1WJZA

Soluiotn structure of j-domain of mouse dnaj like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1700030A21Rik protein
publication title Soluiotn structure of J-domain of mouse DnaJ like protein
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 14
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1wjzA00
2QWQB 2EJ7A 2YS8A 1WJZA 3UO3A 2M6YA 3APQA 1GH6A 1N4CA 4RWUA 2N05A 2Y4UA 1NZ6A 2DMXA 3UCSC 2LGWA 2CTWA 2YUAA 2QWPB 2L6LA 2OCHA 2GUZB 2QWOB 1FPOA 2QWNB 1XBLA 2QWRB 4J80A 1IURA 2PF4E 3BVOA 1FAFA 2CUGA 2CTQA 2GUZA 3AG7A 2CTRA 2DN9A 2LO1A 2Y4TA 2N04A 3APOA 4IT5A 4J7ZA 3UO2A 1BQ0A 1BQZA 2KQXA 2QSAA 1HDJA 2CTPA
chains in the Genus database with same CATH superfamily
1AJPA 5IJ9B 4I0XB 2ZT9B 1K7DA 1B6QA 3PN1A 3TGUH 2RNBA 3GWOA 4GX5A 2EIMC 3B4SA 1Q6HA 4MTGA 1OCCC 1AI6A 2HJDA 4D7TA 1QHTA 5KA6A 1EZJA 3KCYA 2E3CA 3UO3A 3JAKA 3OMIB 3WU2Z 1KBHA 2JS3A 3ICXA 3ABMB 4GX2A 4YY3B 1LNQA 1K3EA 4XDKA 5CMUA 2LJ2A 1IDSA 3L9DA 2GUZA 1GMGA 2W0FC 4JI1B 1H2SB 4ZHQB 1MA1A 3SDLA 2QJ1A 3P30A 5BXZA 3HKEB 3CMEV 3P3PA 2JVDA 4MTFA 3SYQA 4NB5A 3LNNA 4J80A 3ASNB 4KXRA 4LC1A 3W7TA 3ZJZA 1JOYA 2JEUA 2DQ3A 1GN6A 2JGDB 1S77D 1RPOA 3QF7A 3CYOA 3RYIB 2Y4UA 4X1KB 4NYKA 5H2FZ 1BZKA 2HVJC 5LP6A 2ODMA 4HYOA 1FJGB 2HKOA 1S3JA 1KECA 2P6JA 3MDSA 5JH7A 1SS3A 1K4CC 3U10A 3VOUA 2BSKA 1Z2GA 3KKYA 2JJ1G 3AG1C 3M7MX 4FLUA 1WA8A 3JYCA 1NVPB 1Q90D 4AI8A 3L70H 1HNZB 1PNLA 5LHGA 1V54C 3CMAV 4JASA 2OTJV 1L0NH 5B3SC 2WA3A 2WLNA 4JI8O 1YJWV 4G27B 3ZRWB 3OAAG 4UCVA 1K8AW 2WAMA 1MZFA 5LBQA 2WPDG 1SRYA 1TVKA 2F4VO 4OGQB 3WB2A 4LF7O 3RT3C 2P67A 1WLEA 3BFRA 5LA6A 2YUAA 1P7BA 3GB7C 4K8XA 3E86A 2GHYA 3Q4HA 2UXBO 4JPRA 4MVMA 5CA1B 4WFGA 3APOA 4LF8B 1K33A 2CGOA 3ZHUA 5EBLC 5IYZB 2HLDG 5IJ0A 1EN6A 1W2BU 3O9OA 1VQ4V 1G8MA 3U0ZA 3VBBA 3E22B 4PI2A 1YZBA 4HAMA 3ZS8C 1XREA 2ILMA 3RVZA 3ABLB 3X2QC 2NR5A 1G4YB 4O2BA 3RYFA 1LR1A 4GKKO 3K5LA 3FB7C 1WJZA 4IGGA 3QO8A 2B1IA 1J95A 1NQTA 4IYHA 1ZTEA 3N2GA 1KC8W 1M1KW 1XMOB 3ZN1A 1N36B 1FXHA 1ZWIC 1E79G 4B3SO 4LF6B 2X6AA 1HWYA 1KKCA 2ADQB 3HPLC 4X62B 4DV3B 1PPJH 4P2ZA 4RQFA 4EB6B 4JTAB 1SKVA 5IY5B 3B77A 3TJTA 1AVMA 1PKXA 3CCJV 4PV1B 2YI9A 2VQEO 3D3IA 3HKBB 2Y0IA 5E79Z 2OIEA 3K5MA 2CTRA 2OTLV 4I4TB 1ENVA 3FYIB 2ADPA 2MW2B 2AZ0A 1N32O 3ZRSA 1J5EO 4U3FH 5CA0A 4QE7A 1G1XB 4MS2A 1Z5WA 1VQKV 3IGAC 2QKSA 3ZBHA 2JK5C 5IJ9A 4I55A 1AJQA 5LHIA 4I0XA 1BMFG 4AHCA 2UUAB 2R9AA 1QR8A 4PA7A 3CPWU 4RUEA 2ZCEA 5GW7A 4R8CA 3OTOO 3B8NA 4KFMA 1ZSPA 1Y76B 4K3AA 2M6YA 1US6A 3BABA 1T5EA 1ZLZA 2HEPA 2BOBC 3CCLV 1GO3F 4NVPA 1WNSA 1I94B 1FFXA 2YSUB 4RUFA 5L3EA 3JD4A 4FPPA 2Z0AA 3AG3C 2GV9A 2Q7EA 3FKSG 4H44B 1VQLV 1XHXA 3AK3A 4DR2B 4WBNB 1N34B 4J9ZB 1H2GA 4YIOA 3UKMA 3G4SV 2P22C 4FMTA 3K06A 4GZRB 3OW2U 4NTYA 2XAFA 2QWRB 1D5AA 4DR1O 1VQNV 2PGGA 3EHBB 2ZINA 5KHIA 3IAYA 3ZIAG 1AJNA 1TUBB 1EM1A 1BS3A 1XNQO 2CH7A 2B1GA 2X6CA 2DYSB 3MD0A 2HVKC 2XTAA 2Y0PA 4LH7A 4X1KA 3OM3B 4I9QA 3CJHA 1F51A 4JYAO 3ML0A 4LF5B 3H1HH 2RCVA 2D2CB 4CBCA 4PELA 5JJJB 1W0KG 1SERA 2YICA 3K79A 4JTDB 4BW9A 2ZXWB 1M56B 2DMXA 3THOA 1JFFB 1D5NA 1QVFU 1L8DA 3AG2C 3BAAA 3R66A 4BIOA 1FXKC 3LNMB 4EEQA 2E5LO 2X6BA 2WLJA 1XMQO 3L74H 2OCCC 5FNVA 4O4JA 4OX9O 4DR7O 4G28B 5B1AB 4TT3G 3FB6C 3SJAC 4CH3A 3ETGA 5EK0A 2P4KA 3L72H 1KD1W 1FXVA 3T1CA 3CRQA 3APQA 5EBWC 4CH6A 2Q69A 3S3XA 4EFEA 5L3FA 2RQ6A 3OR6C 4LF8O 3CC7V 3DGEA 2R72A 4LBEC 1QVGU 4UB8Z 1VQ6V 3CC2V 4JI6O 2PI5A 2IH3C 1K97A 3J81N 1B04A 4GX1A 3H9VA 3JAWB 4JI2O 3ZCCA 3W7SA 1N33O 4JI8B 3OTFA 4YJ2B 3K04A 4X1YB 1OCZB 4JI4B 2F4VB 3RYCA 4LF7B 3TCUA 5JJEB 4NXNB 5IYDO 5J2TA 4LF9O 4FLVA 1OCRC 3SJQC 4R6ZA 5JQGA 1ZX3A 3DXRA 3T1YO 3ASOC 4FFKA 4KUMA 4PI0A 2ZNJA 5CA3A 5B1BC 1B3QA 1K4DC 1FXKA 2C2AA 5LXTA 1A32A 1YVWA 3WB1A 2UXCO 4DV5O 3HKCB 2QWNB 3ABKB 4J7KA 1M93A 4DYLA 1NH2B 3BEHA 4B7KA 1NU1H 2ATKC 4DV3O 3R65A 2EBOA 1QU7A 2ZDIC 4N21A 2G38A 1COWG 1PM9A 2EZPA 3UCSC 1HP8A 4JI7O 4LFBO 5BR8B 2DYSC 3G67A 5BZBA 4K0KO 1RFYA 1UFIA 2LFSA 1KKDA 4I4TA 5K1PA 2ZIOA 4K8ZA 4GKKB 4HNAB 2PYJA 3H1JH 2EULA 3CE2A 4MVRA 4I50B 1FD9A 2Q6AA 3W7UA 4U3JB 4QGPA 3I56V 4WFFA 4U7OA 2B9ZA 1JR9A 1BQZA 3LDEA 5LMNO 1SQPH 2W6IG 3DTUB 4W4KA 3IC9A 5JVDA 1M56C 3MAQA 4B3SB 3AG4B 5FPOA 4B7EA 5LYJB 2UUAO 3SPJA 2N74A 3K0DA 4UVAA 4TQDA 3E35A 4DR5O 1U96A 4DUYO 3S3WA 3IC7A 5HFMA 2VQEB 4ZOLA 4H0LB 1MZEA 4WFAV 4X65O 4FK5C 4XBFA 2N05A 4X66O 2CTWA 2DQ0A 2K1EA 2YXLA 3N2KB 2KSDA 5B1AC 1UPGA 1N32B 3ZX6A 4MW3A 5FPRA 2LQTA 1J5EB 3ETDA 4YIPA 1PP9H 1S0VA 2A3QA 2DE0X 1H38A 4JYBA 4JI3O 2IJIA 4J7ZA 1KU9A 1OCOB 4DW0A 3BA8A 5DECA 4FM2A 4DV7O 1AR5A 3H1IH 4LNUB 2ZDIA 3OTOB 5EZYA 2AGAA 4PDMA 2EJRA 1OZ0A 1PNMA 4O4LB 2VS0A 2PYLA 5ITZB 4LFAO 1NR1A 4TOIA 1MABG 4J7JA 4CZZA 1IBLO 2ZKOA 1RM1B 1YIJV 4TQFA 1PD3A 2W0XA 1L1FA 2IJKA 5KUKA 3I55V 3CCRV 4UCUA 2R9IA 4LF5O 3JARB 1ZL8A 3JD3A 4JV5O 4I9WA 4MVQA 1IVSA 4DR1B 3CXHF 2NN4A 3CRMA 2Z5UA 2V4DA 1OV9A 3E2EA 3KG2A 2W6JG 4TUYA 2E74B 3FB8C 3ZHVA 2ZM6O 4CH5A 1NT2B 4O2AA 4UV9A 1XNQB 1P7GA 3CB2A 3CEIA 4PD4F 3OE7G 2RMKB 2E75B 2XAGA 1XILA 5HFLA 4JYAB 1E1RG 1Q7YW 3JATB 2IH1C 2JS5A 3CCQV 1YJ9V 4TV8A 1GAXA 5C8YB 4L8JA 2A7WA 4IYIA 1SA0A 2HP8A 5A2QN 2FYUH 5EYPB 1BHAA 1F4MA 1V9PA 1JJ2U 2M7WA 1NKDA 4AQYO 2WLKA 1M5IA 5FLXN 2AW9A 3M99B 4K35A 4FLZA 1NI8A 4JYCA 1GK9A 2R70A 4Q6GA 4E4EA 2E5LB 2UUBO 3CCEV 2EIJC 1N4CA 2GBOA 4CS3A 1XMQB 3T1HB 3ZMVA 4X1IB 5KLVH 3SJBC 3CP1A 2XASA 4FIPC 1JX9A 2IJJA 4OX9B 4DR7B 4UCRA 3A0RA 1Y74B 4DV4O 1I08A 1M4UA 4ZI7A 1M57B 3SJCC 1AP6A 4JI4O 2QKCA 1GN3A 4FVMA 1S5LZ 4RWUA 3SPCA 5LOVA 3BCCH 2K9PA 2P4VA 5GONB 4NXNO 4Q20A 3IFXA 2KG7B 4PA4A 3P32A 3RN4A 4DV2O 4G2KA 2UXXA 3L73H 2R9RB 2Q67A 2A79B 1XEQA 3HKCA 4O4IB 4Z1VA 4P30A 3E89A 1BCCH 1VQ5V 1EN5A 3STLC 5KX5B 1DF5A 4JI6B 2HFEC 5D5QA 4IIJA 3ZRXA 3CS5A 4JI2B 3PJSK 3LUTB 5BMVA 1N33B 4FJCC 3G71V 5CB4B 5BR8O 3HR0A 1IZ3A 3CRAA 1RM1C 2WLLA 4LWSA 1BQ0A 4JAUA 1RPRA 1LUWA 2VQFO 2EJ7A 1H8EG 4LF4O 3ABMC 2P06A 3OUFA 4LF9B 2FL4A 4MVSA 2YEVA 3NXSA 3T1YB 2Z3YA 4LP8A 3RYHB 5IYCO 1WN7A 1Q43A 4DV1O 2ZR2A 3F5TA 2EINB 2UXCB 3WG7B 4XDJA 4TV9A 3CRRA 2QTOA 3CSXA 4DV5B 1SZXA 4I5SA 2FMLA 1VQOV 5DM6V 5DN6G 2LP7A 4IHJB 1QQCA 2RDCA 4JAVA 3RFRA 4X9QA 1MOFA 4CS4A 4JI7B 4LFBB 1NJIW 4GYCB 3ABUA 3CRCA 4K0KB 3ASNC 5CN0A 4DV0O 4DRXA 1I7FA 5IYBO 4FLTA 1IX9A 1H2NA 2UXDO 5KMGA 2Q68A 4Z2WA 4J10A 4GUNA 4H37A 5CBGA 2MK3A 2QDOA 3QNEA 4FM1A 5LMNB 3BRCA 4X8AA 3FAVB 2YIBA 1I5XA 3P3NA 3D3QA 2QM8A 4NXMO 2BTQB 4NR1A 2D3OW 3JSLA 2ITDC 2V7QG 2ITCC 4O4HB 4ABMA 3RGBA 3E8BA 3A0HZ 4FLXA 2DWDC 4DR5B 3DC5A 1WB7A 3ETQA 4DUYB 2V1DA 2NNUA 1TGOA 4JGSA 1KP3A 3IJ4A 3ZMSA 2OCHA 2WSSG 1K92A 2Q5ZA 4LH6A 4UXNA 1BE3H 1TUEB 2RN9A 4X65B 1CPYA 1CEZA 4X66B 4F6RB 2WLIB 2F23A 1M57C 1DLBA 2Q7GA 3ZMUA 4TSFG 1YSCA 4I7ZB 4JI3B 4JAAA 3HB3B 5KA5A 3FD9A 4ZHQA 4F6EA 4DV7B 3HKEA 1GN2A 2P90A 3MHSC 1YTFD 3T2MA 1VMGA 2L35A 5KHHA 4ASUG 4BIZA 4A5UB 4FM0A 3HKDB 4JI0B 2DYRB 1RSOB 4OPAA 2KQXA 3SGIA 3ZMZA 4GKJB 1H2KA 4MSWC 1OJHA 1V55B 1N8RW 4LFAB 3DSQA 4W4LA 2CK3G 1IBLB 2JGDA 3W7WA 2QWOB 3ABLC 3RYIA 2QA4V 5IWAO 1AB3A 2HR3A 4X64O 3UO2A 2Y4TA 5L3CA 3EVKA 5C8YA 3NR7A 1G6UA 2QM7A 4L87A 2LGQA 3OR7C 5E1AC 1GRJA 4JV5B 4B3TO 5LHHA 1H8HG 2EINC 2EZOA 3WG7C 4PA3A 1BHBA 3OFNG 2ZM6B 3C3TA 3JAKB 2XOKG 1KYOF 4J11A 4OXSA 1GM9A 4QPKA 4ICGA 1YITV 3RWRD 5IT9N 2X0LA 2H3OA 1GM8A 4BW5A 3T1HO 4EFBA 2EIKB 3GVMA 2YS8A 1DGSA 5IY5C 3JALB 4YXWG 2Q8VA 1Y74A 3ZRWA 2JRIA 2GUZB 2PI4A 4MW8A 4R7CA 1Q6UA 4CC5A 5EC1C 4YJ3B 4XDLA 3K03A 3FB5C 4BR6A 2Q0AA 2OWOA 3JAMN 4WFHA 4KHPO 3SR2C 2X7RB 2EILB 3ZRVA 1GH6A 2ZIMA 5CA1A 1P4RA 5H5NA 4AQYB 4N23A 1K5SA 3ZHQA 2UUBB 4GT1A 5K1XA 2AZ2A 5KX5A 5IYZA 3SPIA 4RQEA 2XAQA 2PF4E 1H2MA 1X4TA 3E22A 4JTCB 3LDCA 2GDSA 1CP9A 2WWWA 3T4DA 3MHHC 2ZR3A 5LP6B 2LW7A 3CC4V 4WF9V 5JH7B 4DV4B 1SQGA 1GKFA 3SYPA 4DR3O 4DR4O 1XL6A 2BSKB 2EIMB 4D6TH 3O65A 1OCCB 1WA8B 4B3MO 2JEXA 4DV2B 2XAJA 2XAHA 2PY5A 1XOUA 2ZNIA 1IXMA 4KP4A 1IBMO 3UT5B 1THZA 5B1NA 2LW1A 3OUSA 5KUMA 3BY6A 3G6BA 3BA9A 3KCXA 2UUCO 4EB6A 1TVKB 1QR9A 2YI8A 1SZTA 2YIAA 4DW1A 1DTOA 1O9HA 3D36C 3W7XA 1FAFA 3JASB 4UVCA 3BHPA 5LA6B 1AILA 2Q0OC 4UCSA 3N27A 5LMUO 4PDRA 2FB5A 1SQBH 3CHXA 3ZHRA 3HKBA 3Q4HB 3H1LH 4B08A 4J42A 4AILC 1AR1B 1SQQH 3JCUZ 2KB1A 2VQFB 1SF9A 4LF4B 3CX5F 4LFCO 4H33A 2P7TC 4DUZO 4BWAA 3CCSV 5IJ0B 3OMNB 2OIGA 1VQPV 4DV1B 1OHHG 3AEIA 3LSSA 2ZXWC 3RVYA 2XUMA 3K0GA 4WCEV 4QJFB 4WFBV 4O2BB 4O4HA 4EKWA 3RYFB 1X59A 4FZ1A 4JZ2A 1Y76A 2JIZG 2Y69B 1BSMA 4CS2A 3TETA 1EZVH 4OPHA 2N04A 4PDLA 3N2GB 4DV0B 4UVBA 1P49A 1Y66A 2LGWA 1YI2V 3AG1B 5LGNA 2UXDB 5KAFZ 1S76D 3B2EE 2F66C 4WBNA 1IURA 4GLXA 5A9GA 3ABTA 5FL7G 1NBMG 4X20B 5B3SB 3CCVV 1YXBA 2QGNA 4NXMB 4GX0A 2XNDG 3C90A 2OT5A 3FYEB 1HNWO 4MVUA 4Z1MG 3EXAA 2WLMA 3CCMV 3D36A 1TUBA 1VQ8V 1FPOA 4JI0O 1VARA 3RBZA 5CA0B 4GKJO 1S72V 5LP6C 4UCTA 2QSAA 5KHGA 1PL0A 3EFFK 4I55B 4ZIBA 5J2UB 2Y48A 1OCZC 1FYJA 3VQVA 2FKXA 3M8AA 1MSWD 4P9OA 4DK1A 1LUVA 1XNRO 3I5DA 3X2QB 1R6KA 2BOCC 1JFFA 4FZ0A 3VQXA 3ZEDA 1UJWB 1CXZB 1JJOA 1EBOA 2H94A 1O9GA 1XUQA 2CTPA 2DJVA 1FFXB 4CH4A 2YIBD 1R3JC 1Q81W 2DW4A 1VEWA 2A0LA 2CAZC 3A0BZ 1QNMA 3AK1A 3ABKC 3T4ZA 1ROPA 2GTSA 3JALA 3UQ8A 2QM4A 2ZE7A 3SYAA 5EIBC 5L3BA 4E2LA 1QLEB 2JDIG 1AI5A 1N0JA 5IWAB 4PA6A 4YJ3A 3A8TA 1WAZA 2ZQMA 2E76B 2QTSA 4X64B 3J7AU 1YEWA 1K9MW 1SESA 1HNXO 1PV0A 2NLJC 5B5EZ 4B3TB 3GWKC 1K73W 2CH7B 2CDYA 4CC6A 1VQMV 3AG4C 2QWQB 1QBZA 4RAIA 2IBZH 3CJHB 3SPGA 5C93A 1P84F 2Y69C 1BGYH 4H13B 3TK1A 3JAWA 1PNKA 3K57A 1SC5B 5LGUA 4YJ2A 3VQWA 1MG1A 4X1YA 1Q3EA 5H6QA 1S5JA 2FTKA 1VP7A 5IDJA 3JD0A 3QG5A 1R3LC 1IXBA 4P9PA 2H8PC 4KHPB 4FLWA 3QO7A 1IBKO 1AI4A 3K5OA 1HR0O 4DR6O 3UT5A 2ZE5A 2GTAA 1B06A 1OCOC 1ORQC 1KQSU 3TXQA 3LDDA 3L75H 3AG7A 2BE3A 5FNVB 4DXWA 4O4JB 3AG3B 1M90W 3JASA 4FLYA 5EBMC 3SYCA 1GM7A 4PHZA 5BY1A 1NVPD 3H01A 4HNAA 5GTHZ 1VQ7V 4DR3B 4NKGB 5KAIZ 4DR4B 2YC0A 2BTOA 1NTKH 3ZHTA 4I50A 2HHHO 1QCEA 3JD1A 1WP7A 1ZUQA 4U3JA 2KKWA 4B3MB 5LGTA 3G6EV 3CD6V 1IBMB 3OD4A 4MTOA 1NS1A 2VRZA 5F2VO 2OYQA 2DWEC 5LYJA 1VIBA 1XDCA 2HJFC 1URFA 5EC2C 2UUCB 4FFBB 2A06H 3J80N 3RYCB 1NTZH 3B40A 5LMUB 2L6LA 2EX3A 5J2TB 1R6NA 4DV6O 5JQGB 3QO5A 4B3RO 3DXRB 3FX7A 1QLEC 2IW5A 4ZKIA 1F23A 1JA8A 3AG2B 3N2KA 5JCOC 1FXKB 3D8CA 5LXTB 2Q73A 4LFCB 1YDXA 1L0LH 2DOSA 2OCCB 4DUZB 5LL6Y 4X20A 4YHHO 1Y6XA 3OEHG 2UU9O 2QWPB 2O57A 4BIUA 3KZIZ 2F43G 2XT9A 4J41A 1E1QG 1JMKC 3CXCU 4LNUA 4JI5O 4BAYA 4PA9A 2A9HA 2CE4A 1MSDA 4MVOA 5IE9A 1HDJA 3F7VC 1Y67A 2IM9A 1YCIA 4O4LA 5ITZA 5L3GA 1YTFB 3E8FA 3TXSA 3U11A 5J2UA 1VF6C 2YIDA 2HG5C 5JVDB 1QLNA 1N0NA 5AG2A 3SYOA 2LO1A 4UV8A 4TWKA 2QE7G 1JQ0A 2GSMB 3JARA 3H1KH 4JYYA 4IL6Z 1WP8A 1U97A 2Q4PA 3E8HA 3JSNA 1Q6IA 1NTMH 1HNWB 5TISZ 3K9SA 1MMMA 5DEDA 4ZOLB 2PZSA 1XQ8A 1ZAUA 2CUGA 1M9NA 3LSUA 4U7NA 4X88A 3SPHA 1JVMA 2P5OA 1OCRB 5KHKA 5JJNB 4LR3A 4YY3O 4R50A 3BVOA 1AROP 3K9AA 5H6RA 1KP2A 3ASOB 1Q82W 3JCZA 3OMAB 5JCOA 5B1BB 2YXYA 5L3DA 3C3SA 2JJ2G 4JI1O 1YHQV 3JATA 1R3IC 1WPBA 3K58A 3WB0A 5EZYB 1XNRB 3VQYA 1YJNV 3UM7A 1AP5A 5EYPA 1GTOA 2B5UA 1SQFA 3WFVA 1Q86W 2AHYA 3JD2A 3F5WC 5J9PC 4UUJC 3K3WA 4D7SA 5B1OA 4X1IA 4PDVA 2DN9A 3B09A 1FS0G 1NR7A 5D5PA 3A2FA 4HBNA 1VF6A 1FJGO 2VWJA 2QEXV 2WA4A 4JF3A 1ZL8B 4WFEA 3STZC 4ZBMA 1YF2A 3E8GA 1D2DA 2F1MA 4QE9A 5GONA 1I5YA 4TUYB 1HNXB 2KG7A 2RJZA 4O2AB 1HNZO 1AI7A 3FFQA 2PTMA 1Y4MA 2AHZA 3CWBH 4O4IA 5H9CA 1I0HA 1W59A 3E83A 1FKAO 2UXNA 4QIWF 4QNHB 2WLHA 2ZE8A 2CTQA 2VWKA 1BT8A 2CGNA 3ZMTA 5CB4A 4TV8B 1XHZA 1R1BA 4PJ0Z 1VQ9V 5B66Z 1FFTB 1SA0B 1TAEA 4JZGA 3L71H 1R73A 4UCOA 1XBLA 1EN4A 1Z5VA 1IBKB 1DK1A 3K5NA 1HR0B 4DR6B 1KUQA 3RYHA 1WPXA 3ETEA 1H2LA 1GN4A 4UFZA 1NZ6A 3LSQA 4FFBA 2XHBA 4ZI7B 4IHJA 1KMIZ 2DYRC 5LOVB 5CBHA 2JGUA 2UXBB 2Q7HA 1V55C 1XMOO 3OEEG 2ZE6A 2IU3A 4RO2A 4NTXA 4DK0A 1N36O 3CCUV 1XI1A 3BPZA 4LF6O 2QR4A 2HHHB 1SETA 1Q8IA 2ARHA 1JPXA 2Q9LA 2ZD9A 1AR4A 4MTXA 3B8MA 4X62O 4J9YB 2ETNA 3OT7A 4KL1A 3FAVA 1F7YA 2IU0A 1BL8A 1XL4A 4IIJB 2BTQA 1K34A 2IJHA 4C7UA 1HW7A 4HZ3A 5BMVB 4LCUC 2F93B 3AK2A 5GTIZ 1SQVH 3QTCA 2BCCH 1TA8A 2WLLB 4LWSB 3ZN0A 1S5HC 4UB6Z 4MT8A 3DC6A 4F4LA 1JCHA 4DV6B 1NH2D 4MVZA 1KB9F 1F4NA 2LFRA 2YEVB 4B3RB 2EIKC 5EIBD 4NTWA 4F6RA 2WLIA 1K5QA 1WB8A 1PL4A 4TV9B 2EIJB 5KHJA 5CBFA 2YXHA 2YDEA 4YHHB 2UU9B 1V54B 4GCZA 2F95B 3K59A 4DO2A 1R6TA 3QVNA 2EILC 3F7YC 5JWPA 4JI5B 3HKDA 1I94O 1RSOA 1SQXH 3K08A 4X89A 4DRXB 3G80A 2QKAA 1VF5B 1EFRG 1MNGA 4QPJA 2PUSA 3ZHSA 5KMGB 1DF4A 2AXTZ 4DR2O 1N34O 1RP3B 3OGCC 4IT5A 3OGIB 1VF7A 1Q5OA 1R3KC 1W0JG 3RW0A
chains in the Genus database with same CATH topology
2QWQB 2EJ7A 2YS8A 1WJZA 3UO3A 2M6YA 3APQA 1GH6A 1N4CA 4RWUA 2N05A 2Y4UA 1NZ6A 2DMXA 3UCSC 2LGWA 2CTWA 2YUAA 2QWPB 2L6LA 2OCHA 2GUZB 2QWOB 1FPOA 2QWNB 1XBLA 2QWRB 4J80A 1IURA 2PF4E 3BVOA 1FAFA 2CUGA 2CTQA 2GUZA 3AG7A 2CTRA 2DN9A 2LO1A 2Y4TA 2N04A 3APOA 4IT5A 4J7ZA 3UO2A 1BQ0A 1BQZA 2KQXA 2QSAA 1HDJA 2CTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWQ B;  2EJ7 A;  2YS8 A;  1WJZ A;  3UO3 A;  2M6Y A;  3APQ A;  1GH6 A;  1N4C A;  4RWU A;  2N05 A;  2Y4U A;  1NZ6 A;  2DMX A;  3UCS C;  2LGW A;  2CTW A;  2YUA A;  2QWP B;  2L6L A;  2OCH A;  2GUZ B;  2QWO B;  1FPO A;  2QWN B;  1XBL A;  2QWR B;  4J80 A;  1IUR A;  2PF4 E;  3BVO A;  1FAF A;  2CUG A;  2CTQ A;  2GUZ A;  3AG7 A;  2CTR A;  2DN9 A;  2LO1 A;  2Y4T A;  2N04 A;  3APO A;  4IT5 A;  4J7Z A;  3UO2 A;  1BQ0 A;  1BQZ A;  2KQX A;  2QSA A;  1HDJ A;  2CTP A; 
#chains in the Genus database with same CATH topology
 1AJP A;  5IJ9 B;  4I0X B;  2ZT9 B;  1K7D A;  1B6Q A;  3PN1 A;  3TGU H;  2RNB A;  3GWO A;  4GX5 A;  2EIM C;  3B4S A;  1Q6H A;  4MTG A;  1OCC C;  1AI6 A;  2HJD A;  4D7T A;  1QHT A;  5KA6 A;  1EZJ A;  3KCY A;  2E3C A;  3UO3 A;  3JAK A;  3OMI B;  3WU2 Z;  1KBH A;  2JS3 A;  3ICX A;  3ABM B;  4GX2 A;  4YY3 B;  1LNQ A;  1K3E A;  4XDK A;  5CMU A;  2LJ2 A;  1IDS A;  3L9D A;  2GUZ A;  1GMG A;  2W0F C;  4JI1 B;  1H2S B;  4ZHQ B;  1MA1 A;  3SDL A;  2QJ1 A;  3P30 A;  5BXZ A;  3HKE B;  3CME V;  3P3P A;  2JVD A;  4MTF A;  3SYQ A;  4NB5 A;  3LNN A;  4J80 A;  3ASN B;  4KXR A;  4LC1 A;  3W7T A;  3ZJZ A;  1JOY A;  2JEU A;  2DQ3 A;  1GN6 A;  2JGD B;  1S77 D;  1RPO A;  3QF7 A;  3CYO A;  3RYI B;  2Y4U A;  4X1K B;  4NYK A;  5H2F Z;  1BZK A;  2HVJ C;  5LP6 A;  2ODM A;  4HYO A;  1FJG B;  2HKO A;  1S3J A;  1KEC A;  2P6J A;  3MDS A;  5JH7 A;  1SS3 A;  1K4C C;  3U10 A;  3VOU A;  2BSK A;  1Z2G A;  3KKY A;  2JJ1 G;  3AG1 C;  3M7M X;  4FLU A;  1WA8 A;  3JYC A;  1NVP B;  1Q90 D;  4AI8 A;  3L70 H;  1HNZ B;  1PNL A;  5LHG A;  1V54 C;  3CMA V;  4JAS A;  2OTJ V;  1L0N H;  5B3S C;  2WA3 A;  2WLN A;  4JI8 O;  1YJW V;  4G27 B;  3ZRW B;  3OAA G;  4UCV A;  1K8A W;  2WAM A;  1MZF A;  5LBQ A;  2WPD G;  1SRY A;  1TVK A;  2F4V O;  4OGQ B;  3WB2 A;  4LF7 O;  3RT3 C;  2P67 A;  1WLE A;  3BFR A;  5LA6 A;  2YUA A;  1P7B A;  3GB7 C;  4K8X A;  3E86 A;  2GHY A;  3Q4H A;  2UXB O;  4JPR A;  4MVM A;  5CA1 B;  4WFG A;  3APO A;  4LF8 B;  1K33 A;  2CGO A;  3ZHU A;  5EBL C;  5IYZ B;  2HLD G;  5IJ0 A;  1EN6 A;  1W2B U;  3O9O A;  1VQ4 V;  1G8M A;  3U0Z A;  3VBB A;  3E22 B;  4PI2 A;  1YZB A;  4HAM A;  3ZS8 C;  1XRE A;  2ILM A;  3RVZ A;  3ABL B;  3X2Q C;  2NR5 A;  1G4Y B;  4O2B A;  3RYF A;  1LR1 A;  4GKK O;  3K5L A;  3FB7 C;  1WJZ A;  4IGG A;  3QO8 A;  2B1I A;  1J95 A;  1NQT A;  4IYH A;  1ZTE A;  3N2G A;  1KC8 W;  1M1K W;  1XMO B;  3ZN1 A;  1N36 B;  1FXH A;  1ZWI C;  1E79 G;  4B3S O;  4LF6 B;  2X6A A;  1HWY A;  1KKC A;  2ADQ B;  3HPL C;  4X62 B;  4DV3 B;  1PPJ H;  4P2Z A;  4RQF A;  4EB6 B;  4JTA B;  1SKV A;  5IY5 B;  3B77 A;  3TJT A;  1AVM A;  1PKX A;  3CCJ V;  4PV1 B;  2YI9 A;  2VQE O;  3D3I A;  3HKB B;  2Y0I A;  5E79 Z;  2OIE A;  3K5M A;  2CTR A;  2OTL V;  4I4T B;  1ENV A;  3FYI B;  2ADP A;  2MW2 B;  2AZ0 A;  1N32 O;  3ZRS A;  1J5E O;  4U3F H;  5CA0 A;  4QE7 A;  1G1X B;  4MS2 A;  1Z5W A;  1VQK V;  3IGA C;  2QKS A;  3ZBH A;  2JK5 C;  5IJ9 A;  4I55 A;  1AJQ A;  5LHI A;  4I0X A;  1BMF G;  4AHC A;  2UUA B;  2R9A A;  1QR8 A;  4PA7 A;  3CPW U;  4RUE A;  2ZCE A;  5GW7 A;  4R8C A;  3OTO O;  3B8N A;  4KFM A;  1ZSP A;  1Y76 B;  4K3A A;  2M6Y A;  1US6 A;  3BAB A;  1T5E A;  1ZLZ A;  2HEP A;  2BOB C;  3CCL V;  1GO3 F;  4NVP A;  1WNS A;  1I94 B;  1FFX A;  2YSU B;  4RUF A;  5L3E A;  3JD4 A;  4FPP A;  2Z0A A;  3AG3 C;  2GV9 A;  2Q7E A;  3FKS G;  4H44 B;  1VQL V;  1XHX A;  3AK3 A;  4DR2 B;  4WBN B;  1N34 B;  4J9Z B;  1H2G A;  4YIO A;  3UKM A;  3G4S V;  2P22 C;  4FMT A;  3K06 A;  4GZR B;  3OW2 U;  4NTY A;  2XAF A;  2QWR B;  1D5A A;  4DR1 O;  1VQN V;  2PGG A;  3EHB B;  2ZIN A;  5KHI A;  3IAY A;  3ZIA G;  1AJN A;  1TUB B;  1EM1 A;  1BS3 A;  1XNQ O;  2CH7 A;  2B1G A;  2X6C A;  2DYS B;  3MD0 A;  2HVK C;  2XTA A;  2Y0P A;  4LH7 A;  4X1K A;  3OM3 B;  4I9Q A;  3CJH A;  1F51 A;  4JYA O;  3ML0 A;  4LF5 B;  3H1H H;  2RCV A;  2D2C B;  4CBC A;  4PEL A;  5JJJ B;  1W0K G;  1SER A;  2YIC A;  3K79 A;  4JTD B;  4BW9 A;  2ZXW B;  1M56 B;  2DMX A;  3THO A;  1JFF B;  1D5N A;  1QVF U;  1L8D A;  3AG2 C;  3BAA A;  3R66 A;  4BIO A;  1FXK C;  3LNM B;  4EEQ A;  2E5L O;  2X6B A;  2WLJ A;  1XMQ O;  3L74 H;  2OCC C;  5FNV A;  4O4J A;  4OX9 O;  4DR7 O;  4G28 B;  5B1A B;  4TT3 G;  3FB6 C;  3SJA C;  4CH3 A;  3ETG A;  5EK0 A;  2P4K A;  3L72 H;  1KD1 W;  1FXV A;  3T1C A;  3CRQ A;  3APQ A;  5EBW C;  4CH6 A;  2Q69 A;  3S3X A;  4EFE A;  5L3F A;  2RQ6 A;  3OR6 C;  4LF8 O;  3CC7 V;  3DGE A;  2R72 A;  4LBE C;  1QVG U;  4UB8 Z;  1VQ6 V;  3CC2 V;  4JI6 O;  2PI5 A;  2IH3 C;  1K97 A;  3J81 N;  1B04 A;  4GX1 A;  3H9V A;  3JAW B;  4JI2 O;  3ZCC A;  3W7S A;  1N33 O;  4JI8 B;  3OTF A;  4YJ2 B;  3K04 A;  4X1Y B;  1OCZ B;  4JI4 B;  2F4V B;  3RYC A;  4LF7 B;  3TCU A;  5JJE B;  4NXN B;  5IYD O;  5J2T A;  4LF9 O;  4FLV A;  1OCR C;  3SJQ C;  4R6Z A;  5JQG A;  1ZX3 A;  3DXR A;  3T1Y O;  3ASO C;  4FFK A;  4KUM A;  4PI0 A;  2ZNJ A;  5CA3 A;  5B1B C;  1B3Q A;  1K4D C;  1FXK A;  2C2A A;  5LXT A;  1A32 A;  1YVW A;  3WB1 A;  2UXC O;  4DV5 O;  3HKC B;  2QWN B;  3ABK B;  4J7K A;  1M93 A;  4DYL A;  1NH2 B;  3BEH A;  4B7K A;  1NU1 H;  2ATK C;  4DV3 O;  3R65 A;  2EBO A;  1QU7 A;  2ZDI C;  4N21 A;  2G38 A;  1COW G;  1PM9 A;  2EZP A;  3UCS C;  1HP8 A;  4JI7 O;  4LFB O;  5BR8 B;  2DYS C;  3G67 A;  5BZB A;  4K0K O;  1RFY A;  1UFI A;  2LFS A;  1KKD A;  4I4T A;  5K1P A;  2ZIO A;  4K8Z A;  4GKK B;  4HNA B;  2PYJ A;  3H1J H;  2EUL A;  3CE2 A;  4MVR A;  4I50 B;  1FD9 A;  2Q6A A;  3W7U A;  4U3J B;  4QGP A;  3I56 V;  4WFF A;  4U7O A;  2B9Z A;  1JR9 A;  1BQZ A;  3LDE A;  5LMN O;  1SQP H;  2W6I G;  3DTU B;  4W4K A;  3IC9 A;  5JVD A;  1M56 C;  3MAQ A;  4B3S B;  3AG4 B;  5FPO A;  4B7E A;  5LYJ B;  2UUA O;  3SPJ A;  2N74 A;  3K0D A;  4UVA A;  4TQD A;  3E35 A;  4DR5 O;  1U96 A;  4DUY O;  3S3W A;  3IC7 A;  5HFM A;  2VQE B;  4ZOL A;  4H0L B;  1MZE A;  4WFA V;  4X65 O;  4FK5 C;  4XBF A;  2N05 A;  4X66 O;  2CTW A;  2DQ0 A;  2K1E A;  2YXL A;  3N2K B;  2KSD A;  5B1A C;  1UPG A;  1N32 B;  3ZX6 A;  4MW3 A;  5FPR A;  2LQT A;  1J5E B;  3ETD A;  4YIP A;  1PP9 H;  1S0V A;  2A3Q A;  2DE0 X;  1H38 A;  4JYB A;  4JI3 O;  2IJI A;  4J7Z A;  1KU9 A;  1OCO B;  4DW0 A;  3BA8 A;  5DEC A;  4FM2 A;  4DV7 O;  1AR5 A;  3H1I H;  4LNU B;  2ZDI A;  3OTO B;  5EZY A;  2AGA A;  4PDM A;  2EJR A;  1OZ0 A;  1PNM A;  4O4L B;  2VS0 A;  2PYL A;  5ITZ B;  4LFA O;  1NR1 A;  4TOI A;  1MAB G;  4J7J A;  4CZZ A;  1IBL O;  2ZKO A;  1RM1 B;  1YIJ V;  4TQF A;  1PD3 A;  2W0X A;  1L1F A;  2IJK A;  5KUK A;  3I55 V;  3CCR V;  4UCU A;  2R9I A;  4LF5 O;  3JAR B;  1ZL8 A;  3JD3 A;  4JV5 O;  4I9W A;  4MVQ A;  1IVS A;  4DR1 B;  3CXH F;  2NN4 A;  3CRM A;  2Z5U A;  2V4D A;  1OV9 A;  3E2E A;  3KG2 A;  2W6J G;  4TUY A;  2E74 B;  3FB8 C;  3ZHV A;  2ZM6 O;  4CH5 A;  1NT2 B;  4O2A A;  4UV9 A;  1XNQ B;  1P7G A;  3CB2 A;  3CEI A;  4PD4 F;  3OE7 G;  2RMK B;  2E75 B;  2XAG A;  1XIL A;  5HFL A;  4JYA B;  1E1R G;  1Q7Y W;  3JAT B;  2IH1 C;  2JS5 A;  3CCQ V;  1YJ9 V;  4TV8 A;  1GAX A;  5C8Y B;  4L8J A;  2A7W A;  4IYI A;  1SA0 A;  2HP8 A;  5A2Q N;  2FYU H;  5EYP B;  1BHA A;  1F4M A;  1V9P A;  1JJ2 U;  2M7W A;  1NKD A;  4AQY O;  2WLK A;  1M5I A;  5FLX N;  2AW9 A;  3M99 B;  4K35 A;  4FLZ A;  1NI8 A;  4JYC A;  1GK9 A;  2R70 A;  4Q6G A;  4E4E A;  2E5L B;  2UUB O;  3CCE V;  2EIJ C;  1N4C A;  2GBO A;  4CS3 A;  1XMQ B;  3T1H B;  3ZMV A;  4X1I B;  5KLV H;  3SJB C;  3CP1 A;  2XAS A;  4FIP C;  1JX9 A;  2IJJ A;  4OX9 B;  4DR7 B;  4UCR A;  3A0R A;  1Y74 B;  4DV4 O;  1I08 A;  1M4U A;  4ZI7 A;  1M57 B;  3SJC C;  1AP6 A;  4JI4 O;  2QKC A;  1GN3 A;  4FVM A;  1S5L Z;  4RWU A;  3SPC A;  5LOV A;  3BCC H;  2K9P A;  2P4V A;  5GON B;  4NXN O;  4Q20 A;  3IFX A;  2KG7 B;  4PA4 A;  3P32 A;  3RN4 A;  4DV2 O;  4G2K A;  2UXX A;  3L73 H;  2R9R B;  2Q67 A;  2A79 B;  1XEQ A;  3HKC A;  4O4I B;  4Z1V A;  4P30 A;  3E89 A;  1BCC H;  1VQ5 V;  1EN5 A;  3STL C;  5KX5 B;  1DF5 A;  4JI6 B;  2HFE C;  5D5Q A;  4IIJ A;  3ZRX A;  3CS5 A;  4JI2 B;  3PJS K;  3LUT B;  5BMV A;  1N33 B;  4FJC C;  3G71 V;  5CB4 B;  5BR8 O;  3HR0 A;  1IZ3 A;  3CRA A;  1RM1 C;  2WLL A;  4LWS A;  1BQ0 A;  4JAU A;  1RPR A;  1LUW A;  2VQF O;  2EJ7 A;  1H8E G;  4LF4 O;  3ABM C;  2P06 A;  3OUF A;  4LF9 B;  2FL4 A;  4MVS A;  2YEV A;  3NXS A;  3T1Y B;  2Z3Y A;  4LP8 A;  3RYH B;  5IYC O;  1WN7 A;  1Q43 A;  4DV1 O;  2ZR2 A;  3F5T A;  2EIN B;  2UXC B;  3WG7 B;  4XDJ A;  4TV9 A;  3CRR A;  2QTO A;  3CSX A;  4DV5 B;  1SZX A;  4I5S A;  2FML A;  1VQO V;  5DM6 V;  5DN6 G;  2LP7 A;  4IHJ B;  1QQC A;  2RDC A;  4JAV A;  3RFR A;  4X9Q A;  1MOF A;  4CS4 A;  4JI7 B;  4LFB B;  1NJI W;  4GYC B;  3ABU A;  3CRC A;  4K0K B;  3ASN C;  5CN0 A;  4DV0 O;  4DRX A;  1I7F A;  5IYB O;  4FLT A;  1IX9 A;  1H2N A;  2UXD O;  5KMG A;  2Q68 A;  4Z2W A;  4J10 A;  4GUN A;  4H37 A;  5CBG A;  2MK3 A;  2QDO A;  3QNE A;  4FM1 A;  5LMN B;  3BRC A;  4X8A A;  3FAV B;  2YIB A;  1I5X A;  3P3N A;  3D3Q A;  2QM8 A;  4NXM O;  2BTQ B;  4NR1 A;  2D3O W;  3JSL A;  2ITD C;  2V7Q G;  2ITC C;  4O4H B;  4ABM A;  3RGB A;  3E8B A;  3A0H Z;  4FLX A;  2DWD C;  4DR5 B;  3DC5 A;  1WB7 A;  3ETQ A;  4DUY B;  2V1D A;  2NNU A;  1TGO A;  4JGS A;  1KP3 A;  3IJ4 A;  3ZMS A;  2OCH A;  2WSS G;  1K92 A;  2Q5Z A;  4LH6 A;  4UXN A;  1BE3 H;  1TUE B;  2RN9 A;  4X65 B;  1CPY A;  1CEZ A;  4X66 B;  4F6R B;  2WLI B;  2F23 A;  1M57 C;  1DLB A;  2Q7G A;  3ZMU A;  4TSF G;  1YSC A;  4I7Z B;  4JI3 B;  4JAA A;  3HB3 B;  5KA5 A;  3FD9 A;  4ZHQ A;  4F6E A;  4DV7 B;  3HKE A;  1GN2 A;  2P90 A;  3MHS C;  1YTF D;  3T2M A;  1VMG A;  2L35 A;  5KHH A;  4ASU G;  4BIZ A;  4A5U B;  4FM0 A;  3HKD B;  4JI0 B;  2DYR B;  1RSO B;  4OPA A;  2KQX A;  3SGI A;  3ZMZ A;  4GKJ B;  1H2K A;  4MSW C;  1OJH A;  1V55 B;  1N8R W;  4LFA B;  3DSQ A;  4W4L A;  2CK3 G;  1IBL B;  2JGD A;  3W7W A;  2QWO B;  3ABL C;  3RYI A;  2QA4 V;  5IWA O;  1AB3 A;  2HR3 A;  4X64 O;  3UO2 A;  2Y4T A;  5L3C A;  3EVK A;  5C8Y A;  3NR7 A;  1G6U A;  2QM7 A;  4L87 A;  2LGQ A;  3OR7 C;  5E1A C;  1GRJ A;  4JV5 B;  4B3T O;  5LHH A;  1H8H G;  2EIN C;  2EZO A;  3WG7 C;  4PA3 A;  1BHB A;  3OFN G;  2ZM6 B;  3C3T A;  3JAK B;  2XOK G;  1KYO F;  4J11 A;  4OXS A;  1GM9 A;  4QPK A;  4ICG A;  1YIT V;  3RWR D;  5IT9 N;  2X0L A;  2H3O A;  1GM8 A;  4BW5 A;  3T1H O;  4EFB A;  2EIK B;  3GVM A;  2YS8 A;  1DGS A;  5IY5 C;  3JAL B;  4YXW G;  2Q8V A;  1Y74 A;  3ZRW A;  2JRI A;  2GUZ B;  2PI4 A;  4MW8 A;  4R7C A;  1Q6U A;  4CC5 A;  5EC1 C;  4YJ3 B;  4XDL A;  3K03 A;  3FB5 C;  4BR6 A;  2Q0A A;  2OWO A;  3JAM N;  4WFH A;  4KHP O;  3SR2 C;  2X7R B;  2EIL B;  3ZRV A;  1GH6 A;  2ZIM A;  5CA1 A;  1P4R A;  5H5N A;  4AQY B;  4N23 A;  1K5S A;  3ZHQ A;  2UUB B;  4GT1 A;  5K1X A;  2AZ2 A;  5KX5 A;  5IYZ A;  3SPI A;  4RQE A;  2XAQ A;  2PF4 E;  1H2M A;  1X4T A;  3E22 A;  4JTC B;  3LDC A;  2GDS A;  1CP9 A;  2WWW A;  3T4D A;  3MHH C;  2ZR3 A;  5LP6 B;  2LW7 A;  3CC4 V;  4WF9 V;  5JH7 B;  4DV4 B;  1SQG A;  1GKF A;  3SYP A;  4DR3 O;  4DR4 O;  1XL6 A;  2BSK B;  2EIM B;  4D6T H;  3O65 A;  1OCC B;  1WA8 B;  4B3M O;  2JEX A;  4DV2 B;  2XAJ A;  2XAH A;  2PY5 A;  1XOU A;  2ZNI A;  1IXM A;  4KP4 A;  1IBM O;  3UT5 B;  1THZ A;  5B1N A;  2LW1 A;  3OUS A;  5KUM A;  3BY6 A;  3G6B A;  3BA9 A;  3KCX A;  2UUC O;  4EB6 A;  1TVK B;  1QR9 A;  2YI8 A;  1SZT A;  2YIA A;  4DW1 A;  1DTO A;  1O9H A;  3D36 C;  3W7X A;  1FAF A;  3JAS B;  4UVC A;  3BHP A;  5LA6 B;  1AIL A;  2Q0O C;  4UCS A;  3N27 A;  5LMU O;  4PDR A;  2FB5 A;  1SQB H;  3CHX A;  3ZHR A;  3HKB A;  3Q4H B;  3H1L H;  4B08 A;  4J42 A;  4AIL C;  1AR1 B;  1SQQ H;  3JCU Z;  2KB1 A;  2VQF B;  1SF9 A;  4LF4 B;  3CX5 F;  4LFC O;  4H33 A;  2P7T C;  4DUZ O;  4BWA A;  3CCS V;  5IJ0 B;  3OMN B;  2OIG A;  1VQP V;  4DV1 B;  1OHH G;  3AEI A;  3LSS A;  2ZXW C;  3RVY A;  2XUM A;  3K0G A;  4WCE V;  4QJF B;  4WFB V;  4O2B B;  4O4H A;  4EKW A;  3RYF B;  1X59 A;  4FZ1 A;  4JZ2 A;  1Y76 A;  2JIZ G;  2Y69 B;  1BSM A;  4CS2 A;  3TET A;  1EZV H;  4OPH A;  2N04 A;  4PDL A;  3N2G B;  4DV0 B;  4UVB A;  1P49 A;  1Y66 A;  2LGW A;  1YI2 V;  3AG1 B;  5LGN A;  2UXD B;  5KAF Z;  1S76 D;  3B2E E;  2F66 C;  4WBN A;  1IUR A;  4GLX A;  5A9G A;  3ABT A;  5FL7 G;  1NBM G;  4X20 B;  5B3S B;  3CCV V;  1YXB A;  2QGN A;  4NXM B;  4GX0 A;  2XND G;  3C90 A;  2OT5 A;  3FYE B;  1HNW O;  4MVU A;  4Z1M G;  3EXA A;  2WLM A;  3CCM V;  3D36 A;  1TUB A;  1VQ8 V;  1FPO A;  4JI0 O;  1VAR A;  3RBZ A;  5CA0 B;  4GKJ O;  1S72 V;  5LP6 C;  4UCT A;  2QSA A;  5KHG A;  1PL0 A;  3EFF K;  4I55 B;  4ZIB A;  5J2U B;  2Y48 A;  1OCZ C;  1FYJ A;  3VQV A;  2FKX A;  3M8A A;  1MSW D;  4P9O A;  4DK1 A;  1LUV A;  1XNR O;  3I5D A;  3X2Q B;  1R6K A;  2BOC C;  1JFF A;  4FZ0 A;  3VQX A;  3ZED A;  1UJW B;  1CXZ B;  1JJO A;  1EBO A;  2H94 A;  1O9G A;  1XUQ A;  2CTP A;  2DJV A;  1FFX B;  4CH4 A;  2YIB D;  1R3J C;  1Q81 W;  2DW4 A;  1VEW A;  2A0L A;  2CAZ C;  3A0B Z;  1QNM A;  3AK1 A;  3ABK C;  3T4Z A;  1ROP A;  2GTS A;  3JAL A;  3UQ8 A;  2QM4 A;  2ZE7 A;  3SYA A;  5EIB C;  5L3B A;  4E2L A;  1QLE B;  2JDI G;  1AI5 A;  1N0J A;  5IWA B;  4PA6 A;  4YJ3 A;  3A8T A;  1WAZ A;  2ZQM A;  2E76 B;  2QTS A;  4X64 B;  3J7A U;  1YEW A;  1K9M W;  1SES A;  1HNX O;  1PV0 A;  2NLJ C;  5B5E Z;  4B3T B;  3GWK C;  1K73 W;  2CH7 B;  2CDY A;  4CC6 A;  1VQM V;  3AG4 C;  2QWQ B;  1QBZ A;  4RAI A;  2IBZ H;  3CJH B;  3SPG A;  5C93 A;  1P84 F;  2Y69 C;  1BGY H;  4H13 B;  3TK1 A;  3JAW A;  1PNK A;  3K57 A;  1SC5 B;  5LGU A;  4YJ2 A;  3VQW A;  1MG1 A;  4X1Y A;  1Q3E A;  5H6Q A;  1S5J A;  2FTK A;  1VP7 A;  5IDJ A;  3JD0 A;  3QG5 A;  1R3L C;  1IXB A;  4P9P A;  2H8P C;  4KHP B;  4FLW A;  3QO7 A;  1IBK O;  1AI4 A;  3K5O A;  1HR0 O;  4DR6 O;  3UT5 A;  2ZE5 A;  2GTA A;  1B06 A;  1OCO C;  1ORQ C;  1KQS U;  3TXQ A;  3LDD A;  3L75 H;  3AG7 A;  2BE3 A;  5FNV B;  4DXW A;  4O4J B;  3AG3 B;  1M90 W;  3JAS A;  4FLY A;  5EBM C;  3SYC A;  1GM7 A;  4PHZ A;  5BY1 A;  1NVP D;  3H01 A;  4HNA A;  5GTH Z;  1VQ7 V;  4DR3 B;  4NKG B;  5KAI Z;  4DR4 B;  2YC0 A;  2BTO A;  1NTK H;  3ZHT A;  4I50 A;  2HHH O;  1QCE A;  3JD1 A;  1WP7 A;  1ZUQ A;  4U3J A;  2KKW A;  4B3M B;  5LGT A;  3G6E V;  3CD6 V;  1IBM B;  3OD4 A;  4MTO A;  1NS1 A;  2VRZ A;  5F2V O;  2OYQ A;  2DWE C;  5LYJ A;  1VIB A;  1XDC A;  2HJF C;  1URF A;  5EC2 C;  2UUC B;  4FFB B;  2A06 H;  3J80 N;  3RYC B;  1NTZ H;  3B40 A;  5LMU B;  2L6L A;  2EX3 A;  5J2T B;  1R6N A;  4DV6 O;  5JQG B;  3QO5 A;  4B3R O;  3DXR B;  3FX7 A;  1QLE C;  2IW5 A;  4ZKI A;  1F23 A;  1JA8 A;  3AG2 B;  3N2K A;  5JCO C;  1FXK B;  3D8C A;  5LXT B;  2Q73 A;  4LFC B;  1YDX A;  1L0L H;  2DOS A;  2OCC B;  4DUZ B;  5LL6 Y;  4X20 A;  4YHH O;  1Y6X A;  3OEH G;  2UU9 O;  2QWP B;  2O57 A;  4BIU A;  3KZI Z;  2F43 G;  2XT9 A;  4J41 A;  1E1Q G;  1JMK C;  3CXC U;  4LNU A;  4JI5 O;  4BAY A;  4PA9 A;  2A9H A;  2CE4 A;  1MSD A;  4MVO A;  5IE9 A;  1HDJ A;  3F7V C;  1Y67 A;  2IM9 A;  1YCI A;  4O4L A;  5ITZ A;  5L3G A;  1YTF B;  3E8F A;  3TXS A;  3U11 A;  5J2U A;  1VF6 C;  2YID A;  2HG5 C;  5JVD B;  1QLN A;  1N0N A;  5AG2 A;  3SYO A;  2LO1 A;  4UV8 A;  4TWK A;  2QE7 G;  1JQ0 A;  2GSM B;  3JAR A;  3H1K H;  4JYY A;  4IL6 Z;  1WP8 A;  1U97 A;  2Q4P A;  3E8H A;  3JSN A;  1Q6I A;  1NTM H;  1HNW B;  5TIS Z;  3K9S A;  1MMM A;  5DED A;  4ZOL B;  2PZS A;  1XQ8 A;  1ZAU A;  2CUG A;  1M9N A;  3LSU A;  4U7N A;  4X88 A;  3SPH A;  1JVM A;  2P5O A;  1OCR B;  5KHK A;  5JJN B;  4LR3 A;  4YY3 O;  4R50 A;  3BVO A;  1ARO P;  3K9A A;  5H6R A;  1KP2 A;  3ASO B;  1Q82 W;  3JCZ A;  3OMA B;  5JCO A;  5B1B B;  2YXY A;  5L3D A;  3C3S A;  2JJ2 G;  4JI1 O;  1YHQ V;  3JAT A;  1R3I C;  1WPB A;  3K58 A;  3WB0 A;  5EZY B;  1XNR B;  3VQY A;  1YJN V;  3UM7 A;  1AP5 A;  5EYP A;  1GTO A;  2B5U A;  1SQF A;  3WFV A;  1Q86 W;  2AHY A;  3JD2 A;  3F5W C;  5J9P C;  4UUJ C;  3K3W A;  4D7S A;  5B1O A;  4X1I A;  4PDV A;  2DN9 A;  3B09 A;  1FS0 G;  1NR7 A;  5D5P A;  3A2F A;  4HBN A;  1VF6 A;  1FJG O;  2VWJ A;  2QEX V;  2WA4 A;  4JF3 A;  1ZL8 B;  4WFE A;  3STZ C;  4ZBM A;  1YF2 A;  3E8G A;  1D2D A;  2F1M A;  4QE9 A;  5GON A;  1I5Y A;  4TUY B;  1HNX B;  2KG7 A;  2RJZ A;  4O2A B;  1HNZ O;  1AI7 A;  3FFQ A;  2PTM A;  1Y4M A;  2AHZ A;  3CWB H;  4O4I A;  5H9C A;  1I0H A;  1W59 A;  3E83 A;  1FKA O;  2UXN A;  4QIW F;  4QNH B;  2WLH A;  2ZE8 A;  2CTQ A;  2VWK A;  1BT8 A;  2CGN A;  3ZMT A;  5CB4 A;  4TV8 B;  1XHZ A;  1R1B A;  4PJ0 Z;  1VQ9 V;  5B66 Z;  1FFT B;  1SA0 B;  1TAE A;  4JZG A;  3L71 H;  1R73 A;  4UCO A;  1XBL A;  1EN4 A;  1Z5V A;  1IBK B;  1DK1 A;  3K5N A;  1HR0 B;  4DR6 B;  1KUQ A;  3RYH A;  1WPX A;  3ETE A;  1H2L A;  1GN4 A;  4UFZ A;  1NZ6 A;  3LSQ A;  4FFB A;  2XHB A;  4ZI7 B;  4IHJ A;  1KMI Z;  2DYR C;  5LOV B;  5CBH A;  2JGU A;  2UXB B;  2Q7H A;  1V55 C;  1XMO O;  3OEE G;  2ZE6 A;  2IU3 A;  4RO2 A;  4NTX A;  4DK0 A;  1N36 O;  3CCU V;  1XI1 A;  3BPZ A;  4LF6 O;  2QR4 A;  2HHH B;  1SET A;  1Q8I A;  2ARH A;  1JPX A;  2Q9L A;  2ZD9 A;  1AR4 A;  4MTX A;  3B8M A;  4X62 O;  4J9Y B;  2ETN A;  3OT7 A;  4KL1 A;  3FAV A;  1F7Y A;  2IU0 A;  1BL8 A;  1XL4 A;  4IIJ B;  2BTQ A;  1K34 A;  2IJH A;  4C7U A;  1HW7 A;  4HZ3 A;  5BMV B;  4LCU C;  2F93 B;  3AK2 A;  5GTI Z;  1SQV H;  3QTC A;  2BCC H;  1TA8 A;  2WLL B;  4LWS B;  3ZN0 A;  1S5H C;  4UB6 Z;  4MT8 A;  3DC6 A;  4F4L A;  1JCH A;  4DV6 B;  1NH2 D;  4MVZ A;  1KB9 F;  1F4N A;  2LFR A;  2YEV B;  4B3R B;  2EIK C;  5EIB D;  4NTW A;  4F6R A;  2WLI A;  1K5Q A;  1WB8 A;  1PL4 A;  4TV9 B;  2EIJ B;  5KHJ A;  5CBF A;  2YXH A;  2YDE A;  4YHH B;  2UU9 B;  1V54 B;  4GCZ A;  2F95 B;  3K59 A;  4DO2 A;  1R6T A;  3QVN A;  2EIL C;  3F7Y C;  5JWP A;  4JI5 B;  3HKD A;  1I94 O;  1RSO A;  1SQX H;  3K08 A;  4X89 A;  4DRX B;  3G80 A;  2QKA A;  1VF5 B;  1EFR G;  1MNG A;  4QPJ A;  2PUS A;  3ZHS A;  5KMG B;  1DF4 A;  2AXT Z;  4DR2 O;  1N34 O;  1RP3 B;  3OGC C;  4IT5 A;  3OGI B;  1VF7 A;  1Q5O A;  1R3K C;  1W0J G;  3RW0 A; 
#chains in the Genus database with same CATH homology
 2QWQ B;  2EJ7 A;  2YS8 A;  1WJZ A;  3UO3 A;  2M6Y A;  3APQ A;  1GH6 A;  1N4C A;  4RWU A;  2N05 A;  2Y4U A;  1NZ6 A;  2DMX A;  3UCS C;  2LGW A;  2CTW A;  2YUA A;  2QWP B;  2L6L A;  2OCH A;  2GUZ B;  2QWO B;  1FPO A;  2QWN B;  1XBL A;  2QWR B;  4J80 A;  1IUR A;  2PF4 E;  3BVO A;  1FAF A;  2CUG A;  2CTQ A;  2GUZ A;  3AG7 A;  2CTR A;  2DN9 A;  2LO1 A;  2Y4T A;  2N04 A;  3APO A;  4IT5 A;  4J7Z A;  3UO2 A;  1BQ0 A;  1BQZ A;  2KQX A;  2QSA A;  1HDJ A;  2CTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...