1WJZA

Soluiotn structure of j-domain of mouse dnaj like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords 1700030A21Rik protein
publication title Soluiotn structure of J-domain of mouse DnaJ like protein
rcsb
source organism Mus musculus
total genus 14
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1wjzA00
1WJZA 2M6YA 2QWNB 3UO3A 1IURA 2CTRA 1FAFA 2PF4E 2DN9A 2LO1A 2GUZB 2QSAA 2QWQB 2Y4UA 2YS8A 2QWPB 3AG7A 4J7ZA 2GUZA 4RWUA 4IT5A 1BQZA 1GH6A 2CUGA 2L6LA 1HDJA 1N4CA 1XBLA 2CTPA 2DMXA 2CTQA 2QWRB 2N04A 1FPOA 2CTWA 2OCHA 2Y4TA 2KQXA 3BVOA 3APOA 2YUAA 2QWOB 2LGWA 3APQA 4J80A 2EJ7A 1NZ6A 3UO2A 2N05A 1BQ0A 3UCSC
chains in the Genus database with same CATH superfamily
2NNUA 2UXBO 1N36O 4MT8A 4FM1A 3L70H 3CC4V 4PA3A 1EM1A 4BW9A 1YCIA 1FKAO 4GKJO 3H1KH 3E83A 4K35A 4YIOA 1WLEA 4NTYA 3P3NA 1B06A 3KZIZ 3BVOA 2RMKB 5EC2C 4DR6B 2W0XA 1JOYA 3JASA 1BMFG 2CAZC 1GN3A 4PDLA 1M90W 2XUMA 4U7OA 1TGOA 4MVSA 1MG1A 1M56C 2Y4UA 2YS8A 3QF7A 4B7KA 4JZ2A 4NB5A 1AJNA 2A9HA 2UUAB 4FLVA 3EXAA 1KUQA 4X9QA 4O2BA 2HFEC 4IYIA 4LH7A 3WB0A 4OPHA 3FB7C 1WAZA 3BA8A 1G6UA 5L3BA 5E1AC 3CCJV 3FAVB 3HKDB 4XDLA 2HVKC 1B3QA 1W2BU 5LXTB 1YEWA 3N2KA 4EFEA 1NBMG 1FXKA 2Y4TA 2Y48A 1YVWA 4LNUA 4DR6O 3JAKA 2WAMA 4FLXA 1NVPB 3JD3A 1N8RW 3SJBC 2IU3A 4IIJB 1TUBB 1WJZA 4DUYB 2LP7A 1VF6C 4HNAA 4YJ3B 3JCZA 3ZS8C 1L8DA 4JI2O 1U97A 5J2UA 2NN4A 3IC9A 5EC1C 2WLLB 4EB6A 2UUAO 4JYYA 1NTZH 4MVMA 1DTOA 5CBFA 4FJCC 4NXMB 1EN4A 1VF7A 4PDVA 4AHCA 2C2AA 2ADQB 2RN9A 2F93B 4X1IB 1ZX3A 4D7SA 3CD6V 3ZMZA 3QG5A 2CTQA 5IYBO 2GV9A 2Q5ZA 3FB8C 1Y76B 3AG4B 5JH7A 1QQCA 2Q0AA 3ZJZA 3ASNC 3WU2Z 1BCCH 1HNWB 1RSOA 3UO2A 2CK3G 4PV1B 4DUYO 5IJ0A 2HLDG 2A06H 3OT7A 3IAYA 1J95A 4DK1A 2UXXA 1YJNV 5IWAB 1BQZA 3STLC 3AG1C 3CP1A 3U10A 2H8PC 3D3QA 3H01A 2YI9A 1CPYA 3K03A 1SQBH 3VQYA 1RM1C 4E4EA 3K5LA 2BTQA 3JASB 1GM9A 2RJZA 2EZPA 4DUZB 3JCUZ 3TJTA 4NXMO 1SQFA 1YI2V 4UCOA 3SPCA 3FB5C 3TETA 3RYHB 2BE3A 3HB3B 3WG7C 5IY5C 1TVKB 4E2LA 3CWBH 3H1HH 1JMKC 5H6QA 4QE9A 5CN0A 2ZE7A 4OX9B 3X2QC 1FJGB 4MTGA 1ZTEA 2FKXA 1BZKA 2Y0PA 1HNWO 1S77D 4TV9B 1VF6A 1SRYA 3DSQA 3JSNA 3A0RA 3CMAV 4L8JA 5LGUA 3CCQV 5IWAO 2GUZA 4LC1A 3ABKB 5FNVB 2ARHA 1WNSA 4H37A 4LF7B 4LNUB 3IFXA 2RDCA 2JGUA 3JAKB 1URFA 4DUZO 3CB2A 2Y69C 2P06A 4QGPA 4B3MB 3K5OA 5J2UB 1JQ0A 1EN6A 2OCCB 4HYOA 1YHQV 2IJIA 4EB6B 2KKWA 3JAWA 4RUFA 4OX9O 4NXNB 2PGGA 3IJ4A 4J11A 5EBMC 2ZKOA 3ASOC 1I5YA 1QU7A 3OR7C 5EBWC 3C90A 5BMVB 1K34A 3K9SA 1OCCB 3R65A 1R1BA 4PI2A 1G8MA 2LQTA 3AG3B 1VQ8V 4ICGA 3GWOA 3ZBHA 4LF7O 5F2VO 3W7UA 2YC0A 5JH7B 1M93A 2W0FC 3F7YC 4KFMA 3SYQA 1W0KG 3UCSC 3H1JH 2EIKC 3BFRA 2AHYA 3BHPA 4B3MO 2CTRA 2A3QA 4GZRB 1BS3A 2AHZA 4PA9A 2UUBB 1GH6A 4NXNO 3B09A 4JYCA 2QM4A 1KKDA 2BTQB 2CGOA 4YJ2A 1IBLB 3ABUA 3K0DA 4NKGB 5LP6C 2CGNA 2UUCB 2BSKA 1O9GA 2QKAA 1FXVA 1JR9A 4GX1A 3VBBA 3ZHQA 1F23A 4FFBA 1XHZA 1YSCA 5JCOA 1AILA 1E79G 4OPAA 5LMUB 2L6LA 2UXCB 1M4UA 2DQ0A 2DMXA 4H44B 2KSDA 2JGDA 1VQMV 3OR6C 1AP6A 2F23A 3LDDA 4BR6A 3DC5A 2HP8A 5BR8B 5LA6B 2ETNA 2R9IA 2UUBO 1WP7A 3O65A 3JD0A 2BOBC 5IYCO 4QPKA 1IBLO 1KMIZ 1Q90D 3ICXA 3SJAC 2UUCO 3RWRD 3M8AA 3OTOB 2HR3A 3LSUA 4LFCB 1AI5A 3F5TA 5IT9N 1SQVH 1WN7A 3JAWB 1XL6A 3K04A 4F6RB 2F95B 4FZ0A 5LMUO 2UXCO 4GKKB 4DR4B 2CE4A 2B1GA 3WB1A 4JI0B 4LR3A 4UVCA 3HKCA 1BQ0A 1HR0B 3OTFA 4DRXB 5BR8O 4MS2A 3K3WA 4I9QA 1OJHA 2Q69A 5EIBC 5IYZA 2IH3C 3CRQA 4RQEA 3HKEA 5KUKA 4U3FH 3QO5A 4BW5A 5LP6A 3JARA 3OTOO 4R6ZA 1QHTA 5CA0B 4LFCO 1NI8A 1GMGA 4HZ3A 1OCZC 2Z5UA 4DR3B 2W6JG 2XAJA 1ZUQA 5BXZA 3ZMVA 4FLYA 1K8AW 4BAYA 4JV5O 4X62B 1OCRB 4PD4F 1MABG 4JI0O 4AI8A 1PNKA 1XHXA 2Q7EA 4WFHA 1HR0O 2EIMC 2UU9B 2N05A 5ITZA 4ZOLA 4WFAV 1FYJA 4FFBB 3JALB 2KB1A 3D36C 2LGQA 3QVNA 4D7TA 3C3TA 4ZIBA 5GONB 2YXYA 1KD1W 2OTLV 3OD4A 3CHXA 1R6TA 1NJIW 1S5JA 4MVRA 1Q43A 1AI4A 2EIJB 4KXRA 5H5NA 3L71H 3MHHC 2A0LA 2EINB 4ASUG 3RYIA 5EZYB 2AXTZ 1ROPA 2Q0OC 4PDRA 4DR3O 3K08A 1ENVA 1XEQA 2K9PA 1YIJV 3UQ8A 1AROP 1P7BA 1NR1A 3ABLB 2QDOA 2P7TC 2CUGA 4X62O 4DV0B 4LBEC 3M99B 3WFVA 1H38A 4LF9B 2UU9O 5H6RA 1W0JG 4C7UA 4CZZA 4JAAA 3DTUB 4P9OA 2YIDA 2LO1A 3G6BA 2VQEB 2HJDA 1FFTB 2VRZA 3B8NA 4H33A 3EFFK 5CMUA 3G4SV 4Z1MG 1H8HG 1DLBA 3R66A 2WSSG 3HKCB 1B6QA 3FX7A 4GT1A 4QE7A 1S76D 5A2QN 2ZINA 1M9NA 3T1HB 3ABMB 3KG2A 4G27B 4K8ZA 5AG2A 4K3AA 5KA5A 2WA4A 1IBMB 4DV0O 4DV2B 1VQ7V 2B5UA 2HVJC 4FLUA 3K9AA 2QWOB 4U3JB 2YXLA 1GM8A 1P84F 2X0LA 3CE2A 1K3EA 2R9RB 5LGNA 4TUYB 2JJ2G 3HKBA 2OIEA 2UXDB 4DK0A 4ZHQB 4YIPA 1VQ9V 2R72A 5B1AC 4X66B 1US6A 5IDJA 1K4DC 5JQGA 3CRCA 1H2GA 4O4LB 4B3SB 5CB4B 5JVDA 3T1HO 1BGYH 5CA1B 4YHHO 5LMNB 5KMGB 3IC7A 2XAFA 5LL6Y 1IBMO 2DQ3A 3OUFA 2ZXWC 1XI1A 3J80N 2P90A 4X1YB 3OM3B 4PA7A 1QR8A 5JWPA 3K58A 1V54B 1VQKV 2HHHB 1P4RA 2IU0A 3CEIA 1BHAA 2YSUB 1O9HA 2LW7A 3L74H 1VQOV 2X6BA 2UXDO 3BY6A 2XASA 4JI3B 4K8XA 3RVYA 4X66O 3K5NA 3HPLC 4TQDA 3SPIA 4JI1B 1S72V 1MZFA 3OEHG 1MZEA 2GTSA 1VMGA 1EZJA 4B3SO 1H2LA 3B40A 5LMNO 1AB3A 2D2CB 1VQNV 1QLEB 1I94B 2CDYA 5HFLA 1WB7A 3OGCC 1F4NA 3RN4A 3JATA 3ZIAG 1K92A 4TSFG 2RCVA 3D8CA 5FL7G 1QVFU 2HHHO 2IW5A 1I5XA 3J7AU 2IM9A 1ZL8A 2ZIMA 3RW0A 2QA4V 4I0XB 3L72H 1JVMA 1Q6HA 2HJFC 1MMMA 1SESA 3ZHUA 3AG2C 1UPGA 2LW1A 1PNLA 1I08A 3SPHA 4JPRA 2JEXA 4JI3O 4U7NA 4JI1O 2GSMB 4I9WA 3UKMA 3I56V 4YXWG 2Z3YA 2PUSA 3DXRA 1OV9A 2ZD9A 5L3FA 4I55B 2HG5C 2DYRC 4DV5B 4XDJA 1V55C 3RGBA 2YIAA 2A79B 4KHPB 2ODMA 5JQGB 4RAIA 1XBLA 5C8YA 5B5EZ 1RP3B 1HNZB 5JVDB 1XREA 4DR5B 4FVMA 3E8HA 3U0ZA 3A2FA 1SERA 5FPOA 2EILC 1IX9A 1DF4A 3RT3C 2FYUH 4KP4A 1E1QG 3NR7A 4P30A 1I0HA 4UCUA 2OIGA 4HBNA 3OE7G 1FFXA 3ZHVA 3QO7A 3TGUH 2LFSA 1COWG 2H94A 2ZR3A 2DOSA 1J5EB 2RQ6A 3THOA 2JIZG 2YEVA 2WLMA 2QR4A 2MK3A 2PYJA 5BZBA 1SQXH 3CXHF 5D5QA 4KHPO 4LH6A 3CCMV 1GRJA 4O2BB 3K79A 2WPDG 5E79Z 4DR5O 2P22C 2ZNJA 3IGAC 5JJJB 2PYLA 2ATKC 4GX2A 1KP3A 1MA1A 2ZDIC 1H8EG 3N2KB 1PL0A 3BEHA 1IXBA 1Y6XA 1FXKB 4K0KB 3I55V 5K1PA 2W6IG 2XHBA 3APOA 4UCRA 2E74B 3DC6A 1OCRC 4I4TA 2X6CA 5B1BB 4HNAB 5EIBD 5LOVA 5GTIZ 4JGSA 2LJ2A 3SPJA 1RFYA 4FK5C 4UV9A 1M5IA 2YIBD 2Q68A 1AJPA 1KP2A 4FIPC 2PTMA 1FJGO 3CC7V 4JYAB 3DXRB 1FS0G 3JYCA 3K5MA 5LBQA 2EIJC 1SETA 4LWSA 3CPWU 1NS1A 5KLVH 1BT8A 5EBLC 1WA8A 3U11A 4TQFA 2QE7G 3ZRSA 4X88A 3OMIB 1MNGA 1S5HC 2DYSB 5J2TA 4RQFA 2XAQA 4K0KO 3VQXA 3S3WA 3AK3A 4BIZA 3M7MX 3E2EA 1VARA 2Q7GA 4UV8A 3LSSA 1F4MA 1NVPD 2M7WA 2Q8VA 1RSOB 2G38A 3KCYA 2BCCH 5IJ0B 4TWKA 4O4IA 4GLXA 2QM8A 5IE9A 4J7ZA 4RWUA 1JJ2U 3TXQA 1FFXB 1YJ9V 4JYAO 2BOCC 1XL4A 4MTFA 1XQ8A 2VS0A 1R6NA 3CJHA 3APQA 1AR4A 1YTFB 1IVSA 3OAAG 3MD0A 3O9OA 4UCVA 1GN6A 4NTWA 1H2KA 3SR2C 5B3SC 1QR9A 4FZ1A 1OCOC 2QJ1A 1VP7A 2P4KA 1Z5VA 2QWPB 4PJ0Z 4WBNA 1M57C 1Q6IA 3SYCA 3SJQC 2ZCEA 1SC5B 4DV4B 3OGIB 4J9YB 4X1KA 3CS5A 1SQQH 3LUTB 3CRRA 4LP8A 4X8AA 5JJEB 2QKCA 1N33B 1R3IC 3CRMA 2GUZB 3BABA 5BY1A 5KHHA 1PM9A 4NR1A 4CS3A 4PELA 1SA0A 3CCLV 2IH1C 1VQ4V 3ZCCA 4FM2A 3LSQA 1Q81W 3ZN0A 4BIOA 3RFRA 5KHKA 1GK9A 4J80A 5KUMA 5H9CA 2YI8A 2YXHA 3TXSA 3RYFA 4B3TB 3UO3A 4I50A 2DN9A 4P2ZA 2WLJA 3CCUV 4OXSA 3T4DA 3D3IA 5FPRA 2ZIOA 2PZSA 2GHYA 4MW8A 5C93A 3ASNB 2CTWA 4DV4O 1PP9H 3ZHTA 1Z2GA 2P4VA 2ILMA 2LGWA 4LWSB 1GTOA 1V54C 4AQYB 4ZKIA 1IXMA 1YF2A 1XILA 2FMLA 3AG1B 2KG7A 4JTAB 1PL4A 1JCHA 2JVDA 2ITDC 3W7SA 3UT5A 5EK0A 2R70A 1RM1B 4DV6B 1R3JC 4BWAA 4R7CA 4AILC 4O4HA 3OMNB 1X59A 4B3RB 3WG7B 5IY5B 2GTAA 4O4JA 3SGIA 3GB7C 3OMAB 3X2QB 3FB6C 4GKKO 1F51A 4DR4O 4UVBA 3ZRWA 4MW3A 4YJ2B 1Y74A 3CJHB 3OUSA 4AQYO 4FMTA 2BSKB 4HAMA 3W7TA 3JSLA 2EZOA 2GDSA 3FYIB 4CS4A 1SKVA 4A5UB 3ZMSA 1FAFA 3VQWA 4WBNB 4DYLA 1YXBA 5GTHZ 3CCEV 2YDEA 2X7RB 4DV6O 1N4CA 2JEUA 3RVZA 1N0JA 2JS3A 1D2DA 1N0NA 2JGDB 2Y69B 3ML0A 4W4LA 1M1KW 3A0BZ 1SQGA 4F4LA 2JS5A 2DE0X 2ZE6A 4EFBA 3GVMA 2AGAA 3OFNG 1K33A 1SA0B 4N21A 3ASOB 4CH3A 4UVAA 3B77A 4WFBV 1ZAUA 2ITCC 3CMEV 2F1MA 3STZC 1K5SA 2YUAA 5DEDA 4UB8Z 1HWYA 1KBHA 3AG4C 3RYFB 4LCUC 4UCSA 1K9MW 5L3DA 3DGEA 4FLTA 2Q7HA 1BE3H 2O57A 5EYPA 5LYJA 1VQLV 1HDJA 2YIBA 1UJWB 1HNXB 1VIBA 2N74A 3ETDA 1RPRA 3ZEDA 1CP9A 2EIKB 4RO2A 4DR1B 4XDKA 4CH4A 2Q4PA 3QO8A 3F7VC 1EN5A 2QGNA 1OHHG 4F6EA 3E8BA 3FAVA 3CXCU 1QLNA 4PA6A 5IYZB 4NYKA 1NQTA 3JD2A 2DW4A 3HKEB 2ZE8A 1FPOA 5LP6B 3JARB 1JA8A 2XTAA 4O4HB 4LF9O 1XNRB 1L0LH 3QNEA 3ZHRA 4P9PA 4O4JB 4IIJA 2E76B 3D36A 1BHBA 1JPXA 1JFFA 4YJ3A 2DWEC 3W7WA 4LFBB 2CH7A 2X6AA 4I5SA 2VQEO 3ABTA 4JASA 3ZRWB 4IL6Z 1KU9A 2WLLA 1Y74B 3ABKC 1MOFA 2E3CA 2AZ0A 1AJQA 1QBZA 3W7XA 1FXKC 1VQPV 1MSWD 2P6JA 3T2MA 5ITZB 3P30A 2PI5A 2FTKA 1K73W 4ZOLB 2OTJV 2Q73A 1CXZB 4MSWC 1YZBA 1XNQB 3S3XA 1QCEA 4X1IA 2DWDC 1NH2D 4DV2O 2OCCC 3SYOA 4X20A 1XNRO 4EKWA 4R50A 3BAAA 2MW2B 3H9VA 5KA6A 3RYIB 4NTXA 4IHJA 1B04A 4PHZA 3BA9A 4X65B 1XMQB 4DW0A 4LFBO 3AG7A 1OCCC 4OGQB 3VOUA 1AI6A 4MVUA 2DYSC 3LNNA 3AG3C 1KKCA 4ABMA 1H2SB 2ZM6B 4DW1A 1D5NA 1UFIA 5LGTA 2BTOA 2IJHA 3RYCA 2AZ2A 4MVZA 1WP8A 4JI2B 1XNQO 3RYHA 3SYAA 5EYPB 5LYJB 3FYEB 1TVKA 3HR0A 4W4KA 1Q7YW 2IJJA 4WFFA 1CEZA 4X64B 1BSMA 1R6KA 1JJOA 3B8MA 1RPOA 3J81N 4MVQA 1OCZB 4JZGA 4TV9A 3CCSV 4DO2A 4LF4B 4X65O 5KAIZ 1XMQO 4UXNA 2F4VB 2QSAA 3CSXA 4UB6Z 2JDIG 2Y0IA 2QTSA 1PKXA 3G71V 5FNVA 1L0NH 2EIMB 3EHBB 1NT2B 2QTOA 5LHHA 1P7GA 1FD9A 2ZM6O 4JTCB 2XOKG 2XAGA 1JFFB 4GX0A 1VEWA 3HKBB 4CH5A 2CH7B 4CBCA 4LF5B 1NR7A 3ZX6A 1I94O 2E5LB 2XNDG 5GW7A 4JI4B 1TAEA 4X64O 3N27A 2HEPA 3P3PA 4G2KA 4J10A 1Q3EA 4CS2A 5KAFZ 3A0HZ 3K06A 1NKDA 4QIWF 1DK1A 3T4ZA 3BCCH 5L3GA 4ZBMA 4LF4O 2H3OA 4JI7B 1BL8A 1V9PA 3NXSA 1S3JA 4H0LB 4MTXA 4J7JA 5BMVA 2F4VO 4QNHB 4D6TH 1KYOF 2HKOA 3E86A 3EVKA 4JAVA 4X20B 3ETGA 3SYPA 4PI0A 4BIUA 1AI7A 2KQXA 5DM6V 3VQVA 4DV1B 4IHJB 1N32B 3KCXA 2IJKA 4Z2WA 2WA3A 4DV5O 3RBZA 4JF3A 3OW2U 3CCRV 4LFAB 4LF5O 2E5LO 2Z0AA 1NTKH 4JI4O 3MDSA 4LF8B 4N23A 1Z5WA 4NVPA 4UUJC 1HNZO 3QTCA 3I5DA 1HP8A 5JJNB 1NU1H 2WLIA 1NZ6A 3RYCB 2WLKA 5IYDO 4JI7O 3K57A 3E35A 5LHIA 2PF4E 5K1XA 2RNBA 3C3SA 4JAUA 1XMOB 4XBFA 3ZN1A 2FB5A 3JATB 3N2GA 4J41A 1VF5B 3A8TA 4TT3G 2PI4A 2ADPA 4DV1O 4L87A 1ZL8B 1N32O 3B4SA 1YITV 1K4CC 1J5EO 4LFAO 2P67A 5LA6A 5B1AB 4LF8O 5KX5A 5TISZ 2AW9A 5JCOC 4PA4A 1A32A 2FL4A 3PN1A 2L35A 1PV0A 1TA8A 1QVGU 4GUNA 2EINC 1IURA 1AR1B 3MAQA 1DF5A 2ZXWB 3LDCA 1XMOO 4F6RA 5C8YB 2EJRA 3ABLC 2QWRB 1Q5OA 2V7QG 1XOUA 1X4TA 1KB9F 4GYCB 3TK1A 1LNQA 3CCVV 4O2AA 3FKSG 3E89A 4DRXA 2ZR2A 1M56B 1D5AA 4MVOA 3ZRXA 2LFRA 3L73H 2YICA 3G6EV 1IDSA 2PY5A 1R3LC 4KUMA 1YJWV 2N04A 3H1LH 5FLXN 5CBHA 3KKYA 3MHSC 5B1NA 2OWOA 1Q6UA 4UFZA 3GWKC 2B1IA 4ZI7A 4DV7B 1Q86W 4TOIA 2JRIA 1T5EA 2QWNB 1NTMH 4GCZA 5CA0A 1K5QA 2YEVB 4R8CA 5KHJA 1W59A 2ZDIA 3ABMC 4DV3B 4FM0A 1SZTA 4LF6B 2WLHA 3AG2B 4H13B 2WLIB 3T1YB 3AK2A 2EJ7A 4CC6A 4PDMA 4KL1A 3JALA 4WFGA 1PPJH 3ETQA 3N2GB 4Q20A 3G80A 3JAMN 4TV8A 2WLNA 5GONA 1I7FA 1P49A 1S0VA 1HW7A 5L3CA 2DYRB 4I4TB 1SQPH 4DV7O 1GN2A 1IBKB 1V55B 5EZYA 5LOVB 3Q4HA 2V4DA 5KHIA 3ZRVA 4MTOA 5KX5B 4B08A 4IT5A 4DV3O 1VQ5V 3CC2V 1Y66A 4CH6A 4GX5A 1AP5A 2XT9A 3E22A 4DR2B 3T1CA 4LF6O 3ZMUA 2DJVA 2F43G 4G28B 3T1YO 1G4YB 1TUEB 1WB8A 4WCEV 1PD3A 2EILB 4FPPA 4Q6GA 1WA8B 1GN4A 1KQSU 1N33O 2QWQB 4JI5B 5J2TB 2Q67A 4J42A 1MSDA 4WFEA 2NLJC 4JV5B 2F66C 3UM7A 4O2AB 4RUEA 1IBKO 4YY3B 4J7KA 4O4IB 3SDLA 5B66Z 2M6YA 4B3TO 2UXNA 1QNMA 4FFKA 3JD4A 2ZNIA 2Q9LA 1OZ0A 1QLEC 4DR2O 1KECA 3L9DA 1NH2B 4FLZA 4EEQA 1ZLZA 3E8FA 5HFMA 2QM7A 4ZI7B 1XUQA 1L1FA 4U3JA 4QJFB 1G1XB 2OYQA 1DGSA 1GKFA 1WPXA 4DXWA 1K97A 4JI5O 3K59A 5CBGA 4TUYA 3ETEA 5B1OA 2E75B 4ZHQA 2ZE5A 2B9ZA 3G67A 4JI8B 2R9AA 2EBOA 3CRAA 3H1IH 1Y4MA 4X89A 2D3OW 4X1KB 4WF9V 4YY3O 1EBOA 3BRCA 4IGGA 4O4LA 5IJ9A 4B3RO 1WPBA 5CB4A 3CYOA 1EZVH 3FFQA 2JJ1G 5CA1A 2OT5A 2XAHA 4DR7B 3SPGA 5KMGA 1ZWIC 4TV8B 2VWKA 3FD9A 1SZXA 2Q6AA 3CX5F 2K1EA 1GAXA 1H2NA 1ORQC 2CTPA 5D5PA 1H2MA 4X1YA 3P32A 1YTFD 4I7ZB 1Q82W 4JI6B 2V1DA 3Q4HB 3BPZA 4I50B 1PNMA 4FLWA 2NR5A 3L75H 5KHGA 1K7DA 3E22B 4JI8O 1VQ6V 2OCHA 1LR1A 1IZ3A 4J9ZB 2EULA 4JYBA 2A7WA 3LNMB 1N34B 1F7YA 1EFRG 4IYHA 2KG7B 4DR7O 5DN6G 1THZA 2VWJA 3E8GA 5CA3A 2QKSA 2VQFB 5LHGA 1XDCA 2JK5C 5J9PC 3JD1A 3HKDA 3UT5B 4CC5A 3ZMTA 5LXTA 4QPJA 2EX3A 1GM7A 1SF9A 1YDXA 1ZSPA 3LDEA 1E1RG 3AK1A 4UCTA 3F5WC 4JI6O 5B3SB 4I0XA 1OCOB 1GO3F 2ZT9B 2IBZH 3AEIA 1KC8W 2UXBB 1N36B 1M57B 1TUBA 4YHHB 2QEXV 3OEEG 3B2EE 1JX9A 1Y67A 1FXHA 3ZHSA 1HNXO 4GKJB 1R3KC 3WB2A 3PJSK 5A9GA 1LUVA 1Q8IA 1N34O 2GBOA 4DR1O 5DECA 4I55A 1SS3A 1AR5A 4JTDB 1LUWA 5B1BC 3K0GA 2P5OA 1AVMA 2VQFO 5H2FZ 5L3EA 2ZQMA 4B7EA 1S5LZ 1R73A 3TCUA 1Y76A 2WWWA 5IJ9B 4Z1VA 3SJCC 1U96A
chains in the Genus database with same CATH topology
1WJZA 2M6YA 2QWNB 3UO3A 1IURA 2CTRA 1FAFA 2PF4E 2DN9A 2LO1A 2GUZB 2QSAA 2QWQB 2Y4UA 2YS8A 2QWPB 3AG7A 4J7ZA 2GUZA 4RWUA 4IT5A 1BQZA 1GH6A 2CUGA 2L6LA 1HDJA 1N4CA 1XBLA 2CTPA 2DMXA 2CTQA 2QWRB 2N04A 1FPOA 2CTWA 2OCHA 2Y4TA 2KQXA 3BVOA 3APOA 2YUAA 2QWOB 2LGWA 3APQA 4J80A 2EJ7A 1NZ6A 3UO2A 2N05A 1BQ0A 3UCSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJZ A;  2M6Y A;  2QWN B;  3UO3 A;  1IUR A;  2CTR A;  1FAF A;  2PF4 E;  2DN9 A;  2LO1 A;  2GUZ B;  2QSA A;  2QWQ B;  2Y4U A;  2YS8 A;  2QWP B;  3AG7 A;  4J7Z A;  2GUZ A;  4RWU A;  4IT5 A;  1BQZ A;  1GH6 A;  2CUG A;  2L6L A;  1HDJ A;  1N4C A;  1XBL A;  2CTP A;  2DMX A;  2CTQ A;  2QWR B;  2N04 A;  1FPO A;  2CTW A;  2OCH A;  2Y4T A;  2KQX A;  3BVO A;  3APO A;  2YUA A;  2QWO B;  2LGW A;  3APQ A;  4J80 A;  2EJ7 A;  1NZ6 A;  3UO2 A;  2N05 A;  1BQ0 A;  3UCS C; 
#chains in the Genus database with same CATH topology
 2NNU A;  2UXB O;  1N36 O;  4MT8 A;  4FM1 A;  3L70 H;  3CC4 V;  4PA3 A;  1EM1 A;  4BW9 A;  1YCI A;  1FKA O;  4GKJ O;  3H1K H;  3E83 A;  4K35 A;  4YIO A;  1WLE A;  4NTY A;  3P3N A;  1B06 A;  3KZI Z;  3BVO A;  2RMK B;  5EC2 C;  4DR6 B;  2W0X A;  1JOY A;  3JAS A;  1BMF G;  2CAZ C;  1GN3 A;  4PDL A;  1M90 W;  2XUM A;  4U7O A;  1TGO A;  4MVS A;  1MG1 A;  1M56 C;  2Y4U A;  2YS8 A;  3QF7 A;  4B7K A;  4JZ2 A;  4NB5 A;  1AJN A;  2A9H A;  2UUA B;  4FLV A;  3EXA A;  1KUQ A;  4X9Q A;  4O2B A;  2HFE C;  4IYI A;  4LH7 A;  3WB0 A;  4OPH A;  3FB7 C;  1WAZ A;  3BA8 A;  1G6U A;  5L3B A;  5E1A C;  3CCJ V;  3FAV B;  3HKD B;  4XDL A;  2HVK C;  1B3Q A;  1W2B U;  5LXT B;  1YEW A;  3N2K A;  4EFE A;  1NBM G;  1FXK A;  2Y4T A;  2Y48 A;  1YVW A;  4LNU A;  4DR6 O;  3JAK A;  2WAM A;  4FLX A;  1NVP B;  3JD3 A;  1N8R W;  3SJB C;  2IU3 A;  4IIJ B;  1TUB B;  1WJZ A;  4DUY B;  2LP7 A;  1VF6 C;  4HNA A;  4YJ3 B;  3JCZ A;  3ZS8 C;  1L8D A;  4JI2 O;  1U97 A;  5J2U A;  2NN4 A;  3IC9 A;  5EC1 C;  2WLL B;  4EB6 A;  2UUA O;  4JYY A;  1NTZ H;  4MVM A;  1DTO A;  5CBF A;  4FJC C;  4NXM B;  1EN4 A;  1VF7 A;  4PDV A;  4AHC A;  2C2A A;  2ADQ B;  2RN9 A;  2F93 B;  4X1I B;  1ZX3 A;  4D7S A;  3CD6 V;  3ZMZ A;  3QG5 A;  2CTQ A;  5IYB O;  2GV9 A;  2Q5Z A;  3FB8 C;  1Y76 B;  3AG4 B;  5JH7 A;  1QQC A;  2Q0A A;  3ZJZ A;  3ASN C;  3WU2 Z;  1BCC H;  1HNW B;  1RSO A;  3UO2 A;  2CK3 G;  4PV1 B;  4DUY O;  5IJ0 A;  2HLD G;  2A06 H;  3OT7 A;  3IAY A;  1J95 A;  4DK1 A;  2UXX A;  1YJN V;  5IWA B;  1BQZ A;  3STL C;  3AG1 C;  3CP1 A;  3U10 A;  2H8P C;  3D3Q A;  3H01 A;  2YI9 A;  1CPY A;  3K03 A;  1SQB H;  3VQY A;  1RM1 C;  4E4E A;  3K5L A;  2BTQ A;  3JAS B;  1GM9 A;  2RJZ A;  2EZP A;  4DUZ B;  3JCU Z;  3TJT A;  4NXM O;  1SQF A;  1YI2 V;  4UCO A;  3SPC A;  3FB5 C;  3TET A;  3RYH B;  2BE3 A;  3HB3 B;  3WG7 C;  5IY5 C;  1TVK B;  4E2L A;  3CWB H;  3H1H H;  1JMK C;  5H6Q A;  4QE9 A;  5CN0 A;  2ZE7 A;  4OX9 B;  3X2Q C;  1FJG B;  4MTG A;  1ZTE A;  2FKX A;  1BZK A;  2Y0P A;  1HNW O;  1S77 D;  4TV9 B;  1VF6 A;  1SRY A;  3DSQ A;  3JSN A;  3A0R A;  3CMA V;  4L8J A;  5LGU A;  3CCQ V;  5IWA O;  2GUZ A;  4LC1 A;  3ABK B;  5FNV B;  2ARH A;  1WNS A;  4H37 A;  4LF7 B;  4LNU B;  3IFX A;  2RDC A;  2JGU A;  3JAK B;  1URF A;  4DUZ O;  3CB2 A;  2Y69 C;  2P06 A;  4QGP A;  4B3M B;  3K5O A;  5J2U B;  1JQ0 A;  1EN6 A;  2OCC B;  4HYO A;  1YHQ V;  2IJI A;  4EB6 B;  2KKW A;  3JAW A;  4RUF A;  4OX9 O;  4NXN B;  2PGG A;  3IJ4 A;  4J11 A;  5EBM C;  2ZKO A;  3ASO C;  1I5Y A;  1QU7 A;  3OR7 C;  5EBW C;  3C90 A;  5BMV B;  1K34 A;  3K9S A;  1OCC B;  3R65 A;  1R1B A;  4PI2 A;  1G8M A;  2LQT A;  3AG3 B;  1VQ8 V;  4ICG A;  3GWO A;  3ZBH A;  4LF7 O;  5F2V O;  3W7U A;  2YC0 A;  5JH7 B;  1M93 A;  2W0F C;  3F7Y C;  4KFM A;  3SYQ A;  1W0K G;  3UCS C;  3H1J H;  2EIK C;  3BFR A;  2AHY A;  3BHP A;  4B3M O;  2CTR A;  2A3Q A;  4GZR B;  1BS3 A;  2AHZ A;  4PA9 A;  2UUB B;  1GH6 A;  4NXN O;  3B09 A;  4JYC A;  2QM4 A;  1KKD A;  2BTQ B;  2CGO A;  4YJ2 A;  1IBL B;  3ABU A;  3K0D A;  4NKG B;  5LP6 C;  2CGN A;  2UUC B;  2BSK A;  1O9G A;  2QKA A;  1FXV A;  1JR9 A;  4GX1 A;  3VBB A;  3ZHQ A;  1F23 A;  4FFB A;  1XHZ A;  1YSC A;  5JCO A;  1AIL A;  1E79 G;  4OPA A;  5LMU B;  2L6L A;  2UXC B;  1M4U A;  2DQ0 A;  2DMX A;  4H44 B;  2KSD A;  2JGD A;  1VQM V;  3OR6 C;  1AP6 A;  2F23 A;  3LDD A;  4BR6 A;  3DC5 A;  2HP8 A;  5BR8 B;  5LA6 B;  2ETN A;  2R9I A;  2UUB O;  1WP7 A;  3O65 A;  3JD0 A;  2BOB C;  5IYC O;  4QPK A;  1IBL O;  1KMI Z;  1Q90 D;  3ICX A;  3SJA C;  2UUC O;  3RWR D;  3M8A A;  3OTO B;  2HR3 A;  3LSU A;  4LFC B;  1AI5 A;  3F5T A;  5IT9 N;  1SQV H;  1WN7 A;  3JAW B;  1XL6 A;  3K04 A;  4F6R B;  2F95 B;  4FZ0 A;  5LMU O;  2UXC O;  4GKK B;  4DR4 B;  2CE4 A;  2B1G A;  3WB1 A;  4JI0 B;  4LR3 A;  4UVC A;  3HKC A;  1BQ0 A;  1HR0 B;  3OTF A;  4DRX B;  5BR8 O;  4MS2 A;  3K3W A;  4I9Q A;  1OJH A;  2Q69 A;  5EIB C;  5IYZ A;  2IH3 C;  3CRQ A;  4RQE A;  3HKE A;  5KUK A;  4U3F H;  3QO5 A;  4BW5 A;  5LP6 A;  3JAR A;  3OTO O;  4R6Z A;  1QHT A;  5CA0 B;  4LFC O;  1NI8 A;  1GMG A;  4HZ3 A;  1OCZ C;  2Z5U A;  4DR3 B;  2W6J G;  2XAJ A;  1ZUQ A;  5BXZ A;  3ZMV A;  4FLY A;  1K8A W;  4BAY A;  4JV5 O;  4X62 B;  1OCR B;  4PD4 F;  1MAB G;  4JI0 O;  4AI8 A;  1PNK A;  1XHX A;  2Q7E A;  4WFH A;  1HR0 O;  2EIM C;  2UU9 B;  2N05 A;  5ITZ A;  4ZOL A;  4WFA V;  1FYJ A;  4FFB B;  3JAL B;  2KB1 A;  3D36 C;  2LGQ A;  3QVN A;  4D7T A;  3C3T A;  4ZIB A;  5GON B;  2YXY A;  1KD1 W;  2OTL V;  3OD4 A;  3CHX A;  1R6T A;  1NJI W;  1S5J A;  4MVR A;  1Q43 A;  1AI4 A;  2EIJ B;  4KXR A;  5H5N A;  3L71 H;  3MHH C;  2A0L A;  2EIN B;  4ASU G;  3RYI A;  5EZY B;  2AXT Z;  1ROP A;  2Q0O C;  4PDR A;  4DR3 O;  3K08 A;  1ENV A;  1XEQ A;  2K9P A;  1YIJ V;  3UQ8 A;  1ARO P;  1P7B A;  1NR1 A;  3ABL B;  2QDO A;  2P7T C;  2CUG A;  4X62 O;  4DV0 B;  4LBE C;  3M99 B;  3WFV A;  1H38 A;  4LF9 B;  2UU9 O;  5H6R A;  1W0J G;  4C7U A;  4CZZ A;  4JAA A;  3DTU B;  4P9O A;  2YID A;  2LO1 A;  3G6B A;  2VQE B;  2HJD A;  1FFT B;  2VRZ A;  3B8N A;  4H33 A;  3EFF K;  5CMU A;  3G4S V;  4Z1M G;  1H8H G;  1DLB A;  3R66 A;  2WSS G;  3HKC B;  1B6Q A;  3FX7 A;  4GT1 A;  4QE7 A;  1S76 D;  5A2Q N;  2ZIN A;  1M9N A;  3T1H B;  3ABM B;  3KG2 A;  4G27 B;  4K8Z A;  5AG2 A;  4K3A A;  5KA5 A;  2WA4 A;  1IBM B;  4DV0 O;  4DV2 B;  1VQ7 V;  2B5U A;  2HVJ C;  4FLU A;  3K9A A;  2QWO B;  4U3J B;  2YXL A;  1GM8 A;  1P84 F;  2X0L A;  3CE2 A;  1K3E A;  2R9R B;  5LGN A;  4TUY B;  2JJ2 G;  3HKB A;  2OIE A;  2UXD B;  4DK0 A;  4ZHQ B;  4YIP A;  1VQ9 V;  2R72 A;  5B1A C;  4X66 B;  1US6 A;  5IDJ A;  1K4D C;  5JQG A;  3CRC A;  1H2G A;  4O4L B;  4B3S B;  5CB4 B;  5JVD A;  3T1H O;  1BGY H;  5CA1 B;  4YHH O;  5LMN B;  5KMG B;  3IC7 A;  2XAF A;  5LL6 Y;  1IBM O;  2DQ3 A;  3OUF A;  2ZXW C;  1XI1 A;  3J80 N;  2P90 A;  4X1Y B;  3OM3 B;  4PA7 A;  1QR8 A;  5JWP A;  3K58 A;  1V54 B;  1VQK V;  2HHH B;  1P4R A;  2IU0 A;  3CEI A;  1BHA A;  2YSU B;  1O9H A;  2LW7 A;  3L74 H;  1VQO V;  2X6B A;  2UXD O;  3BY6 A;  2XAS A;  4JI3 B;  4K8X A;  3RVY A;  4X66 O;  3K5N A;  3HPL C;  4TQD A;  3SPI A;  4JI1 B;  1S72 V;  1MZF A;  3OEH G;  1MZE A;  2GTS A;  1VMG A;  1EZJ A;  4B3S O;  1H2L A;  3B40 A;  5LMN O;  1AB3 A;  2D2C B;  1VQN V;  1QLE B;  1I94 B;  2CDY A;  5HFL A;  1WB7 A;  3OGC C;  1F4N A;  3RN4 A;  3JAT A;  3ZIA G;  1K92 A;  4TSF G;  2RCV A;  3D8C A;  5FL7 G;  1QVF U;  2HHH O;  2IW5 A;  1I5X A;  3J7A U;  2IM9 A;  1ZL8 A;  2ZIM A;  3RW0 A;  2QA4 V;  4I0X B;  3L72 H;  1JVM A;  1Q6H A;  2HJF C;  1MMM A;  1SES A;  3ZHU A;  3AG2 C;  1UPG A;  2LW1 A;  1PNL A;  1I08 A;  3SPH A;  4JPR A;  2JEX A;  4JI3 O;  4U7N A;  4JI1 O;  2GSM B;  4I9W A;  3UKM A;  3I56 V;  4YXW G;  2Z3Y A;  2PUS A;  3DXR A;  1OV9 A;  2ZD9 A;  5L3F A;  4I55 B;  2HG5 C;  2DYR C;  4DV5 B;  4XDJ A;  1V55 C;  3RGB A;  2YIA A;  2A79 B;  4KHP B;  2ODM A;  5JQG B;  4RAI A;  1XBL A;  5C8Y A;  5B5E Z;  1RP3 B;  1HNZ B;  5JVD B;  1XRE A;  4DR5 B;  4FVM A;  3E8H A;  3U0Z A;  3A2F A;  1SER A;  5FPO A;  2EIL C;  1IX9 A;  1DF4 A;  3RT3 C;  2FYU H;  4KP4 A;  1E1Q G;  3NR7 A;  4P30 A;  1I0H A;  4UCU A;  2OIG A;  4HBN A;  3OE7 G;  1FFX A;  3ZHV A;  3QO7 A;  3TGU H;  2LFS A;  1COW G;  2H94 A;  2ZR3 A;  2DOS A;  1J5E B;  2RQ6 A;  3THO A;  2JIZ G;  2YEV A;  2WLM A;  2QR4 A;  2MK3 A;  2PYJ A;  5BZB A;  1SQX H;  3CXH F;  5D5Q A;  4KHP O;  4LH6 A;  3CCM V;  1GRJ A;  4O2B B;  3K79 A;  2WPD G;  5E79 Z;  4DR5 O;  2P22 C;  2ZNJ A;  3IGA C;  5JJJ B;  2PYL A;  2ATK C;  4GX2 A;  1KP3 A;  1MA1 A;  2ZDI C;  1H8E G;  3N2K B;  1PL0 A;  3BEH A;  1IXB A;  1Y6X A;  1FXK B;  4K0K B;  3I55 V;  5K1P A;  2W6I G;  2XHB A;  3APO A;  4UCR A;  2E74 B;  3DC6 A;  1OCR C;  4I4T A;  2X6C A;  5B1B B;  4HNA B;  5EIB D;  5LOV A;  5GTI Z;  4JGS A;  2LJ2 A;  3SPJ A;  1RFY A;  4FK5 C;  4UV9 A;  1M5I A;  2YIB D;  2Q68 A;  1AJP A;  1KP2 A;  4FIP C;  2PTM A;  1FJG O;  3CC7 V;  4JYA B;  3DXR B;  1FS0 G;  3JYC A;  3K5M A;  5LBQ A;  2EIJ C;  1SET A;  4LWS A;  3CPW U;  1NS1 A;  5KLV H;  1BT8 A;  5EBL C;  1WA8 A;  3U11 A;  4TQF A;  2QE7 G;  3ZRS A;  4X88 A;  3OMI B;  1MNG A;  1S5H C;  2DYS B;  5J2T A;  4RQF A;  2XAQ A;  4K0K O;  3VQX A;  3S3W A;  3AK3 A;  4BIZ A;  3M7M X;  3E2E A;  1VAR A;  2Q7G A;  4UV8 A;  3LSS A;  1F4M A;  1NVP D;  2M7W A;  2Q8V A;  1RSO B;  2G38 A;  3KCY A;  2BCC H;  5IJ0 B;  4TWK A;  4O4I A;  4GLX A;  2QM8 A;  5IE9 A;  4J7Z A;  4RWU A;  1JJ2 U;  3TXQ A;  1FFX B;  1YJ9 V;  4JYA O;  2BOC C;  1XL4 A;  4MTF A;  1XQ8 A;  2VS0 A;  1R6N A;  3CJH A;  3APQ A;  1AR4 A;  1YTF B;  1IVS A;  3OAA G;  3MD0 A;  3O9O A;  4UCV A;  1GN6 A;  4NTW A;  1H2K A;  3SR2 C;  5B3S C;  1QR9 A;  4FZ1 A;  1OCO C;  2QJ1 A;  1VP7 A;  2P4K A;  1Z5V A;  2QWP B;  4PJ0 Z;  4WBN A;  1M57 C;  1Q6I A;  3SYC A;  3SJQ C;  2ZCE A;  1SC5 B;  4DV4 B;  3OGI B;  4J9Y B;  4X1K A;  3CS5 A;  1SQQ H;  3LUT B;  3CRR A;  4LP8 A;  4X8A A;  5JJE B;  2QKC A;  1N33 B;  1R3I C;  3CRM A;  2GUZ B;  3BAB A;  5BY1 A;  5KHH A;  1PM9 A;  4NR1 A;  4CS3 A;  4PEL A;  1SA0 A;  3CCL V;  2IH1 C;  1VQ4 V;  3ZCC A;  4FM2 A;  3LSQ A;  1Q81 W;  3ZN0 A;  4BIO A;  3RFR A;  5KHK A;  1GK9 A;  4J80 A;  5KUM A;  5H9C A;  2YI8 A;  2YXH A;  3TXS A;  3RYF A;  4B3T B;  3UO3 A;  4I50 A;  2DN9 A;  4P2Z A;  2WLJ A;  3CCU V;  4OXS A;  3T4D A;  3D3I A;  5FPR A;  2ZIO A;  2PZS A;  2GHY A;  4MW8 A;  5C93 A;  3ASN B;  2CTW A;  4DV4 O;  1PP9 H;  3ZHT A;  1Z2G A;  2P4V A;  2ILM A;  2LGW A;  4LWS B;  1GTO A;  1V54 C;  4AQY B;  4ZKI A;  1IXM A;  1YF2 A;  1XIL A;  2FML A;  3AG1 B;  2KG7 A;  4JTA B;  1PL4 A;  1JCH A;  2JVD A;  2ITD C;  3W7S A;  3UT5 A;  5EK0 A;  2R70 A;  1RM1 B;  4DV6 B;  1R3J C;  4BWA A;  4R7C A;  4AIL C;  4O4H A;  3OMN B;  1X59 A;  4B3R B;  3WG7 B;  5IY5 B;  2GTA A;  4O4J A;  3SGI A;  3GB7 C;  3OMA B;  3X2Q B;  3FB6 C;  4GKK O;  1F51 A;  4DR4 O;  4UVB A;  3ZRW A;  4MW3 A;  4YJ2 B;  1Y74 A;  3CJH B;  3OUS A;  4AQY O;  4FMT A;  2BSK B;  4HAM A;  3W7T A;  3JSL A;  2EZO A;  2GDS A;  3FYI B;  4CS4 A;  1SKV A;  4A5U B;  3ZMS A;  1FAF A;  3VQW A;  4WBN B;  4DYL A;  1YXB A;  5GTH Z;  3CCE V;  2YDE A;  2X7R B;  4DV6 O;  1N4C A;  2JEU A;  3RVZ A;  1N0J A;  2JS3 A;  1D2D A;  1N0N A;  2JGD B;  2Y69 B;  3ML0 A;  4W4L A;  1M1K W;  3A0B Z;  1SQG A;  4F4L A;  2JS5 A;  2DE0 X;  2ZE6 A;  4EFB A;  3GVM A;  2AGA A;  3OFN G;  1K33 A;  1SA0 B;  4N21 A;  3ASO B;  4CH3 A;  4UVA A;  3B77 A;  4WFB V;  1ZAU A;  2ITC C;  3CME V;  2F1M A;  3STZ C;  1K5S A;  2YUA A;  5DED A;  4UB8 Z;  1HWY A;  1KBH A;  3AG4 C;  3RYF B;  4LCU C;  4UCS A;  1K9M W;  5L3D A;  3DGE A;  4FLT A;  2Q7H A;  1BE3 H;  2O57 A;  5EYP A;  5LYJ A;  1VQL V;  1HDJ A;  2YIB A;  1UJW B;  1HNX B;  1VIB A;  2N74 A;  3ETD A;  1RPR A;  3ZED A;  1CP9 A;  2EIK B;  4RO2 A;  4DR1 B;  4XDK A;  4CH4 A;  2Q4P A;  3QO8 A;  3F7V C;  1EN5 A;  2QGN A;  1OHH G;  4F6E A;  3E8B A;  3FAV A;  3CXC U;  1QLN A;  4PA6 A;  5IYZ B;  4NYK A;  1NQT A;  3JD2 A;  2DW4 A;  3HKE B;  2ZE8 A;  1FPO A;  5LP6 B;  3JAR B;  1JA8 A;  2XTA A;  4O4H B;  4LF9 O;  1XNR B;  1L0L H;  3QNE A;  3ZHR A;  4P9P A;  4O4J B;  4IIJ A;  2E76 B;  3D36 A;  1BHB A;  1JPX A;  1JFF A;  4YJ3 A;  2DWE C;  3W7W A;  4LFB B;  2CH7 A;  2X6A A;  4I5S A;  2VQE O;  3ABT A;  4JAS A;  3ZRW B;  4IL6 Z;  1KU9 A;  2WLL A;  1Y74 B;  3ABK C;  1MOF A;  2E3C A;  2AZ0 A;  1AJQ A;  1QBZ A;  3W7X A;  1FXK C;  1VQP V;  1MSW D;  2P6J A;  3T2M A;  5ITZ B;  3P30 A;  2PI5 A;  2FTK A;  1K73 W;  4ZOL B;  2OTJ V;  2Q73 A;  1CXZ B;  4MSW C;  1YZB A;  1XNQ B;  3S3X A;  1QCE A;  4X1I A;  2DWD C;  1NH2 D;  4DV2 O;  2OCC C;  3SYO A;  4X20 A;  1XNR O;  4EKW A;  4R50 A;  3BAA A;  2MW2 B;  3H9V A;  5KA6 A;  3RYI B;  4NTX A;  4IHJ A;  1B04 A;  4PHZ A;  3BA9 A;  4X65 B;  1XMQ B;  4DW0 A;  4LFB O;  3AG7 A;  1OCC C;  4OGQ B;  3VOU A;  1AI6 A;  4MVU A;  2DYS C;  3LNN A;  3AG3 C;  1KKC A;  4ABM A;  1H2S B;  2ZM6 B;  4DW1 A;  1D5N A;  1UFI A;  5LGT A;  2BTO A;  2IJH A;  3RYC A;  2AZ2 A;  4MVZ A;  1WP8 A;  4JI2 B;  1XNQ O;  3RYH A;  3SYA A;  5EYP B;  5LYJ B;  3FYE B;  1TVK A;  3HR0 A;  4W4K A;  1Q7Y W;  2IJJ A;  4WFF A;  1CEZ A;  4X64 B;  1BSM A;  1R6K A;  1JJO A;  3B8M A;  1RPO A;  3J81 N;  4MVQ A;  1OCZ B;  4JZG A;  4TV9 A;  3CCS V;  4DO2 A;  4LF4 B;  4X65 O;  5KAI Z;  1XMQ O;  4UXN A;  2F4V B;  2QSA A;  3CSX A;  4UB6 Z;  2JDI G;  2Y0I A;  2QTS A;  1PKX A;  3G71 V;  5FNV A;  1L0N H;  2EIM B;  3EHB B;  1NT2 B;  2QTO A;  5LHH A;  1P7G A;  1FD9 A;  2ZM6 O;  4JTC B;  2XOK G;  2XAG A;  1JFF B;  4GX0 A;  1VEW A;  3HKB B;  4CH5 A;  2CH7 B;  4CBC A;  4LF5 B;  1NR7 A;  3ZX6 A;  1I94 O;  2E5L B;  2XND G;  5GW7 A;  4JI4 B;  1TAE A;  4X64 O;  3N27 A;  2HEP A;  3P3P A;  4G2K A;  4J10 A;  1Q3E A;  4CS2 A;  5KAF Z;  3A0H Z;  3K06 A;  1NKD A;  4QIW F;  1DK1 A;  3T4Z A;  3BCC H;  5L3G A;  4ZBM A;  4LF4 O;  2H3O A;  4JI7 B;  1BL8 A;  1V9P A;  3NXS A;  1S3J A;  4H0L B;  4MTX A;  4J7J A;  5BMV A;  2F4V O;  4QNH B;  4D6T H;  1KYO F;  2HKO A;  3E86 A;  3EVK A;  4JAV A;  4X20 B;  3ETG A;  3SYP A;  4PI0 A;  4BIU A;  1AI7 A;  2KQX A;  5DM6 V;  3VQV A;  4DV1 B;  4IHJ B;  1N32 B;  3KCX A;  2IJK A;  4Z2W A;  2WA3 A;  4DV5 O;  3RBZ A;  4JF3 A;  3OW2 U;  3CCR V;  4LFA B;  4LF5 O;  2E5L O;  2Z0A A;  1NTK H;  4JI4 O;  3MDS A;  4LF8 B;  4N23 A;  1Z5W A;  4NVP A;  4UUJ C;  1HNZ O;  3QTC A;  3I5D A;  1HP8 A;  5JJN B;  1NU1 H;  2WLI A;  1NZ6 A;  3RYC B;  2WLK A;  5IYD O;  4JI7 O;  3K57 A;  3E35 A;  5LHI A;  2PF4 E;  5K1X A;  2RNB A;  3C3S A;  4JAU A;  1XMO B;  4XBF A;  3ZN1 A;  2FB5 A;  3JAT B;  3N2G A;  4J41 A;  1VF5 B;  3A8T A;  4TT3 G;  2PI4 A;  2ADP A;  4DV1 O;  4L87 A;  1ZL8 B;  1N32 O;  3B4S A;  1YIT V;  1K4C C;  1J5E O;  4LFA O;  2P67 A;  5LA6 A;  5B1A B;  4LF8 O;  5KX5 A;  5TIS Z;  2AW9 A;  5JCO C;  4PA4 A;  1A32 A;  2FL4 A;  3PN1 A;  2L35 A;  1PV0 A;  1TA8 A;  1QVG U;  4GUN A;  2EIN C;  1IUR A;  1AR1 B;  3MAQ A;  1DF5 A;  2ZXW B;  3LDC A;  1XMO O;  4F6R A;  5C8Y B;  2EJR A;  3ABL C;  2QWR B;  1Q5O A;  2V7Q G;  1XOU A;  1X4T A;  1KB9 F;  4GYC B;  3TK1 A;  1LNQ A;  3CCV V;  4O2A A;  3FKS G;  3E89 A;  4DRX A;  2ZR2 A;  1M56 B;  1D5A A;  4MVO A;  3ZRX A;  2LFR A;  3L73 H;  2YIC A;  3G6E V;  1IDS A;  2PY5 A;  1R3L C;  4KUM A;  1YJW V;  2N04 A;  3H1L H;  5FLX N;  5CBH A;  3KKY A;  3MHS C;  5B1N A;  2OWO A;  1Q6U A;  4UFZ A;  3GWK C;  2B1I A;  4ZI7 A;  4DV7 B;  1Q86 W;  4TOI A;  2JRI A;  1T5E A;  2QWN B;  1NTM H;  4GCZ A;  5CA0 A;  1K5Q A;  2YEV B;  4R8C A;  5KHJ A;  1W59 A;  2ZDI A;  3ABM C;  4DV3 B;  4FM0 A;  1SZT A;  4LF6 B;  2WLH A;  3AG2 B;  4H13 B;  2WLI B;  3T1Y B;  3AK2 A;  2EJ7 A;  4CC6 A;  4PDM A;  4KL1 A;  3JAL A;  4WFG A;  1PPJ H;  3ETQ A;  3N2G B;  4Q20 A;  3G80 A;  3JAM N;  4TV8 A;  2WLN A;  5GON A;  1I7F A;  1P49 A;  1S0V A;  1HW7 A;  5L3C A;  2DYR B;  4I4T B;  1SQP H;  4DV7 O;  1GN2 A;  1IBK B;  1V55 B;  5EZY A;  5LOV B;  3Q4H A;  2V4D A;  5KHI A;  3ZRV A;  4MTO A;  5KX5 B;  4B08 A;  4IT5 A;  4DV3 O;  1VQ5 V;  3CC2 V;  1Y66 A;  4CH6 A;  4GX5 A;  1AP5 A;  2XT9 A;  3E22 A;  4DR2 B;  3T1C A;  4LF6 O;  3ZMU A;  2DJV A;  2F43 G;  4G28 B;  3T1Y O;  1G4Y B;  1TUE B;  1WB8 A;  4WCE V;  1PD3 A;  2EIL B;  4FPP A;  4Q6G A;  1WA8 B;  1GN4 A;  1KQS U;  1N33 O;  2QWQ B;  4JI5 B;  5J2T B;  2Q67 A;  4J42 A;  1MSD A;  4WFE A;  2NLJ C;  4JV5 B;  2F66 C;  3UM7 A;  4O2A B;  4RUE A;  1IBK O;  4YY3 B;  4J7K A;  4O4I B;  3SDL A;  5B66 Z;  2M6Y A;  4B3T O;  2UXN A;  1QNM A;  4FFK A;  3JD4 A;  2ZNI A;  2Q9L A;  1OZ0 A;  1QLE C;  4DR2 O;  1KEC A;  3L9D A;  1NH2 B;  4FLZ A;  4EEQ A;  1ZLZ A;  3E8F A;  5HFM A;  2QM7 A;  4ZI7 B;  1XUQ A;  1L1F A;  4U3J A;  4QJF B;  1G1X B;  2OYQ A;  1DGS A;  1GKF A;  1WPX A;  4DXW A;  1K97 A;  4JI5 O;  3K59 A;  5CBG A;  4TUY A;  3ETE A;  5B1O A;  2E75 B;  4ZHQ A;  2ZE5 A;  2B9Z A;  3G67 A;  4JI8 B;  2R9A A;  2EBO A;  3CRA A;  3H1I H;  1Y4M A;  4X89 A;  2D3O W;  4X1K B;  4WF9 V;  4YY3 O;  1EBO A;  3BRC A;  4IGG A;  4O4L A;  5IJ9 A;  4B3R O;  1WPB A;  5CB4 A;  3CYO A;  1EZV H;  3FFQ A;  2JJ1 G;  5CA1 A;  2OT5 A;  2XAH A;  4DR7 B;  3SPG A;  5KMG A;  1ZWI C;  4TV8 B;  2VWK A;  3FD9 A;  1SZX A;  2Q6A A;  3CX5 F;  2K1E A;  1GAX A;  1H2N A;  1ORQ C;  2CTP A;  5D5P A;  1H2M A;  4X1Y A;  3P32 A;  1YTF D;  4I7Z B;  1Q82 W;  4JI6 B;  2V1D A;  3Q4H B;  3BPZ A;  4I50 B;  1PNM A;  4FLW A;  2NR5 A;  3L75 H;  5KHG A;  1K7D A;  3E22 B;  4JI8 O;  1VQ6 V;  2OCH A;  1LR1 A;  1IZ3 A;  4J9Z B;  2EUL A;  4JYB A;  2A7W A;  3LNM B;  1N34 B;  1F7Y A;  1EFR G;  4IYH A;  2KG7 B;  4DR7 O;  5DN6 G;  1THZ A;  2VWJ A;  3E8G A;  5CA3 A;  2QKS A;  2VQF B;  5LHG A;  1XDC A;  2JK5 C;  5J9P C;  3JD1 A;  3HKD A;  3UT5 B;  4CC5 A;  3ZMT A;  5LXT A;  4QPJ A;  2EX3 A;  1GM7 A;  1SF9 A;  1YDX A;  1ZSP A;  3LDE A;  1E1R G;  3AK1 A;  4UCT A;  3F5W C;  4JI6 O;  5B3S B;  4I0X A;  1OCO B;  1GO3 F;  2ZT9 B;  2IBZ H;  3AEI A;  1KC8 W;  2UXB B;  1N36 B;  1M57 B;  1TUB A;  4YHH B;  2QEX V;  3OEE G;  3B2E E;  1JX9 A;  1Y67 A;  1FXH A;  3ZHS A;  1HNX O;  4GKJ B;  1R3K C;  3WB2 A;  3PJS K;  5A9G A;  1LUV A;  1Q8I A;  1N34 O;  2GBO A;  4DR1 O;  5DEC A;  4I55 A;  1SS3 A;  1AR5 A;  4JTD B;  1LUW A;  5B1B C;  3K0G A;  2P5O A;  1AVM A;  2VQF O;  5H2F Z;  5L3E A;  2ZQM A;  4B7E A;  1S5L Z;  1R73 A;  3TCU A;  1Y76 A;  2WWW A;  5IJ9 B;  4Z1V A;  3SJC C;  1U96 A; 
#chains in the Genus database with same CATH homology
 1WJZ A;  2M6Y A;  2QWN B;  3UO3 A;  1IUR A;  2CTR A;  1FAF A;  2PF4 E;  2DN9 A;  2LO1 A;  2GUZ B;  2QSA A;  2QWQ B;  2Y4U A;  2YS8 A;  2QWP B;  3AG7 A;  4J7Z A;  2GUZ A;  4RWU A;  4IT5 A;  1BQZ A;  1GH6 A;  2CUG A;  2L6L A;  1HDJ A;  1N4C A;  1XBL A;  2CTP A;  2DMX A;  2CTQ A;  2QWR B;  2N04 A;  1FPO A;  2CTW A;  2OCH A;  2Y4T A;  2KQX A;  3BVO A;  3APO A;  2YUA A;  2QWO B;  2LGW A;  3APQ A;  4J80 A;  2EJ7 A;  1NZ6 A;  3UO2 A;  2N05 A;  1BQ0 A;  3UCS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...