N A;  1QBZ A;  4N23 A;  3MHS C;  1EBO A;  2P6J A;  1I5X A;  3B8M A;  3K9A A;  3GWO A;  2LP7 A;  1F23 A;  3M99 B;  3MHH C;  5HFM A;  4JGS A;  5KA6 A;  1QCE A;  2MK3 A;  4FK5 C;  1SZT A;  1DLB A;  1Y66 A;  1DF4 A;  2X7R B; 
#chains in the Genus database with same CATH topology
 3CS5 A;  4DR6 B;  1Q82 W;  5J2T B;  5IYB O;  5BZB A;  1Q8I A;  1IZ3 A;  1R1B A;  1BE3 H;  3CC4 V;  2LQT A;  3THO A;  1IXB A;  4MVS A;  3ZJZ A;  2OCC C;  3ABM C;  2IU3 A;  3RN4 A;  3LDC A;  4P9O A;  4ZI7 B;  5ITZ A;  5JH7 B;  1FXH A;  2DYR C;  2VQE B;  4MVU A;  3JAR B;  1H8H G;  1N4C A;  2KB1 A;  3E35 A;  5E79 Z;  3E8G A;  4X20 B;  4NXN O;  1HDJ A;  3ETQ A;  1K3E A;  1KUQ A;  4UVB A;  4YJ2 A;  3U10 A;  4K35 A;  2H94 A;  4TSF G;  3H1H H;  3FB7 C;  1OHH G;  1WJZ A;  4UFZ A;  4JTC B;  1E1Q G;  3F7Y C;  3RBZ A;  4ZHQ A;  4JZG A;  5IJ0 B;  2ZE5 A;  3CCV V;  3OUF A;  4FLX A;  1HP8 A;  3ASO B;  4LF4 O;  3E22 A;  5L3F A;  1YI2 V;  1XMQ O;  4QJF B;  3CPW U;  2HG5 C;  1M90 W;  1PM9 A;  3AEI A;  1P49 A;  3PJS K;  2QM8 A;  2GBO A;  5CA0 A;  3QF7 A;  2N74 A;  5EIB D;  2V7Q G;  4UCR A;  1VQ7 V;  2CH7 A;  4DK1 A;  2LFS A;  3BAB A;  4JI1 O;  3K9A A;  1BHB A;  1F23 A;  4OX9 B;  1CPY A;  2YXH A;  2QWO B;  4TUY A;  4TV9 A;  4YHH O;  1XL4 A;  4DUZ O;  3K0G A;  2LO1 A;  2R9A A;  2IW5 A;  3FB6 C;  1UJW B;  5IYD O;  2UXD O;  2HKO A;  2ZCE A;  4JAU A;  5CN0 A;  3JSN A;  2XAQ A;  2A0L A;  1WP7 A;  2QE7 G;  4AIL C;  3JAL B;  1VIB A;  3OR6 C;  4H33 A;  4K8X A;  2L6L A;  2WLL B;  1Y66 A;  3BAA A;  4IHJ A;  2BSK A;  4BW5 A;  4NXM B;  2F4V O;  1TA8 A;  3E89 A;  1NVP B;  1YJ9 V;  2ZR3 A;  4DR5 O;  1RPR A;  3J7A U;  3RYI B;  1JMK C;  3ZN0 A;  4HNA B;  1U96 A;  2NLJ C;  1Q6I A;  3WB1 A;  1CXZ B;  3M99 B;  4CH5 A;  1ZUQ A;  5IJ9 B;  1Y67 A;  3RVY A;  4MT8 A;  1K8A W;  3APO A;  4X66 B;  3APQ A;  1DTO A;  1J95 A;  4PEL A;  1PNK A;  3N2K A;  4PA4 A;  1E1R G;  3ZHU A;  3S3X A;  5C8Y A;  2PUS A;  3TK1 A;  4DV2 O;  4PA6 A;  1EBO A;  3VQV A;  3E2E A;  4EKW A;  3IC7 A;  5B66 Z;  4DV6 O;  2DW4 A;  2H8P C;  5C93 A;  1S5J A;  1JR9 A;  3E8F A;  2X0L A;  2P22 C;  4P9P A;  4TT3 G;  1UFI A;  2EIN B;  4DW0 A;  2F43 G;  1VP7 A;  1TUB A;  4I9W A;  1DLB A;  3TXQ A;  2IU0 A;  3ZN1 A;  1YXB A;  1JJO A;  4ZBM A;  1TUE B;  4EB6 A;  3IJ4 A;  5B3S C;  3EFF K;  5EZY A;  1YVW A;  4R50 A;  3B2E E;  4O2A A;  5KHI A;  3HKE A;  3A8T A;  3ZMZ A;  2IJK A;  2Y69 C;  3RYH A;  1OCO C;  5L3E A;  2RN9 A;  1I94 B;  1XMO O;  1Q6H A;  1RFY A;  3MDS A;  5L3G A;  3RYC A;  5LL6 Y;  4U7O A;  4KHP O;  1WPX A;  2JGD A;  4B3S O;  1S77 D;  4B3T B;  1B04 A;  3L72 H;  4JI6 B;  4DR4 O;  4LBE C;  3S3W A;  2Y0I A;  4HBN A;  2DMX A;  2UUC B;  1VAR A;  5FNV B;  2RQ6 A;  1FS0 G;  2FKX A;  4PA9 A;  1QLN A;  1WP8 A;  2DE0 X;  1IBM B;  3L70 H;  2YXY A;  3ZBH A;  4XDK A;  1OCZ B;  3ZMT A;  4JAS A;  4J80 A;  3CRC A;  3WU2 Z;  4MW3 A;  1J5E B;  3SYP A;  1QR9 A;  3B8N A;  1X59 A;  2HR3 A;  3CEI A;  1QQC A;  1VF5 B;  2CTQ A;  4PHZ A;  2E5L B;  1PPJ H;  2ZT9 B;  4O4I B;  3VQW A;  1XMQ B;  3LDD A;  2YIB A;  3MD0 A;  4DRX A;  1G8M A;  2ZD9 A;  4UCO A;  1DF5 A;  1FXV A;  4D7S A;  3A2F A;  3UT5 B;  3AG4 B;  5LGU A;  4NTY A;  2QTO A;  3CX5 F;  3L9D A;  1MZE A;  1HW7 A;  1TGO A;  1M9N A;  2QM7 A;  1ZLZ A;  3X2Q B;  4JI1 B;  3T1H B;  1WNS A;  4PA7 A;  1WA8 A;  4BWA A;  3OMI B;  2RNB A;  3ML0 A;  4JAA A;  5LGT A;  3CCE V;  3OUS A;  2DQ0 A;  1P84 F;  2WLI B;  4GKK O;  5CMU A;  3H9V A;  3OR7 C;  5IYZ B;  2Q7G A;  1FXK B;  4X65 O;  2HJF C;  1OCC C;  2WA3 A;  2IBZ H;  3MHS C;  3D3Q A;  4DR3 O;  1NBM G;  4DR6 O;  2XAH A;  5EBW C;  5IY5 C;  1RM1 C;  4IIJ B;  3JD1 A;  2AHY A;  2B5U A;  1QVG U;  4WFH A;  4DR5 B;  4NVP A;  4RWU A;  2NNU A;  1YJN V;  4LF6 O;  4YIO A;  1NR1 A;  2FTK A;  2ZM6 B;  3H1J H;  3ZIA G;  3EHB B;  3K9S A;  3P3P A;  1GN4 A;  2Q5Z A;  1AP6 A;  4W4K A;  1BZK A;  4WFE A;  1TVK B;  5LOV B;  5LHG A;  2YID A;  5EYP B;  3JD0 A;  1W0K G;  1M4U A;  3D36 A;  3UO2 A;  2VQE O;  4WFG A;  2CTR A;  3E8B A;  4RAI A;  5H6Q A;  1MZF A;  3SYC A;  1VMG A;  1IVS A;  4IYH A;  4NTW A;  2A9H A;  2EIK B;  1GM8 A;  5IDJ A;  1HNX B;  3GWO A;  4C7U A;  4JTA B;  1PKX A;  4J9Z B;  3FYI B;  4HYO A;  5J2U B;  3B4S A;  3BY6 A;  1VF6 C;  4I50 B;  5E1A C;  4UCU A;  2CGO A;  1V54 B;  3DXR B;  5KX5 B;  4UUJ C;  4FJC C;  2UXN A;  1XIL A;  1KP3 A;  2Q73 A;  1OCR C;  2RCV A;  3ABL C;  1I0H A;  3AG2 B;  3CJH A;  1XNR B;  4TQF A;  4JV5 B;  3F7V C;  1VF6 A;  2M6Y A;  2UUB B;  2PZS A;  1DF4 A;  4KFM A;  1EM1 A;  1QHT A;  1NKD A;  4DW1 A;  3OTF A;  3WG7 B;  1NU1 H;  1O9H A;  3JYC A;  2PTM A;  1LUW A;  1R3K C;  1AJQ A;  1S5L Z;  2ZE7 A;  1BQ0 A;  4QIW F;  1UPG A;  2N05 A;  3K59 A;  1NT2 B;  3U11 A;  3E83 A;  5FPO A;  1SQV H;  4LWS A;  4OX9 O;  3SPG A;  2Q67 A;  1SET A;  1N36 O;  1SF9 A;  3GVM A;  1IUR A;  2EIM C;  5BMV B;  2FML A;  4J41 A;  3CCL V;  1XMO B;  3VBB A;  1COW G;  2KQX A;  1YF2 A;  3WB2 A;  3ZRW B;  2BTQ B;  4DK0 A;  1ZL8 B;  3SGI A;  3W7U A;  4KHP B;  1G6U A;  1OZ0 A;  5HFL A;  2MW2 B;  1BT8 A;  3OM3 B;  3G6B A;  4B3S B;  1Z2G A;  3K0D A;  3DC5 A;  2QA4 V;  5LMN B;  2CTP A;  3BEH A;  1AJN A;  2YUA A;  1YJW V;  3CC7 V;  2RMK B;  1N8R W;  4NR1 A;  1THZ A;  1JFF B;  3C90 A;  3CP1 A;  2YEV B;  4NXM O;  4O4L B;  4H44 B;  2GTS A;  1IBK B;  4PD4 F;  1URF A;  2KKW A;  4GX2 A;  2LGQ A;  4PDL A;  4GYC B;  4I0X B;  2RDC A;  1VQ9 V;  3K5O A;  3CB2 A;  4IGG A;  4ABM A;  4DV7 O;  3ICX A;  3ZMV A;  5H6R A;  5J9P C;  4MVM A;  1MNG A;  4X9Q A;  3T1Y B;  3ZMU A;  1P7B A;  3O65 A;  5LHH A;  4X66 O;  3OT7 A;  1XQ8 A;  4X1I A;  1E79 G;  5K1X A;  5GW7 A;  3JAK A;  3OGC C;  4WF9 V;  4I4T A;  2L35 A;  2QEX V;  3N2G A;  2VQF O;  1ZTE A;  4TQD A;  2C2A A;  3K5N A;  2ZNI A;  2DQ3 A;  2UXB B;  4I7Z B;  4F6E A;  4DV4 B;  2JS5 A;  1NI8 A;  5B1A C;  3SYO A;  1QR8 A;  5ITZ B;  4FVM A;  5JWP A;  4X1K A;  3T4Z A;  5CA3 A;  4MW8 A;  1N0N A;  3JD2 A;  4O4J A;  4B7K A;  4CC6 A;  1QLE C;  3ETE A;  4JI5 B;  2UU9 B;  2OCC B;  1F51 A;  5CA1 A;  3ABM B;  4X65 B;  1NH2 D;  3LSS A;  5F2V O;  1FFX A;  4YJ2 B;  3H1I H;  2DYR B;  5BY1 A;  3TGU H;  3P30 A;  3QG5 A;  5JQG A;  3C3T A;  3LNN A;  2B9Z A;  1YIT V;  3W7T A;  3L75 H;  1I08 A;  3CCM V;  2F95 B;  4ZHQ B;  1HR0 B;  1FJG B;  4JYY A;  4LF6 B;  3AK2 A;  1FKA O;  2P7T C;  2WLM A;  1I94 O;  3QO7 A;  4AQY O;  3L74 H;  1GM9 A;  4CS4 A;  1FFT B;  2ILM A;  4B3T O;  5CA0 B;  4JI6 O;  4LFA B;  3PN1 A;  5KHK A;  3CC2 V;  5H2F Z;  2CH7 B;  2UUC O;  3T2M A;  5JCO C;  5BXZ A;  4J7K A;  4TUY B;  4TV9 B;  4GKJ B;  2G38 A;  1IBM O;  4AHC A;  2P4K A;  1IX9 A;  3ABK C;  1R73 A;  4ASU G;  1GK9 A;  2ZR2 A;  2QGN A;  3HKB A;  5GON B;  4GX0 A;  1M57 C;  4I55 A;  1J5E O;  5JCO A;  3FFQ A;  1VEW A;  1BGY H;  1TAE A;  2RJZ A;  3JAM N;  3DC6 A;  4RUF A;  2E5L O;  1KD1 W;  3A0B Z;  1QU7 A;  2MK3 A;  2YSU B;  4IHJ B;  2LFR A;  2BSK B;  4K8Z A;  1MG1 A;  1Q5O A;  3NXS A;  3H01 A;  3AG7 A;  5EC2 C;  2PY5 A;  2O57 A;  4QNH B;  1KMI Z;  5L3B A;  2WLK A;  4IT5 A;  2EZO A;  2ITC C;  4LH7 A;  2WWW A;  2GDS A;  4JTD B;  3TET A;  2IJH A;  1MAB G;  4X89 A;  2Q69 A;  4EFB A;  4G28 B;  1XHX A;  3EXA A;  4X64 O;  3T1H O;  1BCC H;  3SYA A;  5D5P A;  3AG1 C;  4CS3 A;  1N36 B;  1H2S B;  2Z0A A;  2EJR A;  2IH3 C;  3HKC B;  2UUA B;  4OPH A;  1VQL V;  1WPB A;  3N2K B;  2OWO A;  3ZMS A;  1GMG A;  1YDX A;  4B3M B;  1QCE A;  2PGG A;  5LBQ A;  3OGI B;  4YY3 B;  2XT9 A;  4LF8 O;  2A79 B;  4DV1 B;  2EBO A;  3K08 A;  1AR1 B;  3ASO C;  3CWB H;  3OTO B;  1HWY A;  3W7X A;  3J80 N;  1KU9 A;  3DSQ A;  1KYO F;  1L1F A;  4K3A A;  1QVF U;  1YZB A;  3G80 A;  4WFF A;  1MMM A;  2ZM6 O;  2QM4 A;  5CB4 A;  4TWK A;  4TV8 A;  2ZXW C;  4DV7 B;  1TUB B;  3B09 A;  1B06 A;  3CE2 A;  2WSS G;  4JPR A;  3L71 H;  4EB6 B;  4G27 B;  4I9Q A;  1XBL A;  1YSC A;  2A7W A;  4O2B A;  4WBN A;  2K1E A;  1WAZ A;  4Q20 A;  4O2A B;  1NQT A;  3HKE B;  2DOS A;  3JSL A;  1HNX O;  1GN6 A;  2VQF B;  4MVZ A;  1H2K A;  4MTX A;  4TOI A;  3CCR V;  3P3N A;  3RYH B;  1R6T A;  1Y74 A;  4X8A A;  3OEH G;  3UKM A;  2Y4U A;  1AI6 A;  2HEP A;  2EX3 A;  2JGD B;  4ZOL A;  2CGN A;  3ASN B;  1IDS A;  1M93 A;  2GSM B;  2Y69 B;  1OCO B;  3SYQ A;  4UCS A;  4UCT A;  1XNR O;  5JJJ B;  4DR2 O;  4JV5 O;  2GUZ A;  3AG3 C;  2UUB O;  5CBF A;  3SR2 C;  1YHQ V;  2QWN B;  1ZX3 A;  1EN6 A;  5DED A;  2WLJ A;  1D2D A;  4D7T A;  1SQB H;  1M56 C;  1JPX A;  1PL0 A;  2Y4T A;  4HNA A;  1XL6 A;  4GX5 A;  1NTM H;  2P6J A;  3GWK C;  2ODM A;  4MTF A;  5LP6 C;  2ZQM A;  1MSW D;  2NR5 A;  3ZED A;  5L3D A;  4DXW A;  1FD9 A;  3SJQ C;  4CH4 A;  1K73 W;  4AQY B;  4QE7 A;  1BQZ A;  4DRX B;  1ZAU A;  2QKC A;  2IJJ A;  3Q4H B;  1CEZ A;  3JAW A;  3FAV A;  4RQF A;  5LMN O;  5LP6 A;  2OYQ A;  1JOY A;  2OTL V;  4CS2 A;  3QO5 A;  5JVD A;  1NZ6 A;  5BR8 B;  2EUL A;  3CXH F;  1WA8 B;  1AI5 A;  1R3J C;  3UQ8 A;  5LYJ A;  2EIN C;  4JYA B;  4LP8 A;  1IBK O;  4NKG B;  3B40 A;  1JCH A;  1AP5 A;  1NH2 B;  2K9P A;  3STZ C;  3FKS G;  3T4D A;  3CCU V;  2QWQ B;  4QGP A;  3OFN G;  3W7W A;  4EEQ A;  2P06 A;  2YDE A;  4GT1 A;  5HFM A;  3AK3 A;  3T1Y O;  2LGW A;  3C3S A;  1N33 B;  4UCV A;  4LNU A;  4MTO A;  1K5S A;  4FLU A;  1F7Y A;  1D5N A;  2B1I A;  1HNW O;  4PJ0 Z;  4B3R B;  2E74 B;  3KCY A;  2UXB O;  3JAS A;  5IY5 B;  5KMG A;  1RM1 B;  3RYF A;  5DEC A;  1YTF D;  2AZ0 A;  4DV4 O;  1D5A A;  1GAX A;  3O9O A;  4X64 B;  1R3I C;  5FLX N;  2R9R B;  2JJ2 G;  2Q0A A;  1RSO A;  5JJE B;  2YIA A;  2PI4 A;  4F6R A;  4FLT A;  1PD3 A;  2DYS C;  4GX1 A;  3ABT A;  3RVZ A;  1OCZ C;  4JI5 O;  2UU9 O;  2X6C A;  2A3Q A;  2DJV A;  4UVA A;  3P32 A;  5IYC O;  1GM7 A;  1Z5W A;  1VF7 A;  5KAF Z;  4RUE A;  2XTA A;  1XDC A;  4LH6 A;  3CMA V;  4RO2 A;  4LF8 B;  2OTJ V;  4UB8 Z;  3H1K H;  2CE4 A;  2YXL A;  2HJD A;  3JAT A;  1HR0 O;  1FJG O;  5KA5 A;  4J11 A;  5LA6 A;  4JAV A;  4FZ0 A;  3CJH B;  2ZNJ A;  1EZJ A;  3AG4 C;  4FK5 C;  3WFV A;  1MSD A;  1VQK V;  1XUQ A;  3VQX A;  1OCR B;  3CYO A;  4JI3 B;  4D6T H;  5IT9 N;  4J7J A;  4LFA O;  4FFB B;  1AB3 A;  3J81 N;  2KG7 A;  3F5W C;  4LWS B;  4FM2 A;  4GKJ O;  1Q43 A;  5KHJ A;  3A0R A;  4MTG A;  4JF3 A;  3ZHQ A;  2BCC H;  4QE9 A;  5KLV H;  4BAY A;  3HB3 B;  4DV5 O;  2EIM B;  1Y76 A;  1XI1 A;  2LW1 A;  1U97 A;  3RW0 A;  4J7Z A;  4DR2 B;  4O4H B;  1SQP H;  1LUV A;  4ICG A;  5KAI Z;  1WB7 A;  3G67 A;  2EIL C;  4MVR A;  4PDM A;  2ARH A;  1V9P A;  1ROP A;  2EIJ C;  1KEC A;  2JS3 A;  3D8C A;  4RQE A;  1SER A;  2VWK A;  3RFR A;  2FYU H;  3M8A A;  4FMT A;  2PF4 E;  3FYE B;  3CRR A;  3K06 A;  3SDL A;  2QWR B;  1SQQ H;  4GCZ A;  4FLW A;  1DK1 A;  5JJN B;  4DV0 O;  5L3C A;  5LOV A;  1SZX A;  1PNM A;  3DTU B;  4X1I B;  1Q6U A;  3AK1 A;  2UUA O;  4DO2 A;  2UXC O;  3JAK B;  4I4T B;  3RT3 C;  1HNZ B;  4K0K O;  5KHH A;  3N2G B;  4CH6 A;  4U3J A;  4B3M O;  1NS1 A;  4CBC A;  1V54 C;  1YIJ V;  3K04 A;  4CC5 A;  4YY3 O;  2JDI G;  4J42 A;  4DV1 O;  3AG2 C;  2ZIM A;  1MA1 A;  3TJT A;  1YCI A;  1Q7Y W;  4X1K B;  3SJA C;  4P2Z A;  4BIZ A;  3OTO O;  2H3O A;  3IFX A;  2E75 B;  4O4J B;  1M5I A;  5DN6 G;  2CTW A;  1VQO V;  3RGB A;  3OD4 A;  5CA1 B;  1AJP A;  3EVK A;  2ETN A;  2AGA A;  5B1A B;  1GH6 A;  1K97 A;  1FFX B;  3D3I A;  4LFC B;  4JI0 B;  2X7R B;  1H2G A;  3UCS C;  5JQG B;  3HKD A;  3I55 V;  3G6E V;  3SJB C;  1HNW B;  1H2N A;  2Q0O C;  1F4M A;  2N04 A;  1H38 A;  2QWP B;  3I5D A;  5A2Q N;  5B1N A;  3QNE A;  5FL7 G;  1H8E G;  4J9Y B;  2PI5 A;  2PYJ A;  4FFK A;  2BOC C;  2XND G;  5KUM A;  5BMV A;  3JCZ A;  2QDO A;  4H37 A;  3CRQ A;  3R65 A;  3KG2 A;  1JA8 A;  4YJ3 A;  2QR4 A;  1ZL8 A;  1Y4M A;  5EBL C;  1KP2 A;  3IAY A;  2HP8 A;  5K1P A;  4DUY B;  2FL4 A;  4PA3 A;  2QJ1 A;  1ZWI C;  3UM7 A;  2B1G A;  1NR7 A;  1LR1 A;  1PV0 A;  4LF9 B;  2YEV A;  1P7G A;  4E4E A;  1N0J A;  1Q90 D;  4X1Y A;  3HKB B;  3BRC A;  3OW2 U;  4I55 B;  5B1O A;  4DR7 B;  4LFB B;  2JIZ G;  1AR5 A;  4JZ2 A;  5GTI Z;  3ABK B;  2D2C B;  4Z2W A;  1ORQ C;  3ZHV A;  5LGN A;  2OIG A;  3E22 B;  4XBF A;  4OGQ B;  3HR0 A;  2VWJ A;  4DR1 O;  1AR4 A;  1M57 B;  5GTH Z;  3CRM A;  1GO3 F;  4LC1 A;  3ZRS A;  1V55 C;  3B77 A;  3L73 H;  4XDJ A;  5AG2 A;  1YTF B;  3M7M X;  2DWD C;  5B1B C;  1SA0 A;  4DYL A;  2Y48 A;  2V4D A;  1WLE A;  4PI2 A;  1BMF G;  2GHY A;  2AW9 A;  3LSU A;  2XAF A;  1DGS A;  1S76 D;  3W7S A;  5BR8 O;  3LDE A;  2CK3 G;  2NN4 A;  1XNQ O;  1PNL A;  2CDY A;  1NJI W;  2Q9L A;  4JYA O;  1W2B U;  2VS0 A;  1KKC A;  2Q6A A;  4DV3 B;  4UB6 Z;  2VRZ A;  4NTX A;  2AHZ A;  3OE7 G;  4QPJ A;  2W6I G;  3AG1 B;  3ZCC A;  3TCU A;  2IH1 C;  5LXT A;  3LSQ A;  5TIS Z;  4DV5 B;  2XHB A;  4JI7 B;  1EZV H;  2EJ7 A;  1N33 O;  1KBH A;  4MS2 A;  4FLY A;  5A9G A;  3BA9 A;  5J2T A;  1K9M W;  1GN2 A;  2Y0P A;  3G71 V;  4JYB A;  1K34 A;  4B3R O;  3MAQ A;  4F4L A;  4L8J A;  1T5E A;  3UO3 A;  5CB4 B;  3ZS8 C;  4TV8 B;  2W6J G;  2P5O A;  4FLZ A;  4YIP A;  4DV0 B;  1CP9 A;  2PYL A;  4ZI7 A;  4O2B B;  4WBN B;  1N34 B;  1S3J A;  5JH7 A;  2ZXW B;  1I5Y A;  4BIU A;  4WCE V;  2UXC B;  1EFR G;  3CSX A;  3JAR A;  5C8Y B;  4K0K B;  4N23 A;  1BHA A;  2LW7 A;  4JI8 B;  1K4D C;  1Y74 B;  4X20 A;  5KA6 A;  4FPP A;  2AZ2 A;  3I56 V;  3A0H Z;  2OIE A;  4ZOL B;  1L0L H;  5GON A;  1W59 A;  3HPL C;  1US6 A;  2F1M A;  5H5N A;  2P4V A;  3RWR D;  1S5H C;  2GV9 A;  5IJ0 A;  1VQ5 V;  2OCH A;  2GUZ B;  3K58 A;  3MHH C;  4J10 A;  4GUN A;  4Q6G A;  4KUM A;  1RP3 B;  2WPD G;  2BTO A;  1IBL B;  2ZIN A;  3JCU Z;  1VQM V;  4JI3 O;  3CRA A;  3LUT B;  5EZY B;  4H13 B;  4JI4 B;  3AG3 B;  2HVK C;  1QBZ A;  2ZKO A;  3K3W A;  3B8M A;  2HLD G;  1XHZ A;  4MVO A;  4JGS A;  5FPR A;  2GTA A;  1FYJ A;  1AVM A;  3IC9 A;  5B3S B;  3CCJ V;  3RYC B;  1M56 B;  4G2K A;  3OEE G;  3FX7 A;  1B6Q A;  2JEU A;  1Z5V A;  3HKC A;  1A32 A;  1FPO A;  3JAW B;  3FAV B;  1LNQ A;  5LP6 B;  1JJ2 U;  4R7C A;  5JVD B;  4X62 B;  4A5U B;  3JAL A;  4U7N A;  4L87 A;  2HHH B;  2WAM A;  4LF7 B;  1KKD A;  1FAF A;  2YI9 A;  3ZX6 A;  2WLL A;  5LYJ B;  3SPH A;  2Q7E A;  3BCC H;  4U3F H;  4EFE A;  1MOF A;  1R6K A;  2QSA A;  3JD3 A;  1SQG A;  5LMU B;  4KL1 A;  1KB9 F;  1N32 B;  1SQX H;  4UXN A;  3RYI A;  3CD6 V;  5EBM C;  3FB8 C;  4KXR A;  5IJ9 A;  2BOB C;  4NB5 A;  3KCX A;  4LNU B;  1WB8 A;  4DR1 B;  4BIO A;  5KHG A;  4GLX A;  2UXX A;  4FLV A;  4I5S A;  1HNZ O;  4JI2 O;  3K57 A;  3JAS B;  2A06 H;  5KMG B;  3ASN C;  3RYF B;  4R8C A;  2ZIO A;  1BS3 A;  3SPI A;  2YC0 A;  3CME V;  3ZRX A;  1YEW A;  4AI8 A;  2F66 C;  4PI0 A;  1XNQ B;  2EZP A;  1RSO B;  4F6R B;  4Z1M G;  4N21 A;  5CBH A;  1RPO A;  4P30 A;  3K5M A;  1EN5 A;  4WFA V;  1QNM A;  4PV1 B;  3CCS V;  3OAA G;  2Q68 A;  2QTS A;  2WA4 A;  4LF5 O;  1XRE A;  4LFC O;  2YI8 A;  4B08 A;  4NXN B;  2DYS B;  4JI0 O;  3SJC C;  5EK0 A;  4FM0 A;  3CXC U;  4UV8 A;  4IL6 Z;  2W0F C;  4IYI A;  4E2L A;  1VQN V;  1VQ6 V;  3JAT B;  1OCC B;  1KQS U;  3ZHT A;  5LA6 B;  2F93 B;  2HFE C;  2XAS A;  1P4R A;  3NR7 A;  5H9C A;  4LF4 B;  3BHP A;  4GZR B;  1K33 A;  2QKA A;  4X88 A;  3H1L H;  3QO8 A;  5B5E Z;  3BVO A;  3Q4H A;  4DUY O;  2KG7 B;  2ADQ B;  2Q4P A;  2P67 A;  1W0J G;  1BSM A;  4Z1V A;  1PP9 H;  5IWA O;  5FNV A;  1AIL A;  4YHH B;  4LF9 O;  2XOK G;  4DUZ B;  2XAG A;  1SS3 A;  1PL4 A;  1B3Q A;  1H2L A;  3OMN B;  3QTC A;  1NTZ H;  3FB5 C;  2ATK C;  4HZ3 A;  4DR7 O;  4PDV A;  4LFB O;  2UXD B;  2XUM A;  4JYC A;  2LJ2 A;  1Y76 B;  3KKY A;  1AI4 A;  4LR3 A;  4FM1 A;  1K5Q A;  5KUK A;  3R66 A;  3E86 A;  4OPA A;  2W0X A;  1L8D A;  4PDR A;  1XOU A;  3DGE A;  4O4I A;  2ADP A;  4R6Z A;  2F4V B;  3X2Q C;  1BL8 A;  2JRI A;  4ZIB A;  3ABL B;  2E3C A;  4YXW G;  1SC5 B;  3D36 C;  2E76 B;  3UT5 A;  1VQ4 V;  1SQF A;  3QVN A;  2R72 A;  3LNM B;  3IGA C;  1L0N H;  4QPK A;  1JX9 A;  3ETD A;  2ZDI C;  2EIL B;  1Q81 W;  1FXK C;  1S0V A;  4LCU C;  2EIJ B;  4WFB V;  1GN3 A;  1K92 A;  2R9I A;  4XDL A;  3K79 A;  4DV3 O;  3K03 A;  3F5T A;  2BE3 A;  2WLI A;  1Q3E A;  2IJI A;  1IXM A;  4NYK A;  3STL C;  2HVJ C;  4W4L A;  2ZDI A;  4U3J B;  2Z5U A;  3CHX A;  5IYZ A;  1Q86 W;  1FXK A;  2ZE6 A;  4DV2 B;  4BW9 A;  4JI7 O;  1S72 V;  2CUG A;  1SZT A;  4UVC A;  2YIC A;  4DV6 B;  2V1D A;  1WN7 A;  1SRY A;  1ARO P;  4IIJ A;  5DM6 V;  3CCQ V;  1GRJ A;  2WLN A;  4FZ1 A;  5EIB C;  3WB0 A;  3E8H A;  1H2M A;  2ITD C;  3N27 A;  1NVP D;  2X6A A;  3OMA B;  3ZHS A;  1R6N A;  3K5L A;  1Y6X A;  3HKD B;  2EIK C;  4HAM A;  2JK5 C;  1TVK A;  1R3L C;  5EYP A;  1N34 O;  2OT5 A;  3BFR A;  1M1K W;  2Z3Y A;  3ETG A;  1O9G A;  4FFB A;  4JI2 B;  3BA8 A;  4MVQ A;  3JD4 A;  3VOU A;  4JI8 O;  1GKF A;  3ZRV A;  4UV9 A;  5CBG A;  2F23 A;  2CAZ C;  2KSD A;  3GB7 C;  3VQY A;  4YJ3 B;  5LHI A;  5J2U A;  4I50 A;  2P90 A;  2YS8 A;  1OV9 A;  1XEQ A;  3WG7 C;  3DXR A;  5KX5 A;  2QKS A;  1KC8 W;  4DR4 B;  3BPZ A;  1SES A;  5EC1 C;  2D3O W;  1I5X A;  1AI7 A;  4O4H A;  4LF5 B;  3FD9 A;  1IBL O;  4X1Y B;  3G4S V;  1VQP V;  1QLE B;  2JGU A;  4JI4 O;  1SKV A;  3TXS A;  2ZE8 A;  1JQ0 A;  5IE9 A;  4KP4 A;  2JJ1 G;  2DN9 A;  3ABU A;  4CZZ A;  2FB5 A;  1NTK H;  1G4Y B;  4CH3 A;  1EN4 A;  3SPC A;  2LP7 A;  2M7W A;  4FIP C;  1OJH A;  1I7F A;  1ZSP A;  2WLH A;  2Q8V A;  1ENV A;  1F4N A;  3ZRW A;  1SA0 B;  1JVM A;  2XAJ A;  2BTQ A;  3KZI Z;  1VQ8 V;  4X62 O;  2YIB D;  2AXT Z;  2R70 A;  2JEX A;  2HHH O;  4LF7 O;  1GTO A;  3ZHR A;  1V55 B;  4OXS A;  5IWA B;  3T1C A;  1JFF A;  1K7D A;  5B1B B;  4O4L A;  2Q7H A;  1G1X B;  4MSW C;  3U0Z A;  5D5Q A;  4H0L B;  5LMU O;  4GKK B;  1N32 O;  1K4C C;  2DWE C;  5LXT B;  4I0X A;  2X6B A;  4B7E A;  4BR6 A;  2JVD A;  3SPJ A;  2IM9 A;  4DR3 B;  1X4T A;  4ZKI A; 
#chains in the Genus database with same CATH homology
 4KUM A;  1Q82 W;  1NKD A;  2WPD G;  3WG7 B;  4MTO A;  1K5S A;  3JYC A;  5IYB O;  5BZB A;  1VQM V;  3LUT B;  1R3K C;  1AJQ A;  4QIW F;  2B1I A;  3AG3 B;  2HVK C;  1QBZ A;  3E83 A;  3CC4 V;  5IY5 B;  3K3W A;  1RM1 B;  3B8M A;  2HLD G;  3SPG A;  2Q67 A;  1SET A;  4MVO A;  4JGS A;  1YTF D;  4MVS A;  3ZJZ A;  2OCC C;  1R3I C;  2EIM C;  5B3S B;  3CCJ V;  1M56 B;  3ABM C;  4G2K A;  3CCL V;  2IU3 A;  2R9R B;  3VBB A;  2JJ2 G;  3LDC A;  4P9O A;  3OEE G;  2PI4 A;  1B6Q A;  2JEU A;  1COW G;  1PD3 A;  2DYS C;  3ZRW B;  4GX1 A;  3ABT A;  1FXH A;  2DYR C;  3W7U A;  3RVZ A;  1LNQ A;  4MVU A;  1OZ0 A;  1OCZ C;  1H8H G;  5HFL A;  3OM3 B;  2X6C A;  3K0D A;  1JJ2 U;  4R7C A;  2QA4 V;  4UVA A;  2KB1 A;  3P32 A;  3E35 A;  3BEH A;  4U7N A;  1AJN A;  3E8G A;  4L87 A;  5IYC O;  1GM7 A;  2WAM A;  1KKD A;  1YJW V;  1K3E A;  3CC7 V;  1N8R W;  4RUE A;  2WLL A;  1THZ A;  3SPH A;  4UVB A;  3CMA V;  3CP1 A;  2YEV B;  4RO2 A;  2OTJ V;  4GX2 A;  1MOF A;  2H94 A;  1R6K A;  4PDL A;  3JD3 A;  4TSF G;  3FB7 C;  1OHH G;  4JTC B;  5KA5 A;  1S0V A;  4UXN A;  1E1Q G;  3F7Y C;  3RBZ A;  1VQ9 V;  3CD6 V;  4JAV A;  3ZMV A;  3CCV V;  5EBM C;  3OUF A;  5H6R A;  1EZJ A;  3AG4 C;  3FB8 C;  5J9P C;  4MVM A;  4FK5 C;  3ASO B;  2BOB C;  3ZMU A;  5L3F A;  1YI2 V;  1P7B A;  4QJF B;  5LHH A;  3WFV A;  1VQK V;  3CPW U;  2HG5 C;  1M90 W;  2UXX A;  1E79 G;  3AEI A;  1OCR B;  3CYO A;  4I5S A;  5GW7 A;  3PJS K;  3OGC C;  2QM8 A;  4WF9 V;  2QEX V;  3F5W C;  2V7Q G;  1VQ7 V;  2C2A A;  3ASN C;  2LFS A;  2DQ3 A;  4R8C A;  3K9A A;  1BHB A;  3SPI A;  1F23 A;  3CME V;  3ZRX A;  1CPY A;  1XL4 A;  3K0G A;  2EZP A;  3A0R A;  5B1A C;  3SYO A;  1QR8 A;  4Z1M G;  2IW5 A;  3FB6 C;  4N21 A;  5CBH A;  1UJW B;  1RPO A;  4MTG A;  4JF3 A;  3T4Z A;  5CA3 A;  5IYD O;  2HKO A;  4MW8 A;  4JAU A;  4P30 A;  5CN0 A;  4WFA V;  3JD2 A;  2XAQ A;  3CCS V;  4QE9 A;  2A0L A;  1QLE C;  3ETE A;  3HB3 B;  4BAY A;  3OAA G;  2QE7 G;  2OCC B;  2EIM B;  1F51 A;  3ABM B;  3OR6 C;  4H33 A;  2Q68 A;  1NH2 D;  3RW0 A;  2WLL B;  3LSS A;  2DYS B;  1Y66 A;  5EK0 A;  2DYR B;  4BW5 A;  3P30 A;  3CXC U;  4UV8 A;  2W0F C;  1YIT V;  3W7T A;  3E89 A;  2EIL C;  4MVR A;  1NVP B;  4PDM A;  2ZR3 A;  1YJ9 V;  3CCM V;  1RPR A;  1ROP A;  2EIJ C;  4E2L A;  1VQN V;  1VQ6 V;  1OCC B;  1KEC A;  1KQS U;  3ZN0 A;  4RQE A;  1SER A;  4FMT A;  2NLJ C;  3FYE B;  3K06 A;  2P7T C;  2WLM A;  2HFE C;  2XAS A;  3M99 B;  1P4R A;  4GCZ A;  3QO7 A;  3RVY A;  5H9C A;  4MT8 A;  1K8A W;  5L3C A;  1K33 A;  3DTU B;  1PNM A;  1GM9 A;  1DTO A;  1J95 A;  4X88 A;  4DO2 A;  1FFT B;  3QO8 A;  1Q81 W;  4PEL A;  1PNK A;  4PA4 A;  1E1R G;  3CC2 V;  3TK1 A;  4PA6 A;  4CBC A;  1V54 C;  2P67 A;  1EBO A;  3T2M A;  3E2E A;  1W0J G;  1YIJ V;  4EKW A;  3K04 A;  3IC7 A;  2JDI G;  2XOK G;  3AG2 C;  2XAG A;  3ABK C;  1Q7Y W;  1R73 A;  2DW4 A;  2H8P C;  3OMN B;  4ASU G;  5C93 A;  4P2Z A;  1GK9 A;  4BIZ A;  3FB5 C;  2ATK C;  4HZ3 A;  2ZR2 A;  4PDV A;  3IFX A;  3E8F A;  4JYC A;  2X0L A;  4GX0 A;  1M57 C;  5DN6 G;  4P9P A;  1VQO V;  4TT3 G;  1AJP A;  1AI4 A;  5B1A B;  1K5Q A;  2EIN B;  4RUF A;  2F43 G;  1K97 A;  1KD1 W;  3D3I A;  5KUK A;  4I9W A;  2MK3 A;  2YSU B;  1DLB A;  2LFR A;  2IU0 A;  3ZN1 A;  3E86 A;  2X7R B;  1H2G A;  1MG1 A;  3NXS A;  3H01 A;  4ZBM A;  1TUE B;  5EC2 C;  4PDR A;  3DGE A;  4R6Z A;  3I55 V;  3X2Q C;  3G6E V;  1BL8 A;  4QNH B;  5L3B A;  5B3S C;  2WLK A;  3EFF K;  2EZO A;  2ITC C;  4R50 A;  3ABL B;  2WWW A;  4JTD B;  4YXW G;  3TET A;  2IJH A;  1VQ4 V;  1MAB G;  3LNM B;  3IGA C;  4X89 A;  2Q69 A;  1F4M A;  4QPK A;  1JX9 A;  4G28 B;  3ETD A;  1H38 A;  3ZMZ A;  2ZDI C;  2IJK A;  2Y69 C;  2EIL B;  1OCO C;  3SYA A;  1FXK C;  3AG1 C;  3QNE A;  1H8E G;  5FL7 G;  4LCU C;  4J9Y B;  5B1N A;  5L3E A;  2EIJ B;  2PI5 A;  2BOC C;  2XND G;  5KUM A;  5L3G A;  3JCZ A;  1K92 A;  4WFB V;  2R9I A;  4H37 A;  4XDL A;  3K79 A;  3R65 A;  3K03 A;  2EJR A;  3KG2 A;  2IH3 C;  4U7O A;  1WPX A;  1VQL V;  2WLI A;  2IJI A;  1Y4M A;  5EBL C;  1IXM A;  3STL C;  1KP2 A;  1S77 D;  3ZMS A;  2HVJ C;  4LBE C;  2ZDI A;  2Z5U A;  1GMG A;  1Q86 W;  1FXK A;  4PA3 A;  1ZWI C;  1S72 V;  3UM7 A;  1FS0 G;  1QCE A;  4PA9 A;  1SZT A;  2B1G A;  4UVC A;  5LBQ A;  1QLN A;  1NR7 A;  2A79 B;  2EBO A;  2YEV A;  3K08 A;  1AR1 B;  2V1D A;  4XDK A;  3ASO C;  1SRY A;  1OCZ B;  1ARO P;  3ZMT A;  5DM6 V;  1HWY A;  3W7X A;  4JAS A;  3CCQ V;  3OW2 U;  2WLN A;  5B1O A;  4MW3 A;  1L1F A;  1QVF U;  3SYP A;  2JIZ G;  3E8H A;  4WFF A;  1QR9 A;  3B8N A;  2ITD C;  2HR3 A;  4TWK A;  3ABK B;  2X6A A;  1NVP D;  2ZXW C;  3OMA B;  1R6N A;  1ORQ C;  5LGN A;  4XBF A;  2WSS G;  2EIK C;  4HAM A;  1M57 B;  2JK5 C;  4JPR A;  4G27 B;  1R3L C;  3LDD A;  3MD0 A;  1GO3 F;  4LC1 A;  3ZRS A;  1V55 C;  1YSC A;  3B77 A;  4XDJ A;  1YTF B;  1G8M A;  2OT5 A;  2DWD C;  2K1E A;  2ZD9 A;  5B1B C;  1M1K W;  2Y48 A;  2Z3Y A;  4Q20 A;  1DF5 A;  1WLE A;  1FXV A;  3ETG A;  1NQT A;  3AG4 B;  5LGU A;  2QTO A;  4MVQ A;  1BMF G;  3JD4 A;  2GHY A;  2XAF A;  3VOU A;  1S76 D;  4MVZ A;  3W7S A;  1M9N A;  1GKF A;  2QM7 A;  4MTX A;  3LDE A;  3ZRV A;  4UV9 A;  5CBG A;  2CK3 G;  3CCR V;  3X2Q B;  1PNL A;  1NJI W;  4X8A A;  3GB7 C;  4PA7 A;  3OEH G;  3UKM A;  1W2B U;  3OMI B;  3ML0 A;  5LGT A;  3CCE V;  2Q6A A;  1AI6 A;  3OUS A;  5LHI A;  2DQ0 A;  2P90 A;  2WLI B;  5CMU A;  2AHZ A;  3ASN B;  3OE7 G;  4QPJ A;  3WG7 C;  2W6I G;  3OR7 C;  2GSM B;  2Y69 B;  1OCO B;  1FXK B;  3AG1 B;  2QKS A;  3SYQ A;  3TCU A;  2IH1 C;  3ZCC A;  1KC8 W;  3LSQ A;  1SES A;  2HJF C;  1OCC C;  3MHS C;  5EC1 C;  2D3O W;  1I5X A;  3AG3 C;  1AI7 A;  5CBF A;  1NBM G;  1YHQ V;  2XAH A;  5EBW C;  5IY5 C;  4MS2 A;  1RM1 C;  3JD1 A;  3G4S V;  1K9M W;  2WLJ A;  1VQP V;  1QLE B;  2AHY A;  2B5U A;  3G71 V;  1QVG U;  4WFH A;  1M56 C;  1JPX A;  4JYB A;  1JQ0 A;  1K34 A;  1PL0 A;  4KP4 A;  2JJ1 G;  2NNU A;  1YJN V;  4F4L A;  1NR1 A;  3ABU A;  4CZZ A;  1XL6 A;  4GX5 A;  2FTK A;  2W6J G;  1G4Y B;  2P6J A;  3ZIA G;  3SPC A;  2LP7 A;  3EHB B;  4MTF A;  2ZQM A;  1MSW D;  2M7W A;  4FIP C;  5L3D A;  4WFE A;  4DXW A;  3SJQ C;  5LHG A;  1K73 W;  4QE7 A;  1CP9 A;  2WLH A;  1W0K G;  3JD0 A;  1ENV A;  1F4N A;  3D36 A;  2IJJ A;  1S3J A;  3ZRW A;  1JVM A;  2XAJ A;  4WFG A;  1VQ8 V;  1CEZ A;  2ZXW B;  3E8B A;  1I5Y A;  4BIU A;  4WCE V;  4RAI A;  5H6Q A;  1EFR G;  3SYC A;  4RQF A;  1JOY A;  2JEX A;  4N23 A;  2OTL V;  2A9H A;  2EIK B;  1BHA A;  3QO5 A;  1GM8 A;  5IDJ A;  1GTO A;  1K4D C;  3GWO A;  5KA6 A;  1V55 B;  4FPP A;  1AI5 A;  4JTA B;  4OXS A;  1PKX A;  4J9Z B;  1R3J C;  3FYI B;  4HYO A;  3T1C A;  1K7D A;  5B1B B;  2EIN C;  4LP8 A;  3BY6 A;  3I56 V;  5E1A C;  4MSW C;  1JCH A;  1NH2 B;  3STZ C;  3FKS G;  3HPL C;  3T4D A;  3CCU V;  1V54 B;  1K4C C;  4UUJ C;  4FJC C;  2DWE C;  2UXN A;  1KP3 A;  2X6B A;  1OCR C;  1S5H C;  3ABL C;  3SPJ A;  3AG2 B;  3OFN G;  3W7W A;  1VQ5 V;  3MHH C;  4GT1 A;  5HFM A;  3F7V C;  4ZKI A;  1DF4 A;  4KFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...