3TGUH

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3tguH00
2FYUH 1KYOF 3H1JH 1NTMH 2BCCH 1EZVH 3L75H 4PD4F 1SQBH 3CXHF 3H1IH 2A06H 3CX5F 1SQVH 2IBZH 3L73H 1PPJH 1BGYH 1P84F 4U3FH 1SQQH 3TGUH 3L70H 4D6TH 3H1LH 1NU1H 3H1HH 1PP9H 3L72H 1BE3H 1NTKH 3H1KH 3L71H 1BCCH 1SQPH 1L0NH 1SQXH 1L0LH 3L74H 3CWBH 1NTZH 1KB9F 5KLVH 3BCCH
chains in the Genus database with same CATH superfamily
3OR6C 3RYHA 2XT9A 4PHZA 1W0KG 4ZHQB 4KP4A 5CA1A 2OIGA 3AG2B 1TUBB 5J2UA 1OCOC 4HBNA 3EXAA 1M93A 4I55B 3Q4HB 4Q6GA 1SQPH 4IHJA 4DR7B 2CUGA 3ZX6A 1NKDA 2VQFB 1XUQA 3B2EE 1YJWV 3HKEA 4DUZO 5AG2A 1H2SB 1VQLV 5KMGB 4H44B 2NN4A 5TISZ 5F2VO 1OCZB 5EYPA 1R3IC 4WFBV 1PNKA 2RN9A 2XAFA 5J2TB 1BHBA 4JI3O 4IL6Z 3CRCA 4FLTA 5IYZA 1G6UA 1GH6A 5GTIZ 1OCCC 4EEQA 2YUAA 4UFZA 1N32O 4PD4F 5LMNB 3K06A 2A06H 1YEWA 2ZE5A 4ZI7A 4YHHO 3JARB 3L70H 3ZIAG 5LP6C 4D6TH 4JF3A 4ASUG 2ZQMA 2WLJA 1F23A 4LNUA 2EIJC 4CC5A 4IT5A 2ZE6A 3SPJA 1N33B 2ITCC 2Q7HA 5HFLA 3HKBB 3CP1A 4B08A 2WAMA 1S77D 1THZA 3F5TA 5IJ0A 4YXWG 2DYSC 1XEQA 1CXZB 4G2KA 3ZRXA 3CCVV 2R9RB 5EBLC 3JD3A 1XL6A 4NYKA 1B06A 1R3JC 2BOBC 4LBEC 2B1IA 2EJRA 3JD0A 4J7JA 4GUNA 2ZKOA 1MA1A 1LNQA 4ABMA 3SJAC 1SA0A 4B3RO 3H1IH 1QLEB 2PF4E 4B3SO 3G6BA 4MW8A 4LF4O 2DQ0A 5GW7A 5DEDA 2BSKB 2P6JA 1AP6A 3E89A 1NU1H 3X2QC 1KKDA 1EFRG 1KB9F 3ASOB 3CJHA 3RVZA 2PTMA 4LF8B 1XNQB 1DGSA 5B1AC 5E79Z 1NH2B 5CMUA 3J80N 4YJ3A 3K57A 4DO2A 3SYOA 3CRRA 2HJDA 1QQCA 2ZXWC 4XDLA 3T1HO 1N4CA 2BE3A 4ZKIA 3BABA 4DUYB 4F6EA 1SQBH 2ZD9A 2A7WA 2YEVA 3ML0A 2UUAO 2NR5A 3TETA 2PUSA 2M6YA 5B1OA 2DMXA 1ZWIC 4NXMB 2UUCO 2P7TC 2ZNJA 3ABUA 1SQXH 2CAZC 4JZGA 3E35A 5B1NA 3RYCA 3AK3A 1US6A 1IXMA 1VF6A 3OUSA 2AW9A 4HNAB 1M9NA 4LF5O 2CK3G 3ABMB 3FYEB 4DRXB 4AILC 2Q68A 1M57B 1PL4A 1GRJA 5IJ9A 2G38A 4HYOA 3K5MA 1R6KA 3JSLA 2QGNA 2UXNA 1I08A 1KECA 2HHHB 5KAIZ 1FJGB 1I5YA 4FFKA 1SQVH 3LSSA 3APOA 5LL6Y 3JCZA 1WP8A 5JJEB 1TVKB 4JI5B 4X64O 1M4UA 1N34O 4D7TA 3WG7B 1EBOA 4PDVA 4PI0A 4O4IB 3CWBH 1YHQV 4TOIA 5EBMC 2EINC 2ZIMA 4P30A 3LSQA 2ZM6O 1EZJA 5JCOA 4UVBA 5FNVA 4JAVA 2P06A 3U10A 2UXBB 1PPJH 2JEXA 2HKOA 4MTXA 3AG3B 4GX2A 2R70A 3K3WA 3LNMB 5L3DA 2Y4TA 1RM1B 2OT5A 5FL7G 2Y48A 2P4KA 2XOKG 2JS5A 4O2BB 4JAAA 1PD3A 2P5OA 4GKKO 4TUYA 4JYAB 1MOFA 4HZ3A 3BVOA 2FKXA 1SZXA 2CTPA 3VQXA 3QO5A 4K3AA 4CBCA 3K9SA 1FKAO 4I50A 3ZMVA 3DXRB 5B66Z 4ICGA 4Z2WA 3W7UA 5KA5A 4LF7O 2IU0A 2XTAA 3CXCU 1SERA 3JATA 1GK9A 4UVCA 1J5EB 1TA8A 2L35A 2LGWA 2IBZH 3ZMSA 4JI1O 4NR1A 1YDXA 2F95B 2KG7A 3S3XA 2LGQA 3ZMUA 3ABTA 1ZSPA 1KMIZ 3BA8A 5JVDB 4PDLA 1O9GA 4JYCA 1XNRB 4UXNA 4LFBO 4O2AA 3OE7G 1IDSA 2VWJA 5EK0A 3FAVB 3VQYA 1F51A 3DGEA 1SQGA 4L8JA 2OTLV 5IY5B 2WLIA 2ZCEA 3E83A 1YITV 4DV2O 3N2GA 4J41A 5C8YB 1WA8B 1Q5OA 3EHBB 3TXSA 3SPCA 4X89A 2Y69B 1BQ0A 4LWSA 2BCCH 3RWRD 3TCUA 2D3OW 1H2MA 3F5WC 1TUEB 3JCUZ 5LGTA 1AI4A 1K5QA 4J7KA 2XASA 1Z5WA 4OXSA 4I4TA 2CTQA 2F93B 5FPOA 4U7NA 1GKFA 3C3TA 2IH3C 4GZRB 3IJ4A 1IBKO 2BOCC 1GTOA 1IX9A 1PM9A 5GTHZ 3LUTB 1Y74B 3AG1B 1Q3EA 4JTDB 1VEWA 1H8EG 1VF5B 4FLWA 1FD9A 4BIUA 5DN6G 4IIJB 3JAWA 4DR7O 1KP3A 3SYQA 3J7AU 2VQFO 4YJ2A 3CCUV 1G1XB 1L0NH 3PN1A 4JI8O 2DYRB 3F7YC 1VIBA 3T1YB 1VQ9V 1VP7A 5L3CA 2HVJC 2RMKB 3OGCC 3FKSG 3HKCA 2EULA 4GT1A 2N05A 3A8TA 1MZEA 3B09A 2XAHA 2DQ3A 3NXSA 2JGDA 3VQWA 4OX9O 4G28B 4EB6A 5LYJB 5LMNO 3SYPA 3M7MX 4JTAB 4O4JB 2ZR2A 1N36O 4LR3A 5JJNB 3CRMA 3D3IA 3ZBHA 5IDJA 4CC6A 1WP7A 5JH7A 1OCOB 2KB1A 2QR4A 3OAAG 1KU9A 3OW2U 2UU9B 4QE9A 1Y6XA 2WA4A 2EIKB 1AB3A 2E74B 2DE0X 1Q8IA 1XMQB 2Q7GA 1NTMH 1UPGA 1G4YB 2PGGA 5A2QN 1K33A 3K03A 4QNHB 3RGBA 2XAJA 3T2MA 1Y67A 4DV4B 4WFGA 2X6CA 2AZ0A 4EFEA 3CCSV 4K8ZA 5IWAB 1VQ8V 5EZYA 5H9CA 3H1JH 3N2KB 2EBOA 2CH7A 4LF6O 4GX0A 3GVMA 2QM7A 5LP6B 2ZINA 3CCMV 1R6NA 1JFFB 3CRQA 4LF8O 4TV8B 3T4DA 4OPHA 3JALA 1V9PA 2GSMB 3CC4V 3I56V 4JI6O 2X7RB 4PDRA 4JI0O 1XILA 2Y4UA 3KG2A 3CCRV 5CBFA 3N27A 4X1IB 4JI2O 1RPRA 4GKJB 4NVPA 3BA9A 3M99B 4DR4B 2JIZG 4DR3O 3BFRA 1QHTA 4DUYO 1V55B 3E22A 1IBLO 3ZMZA 1S0VA 3WB2A 3BCCH 2L6LA 1DF4A 1M5IA 2GHYA 1VF6C 2EX3A 1HNZB 3JASA 1FXKA 1FPOA 2HP8A 4NXMO 2GDSA 4WFAV 1NQTA 2W0XA 1ZTEA 1XOUA 3JD4A 4LP8A 4RUEA 3OTOB 5CN0A 1M1KW 4LFCO 3X2QB 1JPXA 1L0LH 4PDMA 4K35A 1WAZA 3SGIA 2LW7A 2JRIA 1XHXA 4DRXA 3OTFA 2CGOA 4DXWA 5B1AB 4CS4A 1MABG 3OEHG 2ILMA 3C3SA 5LXTA 4GLXA 3CPWU 2HHHO 1GN3A 3W7TA 4IGGA 2QWPB 1PL0A 3HPLC 3RYFB 1SRYA 2IW5A 3H1LH 3EVKA 4PJ0Z 4FZ0A 1JOYA 4JI5O 5FPRA 2YS8A 4GX1A 4PA3A 5JCOC 1H2NA 4F6RA 2XHBA 2H8PC 5LA6A 2NLJC 5FLXN 4O4IA 2WLKA 3D36A 2LP7A 5A9GA 4PA9A 4LH7A 1ZUQA 2ITDC 3L74H 1S76D 4UCUA 1GMGA 3PJSK 4DR2O 3RYIA 3ZHTA 4FM1A 1ZX3A 1JJOA 2YIDA 1RSOA 2Q0AA 4X1KB 1D5NA 5D5QA 1ZL8B 4X20B 1NH2D 1JCHA 4MTGA 3CHXA 4QJFB 4UCSA 4PI2A 4BR6A 1HNWB 1Q6UA 4ZOLB 4J10A 1OJHA 1BS3A 3UKMA 3I55V 2QTOA 5IYCO 1HW7A 2E76B 4AI8A 3B4SA 3ABLC 2WA3A 2Z3YA 3U0ZA 3DXRA 5K1PA 1PNMA 4TWKA 1QVGU 3ETDA 2IU3A 2EIMC 4YIPA 2DJVA 4H33A 1AR5A 1H38A 3KKYA 2RJZA 3IC9A 1Y76A 3MD0A 4DV0O 5LHIA 4HAMA 5CA0B 5JWPA 2F4VB 4J11A 2A79B 1RPOA 2EINB 4KHPB 2EJ7A 4QGPA 1Q6IA 1I94O 2QWNB 3E8HA 4I0XA 1W0JG 4WFHA 1D2DA 5CB4B 3QTCA 3CE2A 1OHHG 1ROPA 1AJQA 2VS0A 2E3CA 3K9AA 3ZN0A 1W2BU 2YXYA 2WLMA 3UT5A 2OCCB 1K73W 5KX5A 4PV1B 3UO3A 4YY3O 2OYQA 4OGQB 4DW1A 2UXCO 1HWYA 4CZZA 4CH4A 1XHZA 3H1HH 4DV6O 3MHHC 1NTKH 4DV7B 1R3LC 2P4VA 3A0RA 4P9OA 4DV5B 4X65O 1T5EA 3J81N 2OCHA 4MVZA 1WNSA 5D5PA 3DC6A 3JYCA 4K0KB 3FB7C 2DW4A 1BQZA 1FFXB 4FFBB 2ETNA 4EFBA 5JQGA 4UVAA 1AR1B 3S3WA 1HR0O 5B5EZ 2BTQA 5BY1A 4G27B 4H37A 4B3TB 2QWQB 1UJWB 2H3OA 3STLC 2QE7G 1DK1A 2R72A 2F23A 3ZRWB 1K92A 4TV9A 5EC1C 5LMUB 1YIJV 1XMOO 2E75B 4IIJA 4O4LB 1VQNV 2ZNIA 2MW2B 4LF9O 2NNUA 1OCZC 3DTUB 3E86A 4J80A 5LGUA 3ZN1A 4DW0A 1SF9A 3T1YO 2QTSA 3SDLA 4ZBMA 2UXDB 5GONA 4UCOA 3CYOA 3W7SA 4ZIBA 4O4HA 3RVYA 3HKDB 3RYHB 3JSNA 4W4LA 1TAEA 5B1BC 5ITZA 4JV5B 5CA1B 4MSWC 2LFSA 5BR8O 2AHYA 1W59A 4TQDA 1B04A 2JEUA 3ZS8C 3QF7A 2JVDA 3ZHRA 5H2FZ 5KHGA 1JMKC 2WLLA 1SC5B 3K5LA 5LOVB 2UU9O 2WLNA 2P67A 3A0BZ 4MVQA 3F7VC 1YZBA 1KQSU 5EYPB 3R66A 3BRCA 1Q86W 4BIOA 2AHZA 2RDCA 4J9ZB 1NR1A 1R73A 5L3GA 3HR0A 4JI4O 3G6EV 1GN4A 5EIBD 1GN6A 5IYZB 1QLEC 1JA8A 2HFEC 4X1YA 3CX5F 1FAFA 4U3JA 3JD1A 1N32B 2UUBO 3NR7A 3JAKA 4ZI7B 1M90W 2OWOA 4XDJA 3CCLV 1DLBA 4LNUB 4X9QA 1GO3F 2F43G 5CBHA 3B40A 2Q73A 2GUZA 4X66O 2FL4A 3K08A 4FLYA 3CD6V 3AG4C 5IYBO 2JS3A 5IJ0B 1BZKA 4U7OA 5KA6A 4A5UB 4MVMA 1SQFA 1WPBA 4NXNO 3AK2A 3D3QA 4NTWA 5KLVH 4DR5O 3CS5A 1O9HA 2W0FC 1HNXO 4TSFG 4DR4O 1PNLA 1FXKC 2A9HA 1R3KC 4WBNA 3T4ZA 3UO2A 2XAQA 1N8RW 4LF4B 4NB5A 3UM7A 4CH6A 4DV1B 4DR1O 4RAIA 2FTKA 3CJHB 3ETGA 3L75H 3IGAC 3ZHUA 3OTOO 1Q81W 2IJJA 4X62O 1SQQH 4YJ3B 5K1XA 4Q20A 2GTSA 2LO1A 2B5UA 4WFFA 3T1HB 2N04A 4N23A 1I0HA 1PKXA 2FYUH 3SJBC 1OCRB 2JGUA 1K4CC 3K5OA 4ZHQA 1H2KA 3ICXA 1L1FA 2QA4V 2V7QG 2R9AA 4MT8A 1P7BA 2PZSA 3L9DA 1TUBA 2XNDG 2YEVB 3ETEA 3TGUH 4I55A 3Q4HA 2JJ2G 4MTOA 3K79A 1BCCH 3D36C 1WJZA 3AEIA 3IAYA 3RYCB 2UUCB 2WWWA 4UV9A 1FXHA 1FFTB 3ETQA 3ZRSA 5KMGA 1ZLZA 4F4LA 4MVRA 1RM1C 3GWKC 4UCVA 5J2TA 1Q43A 5DECA 3ASNB 5IJ9B 1K3EA 1H2GA 2A0LA 1NVPB 3WU2Z 4GX5A 1AVMA 3O9OA 3A0HZ 1U96A 2YICA 2QSAA 4UB6Z 3E8FA 2X6BA 3JARA 4C7UA 1GM8A 1NS1A 3QO7A 5LHHA 1HNWO 3B8MA 4UCRA 2X6AA 1V54C 4X8AA 1N33O 2LW1A 1YF2A 3FB8C 4X64B 3HKBA 1SS3A 2LFRA 4QPJA 1UFIA 4IYHA 1S72V 1N34B 1K9MW 4RQEA 1M56C 4WF9V 3K0GA 2HLDG 2KKWA 1QCEA 5FNVB 1SETA 2ZM6B 4I5SA 3I5DA 4PELA 3FB5C 3E8BA 1R1BA 1JJ2U 1X59A 4KHPO 1NTZH 2QKAA 1KYOF 1CP9A 2FMLA 4JTCB 3TK1A 1OCCB 4GCZA 3K58A 1WB7A 4AQYB 4TUYB 1BMFG 1LUWA 5CB4A 2BSKA 3OFNG 3KZIZ 3AG7A 3KCXA 3T1CA 2Y0IA 4NTXA 4I50B 1XNQO 1GM7A 2EIJB 3BEHA 4LF7B 1R6TA 3M8AA 2Y69C 3ZHVA 2VWKA 1BT8A 2ZDIA 3JATB 4W4KA 1MZFA 5L3FA 4LFAB 3CSXA 3ABLB 4FLZA 1XBLA 1GAXA 2DYSB 1D5AA 3VQVA 2KG7B 2V4DA 4MW3A 4PA7A 4FJCC 2EIMB 3APQA 2P22C 3IC7A 3HB3B 2QKCA 3EFFK 5LBQA 3QG5A 2WSSG 2FB5A 4O2AB 3AG1C 4LFBB 4MVUA 1EN6A 4B3TO 2RCVA 1E1RG 3LDDA 5DM6V 2WLIB 2Z0AA 2GV9A 4MVOA 3FFQA 1XL4A 3CMEV 1Q90D 2QEXV 2Y0PA 4MS2A 1WN7A 2ADQB 1YXBA 3TXQA 3N2GB 4HNAA 2N74A 4DV2B 2HVKC 1AI5A 2YXHA 1YJNV 3OEEG 4LCUC 3FD9A 4LWSB 2F1MA 1P84F 1P4RA 1AR4A 1OV9A 2ZXWB 1VQ4V 1QU7A 1Z5VA 4E2LA 4I4TB 1FJGO 2ADPA 2QWOB 1AJPA 3OM3B 5BZBA 3HKDA 3O65A 4FPPA 5H6RA 2IJKA 3FX7A 5EC2C 1I7FA 1SKVA 1L8DA 1LR1A 1TVKA 1IBKB 1URFA 4JV5O 1GN2A 4U3FH 3ZJZA 2YIBD 1VARA 3ZRVA 2HJFC 1ZAUA 1N0NA 4FIPC 5B3SC 4I9WA 1F7YA 4UB8Z 3JAWB 2LJ2A 3K0DA 2YI8A 4J42A 1NI8A 2EIKC 3UQ8A 2XAGA 2PYLA 4YJ2B 1S5HC 1IVSA 3SR2C 1VQ6V 2KQXA 1RFYA 2UXBO 1IXBA 1VQPV 2CTRA 1B6QA 2QDOA 4P2ZA 5LOVA 4JI8B 3CXHF 4FM2A 2BTOA 1FXVA 4FK5C 3FB6C 3W7WA 3HKCB 2E5LB 1AP5A 1VQ5V 5H6QA 4DR6B 2V1DA 2JGDB 4B3MB 4AHCA 4JYAO 3SJQC 4O2BA 5LGNA 1F4NA 4EB6B 4OX9B 3OD4A 2Q69A 1N36B 3RFRA 1BGYH 1QR9A 3OGIB 1NT2B 2YDEA 4X88A 1CEZA 5B1BB 3ZHSA 2WPDG 5JH7B 4JASA 2O57A 2AXTZ 2D2CB 3L72H 4R7CA 1J5EO 1IBMB 1Y66A 3KCYA 5LHGA 4Z1MG 5IE9A 3CCEV 4DV3B 1YTFD 4NKGB 2IH1C 1IURA 3ABKC 1BL8A 2Q8VA 2GBOA 2CGNA 4I7ZB 1XNRO 5JVDA 1V55C 4RO2A 1HP8A 1JVMA 1YSCA 4LC1A 3FAVA 1EN4A 1RP3B 5EZYB 4QIWF 5CBGA 5CA3A 4K8XA 3SJCC 2B9ZA 2EILC 2CH7B 4LF6B 2R9IA 1QR8A 3THOA 2F66C 5C8YA 4DV1O 1WA8A 2IJHA 1A32A 2DWDC 4FLUA 4CH3A 3JALB 1S5JA 2KSDA 3AG4B 3SYAA 1QBZA 1P7GA 4JI7B 2IJIA 1YCIA 4KUMA 4JI6B 3GB7C 4JI0B 3AG2C 5BMVB 1Q7YW 2VQEB 4Z1VA 4IYIA 3C90A 1QNMA 1F4MA 4H0LB 4JI2B 2Q5ZA 1K4DC 4J9YB 1EN5A 1K8AW 3L71H 3SPGA 2YC0A 3FYIB 1YTFB 4DR3B 4UUJC 3E22B 5E1AC 1Y74A 2RQ6A 1IBLB 1GM9A 1I5XA 3BY6A 4MVSA 1QLNA 3JASB 1FXKB 2CDYA 5L3BA 1Y4MA 1NJIW 1E79G 4BW9A 3BPZA 4LFCB 3VOUA 4P9PA 3WB0A 4DYLA 1FS0G 4JAUA 3STZC 1MG1A 2PI5A 5IT9N 3CB2A 2HG5C 2IM9A 2YIAA 4FLXA 1VF7A 1JX9A 2Q67A 2QJ1A 5LYJA 2AZ2A 5LXTB 3CC7V 2YSUB 5J2UB 2OTJV 4O4JA 1B3QA 4JGSA 2Q4PA 4NTYA 4IHJB 2HEPA 1KC8W 5KUMA 3SYCA 3GWOA 1E1QG 4TQFA 3HKEB 4QE7A 4FZ1A 4DUZB 2VRZA 1XREA 3CCJV 4F6RB 5C93A 3RT3C 4BIZA 5JJJB 5LA6B 1XMQO 4RUFA 2EZPA 5KHIA 4B7EA 4N21A 1MSWD 4R50A 3RYIB 2Q0OC 4JI3B 2CTWA 1DF5A 4DR2B 3P3NA 4DV4O 3E2EA 1K7DA 1N0JA 4QPKA 1RSOB 1PV0A 1MMMA 1K97A 1K34A 4BW5A 3BAAA 5IWAO 3DC5A 4YHHB 2K1EA 3G67A 1Q6HA 1BHAA 4AQYO 3ASOC 2C2AA 3N2KA 2OCCC 1WPXA 4DK1A 3P32A 3OUFA 2ZIOA 2YXLA 3DSQA 5EBWC 1S5LZ 2ZDIC 1KP2A 2CE4A 2UXXA 5LP6A 1JFFA 2ZT9B 2DWEC 4TV8A 1V54B 4KFMA 1BE3H 1YJ9V 4LFAO 4KL1A 1S3JA 1SZTA 1X4TA 1CPYA 1M56B 4WCEV 1Y76B 3H01A 4GKJO 4X1IA 4DV0B 3L73H 5L3EA 1SA0B 1H8HG 4B3RB 4I0XB 1I94B 2ARHA 4B3SB 3VBBA 1NR7A 3LSUA 4XBFA 3OMNB 5J9PC 1HNZO 3ZHQA 1AILA 3SPHA 1NVPD 3CRAA 3UT5B 1G8MA 3ABMC 3OR7C 4KXRA 1XDCA 5KX5B 1M57C 1XI1A 4YY3B 3JD2A 1KD1W 4L87A 1PP9H 4WFEA 2UXCB 3CEIA 2YI9A 2W6IG 4DV6B 1MSDA 4UCTA 3JAMN 2ZE7A 1BSMA 4RQFA 2Q6AA 2ZR3A 5HFMA 5H5NA 4JYYA 4X65B 2HR3A 1XQ8A 3MHSC 2LQTA 3H9VA 4FM0A 5JQGB 1Q82W 3WG7C 2UUAB 4CS3A 3RYFA 1HR0B 3OT7A 2BTQB 1AI7A 3CC2V 3ZMTA 3LNNA 1SESA 2QWRB 2JK5C 3U11A 1VQOV 2RNBA 4TV9B 4B7KA 3P30A 1WLEA 4PA6A 3AG3C 1XMOB 4LH6A 2M7WA 4EKWA 1QVFU 2GTAA 4LF5B 3OMAB 4GYCB 1NBMG 1VQKV 4LF9B 4D7SA 3G80A 1K5SA 2OIEA 4R8CA 2K9PA 3A2FA 2H94A 1MNGA 2QKSA 3B77A 4TT3G 1ENVA 5GONB 2E5LO 4O4HB 1H2LA 1JQ0A 1IZ3A 1OZ0A 4X1KA 4DR6O 1ZL8A 4X20A 4B3MO 4J7ZA 1LUVA 1VMGA 1Z2GA 2QM8A 1VQMV 1KUQA 5ITZB 2PI4A 4ZOLA 4JYBA 1AJNA 5BR8B 3QVNA 1YVWA 3AK1A 2QM4A 1ORQC 1KKCA 2DN9A 4MTFA 3RW0A 3K04A 2PY5A 4E4EA 2ATKC 2WLLB 3RN4A 4R6ZA 5B3SB 1IBMO 2PYJA 2F4VO 4DV3O 1VQ7V 5CA0A 5KAFZ 2EZOA 1J95A 2YIBA 3TJTA 4FVMA 3W7XA 3P3PA 4CH5A 4JI4B 3K59A 5IY5C 5BXZA 4X1YB 4GKKB 5KHHA 4FLVA 2A3QA 2Q9LA 4JZ2A 3G71V 2MK3A 4U3JB 4BAYA 3JAKB 1DTOA 5EIBC 2UUBB 2XUMA 1U97A 3K5NA 2P90A 4DK0A 3ZCCA 1FYJA 2W6JG 1EZVH 2GUZB 4CS2A 3D8CA 4X66B 4XDKA 4DV7O 2AGAA 3OMIB 4DV5O 3MDSA 4JI1B 3G4SV 3B8NA 1AI6A 3LDCA 4RWUA 4YIOA 4JI7O 3QNEA 3IFXA 2WLHA 4K0KO 1OCRC 4NXNB 1TGOA 1WB8A 2JDIG 4UV8A 1FFXA 4FFBA 2VQEO 5BMVA 4DR5B 3ABKB 3SPIA 3MAQA 3ZEDA 1HNXB 4PA4A 3RBZA 3R65A 2B1GA 1COWG 4WBNB 3ZRWA 5KHKA 3H1KH 1AROP 5LMUO 1NZ6A 3UCSC 1P49A 5IYDO 4OPAA 2DYRC 2Z5UA 3WFVA 1JR9A 2X0LA 3QO8A 5KUKA 2JJ1G 2ZE8A 4JPRA 4O4LA 1YI2V 1EM1A 4FMTA 4H13B 4DR1B 4BWAA 2EILB 3BHPA 1HDJA 2Q7EA 1KBHA 5KHJA 2DOSA 4X62B 3ASNC 3E8GA 4I9QA 2UXDO 3CMAV 3LDEA 3CCQV 3WB1A 2ODMA
chains in the Genus database with same CATH topology
2FYUH 1KYOF 3H1JH 1NTMH 2BCCH 1EZVH 3L75H 4PD4F 1SQBH 3CXHF 3H1IH 2A06H 3CX5F 1SQVH 2IBZH 3L73H 1PPJH 1BGYH 1P84F 4U3FH 1SQQH 3TGUH 3L70H 4D6TH 3H1LH 1NU1H 3H1HH 1PP9H 3L72H 1BE3H 1NTKH 3H1KH 3L71H 1BCCH 1SQPH 1L0NH 1SQXH 1L0LH 3L74H 3CWBH 1NTZH 1KB9F 5KLVH 3BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU H;  1KYO F;  3H1J H;  1NTM H;  2BCC H;  1EZV H;  3L75 H;  4PD4 F;  1SQB H;  3CXH F;  3H1I H;  2A06 H;  3CX5 F;  1SQV H;  2IBZ H;  3L73 H;  1PPJ H;  1BGY H;  1P84 F;  4U3F H;  1SQQ H;  3TGU H;  3L70 H;  4D6T H;  3H1L H;  1NU1 H;  3H1H H;  1PP9 H;  3L72 H;  1BE3 H;  1NTK H;  3H1K H;  3L71 H;  1BCC H;  1SQP H;  1L0N H;  1SQX H;  1L0L H;  3L74 H;  3CWB H;  1NTZ H;  1KB9 F;  5KLV H;  3BCC H; 
#chains in the Genus database with same CATH topology
 3OR6 C;  3RYH A;  2XT9 A;  4PHZ A;  1W0K G;  4ZHQ B;  4KP4 A;  5CA1 A;  2OIG A;  3AG2 B;  1TUB B;  5J2U A;  1OCO C;  4HBN A;  3EXA A;  1M93 A;  4I55 B;  3Q4H B;  4Q6G A;  1SQP H;  4IHJ A;  4DR7 B;  2CUG A;  3ZX6 A;  1NKD A;  2VQF B;  1XUQ A;  3B2E E;  1YJW V;  3HKE A;  4DUZ O;  5AG2 A;  1H2S B;  1VQL V;  5KMG B;  4H44 B;  2NN4 A;  5TIS Z;  5F2V O;  1OCZ B;  5EYP A;  1R3I C;  4WFB V;  1PNK A;  2RN9 A;  2XAF A;  5J2T B;  1BHB A;  4JI3 O;  4IL6 Z;  3CRC A;  4FLT A;  5IYZ A;  1G6U A;  1GH6 A;  5GTI Z;  1OCC C;  4EEQ A;  2YUA A;  4UFZ A;  1N32 O;  4PD4 F;  5LMN B;  3K06 A;  2A06 H;  1YEW A;  2ZE5 A;  4ZI7 A;  4YHH O;  3JAR B;  3L70 H;  3ZIA G;  5LP6 C;  4D6T H;  4JF3 A;  4ASU G;  2ZQM A;  2WLJ A;  1F23 A;  4LNU A;  2EIJ C;  4CC5 A;  4IT5 A;  2ZE6 A;  3SPJ A;  1N33 B;  2ITC C;  2Q7H A;  5HFL A;  3HKB B;  3CP1 A;  4B08 A;  2WAM A;  1S77 D;  1THZ A;  3F5T A;  5IJ0 A;  4YXW G;  2DYS C;  1XEQ A;  1CXZ B;  4G2K A;  3ZRX A;  3CCV V;  2R9R B;  5EBL C;  3JD3 A;  1XL6 A;  4NYK A;  1B06 A;  1R3J C;  2BOB C;  4LBE C;  2B1I A;  2EJR A;  3JD0 A;  4J7J A;  4GUN A;  2ZKO A;  1MA1 A;  1LNQ A;  4ABM A;  3SJA C;  1SA0 A;  4B3R O;  3H1I H;  1QLE B;  2PF4 E;  4B3S O;  3G6B A;  4MW8 A;  4LF4 O;  2DQ0 A;  5GW7 A;  5DED A;  2BSK B;  2P6J A;  1AP6 A;  3E89 A;  1NU1 H;  3X2Q C;  1KKD A;  1EFR G;  1KB9 F;  3ASO B;  3CJH A;  3RVZ A;  2PTM A;  4LF8 B;  1XNQ B;  1DGS A;  5B1A C;  5E79 Z;  1NH2 B;  5CMU A;  3J80 N;  4YJ3 A;  3K57 A;  4DO2 A;  3SYO A;  3CRR A;  2HJD A;  1QQC A;  2ZXW C;  4XDL A;  3T1H O;  1N4C A;  2BE3 A;  4ZKI A;  3BAB A;  4DUY B;  4F6E A;  1SQB H;  2ZD9 A;  2A7W A;  2YEV A;  3ML0 A;  2UUA O;  2NR5 A;  3TET A;  2PUS A;  2M6Y A;  5B1O A;  2DMX A;  1ZWI C;  4NXM B;  2UUC O;  2P7T C;  2ZNJ A;  3ABU A;  1SQX H;  2CAZ C;  4JZG A;  3E35 A;  5B1N A;  3RYC A;  3AK3 A;  1US6 A;  1IXM A;  1VF6 A;  3OUS A;  2AW9 A;  4HNA B;  1M9N A;  4LF5 O;  2CK3 G;  3ABM B;  3FYE B;  4DRX B;  4AIL C;  2Q68 A;  1M57 B;  1PL4 A;  1GRJ A;  5IJ9 A;  2G38 A;  4HYO A;  3K5M A;  1R6K A;  3JSL A;  2QGN A;  2UXN A;  1I08 A;  1KEC A;  2HHH B;  5KAI Z;  1FJG B;  1I5Y A;  4FFK A;  1SQV H;  3LSS A;  3APO A;  5LL6 Y;  3JCZ A;  1WP8 A;  5JJE B;  1TVK B;  4JI5 B;  4X64 O;  1M4U A;  1N34 O;  4D7T A;  3WG7 B;  1EBO A;  4PDV A;  4PI0 A;  4O4I B;  3CWB H;  1YHQ V;  4TOI A;  5EBM C;  2EIN C;  2ZIM A;  4P30 A;  3LSQ A;  2ZM6 O;  1EZJ A;  5JCO A;  4UVB A;  5FNV A;  4JAV A;  2P06 A;  3U10 A;  2UXB B;  1PPJ H;  2JEX A;  2HKO A;  4MTX A;  3AG3 B;  4GX2 A;  2R70 A;  3K3W A;  3LNM B;  5L3D A;  2Y4T A;  1RM1 B;  2OT5 A;  5FL7 G;  2Y48 A;  2P4K A;  2XOK G;  2JS5 A;  4O2B B;  4JAA A;  1PD3 A;  2P5O A;  4GKK O;  4TUY A;  4JYA B;  1MOF A;  4HZ3 A;  3BVO A;  2FKX A;  1SZX A;  2CTP A;  3VQX A;  3QO5 A;  4K3A A;  4CBC A;  3K9S A;  1FKA O;  4I50 A;  3ZMV A;  3DXR B;  5B66 Z;  4ICG A;  4Z2W A;  3W7U A;  5KA5 A;  4LF7 O;  2IU0 A;  2XTA A;  3CXC U;  1SER A;  3JAT A;  1GK9 A;  4UVC A;  1J5E B;  1TA8 A;  2L35 A;  2LGW A;  2IBZ H;  3ZMS A;  4JI1 O;  4NR1 A;  1YDX A;  2F95 B;  2KG7 A;  3S3X A;  2LGQ A;  3ZMU A;  3ABT A;  1ZSP A;  1KMI Z;  3BA8 A;  5JVD B;  4PDL A;  1O9G A;  4JYC A;  1XNR B;  4UXN A;  4LFB O;  4O2A A;  3OE7 G;  1IDS A;  2VWJ A;  5EK0 A;  3FAV B;  3VQY A;  1F51 A;  3DGE A;  1SQG A;  4L8J A;  2OTL V;  5IY5 B;  2WLI A;  2ZCE A;  3E83 A;  1YIT V;  4DV2 O;  3N2G A;  4J41 A;  5C8Y B;  1WA8 B;  1Q5O A;  3EHB B;  3TXS A;  3SPC A;  4X89 A;  2Y69 B;  1BQ0 A;  4LWS A;  2BCC H;  3RWR D;  3TCU A;  2D3O W;  1H2M A;  3F5W C;  1TUE B;  3JCU Z;  5LGT A;  1AI4 A;  1K5Q A;  4J7K A;  2XAS A;  1Z5W A;  4OXS A;  4I4T A;  2CTQ A;  2F93 B;  5FPO A;  4U7N A;  1GKF A;  3C3T A;  2IH3 C;  4GZR B;  3IJ4 A;  1IBK O;  2BOC C;  1GTO A;  1IX9 A;  1PM9 A;  5GTH Z;  3LUT B;  1Y74 B;  3AG1 B;  1Q3E A;  4JTD B;  1VEW A;  1H8E G;  1VF5 B;  4FLW A;  1FD9 A;  4BIU A;  5DN6 G;  4IIJ B;  3JAW A;  4DR7 O;  1KP3 A;  3SYQ A;  3J7A U;  2VQF O;  4YJ2 A;  3CCU V;  1G1X B;  1L0N H;  3PN1 A;  4JI8 O;  2DYR B;  3F7Y C;  1VIB A;  3T1Y B;  1VQ9 V;  1VP7 A;  5L3C A;  2HVJ C;  2RMK B;  3OGC C;  3FKS G;  3HKC A;  2EUL A;  4GT1 A;  2N05 A;  3A8T A;  1MZE A;  3B09 A;  2XAH A;  2DQ3 A;  3NXS A;  2JGD A;  3VQW A;  4OX9 O;  4G28 B;  4EB6 A;  5LYJ B;  5LMN O;  3SYP A;  3M7M X;  4JTA B;  4O4J B;  2ZR2 A;  1N36 O;  4LR3 A;  5JJN B;  3CRM A;  3D3I A;  3ZBH A;  5IDJ A;  4CC6 A;  1WP7 A;  5JH7 A;  1OCO B;  2KB1 A;  2QR4 A;  3OAA G;  1KU9 A;  3OW2 U;  2UU9 B;  4QE9 A;  1Y6X A;  2WA4 A;  2EIK B;  1AB3 A;  2E74 B;  2DE0 X;  1Q8I A;  1XMQ B;  2Q7G A;  1NTM H;  1UPG A;  1G4Y B;  2PGG A;  5A2Q N;  1K33 A;  3K03 A;  4QNH B;  3RGB A;  2XAJ A;  3T2M A;  1Y67 A;  4DV4 B;  4WFG A;  2X6C A;  2AZ0 A;  4EFE A;  3CCS V;  4K8Z A;  5IWA B;  1VQ8 V;  5EZY A;  5H9C A;  3H1J H;  3N2K B;  2EBO A;  2CH7 A;  4LF6 O;  4GX0 A;  3GVM A;  2QM7 A;  5LP6 B;  2ZIN A;  3CCM V;  1R6N A;  1JFF B;  3CRQ A;  4LF8 O;  4TV8 B;  3T4D A;  4OPH A;  3JAL A;  1V9P A;  2GSM B;  3CC4 V;  3I56 V;  4JI6 O;  2X7R B;  4PDR A;  4JI0 O;  1XIL A;  2Y4U A;  3KG2 A;  3CCR V;  5CBF A;  3N27 A;  4X1I B;  4JI2 O;  1RPR A;  4GKJ B;  4NVP A;  3BA9 A;  3M99 B;  4DR4 B;  2JIZ G;  4DR3 O;  3BFR A;  1QHT A;  4DUY O;  1V55 B;  3E22 A;  1IBL O;  3ZMZ A;  1S0V A;  3WB2 A;  3BCC H;  2L6L A;  1DF4 A;  1M5I A;  2GHY A;  1VF6 C;  2EX3 A;  1HNZ B;  3JAS A;  1FXK A;  1FPO A;  2HP8 A;  4NXM O;  2GDS A;  4WFA V;  1NQT A;  2W0X A;  1ZTE A;  1XOU A;  3JD4 A;  4LP8 A;  4RUE A;  3OTO B;  5CN0 A;  1M1K W;  4LFC O;  3X2Q B;  1JPX A;  1L0L H;  4PDM A;  4K35 A;  1WAZ A;  3SGI A;  2LW7 A;  2JRI A;  1XHX A;  4DRX A;  3OTF A;  2CGO A;  4DXW A;  5B1A B;  4CS4 A;  1MAB G;  3OEH G;  2ILM A;  3C3S A;  5LXT A;  4GLX A;  3CPW U;  2HHH O;  1GN3 A;  3W7T A;  4IGG A;  2QWP B;  1PL0 A;  3HPL C;  3RYF B;  1SRY A;  2IW5 A;  3H1L H;  3EVK A;  4PJ0 Z;  4FZ0 A;  1JOY A;  4JI5 O;  5FPR A;  2YS8 A;  4GX1 A;  4PA3 A;  5JCO C;  1H2N A;  4F6R A;  2XHB A;  2H8P C;  5LA6 A;  2NLJ C;  5FLX N;  4O4I A;  2WLK A;  3D36 A;  2LP7 A;  5A9G A;  4PA9 A;  4LH7 A;  1ZUQ A;  2ITD C;  3L74 H;  1S76 D;  4UCU A;  1GMG A;  3PJS K;  4DR2 O;  3RYI A;  3ZHT A;  4FM1 A;  1ZX3 A;  1JJO A;  2YID A;  1RSO A;  2Q0A A;  4X1K B;  1D5N A;  5D5Q A;  1ZL8 B;  4X20 B;  1NH2 D;  1JCH A;  4MTG A;  3CHX A;  4QJF B;  4UCS A;  4PI2 A;  4BR6 A;  1HNW B;  1Q6U A;  4ZOL B;  4J10 A;  1OJH A;  1BS3 A;  3UKM A;  3I55 V;  2QTO A;  5IYC O;  1HW7 A;  2E76 B;  4AI8 A;  3B4S A;  3ABL C;  2WA3 A;  2Z3Y A;  3U0Z A;  3DXR A;  5K1P A;  1PNM A;  4TWK A;  1QVG U;  3ETD A;  2IU3 A;  2EIM C;  4YIP A;  2DJV A;  4H33 A;  1AR5 A;  1H38 A;  3KKY A;  2RJZ A;  3IC9 A;  1Y76 A;  3MD0 A;  4DV0 O;  5LHI A;  4HAM A;  5CA0 B;  5JWP A;  2F4V B;  4J11 A;  2A79 B;  1RPO A;  2EIN B;  4KHP B;  2EJ7 A;  4QGP A;  1Q6I A;  1I94 O;  2QWN B;  3E8H A;  4I0X A;  1W0J G;  4WFH A;  1D2D A;  5CB4 B;  3QTC A;  3CE2 A;  1OHH G;  1ROP A;  1AJQ A;  2VS0 A;  2E3C A;  3K9A A;  3ZN0 A;  1W2B U;  2YXY A;  2WLM A;  3UT5 A;  2OCC B;  1K73 W;  5KX5 A;  4PV1 B;  3UO3 A;  4YY3 O;  2OYQ A;  4OGQ B;  4DW1 A;  2UXC O;  1HWY A;  4CZZ A;  4CH4 A;  1XHZ A;  3H1H H;  4DV6 O;  3MHH C;  1NTK H;  4DV7 B;  1R3L C;  2P4V A;  3A0R A;  4P9O A;  4DV5 B;  4X65 O;  1T5E A;  3J81 N;  2OCH A;  4MVZ A;  1WNS A;  5D5P A;  3DC6 A;  3JYC A;  4K0K B;  3FB7 C;  2DW4 A;  1BQZ A;  1FFX B;  4FFB B;  2ETN A;  4EFB A;  5JQG A;  4UVA A;  1AR1 B;  3S3W A;  1HR0 O;  5B5E Z;  2BTQ A;  5BY1 A;  4G27 B;  4H37 A;  4B3T B;  2QWQ B;  1UJW B;  2H3O A;  3STL C;  2QE7 G;  1DK1 A;  2R72 A;  2F23 A;  3ZRW B;  1K92 A;  4TV9 A;  5EC1 C;  5LMU B;  1YIJ V;  1XMO O;  2E75 B;  4IIJ A;  4O4L B;  1VQN V;  2ZNI A;  2MW2 B;  4LF9 O;  2NNU A;  1OCZ C;  3DTU B;  3E86 A;  4J80 A;  5LGU A;  3ZN1 A;  4DW0 A;  1SF9 A;  3T1Y O;  2QTS A;  3SDL A;  4ZBM A;  2UXD B;  5GON A;  4UCO A;  3CYO A;  3W7S A;  4ZIB A;  4O4H A;  3RVY A;  3HKD B;  3RYH B;  3JSN A;  4W4L A;  1TAE A;  5B1B C;  5ITZ A;  4JV5 B;  5CA1 B;  4MSW C;  2LFS A;  5BR8 O;  2AHY A;  1W59 A;  4TQD A;  1B04 A;  2JEU A;  3ZS8 C;  3QF7 A;  2JVD A;  3ZHR A;  5H2F Z;  5KHG A;  1JMK C;  2WLL A;  1SC5 B;  3K5L A;  5LOV B;  2UU9 O;  2WLN A;  2P67 A;  3A0B Z;  4MVQ A;  3F7V C;  1YZB A;  1KQS U;  5EYP B;  3R66 A;  3BRC A;  1Q86 W;  4BIO A;  2AHZ A;  2RDC A;  4J9Z B;  1NR1 A;  1R73 A;  5L3G A;  3HR0 A;  4JI4 O;  3G6E V;  1GN4 A;  5EIB D;  1GN6 A;  5IYZ B;  1QLE C;  1JA8 A;  2HFE C;  4X1Y A;  3CX5 F;  1FAF A;  4U3J A;  3JD1 A;  1N32 B;  2UUB O;  3NR7 A;  3JAK A;  4ZI7 B;  1M90 W;  2OWO A;  4XDJ A;  3CCL V;  1DLB A;  4LNU B;  4X9Q A;  1GO3 F;  2F43 G;  5CBH A;  3B40 A;  2Q73 A;  2GUZ A;  4X66 O;  2FL4 A;  3K08 A;  4FLY A;  3CD6 V;  3AG4 C;  5IYB O;  2JS3 A;  5IJ0 B;  1BZK A;  4U7O A;  5KA6 A;  4A5U B;  4MVM A;  1SQF A;  1WPB A;  4NXN O;  3AK2 A;  3D3Q A;  4NTW A;  5KLV H;  4DR5 O;  3CS5 A;  1O9H A;  2W0F C;  1HNX O;  4TSF G;  4DR4 O;  1PNL A;  1FXK C;  2A9H A;  1R3K C;  4WBN A;  3T4Z A;  3UO2 A;  2XAQ A;  1N8R W;  4LF4 B;  4NB5 A;  3UM7 A;  4CH6 A;  4DV1 B;  4DR1 O;  4RAI A;  2FTK A;  3CJH B;  3ETG A;  3L75 H;  3IGA C;  3ZHU A;  3OTO O;  1Q81 W;  2IJJ A;  4X62 O;  1SQQ H;  4YJ3 B;  5K1X A;  4Q20 A;  2GTS A;  2LO1 A;  2B5U A;  4WFF A;  3T1H B;  2N04 A;  4N23 A;  1I0H A;  1PKX A;  2FYU H;  3SJB C;  1OCR B;  2JGU A;  1K4C C;  3K5O A;  4ZHQ A;  1H2K A;  3ICX A;  1L1F A;  2QA4 V;  2V7Q G;  2R9A A;  4MT8 A;  1P7B A;  2PZS A;  3L9D A;  1TUB A;  2XND G;  2YEV B;  3ETE A;  3TGU H;  4I55 A;  3Q4H A;  2JJ2 G;  4MTO A;  3K79 A;  1BCC H;  3D36 C;  1WJZ A;  3AEI A;  3IAY A;  3RYC B;  2UUC B;  2WWW A;  4UV9 A;  1FXH A;  1FFT B;  3ETQ A;  3ZRS A;  5KMG A;  1ZLZ A;  4F4L A;  4MVR A;  1RM1 C;  3GWK C;  4UCV A;  5J2T A;  1Q43 A;  5DEC A;  3ASN B;  5IJ9 B;  1K3E A;  1H2G A;  2A0L A;  1NVP B;  3WU2 Z;  4GX5 A;  1AVM A;  3O9O A;  3A0H Z;  1U96 A;  2YIC A;  2QSA A;  4UB6 Z;  3E8F A;  2X6B A;  3JAR A;  4C7U A;  1GM8 A;  1NS1 A;  3QO7 A;  5LHH A;  1HNW O;  3B8M A;  4UCR A;  2X6A A;  1V54 C;  4X8A A;  1N33 O;  2LW1 A;  1YF2 A;  3FB8 C;  4X64 B;  3HKB A;  1SS3 A;  2LFR A;  4QPJ A;  1UFI A;  4IYH A;  1S72 V;  1N34 B;  1K9M W;  4RQE A;  1M56 C;  4WF9 V;  3K0G A;  2HLD G;  2KKW A;  1QCE A;  5FNV B;  1SET A;  2ZM6 B;  4I5S A;  3I5D A;  4PEL A;  3FB5 C;  3E8B A;  1R1B A;  1JJ2 U;  1X59 A;  4KHP O;  1NTZ H;  2QKA A;  1KYO F;  1CP9 A;  2FML A;  4JTC B;  3TK1 A;  1OCC B;  4GCZ A;  3K58 A;  1WB7 A;  4AQY B;  4TUY B;  1BMF G;  1LUW A;  5CB4 A;  2BSK A;  3OFN G;  3KZI Z;  3AG7 A;  3KCX A;  3T1C A;  2Y0I A;  4NTX A;  4I50 B;  1XNQ O;  1GM7 A;  2EIJ B;  3BEH A;  4LF7 B;  1R6T A;  3M8A A;  2Y69 C;  3ZHV A;  2VWK A;  1BT8 A;  2ZDI A;  3JAT B;  4W4K A;  1MZF A;  5L3F A;  4LFA B;  3CSX A;  3ABL B;  4FLZ A;  1XBL A;  1GAX A;  2DYS B;  1D5A A;  3VQV A;  2KG7 B;  2V4D A;  4MW3 A;  4PA7 A;  4FJC C;  2EIM B;  3APQ A;  2P22 C;  3IC7 A;  3HB3 B;  2QKC A;  3EFF K;  5LBQ A;  3QG5 A;  2WSS G;  2FB5 A;  4O2A B;  3AG1 C;  4LFB B;  4MVU A;  1EN6 A;  4B3T O;  2RCV A;  1E1R G;  3LDD A;  5DM6 V;  2WLI B;  2Z0A A;  2GV9 A;  4MVO A;  3FFQ A;  1XL4 A;  3CME V;  1Q90 D;  2QEX V;  2Y0P A;  4MS2 A;  1WN7 A;  2ADQ B;  1YXB A;  3TXQ A;  3N2G B;  4HNA A;  2N74 A;  4DV2 B;  2HVK C;  1AI5 A;  2YXH A;  1YJN V;  3OEE G;  4LCU C;  3FD9 A;  4LWS B;  2F1M A;  1P84 F;  1P4R A;  1AR4 A;  1OV9 A;  2ZXW B;  1VQ4 V;  1QU7 A;  1Z5V A;  4E2L A;  4I4T B;  1FJG O;  2ADP A;  2QWO B;  1AJP A;  3OM3 B;  5BZB A;  3HKD A;  3O65 A;  4FPP A;  5H6R A;  2IJK A;  3FX7 A;  5EC2 C;  1I7F A;  1SKV A;  1L8D A;  1LR1 A;  1TVK A;  1IBK B;  1URF A;  4JV5 O;  1GN2 A;  4U3F H;  3ZJZ A;  2YIB D;  1VAR A;  3ZRV A;  2HJF C;  1ZAU A;  1N0N A;  4FIP C;  5B3S C;  4I9W A;  1F7Y A;  4UB8 Z;  3JAW B;  2LJ2 A;  3K0D A;  2YI8 A;  4J42 A;  1NI8 A;  2EIK C;  3UQ8 A;  2XAG A;  2PYL A;  4YJ2 B;  1S5H C;  1IVS A;  3SR2 C;  1VQ6 V;  2KQX A;  1RFY A;  2UXB O;  1IXB A;  1VQP V;  2CTR A;  1B6Q A;  2QDO A;  4P2Z A;  5LOV A;  4JI8 B;  3CXH F;  4FM2 A;  2BTO A;  1FXV A;  4FK5 C;  3FB6 C;  3W7W A;  3HKC B;  2E5L B;  1AP5 A;  1VQ5 V;  5H6Q A;  4DR6 B;  2V1D A;  2JGD B;  4B3M B;  4AHC A;  4JYA O;  3SJQ C;  4O2B A;  5LGN A;  1F4N A;  4EB6 B;  4OX9 B;  3OD4 A;  2Q69 A;  1N36 B;  3RFR A;  1BGY H;  1QR9 A;  3OGI B;  1NT2 B;  2YDE A;  4X88 A;  1CEZ A;  5B1B B;  3ZHS A;  2WPD G;  5JH7 B;  4JAS A;  2O57 A;  2AXT Z;  2D2C B;  3L72 H;  4R7C A;  1J5E O;  1IBM B;  1Y66 A;  3KCY A;  5LHG A;  4Z1M G;  5IE9 A;  3CCE V;  4DV3 B;  1YTF D;  4NKG B;  2IH1 C;  1IUR A;  3ABK C;  1BL8 A;  2Q8V A;  2GBO A;  2CGN A;  4I7Z B;  1XNR O;  5JVD A;  1V55 C;  4RO2 A;  1HP8 A;  1JVM A;  1YSC A;  4LC1 A;  3FAV A;  1EN4 A;  1RP3 B;  5EZY B;  4QIW F;  5CBG A;  5CA3 A;  4K8X A;  3SJC C;  2B9Z A;  2EIL C;  2CH7 B;  4LF6 B;  2R9I A;  1QR8 A;  3THO A;  2F66 C;  5C8Y A;  4DV1 O;  1WA8 A;  2IJH A;  1A32 A;  2DWD C;  4FLU A;  4CH3 A;  3JAL B;  1S5J A;  2KSD A;  3AG4 B;  3SYA A;  1QBZ A;  1P7G A;  4JI7 B;  2IJI A;  1YCI A;  4KUM A;  4JI6 B;  3GB7 C;  4JI0 B;  3AG2 C;  5BMV B;  1Q7Y W;  2VQE B;  4Z1V A;  4IYI A;  3C90 A;  1QNM A;  1F4M A;  4H0L B;  4JI2 B;  2Q5Z A;  1K4D C;  4J9Y B;  1EN5 A;  1K8A W;  3L71 H;  3SPG A;  2YC0 A;  3FYI B;  1YTF B;  4DR3 B;  4UUJ C;  3E22 B;  5E1A C;  1Y74 A;  2RQ6 A;  1IBL B;  1GM9 A;  1I5X A;  3BY6 A;  4MVS A;  1QLN A;  3JAS B;  1FXK B;  2CDY A;  5L3B A;  1Y4M A;  1NJI W;  1E79 G;  4BW9 A;  3BPZ A;  4LFC B;  3VOU A;  4P9P A;  3WB0 A;  4DYL A;  1FS0 G;  4JAU A;  3STZ C;  1MG1 A;  2PI5 A;  5IT9 N;  3CB2 A;  2HG5 C;  2IM9 A;  2YIA A;  4FLX A;  1VF7 A;  1JX9 A;  2Q67 A;  2QJ1 A;  5LYJ A;  2AZ2 A;  5LXT B;  3CC7 V;  2YSU B;  5J2U B;  2OTJ V;  4O4J A;  1B3Q A;  4JGS A;  2Q4P A;  4NTY A;  4IHJ B;  2HEP A;  1KC8 W;  5KUM A;  3SYC A;  3GWO A;  1E1Q G;  4TQF A;  3HKE B;  4QE7 A;  4FZ1 A;  4DUZ B;  2VRZ A;  1XRE A;  3CCJ V;  4F6R B;  5C93 A;  3RT3 C;  4BIZ A;  5JJJ B;  5LA6 B;  1XMQ O;  4RUF A;  2EZP A;  5KHI A;  4B7E A;  4N21 A;  1MSW D;  4R50 A;  3RYI B;  2Q0O C;  4JI3 B;  2CTW A;  1DF5 A;  4DR2 B;  3P3N A;  4DV4 O;  3E2E A;  1K7D A;  1N0J A;  4QPK A;  1RSO B;  1PV0 A;  1MMM A;  1K97 A;  1K34 A;  4BW5 A;  3BAA A;  5IWA O;  3DC5 A;  4YHH B;  2K1E A;  3G67 A;  1Q6H A;  1BHA A;  4AQY O;  3ASO C;  2C2A A;  3N2K A;  2OCC C;  1WPX A;  4DK1 A;  3P32 A;  3OUF A;  2ZIO A;  2YXL A;  3DSQ A;  5EBW C;  1S5L Z;  2ZDI C;  1KP2 A;  2CE4 A;  2UXX A;  5LP6 A;  1JFF A;  2ZT9 B;  2DWE C;  4TV8 A;  1V54 B;  4KFM A;  1BE3 H;  1YJ9 V;  4LFA O;  4KL1 A;  1S3J A;  1SZT A;  1X4T A;  1CPY A;  1M56 B;  4WCE V;  1Y76 B;  3H01 A;  4GKJ O;  4X1I A;  4DV0 B;  3L73 H;  5L3E A;  1SA0 B;  1H8H G;  4B3R B;  4I0X B;  1I94 B;  2ARH A;  4B3S B;  3VBB A;  1NR7 A;  3LSU A;  4XBF A;  3OMN B;  5J9P C;  1HNZ O;  3ZHQ A;  1AIL A;  3SPH A;  1NVP D;  3CRA A;  3UT5 B;  1G8M A;  3ABM C;  3OR7 C;  4KXR A;  1XDC A;  5KX5 B;  1M57 C;  1XI1 A;  4YY3 B;  3JD2 A;  1KD1 W;  4L87 A;  1PP9 H;  4WFE A;  2UXC B;  3CEI A;  2YI9 A;  2W6I G;  4DV6 B;  1MSD A;  4UCT A;  3JAM N;  2ZE7 A;  1BSM A;  4RQF A;  2Q6A A;  2ZR3 A;  5HFM A;  5H5N A;  4JYY A;  4X65 B;  2HR3 A;  1XQ8 A;  3MHS C;  2LQT A;  3H9V A;  4FM0 A;  5JQG B;  1Q82 W;  3WG7 C;  2UUA B;  4CS3 A;  3RYF A;  1HR0 B;  3OT7 A;  2BTQ B;  1AI7 A;  3CC2 V;  3ZMT A;  3LNN A;  1SES A;  2QWR B;  2JK5 C;  3U11 A;  1VQO V;  2RNB A;  4TV9 B;  4B7K A;  3P30 A;  1WLE A;  4PA6 A;  3AG3 C;  1XMO B;  4LH6 A;  2M7W A;  4EKW A;  1QVF U;  2GTA A;  4LF5 B;  3OMA B;  4GYC B;  1NBM G;  1VQK V;  4LF9 B;  4D7S A;  3G80 A;  1K5S A;  2OIE A;  4R8C A;  2K9P A;  3A2F A;  2H94 A;  1MNG A;  2QKS A;  3B77 A;  4TT3 G;  1ENV A;  5GON B;  2E5L O;  4O4H B;  1H2L A;  1JQ0 A;  1IZ3 A;  1OZ0 A;  4X1K A;  4DR6 O;  1ZL8 A;  4X20 A;  4B3M O;  4J7Z A;  1LUV A;  1VMG A;  1Z2G A;  2QM8 A;  1VQM V;  1KUQ A;  5ITZ B;  2PI4 A;  4ZOL A;  4JYB A;  1AJN A;  5BR8 B;  3QVN A;  1YVW A;  3AK1 A;  2QM4 A;  1ORQ C;  1KKC A;  2DN9 A;  4MTF A;  3RW0 A;  3K04 A;  2PY5 A;  4E4E A;  2ATK C;  2WLL B;  3RN4 A;  4R6Z A;  5B3S B;  1IBM O;  2PYJ A;  2F4V O;  4DV3 O;  1VQ7 V;  5CA0 A;  5KAF Z;  2EZO A;  1J95 A;  2YIB A;  3TJT A;  4FVM A;  3W7X A;  3P3P A;  4CH5 A;  4JI4 B;  3K59 A;  5IY5 C;  5BXZ A;  4X1Y B;  4GKK B;  5KHH A;  4FLV A;  2A3Q A;  2Q9L A;  4JZ2 A;  3G71 V;  2MK3 A;  4U3J B;  4BAY A;  3JAK B;  1DTO A;  5EIB C;  2UUB B;  2XUM A;  1U97 A;  3K5N A;  2P90 A;  4DK0 A;  3ZCC A;  1FYJ A;  2W6J G;  1EZV H;  2GUZ B;  4CS2 A;  3D8C A;  4X66 B;  4XDK A;  4DV7 O;  2AGA A;  3OMI B;  4DV5 O;  3MDS A;  4JI1 B;  3G4S V;  3B8N A;  1AI6 A;  3LDC A;  4RWU A;  4YIO A;  4JI7 O;  3QNE A;  3IFX A;  2WLH A;  4K0K O;  1OCR C;  4NXN B;  1TGO A;  1WB8 A;  2JDI G;  4UV8 A;  1FFX A;  4FFB A;  2VQE O;  5BMV A;  4DR5 B;  3ABK B;  3SPI A;  3MAQ A;  3ZED A;  1HNX B;  4PA4 A;  3RBZ A;  3R65 A;  2B1G A;  1COW G;  4WBN B;  3ZRW A;  5KHK A;  3H1K H;  1ARO P;  5LMU O;  1NZ6 A;  3UCS C;  1P49 A;  5IYD O;  4OPA A;  2DYR C;  2Z5U A;  3WFV A;  1JR9 A;  2X0L A;  3QO8 A;  5KUK A;  2JJ1 G;  2ZE8 A;  4JPR A;  4O4L A;  1YI2 V;  1EM1 A;  4FMT A;  4H13 B;  4DR1 B;  4BWA A;  2EIL B;  3BHP A;  1HDJ A;  2Q7E A;  1KBH A;  5KHJ A;  2DOS A;  4X62 B;  3ASN C;  3E8G A;  4I9Q A;  2UXD O;  3CMA V;  3LDE A;  3CCQ V;  3WB1 A;  2ODM A; 
#chains in the Genus database with same CATH homology
 2FYU H;  1KYO F;  3H1J H;  1NTM H;  2BCC H;  1EZV H;  3L75 H;  4PD4 F;  1SQB H;  3CXH F;  3H1I H;  2A06 H;  3CX5 F;  1SQV H;  2IBZ H;  3L73 H;  1PPJ H;  1BGY H;  1P84 F;  4U3F H;  1SQQ H;  3TGU H;  3L70 H;  4D6T H;  3H1L H;  1NU1 H;  3H1H H;  1PP9 H;  3L72 H;  1BE3 H;  1NTK H;  3H1K H;  3L71 H;  1BCC H;  1SQP H;  1L0N H;  1SQX H;  1L0L H;  3L74 H;  3CWB H;  1NTZ H;  1KB9 F;  5KLV H;  3BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...