3TGUH

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3tguH00
3H1LH 3H1IH 3CXHF 4PD4F 1SQXH 3L70H 1SQBH 1KB9F 4D6TH 3CX5F 3L75H 1BCCH 5KLVH 1PPJH 2FYUH 1P84F 1SQQH 2BCCH 3L74H 3H1HH 3H1JH 1NTMH 1L0LH 3L73H 4U3FH 1NU1H 1PP9H 1BGYH 1KYOF 1NTKH 1BE3H 1SQVH 3CWBH 2A06H 3H1KH 3L71H 3TGUH 1SQPH 1NTZH 3L72H 1EZVH 2IBZH 3BCCH 1L0NH
chains in the Genus database with same CATH superfamily
3E8BA 4PDMA 2M6YA 2CGOA 1MSWD 2IU3A 3BVOA 1J95A 3JASA 1J5EB 1P4RA 1VF6C 2BSKA 3E8GA 1JOYA 4DR4O 1XNRO 3OMIB 1NR7A 2HVJC 2B1IA 5HFLA 4PA7A 3CRRA 4LFBB 5B5EZ 1D2DA 4LFAO 3WB1A 4FMTA 2LJ2A 4YIPA 1HNWB 2DQ0A 3J81N 2QE7G 1AJNA 5EZYA 2ZE6A 3I56V 1XHXA 3CHXA 1S5HC 4NVPA 3FYIB 3K5NA 4MS2A 3CRQA 3RVYA 2EIKC 1VQLV 4K3AA 1JFFA 1GKFA 4F6RB 1RSOA 5EC2C 1Y74A 1HR0B 4H13B 4PA3A 1V54B 2Q73A 3DGEA 5A9GA 5IWAO 4NXMB 1KC8W 4GZRB 1MA1A 5FLXN 4UCOA 2AHYA 1VQ4V 4WCEV 2CH7B 1YIJV 1ZLZA 3BA8A 1KU9A 2YIBA 2AZ0A 1H2LA 1N0NA 1S72V 5KX5A 2EILB 1GK9A 1GTOA 2YEVB 5LA6B 4JI0O 1VQKV 4RQEA 3CD6V 3HKCB 3O9OA 4FVMA 4YY3B 1P7BA 5FNVB 4W4LA 2UXCO 5KA6A 2GHYA 4RO2A 2JVDA 1GH6A 3G4SV 1SF9A 2FMLA 4O4HB 5H6QA 2BCCH 3K5LA 1V9PA 4DRXA 3X2QC 1YHQV 1WA8B 2RQ6A 2X6CA 1Z2GA 4DV2B 2BTQA 1Y66A 3K04A 1NH2D 2DMXA 1TGOA 2ZE5A 5IJ9B 1R6TA 1GM7A 2X7RB 4Z1MG 2CH7A 1IXBA 2RN9A 2YUAA 3ABKB 3Q4HB 1S5JA 2GSMB 5LA6A 2YEVA 3H1JH 4ABMA 1PD3A 2A9HA 5KA5A 3HKCA 1Q43A 2ZQMA 4R6ZA 5FNVA 3K08A 4FPPA 3I55V 1XNQO 1GRJA 4PA6A 5AG2A 1Y6XA 2Y0IA 1N33O 2YI9A 4O4HA 1P7GA 4GYCB 1QBZA 2QTSA 1WA8A 2Q9LA 2JGDB 4U3JA 1JQ0A 1NH2B 1WLEA 4BIOA 5B3SB 3G71V 2AXTZ 5JH7B 2Y48A 5EBMC 4IL6Z 3UO3A 2IH1C 1SA0B 1VF5B 1SQBH 1Q86W 4F6EA 3SYCA 2W0XA 3ZEDA 2GV9A 5IYBO 5DM6V 2UXBB 5LMUO 2OTLV 2ADPA 2WLIB 1SS3A 1GN2A 2EZOA 3QVNA 4I50A 3GB7C 5DN6G 3AG3B 3BHPA 4DR4B 4UCSA 2JEXA 3E2EA 1BCCH 2VQFO 1OCZB 2ZXWC 1Q6UA 3ZMZA 5IYZB 3SYOA 5BY1A 2KSDA 1W59A 5IYDO 2HR3A 2QGNA 1M56B 1R6KA 1R73A 2ODMA 3J80N 2JS3A 2UUCB 2XAHA 2H8PC 2YC0A 4JF3A 5CBHA 4NXNO 3TGUH 4QGPA 3ETGA 5E79Z 4GKJB 1YTFD 5TISZ 2KQXA 2DE0X 1FFXB 2P5OA 1FXVA 4LBEC 3CRAA 2ITCC 2Q7GA 3W7SA 1DF4A 4PELA 4X64O 2OCHA 2YICA 4X66O 4I4TB 5KUKA 1ZTEA 3IC7A 2WLIA 1MABG 4JI3O 4YHHO 2ZD9A 3QO7A 3ZBHA 2FKXA 3K5MA 4PDLA 1YF2A 3ZN0A 5IE9A 3M99B 1PPJH 3WG7C 1IBKO 4KFMA 3OR7C 2QWOB 1VQ8V 4X62O 5K1PA 3OTOB 1YI2V 3FB6C 5A2QN 4Q6GA 2GBOA 1Z5WA 2V7QG 1Q81W 2VRZA 1IURA 1ROPA 1YTFB 4DV7B 2EIKB 1D5NA 4G28B 2N04A 4TT3G 5JCOC 4IHJA 5LXTB 5KMGB 1VQ5V 1M57C 2P6JA 3JSLA 4YJ3A 1PNKA 2Y0PA 4JI8B 2DYSC 2E76B 1K9MW 4I4TA 1FAFA 4P9PA 3DXRB 2A0LA 3U11A 3WB0A 1YVWA 4X89A 1H2SB 1S0VA 1SETA 4G2KA 4MVUA 4X65O 5KAFZ 3OEEG 5FL7G 4XDLA 4AQYB 5EC1C 3APQA 2PTMA 4LC1A 4JPRA 3OEHG 5LL6Y 1KQSU 2QKSA 3U10A 1BHAA 1NI8A 4CC5A 1GM8A 4LCUC 3F5WC 1JCHA 1K5QA 3ZS8C 2HEPA 4X1YB 4JTAB 3AG7A 1QVGU 1K3EA 5JQGB 2UUAB 5KLVH 1YITV 2IU0A 2IH3C 2UUBO 3LUTB 2B1GA 4LH7A 1HNXB 1UPGA 1XNQB 5H6RA 1F23A 5JVDB 3CCQV 3JD2A 2EINC 4L8JA 2OCCC 3X2QB 1G6UA 4JI2B 4JI4O 5KUMA 3DXRA 4CH5A 4LP8A 3CEIA 3LSUA 2YS8A 5LHGA 3SYAA 4DV5B 1K4CC 4I0XB 4KHPO 3N27A 3TXQA 1NTMH 3T2MA 4JI5B 4J7KA 2XAQA 3SGIA 3ZHSA 1H2KA 1H2GA 1M1KW 2KKWA 4X1YA 1I5XA 4EKWA 4PA9A 3T1YO 3SYPA 4R50A 3K9SA 3RW0A 3HKEA 4LNUB 1XL6A 4D7SA 2X6AA 2ZDIC 1AR4A 1YJNV 2UU9O 5EK0A 1O9GA 4LWSA 4CH3A 3ZJZA 3A2FA 3K5OA 4B7KA 3KCYA 4BW5A 3JATB 3VQYA 1YSCA 1VIBA 4X1IB 2YI8A 1D5AA 1BGYH 2RNBA 5E1AC 1S3JA 5CN0A 1XMOB 4PHZA 2XOKG 3RYFB 3ZHVA 2Z3YA 4GX1A 4ASUG 3AG2B 3JD0A 4DW0A 3CPWU 1PL4A 2ITDC 3B4SA 2QM4A 2AHZA 3MHSC 4LF6B 4FM1A 4IYHA 4OPAA 3JAWB 1K4DC 2XAGA 2QWNB 4JTCB 1MZFA 1T5EA 1WN7A 4LF8B 1VQ6V 4TV8B 3BCCH 1N36B 4B3MB 1N0JA 5BXZA 5GONB 3HPLC 3TETA 4WBNB 1K92A 4DR2O 3K3WA 3ABLC 1AB3A 2B5UA 1CEZA 4DV1O 3TK1A 2CTWA 3OR6C 1NS1A 3AEIA 3DSQA 2RDCA 2Q6AA 4XDKA 1QHTA 3TCUA 1MMMA 3N2GB 3RYFA 3OUSA 3RFRA 1N34O 4DR3O 2ZM6B 2V4DA 2HP8A 2RMKB 2HJDA 3L70H 4G27B 1THZA 5C93A 3JASB 3B40A 4JI6O 1K7DA 1H38A 4DV3B 1TVKB 4FK5C 3FFQA 3JAWA 1TAEA 4KP4A 5BR8O 3WG7B 2VQEO 3OM3B 4O4LB 1PM9A 2G38A 4C7UA 3CXCU 4P2ZA 4UCUA 4TV8A 2DYRC 3VOUA 4FM2A 3CC7V 5GONA 1N32B 2DWDC 1P49A 4WBNA 4DV0O 5EZYB 1IBMB 3CCLV 3W7UA 3OT7A 4JAUA 4P9OA 4PA4A 2QJ1A 4NB5A 2ETNA 2F95B 1M57B 4PI0A 2X0LA 2YIDA 2JJ1G 5EIBC 1RSOB 1Y74B 2DYSB 4YIOA 1KMIZ 1IZ3A 2IM9A 2H94A 1RPOA 2WA4A 3RN4A 3L75H 3K0GA 2WLHA 4B3TO 4HBNA 4DYLA 2EIJC 1TVKA 4O2AB 2LO1A 3B8MA 4DV6O 1Y67A 4FFBA 1X59A 1SERA 3CMAV 1KD1W 4O4LA 2K9PA 4JI1B 4MVQA 4QPJA 1HW7A 3F5TA 3TXSA 4O2BB 5KX5B 3MAQA 3T1HB 4MTGA 1EZJA 1WPXA 1OCCC 1KP2A 4NTXA 3C3SA 3D8CA 4H33A 2AW9A 1GN6A 5B66Z 1BSMA 4LH6A 3FX7A 3CCRV 3K9AA 4DO2A 1I08A 2WLKA 3K03A 3JCUZ 5JCOA 2EIMC 3JD4A 4DW1A 4GT1A 2IJIA 2EINB 1EN6A 2OCCB 2P4VA 3AG1C 2JK5C 4MVRA 1FS0G 4O4IA 4LFCB 3M8AA 4LF5B 4UFZA 4DRXB 3MHHC 4CH6A 1EN4A 3ZMTA 3CS5A 1COWG 1PP9H 1I0HA 4O2AA 2BTQB 2PI4A 1Q8IA 4JYCA 2BTOA 5IJ0B 4NTWA 1S76D 4A5UB 2HJFC 1R3KC 3OGIB 1SESA 5IDJA 1V55C 4O2BA 4EFEA 1XL4A 1SZTA 2YDEA 1IVSA 1FJGB 2ZE8A 1US6A 4Z1VA 4K8XA 4B3RB 4U3FH 2Y4TA 1UFIA 4OX9O 3APOA 1Q6IA 4CBCA 2FL4A 5KHHA 3SPGA 1R1BA 3VQVA 3N2KA 5D5PA 1EZVH 3A0RA 1SQXH 4P30A 3CCMV 4DUYB 4WFBV 4Z2WA 4I9WA 1XOUA 3K59A 4U3JB 2RCVA 2PGGA 4MTXA 3AK3A 5IJ0A 1I5YA 3QO5A 4DR1O 4DV1B 3MDSA 3JSNA 4B3SO 4K0KO 3SJQC 1KBHA 3ICXA 3L73H 2ILMA 5LMNO 3OE7G 2DW4A 3C3TA 3ETDA 1XDCA 1N34B 4IGGA 3HKBA 3CP1A 4J7ZA 4JYAO 4I50B 4N23A 4JI6B 5L3BA 4LF7B 4ICGA 2HLDG 4JAAA 3FYEB 2ZDIA 1K73W 3CCUV 4PV1B 3FB7C 1VQPV 1BQZA 1TUEB 3GWOA 1ZSPA 1LNQA 1OCRC 4DV4O 3ABLB 4UVCA 4LF9O 2EZPA 5LBQA 3ZMVA 1AJQA 2IJJA 3GWKC 2WPDG 4FZ1A 4ZIBA 3G80A 2JRIA 4N21A 4JI7O 1IX9A 5EIBD 4IIJA 3OGCC 1Q5OA 1XHZA 2F23A 3CRMA 1Q6HA 2HHHO 3CSXA 2KB1A 4GX2A 4R8CA 2LGWA 2M7WA 2N05A 4AILC 3BA9A 1XMQO 4FLXA 3HKDB 1H2NA 2V1DA 1GO3F 1OCOC 1XUQA 1DGSA 1HNZO 1XNRB 4CS4A 2DYRB 4J10A 4MSWC 3JALB 3A0BZ 3K58A 3SYQA 3T4ZA 4BIUA 4LFAB 4UV8A 5KHGA 1DLBA 5LGNA 5ITZA 1AROP 3STLC 1RP3B 3CCJV 3JAKA 2ATKC 4UUJC 2PYLA 4TOIA 4IHJB 3IGAC 2PF4E 1JJOA 2Y69C 4YJ3B 2UXDO 1CP9A 1YXBA 4TUYA 2A7WA 1QU7A 1YDXA 2R70A 4MVMA 1JMKC 1QVFU 2EIJB 3ZCCA 1FFTB 2QWPB 2WLJA 4JV5O 5IWAB 5L3GA 3HKDA 1AP5A 3H1IH 1WB8A 3OAAG 1GAXA 5LP6C 1SQGA 2K1EA 5CBGA 4DR5O 2MW2B 3JALA 2IJKA 4DR7O 1S5LZ 5FPRA 2A06H 4E2LA 1R6NA 4UB8Z 1Q90D 4DR6O 3ASOC 4JI0B 2XHBA 2ZT9B 3IC9A 4QJFB 1SQQH 3SJCC 5L3EA 2JIZG 3CJHA 2UXCB 3KCXA 2R9IA 4J42A 3AG1B 4DXWA 1F7YA 5B1BC 4WFAV 1B06A 3K06A 5BMVB 4DUZO 5LOVA 4EB6B 4WFFA 2EX3A 1W2BU 4GKKO 4MW3A 4WFGA 1MG1A 1HWYA 4PD4F 3RYHA 1L1FA 2F4VO 2Q7EA 4BR6A 2N74A 3U0ZA 1OHHG 1V55B 3SJAC 3SPIA 1VF7A 1OZ0A 1G8MA 2QKCA 4TV9B 3WFVA 2AGAA 5CMUA 1TUBB 3L71H 1VQNV 2YXHA 2UXNA 1QCEA 5B1OA 2EULA 1P84F 3L74H 1SZXA 3H1HH 2Y4UA 3IAYA 4FJCC 3HKEB 4UXNA 1BT8A 2W6IG 1IBLO 2KG7B 1WNSA 1N33B 5L3DA 5BMVA 1AI7A 1XI1A 4LWSB 4EB6A 1K97A 2DQ3A 3E86A 1AILA 4ZI7A 3HR0A 2L6LA 4OPHA 4JASA 4CS3A 2CK3G 2WLMA 2ZNJA 3F7VC 1J5EO 1V54C 1EN5A 1M9NA 4TV9A 1TUBA 3EXAA 2HHHB 4FLUA 3FKSG 5LMUB 4LFBO 3DC5A 4JGSA 3W7WA 1Z5VA 3LDEA 4WFHA 5J2TB 3ZN1A 2Q4PA 4BW9A 3OW2U 2R72A 3E8HA 4I5SA 2WA3A 1HNWO 2LW7A 2EJRA 2ZNIA 1BS3A 1O9HA 1QNMA 1JR9A 3ZRXA 1HNZB 1K5SA 2KG7A 4FZ0A 1DK1A 1WB7A 1PNLA 2VQFB 3JD3A 3TJTA 3E8FA 4CH4A 3ZRWB 3OMNB 1HR0O 5CA0B 3E22B 1G1XB 1NR1A 4NXNB 5IY5C 5IT9N 4UV9A 1OJHA 3CCSV 3EHBB 4NXMO 4H0LB 2E75B 3B77A 3ZMSA 2Z0AA 1SQPH 2ADQB 1AVMA 1FYJA 3T4DA 4UVAA 2XAJA 4X64B 4X66B 2XAFA 5J2TA 1OCOB 4FLWA 1NVPD 3JARA 4NYKA 1BL8A 4JI3B 4YHHB 4JV5B 1H2MA 5BZBA 3KKYA 1FXKC 2QA4V 3QTCA 3SJBC 4ZOLB 3S3XA 2ZCEA 3B2EE 3K0DA 2ZXWB 3SPHA 1BZKA 1GMGA 4YY3O 2OWOA 3LSSA 2ZINA 1IBKB 3CCEV 1KKDA 1VQOV 2E74B 4NKGB 5FPOA 3BPZA 1XREA 2XTAA 4X62B 3ZRWA 1N4CA 4DR7B 1ZL8A 4KUMA 3F7YC 5J2UA 3ETEA 5CA0A 3ABUA 3E22A 5LGUA 2VS0A 1RFYA 2GTAA 2IW5A 1E79G 1JVMA 3CWBH 2Y69B 3OTFA 4DV2O 2HKOA 3ABTA 2XUMA 2QDOA 4UCRA 4HNAB 1R3LC 2JEUA 1H8HG 1NVPB 4I55A 3CYOA 2R9AA 3RT3C 4FFBB 4ZHQB 4LF4O 4GKKB 1W0KG 2Q8VA 1BE3H 1SC5B 4ZOLA 2DOSA 2R9RB 4X65B 3GVMA 3BY6A 3CXHF 4TWKA 3OFNG 1NZ6A 3R65A 3ASOB 2GDSA 1I7FA 1K8AW 4RWUA 2JJ2G 1GN4A 3I5DA 2F93B 4UB6Z 1FXHA 1WJZA 4UVBA 1XQ8A 5KHJA 2ZR2A 4JYYA 4AI8A 4QNHB 1OCZC 2LGQA 1NTZH 5JJEB 3G6BA 5B1BB 2UUBB 3FB8C 5CB4B 3ZX6A 1ZUQA 5GTIZ 1I94O 4HNAA 1K33A 4O4IB 3BABA 2XNDG 4FLZA 4X9QA 3RWRD 3P30A 1NQTA 2P22C 3O65A 4JI4B 1XBLA 3UT5B 4J7JA 2EJ7A 4ZHQA 5LP6A 1RPRA 1QLEC 3OUFA 1Q82W 3LNMB 2UXBO 4WF9V 2YXYA 2H3OA 3QG5A 1OV9A 4KHPB 1LUWA 4J9YB 1CPYA 2QM8A 1RM1C 1YJ9V 3RYIB 4MW8A 2C2AA 3ZHTA 5B1AC 4XBFA 3VQWA 3CMEV 1KECA 3ABMC 3LDCA 4YJ2B 4JZGA 1VQMV 3N2KB 3EVKA 4X20A 3L72H 3T1YB 2E5LO 1HDJA 5GW7A 2CE4A 5CB4A 2UUCO 3NR7A 3MD0A 1JPXA 4HAMA 4GKJO 3K57A 2MK3A 5JJJB 5IYCO 3THOA 2LQTA 5B1NA 1YCIA 1JJ2U 3ETQA 1VEWA 3E35A 2OYQA 2UU9B 2Q7HA 3UT5A 4JAVA 3FB5C 4X88A 1PL0A 4DK0A 2Z5UA 2Q0OC 1SQFA 2Q67A 3P32A 4W4KA 1EM1A 4FLVA 2QM7A 4L87A 1IDSA 3RYIA 5LYJB 3BAAA 4OXSA 3AK1A 5LGTA 2LW1A 1XILA 3G67A 4YJ2A 1UJWB 4EFBA 3ZHQA 2PUSA 3HKBB 2D2CB 3OTOO 1ORQC 5L3CA 2HFEC 5LHIA 3VQXA 3CX5F 3CC4V 3G6EV 3T1CA 4DV7O 4RAIA 4MVSA 3E89A 2ZR3A 2CGNA 1WAZA 4LR3A 3B8NA 4JI8O 5IY5B 4DR2B 4F6RA 3PN1A 2VWJA 3PJSK 3UCSC 3P3PA 4ZBMA 4PDVA 4IIJB 1FKAO 1R3IC 1M5IA 4GLXA 5LYJA 4U7NA 5KHKA 4JZ2A 2NLJC 4AQYO 1F51A 4DR3B 1NBMG 3RYCB 4PI2A 3W7XA 3DC6A 1FXKB 1GM9A 4BWAA 4TSFG 1BHBA 3B09A 4D6TH 4LF4B 5BR8B 2BE3A 3H9VA 2HG5C 2A3QA 2ZKOA 2VQEB 1KP3A 4PDRA 3H01A 3CC2V 2WAMA 2UUAO 2QTOA 4J11A 3LNNA 2JS5A 3ZIAG 1HNXO 5ITZB 2ARHA 4DV0B 5EYPB 1U96A 2VWKA 1BMFG 3JAKB 1WPBA 3DTUB 4JI2O 1X4TA 1GN3A 2QWQB 1AI4A 2JGUA 4I7ZB 1ZWIC 3D3IA 2QWRB 3D36C 4DV5O 2F1MA 2F66C 5H9CA 4TUYB 2P06A 3UO2A 4JI5O 5IJ9A 1I94B 4Q20A 4HZ3A 3RYCA 2F43G 4B3TB 1FXKA 3QO8A 3CCVV 4DV6B 1PV0A 3Q4HA 4MVOA 1WP8A 3C90A 2FTKA 3BFRA 4IYIA 4UCVA 5JJNB 1FPOA 1Y76B 1VP7A 3UM7A 3AG2C 1URFA 3WB2A 4JYBA 3ML0A 1B04A 3H1KH 4QIWF 2X6BA 4FLTA 5EYPA 3UQ8A 3KG2A 1LR1A 3KZIZ 1W0JG 1EBOA 1M4UA 2XASA 1L8DA 2CDYA 3CJHB 2L35A 2JGDA 2QSAA 5EBWC 2E5LB 3CB2A 4JTDB 4IT5A 3NXSA 4X8AA 3L9DA 3W7TA 2WLNA 1YJWV 5JH7A 5LOVB 2DN9A 2IBZH 3FAVB 4UCTA 1L0NH 1XMOO 1QLEB 1VQ7V 3RYHB 1SA0A 3OD4A 2BOCC 4KXRA 4PJ0Z 4GCZA 2HVKC 2YSUB 5L3FA 1Y76A 1RM1B 1LUVA 2LFRA 3QF7A 1ZX3A 3ZHRA 3A8TA 4LF6O 1OCCB 4GX0A 5B1AB 1WP7A 3ABMB 2UXXA 1M93A 1PKXA 2EIMB 4AHCA 4LF8O 4OX9B 1R3JC 2PI5A 1N36O 3CE2A 4B3MO 3BEHA 1CXZB 5IYZA 2PY5A 2RJZA 1F4NA 2QR4A 1FD9A 4QE7A 3SPJA 2BOBC 1QLNA 1VMGA 1E1QG 4CC6A 1DF5A 1ZAUA 3FAVA 1TA8A 4OGQB 3ZHUA 1FFXA 1IXMA 3AG4C 4ZI7B 2P67A 5J9PC 2ZM6O 3SR2C 3P3NA 3ASNC 4DR1B 4DV3O 5K1XA 1VF6A 5CA3A 5D5QA 5C8YB 4MT8A 4B3SB 1G4YB 4K0KB 3E83A 2EBOA 4CZZA 4FLYA 3LDDA 4J9ZB 2Q0AA 5LMNB 1BQ0A 2YXLA 3CRCA 1AI6A 2IJHA 2GTSA 1XEQA 1N32O 4JYAB 2CUGA 1IBMO 4I9QA 1EFRG 4NTYA 4QE9A 2OIGA 5GTHZ 1AJPA 5JWPA 4RQFA 3R66A 4KL1A 4DV4B 4LF9B 5LXTA 3D3QA 5KMGA 2GUZB 2O57A 5F2VO 5KAIZ 5H5NA 2LP7A 4BAYA 2OT5A 4GUNA 1E1RG 4JI7B 3JAMN 1U97A 2FB5A 5C8YA 4TQDA 4DK1A 2B9ZA 4EEQA 3S3WA 4JI1O 1QR9A 1AR1B 3JARB 1L0LH 4GX5A 4E4EA 1M90W 4QPKA 1XMQB 3T1HO 1K34A 1YZBA 1SQVH 3JYCA 1S77D 2WLLB 4H44B 2EILC 4RUEA 1AP6A 3RBZA 2Q68A 1OCRB 5DEDA 5JQGA 3H1LH 4X1KB 1PNMA 1F4MA 2CTRA 2CAZC 1ZL8B 4O4JB 2E3CA 5J2UB 5DECA 3M7MX 2GUZA 3ZMUA 4F4LA 5JVDA 4LFCO 1NTKH 2Q69A 4B08A 4LF5O 4R7CA 4J80A 1HP8A 1Y4MA 3RVZA 2NNUA 5H2FZ 2AZ2A 3IJ4A 3HB3B 2NR5A 2QEXV 4FM0A 4I0XA 2UXDB 4MVZA 2D3OW 3LSQA 4B7EA 1JA8A 1JX9A 2Q5ZA 4I55B 4J41A 4YXWG 2W0FC 4WFEA 3STZC 1KYOF 1FJGO 1MSDA 4U7OA 4B3RO 1N8RW 3ABKC 2WLLA 1YEWA 4NR1A 4DR5B 2ZE7A 2ZIOA 3EFFK 3RGBA 4X1KA 3QNEA 2PYJA 1NJIW 4O4JA 5CA1B 1AI5A 4DR6B 4LNUA 1NU1H 4D7TA 4DUYO 3K79A 2ZIMA 1Q7YW 2QKAA 1B3QA 2WSSG 1KKCA 4XDJA 3ZRSA 4FIPC 3D36A 4FFKA 1Q3EA 2LFSA 1SRYA 1QQCA 4HYOA 3JATA 1DTOA 2YIAA 3SDLA 2WWWA 3ZRVA 5B3SC 2DJVA 4X1IA 3UKMA 5KHIA 1AR5A 1SKVA 3IFXA 2XT9A 4DUZB 3VBBA 5LP6B 3AK2A 4MTOA 3WU2Z 2OIEA 1NT2B 2DWEC 2F4VB 3SPCA 1ENVA 5EBLC 5LHHA 1MZEA 4BIZA 2CTQA 3FD9A 4LF7O 2P90A 3BRCA 2BSKB 5CA1A 1NKDA 2PZSA 3JCZA 4RUFA 4H37A 4ZKIA 1VQ9V 3AG3C 4K8ZA 2P7TC 4CS2A 4X20B 1KUQA 1VARA 1A32A 4MTFA 2YIBD 1MOFA 2P4KA 1KB9F 1QR8A 3A0HZ 2A79B 2FYUH 3JD1A 2OTJV 2NN4A 1M56C 1IBLB 4K35A 3J7AU 4TQFA 2W6JG 3AG4B 1B6QA 5CBFA 2CTPA 1MNGA 1JFFB 3OMAB 5HFMA 3N2GA 2JDIG 3ASNB 1H8EG
chains in the Genus database with same CATH topology
3H1LH 3H1IH 3CXHF 4PD4F 1SQXH 3L70H 1SQBH 1KB9F 4D6TH 3CX5F 3L75H 1BCCH 5KLVH 1PPJH 2FYUH 1P84F 1SQQH 2BCCH 3L74H 3H1HH 3H1JH 1NTMH 1L0LH 3L73H 4U3FH 1NU1H 1PP9H 1BGYH 1KYOF 1NTKH 1BE3H 1SQVH 3CWBH 2A06H 3H1KH 3L71H 3TGUH 1SQPH 1NTZH 3L72H 1EZVH 2IBZH 3BCCH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L H;  3H1I H;  3CXH F;  4PD4 F;  1SQX H;  3L70 H;  1SQB H;  1KB9 F;  4D6T H;  3CX5 F;  3L75 H;  1BCC H;  5KLV H;  1PPJ H;  2FYU H;  1P84 F;  1SQQ H;  2BCC H;  3L74 H;  3H1H H;  3H1J H;  1NTM H;  1L0L H;  3L73 H;  4U3F H;  1NU1 H;  1PP9 H;  1BGY H;  1KYO F;  1NTK H;  1BE3 H;  1SQV H;  3CWB H;  2A06 H;  3H1K H;  3L71 H;  3TGU H;  1SQP H;  1NTZ H;  3L72 H;  1EZV H;  2IBZ H;  3BCC H;  1L0N H; 
#chains in the Genus database with same CATH topology
 3E8B A;  4PDM A;  2M6Y A;  2CGO A;  1MSW D;  2IU3 A;  3BVO A;  1J95 A;  3JAS A;  1J5E B;  1P4R A;  1VF6 C;  2BSK A;  3E8G A;  1JOY A;  4DR4 O;  1XNR O;  3OMI B;  1NR7 A;  2HVJ C;  2B1I A;  5HFL A;  4PA7 A;  3CRR A;  4LFB B;  5B5E Z;  1D2D A;  4LFA O;  3WB1 A;  4FMT A;  2LJ2 A;  4YIP A;  1HNW B;  2DQ0 A;  3J81 N;  2QE7 G;  1AJN A;  5EZY A;  2ZE6 A;  3I56 V;  1XHX A;  3CHX A;  1S5H C;  4NVP A;  3FYI B;  3K5N A;  4MS2 A;  3CRQ A;  3RVY A;  2EIK C;  1VQL V;  4K3A A;  1JFF A;  1GKF A;  4F6R B;  1RSO A;  5EC2 C;  1Y74 A;  1HR0 B;  4H13 B;  4PA3 A;  1V54 B;  2Q73 A;  3DGE A;  5A9G A;  5IWA O;  4NXM B;  1KC8 W;  4GZR B;  1MA1 A;  5FLX N;  4UCO A;  2AHY A;  1VQ4 V;  4WCE V;  2CH7 B;  1YIJ V;  1ZLZ A;  3BA8 A;  1KU9 A;  2YIB A;  2AZ0 A;  1H2L A;  1N0N A;  1S72 V;  5KX5 A;  2EIL B;  1GK9 A;  1GTO A;  2YEV B;  5LA6 B;  4JI0 O;  1VQK V;  4RQE A;  3CD6 V;  3HKC B;  3O9O A;  4FVM A;  4YY3 B;  1P7B A;  5FNV B;  4W4L A;  2UXC O;  5KA6 A;  2GHY A;  4RO2 A;  2JVD A;  1GH6 A;  3G4S V;  1SF9 A;  2FML A;  4O4H B;  5H6Q A;  2BCC H;  3K5L A;  1V9P A;  4DRX A;  3X2Q C;  1YHQ V;  1WA8 B;  2RQ6 A;  2X6C A;  1Z2G A;  4DV2 B;  2BTQ A;  1Y66 A;  3K04 A;  1NH2 D;  2DMX A;  1TGO A;  2ZE5 A;  5IJ9 B;  1R6T A;  1GM7 A;  2X7R B;  4Z1M G;  2CH7 A;  1IXB A;  2RN9 A;  2YUA A;  3ABK B;  3Q4H B;  1S5J A;  2GSM B;  5LA6 A;  2YEV A;  3H1J H;  4ABM A;  1PD3 A;  2A9H A;  5KA5 A;  3HKC A;  1Q43 A;  2ZQM A;  4R6Z A;  5FNV A;  3K08 A;  4FPP A;  3I55 V;  1XNQ O;  1GRJ A;  4PA6 A;  5AG2 A;  1Y6X A;  2Y0I A;  1N33 O;  2YI9 A;  4O4H A;  1P7G A;  4GYC B;  1QBZ A;  2QTS A;  1WA8 A;  2Q9L A;  2JGD B;  4U3J A;  1JQ0 A;  1NH2 B;  1WLE A;  4BIO A;  5B3S B;  3G71 V;  2AXT Z;  5JH7 B;  2Y48 A;  5EBM C;  4IL6 Z;  3UO3 A;  2IH1 C;  1SA0 B;  1VF5 B;  1SQB H;  1Q86 W;  4F6E A;  3SYC A;  2W0X A;  3ZED A;  2GV9 A;  5IYB O;  5DM6 V;  2UXB B;  5LMU O;  2OTL V;  2ADP A;  2WLI B;  1SS3 A;  1GN2 A;  2EZO A;  3QVN A;  4I50 A;  3GB7 C;  5DN6 G;  3AG3 B;  3BHP A;  4DR4 B;  4UCS A;  2JEX A;  3E2E A;  1BCC H;  2VQF O;  1OCZ B;  2ZXW C;  1Q6U A;  3ZMZ A;  5IYZ B;  3SYO A;  5BY1 A;  2KSD A;  1W59 A;  5IYD O;  2HR3 A;  2QGN A;  1M56 B;  1R6K A;  1R73 A;  2ODM A;  3J80 N;  2JS3 A;  2UUC B;  2XAH A;  2H8P C;  2YC0 A;  4JF3 A;  5CBH A;  4NXN O;  3TGU H;  4QGP A;  3ETG A;  5E79 Z;  4GKJ B;  1YTF D;  5TIS Z;  2KQX A;  2DE0 X;  1FFX B;  2P5O A;  1FXV A;  4LBE C;  3CRA A;  2ITC C;  2Q7G A;  3W7S A;  1DF4 A;  4PEL A;  4X64 O;  2OCH A;  2YIC A;  4X66 O;  4I4T B;  5KUK A;  1ZTE A;  3IC7 A;  2WLI A;  1MAB G;  4JI3 O;  4YHH O;  2ZD9 A;  3QO7 A;  3ZBH A;  2FKX A;  3K5M A;  4PDL A;  1YF2 A;  3ZN0 A;  5IE9 A;  3M99 B;  1PPJ H;  3WG7 C;  1IBK O;  4KFM A;  3OR7 C;  2QWO B;  1VQ8 V;  4X62 O;  5K1P A;  3OTO B;  1YI2 V;  3FB6 C;  5A2Q N;  4Q6G A;  2GBO A;  1Z5W A;  2V7Q G;  1Q81 W;  2VRZ A;  1IUR A;  1ROP A;  1YTF B;  4DV7 B;  2EIK B;  1D5N A;  4G28 B;  2N04 A;  4TT3 G;  5JCO C;  4IHJ A;  5LXT B;  5KMG B;  1VQ5 V;  1M57 C;  2P6J A;  3JSL A;  4YJ3 A;  1PNK A;  2Y0P A;  4JI8 B;  2DYS C;  2E76 B;  1K9M W;  4I4T A;  1FAF A;  4P9P A;  3DXR B;  2A0L A;  3U11 A;  3WB0 A;  1YVW A;  4X89 A;  1H2S B;  1S0V A;  1SET A;  4G2K A;  4MVU A;  4X65 O;  5KAF Z;  3OEE G;  5FL7 G;  4XDL A;  4AQY B;  5EC1 C;  3APQ A;  2PTM A;  4LC1 A;  4JPR A;  3OEH G;  5LL6 Y;  1KQS U;  2QKS A;  3U10 A;  1BHA A;  1NI8 A;  4CC5 A;  1GM8 A;  4LCU C;  3F5W C;  1JCH A;  1K5Q A;  3ZS8 C;  2HEP A;  4X1Y B;  4JTA B;  3AG7 A;  1QVG U;  1K3E A;  5JQG B;  2UUA B;  5KLV H;  1YIT V;  2IU0 A;  2IH3 C;  2UUB O;  3LUT B;  2B1G A;  4LH7 A;  1HNX B;  1UPG A;  1XNQ B;  5H6R A;  1F23 A;  5JVD B;  3CCQ V;  3JD2 A;  2EIN C;  4L8J A;  2OCC C;  3X2Q B;  1G6U A;  4JI2 B;  4JI4 O;  5KUM A;  3DXR A;  4CH5 A;  4LP8 A;  3CEI A;  3LSU A;  2YS8 A;  5LHG A;  3SYA A;  4DV5 B;  1K4C C;  4I0X B;  4KHP O;  3N27 A;  3TXQ A;  1NTM H;  3T2M A;  4JI5 B;  4J7K A;  2XAQ A;  3SGI A;  3ZHS A;  1H2K A;  1H2G A;  1M1K W;  2KKW A;  4X1Y A;  1I5X A;  4EKW A;  4PA9 A;  3T1Y O;  3SYP A;  4R50 A;  3K9S A;  3RW0 A;  3HKE A;  4LNU B;  1XL6 A;  4D7S A;  2X6A A;  2ZDI C;  1AR4 A;  1YJN V;  2UU9 O;  5EK0 A;  1O9G A;  4LWS A;  4CH3 A;  3ZJZ A;  3A2F A;  3K5O A;  4B7K A;  3KCY A;  4BW5 A;  3JAT B;  3VQY A;  1YSC A;  1VIB A;  4X1I B;  2YI8 A;  1D5A A;  1BGY H;  2RNB A;  5E1A C;  1S3J A;  5CN0 A;  1XMO B;  4PHZ A;  2XOK G;  3RYF B;  3ZHV A;  2Z3Y A;  4GX1 A;  4ASU G;  3AG2 B;  3JD0 A;  4DW0 A;  3CPW U;  1PL4 A;  2ITD C;  3B4S A;  2QM4 A;  2AHZ A;  3MHS C;  4LF6 B;  4FM1 A;  4IYH A;  4OPA A;  3JAW B;  1K4D C;  2XAG A;  2QWN B;  4JTC B;  1MZF A;  1T5E A;  1WN7 A;  4LF8 B;  1VQ6 V;  4TV8 B;  3BCC H;  1N36 B;  4B3M B;  1N0J A;  5BXZ A;  5GON B;  3HPL C;  3TET A;  4WBN B;  1K92 A;  4DR2 O;  3K3W A;  3ABL C;  1AB3 A;  2B5U A;  1CEZ A;  4DV1 O;  3TK1 A;  2CTW A;  3OR6 C;  1NS1 A;  3AEI A;  3DSQ A;  2RDC A;  2Q6A A;  4XDK A;  1QHT A;  3TCU A;  1MMM A;  3N2G B;  3RYF A;  3OUS A;  3RFR A;  1N34 O;  4DR3 O;  2ZM6 B;  2V4D A;  2HP8 A;  2RMK B;  2HJD A;  3L70 H;  4G27 B;  1THZ A;  5C93 A;  3JAS B;  3B40 A;  4JI6 O;  1K7D A;  1H38 A;  4DV3 B;  1TVK B;  4FK5 C;  3FFQ A;  3JAW A;  1TAE A;  4KP4 A;  5BR8 O;  3WG7 B;  2VQE O;  3OM3 B;  4O4L B;  1PM9 A;  2G38 A;  4C7U A;  3CXC U;  4P2Z A;  4UCU A;  4TV8 A;  2DYR C;  3VOU A;  4FM2 A;  3CC7 V;  5GON A;  1N32 B;  2DWD C;  1P49 A;  4WBN A;  4DV0 O;  5EZY B;  1IBM B;  3CCL V;  3W7U A;  3OT7 A;  4JAU A;  4P9O A;  4PA4 A;  2QJ1 A;  4NB5 A;  2ETN A;  2F95 B;  1M57 B;  4PI0 A;  2X0L A;  2YID A;  2JJ1 G;  5EIB C;  1RSO B;  1Y74 B;  2DYS B;  4YIO A;  1KMI Z;  1IZ3 A;  2IM9 A;  2H94 A;  1RPO A;  2WA4 A;  3RN4 A;  3L75 H;  3K0G A;  2WLH A;  4B3T O;  4HBN A;  4DYL A;  2EIJ C;  1TVK A;  4O2A B;  2LO1 A;  3B8M A;  4DV6 O;  1Y67 A;  4FFB A;  1X59 A;  1SER A;  3CMA V;  1KD1 W;  4O4L A;  2K9P A;  4JI1 B;  4MVQ A;  4QPJ A;  1HW7 A;  3F5T A;  3TXS A;  4O2B B;  5KX5 B;  3MAQ A;  3T1H B;  4MTG A;  1EZJ A;  1WPX A;  1OCC C;  1KP2 A;  4NTX A;  3C3S A;  3D8C A;  4H33 A;  2AW9 A;  1GN6 A;  5B66 Z;  1BSM A;  4LH6 A;  3FX7 A;  3CCR V;  3K9A A;  4DO2 A;  1I08 A;  2WLK A;  3K03 A;  3JCU Z;  5JCO A;  2EIM C;  3JD4 A;  4DW1 A;  4GT1 A;  2IJI A;  2EIN B;  1EN6 A;  2OCC B;  2P4V A;  3AG1 C;  2JK5 C;  4MVR A;  1FS0 G;  4O4I A;  4LFC B;  3M8A A;  4LF5 B;  4UFZ A;  4DRX B;  3MHH C;  4CH6 A;  1EN4 A;  3ZMT A;  3CS5 A;  1COW G;  1PP9 H;  1I0H A;  4O2A A;  2BTQ B;  2PI4 A;  1Q8I A;  4JYC A;  2BTO A;  5IJ0 B;  4NTW A;  1S76 D;  4A5U B;  2HJF C;  1R3K C;  3OGI B;  1SES A;  5IDJ A;  1V55 C;  4O2B A;  4EFE A;  1XL4 A;  1SZT A;  2YDE A;  1IVS A;  1FJG B;  2ZE8 A;  1US6 A;  4Z1V A;  4K8X A;  4B3R B;  4U3F H;  2Y4T A;  1UFI A;  4OX9 O;  3APO A;  1Q6I A;  4CBC A;  2FL4 A;  5KHH A;  3SPG A;  1R1B A;  3VQV A;  3N2K A;  5D5P A;  1EZV H;  3A0R A;  1SQX H;  4P30 A;  3CCM V;  4DUY B;  4WFB V;  4Z2W A;  4I9W A;  1XOU A;  3K59 A;  4U3J B;  2RCV A;  2PGG A;  4MTX A;  3AK3 A;  5IJ0 A;  1I5Y A;  3QO5 A;  4DR1 O;  4DV1 B;  3MDS A;  3JSN A;  4B3S O;  4K0K O;  3SJQ C;  1KBH A;  3ICX A;  3L73 H;  2ILM A;  5LMN O;  3OE7 G;  2DW4 A;  3C3T A;  3ETD A;  1XDC A;  1N34 B;  4IGG A;  3HKB A;  3CP1 A;  4J7Z A;  4JYA O;  4I50 B;  4N23 A;  4JI6 B;  5L3B A;  4LF7 B;  4ICG A;  2HLD G;  4JAA A;  3FYE B;  2ZDI A;  1K73 W;  3CCU V;  4PV1 B;  3FB7 C;  1VQP V;  1BQZ A;  1TUE B;  3GWO A;  1ZSP A;  1LNQ A;  1OCR C;  4DV4 O;  3ABL B;  4UVC A;  4LF9 O;  2EZP A;  5LBQ A;  3ZMV A;  1AJQ A;  2IJJ A;  3GWK C;  2WPD G;  4FZ1 A;  4ZIB A;  3G80 A;  2JRI A;  4N21 A;  4JI7 O;  1IX9 A;  5EIB D;  4IIJ A;  3OGC C;  1Q5O A;  1XHZ A;  2F23 A;  3CRM A;  1Q6H A;  2HHH O;  3CSX A;  2KB1 A;  4GX2 A;  4R8C A;  2LGW A;  2M7W A;  2N05 A;  4AIL C;  3BA9 A;  1XMQ O;  4FLX A;  3HKD B;  1H2N A;  2V1D A;  1GO3 F;  1OCO C;  1XUQ A;  1DGS A;  1HNZ O;  1XNR B;  4CS4 A;  2DYR B;  4J10 A;  4MSW C;  3JAL B;  3A0B Z;  3K58 A;  3SYQ A;  3T4Z A;  4BIU A;  4LFA B;  4UV8 A;  5KHG A;  1DLB A;  5LGN A;  5ITZ A;  1ARO P;  3STL C;  1RP3 B;  3CCJ V;  3JAK A;  2ATK C;  4UUJ C;  2PYL A;  4TOI A;  4IHJ B;  3IGA C;  2PF4 E;  1JJO A;  2Y69 C;  4YJ3 B;  2UXD O;  1CP9 A;  1YXB A;  4TUY A;  2A7W A;  1QU7 A;  1YDX A;  2R70 A;  4MVM A;  1JMK C;  1QVF U;  2EIJ B;  3ZCC A;  1FFT B;  2QWP B;  2WLJ A;  4JV5 O;  5IWA B;  5L3G A;  3HKD A;  1AP5 A;  3H1I H;  1WB8 A;  3OAA G;  1GAX A;  5LP6 C;  1SQG A;  2K1E A;  5CBG A;  4DR5 O;  2MW2 B;  3JAL A;  2IJK A;  4DR7 O;  1S5L Z;  5FPR A;  2A06 H;  4E2L A;  1R6N A;  4UB8 Z;  1Q90 D;  4DR6 O;  3ASO C;  4JI0 B;  2XHB A;  2ZT9 B;  3IC9 A;  4QJF B;  1SQQ H;  3SJC C;  5L3E A;  2JIZ G;  3CJH A;  2UXC B;  3KCX A;  2R9I A;  4J42 A;  3AG1 B;  4DXW A;  1F7Y A;  5B1B C;  4WFA V;  1B06 A;  3K06 A;  5BMV B;  4DUZ O;  5LOV A;  4EB6 B;  4WFF A;  2EX3 A;  1W2B U;  4GKK O;  4MW3 A;  4WFG A;  1MG1 A;  1HWY A;  4PD4 F;  3RYH A;  1L1F A;  2F4V O;  2Q7E A;  4BR6 A;  2N74 A;  3U0Z A;  1OHH G;  1V55 B;  3SJA C;  3SPI A;  1VF7 A;  1OZ0 A;  1G8M A;  2QKC A;  4TV9 B;  3WFV A;  2AGA A;  5CMU A;  1TUB B;  3L71 H;  1VQN V;  2YXH A;  2UXN A;  1QCE A;  5B1O A;  2EUL A;  1P84 F;  3L74 H;  1SZX A;  3H1H H;  2Y4U A;  3IAY A;  4FJC C;  3HKE B;  4UXN A;  1BT8 A;  2W6I G;  1IBL O;  2KG7 B;  1WNS A;  1N33 B;  5L3D A;  5BMV A;  1AI7 A;  1XI1 A;  4LWS B;  4EB6 A;  1K97 A;  2DQ3 A;  3E86 A;  1AIL A;  4ZI7 A;  3HR0 A;  2L6L A;  4OPH A;  4JAS A;  4CS3 A;  2CK3 G;  2WLM A;  2ZNJ A;  3F7V C;  1J5E O;  1V54 C;  1EN5 A;  1M9N A;  4TV9 A;  1TUB A;  3EXA A;  2HHH B;  4FLU A;  3FKS G;  5LMU B;  4LFB O;  3DC5 A;  4JGS A;  3W7W A;  1Z5V A;  3LDE A;  4WFH A;  5J2T B;  3ZN1 A;  2Q4P A;  4BW9 A;  3OW2 U;  2R72 A;  3E8H A;  4I5S A;  2WA3 A;  1HNW O;  2LW7 A;  2EJR A;  2ZNI A;  1BS3 A;  1O9H A;  1QNM A;  1JR9 A;  3ZRX A;  1HNZ B;  1K5S A;  2KG7 A;  4FZ0 A;  1DK1 A;  1WB7 A;  1PNL A;  2VQF B;  3JD3 A;  3TJT A;  3E8F A;  4CH4 A;  3ZRW B;  3OMN B;  1HR0 O;  5CA0 B;  3E22 B;  1G1X B;  1NR1 A;  4NXN B;  5IY5 C;  5IT9 N;  4UV9 A;  1OJH A;  3CCS V;  3EHB B;  4NXM O;  4H0L B;  2E75 B;  3B77 A;  3ZMS A;  2Z0A A;  1SQP H;  2ADQ B;  1AVM A;  1FYJ A;  3T4D A;  4UVA A;  2XAJ A;  4X64 B;  4X66 B;  2XAF A;  5J2T A;  1OCO B;  4FLW A;  1NVP D;  3JAR A;  4NYK A;  1BL8 A;  4JI3 B;  4YHH B;  4JV5 B;  1H2M A;  5BZB A;  3KKY A;  1FXK C;  2QA4 V;  3QTC A;  3SJB C;  4ZOL B;  3S3X A;  2ZCE A;  3B2E E;  3K0D A;  2ZXW B;  3SPH A;  1BZK A;  1GMG A;  4YY3 O;  2OWO A;  3LSS A;  2ZIN A;  1IBK B;  3CCE V;  1KKD A;  1VQO V;  2E74 B;  4NKG B;  5FPO A;  3BPZ A;  1XRE A;  2XTA A;  4X62 B;  3ZRW A;  1N4C A;  4DR7 B;  1ZL8 A;  4KUM A;  3F7Y C;  5J2U A;  3ETE A;  5CA0 A;  3ABU A;  3E22 A;  5LGU A;  2VS0 A;  1RFY A;  2GTA A;  2IW5 A;  1E79 G;  1JVM A;  3CWB H;  2Y69 B;  3OTF A;  4DV2 O;  2HKO A;  3ABT A;  2XUM A;  2QDO A;  4UCR A;  4HNA B;  1R3L C;  2JEU A;  1H8H G;  1NVP B;  4I55 A;  3CYO A;  2R9A A;  3RT3 C;  4FFB B;  4ZHQ B;  4LF4 O;  4GKK B;  1W0K G;  2Q8V A;  1BE3 H;  1SC5 B;  4ZOL A;  2DOS A;  2R9R B;  4X65 B;  3GVM A;  3BY6 A;  3CXH F;  4TWK A;  3OFN G;  1NZ6 A;  3R65 A;  3ASO B;  2GDS A;  1I7F A;  1K8A W;  4RWU A;  2JJ2 G;  1GN4 A;  3I5D A;  2F93 B;  4UB6 Z;  1FXH A;  1WJZ A;  4UVB A;  1XQ8 A;  5KHJ A;  2ZR2 A;  4JYY A;  4AI8 A;  4QNH B;  1OCZ C;  2LGQ A;  1NTZ H;  5JJE B;  3G6B A;  5B1B B;  2UUB B;  3FB8 C;  5CB4 B;  3ZX6 A;  1ZUQ A;  5GTI Z;  1I94 O;  4HNA A;  1K33 A;  4O4I B;  3BAB A;  2XND G;  4FLZ A;  4X9Q A;  3RWR D;  3P30 A;  1NQT A;  2P22 C;  3O65 A;  4JI4 B;  1XBL A;  3UT5 B;  4J7J A;  2EJ7 A;  4ZHQ A;  5LP6 A;  1RPR A;  1QLE C;  3OUF A;  1Q82 W;  3LNM B;  2UXB O;  4WF9 V;  2YXY A;  2H3O A;  3QG5 A;  1OV9 A;  4KHP B;  1LUW A;  4J9Y B;  1CPY A;  2QM8 A;  1RM1 C;  1YJ9 V;  3RYI B;  4MW8 A;  2C2A A;  3ZHT A;  5B1A C;  4XBF A;  3VQW A;  3CME V;  1KEC A;  3ABM C;  3LDC A;  4YJ2 B;  4JZG A;  1VQM V;  3N2K B;  3EVK A;  4X20 A;  3L72 H;  3T1Y B;  2E5L O;  1HDJ A;  5GW7 A;  2CE4 A;  5CB4 A;  2UUC O;  3NR7 A;  3MD0 A;  1JPX A;  4HAM A;  4GKJ O;  3K57 A;  2MK3 A;  5JJJ B;  5IYC O;  3THO A;  2LQT A;  5B1N A;  1YCI A;  1JJ2 U;  3ETQ A;  1VEW A;  3E35 A;  2OYQ A;  2UU9 B;  2Q7H A;  3UT5 A;  4JAV A;  3FB5 C;  4X88 A;  1PL0 A;  4DK0 A;  2Z5U A;  2Q0O C;  1SQF A;  2Q67 A;  3P32 A;  4W4K A;  1EM1 A;  4FLV A;  2QM7 A;  4L87 A;  1IDS A;  3RYI A;  5LYJ B;  3BAA A;  4OXS A;  3AK1 A;  5LGT A;  2LW1 A;  1XIL A;  3G67 A;  4YJ2 A;  1UJW B;  4EFB A;  3ZHQ A;  2PUS A;  3HKB B;  2D2C B;  3OTO O;  1ORQ C;  5L3C A;  2HFE C;  5LHI A;  3VQX A;  3CX5 F;  3CC4 V;  3G6E V;  3T1C A;  4DV7 O;  4RAI A;  4MVS A;  3E89 A;  2ZR3 A;  2CGN A;  1WAZ A;  4LR3 A;  3B8N A;  4JI8 O;  5IY5 B;  4DR2 B;  4F6R A;  3PN1 A;  2VWJ A;  3PJS K;  3UCS C;  3P3P A;  4ZBM A;  4PDV A;  4IIJ B;  1FKA O;  1R3I C;  1M5I A;  4GLX A;  5LYJ A;  4U7N A;  5KHK A;  4JZ2 A;  2NLJ C;  4AQY O;  1F51 A;  4DR3 B;  1NBM G;  3RYC B;  4PI2 A;  3W7X A;  3DC6 A;  1FXK B;  1GM9 A;  4BWA A;  4TSF G;  1BHB A;  3B09 A;  4D6T H;  4LF4 B;  5BR8 B;  2BE3 A;  3H9V A;  2HG5 C;  2A3Q A;  2ZKO A;  2VQE B;  1KP3 A;  4PDR A;  3H01 A;  3CC2 V;  2WAM A;  2UUA O;  2QTO A;  4J11 A;  3LNN A;  2JS5 A;  3ZIA G;  1HNX O;  5ITZ B;  2ARH A;  4DV0 B;  5EYP B;  1U96 A;  2VWK A;  1BMF G;  3JAK B;  1WPB A;  3DTU B;  4JI2 O;  1X4T A;  1GN3 A;  2QWQ B;  1AI4 A;  2JGU A;  4I7Z B;  1ZWI C;  3D3I A;  2QWR B;  3D36 C;  4DV5 O;  2F1M A;  2F66 C;  5H9C A;  4TUY B;  2P06 A;  3UO2 A;  4JI5 O;  5IJ9 A;  1I94 B;  4Q20 A;  4HZ3 A;  3RYC A;  2F43 G;  4B3T B;  1FXK A;  3QO8 A;  3CCV V;  4DV6 B;  1PV0 A;  3Q4H A;  4MVO A;  1WP8 A;  3C90 A;  2FTK A;  3BFR A;  4IYI A;  4UCV A;  5JJN B;  1FPO A;  1Y76 B;  1VP7 A;  3UM7 A;  3AG2 C;  1URF A;  3WB2 A;  4JYB A;  3ML0 A;  1B04 A;  3H1K H;  4QIW F;  2X6B A;  4FLT A;  5EYP A;  3UQ8 A;  3KG2 A;  1LR1 A;  3KZI Z;  1W0J G;  1EBO A;  1M4U A;  2XAS A;  1L8D A;  2CDY A;  3CJH B;  2L35 A;  2JGD A;  2QSA A;  5EBW C;  2E5L B;  3CB2 A;  4JTD B;  4IT5 A;  3NXS A;  4X8A A;  3L9D A;  3W7T A;  2WLN A;  1YJW V;  5JH7 A;  5LOV B;  2DN9 A;  2IBZ H;  3FAV B;  4UCT A;  1L0N H;  1XMO O;  1QLE B;  1VQ7 V;  3RYH B;  1SA0 A;  3OD4 A;  2BOC C;  4KXR A;  4PJ0 Z;  4GCZ A;  2HVK C;  2YSU B;  5L3F A;  1Y76 A;  1RM1 B;  1LUV A;  2LFR A;  3QF7 A;  1ZX3 A;  3ZHR A;  3A8T A;  4LF6 O;  1OCC B;  4GX0 A;  5B1A B;  1WP7 A;  3ABM B;  2UXX A;  1M93 A;  1PKX A;  2EIM B;  4AHC A;  4LF8 O;  4OX9 B;  1R3J C;  2PI5 A;  1N36 O;  3CE2 A;  4B3M O;  3BEH A;  1CXZ B;  5IYZ A;  2PY5 A;  2RJZ A;  1F4N A;  2QR4 A;  1FD9 A;  4QE7 A;  3SPJ A;  2BOB C;  1QLN A;  1VMG A;  1E1Q G;  4CC6 A;  1DF5 A;  1ZAU A;  3FAV A;  1TA8 A;  4OGQ B;  3ZHU A;  1FFX A;  1IXM A;  3AG4 C;  4ZI7 B;  2P67 A;  5J9P C;  2ZM6 O;  3SR2 C;  3P3N A;  3ASN C;  4DR1 B;  4DV3 O;  5K1X A;  1VF6 A;  5CA3 A;  5D5Q A;  5C8Y B;  4MT8 A;  4B3S B;  1G4Y B;  4K0K B;  3E83 A;  2EBO A;  4CZZ A;  4FLY A;  3LDD A;  4J9Z B;  2Q0A A;  5LMN B;  1BQ0 A;  2YXL A;  3CRC A;  1AI6 A;  2IJH A;  2GTS A;  1XEQ A;  1N32 O;  4JYA B;  2CUG A;  1IBM O;  4I9Q A;  1EFR G;  4NTY A;  4QE9 A;  2OIG A;  5GTH Z;  1AJP A;  5JWP A;  4RQF A;  3R66 A;  4KL1 A;  4DV4 B;  4LF9 B;  5LXT A;  3D3Q A;  5KMG A;  2GUZ B;  2O57 A;  5F2V O;  5KAI Z;  5H5N A;  2LP7 A;  4BAY A;  2OT5 A;  4GUN A;  1E1R G;  4JI7 B;  3JAM N;  1U97 A;  2FB5 A;  5C8Y A;  4TQD A;  4DK1 A;  2B9Z A;  4EEQ A;  3S3W A;  4JI1 O;  1QR9 A;  1AR1 B;  3JAR B;  1L0L H;  4GX5 A;  4E4E A;  1M90 W;  4QPK A;  1XMQ B;  3T1H O;  1K34 A;  1YZB A;  1SQV H;  3JYC A;  1S77 D;  2WLL B;  4H44 B;  2EIL C;  4RUE A;  1AP6 A;  3RBZ A;  2Q68 A;  1OCR B;  5DED A;  5JQG A;  3H1L H;  4X1K B;  1PNM A;  1F4M A;  2CTR A;  2CAZ C;  1ZL8 B;  4O4J B;  2E3C A;  5J2U B;  5DEC A;  3M7M X;  2GUZ A;  3ZMU A;  4F4L A;  5JVD A;  4LFC O;  1NTK H;  2Q69 A;  4B08 A;  4LF5 O;  4R7C A;  4J80 A;  1HP8 A;  1Y4M A;  3RVZ A;  2NNU A;  5H2F Z;  2AZ2 A;  3IJ4 A;  3HB3 B;  2NR5 A;  2QEX V;  4FM0 A;  4I0X A;  2UXD B;  4MVZ A;  2D3O W;  3LSQ A;  4B7E A;  1JA8 A;  1JX9 A;  2Q5Z A;  4I55 B;  4J41 A;  4YXW G;  2W0F C;  4WFE A;  3STZ C;  1KYO F;  1FJG O;  1MSD A;  4U7O A;  4B3R O;  1N8R W;  3ABK C;  2WLL A;  1YEW A;  4NR1 A;  4DR5 B;  2ZE7 A;  2ZIO A;  3EFF K;  3RGB A;  4X1K A;  3QNE A;  2PYJ A;  1NJI W;  4O4J A;  5CA1 B;  1AI5 A;  4DR6 B;  4LNU A;  1NU1 H;  4D7T A;  4DUY O;  3K79 A;  2ZIM A;  1Q7Y W;  2QKA A;  1B3Q A;  2WSS G;  1KKC A;  4XDJ A;  3ZRS A;  4FIP C;  3D36 A;  4FFK A;  1Q3E A;  2LFS A;  1SRY A;  1QQC A;  4HYO A;  3JAT A;  1DTO A;  2YIA A;  3SDL A;  2WWW A;  3ZRV A;  5B3S C;  2DJV A;  4X1I A;  3UKM A;  5KHI A;  1AR5 A;  1SKV A;  3IFX A;  2XT9 A;  4DUZ B;  3VBB A;  5LP6 B;  3AK2 A;  4MTO A;  3WU2 Z;  2OIE A;  1NT2 B;  2DWE C;  2F4V B;  3SPC A;  1ENV A;  5EBL C;  5LHH A;  1MZE A;  4BIZ A;  2CTQ A;  3FD9 A;  4LF7 O;  2P90 A;  3BRC A;  2BSK B;  5CA1 A;  1NKD A;  2PZS A;  3JCZ A;  4RUF A;  4H37 A;  4ZKI A;  1VQ9 V;  3AG3 C;  4K8Z A;  2P7T C;  4CS2 A;  4X20 B;  1KUQ A;  1VAR A;  1A32 A;  4MTF A;  2YIB D;  1MOF A;  2P4K A;  1KB9 F;  1QR8 A;  3A0H Z;  2A79 B;  2FYU H;  3JD1 A;  2OTJ V;  2NN4 A;  1M56 C;  1IBL B;  4K35 A;  3J7A U;  4TQF A;  2W6J G;  3AG4 B;  1B6Q A;  5CBF A;  2CTP A;  1MNG A;  1JFF B;  3OMA B;  5HFM A;  3N2G A;  2JDI G;  3ASN B;  1H8E G; 
#chains in the Genus database with same CATH homology
 3H1L H;  3H1I H;  3CXH F;  4PD4 F;  1SQX H;  3L70 H;  1SQB H;  1KB9 F;  4D6T H;  3CX5 F;  3L75 H;  1BCC H;  5KLV H;  1PPJ H;  2FYU H;  1P84 F;  1SQQ H;  2BCC H;  3L74 H;  3H1H H;  3H1J H;  1NTM H;  1L0L H;  3L73 H;  4U3F H;  1NU1 H;  1PP9 H;  1BGY H;  1KYO F;  1NTK H;  1BE3 H;  1SQV H;  3CWB H;  2A06 H;  3H1K H;  3L71 H;  3TGU H;  1SQP H;  1NTZ H;  3L72 H;  1EZV H;  2IBZ H;  3BCC H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...