3TGUH

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3tguH00
1P84F 1SQPH 4PD4F 1NTKH 1KB9F 1NTZH 1PP9H 2FYUH 3CXHF 1PPJH 3H1JH 2A06H 1KYOF 3H1KH 4U3FH 1BCCH 1L0NH 1BGYH 1NU1H 3CX5F 1BE3H 3L73H 3L72H 5KLVH 1EZVH 3H1HH 3L74H 2IBZH 3H1IH 3L71H 1NTMH 3L75H 1SQXH 3TGUH 1SQVH 1SQBH 1SQQH 3CWBH 3L70H 3BCCH 1L0LH 2BCCH 3H1LH 4D6TH
chains in the Genus database with same CATH superfamily
2H3OA 4MTOA 1JJOA 3G67A 1KBHA 1KP2A 3R65A 2RDCA 3OAAG 4HAMA 1VQOV 4UUJC 2AHZA 1K7DA 1TUBB 4GX2A 2PI5A 1FXVA 4U3JB 2ODMA 4X62B 4ZHQA 2VQEO 3VQWA 5L3GA 1Y76A 5LGTA 4MTGA 4IIJB 3JD3A 2CTPA 3J81N 1IURA 4DV5O 1FPOA 5CB4B 4LH7A 4I5SA 3DC5A 3SPIA 5CB4A 1KMIZ 2YDEA 5DM6V 1R73A 2FKXA 4MVUA 4CBCA 1H38A 3OUFA 3CCMV 1XMQB 4QPJA 2E5LO 1HNZO 4JAAA 2P7TC 1SRYA 3QTCA 1JQ0A 2H8PC 2W6IG 2CK3G 3ZN1A 4YHHB 2WWWA 1BHBA 1GTOA 3JCZA 3A8TA 4JI5B 1P7BA 1CEZA 2ARHA 4DV3O 1NQTA 2PTMA 5B1NA 4K0KO 4X88A 3TETA 1F51A 2EILB 1M1KW 5GW7A 4JTAB 1JVMA 4PDLA 2P6JA 3H1JH 4WFEA 5L3BA 1S3JA 4DW1A 3JALA 2ITDC 3ASNC 2V7QG 3NXSA 2XAJA 3L75H 4AQYO 1WAZA 2QE7G 1M57B 3JD4A 1GMGA 5KHGA 3JALB 5JH7B 4CH6A 1S5JA 4LNUA 5B1BB 4UCVA 2N04A 4FIPC 5E1AC 3RW0A 1CPYA 4KHPO 2F66C 4LWSB 4X65O 2JRIA 3ZS8C 1GH6A 2IH3C 1VQ5V 2CTWA 2DWDC 1VIBA 2YI8A 4CC6A 3FAVB 1SQGA 1I08A 1YZBA 1BMFG 1PL0A 1V9PA 3SYCA 4DK0A 3ICXA 1Y6XA 2DW4A 5KHKA 1URFA 3UQ8A 4JI3O 4OX9B 4JI2O 4DXWA 3E35A 2UUBO 1Z2GA 5B66Z 3IFXA 4I4TB 4Q6GA 5B3SC 2BE3A 3Q4HB 1LNQA 1Y76B 5LGUA 4DYLA 2ZIOA 1VP7A 2HVKC 3H1HH 4KFMA 2ZE7A 2QDOA 1S76D 3JD2A 2JS3A 4LF6B 2ZKOA 1NZ6A 2OTLV 3BY6A 5J2UA 1NTKH 1EN4A 1TUEB 4B3RO 1IZ3A 3B8NA 3LDDA 1VQ9V 4LFAO 2W0FC 5J2UB 4FLTA 3K0DA 1ZL8A 1SQQH 1MABG 3N2GA 2YICA 2RNBA 4JV5B 3ASOC 1YCIA 1M56C 3HB3B 1W0KG 2JJ2G 3G6EV 3CCSV 1SA0A 3ABTA 5CBGA 4UCOA 4JI8O 1YTFD 4JI8B 2Q68A 4P9OA 1F23A 1PD3A 4LF9O 5EBLC 4ZHQB 1GM7A 3HKBA 1M90W 4J80A 1K3EA 1HWYA 1TAEA 1S72V 2EULA 3RVYA 4QE7A 4X1YB 5KHHA 2EIKC 1P49A 4WFBV 4D6TH 4JI1B 4ZI7A 2GHYA 2YIBD 4P30A 1IBLO 4PELA 4XBFA 1AJQA 3FB7C 5EZYA 4DUZO 2DQ0A 1OCRB 1XREA 3GB7C 3N2GB 1K33A 3ASOB 3J7AU 1SS3A 2PYJA 1SQVH 1BQ0A 4N21A 2FTKA 2VWJA 3BVOA 4I4TA 1CP9A 2DE0X 1R3IC 4JGSA 1DTOA 1QCEA 3K59A 1N36O 4O2AA 2LGQA 5BY1A 2XHBA 1K73W 1QQCA 5JQGB 2A3QA 1AP6A 2BOBC 4DK1A 2LJ2A 4UCRA 2VS0A 1QR8A 2PI4A 1IBKO 2DMXA 5KUKA 1SQBH 1L0LH 1OCCB 3QO7A 2X6BA 4RQEA 3H1LH 2X6CA 1QBZA 3ETQA 4JI6B 3AG3B 3G6BA 1K4DC 2HEPA 2WLNA 5H6RA 3KCXA 4L8JA 4LF9B 4JI1O 3FFQA 4LF8B 4ZI7B 3OTFA 2JK5C 2ZM6O 3TGUH 4TSFG 2Q4PA 3O9OA 3CWBH 1MOFA 2ZD9A 5H5NA 3WU2Z 4K8XA 2B5UA 4KHPB 2DYSC 2BTQB 1FJGO 4JAUA 1FD9A 4MVZA 3W7SA 4GCZA 2BTQA 1XMOB 4DR2B 4LF7O 1BS3A 4OPAA 5F2VO 4JAVA 1DF4A 4J7ZA 5CA1B 3TXSA 3APOA 2CH7B 4NTWA 1JX9A 4J41A 1G4YB 4JF3A 1YSCA 3BRCA 3ABMC 1Q8IA 2P06A 4W4LA 1KYOF 4JASA 5JVDB 3CRMA 5CA0B 3H1IH 4JV5O 2GTSA 3LUTB 3H9VA 2XASA 2AW9A 4DR2O 2QJ1A 4UCSA 2GUZB 4R8CA 2JJ1G 5LMUO 4G28B 1MG1A 5IYZA 1BGYH 1NU1H 3B77A 3LSSA 3T4ZA 3F7VC 2E3CA 2KG7A 2OIGA 1AI4A 4E2LA 2OCCB 2YI9A 1OCCC 3S3WA 2PYLA 2F93B 3FD9A 5K1XA 4DR7B 3QNEA 1VF5B 1SA0B 2CGOA 3KZIZ 3D3QA 5J2TA 1XNQB 2AHYA 5LMNB 2CTRA 4CS3A 1HDJA 2JVDA 2LW7A 3F7YC 1TVKB 1Q90D 5B5EZ 4K35A 2ITCC 3SR2C 5J2TB 2PZSA 2ADQB 2EX3A 4UVBA 2CUGA 1JMKC 5LYJA 4YXWG 5D5PA 2FYUH 5H2FZ 4RO2A 3OE7G 3RGBA 1W2BU 4KXRA 1HR0O 1IBLB 4JZ2A 5EC1C 2Y4TA 4X8AA 1KP3A 3OMNB 4PDVA 2OCCC 5IY5B 3SGIA 5J9PC 5EZYB 2IJHA 4PA9A 2P67A 3CCQV 3OW2U 4UFZA 2IH1C 3UO2A 1XDCA 3LDEA 1Q43A 1QU7A 2CH7A 5JCOA 4X66B 4JPRA 2BTOA 1N0NA 1Y74A 1WPXA 3JAWB 2P22C 2ZIMA 3M7MX 3EXAA 1P84F 4DR1B 4LF4B 3DXRB 4HNAA 2WLHA 1NS1A 3AG7A 1YDXA 4O4IB 1XL6A 2LQTA 1XL4A 3DXRA 1BE3H 2X0LA 3TK1A 4YJ2A 1M5IA 1GM9A 1QR9A 1MMMA 4Q20A 3VQYA 4PA7A 2IJKA 3TJTA 3FKSG 4JI0O 4Z1MG 2UUCB 3EVKA 2XT9A 3CRQA 1TGOA 4CH5A 2QWRB 1GN6A 4P9PA 3OUSA 3QF7A 2D2CB 2IW5A 3RYIA 2C2AA 1RSOA 4IYIA 4JI2B 1PNKA 2OT5A 5LOVB 1UPGA 2WLJA 1BHAA 4YJ3B 2LFRA 3ZCCA 4X1IB 4LBEC 4FFBB 1AR1B 1YIJV 1JFFA 4IHJB 2XTAA 5A2QN 3U11A 1M56B 4X1IA 1K5SA 3E89A 4OGQB 1NJIW 1Y67A 3L9DA 4D7TA 3L71H 1KU9A 3FX7A 5JJEB 3RYCA 3MDSA 4MSWC 4BWAA 2W6JG 2UXBB 2QWNB 1RFYA 5L3EA 1SZXA 4XDJA 2ZXWC 3BFRA 4NYKA 2OIEA 5FL7G 5ITZB 1ZUQA 3ABUA 5C93A 3K58A 3LDCA 3WG7C 2G38A 1G6UA 2EJRA 3CRAA 2HVJC 1N0JA 1Q7YW 3GVMA 4I55A 3JYCA 5JCOC 5LP6A 1LR1A 2F4VO 1K92A 5IYZB 2Q0AA 4J9YB 1K5QA 4QIWF 1VQMV 3ZMZA 1VARA 1X4TA 3P30A 4MS2A 3DC6A 2QGNA 2Y69B 3SJAC 1AI5A 1KC8W 1OJHA 5IY5C 1DF5A 4WFGA 1KQSU 3CMEV 4U7NA 1AVMA 1F4NA 2L35A 3E8HA 1R3JC 2ZR3A 1PL4A 4UV9A 4GKKB 2Q7GA 3P3NA 5GTHZ 4BR6A 4OXSA 1QNMA 2F4VB 2WLIB 2EJ7A 3CRRA 2UXBO 4XDLA 2X6AA 2F95B 4O2BA 4H33A 5LA6A 1JPXA 4PDMA 5IDJA 1QVGU 2WSSG 1Q6IA 1R1BA 4F6EA 3C90A 2LP7A 2A06H 4DV2O 5LP6C 1E79G 2HHHO 4I55B 4R6ZA 5KMGB 1XHXA 1V55C 1XNRO 4TT3G 3T2MA 4FFBA 2ZE8A 4DR5O 3AG4C 1I5YA 2QA4V 4FMTA 2UXDO 3E8FA 4PJ0Z 4QPKA 2LO1A 5FNVB 2N74A 2EIMC 3D36C 3ZMTA 1YJWV 2IJIA 1V54C 1RPOA 2FB5A 1OV9A 1G1XB 1RP3B 1QLNA 2OWOA 4FLYA 3K5LA 1ZX3A 4GX1A 4DUZB 2Q8VA 1SQXH 3E86A 5KX5A 4DV7B 2M7WA 1JOYA 4J7KA 3GWOA 5IJ9B 3APQA 4PI2A 4AHCA 2PGGA 2Q73A 1R6KA 1SZTA 2DYRC 2N05A 4UCTA 2XAQA 1NR7A 4MVRA 4CS4A 2XOKG 2ZNIA 3JARB 4NTYA 2B9ZA 1N33O 1NR1A 4X1KB 3ZMSA 1HNXO 3BHPA 1ORQC 4Z2WA 3BEHA 4FM1A 4OPHA 3W7WA 1K9MW 3D36A 4WFFA 4K0KB 1US6A 4DV4B 1N32O 4KUMA 1AI7A 1H2LA 4NXNB 4UVAA 4JTDB 4L87A 4I0XB 3N2KA 1WLEA 2HR3A 2P4KA 1D2DA 1FAFA 4YJ3A 5KAIZ 2ATKC 2EZOA 4FLUA 3C3TA 4TOIA 1ENVA 1TUBA 1SC5B 2WLIA 1XOUA 5C8YA 5BXZA 3FYEB 1PPJH 2KB1A 2ETNA 2NNUA 1GKFA 1OCZB 3I55V 2GV9A 5IJ9A 3HKCB 4LFCO 1HW7A 2K1EA 2QWPB 1D5NA 3E22A 3UT5A 1VQNV 2GDSA 5KMGA 3K9SA 4W4KA 2UXCO 3OD4A 3A0RA 3LSQA 1YEWA 4X64O 4FM0A 4KL1A 1IXMA 2QM4A 5JWPA 2FMLA 3CB2A 2ZM6B 1BCCH 3G71V 3AG2C 3I5DA 2R70A 3F5TA 4ZIBA 4WCEV 3M8AA 4UB6Z 3E83A 3K57A 2UXDB 1GN3A 3OEEG 3MAQA 1Y4MA 4U3JA 5EC2C 2R9AA 4JYYA 3OMIB 1UJWB 4K8ZA 1FS0G 4X62O 1FXKA 4O4LB 4MVMA 2YXLA 3PN1A 1W59A 1S5LZ 2Q67A 4B3SB 1F7YA 1IXBA 3D3IA 2Q0OC 3K03A 5DECA 2Q9LA 4JI4B 2RN9A 3JATB 5LMUB 2ADPA 4LFCB 4MW3A 3DTUB 4GX5A 4UV8A 4CS2A 2RQ6A 1K34A 4O2BB 4TV9B 4Z1VA 1M4UA 3HKCA 3BAAA 3NR7A 3X2QC 1WB8A 4DR1O 1FFXB 1NBMG 2YUAA 4X64B 1IVSA 1OCOB 2EIMB 4TV9A 3ZHQA 3W7UA 4HYOA 3N27A 5FPRA 1FFXA 4LF7B 3D8CA 1U96A 2Z0AA 1WA8A 4TUYA 4B7EA 4DR4O 3CC2V 3JD0A 2V4DA 1A32A 3ZJZA 2F23A 4TUYB 1WP7A 2DQ3A 1EN6A 1O9HA 4GKJO 4NXNO 2P5OA 2EBOA 3QVNA 4DV4O 4AILC 4X66O 5L3DA 1FXKB 3MD0A 4EEQA 4TV8A 2M6YA 1YJ9V 2WA4A 4PD4F 3A0BZ 1V55B 5BR8O 3FB8C 3KCYA 3WG7B 2ZQMA 3RFRA 1WJZA 4ABMA 4LFBB 3ZRWB 1FXKC 2XAHA 1ZLZA 3W7XA 1XMQO 1VQPV 2K9PA 2BOCC 4D7SA 1BZKA 3P32A 4DR5B 1ZL8B 1Q86W 1OCZC 1NH2D 1I94B 5HFLA 3ABLC 3CCVV 2UU9O 1JCHA 4UB8Z 4DV1B 3RVZA 3CCUV 5A9GA 1P7GA 1PM9A 2JGDA 2RCVA 1BSMA 1YTFB 4O2AB 1WA8B 1Y66A 2IJJA 4NR1A 3B4SA 4BIZA 2E74B 3A2FA 3ZIAG 1XILA 2HJFC 4JI4O 4I0XA 4X20A 1SF9A 4JI6O 4BIUA 5AG2A 4NVPA 1QLEC 2QWOB 4LF6O 2LFSA 3RWRD 1XNQO 2WLLB 1O9GA 2DOSA 3L74H 4E4EA 1AILA 3STZC 1AR4A 2YIAA 1WNSA 4LR3A 4FLVA 3ZBHA 1XHZA 4LWSA 1OZ0A 1XBLA 4PA3A 5JH7A 2HHHB 1B06A 2V1DA 2AXTZ 2AGAA 4AQYB 3E22B 4JYBA 3ZHSA 1T5EA 1JJ2U 2GSMB 4FK5C 2EIKB 4JI7B 5CA3A 4BIOA 1NI8A 2A79B 3OT7A 5IJ0B 3Q4HA 2IU3A 3ABKC 3CCEV 1FYJA 3CCRV 1DGSA 4DR3O 1HNXB 4BW9A 1LUVA 4U7OA 3VQXA 3CP1A 3T1YO 4YIOA 1X59A 3T1YB 2B1GA 1KKDA 5DN6G 2EIJB 4AI8A 2QKCA 4O4LA 3CYOA 3UM7A 4MW8A 1RPRA 1RM1B 2WLLA 2WLKA 1KECA 1SQPH 5B1AC 1XQ8A 2Q7HA 3JASA 4MT8A 4ZOLA 3OTOB 1L1FA 2A0LA 1SKVA 2QTSA 3W7TA 3U10A 1F4MA 1JA8A 1MZEA 3LNNA 3JSLA 3FYIB 4G2KA 2ZXWB 2VQFB 1KUQA 2JIZG 2UUAO 3LSUA 4HZ3A 1GN2A 4QGPA 1PP9H 4EKWA 4J11A 4B3MB 2YEVA 3G80A 1XEQA 1VEWA 2KKWA 1J95A 4X20B 4LF5O 1R3KC 1VMGA 2YEVB 5IE9A 1M9NA 3K08A 1MSWD 5JQGA 2GBOA 4FFKA 4J9ZB 3ZRSA 1S5HC 5LGNA 4F6RB 1TA8A 3ZRVA 1S0VA 2KQXA 2QM8A 3CEIA 2YIDA 3QO8A 1R6NA 3VBBA 4B08A 4JI3B 4OX9O 4PA6A 3ZHTA 4N23A 3QG5A 1GO3F 4RUEA 2ZE5A 4IIJA 3CRCA 4I9QA 3IC9A 1B04A 1AJPA 4MVQA 4FM2A 3B8MA 2BCCH 4GKKO 5CA0A 3JASB 4ZOLB 1I5XA 4GYCB 5CBFA 2UUCO 4JI0B 2RJZA 1MNGA 4NXMB 5E79Z 1YI2V 2D3OW 4DV0B 3DGEA 4PDRA 2NR5A 1GM8A 3JCUZ 1EBOA 4QJFB 3K3WA 5B1BC 2JGUA 4O4JB 5EYPB 1BT8A 3CPWU 1P4RA 4ZBMA 1MSDA 2YS8A 2GTAA 2HJDA 2JGDB 2OYQA 1SETA 4TQFA 5EIBD 4K3AA 5DEDA 4DO2A 4JI7O 5KLVH 5IYBO 2Z3YA 5KA6A 1H8EG 5CBHA 4YY3B 4F6RA 3RYFB 2CTQA 4LC1A 4UXNA 1FFTB 3K9AA 2HFEC 1Q6UA 1B6QA 3ETEA 3K06A 1THZA 5JJNB 3AK1A 2CAZC 1NTZH 1PKXA 2NLJC 2JS5A 4YIPA 3IC7A 2YXHA 1HNZB 3K79A 4X1YA 3L72H 4G27B 4DW0A 4LNUB 3AG3C 3A0HZ 3KG2A 3SYAA 3U0ZA 5LL6Y 4A5UB 2IU0A 3THOA 3AG4B 4ZKIA 3ZN0A 1Q3EA 3I56V 1EFRG 4GUNA 4LCUC 4O4HB 2ILMA 1DK1A 1NVPB 4GLXA 2E5LB 3FAVA 3R66A 3SJBC 4MVSA 1N4CA 1YHQV 1GAXA 3OGIB 1WN7A 2Q6AA 3JAMN 3CJHB 2JEXA 5B1AB 3IGAC 1VF6A 4B3SO 4DUYO 2EIJC 4RQFA 2F1MA 3G4SV 4DV1O 2OTJV 4J10A 3HKBB 5KAFZ 3ASNB 1I7FA 4TWKA 5CA1A 3LNMB 1U97A 3AEIA 1Z5WA 3JAKB 3BA9A 2NN4A 2ZDIC 2Y4UA 1HNWO 4J42A 1NTMH 4LH6A 3JAKA 3B40A 5EBWC 4GZRB 2ZDIA 3AK3A 1K8AW 3E8GA 5GTIZ 1JR9A 4EFBA 5BR8B 3K5MA 2PF4E 4FJCC 3H1KH 2B1IA 4UCUA 5IT9N 2HLDG 4O4JA 5EYPA 3WB2A 3OM3B 1S77D 1Q6HA 1H8HG 3ZMVA 1VF6C 1EZJA 1YITV 4GKJB 3RYIB 2ZINA 1VQ8V 1AB3A 1RSOB 2QWQB 1Y74B 4XDKA 4EFEA 3JAWA 4RUFA 2XUMA 4CC5A 4H37A 4NTXA 3SPJA 4WBNB 2VWKA 4WFHA 4NXMO 1L8DA 5L3CA 3MHSC 4F4LA 5LXTB 4H13B 1OHHG 4H0LB 4IT5A 5BMVB 1NH2B 1IBKB 5GONA 5LYJB 2Y0IA 4DV6B 4U3FH 1B3QA 3AG2B 3PJSK 4DV7O 2WPDG 4O4HA 3SPCA 4C7UA 3T1CA 2EILC 2YXYA 2VQEB 1ZAUA 5KHIA 3CC7V 2CE4A 5KUMA 2IM9A 4FVMA 5B1OA 1Q82W 2Y69C 1KB9F 5LOVA 1EM1A 1FKAO 2YC0A 4LF5B 3HKDB 2DJVA 3BA8A 3L73H 1Q81W 1EZVH 1QHTA 2Q7EA 5LBQA 5BZBA 2XNDG 2YIBA 3CSXA 5JVDA 4WBNA 3RYCB 4DV2B 2UUAB 4I50B 1TVKA 1MZFA 3BABA 3RYFA 5KA5A 4ICGA 2CGNA 4I50A 1N36B 2FL4A 4B3MO 1VQ7V 3STLC 5EK0A 5CN0A 2LGWA 5BMVA 2JDIG 4O4IA 1AJNA 3CC4V 3WB1A 1RM1C 2GUZA 3L70H 4DR7O 5GONB 3C3SA 1H2SB 2R72A 3AK2A 4JYAB 3E8BA 4IGGA 2PUSA 4JZGA 3J80N 2ZR2A 2E75B 1ROPA 3ZMUA 5LHGA 5FLXN 3F5WC 4DR3B 4ASUG 2XAGA 1Z5VA 4LP8A 1IX9A 4GX0A 3CJHA 3OEHG 4PA4A 3VOUA 1NKDA 2QSAA 3UO3A 2WA3A 1H2GA 4FPPA 1CXZB 2O57A 5FNVA 3ZHVA 3ABLB 1WP8A 3T1HO 4IHJA 1SESA 4MTXA 4B3RB 5IYCO 3UCSC 4HNAB 1PNLA 5IYDO 1EN5A 1R3LC 5ITZA 1E1QG 1VQLV 1YXBA 1BQZA 2AZ2A 2A7WA 1PV0A 4BW5A 1VQKV 1ZWIC 3OR6C 3B09A 4CH4A 4LF8O 1N34B 4B3TB 1COWG 3ABMB 2UXNA 3K5OA 4KP4A 4X9QA 1FJGB 2WLMA 1GRJA 1K4CC 1H2KA 3CHXA 4QNHB 5LMNO 2OCHA 1Q5OA 3HKDA 3JARA 2R9RB 4QE9A 1OCOC 2UXXA 3GWKC 2HG5C 5H9CA 2KG7B 3OR7C 3WFVA 1HNWB 1MA1A 2DYRB 3WB0A 4FLXA 3CD6V 2UU9B 5EBMC 2DWEC 2YSUB 2DYSB 1HP8A 2DN9A 3OFNG 3K04A 4CH3A 3UKMA 4PHZA 2AZ0A 2ZNJA 2H94A 4WF9V 4PI0A 4B3TO 1R6TA 2R9IA 1KD1W 2X7RB 3CXHF 5LXTA 1D5AA 2JEUA 2LW1A 2PY5A 1G8MA 3CS5A 1L0NH 5LA6B 2KSDA 2HP8A 3RT3C 1W0JG 4R50A 3SYOA 4GT1A 2P4VA 3ABKB 4IL6Z 3OMAB 4UVCA 1J5EB 1AP5A 1XNRB 4MTFA 5K1PA 1H2NA 3RYHA 1N34O 3AG1B 4X1KA 3SYPA 5H6QA 3VQVA 3SPGA 2UXCB 4X65B 3ZHUA 2EINB 2Y0PA 3RN4A 3ZX6A 3OTOO 1SQFA 3CCJV 3TCUA 1XMOO 3T1HB 3CCLV 3K5NA 4NB5A 4JTCB 1KKCA 5D5QA 1GN4A 3TXQA 1M57C 4CZZA 1E1RG 4JI5O 2Z5UA 1OCRC 1AR5A 5B3SB 4JYAO 3FB6C 4TQDA 1XI1A 4DR4B 5EIBC 1YVWA 1QLEB 3KKYA 2F43G 3BCCH 3EFFK 1N33B 3ZEDA 3SPHA 4FLZA 3ZHRA 2P90A 4FZ0A 4YJ2B 2L6LA 3P3PA 4DRXB 2VRZA 5FPOA 5KX5B 1IBMB 5TISZ 1N32B 3X2QB 4DRXA 1YJNV 3K0GA 1UFIA 4J7JA 2QEXV 3RYHB 2XAFA 2E76B 1WB7A 1HR0B 2CDYA 2UUBB 4RAIA 5CMUA 3O65A 1IDSA 4FZ1A 5JJJB 3S3XA 2BSKB 1AI6A 1LUWA 1NT2B 2MK3A 1WPBA 2EINC 2RMKB 3SJCC 3OGCC 5IWAB 1GK9A 2BSKA 2Q5ZA 4FLWA 3N2KB 3ZRXA 1FXHA 4P2ZA 1JFFB 3SJQC 1N8RW 3SDLA 4B7KA 3IAYA 3CMAV 4EB6B 4I7ZB 1BL8A 3HPLC 4DUYB 5IWAO 4DV6O 1VQ6V 4NKGB 3B2EE 4BAYA 3CXCU 3RBZA 1M93A 1VF7A 3QO5A 4TV8B 4EB6A 2VQFO 1V54B 1IBMO 1I94O 4HBNA 2HKOA 4RWUA 2W0XA 3CE2A 3HR0A 1H2MA 3JD1A 1PNMA 4LFBO 4H44B 2Y48A 4DR6O 4JYCA 1AROP 3ZRWA 3HKEA 5LP6B 1I0HA 2ZT9B 4I9WA 1VQ4V 1ZSPA 5IJ0A 3H01A 3IJ4A 5HFMA 3HKEB 1DLBA 4MVOA 4PV1B 3AG1C 2QTOA 4X89A 5LHIA 4DR6B 3EHBB 1QVFU 3E2EA 4LF4O 1SERA 4IYHA 5KHJA 3DSQA 3SYQA 1ZTEA 2MW2B 3ETGA 4R7CA 4YY3O 1K97A 2QR4A 3T4DA 2WAMA 5C8YB 3ETDA 4WFAV 2QM7A 2ZE6A 3ML0A 2QKAA 3MHHC 4DV5B 4DV3B 1NVPD 1XUQA 2Q69A 3FB5C 2EZPA 4YHHO 3JATA 3CX5F 3JSNA 2IBZH 2A9HA 2QKSA 3UT5B 4DV0O 5L3FA 4LFAB 3BPZA 5LHHA 1J5EO 1YF2A 3M99B 2ZCEA
chains in the Genus database with same CATH topology
1P84F 1SQPH 4PD4F 1NTKH 1KB9F 1NTZH 1PP9H 2FYUH 3CXHF 1PPJH 3H1JH 2A06H 1KYOF 3H1KH 4U3FH 1BCCH 1L0NH 1BGYH 1NU1H 3CX5F 1BE3H 3L73H 3L72H 5KLVH 1EZVH 3H1HH 3L74H 2IBZH 3H1IH 3L71H 1NTMH 3L75H 1SQXH 3TGUH 1SQVH 1SQBH 1SQQH 3CWBH 3L70H 3BCCH 1L0LH 2BCCH 3H1LH 4D6TH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  1SQP H;  4PD4 F;  1NTK H;  1KB9 F;  1NTZ H;  1PP9 H;  2FYU H;  3CXH F;  1PPJ H;  3H1J H;  2A06 H;  1KYO F;  3H1K H;  4U3F H;  1BCC H;  1L0N H;  1BGY H;  1NU1 H;  3CX5 F;  1BE3 H;  3L73 H;  3L72 H;  5KLV H;  1EZV H;  3H1H H;  3L74 H;  2IBZ H;  3H1I H;  3L71 H;  1NTM H;  3L75 H;  1SQX H;  3TGU H;  1SQV H;  1SQB H;  1SQQ H;  3CWB H;  3L70 H;  3BCC H;  1L0L H;  2BCC H;  3H1L H;  4D6T H; 
#chains in the Genus database with same CATH topology
 2H3O A;  4MTO A;  1JJO A;  3G67 A;  1KBH A;  1KP2 A;  3R65 A;  2RDC A;  3OAA G;  4HAM A;  1VQO V;  4UUJ C;  2AHZ A;  1K7D A;  1TUB B;  4GX2 A;  2PI5 A;  1FXV A;  4U3J B;  2ODM A;  4X62 B;  4ZHQ A;  2VQE O;  3VQW A;  5L3G A;  1Y76 A;  5LGT A;  4MTG A;  4IIJ B;  3JD3 A;  2CTP A;  3J81 N;  1IUR A;  4DV5 O;  1FPO A;  5CB4 B;  4LH7 A;  4I5S A;  3DC5 A;  3SPI A;  5CB4 A;  1KMI Z;  2YDE A;  5DM6 V;  1R73 A;  2FKX A;  4MVU A;  4CBC A;  1H38 A;  3OUF A;  3CCM V;  1XMQ B;  4QPJ A;  2E5L O;  1HNZ O;  4JAA A;  2P7T C;  1SRY A;  3QTC A;  1JQ0 A;  2H8P C;  2W6I G;  2CK3 G;  3ZN1 A;  4YHH B;  2WWW A;  1BHB A;  1GTO A;  3JCZ A;  3A8T A;  4JI5 B;  1P7B A;  1CEZ A;  2ARH A;  4DV3 O;  1NQT A;  2PTM A;  5B1N A;  4K0K O;  4X88 A;  3TET A;  1F51 A;  2EIL B;  1M1K W;  5GW7 A;  4JTA B;  1JVM A;  4PDL A;  2P6J A;  3H1J H;  4WFE A;  5L3B A;  1S3J A;  4DW1 A;  3JAL A;  2ITD C;  3ASN C;  2V7Q G;  3NXS A;  2XAJ A;  3L75 H;  4AQY O;  1WAZ A;  2QE7 G;  1M57 B;  3JD4 A;  1GMG A;  5KHG A;  3JAL B;  5JH7 B;  4CH6 A;  1S5J A;  4LNU A;  5B1B B;  4UCV A;  2N04 A;  4FIP C;  5E1A C;  3RW0 A;  1CPY A;  4KHP O;  2F66 C;  4LWS B;  4X65 O;  2JRI A;  3ZS8 C;  1GH6 A;  2IH3 C;  1VQ5 V;  2CTW A;  2DWD C;  1VIB A;  2YI8 A;  4CC6 A;  3FAV B;  1SQG A;  1I08 A;  1YZB A;  1BMF G;  1PL0 A;  1V9P A;  3SYC A;  4DK0 A;  3ICX A;  1Y6X A;  2DW4 A;  5KHK A;  1URF A;  3UQ8 A;  4JI3 O;  4OX9 B;  4JI2 O;  4DXW A;  3E35 A;  2UUB O;  1Z2G A;  5B66 Z;  3IFX A;  4I4T B;  4Q6G A;  5B3S C;  2BE3 A;  3Q4H B;  1LNQ A;  1Y76 B;  5LGU A;  4DYL A;  2ZIO A;  1VP7 A;  2HVK C;  3H1H H;  4KFM A;  2ZE7 A;  2QDO A;  1S76 D;  3JD2 A;  2JS3 A;  4LF6 B;  2ZKO A;  1NZ6 A;  2OTL V;  3BY6 A;  5J2U A;  1NTK H;  1EN4 A;  1TUE B;  4B3R O;  1IZ3 A;  3B8N A;  3LDD A;  1VQ9 V;  4LFA O;  2W0F C;  5J2U B;  4FLT A;  3K0D A;  1ZL8 A;  1SQQ H;  1MAB G;  3N2G A;  2YIC A;  2RNB A;  4JV5 B;  3ASO C;  1YCI A;  1M56 C;  3HB3 B;  1W0K G;  2JJ2 G;  3G6E V;  3CCS V;  1SA0 A;  3ABT A;  5CBG A;  4UCO A;  4JI8 O;  1YTF D;  4JI8 B;  2Q68 A;  4P9O A;  1F23 A;  1PD3 A;  4LF9 O;  5EBL C;  4ZHQ B;  1GM7 A;  3HKB A;  1M90 W;  4J80 A;  1K3E A;  1HWY A;  1TAE A;  1S72 V;  2EUL A;  3RVY A;  4QE7 A;  4X1Y B;  5KHH A;  2EIK C;  1P49 A;  4WFB V;  4D6T H;  4JI1 B;  4ZI7 A;  2GHY A;  2YIB D;  4P30 A;  1IBL O;  4PEL A;  4XBF A;  1AJQ A;  3FB7 C;  5EZY A;  4DUZ O;  2DQ0 A;  1OCR B;  1XRE A;  3GB7 C;  3N2G B;  1K33 A;  3ASO B;  3J7A U;  1SS3 A;  2PYJ A;  1SQV H;  1BQ0 A;  4N21 A;  2FTK A;  2VWJ A;  3BVO A;  4I4T A;  1CP9 A;  2DE0 X;  1R3I C;  4JGS A;  1DTO A;  1QCE A;  3K59 A;  1N36 O;  4O2A A;  2LGQ A;  5BY1 A;  2XHB A;  1K73 W;  1QQC A;  5JQG B;  2A3Q A;  1AP6 A;  2BOB C;  4DK1 A;  2LJ2 A;  4UCR A;  2VS0 A;  1QR8 A;  2PI4 A;  1IBK O;  2DMX A;  5KUK A;  1SQB H;  1L0L H;  1OCC B;  3QO7 A;  2X6B A;  4RQE A;  3H1L H;  2X6C A;  1QBZ A;  3ETQ A;  4JI6 B;  3AG3 B;  3G6B A;  1K4D C;  2HEP A;  2WLN A;  5H6R A;  3KCX A;  4L8J A;  4LF9 B;  4JI1 O;  3FFQ A;  4LF8 B;  4ZI7 B;  3OTF A;  2JK5 C;  2ZM6 O;  3TGU H;  4TSF G;  2Q4P A;  3O9O A;  3CWB H;  1MOF A;  2ZD9 A;  5H5N A;  3WU2 Z;  4K8X A;  2B5U A;  4KHP B;  2DYS C;  2BTQ B;  1FJG O;  4JAU A;  1FD9 A;  4MVZ A;  3W7S A;  4GCZ A;  2BTQ A;  1XMO B;  4DR2 B;  4LF7 O;  1BS3 A;  4OPA A;  5F2V O;  4JAV A;  1DF4 A;  4J7Z A;  5CA1 B;  3TXS A;  3APO A;  2CH7 B;  4NTW A;  1JX9 A;  4J41 A;  1G4Y B;  4JF3 A;  1YSC A;  3BRC A;  3ABM C;  1Q8I A;  2P06 A;  4W4L A;  1KYO F;  4JAS A;  5JVD B;  3CRM A;  5CA0 B;  3H1I H;  4JV5 O;  2GTS A;  3LUT B;  3H9V A;  2XAS A;  2AW9 A;  4DR2 O;  2QJ1 A;  4UCS A;  2GUZ B;  4R8C A;  2JJ1 G;  5LMU O;  4G28 B;  1MG1 A;  5IYZ A;  1BGY H;  1NU1 H;  3B77 A;  3LSS A;  3T4Z A;  3F7V C;  2E3C A;  2KG7 A;  2OIG A;  1AI4 A;  4E2L A;  2OCC B;  2YI9 A;  1OCC C;  3S3W A;  2PYL A;  2F93 B;  3FD9 A;  5K1X A;  4DR7 B;  3QNE A;  1VF5 B;  1SA0 B;  2CGO A;  3KZI Z;  3D3Q A;  5J2T A;  1XNQ B;  2AHY A;  5LMN B;  2CTR A;  4CS3 A;  1HDJ A;  2JVD A;  2LW7 A;  3F7Y C;  1TVK B;  1Q90 D;  5B5E Z;  4K35 A;  2ITC C;  3SR2 C;  5J2T B;  2PZS A;  2ADQ B;  2EX3 A;  4UVB A;  2CUG A;  1JMK C;  5LYJ A;  4YXW G;  5D5P A;  2FYU H;  5H2F Z;  4RO2 A;  3OE7 G;  3RGB A;  1W2B U;  4KXR A;  1HR0 O;  1IBL B;  4JZ2 A;  5EC1 C;  2Y4T A;  4X8A A;  1KP3 A;  3OMN B;  4PDV A;  2OCC C;  5IY5 B;  3SGI A;  5J9P C;  5EZY B;  2IJH A;  4PA9 A;  2P67 A;  3CCQ V;  3OW2 U;  4UFZ A;  2IH1 C;  3UO2 A;  1XDC A;  3LDE A;  1Q43 A;  1QU7 A;  2CH7 A;  5JCO A;  4X66 B;  4JPR A;  2BTO A;  1N0N A;  1Y74 A;  1WPX A;  3JAW B;  2P22 C;  2ZIM A;  3M7M X;  3EXA A;  1P84 F;  4DR1 B;  4LF4 B;  3DXR B;  4HNA A;  2WLH A;  1NS1 A;  3AG7 A;  1YDX A;  4O4I B;  1XL6 A;  2LQT A;  1XL4 A;  3DXR A;  1BE3 H;  2X0L A;  3TK1 A;  4YJ2 A;  1M5I A;  1GM9 A;  1QR9 A;  1MMM A;  4Q20 A;  3VQY A;  4PA7 A;  2IJK A;  3TJT A;  3FKS G;  4JI0 O;  4Z1M G;  2UUC B;  3EVK A;  2XT9 A;  3CRQ A;  1TGO A;  4CH5 A;  2QWR B;  1GN6 A;  4P9P A;  3OUS A;  3QF7 A;  2D2C B;  2IW5 A;  3RYI A;  2C2A A;  1RSO A;  4IYI A;  4JI2 B;  1PNK A;  2OT5 A;  5LOV B;  1UPG A;  2WLJ A;  1BHA A;  4YJ3 B;  2LFR A;  3ZCC A;  4X1I B;  4LBE C;  4FFB B;  1AR1 B;  1YIJ V;  1JFF A;  4IHJ B;  2XTA A;  5A2Q N;  3U11 A;  1M56 B;  4X1I A;  1K5S A;  3E89 A;  4OGQ B;  1NJI W;  1Y67 A;  3L9D A;  4D7T A;  3L71 H;  1KU9 A;  3FX7 A;  5JJE B;  3RYC A;  3MDS A;  4MSW C;  4BWA A;  2W6J G;  2UXB B;  2QWN B;  1RFY A;  5L3E A;  1SZX A;  4XDJ A;  2ZXW C;  3BFR A;  4NYK A;  2OIE A;  5FL7 G;  5ITZ B;  1ZUQ A;  3ABU A;  5C93 A;  3K58 A;  3LDC A;  3WG7 C;  2G38 A;  1G6U A;  2EJR A;  3CRA A;  2HVJ C;  1N0J A;  1Q7Y W;  3GVM A;  4I55 A;  3JYC A;  5JCO C;  5LP6 A;  1LR1 A;  2F4V O;  1K92 A;  5IYZ B;  2Q0A A;  4J9Y B;  1K5Q A;  4QIW F;  1VQM V;  3ZMZ A;  1VAR A;  1X4T A;  3P30 A;  4MS2 A;  3DC6 A;  2QGN A;  2Y69 B;  3SJA C;  1AI5 A;  1KC8 W;  1OJH A;  5IY5 C;  1DF5 A;  4WFG A;  1KQS U;  3CME V;  4U7N A;  1AVM A;  1F4N A;  2L35 A;  3E8H A;  1R3J C;  2ZR3 A;  1PL4 A;  4UV9 A;  4GKK B;  2Q7G A;  3P3N A;  5GTH Z;  4BR6 A;  4OXS A;  1QNM A;  2F4V B;  2WLI B;  2EJ7 A;  3CRR A;  2UXB O;  4XDL A;  2X6A A;  2F95 B;  4O2B A;  4H33 A;  5LA6 A;  1JPX A;  4PDM A;  5IDJ A;  1QVG U;  2WSS G;  1Q6I A;  1R1B A;  4F6E A;  3C90 A;  2LP7 A;  2A06 H;  4DV2 O;  5LP6 C;  1E79 G;  2HHH O;  4I55 B;  4R6Z A;  5KMG B;  1XHX A;  1V55 C;  1XNR O;  4TT3 G;  3T2M A;  4FFB A;  2ZE8 A;  4DR5 O;  3AG4 C;  1I5Y A;  2QA4 V;  4FMT A;  2UXD O;  3E8F A;  4PJ0 Z;  4QPK A;  2LO1 A;  5FNV B;  2N74 A;  2EIM C;  3D36 C;  3ZMT A;  1YJW V;  2IJI A;  1V54 C;  1RPO A;  2FB5 A;  1OV9 A;  1G1X B;  1RP3 B;  1QLN A;  2OWO A;  4FLY A;  3K5L A;  1ZX3 A;  4GX1 A;  4DUZ B;  2Q8V A;  1SQX H;  3E86 A;  5KX5 A;  4DV7 B;  2M7W A;  1JOY A;  4J7K A;  3GWO A;  5IJ9 B;  3APQ A;  4PI2 A;  4AHC A;  2PGG A;  2Q73 A;  1R6K A;  1SZT A;  2DYR C;  2N05 A;  4UCT A;  2XAQ A;  1NR7 A;  4MVR A;  4CS4 A;  2XOK G;  2ZNI A;  3JAR B;  4NTY A;  2B9Z A;  1N33 O;  1NR1 A;  4X1K B;  3ZMS A;  1HNX O;  3BHP A;  1ORQ C;  4Z2W A;  3BEH A;  4FM1 A;  4OPH A;  3W7W A;  1K9M W;  3D36 A;  4WFF A;  4K0K B;  1US6 A;  4DV4 B;  1N32 O;  4KUM A;  1AI7 A;  1H2L A;  4NXN B;  4UVA A;  4JTD B;  4L87 A;  4I0X B;  3N2K A;  1WLE A;  2HR3 A;  2P4K A;  1D2D A;  1FAF A;  4YJ3 A;  5KAI Z;  2ATK C;  2EZO A;  4FLU A;  3C3T A;  4TOI A;  1ENV A;  1TUB A;  1SC5 B;  2WLI A;  1XOU A;  5C8Y A;  5BXZ A;  3FYE B;  1PPJ H;  2KB1 A;  2ETN A;  2NNU A;  1GKF A;  1OCZ B;  3I55 V;  2GV9 A;  5IJ9 A;  3HKC B;  4LFC O;  1HW7 A;  2K1E A;  2QWP B;  1D5N A;  3E22 A;  3UT5 A;  1VQN V;  2GDS A;  5KMG A;  3K9S A;  4W4K A;  2UXC O;  3OD4 A;  3A0R A;  3LSQ A;  1YEW A;  4X64 O;  4FM0 A;  4KL1 A;  1IXM A;  2QM4 A;  5JWP A;  2FML A;  3CB2 A;  2ZM6 B;  1BCC H;  3G71 V;  3AG2 C;  3I5D A;  2R70 A;  3F5T A;  4ZIB A;  4WCE V;  3M8A A;  4UB6 Z;  3E83 A;  3K57 A;  2UXD B;  1GN3 A;  3OEE G;  3MAQ A;  1Y4M A;  4U3J A;  5EC2 C;  2R9A A;  4JYY A;  3OMI B;  1UJW B;  4K8Z A;  1FS0 G;  4X62 O;  1FXK A;  4O4L B;  4MVM A;  2YXL A;  3PN1 A;  1W59 A;  1S5L Z;  2Q67 A;  4B3S B;  1F7Y A;  1IXB A;  3D3I A;  2Q0O C;  3K03 A;  5DEC A;  2Q9L A;  4JI4 B;  2RN9 A;  3JAT B;  5LMU B;  2ADP A;  4LFC B;  4MW3 A;  3DTU B;  4GX5 A;  4UV8 A;  4CS2 A;  2RQ6 A;  1K34 A;  4O2B B;  4TV9 B;  4Z1V A;  1M4U A;  3HKC A;  3BAA A;  3NR7 A;  3X2Q C;  1WB8 A;  4DR1 O;  1FFX B;  1NBM G;  2YUA A;  4X64 B;  1IVS A;  1OCO B;  2EIM B;  4TV9 A;  3ZHQ A;  3W7U A;  4HYO A;  3N27 A;  5FPR A;  1FFX A;  4LF7 B;  3D8C A;  1U96 A;  2Z0A A;  1WA8 A;  4TUY A;  4B7E A;  4DR4 O;  3CC2 V;  3JD0 A;  2V4D A;  1A32 A;  3ZJZ A;  2F23 A;  4TUY B;  1WP7 A;  2DQ3 A;  1EN6 A;  1O9H A;  4GKJ O;  4NXN O;  2P5O A;  2EBO A;  3QVN A;  4DV4 O;  4AIL C;  4X66 O;  5L3D A;  1FXK B;  3MD0 A;  4EEQ A;  4TV8 A;  2M6Y A;  1YJ9 V;  2WA4 A;  4PD4 F;  3A0B Z;  1V55 B;  5BR8 O;  3FB8 C;  3KCY A;  3WG7 B;  2ZQM A;  3RFR A;  1WJZ A;  4ABM A;  4LFB B;  3ZRW B;  1FXK C;  2XAH A;  1ZLZ A;  3W7X A;  1XMQ O;  1VQP V;  2K9P A;  2BOC C;  4D7S A;  1BZK A;  3P32 A;  4DR5 B;  1ZL8 B;  1Q86 W;  1OCZ C;  1NH2 D;  1I94 B;  5HFL A;  3ABL C;  3CCV V;  2UU9 O;  1JCH A;  4UB8 Z;  4DV1 B;  3RVZ A;  3CCU V;  5A9G A;  1P7G A;  1PM9 A;  2JGD A;  2RCV A;  1BSM A;  1YTF B;  4O2A B;  1WA8 B;  1Y66 A;  2IJJ A;  4NR1 A;  3B4S A;  4BIZ A;  2E74 B;  3A2F A;  3ZIA G;  1XIL A;  2HJF C;  4JI4 O;  4I0X A;  4X20 A;  1SF9 A;  4JI6 O;  4BIU A;  5AG2 A;  4NVP A;  1QLE C;  2QWO B;  4LF6 O;  2LFS A;  3RWR D;  1XNQ O;  2WLL B;  1O9G A;  2DOS A;  3L74 H;  4E4E A;  1AIL A;  3STZ C;  1AR4 A;  2YIA A;  1WNS A;  4LR3 A;  4FLV A;  3ZBH A;  1XHZ A;  4LWS A;  1OZ0 A;  1XBL A;  4PA3 A;  5JH7 A;  2HHH B;  1B06 A;  2V1D A;  2AXT Z;  2AGA A;  4AQY B;  3E22 B;  4JYB A;  3ZHS A;  1T5E A;  1JJ2 U;  2GSM B;  4FK5 C;  2EIK B;  4JI7 B;  5CA3 A;  4BIO A;  1NI8 A;  2A79 B;  3OT7 A;  5IJ0 B;  3Q4H A;  2IU3 A;  3ABK C;  3CCE V;  1FYJ A;  3CCR V;  1DGS A;  4DR3 O;  1HNX B;  4BW9 A;  1LUV A;  4U7O A;  3VQX A;  3CP1 A;  3T1Y O;  4YIO A;  1X59 A;  3T1Y B;  2B1G A;  1KKD A;  5DN6 G;  2EIJ B;  4AI8 A;  2QKC A;  4O4L A;  3CYO A;  3UM7 A;  4MW8 A;  1RPR A;  1RM1 B;  2WLL A;  2WLK A;  1KEC A;  1SQP H;  5B1A C;  1XQ8 A;  2Q7H A;  3JAS A;  4MT8 A;  4ZOL A;  3OTO B;  1L1F A;  2A0L A;  1SKV A;  2QTS A;  3W7T A;  3U10 A;  1F4M A;  1JA8 A;  1MZE A;  3LNN A;  3JSL A;  3FYI B;  4G2K A;  2ZXW B;  2VQF B;  1KUQ A;  2JIZ G;  2UUA O;  3LSU A;  4HZ3 A;  1GN2 A;  4QGP A;  1PP9 H;  4EKW A;  4J11 A;  4B3M B;  2YEV A;  3G80 A;  1XEQ A;  1VEW A;  2KKW A;  1J95 A;  4X20 B;  4LF5 O;  1R3K C;  1VMG A;  2YEV B;  5IE9 A;  1M9N A;  3K08 A;  1MSW D;  5JQG A;  2GBO A;  4FFK A;  4J9Z B;  3ZRS A;  1S5H C;  5LGN A;  4F6R B;  1TA8 A;  3ZRV A;  1S0V A;  2KQX A;  2QM8 A;  3CEI A;  2YID A;  3QO8 A;  1R6N A;  3VBB A;  4B08 A;  4JI3 B;  4OX9 O;  4PA6 A;  3ZHT A;  4N23 A;  3QG5 A;  1GO3 F;  4RUE A;  2ZE5 A;  4IIJ A;  3CRC A;  4I9Q A;  3IC9 A;  1B04 A;  1AJP A;  4MVQ A;  4FM2 A;  3B8M A;  2BCC H;  4GKK O;  5CA0 A;  3JAS B;  4ZOL B;  1I5X A;  4GYC B;  5CBF A;  2UUC O;  4JI0 B;  2RJZ A;  1MNG A;  4NXM B;  5E79 Z;  1YI2 V;  2D3O W;  4DV0 B;  3DGE A;  4PDR A;  2NR5 A;  1GM8 A;  3JCU Z;  1EBO A;  4QJF B;  3K3W A;  5B1B C;  2JGU A;  4O4J B;  5EYP B;  1BT8 A;  3CPW U;  1P4R A;  4ZBM A;  1MSD A;  2YS8 A;  2GTA A;  2HJD A;  2JGD B;  2OYQ A;  1SET A;  4TQF A;  5EIB D;  4K3A A;  5DED A;  4DO2 A;  4JI7 O;  5KLV H;  5IYB O;  2Z3Y A;  5KA6 A;  1H8E G;  5CBH A;  4YY3 B;  4F6R A;  3RYF B;  2CTQ A;  4LC1 A;  4UXN A;  1FFT B;  3K9A A;  2HFE C;  1Q6U A;  1B6Q A;  3ETE A;  3K06 A;  1THZ A;  5JJN B;  3AK1 A;  2CAZ C;  1NTZ H;  1PKX A;  2NLJ C;  2JS5 A;  4YIP A;  3IC7 A;  2YXH A;  1HNZ B;  3K79 A;  4X1Y A;  3L72 H;  4G27 B;  4DW0 A;  4LNU B;  3AG3 C;  3A0H Z;  3KG2 A;  3SYA A;  3U0Z A;  5LL6 Y;  4A5U B;  2IU0 A;  3THO A;  3AG4 B;  4ZKI A;  3ZN0 A;  1Q3E A;  3I56 V;  1EFR G;  4GUN A;  4LCU C;  4O4H B;  2ILM A;  1DK1 A;  1NVP B;  4GLX A;  2E5L B;  3FAV A;  3R66 A;  3SJB C;  4MVS A;  1N4C A;  1YHQ V;  1GAX A;  3OGI B;  1WN7 A;  2Q6A A;  3JAM N;  3CJH B;  2JEX A;  5B1A B;  3IGA C;  1VF6 A;  4B3S O;  4DUY O;  2EIJ C;  4RQF A;  2F1M A;  3G4S V;  4DV1 O;  2OTJ V;  4J10 A;  3HKB B;  5KAF Z;  3ASN B;  1I7F A;  4TWK A;  5CA1 A;  3LNM B;  1U97 A;  3AEI A;  1Z5W A;  3JAK B;  3BA9 A;  2NN4 A;  2ZDI C;  2Y4U A;  1HNW O;  4J42 A;  1NTM H;  4LH6 A;  3JAK A;  3B40 A;  5EBW C;  4GZR B;  2ZDI A;  3AK3 A;  1K8A W;  3E8G A;  5GTI Z;  1JR9 A;  4EFB A;  5BR8 B;  3K5M A;  2PF4 E;  4FJC C;  3H1K H;  2B1I A;  4UCU A;  5IT9 N;  2HLD G;  4O4J A;  5EYP A;  3WB2 A;  3OM3 B;  1S77 D;  1Q6H A;  1H8H G;  3ZMV A;  1VF6 C;  1EZJ A;  1YIT V;  4GKJ B;  3RYI B;  2ZIN A;  1VQ8 V;  1AB3 A;  1RSO B;  2QWQ B;  1Y74 B;  4XDK A;  4EFE A;  3JAW A;  4RUF A;  2XUM A;  4CC5 A;  4H37 A;  4NTX A;  3SPJ A;  4WBN B;  2VWK A;  4WFH A;  4NXM O;  1L8D A;  5L3C A;  3MHS C;  4F4L A;  5LXT B;  4H13 B;  1OHH G;  4H0L B;  4IT5 A;  5BMV B;  1NH2 B;  1IBK B;  5GON A;  5LYJ B;  2Y0I A;  4DV6 B;  4U3F H;  1B3Q A;  3AG2 B;  3PJS K;  4DV7 O;  2WPD G;  4O4H A;  3SPC A;  4C7U A;  3T1C A;  2EIL C;  2YXY A;  2VQE B;  1ZAU A;  5KHI A;  3CC7 V;  2CE4 A;  5KUM A;  2IM9 A;  4FVM A;  5B1O A;  1Q82 W;  2Y69 C;  1KB9 F;  5LOV A;  1EM1 A;  1FKA O;  2YC0 A;  4LF5 B;  3HKD B;  2DJV A;  3BA8 A;  3L73 H;  1Q81 W;  1EZV H;  1QHT A;  2Q7E A;  5LBQ A;  5BZB A;  2XND G;  2YIB A;  3CSX A;  5JVD A;  4WBN A;  3RYC B;  4DV2 B;  2UUA B;  4I50 B;  1TVK A;  1MZF A;  3BAB A;  3RYF A;  5KA5 A;  4ICG A;  2CGN A;  4I50 A;  1N36 B;  2FL4 A;  4B3M O;  1VQ7 V;  3STL C;  5EK0 A;  5CN0 A;  2LGW A;  5BMV A;  2JDI G;  4O4I A;  1AJN A;  3CC4 V;  3WB1 A;  1RM1 C;  2GUZ A;  3L70 H;  4DR7 O;  5GON B;  3C3S A;  1H2S B;  2R72 A;  3AK2 A;  4JYA B;  3E8B A;  4IGG A;  2PUS A;  4JZG A;  3J80 N;  2ZR2 A;  2E75 B;  1ROP A;  3ZMU A;  5LHG A;  5FLX N;  3F5W C;  4DR3 B;  4ASU G;  2XAG A;  1Z5V A;  4LP8 A;  1IX9 A;  4GX0 A;  3CJH A;  3OEH G;  4PA4 A;  3VOU A;  1NKD A;  2QSA A;  3UO3 A;  2WA3 A;  1H2G A;  4FPP A;  1CXZ B;  2O57 A;  5FNV A;  3ZHV A;  3ABL B;  1WP8 A;  3T1H O;  4IHJ A;  1SES A;  4MTX A;  4B3R B;  5IYC O;  3UCS C;  4HNA B;  1PNL A;  5IYD O;  1EN5 A;  1R3L C;  5ITZ A;  1E1Q G;  1VQL V;  1YXB A;  1BQZ A;  2AZ2 A;  2A7W A;  1PV0 A;  4BW5 A;  1VQK V;  1ZWI C;  3OR6 C;  3B09 A;  4CH4 A;  4LF8 O;  1N34 B;  4B3T B;  1COW G;  3ABM B;  2UXN A;  3K5O A;  4KP4 A;  4X9Q A;  1FJG B;  2WLM A;  1GRJ A;  1K4C C;  1H2K A;  3CHX A;  4QNH B;  5LMN O;  2OCH A;  1Q5O A;  3HKD A;  3JAR A;  2R9R B;  4QE9 A;  1OCO C;  2UXX A;  3GWK C;  2HG5 C;  5H9C A;  2KG7 B;  3OR7 C;  3WFV A;  1HNW B;  1MA1 A;  2DYR B;  3WB0 A;  4FLX A;  3CD6 V;  2UU9 B;  5EBM C;  2DWE C;  2YSU B;  2DYS B;  1HP8 A;  2DN9 A;  3OFN G;  3K04 A;  4CH3 A;  3UKM A;  4PHZ A;  2AZ0 A;  2ZNJ A;  2H94 A;  4WF9 V;  4PI0 A;  4B3T O;  1R6T A;  2R9I A;  1KD1 W;  2X7R B;  3CXH F;  5LXT A;  1D5A A;  2JEU A;  2LW1 A;  2PY5 A;  1G8M A;  3CS5 A;  1L0N H;  5LA6 B;  2KSD A;  2HP8 A;  3RT3 C;  1W0J G;  4R50 A;  3SYO A;  4GT1 A;  2P4V A;  3ABK B;  4IL6 Z;  3OMA B;  4UVC A;  1J5E B;  1AP5 A;  1XNR B;  4MTF A;  5K1P A;  1H2N A;  3RYH A;  1N34 O;  3AG1 B;  4X1K A;  3SYP A;  5H6Q A;  3VQV A;  3SPG A;  2UXC B;  4X65 B;  3ZHU A;  2EIN B;  2Y0P A;  3RN4 A;  3ZX6 A;  3OTO O;  1SQF A;  3CCJ V;  3TCU A;  1XMO O;  3T1H B;  3CCL V;  3K5N A;  4NB5 A;  4JTC B;  1KKC A;  5D5Q A;  1GN4 A;  3TXQ A;  1M57 C;  4CZZ A;  1E1R G;  4JI5 O;  2Z5U A;  1OCR C;  1AR5 A;  5B3S B;  4JYA O;  3FB6 C;  4TQD A;  1XI1 A;  4DR4 B;  5EIB C;  1YVW A;  1QLE B;  3KKY A;  2F43 G;  3BCC H;  3EFF K;  1N33 B;  3ZED A;  3SPH A;  4FLZ A;  3ZHR A;  2P90 A;  4FZ0 A;  4YJ2 B;  2L6L A;  3P3P A;  4DRX B;  2VRZ A;  5FPO A;  5KX5 B;  1IBM B;  5TIS Z;  1N32 B;  3X2Q B;  4DRX A;  1YJN V;  3K0G A;  1UFI A;  4J7J A;  2QEX V;  3RYH B;  2XAF A;  2E76 B;  1WB7 A;  1HR0 B;  2CDY A;  2UUB B;  4RAI A;  5CMU A;  3O65 A;  1IDS A;  4FZ1 A;  5JJJ B;  3S3X A;  2BSK B;  1AI6 A;  1LUW A;  1NT2 B;  2MK3 A;  1WPB A;  2EIN C;  2RMK B;  3SJC C;  3OGC C;  5IWA B;  1GK9 A;  2BSK A;  2Q5Z A;  4FLW A;  3N2K B;  3ZRX A;  1FXH A;  4P2Z A;  1JFF B;  3SJQ C;  1N8R W;  3SDL A;  4B7K A;  3IAY A;  3CMA V;  4EB6 B;  4I7Z B;  1BL8 A;  3HPL C;  4DUY B;  5IWA O;  4DV6 O;  1VQ6 V;  4NKG B;  3B2E E;  4BAY A;  3CXC U;  3RBZ A;  1M93 A;  1VF7 A;  3QO5 A;  4TV8 B;  4EB6 A;  2VQF O;  1V54 B;  1IBM O;  1I94 O;  4HBN A;  2HKO A;  4RWU A;  2W0X A;  3CE2 A;  3HR0 A;  1H2M A;  3JD1 A;  1PNM A;  4LFB O;  4H44 B;  2Y48 A;  4DR6 O;  4JYC A;  1ARO P;  3ZRW A;  3HKE A;  5LP6 B;  1I0H A;  2ZT9 B;  4I9W A;  1VQ4 V;  1ZSP A;  5IJ0 A;  3H01 A;  3IJ4 A;  5HFM A;  3HKE B;  1DLB A;  4MVO A;  4PV1 B;  3AG1 C;  2QTO A;  4X89 A;  5LHI A;  4DR6 B;  3EHB B;  1QVF U;  3E2E A;  4LF4 O;  1SER A;  4IYH A;  5KHJ A;  3DSQ A;  3SYQ A;  1ZTE A;  2MW2 B;  3ETG A;  4R7C A;  4YY3 O;  1K97 A;  2QR4 A;  3T4D A;  2WAM A;  5C8Y B;  3ETD A;  4WFA V;  2QM7 A;  2ZE6 A;  3ML0 A;  2QKA A;  3MHH C;  4DV5 B;  4DV3 B;  1NVP D;  1XUQ A;  2Q69 A;  3FB5 C;  2EZP A;  4YHH O;  3JAT A;  3CX5 F;  3JSN A;  2IBZ H;  2A9H A;  2QKS A;  3UT5 B;  4DV0 O;  5L3F A;  4LFA B;  3BPZ A;  5LHH A;  1J5E O;  1YF2 A;  3M99 B;  2ZCE A; 
#chains in the Genus database with same CATH homology
 1P84 F;  1SQP H;  4PD4 F;  1NTK H;  1KB9 F;  1NTZ H;  1PP9 H;  2FYU H;  3CXH F;  1PPJ H;  3H1J H;  2A06 H;  1KYO F;  3H1K H;  4U3F H;  1BCC H;  1L0N H;  1BGY H;  1NU1 H;  3CX5 F;  1BE3 H;  3L73 H;  3L72 H;  5KLV H;  1EZV H;  3H1H H;  3L74 H;  2IBZ H;  3H1I H;  3L71 H;  1NTM H;  3L75 H;  1SQX H;  3TGU H;  1SQV H;  1SQB H;  1SQQ H;  3CWB H;  3L70 H;  3BCC H;  1L0L H;  2BCC H;  3H1L H;  4D6T H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...