1SZTA

Atomic structure of a thermostable subdomain of hiv-1 gp41
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Atomic structure of a thermostable subdomain of HIV-1 gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1sztA00
2X7RB 5HFLA 1MOFA 2MK3A 4N21A 1ENVA 2EBOA 4JF3A 1F23A 4FIPC 1QR8A 3B8NA 1DLBA 1K33A 5CN0A 1JPXA 5KA5A 3MHHC 3B8MA 1Y66A 3H01A 3M99B 1Y4MA 1DF4A 4G2KA 1DF5A 1QCEA 3CYOA 4FK5C 5KA6A 4N23A 3CP1A 2EZOA 3K9AA 3WFVA 4JPRA 2EZPA 5H9CA 4FJCC 5HFMA 4E2LA 3MHSC 1JQ0A 1QBZA 1K34A 1EBOA 4JGSA 5CMUA 2OT5A 3P30A 1QR9A 3GWOA 1I5XA 1SZTA 2LP7A 1MG1A 2M7WA 1I5YA 3B77A 2P6JA
chains in the Genus database with same CATH superfamily
2F43G 4F6RB 1MSDA 2OTLV 5F2VO 3E22A 2IH1C 3AG7A 3STLC 3FB7C 4JZ2A 4FPPA 2LW7A 1NBMG 2Y0IA 5B1BB 4UCUA 4FFBB 1LR1A 2ZE7A 3K5LA 4LF5O 4B08A 1AJNA 4TSFG 1OZ0A 5B3SC 4H0LB 3CXHF 1D5NA 5GW7A 4LF6B 5KUKA 1BT8A 4GCZA 4FK5C 3UT5B 2A06H 2UXDO 2XAQA 5HFMA 2ZCEA 2MW2B 3N2KB 4YJ2A 1WNSA 1QLNA 4LF8O 1ZUQA 4NXMO 3G4SV 3OMNB 2QWQB 4WFHA 3K59A 4MW8A 4QPJA 2DE0X 4DO2A 2WA4A 3STZC 4L87A 2KSDA 3T1HO 2Q4PA 1Y74B 4OX9B 1F51A 1K9MW 3MDSA 2OCCC 3KG2A 4IYHA 1Q90D 4CS2A 1TAEA 1E1QG 3JD4A 4DV7O 1XEQA 1UJWB 1AI4A 4DR4B 1AI6A 3QG5A 2QKAA 1ZWIC 1R1BA 1VQ4V 3AG2C 5B1OA 5E1AC 4DR7O 2NLJC 3HKDB 5L3BA 1YDXA 4KHPB 1RPRA 4RUFA 1WP7A 4X65B 5EIBC 1JJ2U 3ASOC 2ZE8A 4JYCA 2ODMA 3EVKA 3LSQA 4J7KA 5LMUO 3APQA 5JJNB 1I08A 4J9YB 4JI2O 5IYCO 4JI8O 3CCUV 1O9HA 1V54B 3SGIA 1KECA 4IIJA 3J80N 3D3IA 3EFFK 2KG7B 1XMOO 1K7DA 4HYOA 4WFGA 1N36B 5LP6C 2W6JG 3B4SA 4XDJA 4NR1A 3JD0A 2GTAA 2E76B 3A2FA 4UVCA 1QBZA 4I0XA 3ZHUA 4E4EA 3JSNA 3ZBHA 2M7WA 2YXYA 5L3FA 5LHIA 4Q6GA 1MZFA 1AP6A 3HPLC 3JD2A 2ZDIA 1JMKC 1YXBA 1TA8A 5KA5A 3H1KH 1MNGA 4IT5A 4PI2A 4X64B 4DR6O 3HKEA 2B5UA 4G2KA 1PD3A 3QVNA 3TXQA 2YDEA 3K3WA 1URFA 5LGTA 3L73H 2UUAB 1R3JC 2Q73A 3TXSA 1SRYA 4E2LA 1YJNV 1R6KA 2V4DA 4MTFA 2IJIA 3J7AU 4Z1MG 1PNMA 1KD1W 3ZHQA 2HEPA 4I50A 3J81N 2WLLA 2DJVA 2IJHA 2OIEA 1E1RG 4B7KA 3CPWU 1HNWO 4G27B 1VP7A 5C8YA 1IBMO 1K5QA 4CH6A 1VIBA 3FD9A 1K5SA 1K34A 4DV3B 1XNRO 2ZR3A 1NTZH 2MK3A 3FB6C 1K4DC 3UO3A 3JAMN 2XAGA 5EZYA 1RSOA 3FAVB 1QHTA 2ZE5A 5J2UB 3WG7B 1VF6C 4LCUC 3QO5A 3CHXA 1ZSPA 1ZAUA 2ZXWB 2WAMA 1JJOA 2EILC 4X9QA 3IJ4A 4DUYO 3LDCA 1MA1A 3ETQA 1JPXA 5JCOC 3JSLA 1OV9A 1KB9F 2HVJC 1W0KG 4ZOLA 1NTKH 1P84F 5IYBO 1XMQO 4BWAA 3ABLC 2W6IG 2PUSA 1HP8A 3UM7A 2JEXA 4PD4F 2PYLA 3VQYA 3JATA 2P5OA 2EBOA 2RNBA 3T1YO 3ZRXA 1SZXA 2FTKA 4I5SA 4O4JA 4K35A 4O4LB 1TGOA 3ABTA 4UCSA 1OCCB 4TT3G 2EINB 5BMVB 2VQFO 1QU7A 3OEEG 1Q81W 1MOFA 2CGOA 1MSWD 2WLIB 1PNKA 2EJ7A 2YICA 4JTCB 4G28B 3ABKB 3H1LH 2LFSA 4O4IA 1BS3A 5D5PA 4AQYB 2OWOA 2QR4A 1Z5VA 2CTPA 2EZPA 5H9CA 1N34O 2YI9A 3JALA 5IY5C 4IL6Z 1SQXH 1YI2V 1AI5A 1Q43A 3BFRA 4MSWC 1W2BU 2DW4A 4TUYA 2P67A 4L8JA 2ZQMA 5IJ9A 2EIJC 2BE3A 1RFYA 1B06A 4GX2A 1H38A 1VQ7V 2VQEO 2ILMA 4PDVA 4D7SA 4NKGB 1S76D 3HR0A 1YVWA 2PI5A 1GM7A 1P4RA 3RN4A 1JA8A 2Y69C 5B5EZ 2LW1A 4H37A 2HJDA 4N23A 4LBEC 1MZEA 1VQ8V 1R6TA 4UCRA 1OCRC 3LNMB 4U3JB 4X1YB 3JARA 1JFFB 1Q6UA 1IBLB 4DXWA 3B8NA 2PZSA 1DLBA 4UVAA 4UB8Z 1CPYA 1IURA 1NH2B 4BIUA 3H1JH 3SJBC 3RT3C 2ADQB 3CS5A 3LNNA 3DC5A 3C3SA 5GONB 5B1AC 2XHBA 3CMAV 2UXBB 5CBHA 2QWNB 1TUBA 3AG3B 4WFAV 1H8HG 3MHHC 3FYIB 4RQEA 1XBLA 4J10A 3JCUZ 1EN6A 1FJGO 1KU9A 4GKKO 3HKBB 3R65A 1AILA 4AILC 2UXCO 2D2CB 1LUVA 2DYRB 3RVYA 5LMNB 2K9PA 1NTMH 1H2LA 2B1GA 4UB6Z 4BW9A 4LFAB 3P30A 4FZ1A 2G38A 4W4KA 1QVGU 3HB3B 3SJCC 5EK0A 2PYJA 1G1XB 1QVFU 5FNVB 4NTWA 1HR0B 4LF9O 2ZT9B 2YEVB 3DSQA 4QE9A 2UU9B 2IBZH 3RGBA 1N33B 3CE2A 4X1IB 1KKCA 4FM1A 1NVPD 2H8PC 2Y0PA 5JQGB 4CC5A 3ABKC 4YIOA 5IYDO 2OIGA 3A0HZ 4OXSA 5J2TB 1AROP 4B3MO 1COWG 1DTOA 3CCRV 3OM3B 1JOYA 3ML0A 4CS4A 3IC7A 4FM0A 2RQ6A 2JEUA 3M7MX 5LXTA 4KP4A 1WLEA 4JI3B 3A0BZ 4DV0O 4DV2B 2YIDA 4K3AA 5KMGA 4CS3A 4FLYA 4TV9A 2YC0A 2JIZG 1M56C 2JK5C 2DQ0A 2DQ3A 1T5EA 2WLMA 4MTOA 5C93A 2QM8A 4UV9A 5CB4A 3IFXA 5LP6A 1ZTEA 2YI8A 1K33A 3UKMA 3JYCA 5BXZA 1YHQV 4PA6A 2IM9A 4UXNA 4MVUA 2Z3YA 1GK9A 4EB6B 2ARHA 5CA0A 3ZIAG 3E8GA 3H9VA 3KCXA 4PHZA 4LFBB 3K58A 1Y6XA 1ORQC 3SJAC 3CC2V 2GSMB 1VQKV 4JI1B 3CX5F 2HFEC 1QLEC 4LF7B 3K5OA 3WU2Z 2LJ2A 4O2AA 1TUEB 2ZKOA 3C90A 1BCCH 3CMEV 1IZ3A 1WN7A 3ZHRA 1XI1A 4TV8B 5CN0A 1XNQO 1WA8B 2GV9A 4B3RB 2Y4UA 3Q4HB 3UT5A 2QWOB 4Z2WA 1N8RW 3VQVA 3CCMV 4DV5B 4JI4O 1QQCA 5FLXN 3CCLV 4J42A 1HW7A 4LP8A 3CRMA 3LDDA 4H13B 5DEDA 4X62O 3QF7A 1NQTA 5DN6G 3K0GA 1NH2D 5ITZA 4DR2O 2A9HA 1FD9A 3G6EV 3SR2C 2JVDA 4TQFA 4IHJB 2RMKB 3ETEA 1I5YA 3CEIA 3IAYA 4DR3O 1Q6IA 4DYLA 1S5HC 2D3OW 5LOVA 4R6ZA 2N04A 4U7NA 5GTIZ 4NB5A 1OHHG 2VRZA 3RYHB 1B3QA 1FXKC 2L35A 2WSSG 4JV5B 2RN9A 4PDRA 1L0LH 1VMGA 1B04A 4FLVA 1A32A 4UCVA 4BAYA 2QE7G 1J95A 4PI0A 3K79A 1DK1A 1AI7A 3AG4C 4PA9A 4PV1B 1B6QA 2AZ2A 4LF6O 2W0FC 1OCZB 4DR1B 2R9RB 2IW5A 2KKWA 5KX5B 4P9PA 1DGSA 2HR3A 1BQZA 3OTOB 3L75H 1GH6A 3T4ZA 2DYSB 1Q82W 3CC7V 1GO3F 4JASA 2X0LA 4YHHB 3RWRD 2R70A 1WPBA 3I55V 2GUZB 1WB7A 1AJQA 3W7TA 3DXRB 4X88A 4OX9O 2ETNA 5H5NA 3OUFA 4KUMA 2UUBB 5JH7A 2P22C 1H2MA 1P49A 3JCZA 2DWDC 2A0LA 3RYCB 4ZBMA 1ZLZA 3RVZA 3OMIB 5EYPB 5K1PA 5EC2C 1YIJV 2ZR2A 1L0NH 3MD0A 4FFKA 3VBBA 4KHPO 1L8DA 2R9IA 2ZM6O 1VQPV 2VWJA 5IJ0A 4X20B 1SF9A 2LGQA 4X65O 4FLWA 1M57C 3GWOA 1P7GA 4EFBA 3BEHA 1GKFA 4DRXA 1S77D 3FAVA 3U10A 1IXMA 1KBHA 3TK1A 1J5EB 3N2GB 5J2UA 1GM9A 4C7UA 1N36O 4JI5O 2BSKB 3TJTA 4RAIA 2A7WA 3ABMB 4PDLA 1KP2A 2EJRA 3ZJZA 2PTMA 2V7QG 4JI8B 3OD4A 1OCOC 1N0NA 4O4HA 4JI0B 2AGAA 4LFCO 1FPOA 1F7YA 3PN1A 4CZZA 2OTJV 4U3FH 3ABUA 1Y76B 3K5NA 1THZA 2UUAO 1N0JA 4FLTA 1GN6A 5B1BC 2QJ1A 3RBZA 4ABMA 3E8HA 4DR6B 2CUGA 3CXCU 4O4LA 1Y66A 2EIMB 5EIBD 4BIZA 4LNUB 3O65A 5BMVA 3W7XA 2WWWA 3W7WA 1SQFA 2K1EA 2WLKA 2WLIA 4J80A 2VWKA 1LUWA 2VS0A 2M6YA 4TOIA 3JAKA 3SPIA 1K92A 3UCSC 5JVDB 2BTQB 3L72H 4GT1A 1V55B 4LH7A 3ZEDA 3AG1B 5KHIA 5LL6Y 3B09A 4EKWA 2Y48A 4FM2A 3CWBH 2YIBA 4MVOA 3X2QB 1F23A 1QR8A 3ASNB 3APOA 2QM4A 4JYAB 2N74A 4CC6A 3P3PA 4K0KB 1KYOF 2JDIG 5KAIZ 1NVPB 3VOUA 3G6BA 4YIPA 1SA0B 1K3EA 1YZBA 1WP8A 1XQ8A 4CBCA 1H2KA 1SZTA 4B3SB 4GZRB 1JVMA 2YS8A 1FS0G 5LYJB 4KFMA 2ZD9A 1U97A 2QKCA 3L71H 5IYZB 3CB2A 1U96A 1SQQH 2PF4E 3K06A 2CTRA 1V54C 5KHJA 1XL4A 3JD1A 4X1YA 3S3XA 3T1YB 3OW2U 3CD6V 3ZN1A 4ZIBA 4I50B 2UXXA 3T4DA 4CH4A 3D3QA 1AVMA 2NR5A 1PL4A 2UUCB 3DTUB 3VQWA 5C8YB 1KMIZ 4JPRA 4AQYO 1XILA 5B1NA 5IT9N 2H3OA 1XHXA 4DV4O 1I0HA 3P3NA 1SESA 2LGWA 4PDMA 4X1KA 4WBNA 3BY6A 3DC6A 4BW5A 3GWKC 3SYPA 4J7ZA 1KUQA 4R8CA 1NS1A 4CH5A 1DF5A 1AB3A 3BRCA 1RM1B 4UV8A 1NR1A 1YF2A 3G71V 1X59A 1R6NA 3N27A 3DGEA 3WB1A 1D2DA 1XHZA 1YJWV 5JJEB 2WA3A 4X1IA 4GYCB 1XUQA 4DV1B 4FVMA 3WG7C 4NXNB 4UCTA 1HNZB 1WB8A 1V9PA 1EN5A 1ENVA 3E8FA 5KHHA 1FXKA 3JATB 4H33A 3TETA 1IBLO 3ETDA 1UPGA 3E89A 5JWPA 2ZXWC 5FPOA 4HNAB 4O4JB 4B3TB 1MMMA 2Q0AA 3ZHTA 2EIKB 2QTOA 1JCHA 3U0ZA 1SQPH 3BA8A 2LP7A 2JS3A 3LUTB 3LSSA 1VQ5V 3JAWA 2WLHA 1HNXB 3JASA 4HBNA 1Q86W 1DF4A 4LH6A 4LWSB 4X66O 1PL0A 4F4LA 5KUMA 4KL1A 4GKJO 5LMNO 2P4VA 1AJPA 1N32B 2OT5A 5LGNA 5IWAB 4LFAO 3B77A 1OCCC 3OFNG 5HFLA 4YJ3A 2EINC 2CAZC 4JF3A 3UQ8A 4JI7B 1NJIW 1FFXB 4MTGA 3CJHA 1BZKA 1LNQA 4MT8A 1HR0O 5H6RA 1EM1A 4IYIA 5EBMC 3OR7C 3SDLA 1XOUA 3SPGA 4I9WA 3PJSK 4MW3A 1K97A 4FLXA 1KC8W 4QNHB 4UCOA 3K08A 4JTDB 2HP8A 1YTFB 4O2BB 4DV6O 1OJHA 1M9NA 4TV8A 1UFIA 2FMLA 2CTQA 5CA1B 3Q4HA 3L9DA 4JI6B 2CH7B 1FXHA 1Z5WA 4JAVA 1G8MA 4YY3B 4DV2O 3R66A 1XL6A 3A8TA 4X89A 2F66C 5BR8B 3GVMA 1XREA 4OPHA 4A5UB 2XTAA 1VQ9V 3HKCA 4ZHQA 1H2SB 4P2ZA 3D8CA 2ZIMA 5B3SB 1BMFG 1KQSU 4IHJA 2X6BA 2O57A 5FPRA 2F1MA 5EBWC 2IJJA 4LR3A 1TUBB 4F6RA 3CRQA 4LFBO 1JX9A 2EX3A 4Q20A 1CXZB 1BSMA 2E5LB 1RPOA 4QE7A 4JZGA 3RYHA 3CC4V 4FFBA 1AP5A 3BPZA 4Z1VA 3H1HH 1WPXA 4JI1O 2HKOA 1I7FA 3I5DA 4JAUA 3ZHSA 1SETA 4DW0A 1MABG 3T1CA 1ZL8B 4DW1A 2QEXV 1I94O 2WLJA 2DWEC 5H2FZ 2F4VB 2YSUB 2QM7A 3A0RA 3AG3C 1Y4MA 2OCCB 2JGDB 2RJZA 2LQTA 5TISZ 3BHPA 3OAAG 3T2MA 5D5QA 4FJCC 4J41A 3N2KA 4DV5O 3AG2B 1IBKB 2N05A 2Q67A 4DR5B 5EBLC 4MVSA 2HHHO 1YEWA 4J7JA 2DYRC 2GHYA 4R50A 3EXAA 2JGUA 2ZNIA 2QKSA 2GUZA 4MVRA 4TQDA 3BA9A 5LXTB 3BAAA 3OUSA 4MVMA 5EC1C 3ASOB 1Y74A 5LGUA 3S3WA 3M8AA 1NT2B 4UVBA 1FXVA 4TV9B 4DUZO 3SPHA 2JS5A 2ZINA 2JJ1G 1GM8A 3ZRWB 5CB4B 2ZE6A 5LP6B 4LF4O 5EYPA 4DR2B 1SERA 3HKDA 3AK2A 2KB1A 4RWUA 1YCIA 1O9GA 1CEZA 2XAHA 3WB2A 4K8ZA 4GX5A 1SQBH 4X20A 3VQXA 4JV5O 1EBOA 3RYIB 5CA0B 1VF5B 2YUAA 4N21A 1W59A 3RYFB 2HJFC 5IE9A 1G6UA 3N2GA 3TGUH 2KG7A 3QTCA 2XUMA 5KLVH 4I4TB 2BSKA 4R7CA 4PJ0Z 1GN2A 1GMGA 3LDEA 4DR1O 4LF5B 2OCHA 3KKYA 4RO2A 2E75B 4JGSA 2QA4V 4HZ3A 2Q7HA 1Z2GA 1F4NA 3OTOO 2NN4A 5BY1A 4O2AB 1YTFD 1Q3EA 5L3DA 4W4LA 4I9QA 1GN4A 2P90A 3L74H 4MTXA 1TVKB 4YHHO 1Y76A 3OGIB 3SYAA 2UXDB 4AHCA 1JQ0A 2AZ0A 4XBFA 1NKDA 1BGYH 3K5MA 1QR9A 2QGNA 4LF8B 4I55B 2BOCC 4NXMB 2UUBO 1G4YB 4LC1A 4DR4O 4P30A 3ZRVA 2AHZA 1PM9A 3OMAB 2Q8VA 5ITZB 3SYCA 3T1HB 2Q5ZA 4ZI7B 4LNUA 4J11A 2EILB 2F23A 5LA6B 4ICGA 3B40A 3O9OA 2Q6AA 2Q7EA 4DV7B 5LHHA 1R73A 2Q69A 1M93A 3ZX6A 1AR4A 4WCEV 3MAQA 2CDYA 4JYYA 1M90W 4DR7B 4PELA 5LOVB 3U11A 1FAFA 3E22B 3ABLB 5JVDA 2BTQA 4BR6A 2RDCA 1J5EO 1EZJA 4P9OA 2ZM6B 2RCVA 5L3GA 4AI8A 2XAJA 4EEQA 2F93B 4D6TH 1VQ6V 1BE3H 5KHGA 5CMUA 3FFQA 2C2AA 2HVKC 2ADPA 5LMUB 1GTOA 2XAFA 1PP9H 1S5JA 2BOBC 3RW0A 3K0DA 4JI2B 4JI0O 1XMOB 2XASA 3C3TA 3H01A 3ZN0A 3OR6C 4FZ0A 4JI5B 4X64O 3E2EA 2IU0A 1SA0A 3F7YC 5KAFZ 2YIAA 3KCYA 2IJKA 3ZMSA 4YJ2B 2IU3A 2P6JA 1EZVH 1SKVA 3W7SA 3CCSV 5LYJA 4GX0A 4LFCB 3L70H 5IYZA 4JAAA 3AK3A 1NU1H 3OGCC 2QSAA 5IY5B 3CP1A 4MS2A 2QTSA 1P7BA 3B2EE 3GB7C 3LSUA 1YITV 5JH7B 1OCZC 2YXLA 4DV3O 1IXBA 4X8AA 2HG5C 2EIJB 3UO2A 5L3CA 4WFBV 1K8AW 3G80A 1HNWB 3KZIZ 1IBMB 2DYSC 1Q6HA 3OT7A 3CRCA 1IX9A 1XNRB 5IJ0B 3SJQC 2Y69B 4H44B 1KP3A 1R3KC 3D36A 4DRXB 4U7OA 1AR1B 3SYQA 2BCCH 1H2GA 3ZMVA 4WF9V 4UUJC 2DMXA 5BZBA 4IIJB 4JYAO 1OCRB 5IDJA 2H94A 3CCQV 3K9AA 2Y4TA 3E83A 4K0KO 2E3CA 5DECA 4FLUA 4WFEA 2CTWA 4I0XB 4DUYB 4GX1A 1M4UA 4JYBA 4B3SO 2B1IA 2DN9A 5H6QA 5B1AB 4O4HB 3ZMTA 2DOSA 1H2NA 5LHGA 1EFRG 1QCEA 1NZ6A 3HKEB 1XMQB 4WFFA 1L1FA 1X4TA 4U3JA 3SYOA 1HWYA 1JFFA 1ZX3A 3OEHG 3ZRSA 5AG2A 4OPAA 3K9SA 4K8XA 3AEIA 4HNAA 3RFRA 3ABMC 4DK1A 1AR5A 2WLLB 3ZMUA 5DM6V 4EFEA 2ITCC 3CYOA 2AW9A 5GONA 2UUCO 5K1XA 4GUNA 2VQFB 1FFTB 3CCVV 1JR9A 1GAXA 4XDLA 3ZCCA 2Q0OC 4MVZA 3P32A 2CGNA 2FKXA 3JAKB 4NYKA 3HKBA 4LWSA 5EZYB 1RSOB 2EULA 2L6LA 4PA3A 1FKAO 1N34B 3SPCA 3F5WC 3WFVA 1KKDA 1PV0A 3TCUA 4DV4B 2EIMC 3K03A 5A9GA 1FFXA 2P4KA 4NTXA 5FNVA 4B7EA 2Q9LA 1PKXA 1M56B 3F7VC 3CCJV 2YEVA 3FB8C 4PA7A 1Y67A 3FX7A 4D7TA 4ZOLB 2VQEB 3QNEA 1BHAA 2P7TC 1M5IA 5JQGA 5KHKA 4DV1O 2XT9A 4I7ZB 2FB5A 2YXHA 1IVSA 3I56V 1MG1A 4O2BA 5J2TA 1V55C 2AXTZ 3CRRA 4NXNO 1HNZO 1ROPA 3AG1C 4BIOA 5CA1A 1BL8A 2UXNA 3E35A 4UFZA 2CH7A 2QDOA 2CK3G 4QGPA 3X2QC 3ASNC 4RQFA 4B3TO 2B9ZA 2PY5A 3CSXA 2WPDG 4ASUG 2LO1A 1VQMV 2UXBO 3QO7A 1XDCA 3IC9A 3H1IH 1E79G 4KXRA 4F6EA 1QNMA 4DK0A 1VARA 2Z0AA 4QPKA 5LBQA 1HNXO 1QLEB 1K4CC 4RUEA 4QIWF 1WJZA 1Q8IA 1H8EG 4EB6A 2ZDIC 1F4MA 4O4IB 1VEWA 1VQLV 3ZS8C 3K04A 1YSCA 2LFRA 3JALB 1RP3B 3THOA 1N32O 2Q68A 3EHBB 5IWAO 3QO8A 1FJGB 4JI7O 3IGAC 4X1KB 4WBNB 2XOKG 4GKKB 4X66B 2AHYA 2QWPB 4TUYB 1IDSA 2UXCB 4GKJB 5IJ9B 1N33O 2UU9O 4QJFB 1ZL8A 3AK1A 3NR7A 2W0XA 1SQGA 1R3LC 2NNUA 2GBOA 4FLZA 1HDJA 4IGGA 4FMTA 4LF9B 2JGDA 5B66Z 3CCEV 1WA8A 5GTHZ 2OYQA 4JI6O 3BCCH 5KA6A 4JI3O 2PI4A 4YY3O 1Q5OA 2V1DA 3D36C 4GLXA 2XNDG 5FL7G 2F95B 4B3MB 4DV6B 1RM1C 1SC5B 1GN3A 3JARB 1FXKB 2JJ2G 5BR8O 1SS3A 4XDKA 3B8MA 1D5AA 4DV0B 2KQXA 1EN4A 1K73W 2GTSA 5E79Z 2ATKC 2ZIOA 5JJJB 2A3QA 2GDSA 2Z5UA 3AG4B 4NTYA 3ZRWA 1CP9A 3ICXA 2HLDG 3NXSA 1WAZA 3JAWB 1VQOV 3OE7G 3JASB 3W7UA 1SQVH 3M99B 2E5LO 1S3JA 2EZOA 3FYEB 4YXWG 3SPJA 2ZNJA 3RYIA 2X6CA 1PNLA 1S0VA 2PGGA 3F5TA 3RYFA 1W0JG 1BHBA 2FL4A 4LF7O 4HAMA 3E8BA 2X7RB 2EIKC 4YJ3B 5L3EA 4FIPC 5CBGA 2YIBD 1NR7A 4OGQB 1VF7A 3CJHB 1S72V 4I4TA 2F4VO 2R9AA 2ITDC 3G67A 4NVPA 4B3RO 3FB5C 5KX5A 4ZKIA 2IH3C 4J9ZB 1PPJH 1IBKO 1I5XA 3K57A 4DR5O 1I94B 2JRIA 4MVQA 3BVOA 3OTFA 4PA4A 1XNQB 4CH3A 5CA3A 1TVKA 3JD3A 1M57B 2FYUH 1R3IC 1Q7YW 1M1KW 2Q7GA 3DXRA 1VQNV 4JI4B 5KMGB 3ZHVA 3ZMZA 1NI8A 4I55A 3WB0A 2WLNA 2CE4A 2HHHB 1FYJA 3E86A 3ETGA 4X62B 2BTOA 1S5LZ 1VF6A 3RYCA 2A79B 2R72A 3BABA 1BQ0A 1YJ9V 4ZI7A 5J9PC 1US6A 3HKCB 2E74B 4ZHQB 2QWRB 1N4CA 5LA6A 5CBFA 1GRJA 2X6AA 4TWKA 4DUZB 1OCOB 3FKSG 2P06A 5JCOA 4JTAB 5A2QN 3CRAA 4DR3B 3MHSC 4LF4B
chains in the Genus database with same CATH topology
1AROP 2F43G 3W7SA 1COWG 1DTOA 3CCSV 3CCRV 1SESA 4GX0A 2OTLV 3OM3B 1JOYA 4PDMA 3ML0A 2IH1C 3IC7A 3BY6A 3STLC 4BW5A 2JEUA 3SYPA 3OGCC 4R8CA 3FB7C 4KP4A 1WLEA 4FPPA 5IY5B 1DF5A 1NBMG 5B1BB 1RM1B 3CP1A 4MS2A 1P7BA 2JIZG 3GB7C 1M56C 2JK5C 4UV8A 2DQ0A 2DQ3A 1AJNA 2WLMA 4MTOA 5C93A 2QM8A 1NR1A 1YITV 4TSFG 3G71V 1R6NA 1OCZC 1OZ0A 5B3SC 4UV9A 3IFXA 4X8AA 2HG5C 2EIJB 3DGEA 5GW7A 1K33A 1YJWV 3UKMA 3JYCA 5L3CA 4WFBV 1K8AW 5KUKA 1YHQV 4PA6A 4GCZA 4FK5C 4UXNA 4MVUA 2DYSC 2Z3YA 1GK9A 2XAQA 5HFMA 3ZIAG 3E8GA 3SJQC 3WG7C 2Y69B 1QLNA 1KP3A 3G4SV 3E8FA 1ENVA 1FXKA 3OMNB 1R3KC 4H33A 3TETA 1ORQC 3D36A 4U7OA 3ETDA 4WFHA 3E89A 2ZXWC 1AR1B 3SYQA 3ZMVA 1H2GA 4MW8A 4QPJA 4WF9V 4UUJC 4DO2A 3CC2V 5BZBA 3STZC 2GSMB 4L87A 1OCRB 1VQKV 5IDJA 2H94A 3CCQV 3K9AA 2EIKB 2QTOA 2HFEC 1F51A 3E83A 1K9MW 1QLEC 1JCHA 2OCCC 3KG2A 1E1QG 3JD4A 4WFEA 2LP7A 1UJWB 1AI4A 1TUEB 3LUTB 1AI6A 3LSSA 4GX1A 1VQ5V 4JYBA 2B1IA 5H6QA 1ZWIC 3CMEV 1VQ4V 2WLHA 3AG2C 5B1AB 5CN0A 5B1OA 5E1AC 3ZMTA 2NLJC 1Q86W 5L3BA 1DF4A 5LHGA 1EFRG 1QCEA 1PL0A 4WFFA 1RPRA 4F4LA 1N8RW 1L1FA 5KUMA 3CCMV 4RUFA 1AJPA 3CCLV 2OT5A 5LGNA 3SYOA 1JJ2U 4LP8A 3ASOC 1HWYA 3B77A 1OCCC 3LDDA 3OFNG 3OEHG 4JYCA 5HFLA 3LSQA 2EINC 3ZRSA 4JF3A 1NJIW 3AEIA 4MTGA 1NQTA 5DN6G 4J9YB 5IYCO 3K0GA 3CCUV 3ABMC 1NH2D 1V54B 1LNQA 2WLLB 1KECA 2A9HA 4MT8A 3ZMUA 3D3IA 3EFFK 5DM6V 5H6RA 5EBMC 3OR7C 1K7DA 2ITCC 4HYOA 4WFGA 3CYOA 3G6EV 2W6JG 3SPGA 4I9WA 4XDJA 3JD0A 3PJSK 4MW3A 4UVCA 1QBZA 3ETEA 1FFTB 3CCVV 1K97A 1KC8W 2M7WA 4QNHB 5L3FA 1I5YA 4XDLA 3K08A 5LHIA 4JTDB 3ZCCA 1YTFB 4MVZA 1M9NA 1S5HC 2D3OW 3HPLC 3JD2A 2ZDIA 4R6ZA 3P32A 4U7NA 3ZMSA 5KA5A 1OHHG 2B5UA 4G2KA 1PD3A 4PA3A 4JAVA 1FXHA 1G8MA 3K3WA 1FXKC 5LGTA 3SPCA 3F5WC 2WSSG 1R3JC 3WFVA 1KKDA 3TCUA 1SRYA 4E2LA 1YJNV 1R6KA 4MTFA 2EIMC 4PDRA 2IJIA 1XL6A 3K03A 4X89A 4Z1MG 1PNMA 1KD1W 4BAYA 2QE7G 1J95A 3K79A 2WLLA 2IJHA 1AI7A 3AG4C 1E1RG 4PA9A 1B6QA 1PKXA 1M56B 1VQ9V 3F7VC 3CCJV 3CPWU 2YEVA 3FB8C 4PA7A 2W0FC 4G27B 4P2ZA 1OCZB 5B3SB 1BMFG 1K5QA 2R9RB 1KQSU 2IW5A 3QNEA 2X6BA 1BHAA 2P7TC 4P9PA 1K5SA 1K34A 2HR3A 5EBWC 2IJJA 2ZR3A 3I56V 1MG1A 1V55C 2MK3A 3T4ZA 3FB6C 1JX9A 1ROPA 4Q20A 1K4DC 2DYSB 1Q82W 3AG1C 2XAGA 3CC7V 1GO3F 1BL8A 2UXNA 1RPOA 3E35A 4JASA 4QE7A 2X0LA 2CK3G 3CC4V 3I55V 3WG7B 3X2QC 3ASNC 1AJQA 4RQFA 4LCUC 1WPXA 3QO5A 2HKOA 3W7TA 4X88A 4JAUA 2WPDG 1SETA 4ASUG 3OUFA 4KUMA 2ZXWB 1MABG 3T1CA 1VQMV 3QO7A 2WAMA 2EILC 3JCZA 1E79G 2A0LA 2DWDC 4ZBMA 2QEXV 2WLJA 3LDCA 3RVZA 2DWEC 3OMIB 4QPKA 1JPXA 2YSUB 5LBQA 2QM7A 5EC2C 1QLEB 3A0RA 3AG3C 1K4CC 4RUEA 1YIJV 1Y4MA 2HVJC 4QIWF 2OCCB 2ZR2A 1W0KG 3MD0A 1H8EG 3OAAG 5IYBO 3T2MA 3VBBA 2R9IA 2ZDIC 1F4MA 1VQPV 3ABLC 1VQLV 4FJCC 2W6IG 3K04A 1YSCA 3AG2B 3UM7A 2LFRA 2JEXA 2Q67A 1M57C 3GWOA 5EBLC 2Q68A 3EHBB 4MVSA 3BEHA 3QO8A 2DYRC 2GHYA 1GKFA 2EBOA 4R50A 1S77D 3IGAC 3ZRXA 1IXMA 2FTKA 4I5SA 3TK1A 2XOKG 2QKSA 4MVRA 1GM9A 2AHYA 3OUSA 4MVMA 5EC1C 3ASOB 3ABTA 1OCCB 4TT3G 5LGUA 2EINB 4RAIA 4UVBA 4QJFB 1FXVA 3OEEG 3ABMB 3SPHA 2JJ1G 1GM8A 1Q81W 4PDLA 1KP2A 2EJRA 3ZJZA 1MOFA 1R3LC 2NNUA 3ZRWB 2V7QG 1MSWD 1OCOC 1PNKA 2WLIB 1SERA 4FMTA 4JTCB 3CCEV 4G28B 2KB1A 4CZZA 3ABKB 2LFSA 5KA6A 2OTJV 3ABUA 2XAHA 1CEZA 2PI4A 4GX5A 2EZPA 1THZA 2V1DA 5H9CA 2XNDG 5FL7G 1EBOA 5IY5C 5B1BC 1RM1C 4N21A 1YI2V 2HJFC 3RBZA 1AI5A 1FXKB 2JJ2G 3E8HA 4MSWC 4XDKA 1W2BU 2DW4A 3CXCU 3B8MA 1Y66A 2EIMB 2P67A 2ZQMA 2EIJC 4R7CA 4GX2A 4BIZA 1H38A 1GMGA 3LDEA 1K73W 2ATKC 3W7XA 1VQ7V 2WWWA 4PDVA 4RO2A 4JGSA 3W7WA 2Z5UA 3AG4B 2QA4V 1S76D 4HZ3A 2K1EA 3ZRWA 1F4NA 2WLKA 1CP9A 2PI5A 1GM7A 2WLIA 1YTFD 5L3DA 2HLDG 3NXSA 1VQOV 3OE7G 1P4RA 3SPIA 1K92A 2Y69C 3W7UA 2P90A 3M99B 4MTXA 4H37A 1S3JA 4GT1A 4N23A 3SYAA 4LBEC 1V55B 2EZOA 3FYEB 4YXWG 3SPJA 1VQ8V 2X6CA 1PNLA 1JQ0A 3AG1B 1S0VA 4XBFA 1NKDA 1W0JG 1BHBA 1QR9A 1OCRC 2BOCC 3LNMB 4EKWA 4HAMA 2Y48A 3E8BA 1G4YB 2X7RB 4LC1A 2EIKC 4MVOA 5L3EA 3X2QB 1F23A 4FIPC 1QR8A 3B8NA 4DXWA 3ASNB 5CBGA 1DLBA 4P30A 4UVAA 3ZRVA 1CPYA 1NR7A 4BIUA 1NH2B 2AHZA 3OMAB 1S72V 3SYCA 2EILB 2ITDC 2JDIG 5B1AC 3CMAV 3VOUA 1NVPB 3FB5C 2Q6AA 4ZKIA 2IH3C 4J9ZB 5CBHA 5LHHA 1R73A 1K3EA 2Q69A 4CBCA 4WCEV 1I5XA 1SZTA 3AG3B 4WFAV 1H8HG 3MHHC 3FYIB 4RQEA 4MVQA 1JVMA 1FS0G 1M90W 4KFMA 4PA4A 4PELA 2ZD9A 3ABLB 5CA3A 1EZJA 3JD3A 4P9OA 3R65A 1M57B 1R3IC 1Q7YW 1M1KW 3K06A 1VQNV 2DYRB 3RVYA 5L3GA 2XAJA 1V54C 3ZMZA 2B1GA 1VQ6V 1XL4A 2WLNA 3JD1A 5CMUA 3P30A 3E86A 3ETGA 2C2AA 2HVKC 1QVGU 1GTOA 2XAFA 3HB3B 3OW2U 2BOBC 3RW0A 3CD6V 3ZN1A 3K0DA 2A79B 5EK0A 2UXXA 3T4DA 1QVFU 2XASA 1YJ9V 5J9PC 3H01A 3ZN0A 3OR6C 2YEVB 4QE9A 5CBFA 3DTUB 1NVPD 3E2EA 2H8PC 4JPRA 2IU0A 2X6AA 4TWKA 3F7YC 5B1NA 1OCOB 3FKSG 3ABKC 4JTAB 5IYDO 2IJKA 3MHSC 4OXSA 2IU3A 2P6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7R B;  5HFL A;  1MOF A;  2MK3 A;  4N21 A;  1ENV A;  2EBO A;  4JF3 A;  1F23 A;  4FIP C;  1QR8 A;  3B8N A;  1DLB A;  1K33 A;  5CN0 A;  1JPX A;  5KA5 A;  3MHH C;  3B8M A;  1Y66 A;  3H01 A;  3M99 B;  1Y4M A;  1DF4 A;  4G2K A;  1DF5 A;  1QCE A;  3CYO A;  4FK5 C;  5KA6 A;  4N23 A;  3CP1 A;  2EZO A;  3K9A A;  3WFV A;  4JPR A;  2EZP A;  5H9C A;  4FJC C;  5HFM A;  4E2L A;  3MHS C;  1JQ0 A;  1QBZ A;  1K34 A;  1EBO A;  4JGS A;  5CMU A;  2OT5 A;  3P30 A;  1QR9 A;  3GWO A;  1I5X A;  1SZT A;  2LP7 A;  1MG1 A;  2M7W A;  1I5Y A;  3B77 A;  2P6J A; 
#chains in the Genus database with same CATH topology
 2F43 G;  4F6R B;  1MSD A;  2OTL V;  5F2V O;  3E22 A;  2IH1 C;  3AG7 A;  3STL C;  3FB7 C;  4JZ2 A;  4FPP A;  2LW7 A;  1NBM G;  2Y0I A;  5B1B B;  4UCU A;  4FFB B;  1LR1 A;  2ZE7 A;  3K5L A;  4LF5 O;  4B08 A;  1AJN A;  4TSF G;  1OZ0 A;  5B3S C;  4H0L B;  3CXH F;  1D5N A;  5GW7 A;  4LF6 B;  5KUK A;  1BT8 A;  4GCZ A;  4FK5 C;  3UT5 B;  2A06 H;  2UXD O;  2XAQ A;  5HFM A;  2ZCE A;  2MW2 B;  3N2K B;  4YJ2 A;  1WNS A;  1QLN A;  4LF8 O;  1ZUQ A;  4NXM O;  3G4S V;  3OMN B;  2QWQ B;  4WFH A;  3K59 A;  4MW8 A;  4QPJ A;  2DE0 X;  4DO2 A;  2WA4 A;  3STZ C;  4L87 A;  2KSD A;  3T1H O;  2Q4P A;  1Y74 B;  4OX9 B;  1F51 A;  1K9M W;  3MDS A;  2OCC C;  3KG2 A;  4IYH A;  1Q90 D;  4CS2 A;  1TAE A;  1E1Q G;  3JD4 A;  4DV7 O;  1XEQ A;  1UJW B;  1AI4 A;  4DR4 B;  1AI6 A;  3QG5 A;  2QKA A;  1ZWI C;  1R1B A;  1VQ4 V;  3AG2 C;  5B1O A;  5E1A C;  4DR7 O;  2NLJ C;  3HKD B;  5L3B A;  1YDX A;  4KHP B;  1RPR A;  4RUF A;  1WP7 A;  4X65 B;  5EIB C;  1JJ2 U;  3ASO C;  2ZE8 A;  4JYC A;  2ODM A;  3EVK A;  3LSQ A;  4J7K A;  5LMU O;  3APQ A;  5JJN B;  1I08 A;  4J9Y B;  4JI2 O;  5IYC O;  4JI8 O;  3CCU V;  1O9H A;  1V54 B;  3SGI A;  1KEC A;  4IIJ A;  3J80 N;  3D3I A;  3EFF K;  2KG7 B;  1XMO O;  1K7D A;  4HYO A;  4WFG A;  1N36 B;  5LP6 C;  2W6J G;  3B4S A;  4XDJ A;  4NR1 A;  3JD0 A;  2GTA A;  2E76 B;  3A2F A;  4UVC A;  1QBZ A;  4I0X A;  3ZHU A;  4E4E A;  3JSN A;  3ZBH A;  2M7W A;  2YXY A;  5L3F A;  5LHI A;  4Q6G A;  1MZF A;  1AP6 A;  3HPL C;  3JD2 A;  2ZDI A;  1JMK C;  1YXB A;  1TA8 A;  5KA5 A;  3H1K H;  1MNG A;  4IT5 A;  4PI2 A;  4X64 B;  4DR6 O;  3HKE A;  2B5U A;  4G2K A;  1PD3 A;  3QVN A;  3TXQ A;  2YDE A;  3K3W A;  1URF A;  5LGT A;  3L73 H;  2UUA B;  1R3J C;  2Q73 A;  3TXS A;  1SRY A;  4E2L A;  1YJN V;  1R6K A;  2V4D A;  4MTF A;  2IJI A;  3J7A U;  4Z1M G;  1PNM A;  1KD1 W;  3ZHQ A;  2HEP A;  4I50 A;  3J81 N;  2WLL A;  2DJV A;  2IJH A;  2OIE A;  1E1R G;  4B7K A;  3CPW U;  1HNW O;  4G27 B;  1VP7 A;  5C8Y A;  1IBM O;  1K5Q A;  4CH6 A;  1VIB A;  3FD9 A;  1K5S A;  1K34 A;  4DV3 B;  1XNR O;  2ZR3 A;  1NTZ H;  2MK3 A;  3FB6 C;  1K4D C;  3UO3 A;  3JAM N;  2XAG A;  5EZY A;  1RSO A;  3FAV B;  1QHT A;  2ZE5 A;  5J2U B;  3WG7 B;  1VF6 C;  4LCU C;  3QO5 A;  3CHX A;  1ZSP A;  1ZAU A;  2ZXW B;  2WAM A;  1JJO A;  2EIL C;  4X9Q A;  3IJ4 A;  4DUY O;  3LDC A;  1MA1 A;  3ETQ A;  1JPX A;  5JCO C;  3JSL A;  1OV9 A;  1KB9 F;  2HVJ C;  1W0K G;  4ZOL A;  1NTK H;  1P84 F;  5IYB O;  1XMQ O;  4BWA A;  3ABL C;  2W6I G;  2PUS A;  1HP8 A;  3UM7 A;  2JEX A;  4PD4 F;  2PYL A;  3VQY A;  3JAT A;  2P5O A;  2EBO A;  2RNB A;  3T1Y O;  3ZRX A;  1SZX A;  2FTK A;  4I5S A;  4O4J A;  4K35 A;  4O4L B;  1TGO A;  3ABT A;  4UCS A;  1OCC B;  4TT3 G;  2EIN B;  5BMV B;  2VQF O;  1QU7 A;  3OEE G;  1Q81 W;  1MOF A;  2CGO A;  1MSW D;  2WLI B;  1PNK A;  2EJ7 A;  2YIC A;  4JTC B;  4G28 B;  3ABK B;  3H1L H;  2LFS A;  4O4I A;  1BS3 A;  5D5P A;  4AQY B;  2OWO A;  2QR4 A;  1Z5V A;  2CTP A;  2EZP A;  5H9C A;  1N34 O;  2YI9 A;  3JAL A;  5IY5 C;  4IL6 Z;  1SQX H;  1YI2 V;  1AI5 A;  1Q43 A;  3BFR A;  4MSW C;  1W2B U;  2DW4 A;  4TUY A;  2P67 A;  4L8J A;  2ZQM A;  5IJ9 A;  2EIJ C;  2BE3 A;  1RFY A;  1B06 A;  4GX2 A;  1H38 A;  1VQ7 V;  2VQE O;  2ILM A;  4PDV A;  4D7S A;  4NKG B;  1S76 D;  3HR0 A;  1YVW A;  2PI5 A;  1GM7 A;  1P4R A;  3RN4 A;  1JA8 A;  2Y69 C;  5B5E Z;  2LW1 A;  4H37 A;  2HJD A;  4N23 A;  4LBE C;  1MZE A;  1VQ8 V;  1R6T A;  4UCR A;  1OCR C;  3LNM B;  4U3J B;  4X1Y B;  3JAR A;  1JFF B;  1Q6U A;  1IBL B;  4DXW A;  3B8N A;  2PZS A;  1DLB A;  4UVA A;  4UB8 Z;  1CPY A;  1IUR A;  1NH2 B;  4BIU A;  3H1J H;  3SJB C;  3RT3 C;  2ADQ B;  3CS5 A;  3LNN A;  3DC5 A;  3C3S A;  5GON B;  5B1A C;  2XHB A;  3CMA V;  2UXB B;  5CBH A;  2QWN B;  1TUB A;  3AG3 B;  4WFA V;  1H8H G;  3MHH C;  3FYI B;  4RQE A;  1XBL A;  4J10 A;  3JCU Z;  1EN6 A;  1FJG O;  1KU9 A;  4GKK O;  3HKB B;  3R65 A;  1AIL A;  4AIL C;  2UXC O;  2D2C B;  1LUV A;  2DYR B;  3RVY A;  5LMN B;  2K9P A;  1NTM H;  1H2L A;  2B1G A;  4UB6 Z;  4BW9 A;  4LFA B;  3P30 A;  4FZ1 A;  2G38 A;  4W4K A;  1QVG U;  3HB3 B;  3SJC C;  5EK0 A;  2PYJ A;  1G1X B;  1QVF U;  5FNV B;  4NTW A;  1HR0 B;  4LF9 O;  2ZT9 B;  2YEV B;  3DSQ A;  4QE9 A;  2UU9 B;  2IBZ H;  3RGB A;  1N33 B;  3CE2 A;  4X1I B;  1KKC A;  4FM1 A;  1NVP D;  2H8P C;  2Y0P A;  5JQG B;  4CC5 A;  3ABK C;  4YIO A;  5IYD O;  2OIG A;  3A0H Z;  4OXS A;  5J2T B;  1ARO P;  4B3M O;  1COW G;  1DTO A;  3CCR V;  3OM3 B;  1JOY A;  3ML0 A;  4CS4 A;  3IC7 A;  4FM0 A;  2RQ6 A;  2JEU A;  3M7M X;  5LXT A;  4KP4 A;  1WLE A;  4JI3 B;  3A0B Z;  4DV0 O;  4DV2 B;  2YID A;  4K3A A;  5KMG A;  4CS3 A;  4FLY A;  4TV9 A;  2YC0 A;  2JIZ G;  1M56 C;  2JK5 C;  2DQ0 A;  2DQ3 A;  1T5E A;  2WLM A;  4MTO A;  5C93 A;  2QM8 A;  4UV9 A;  5CB4 A;  3IFX A;  5LP6 A;  1ZTE A;  2YI8 A;  1K33 A;  3UKM A;  3JYC A;  5BXZ A;  1YHQ V;  4PA6 A;  2IM9 A;  4UXN A;  4MVU A;  2Z3Y A;  1GK9 A;  4EB6 B;  2ARH A;  5CA0 A;  3ZIA G;  3E8G A;  3H9V A;  3KCX A;  4PHZ A;  4LFB B;  3K58 A;  1Y6X A;  1ORQ C;  3SJA C;  3CC2 V;  2GSM B;  1VQK V;  4JI1 B;  3CX5 F;  2HFE C;  1QLE C;  4LF7 B;  3K5O A;  3WU2 Z;  2LJ2 A;  4O2A A;  1TUE B;  2ZKO A;  3C90 A;  1BCC H;  3CME V;  1IZ3 A;  1WN7 A;  3ZHR A;  1XI1 A;  4TV8 B;  5CN0 A;  1XNQ O;  1WA8 B;  2GV9 A;  4B3R B;  2Y4U A;  3Q4H B;  3UT5 A;  2QWO B;  4Z2W A;  1N8R W;  3VQV A;  3CCM V;  4DV5 B;  4JI4 O;  1QQC A;  5FLX N;  3CCL V;  4J42 A;  1HW7 A;  4LP8 A;  3CRM A;  3LDD A;  4H13 B;  5DED A;  4X62 O;  3QF7 A;  1NQT A;  5DN6 G;  3K0G A;  1NH2 D;  5ITZ A;  4DR2 O;  2A9H A;  1FD9 A;  3G6E V;  3SR2 C;  2JVD A;  4TQF A;  4IHJ B;  2RMK B;  3ETE A;  1I5Y A;  3CEI A;  3IAY A;  4DR3 O;  1Q6I A;  4DYL A;  1S5H C;  2D3O W;  5LOV A;  4R6Z A;  2N04 A;  4U7N A;  5GTI Z;  4NB5 A;  1OHH G;  2VRZ A;  3RYH B;  1B3Q A;  1FXK C;  2L35 A;  2WSS G;  4JV5 B;  2RN9 A;  4PDR A;  1L0L H;  1VMG A;  1B04 A;  4FLV A;  1A32 A;  4UCV A;  4BAY A;  2QE7 G;  1J95 A;  4PI0 A;  3K79 A;  1DK1 A;  1AI7 A;  3AG4 C;  4PA9 A;  4PV1 B;  1B6Q A;  2AZ2 A;  4LF6 O;  2W0F C;  1OCZ B;  4DR1 B;  2R9R B;  2IW5 A;  2KKW A;  5KX5 B;  4P9P A;  1DGS A;  2HR3 A;  1BQZ A;  3OTO B;  3L75 H;  1GH6 A;  3T4Z A;  2DYS B;  1Q82 W;  3CC7 V;  1GO3 F;  4JAS A;  2X0L A;  4YHH B;  3RWR D;  2R70 A;  1WPB A;  3I55 V;  2GUZ B;  1WB7 A;  1AJQ A;  3W7T A;  3DXR B;  4X88 A;  4OX9 O;  2ETN A;  5H5N A;  3OUF A;  4KUM A;  2UUB B;  5JH7 A;  2P22 C;  1H2M A;  1P49 A;  3JCZ A;  2DWD C;  2A0L A;  3RYC B;  4ZBM A;  1ZLZ A;  3RVZ A;  3OMI B;  5EYP B;  5K1P A;  5EC2 C;  1YIJ V;  2ZR2 A;  1L0N H;  3MD0 A;  4FFK A;  3VBB A;  4KHP O;  1L8D A;  2R9I A;  2ZM6 O;  1VQP V;  2VWJ A;  5IJ0 A;  4X20 B;  1SF9 A;  2LGQ A;  4X65 O;  4FLW A;  1M57 C;  3GWO A;  1P7G A;  4EFB A;  3BEH A;  1GKF A;  4DRX A;  1S77 D;  3FAV A;  3U10 A;  1IXM A;  1KBH A;  3TK1 A;  1J5E B;  3N2G B;  5J2U A;  1GM9 A;  4C7U A;  1N36 O;  4JI5 O;  2BSK B;  3TJT A;  4RAI A;  2A7W A;  3ABM B;  4PDL A;  1KP2 A;  2EJR A;  3ZJZ A;  2PTM A;  2V7Q G;  4JI8 B;  3OD4 A;  1OCO C;  1N0N A;  4O4H A;  4JI0 B;  2AGA A;  4LFC O;  1FPO A;  1F7Y A;  3PN1 A;  4CZZ A;  2OTJ V;  4U3F H;  3ABU A;  1Y76 B;  3K5N A;  1THZ A;  2UUA O;  1N0J A;  4FLT A;  1GN6 A;  5B1B C;  2QJ1 A;  3RBZ A;  4ABM A;  3E8H A;  4DR6 B;  2CUG A;  3CXC U;  4O4L A;  1Y66 A;  2EIM B;  5EIB D;  4BIZ A;  4LNU B;  3O65 A;  5BMV A;  3W7X A;  2WWW A;  3W7W A;  1SQF A;  2K1E A;  2WLK A;  2WLI A;  4J80 A;  2VWK A;  1LUW A;  2VS0 A;  2M6Y A;  4TOI A;  3JAK A;  3SPI A;  1K92 A;  3UCS C;  5JVD B;  2BTQ B;  3L72 H;  4GT1 A;  1V55 B;  4LH7 A;  3ZED A;  3AG1 B;  5KHI A;  5LL6 Y;  3B09 A;  4EKW A;  2Y48 A;  4FM2 A;  3CWB H;  2YIB A;  4MVO A;  3X2Q B;  1F23 A;  1QR8 A;  3ASN B;  3APO A;  2QM4 A;  4JYA B;  2N74 A;  4CC6 A;  3P3P A;  4K0K B;  1KYO F;  2JDI G;  5KAI Z;  1NVP B;  3VOU A;  3G6B A;  4YIP A;  1SA0 B;  1K3E A;  1YZB A;  1WP8 A;  1XQ8 A;  4CBC A;  1H2K A;  1SZT A;  4B3S B;  4GZR B;  1JVM A;  2YS8 A;  1FS0 G;  5LYJ B;  4KFM A;  2ZD9 A;  1U97 A;  2QKC A;  3L71 H;  5IYZ B;  3CB2 A;  1U96 A;  1SQQ H;  2PF4 E;  3K06 A;  2CTR A;  1V54 C;  5KHJ A;  1XL4 A;  3JD1 A;  4X1Y A;  3S3X A;  3T1Y B;  3OW2 U;  3CD6 V;  3ZN1 A;  4ZIB A;  4I50 B;  2UXX A;  3T4D A;  4CH4 A;  3D3Q A;  1AVM A;  2NR5 A;  1PL4 A;  2UUC B;  3DTU B;  3VQW A;  5C8Y B;  1KMI Z;  4JPR A;  4AQY O;  1XIL A;  5B1N A;  5IT9 N;  2H3O A;  1XHX A;  4DV4 O;  1I0H A;  3P3N A;  1SES A;  2LGW A;  4PDM A;  4X1K A;  4WBN A;  3BY6 A;  3DC6 A;  4BW5 A;  3GWK C;  3SYP A;  4J7Z A;  1KUQ A;  4R8C A;  1NS1 A;  4CH5 A;  1DF5 A;  1AB3 A;  3BRC A;  1RM1 B;  4UV8 A;  1NR1 A;  1YF2 A;  3G71 V;  1X59 A;  1R6N A;  3N27 A;  3DGE A;  3WB1 A;  1D2D A;  1XHZ A;  1YJW V;  5JJE B;  2WA3 A;  4X1I A;  4GYC B;  1XUQ A;  4DV1 B;  4FVM A;  3WG7 C;  4NXN B;  4UCT A;  1HNZ B;  1WB8 A;  1V9P A;  1EN5 A;  1ENV A;  3E8F A;  5KHH A;  1FXK A;  3JAT B;  4H33 A;  3TET A;  1IBL O;  3ETD A;  1UPG A;  3E89 A;  5JWP A;  2ZXW C;  5FPO A;  4HNA B;  4O4J B;  4B3T B;  1MMM A;  2Q0A A;  3ZHT A;  2EIK B;  2QTO A;  1JCH A;  3U0Z A;  1SQP H;  3BA8 A;  2LP7 A;  2JS3 A;  3LUT B;  3LSS A;  1VQ5 V;  3JAW A;  2WLH A;  1HNX B;  3JAS A;  4HBN A;  1Q86 W;  1DF4 A;  4LH6 A;  4LWS B;  4X66 O;  1PL0 A;  4F4L A;  5KUM A;  4KL1 A;  4GKJ O;  5LMN O;  2P4V A;  1AJP A;  1N32 B;  2OT5 A;  5LGN A;  5IWA B;  4LFA O;  3B77 A;  1OCC C;  3OFN G;  5HFL A;  4YJ3 A;  2EIN C;  2CAZ C;  4JF3 A;  3UQ8 A;  4JI7 B;  1NJI W;  1FFX B;  4MTG A;  3CJH A;  1BZK A;  1LNQ A;  4MT8 A;  1HR0 O;  5H6R A;  1EM1 A;  4IYI A;  5EBM C;  3OR7 C;  3SDL A;  1XOU A;  3SPG A;  4I9W A;  3PJS K;  4MW3 A;  1K97 A;  4FLX A;  1KC8 W;  4QNH B;  4UCO A;  3K08 A;  4JTD B;  2HP8 A;  1YTF B;  4O2B B;  4DV6 O;  1OJH A;  1M9N A;  4TV8 A;  1UFI A;  2FML A;  2CTQ A;  5CA1 B;  3Q4H A;  3L9D A;  4JI6 B;  2CH7 B;  1FXH A;  1Z5W A;  4JAV A;  1G8M A;  4YY3 B;  4DV2 O;  3R66 A;  1XL6 A;  3A8T A;  4X89 A;  2F66 C;  5BR8 B;  3GVM A;  1XRE A;  4OPH A;  4A5U B;  2XTA A;  1VQ9 V;  3HKC A;  4ZHQ A;  1H2S B;  4P2Z A;  3D8C A;  2ZIM A;  5B3S B;  1BMF G;  1KQS U;  4IHJ A;  2X6B A;  2O57 A;  5FPR A;  2F1M A;  5EBW C;  2IJJ A;  4LR3 A;  1TUB B;  4F6R A;  3CRQ A;  4LFB O;  1JX9 A;  2EX3 A;  4Q20 A;  1CXZ B;  1BSM A;  2E5L B;  1RPO A;  4QE7 A;  4JZG A;  3RYH A;  3CC4 V;  4FFB A;  1AP5 A;  3BPZ A;  4Z1V A;  3H1H H;  1WPX A;  4JI1 O;  2HKO A;  1I7F A;  3I5D A;  4JAU A;  3ZHS A;  1SET A;  4DW0 A;  1MAB G;  3T1C A;  1ZL8 B;  4DW1 A;  2QEX V;  1I94 O;  2WLJ A;  2DWE C;  5H2F Z;  2F4V B;  2YSU B;  2QM7 A;  3A0R A;  3AG3 C;  1Y4M A;  2OCC B;  2JGD B;  2RJZ A;  2LQT A;  5TIS Z;  3BHP A;  3OAA G;  3T2M A;  5D5Q A;  4FJC C;  4J41 A;  3N2K A;  4DV5 O;  3AG2 B;  1IBK B;  2N05 A;  2Q67 A;  4DR5 B;  5EBL C;  4MVS A;  2HHH O;  1YEW A;  4J7J A;  2DYR C;  2GHY A;  4R50 A;  3EXA A;  2JGU A;  2ZNI A;  2QKS A;  2GUZ A;  4MVR A;  4TQD A;  3BA9 A;  5LXT B;  3BAA A;  3OUS A;  4MVM A;  5EC1 C;  3ASO B;  1Y74 A;  5LGU A;  3S3W A;  3M8A A;  1NT2 B;  4UVB A;  1FXV A;  4TV9 B;  4DUZ O;  3SPH A;  2JS5 A;  2ZIN A;  2JJ1 G;  1GM8 A;  3ZRW B;  5CB4 B;  2ZE6 A;  5LP6 B;  4LF4 O;  5EYP A;  4DR2 B;  1SER A;  3HKD A;  3AK2 A;  2KB1 A;  4RWU A;  1YCI A;  1O9G A;  1CEZ A;  2XAH A;  3WB2 A;  4K8Z A;  4GX5 A;  1SQB H;  4X20 A;  3VQX A;  4JV5 O;  1EBO A;  3RYI B;  5CA0 B;  1VF5 B;  2YUA A;  4N21 A;  1W59 A;  3RYF B;  2HJF C;  5IE9 A;  1G6U A;  3N2G A;  3TGU H;  2KG7 A;  3QTC A;  2XUM A;  5KLV H;  4I4T B;  2BSK A;  4R7C A;  4PJ0 Z;  1GN2 A;  1GMG A;  3LDE A;  4DR1 O;  4LF5 B;  2OCH A;  3KKY A;  4RO2 A;  2E75 B;  4JGS A;  2QA4 V;  4HZ3 A;  2Q7H A;  1Z2G A;  1F4N A;  3OTO O;  2NN4 A;  5BY1 A;  4O2A B;  1YTF D;  1Q3E A;  5L3D A;  4W4L A;  4I9Q A;  1GN4 A;  2P90 A;  3L74 H;  4MTX A;  1TVK B;  4YHH O;  1Y76 A;  3OGI B;  3SYA A;  2UXD B;  4AHC A;  1JQ0 A;  2AZ0 A;  4XBF A;  1NKD A;  1BGY H;  3K5M A;  1QR9 A;  2QGN A;  4LF8 B;  4I55 B;  2BOC C;  4NXM B;  2UUB O;  1G4Y B;  4LC1 A;  4DR4 O;  4P30 A;  3ZRV A;  2AHZ A;  1PM9 A;  3OMA B;  2Q8V A;  5ITZ B;  3SYC A;  3T1H B;  2Q5Z A;  4ZI7 B;  4LNU A;  4J11 A;  2EIL B;  2F23 A;  5LA6 B;  4ICG A;  3B40 A;  3O9O A;  2Q6A A;  2Q7E A;  4DV7 B;  5LHH A;  1R73 A;  2Q69 A;  1M93 A;  3ZX6 A;  1AR4 A;  4WCE V;  3MAQ A;  2CDY A;  4JYY A;  1M90 W;  4DR7 B;  4PEL A;  5LOV B;  3U11 A;  1FAF A;  3E22 B;  3ABL B;  5JVD A;  2BTQ A;  4BR6 A;  2RDC A;  1J5E O;  1EZJ A;  4P9O A;  2ZM6 B;  2RCV A;  5L3G A;  4AI8 A;  2XAJ A;  4EEQ A;  2F93 B;  4D6T H;  1VQ6 V;  1BE3 H;  5KHG A;  5CMU A;  3FFQ A;  2C2A A;  2HVK C;  2ADP A;  5LMU B;  1GTO A;  2XAF A;  1PP9 H;  1S5J A;  2BOB C;  3RW0 A;  3K0D A;  4JI2 B;  4JI0 O;  1XMO B;  2XAS A;  3C3T A;  3H01 A;  3ZN0 A;  3OR6 C;  4FZ0 A;  4JI5 B;  4X64 O;  3E2E A;  2IU0 A;  1SA0 A;  3F7Y C;  5KAF Z;  2YIA A;  3KCY A;  2IJK A;  3ZMS A;  4YJ2 B;  2IU3 A;  2P6J A;  1EZV H;  1SKV A;  3W7S A;  3CCS V;  5LYJ A;  4GX0 A;  4LFC B;  3L70 H;  5IYZ A;  4JAA A;  3AK3 A;  1NU1 H;  3OGC C;  2QSA A;  5IY5 B;  3CP1 A;  4MS2 A;  2QTS A;  1P7B A;  3B2E E;  3GB7 C;  3LSU A;  1YIT V;  5JH7 B;  1OCZ C;  2YXL A;  4DV3 O;  1IXB A;  4X8A A;  2HG5 C;  2EIJ B;  3UO2 A;  5L3C A;  4WFB V;  1K8A W;  3G80 A;  1HNW B;  3KZI Z;  1IBM B;  2DYS C;  1Q6H A;  3OT7 A;  3CRC A;  1IX9 A;  1XNR B;  5IJ0 B;  3SJQ C;  2Y69 B;  4H44 B;  1KP3 A;  1R3K C;  3D36 A;  4DRX B;  4U7O A;  1AR1 B;  3SYQ A;  2BCC H;  1H2G A;  3ZMV A;  4WF9 V;  4UUJ C;  2DMX A;  5BZB A;  4IIJ B;  4JYA O;  1OCR B;  5IDJ A;  2H94 A;  3CCQ V;  3K9A A;  2Y4T A;  3E83 A;  4K0K O;  2E3C A;  5DEC A;  4FLU A;  4WFE A;  2CTW A;  4I0X B;  4DUY B;  4GX1 A;  1M4U A;  4JYB A;  4B3S O;  2B1I A;  2DN9 A;  5H6Q A;  5B1A B;  4O4H B;  3ZMT A;  2DOS A;  1H2N A;  5LHG A;  1EFR G;  1QCE A;  1NZ6 A;  3HKE B;  1XMQ B;  4WFF A;  1L1F A;  1X4T A;  4U3J A;  3SYO A;  1HWY A;  1JFF A;  1ZX3 A;  3OEH G;  3ZRS A;  5AG2 A;  4OPA A;  3K9S A;  4K8X A;  3AEI A;  4HNA A;  3RFR A;  3ABM C;  4DK1 A;  1AR5 A;  2WLL B;  3ZMU A;  5DM6 V;  4EFE A;  2ITC C;  3CYO A;  2AW9 A;  5GON A;  2UUC O;  5K1X A;  4GUN A;  2VQF B;  1FFT B;  3CCV V;  1JR9 A;  1GAX A;  4XDL A;  3ZCC A;  2Q0O C;  4MVZ A;  3P32 A;  2CGN A;  2FKX A;  3JAK B;  4NYK A;  3HKB A;  4LWS A;  5EZY B;  1RSO B;  2EUL A;  2L6L A;  4PA3 A;  1FKA O;  1N34 B;  3SPC A;  3F5W C;  3WFV A;  1KKD A;  1PV0 A;  3TCU A;  4DV4 B;  2EIM C;  3K03 A;  5A9G A;  1FFX A;  2P4K A;  4NTX A;  5FNV A;  4B7E A;  2Q9L A;  1PKX A;  1M56 B;  3F7V C;  3CCJ V;  2YEV A;  3FB8 C;  4PA7 A;  1Y67 A;  3FX7 A;  4D7T A;  4ZOL B;  2VQE B;  3QNE A;  1BHA A;  2P7T C;  1M5I A;  5JQG A;  5KHK A;  4DV1 O;  2XT9 A;  4I7Z B;  2FB5 A;  2YXH A;  1IVS A;  3I56 V;  1MG1 A;  4O2B A;  5J2T A;  1V55 C;  2AXT Z;  3CRR A;  4NXN O;  1HNZ O;  1ROP A;  3AG1 C;  4BIO A;  5CA1 A;  1BL8 A;  2UXN A;  3E35 A;  4UFZ A;  2CH7 A;  2QDO A;  2CK3 G;  4QGP A;  3X2Q C;  3ASN C;  4RQF A;  4B3T O;  2B9Z A;  2PY5 A;  3CSX A;  2WPD G;  4ASU G;  2LO1 A;  1VQM V;  2UXB O;  3QO7 A;  1XDC A;  3IC9 A;  3H1I H;  1E79 G;  4KXR A;  4F6E A;  1QNM A;  4DK0 A;  1VAR A;  2Z0A A;  4QPK A;  5LBQ A;  1HNX O;  1QLE B;  1K4C C;  4RUE A;  4QIW F;  1WJZ A;  1Q8I A;  1H8E G;  4EB6 A;  2ZDI C;  1F4M A;  4O4I B;  1VEW A;  1VQL V;  3ZS8 C;  3K04 A;  1YSC A;  2LFR A;  3JAL B;  1RP3 B;  3THO A;  1N32 O;  2Q68 A;  3EHB B;  5IWA O;  3QO8 A;  1FJG B;  4JI7 O;  3IGA C;  4X1K B;  4WBN B;  2XOK G;  4GKK B;  4X66 B;  2AHY A;  2QWP B;  4TUY B;  1IDS A;  2UXC B;  4GKJ B;  5IJ9 B;  1N33 O;  2UU9 O;  4QJF B;  1ZL8 A;  3AK1 A;  3NR7 A;  2W0X A;  1SQG A;  1R3L C;  2NNU A;  2GBO A;  4FLZ A;  1HDJ A;  4IGG A;  4FMT A;  4LF9 B;  2JGD A;  5B66 Z;  3CCE V;  1WA8 A;  5GTH Z;  2OYQ A;  4JI6 O;  3BCC H;  5KA6 A;  4JI3 O;  2PI4 A;  4YY3 O;  1Q5O A;  2V1D A;  3D36 C;  4GLX A;  2XND G;  5FL7 G;  2F95 B;  4B3M B;  4DV6 B;  1RM1 C;  1SC5 B;  1GN3 A;  3JAR B;  1FXK B;  2JJ2 G;  5BR8 O;  1SS3 A;  4XDK A;  3B8M A;  1D5A A;  4DV0 B;  2KQX A;  1EN4 A;  1K73 W;  2GTS A;  5E79 Z;  2ATK C;  2ZIO A;  5JJJ B;  2A3Q A;  2GDS A;  2Z5U A;  3AG4 B;  4NTY A;  3ZRW A;  1CP9 A;  3ICX A;  2HLD G;  3NXS A;  1WAZ A;  3JAW B;  1VQO V;  3OE7 G;  3JAS B;  3W7U A;  1SQV H;  3M99 B;  2E5L O;  1S3J A;  2EZO A;  3FYE B;  4YXW G;  3SPJ A;  2ZNJ A;  3RYI A;  2X6C A;  1PNL A;  1S0V A;  2PGG A;  3F5T A;  3RYF A;  1W0J G;  1BHB A;  2FL4 A;  4LF7 O;  4HAM A;  3E8B A;  2X7R B;  2EIK C;  4YJ3 B;  5L3E A;  4FIP C;  5CBG A;  2YIB D;  1NR7 A;  4OGQ B;  1VF7 A;  3CJH B;  1S72 V;  4I4T A;  2F4V O;  2R9A A;  2ITD C;  3G67 A;  4NVP A;  4B3R O;  3FB5 C;  5KX5 A;  4ZKI A;  2IH3 C;  4J9Z B;  1PPJ H;  1IBK O;  1I5X A;  3K57 A;  4DR5 O;  1I94 B;  2JRI A;  4MVQ A;  3BVO A;  3OTF A;  4PA4 A;  1XNQ B;  4CH3 A;  5CA3 A;  1TVK A;  3JD3 A;  1M57 B;  2FYU H;  1R3I C;  1Q7Y W;  1M1K W;  2Q7G A;  3DXR A;  1VQN V;  4JI4 B;  5KMG B;  3ZHV A;  3ZMZ A;  1NI8 A;  4I55 A;  3WB0 A;  2WLN A;  2CE4 A;  2HHH B;  1FYJ A;  3E86 A;  3ETG A;  4X62 B;  2BTO A;  1S5L Z;  1VF6 A;  3RYC A;  2A79 B;  2R72 A;  3BAB A;  1BQ0 A;  1YJ9 V;  4ZI7 A;  5J9P C;  1US6 A;  3HKC B;  2E74 B;  4ZHQ B;  2QWR B;  1N4C A;  5LA6 A;  5CBF A;  1GRJ A;  2X6A A;  4TWK A;  4DUZ B;  1OCO B;  3FKS G;  2P06 A;  5JCO A;  4JTA B;  5A2Q N;  3CRA A;  4DR3 B;  3MHS C;  4LF4 B; 
#chains in the Genus database with same CATH homology
 1ARO P;  2F43 G;  3W7S A;  1COW G;  1DTO A;  3CCS V;  3CCR V;  1SES A;  4GX0 A;  2OTL V;  3OM3 B;  1JOY A;  4PDM A;  3ML0 A;  2IH1 C;  3IC7 A;  3BY6 A;  3STL C;  4BW5 A;  2JEU A;  3SYP A;  3OGC C;  4R8C A;  3FB7 C;  4KP4 A;  1WLE A;  4FPP A;  5IY5 B;  1DF5 A;  1NBM G;  5B1B B;  1RM1 B;  3CP1 A;  4MS2 A;  1P7B A;  2JIZ G;  3GB7 C;  1M56 C;  2JK5 C;  4UV8 A;  2DQ0 A;  2DQ3 A;  1AJN A;  2WLM A;  4MTO A;  5C93 A;  2QM8 A;  1NR1 A;  1YIT V;  4TSF G;  3G71 V;  1R6N A;  1OCZ C;  1OZ0 A;  5B3S C;  4UV9 A;  3IFX A;  4X8A A;  2HG5 C;  2EIJ B;  3DGE A;  5GW7 A;  1K33 A;  1YJW V;  3UKM A;  3JYC A;  5L3C A;  4WFB V;  1K8A W;  5KUK A;  1YHQ V;  4PA6 A;  4GCZ A;  4FK5 C;  4UXN A;  4MVU A;  2DYS C;  2Z3Y A;  1GK9 A;  2XAQ A;  5HFM A;  3ZIA G;  3E8G A;  3SJQ C;  3WG7 C;  2Y69 B;  1QLN A;  1KP3 A;  3G4S V;  3E8F A;  1ENV A;  1FXK A;  3OMN B;  1R3K C;  4H33 A;  3TET A;  1ORQ C;  3D36 A;  4U7O A;  3ETD A;  4WFH A;  3E89 A;  2ZXW C;  1AR1 B;  3SYQ A;  3ZMV A;  1H2G A;  4MW8 A;  4QPJ A;  4WF9 V;  4UUJ C;  4DO2 A;  3CC2 V;  5BZB A;  3STZ C;  2GSM B;  4L87 A;  1OCR B;  1VQK V;  5IDJ A;  2H94 A;  3CCQ V;  3K9A A;  2EIK B;  2QTO A;  2HFE C;  1F51 A;  3E83 A;  1K9M W;  1QLE C;  1JCH A;  2OCC C;  3KG2 A;  1E1Q G;  3JD4 A;  4WFE A;  2LP7 A;  1UJW B;  1AI4 A;  1TUE B;  3LUT B;  1AI6 A;  3LSS A;  4GX1 A;  1VQ5 V;  4JYB A;  2B1I A;  5H6Q A;  1ZWI C;  3CME V;  1VQ4 V;  2WLH A;  3AG2 C;  5B1A B;  5CN0 A;  5B1O A;  5E1A C;  3ZMT A;  2NLJ C;  1Q86 W;  5L3B A;  1DF4 A;  5LHG A;  1EFR G;  1QCE A;  1PL0 A;  4WFF A;  1RPR A;  4F4L A;  1N8R W;  1L1F A;  5KUM A;  3CCM V;  4RUF A;  1AJP A;  3CCL V;  2OT5 A;  5LGN A;  3SYO A;  1JJ2 U;  4LP8 A;  3ASO C;  1HWY A;  3B77 A;  1OCC C;  3LDD A;  3OFN G;  3OEH G;  4JYC A;  5HFL A;  3LSQ A;  2EIN C;  3ZRS A;  4JF3 A;  1NJI W;  3AEI A;  4MTG A;  1NQT A;  5DN6 G;  4J9Y B;  5IYC O;  3K0G A;  3CCU V;  3ABM C;  1NH2 D;  1V54 B;  1LNQ A;  2WLL B;  1KEC A;  2A9H A;  4MT8 A;  3ZMU A;  3D3I A;  3EFF K;  5DM6 V;  5H6R A;  5EBM C;  3OR7 C;  1K7D A;  2ITC C;  4HYO A;  4WFG A;  3CYO A;  3G6E V;  2W6J G;  3SPG A;  4I9W A;  4XDJ A;  3JD0 A;  3PJS K;  4MW3 A;  4UVC A;  1QBZ A;  3ETE A;  1FFT B;  3CCV V;  1K97 A;  1KC8 W;  2M7W A;  4QNH B;  5L3F A;  1I5Y A;  4XDL A;  3K08 A;  5LHI A;  4JTD B;  3ZCC A;  1YTF B;  4MVZ A;  1M9N A;  1S5H C;  2D3O W;  3HPL C;  3JD2 A;  2ZDI A;  4R6Z A;  3P32 A;  4U7N A;  3ZMS A;  5KA5 A;  1OHH G;  2B5U A;  4G2K A;  1PD3 A;  4PA3 A;  4JAV A;  1FXH A;  1G8M A;  3K3W A;  1FXK C;  5LGT A;  3SPC A;  3F5W C;  2WSS G;  1R3J C;  3WFV A;  1KKD A;  3TCU A;  1SRY A;  4E2L A;  1YJN V;  1R6K A;  4MTF A;  2EIM C;  4PDR A;  2IJI A;  1XL6 A;  3K03 A;  4X89 A;  4Z1M G;  1PNM A;  1KD1 W;  4BAY A;  2QE7 G;  1J95 A;  3K79 A;  2WLL A;  2IJH A;  1AI7 A;  3AG4 C;  1E1R G;  4PA9 A;  1B6Q A;  1PKX A;  1M56 B;  1VQ9 V;  3F7V C;  3CCJ V;  3CPW U;  2YEV A;  3FB8 C;  4PA7 A;  2W0F C;  4G27 B;  4P2Z A;  1OCZ B;  5B3S B;  1BMF G;  1K5Q A;  2R9R B;  1KQS U;  2IW5 A;  3QNE A;  2X6B A;  1BHA A;  2P7T C;  4P9P A;  1K5S A;  1K34 A;  2HR3 A;  5EBW C;  2IJJ A;  2ZR3 A;  3I56 V;  1MG1 A;  1V55 C;  2MK3 A;  3T4Z A;  3FB6 C;  1JX9 A;  1ROP A;  4Q20 A;  1K4D C;  2DYS B;  1Q82 W;  3AG1 C;  2XAG A;  3CC7 V;  1GO3 F;  1BL8 A;  2UXN A;  1RPO A;  3E35 A;  4JAS A;  4QE7 A;  2X0L A;  2CK3 G;  3CC4 V;  3I55 V;  3WG7 B;  3X2Q C;  3ASN C;  1AJQ A;  4RQF A;  4LCU C;  1WPX A;  3QO5 A;  2HKO A;  3W7T A;  4X88 A;  4JAU A;  2WPD G;  1SET A;  4ASU G;  3OUF A;  4KUM A;  2ZXW B;  1MAB G;  3T1C A;  1VQM V;  3QO7 A;  2WAM A;  2EIL C;  3JCZ A;  1E79 G;  2A0L A;  2DWD C;  4ZBM A;  2QEX V;  2WLJ A;  3LDC A;  3RVZ A;  2DWE C;  3OMI B;  4QPK A;  1JPX A;  2YSU B;  5LBQ A;  2QM7 A;  5EC2 C;  1QLE B;  3A0R A;  3AG3 C;  1K4C C;  4RUE A;  1YIJ V;  1Y4M A;  2HVJ C;  4QIW F;  2OCC B;  2ZR2 A;  1W0K G;  3MD0 A;  1H8E G;  3OAA G;  5IYB O;  3T2M A;  3VBB A;  2R9I A;  2ZDI C;  1F4M A;  1VQP V;  3ABL C;  1VQL V;  4FJC C;  2W6I G;  3K04 A;  1YSC A;  3AG2 B;  3UM7 A;  2LFR A;  2JEX A;  2Q67 A;  1M57 C;  3GWO A;  5EBL C;  2Q68 A;  3EHB B;  4MVS A;  3BEH A;  3QO8 A;  2DYR C;  2GHY A;  1GKF A;  2EBO A;  4R50 A;  1S77 D;  3IGA C;  3ZRX A;  1IXM A;  2FTK A;  4I5S A;  3TK1 A;  2XOK G;  2QKS A;  4MVR A;  1GM9 A;  2AHY A;  3OUS A;  4MVM A;  5EC1 C;  3ASO B;  3ABT A;  1OCC B;  4TT3 G;  5LGU A;  2EIN B;  4RAI A;  4UVB A;  4QJF B;  1FXV A;  3OEE G;  3ABM B;  3SPH A;  2JJ1 G;  1GM8 A;  1Q81 W;  4PDL A;  1KP2 A;  2EJR A;  3ZJZ A;  1MOF A;  1R3L C;  2NNU A;  3ZRW B;  2V7Q G;  1MSW D;  1OCO C;  1PNK A;  2WLI B;  1SER A;  4FMT A;  4JTC B;  3CCE V;  4G28 B;  2KB1 A;  4CZZ A;  3ABK B;  2LFS A;  5KA6 A;  2OTJ V;  3ABU A;  2XAH A;  1CEZ A;  2PI4 A;  4GX5 A;  2EZP A;  1THZ A;  2V1D A;  5H9C A;  2XND G;  5FL7 G;  1EBO A;  5IY5 C;  5B1B C;  1RM1 C;  4N21 A;  1YI2 V;  2HJF C;  3RBZ A;  1AI5 A;  1FXK B;  2JJ2 G;  3E8H A;  4MSW C;  4XDK A;  1W2B U;  2DW4 A;  3CXC U;  3B8M A;  1Y66 A;  2EIM B;  2P67 A;  2ZQM A;  2EIJ C;  4R7C A;  4GX2 A;  4BIZ A;  1H38 A;  1GMG A;  3LDE A;  1K73 W;  2ATK C;  3W7X A;  1VQ7 V;  2WWW A;  4PDV A;  4RO2 A;  4JGS A;  3W7W A;  2Z5U A;  3AG4 B;  2QA4 V;  1S76 D;  4HZ3 A;  2K1E A;  3ZRW A;  1F4N A;  2WLK A;  1CP9 A;  2PI5 A;  1GM7 A;  2WLI A;  1YTF D;  5L3D A;  2HLD G;  3NXS A;  1VQO V;  3OE7 G;  1P4R A;  3SPI A;  1K92 A;  2Y69 C;  3W7U A;  2P90 A;  3M99 B;  4MTX A;  4H37 A;  1S3J A;  4GT1 A;  4N23 A;  3SYA A;  4LBE C;  1V55 B;  2EZO A;  3FYE B;  4YXW G;  3SPJ A;  1VQ8 V;  2X6C A;  1PNL A;  1JQ0 A;  3AG1 B;  1S0V A;  4XBF A;  1NKD A;  1W0J G;  1BHB A;  1QR9 A;  1OCR C;  2BOC C;  3LNM B;  4EKW A;  4HAM A;  2Y48 A;  3E8B A;  1G4Y B;  2X7R B;  4LC1 A;  2EIK C;  4MVO A;  5L3E A;  3X2Q B;  1F23 A;  4FIP C;  1QR8 A;  3B8N A;  4DXW A;  3ASN B;  5CBG A;  1DLB A;  4P30 A;  4UVA A;  3ZRV A;  1CPY A;  1NR7 A;  4BIU A;  1NH2 B;  2AHZ A;  3OMA B;  1S72 V;  3SYC A;  2EIL B;  2ITD C;  2JDI G;  5B1A C;  3CMA V;  3VOU A;  1NVP B;  3FB5 C;  2Q6A A;  4ZKI A;  2IH3 C;  4J9Z B;  5CBH A;  5LHH A;  1R73 A;  1K3E A;  2Q69 A;  4CBC A;  4WCE V;  1I5X A;  1SZT A;  3AG3 B;  4WFA V;  1H8H G;  3MHH C;  3FYI B;  4RQE A;  4MVQ A;  1JVM A;  1FS0 G;  1M90 W;  4KFM A;  4PA4 A;  4PEL A;  2ZD9 A;  3ABL B;  5CA3 A;  1EZJ A;  3JD3 A;  4P9O A;  3R65 A;  1M57 B;  1R3I C;  1Q7Y W;  1M1K W;  3K06 A;  1VQN V;  2DYR B;  3RVY A;  5L3G A;  2XAJ A;  1V54 C;  3ZMZ A;  2B1G A;  1VQ6 V;  1XL4 A;  2WLN A;  3JD1 A;  5CMU A;  3P30 A;  3E86 A;  3ETG A;  2C2A A;  2HVK C;  1QVG U;  1GTO A;  2XAF A;  3HB3 B;  3OW2 U;  2BOB C;  3RW0 A;  3CD6 V;  3ZN1 A;  3K0D A;  2A79 B;  5EK0 A;  2UXX A;  3T4D A;  1QVF U;  2XAS A;  1YJ9 V;  5J9P C;  3H01 A;  3ZN0 A;  3OR6 C;  2YEV B;  4QE9 A;  5CBF A;  3DTU B;  1NVP D;  3E2E A;  2H8P C;  4JPR A;  2IU0 A;  2X6A A;  4TWK A;  3F7Y C;  5B1N A;  1OCO B;  3FKS G;  3ABK C;  4JTA B;  5IYD O;  2IJK A;  3MHS C;  4OXS A;  2IU3 A;  2P6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...