1WJZA

Soluiotn structure of j-domain of mouse dnaj like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1700030A21Rik protein
publication title Soluiotn structure of J-domain of mouse DnaJ like protein
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 14
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1wjzA00
3BVOA 2CTWA 2DMXA 2OCHA 2Y4TA 1N4CA 2QSAA 2L6LA 2LO1A 2Y4UA 4IT5A 2GUZA 1HDJA 2PF4E 1IURA 2N05A 2QWNB 1BQZA 2CTQA 2QWRB 4J7ZA 3AG7A 2QWOB 3UCSC 3APOA 1FAFA 2EJ7A 1NZ6A 2QWQB 2M6YA 4J80A 2CTRA 2KQXA 3APQA 1WJZA 3UO3A 2CTPA 2CUGA 2YUAA 1BQ0A 2QWPB 2YS8A 2N04A 3UO2A 2LGWA 4RWUA 1FPOA 1GH6A 1XBLA 2DN9A 2GUZB
chains in the Genus database with same CATH superfamily
2Q0AA 1R6NA 1DTOA 2EJRA 2KB1A 1GN6A 3RVZA 1IZ3A 4FJCC 4MTGA 5LYJA 2BCCH 1KBHA 4TT3G 2Q8VA 4JI8B 4JAVA 3SYOA 5LGUA 3B8NA 2YS8A 4UFZA 4MVOA 2E76B 1NQTA 3UO2A 4LF9O 3SYPA 1YJNV 4LC1A 2ZT9B 3LDCA 1WAZA 4J9YB 3RW0A 4LWSA 5IYZB 5ITZB 2ADQB 5L3EA 2BOCC 1UFIA 1P4RA 1JJ2U 3P3NA 2UUAO 1Y66A 4YY3O 2A9HA 4P9OA 1FPOA 4FIPC 4PJ0Z 3T1YB 2XAQA 4KFMA 2XOKG 1GM8A 1GRJA 2OT5A 1YTFD 4LH6A 1WNSA 4PI2A 5LL6Y 4MS2A 3G67A 3N2KA 2DYSC 4B3RB 1N33B 1AB3A 3JATA 4NXNO 3CWBH 4PA7A 5CBGA 1ZSPA 1AR1B 4UB8Z 1PL0A 1VEWA 1K33A 1KD1W 2WLNA 2GUZB 2CTWA 4O4JA 3K06A 3ZX6A 5JCOC 1MABG 2LFRA 3J7AU 3X2QC 2DYSB 3CHXA 2YEVA 4X64O 4GCZA 3CS5A 3EFFK 1XL4A 4LFBB 4RQFA 2IU0A 1DF5A 3ZIAG 3B8MA 4LFCO 1KP3A 4O2BB 3X2QB 1GAXA 3RYIB 2X6AA 3P30A 1IXMA 4D7TA 2QA4V 2DJVA 3P3PA 1YEWA 4K35A 1FD9A 3RWRD 4NXMB 2JS3A 4JTDB 1GN2A 4X66B 5E79Z 3ASOC 3MAQA 1WB8A 4PDVA 1NKDA 2HR3A 4I4TA 4GX1A 3SJQC 1K4DC 1Q43A 4WFFA 2A0LA 3HPLC 2JVDA 3JAWB 3SPIA 2JDIG 2WA4A 3UM7A 1S76D 4I9WA 1YDXA 4IL6Z 1H8HG 3OMIB 3WB0A 1I94B 2X6CA 3ASOB 3QG5A 4PHZA 1URFA 5LOVB 2DQ0A 4OPAA 1Q81W 3ZBHA 5KUMA 3KG2A 2F66C 2HEPA 3K5NA 4KHPO 1DLBA 1Q6HA 2XNDG 3K3WA 4JI6B 2LW7A 2XT9A 4AI8A 1EM1A 1D5NA 2CTPA 4TQDA 1VQKV 5GW7A 4JI5B 3BHPA 2YC0A 3O65A 4JTAB 4DV3O 4WBNB 2OWOA 4DR6O 3E35A 3C90A 2WLMA 3JALB 5FNVA 2DQ3A 3OMNB 4CH6A 4R7CA 2ZINA 4LF9B 3OUSA 2CE4A 4DXWA 1I5YA 2YUAA 2QTOA 2ILMA 3JD2A 4I55A 1N34B 3BA8A 2KG7A 2UXDB 1H38A 2OIEA 1KKCA 4OX9B 2JGUA 4JI0O 4QE9A 4MVSA 5KA6A 2EINC 1A32A 1TGOA 1K9MW 2UUAB 2ITDC 4EFEA 4ICGA 4BWAA 4I50B 3JYCA 3FAVB 2QM8A 1BQ0A 2WLIA 5AG2A 1PV0A 4J9ZB 4CH4A 2YIBD 3VQWA 2JGDB 2FYUH 1NI8A 1LUVA 2EINB 4NXNB 2JJ1G 5FL7G 3MHSC 3B40A 2ZM6O 2QM7A 2QJ1A 4B3MO 2QTSA 4YJ3B 3C3TA 4O2AA 3HKBA 4DV5O 3IFXA 2QWPB 4X1YA 2NR5A 1AR5A 2BSKB 3LSQA 5CA0B 2AHZA 4LCUC 1K73W 4LF7O 1AP5A 2PYLA 3S3WA 4JYAO 4LH7A 2UXXA 2IBZH 2YIBA 3ZHVA 5KHHA 1Q6UA 1WJZA 5LGNA 3ZCCA 1R1BA 4X65B 3H1LH 4LFCB 5GTHZ 3NR7A 1AJNA 4H0LB 5IYCO 2Y0IA 3HKCB 4TUYA 4DR1O 2QM4A 3D36C 4RO2A 4MW8A 3FYEB 4O4IB 4ZKIA 3CB2A 4LF5B 1S77D 4C7UA 3TXQA 1R3JC 4BIOA 4DR3B 4DR4O 1E79G 3CRCA 4X62O 1M9NA 3RYCB 3FYIB 4PDRA 2WLKA 2VS0A 1KP2A 1QR8A 4TV8A 3OFNG 3ASNC 4DUZO 1XMOO 4DR2O 1H2GA 5GTIZ 3UT5B 3DTUB 3L73H 4ASUG 3H1HH 1Q5OA 3A8TA 2N05A 4K0KB 1VQ5V 1D5AA 4DV4B 4FLUA 4O4HB 1XHXA 1ORQC 1YSCA 3CCJV 3QNEA 1VQ9V 3ASNB 4LF4O 2F95B 4DV3B 4YJ2B 1P84F 4DR6B 3SJAC 1PL4A 5D5QA 1M57C 2HJDA 2ZNIA 2CDYA 2F4VB 5JCOA 4JF3A 1YJ9V 4O2BA 1OHHG 4TSFG 1QNMA 4K3AA 5DEDA 3RYFA 3RYIA 1Q7YW 4TWKA 1B3QA 4CZZA 2ZE8A 3FKSG 1JFFB 2Y0PA 3JAKA 2UUBO 4H37A 4DUYO 2CH7A 1YJWV 5FPOA 1HNZO 1M57B 4EKWA 2IJHA 4WF9V 2P90A 3CX5F 2B1IA 2P67A 3BPZA 2JIZG 2PY5A 2UXBO 3CRMA 3JAWA 5LBQA 1N8RW 3TK1A 2Y69C 4X9QA 4ZIBA 4N21A 2PZSA 2ZCEA 3TCUA 4J7KA 3ICXA 2Z3YA 1VP7A 2ZDIA 4E4EA 2JJ2G 5EC1C 4CS2A 1Q3EA 4PA3A 3RFRA 1K92A 2ZM6B 2Q7HA 5EIBC 4DW1A 3M7MX 4DV5B 1JMKC 3O9OA 2VQFB 2Y69B 4I0XB 4JI3B 4FZ1A 4LF6B 1U96A 3UO3A 3E86A 4X8AA 4LF7B 1SETA 1SQBH 3LUTB 1YCIA 3AG2C 3OTOO 4EEQA 4GLXA 2Q7EA 2QKAA 3N27A 5B1AC 2QEXV 1L0LH 3SPJA 4ZOLB 2C2AA 3QO7A 1VARA 1SZXA 1MNGA 3JALA 2YI8A 1D2DA 2Q5ZA 1KC8W 1BL8A 4LR3A 5EC2C 3LDDA 4JASA 1ZUQA 1H2SB 5IWAB 3AG2B 1OCOC 3BA9A 4AQYB 3THOA 1XNQO 4DV2O 5B1AB 4DR7O 1LR1A 2WAMA 3H9VA 5KHIA 2ZNJA 4NKGB 2W0XA 4U3JB 3SPGA 4IIJB 4XDKA 1ZL8B 1AR4A 4G2KA 4B3TO 3F5TA 2RCVA 2EIKC 5JQGB 5BR8O 1OCOB 1GK9A 2A06H 4DR4B 2V1DA 3ZS8C 1N0JA 5EYPB 2JGDA 4B7EA 1FFTB 4GKJO 1NTKH 3VQVA 3H1JH 4OXSA 5C8YB 1VQMV 4LNUA 4R50A 1FAFA 2X7RB 5BXZA 1YI2V 5J2TA 2EIKB 1ZX3A 2CAZC 1BHAA 5E1AC 1QCEA 3EHBB 4LP8A 1TAEA 5CA0A 3Q4HB 1E1RG 3AEIA 1ZLZA 3ZN1A 2IJJA 5KAIZ 5KX5B 1H2MA 3ZMTA 4MVRA 4ABMA 1MA1A 2D3OW 5J2UB 3CJHA 3E83A 4XBFA 3IGAC 2WLHA 1NH2B 2M7WA 3FD9A 1AVMA 3ZMZA 4LF4B 3LNNA 1WN7A 3CCVV 4HNAB 5B1NA 2PTMA 1KU9A 3JSNA 1XBLA 3AK3A 2IH3C 5BZBA 3CCQV 3ABKC 2HFEC 1NBMG 1NR7A 3OMAB 4YHHB 4GX0A 2QKSA 2YI9A 2WLLB 2UU9O 4CS3A 3HKCA 2UUBB 4DUYB 2V4DA 4AILC 4NR1A 2YICA 3K59A 4UCSA 3SJCC 4JYYA 3B09A 4DV0B 1N32B 1VQ4V 1XHZA 2FTKA 4O4IA 2YXYA 1EFRG 2BTQB 4P2ZA 1JJOA 4QGPA 4DV6B 2XTAA 5B66Z 4FFKA 3ABKB 1GO3F 1P49A 3GWOA 2UXBB 1V54C 3SYCA 4EB6A 4L87A 5LMUO 1QBZA 4B3SB 2VQEO 4FFBA 5LA6B 1TVKB 3TGUH 1QR9A 4WFAV 3U10A 3ZRXA 3JARB 1XNRB 1AI5A 4OGQB 3UT5A 2LO1A 1V54B 1XMQB 1SA0A 4IHJB 5EBMC 4D6TH 3K03A 2Q6AA 1NZ6A 1O9HA 1AJQA 1JOYA 4MW3A 5A9GA 1THZA 4OPHA 3EVKA 1GH6A 4RAIA 3A0BZ 3RT3C 5DN6G 3PJSK 5EZYB 3A0RA 1N4CA 2QSAA 1UPGA 3PN1A 3CCEV 4Q20A 1V55C 4CH5A 1K5SA 3E8BA 1S72V 1B06A 2ITCC 3JAMN 2GDSA 1RFYA 2QWOB 4D7SA 4Z2WA 3RYHB 2PI4A 4YXWG 4DV2B 3JASB 2DOSA 4QJFB 1UJWB 4UUJC 1EZJA 1H8EG 1WA8B 3OR7C 5KLVH 2H94A 4DW0A 1H2KA 1V55B 1ZAUA 1IDSA 5IDJA 4UCTA 3D3IA 3CCSV 3IAYA 3A2FA 4Q6GA 2YDEA 3SDLA 2WWWA 5EIBD 1XEQA 4K8XA 2P5OA 1FFXB 1VF5B 4I9QA 2B5UA 4GX5A 2JK5C 3CE2A 3BEHA 2R9AA 2HG5C 3SR2C 4J41A 2ODMA 1US6A 4X1IA 4F6RB 5H9CA 3HKEA 1LUWA 3W7WA 3U0ZA 1EN6A 4JI2B 3ZJZA 5JJEB 3L74H 1SESA 1WPXA 1FJGO 5LP6C 1BHBA 5JJNB 3CP1A 1VQ6V 1SQGA 3OR6C 4FLXA 5EK0A 2ZXWC 2QWNB 5LHGA 4LBEC 1NT2B 1VQNV 5IJ9B 1L8DA 5JH7B 3L71H 5IE9A 4W4LA 4WFGA 1N36O 3K0DA 3KCYA 5LP6B 1I08A 3RGBA 2IH1C 3H1IH 3OEEG 2ZXWB 2H8PC 3DC6A 2PF4E 2E5LO 3E2EA 4CBCA 5H6RA 3LNMB 3UCSC 5A2QN 2EX3A 1ZL8A 4MTFA 5B1BC 4NYKA 5GONB 3G4SV 5JQGA 1NH2D 2W0FC 2X6BA 4UCOA 1W0KG 1F4MA 3VQYA 1E1QG 4GUNA 4TOIA 5EYPA 2PGGA 3QTCA 2WSSG 2RQ6A 3K57A 1R6KA 3MD0A 4G28B 4PA9A 1G8MA 3ZHSA 5C8YA 3CCLV 3VQXA 2Q9LA 4YY3B 5B1BB 3DSQA 1EN4A 3SPHA 4FVMA 4DR5O 1Z2GA 2LGQA 3IC9A 1Q6IA 1JVMA 1XL6A 3E22B 1R3IC 1CP9A 3OT7A 4L8JA 1MMMA 1FXVA 1R6TA 4QIWF 1AI4A 3Q4HA 1VQOV 2ARHA 2KKWA 3HR0A 1BCCH 2CGNA 1JA8A 3F5WC 5C93A 1BQZA 4X89A 1WP8A 1R73A 2L35A 3STZC 3DXRB 1V9PA 4GKKO 4HNAA 2ZR2A 2F93B 1PD3A 4TV9B 4FLVA 2Y4UA 5KMGB 4PELA 3UKMA 4P9PA 2ETNA 3CYOA 3N2GB 1F51A 4X64B 4DV1O 1S5HC 4FPPA 1XOUA 2P06A 4J10A 5TISZ 2FMLA 1B6QA 3BRCA 5JVDB 4JYBA 4A5UB 1OCZC 3AG1C 1M90W 3ZRSA 1Y76B 2A79B 4AHCA 4RQEA 2ZE5A 4X1KB 3I5DA 3W7UA 3JCUZ 3AG7A 5IYZA 2NN4A 5EBLC 4BIZA 5ITZA 4E2LA 2XASA 1H2NA 2HLDG 1TVKA 1VQ8V 3BAAA 4HBNA 1GN4A 2RDCA 1OCZB 3AG1B 5LXTB 4WFEA 3JARA 2L6LA 2P7TC 4TQFA 5LYJB 2Q73A 1PP9H 4DRXB 2QWRB 4IHJA 1BGYH 2Z0AA 3MHHC 3L75H 4O4LB 1PNKA 3H1KH 3CMAV 2KQXA 3OD4A 4NVPA 1GM7A 1SERA 2R9IA 4WCEV 4H13B 1SS3A 5EZYA 4KHPB 2GUZA 1Q90D 4LWSB 5L3CA 1IURA 3T1HO 1CEZA 1SQXH 3MDSA 3ZRWB 3GWKC 1Q82W 1KKDA 4FLTA 4IYIA 1TUBB 2LGWA 1U97A 4LFAO 2OTLV 1MSWD 2H3OA 1RPRA 1NTZH 4Z1MG 1GM9A 3FB8C 1ENVA 1VMGA 3W7SA 3JATB 4J7ZA 3WB1A 3ZMVA 2QWQB 3P32A 1NJIW 4FM0A 4BR6A 1KB9F 5HFLA 4JI0B 1S5LZ 4DYLA 4RWUA 1BT8A 1FFXA 1QHTA 2ZIMA 4XDJA 1QVGU 3R65A 1HDJA 3RN4A 2JEUA 1Z5WA 3RVYA 1HR0O 2RJZA 1Y67A 2YEVB 5JJJB 5CA1B 1YTFB 3ML0A 1SZTA 3ZRVA 3K58A 2EBOA 4HYOA 3G6EV 1YZBA 1JCHA 4RUEA 1GKFA 2HVKC 3I55V 1M4UA 3TXSA 5LOVA 1I5XA 4B3MB 3T2MA 2XHBA 1LNQA 1VQ7V 2A7WA 5CMUA 2Q67A 1AJPA 4GKKB 2P6JA 3JD0A 2GBOA 3K5LA 2ZQMA 1IX9A 4H44B 3TETA 4I4TB 1MZFA 5LP6A 4JYAB 2AGAA 1WLEA 1HW7A 2ZR3A 5JWPA 1BSMA 3JD1A 3T1YO 3CD6V 1S5JA 4WBNA 5L3BA 4NB5A 1G4YB 2OTJV 2RN9A 1IVSA 2OYQA 4U7NA 4J7JA 1N33O 5GONA 1PPJH 2CGOA 3B77A 3ZHTA 5KHJA 4DO2A 3CCRV 1VIBA 5CN0A 2Y4TA 3A0HZ 4DR1B 2B9ZA 5IY5C 5CA3A 3CRAA 4JYCA 4N23A 1VQPV 4Z1VA 1JX9A 3DC5A 1K34A 1ROPA 4MSWC 2UUCO 2Q4PA 3EXAA 1EBOA 2BE3A 3QO8A 3S3XA 4I50A 2XAHA 3FAVA 3E22A 3ETQA 1NTMH 3D8CA 1BS3A 3T4DA 2OCHA 1QU7A 5IY5B 4X62B 3K79A 1SQVH 3FB6C 4I7ZB 4UB6Z 2A3QA 3ABLC 1GMGA 4DK1A 5CB4B 4DUZB 1XMOB 4DR2B 3QVNA 1OV9A 4FK5C 3I56V 4YJ3A 3E8FA 3RBZA 4X20B 4MVQA 4NTWA 2BSKA 3K9SA 3OTFA 4R6ZA 4JV5O 3GB7C 3W7TA 4IT5A 1OCCC 5B3SC 4QPJA 3ABLB 2N74A 4MT8A 3N2GA 1NVPB 4UV8A 2CK3G 2QR4A 2WLIB 2BTOA 1K97A 4ZBMA 4NTYA 5JVDA 4I5SA 5EBWC 1Y76A 5D5PA 1OCCB 5B3SB 4BW9A 1KECA 4JI1O 1X4TA 4IGGA 2ZE7A 4BAYA 2EILC 2IJKA 4PDMA 1Y6XA 1VF6C 4X1KA 3K5MA 4GYCB 4MVMA 4UXNA 2WLJA 1SKVA 4X1YB 2G38A 3CMEV 1HNZB 1IBKO 1QLNA 4U3FH 2IJIA 2EZOA 5LXTA 2DMXA 4JI5O 1RPOA 1PKXA 1TA8A 1HR0B 3CC7V 2EILB 3ABUA 2AZ2A 3FX7A 4DRXA 1K7DA 2ATKC 2DYRC 3D36A 3RYCA 4O4LA 2NNUA 3CXHF 4UVBA 2Q7GA 3OUFA 4YIOA 4UCRA 3ETEA 1FXHA 2NLJC 2F23A 1M56C 4MVUA 1N34O 2E74B 2E75B 4TUYB 3BABA 2JS5A 2UXDO 2FKXA 3KCXA 4OX9O 4KP4A 2W6JG 2VWJA 1JPXA 2HJFC 2FL4A 2DYRB 2VWKA 3ZRWA 2AW9A 2GHYA 5FLXN 1ZWIC 2UXNA 4O4HA 3OTOB 2YIAA 2CUGA 5LHIA 3E8HA 1TUBA 4YJ2A 1K3EA 3B2EE 1M56B 4RUFA 2VRZA 1I7FA 4PV1B 2WA3A 5L3GA 5DECA 4JZGA 1HWYA 3QF7A 1X59A 3VBBA 1Y74B 3CC2V 4TV8B 3K9AA 3L9DA 4QNHB 1XNQB 2GTAA 1GN3A 4DR7B 2ZIOA 5KHGA 3AK2A 1JFFA 1SQPH 1R3KC 2DN9A 2ZD9A 1Z5VA 4B08A 3OEHG 2YXHA 3ZEDA 2UUCB 2QGNA 4B3TB 1NS1A 2XAGA 3JD4A 2QKCA 2YXLA 5BR8B 3OAAG 2EULA 5CA1A 4LF8O 2AZ0A 3ZHUA 5FPRA 3CCMV 4X65O 4GKJB 3BVOA 1MG1A 1AILA 2HVJC 5KUKA 1Y4MA 2QE7G 3RYFB 2GTSA 1OJHA 5KHKA 5IYDO 3FB7C 1BMFG 3JAKB 4MTOA 2K9PA 3U11A 4KUMA 2CH7B 1DF4A 4I0XA 4JV5B 1OCRC 3OE7G 4ZI7B 4DV7O 2ZDIC 4B7KA 4LF5O 2DE0X 2HHHO 4G27B 5DM6V 4UVAA 4ZOLA 4DR3O 1PM9A 4CS4A 4JI7O 4BIUA 2P22C 1YITV 2Q0OC 4R8CA 4UVCA 5L3DA 2X0LA 1SC5B 2QDOA 5CBFA 1JR9A 1OCRB 2E3CA 3KKYA 4EFBA 4JI1B 2DW4A 3QO5A 1WPBA 2UU9B 1KUQA 2XUMA 2LFSA 4JAUA 2LJ2A 3SYQA 1S0VA 4U3JA 1DK1A 3R66A 4GT1A 1IBKB 1IBMO 4IIJA 1IXBA 4WFBV 4K0KO 2Y48A 4UCVA 4DV4O 1J5EO 3CEIA 3SPCA 5J9PC 1RSOB 3OM3B 1NVPD 2R9RB 3L72H 5LMUB 4P30A 4X88A 1O9GA 3KZIZ 2VQEB 4W4KA 4FZ0A 2CTQA 2RMKB 3AG3C 4CH3A 2F4VO 4QPKA 5IJ0B 3BY6A 5CB4A 2YSUB 4FM1A 5BMVB 1HNXO 4X20A 1BE3H 2K1EA 4J42A 5KX5A 1HP8A 5J2UA 1SQQH 3C3SA 3AG3B 5H6QA 2GSMB 5CBHA 3APOA 1F4NA 1XILA 1OZ0A 1NR1A 4JZ2A 1N0NA 1I0HA 4FLYA 1XQ8A 3AK1A 2XAJA 3WFVA 1FYJA 1K4CC 1FXKC 2P4VA 2PYJA 4LNUB 5IYBO 2D2CB 3G80A 4KXRA 2WLLA 5J2TB 2P4KA 5HFMA 1NU1H 3CSXA 4JAAA 4FM2A 3OGIB 2VQFO 4LF6O 4JI3O 3ABTA 4H33A 3APQA 2BTQA 3CJHB 3M99B 1AP6A 1FXKB 1M5IA 5F2VO 2R72A 2OCCC 3CRRA 2HP8A 1VF6A 4LF8B 2WPDG 1W2BU 3LSUA 1VQLV 5LMNO 2XAFA 2CTRA 2BOBC 5LA6A 4ZHQB 3HKDB 1F7YA 3OW2U 1RP3B 3UQ8A 2ZE6A 1SQFA 5IWAO 4WFHA 2IW5A 4CC5A 4AQYO 2EZPA 1G6UA 2OCCB 2FB5A 3VOUA 1RM1C 1CXZB 4F4LA 1P7GA 1L1FA 5K1XA 4DV7B 1MSDA 4JI4O 1FJGB 4JGSA 5K1PA 3SJBC 2HHHB 1KQSU 1XDCA 4HZ3A 1WB7A 1TUEB 1ZTEA 5B1OA 4JI7B 3ZHRA 4EB6B 1XREA 2HKOA 3E89A 4NTXA 3WB2A 2UXCO 1RM1B 1HNWO 5H5NA 3LSSA 4FFBB 3ZN0A 1PNLA 1N36B 2O57A 1W0JG 3F7VC 2PUSA 2W6IG 1Y74A 4J80A 3RYHA 3JASA 1AROP 3AG4C 2R70A 2E5LB 4PDLA 1WA8A 3G6BA 1M1KW 1IBMB 1SA0B 3SYAA 1Q8IA 3N2KB 1K5QA 1J5EB 4IYHA 3ZMUA 1T5EA 5LHHA 4JTCB 3TJTA 1QQCA 3AG4B 1L0NH 1YVWA 2F43G 4O4JB 3M8AA 4CC6A 2PI5A 1IBLO 1B04A 3WU2Z 1XI1A 2MK3A 3G71V 2LQTA 4DR5B 4YHHO 2ADPA 1BZKA 4FLWA 3L70H 4F6RA 1HNXB 4J11A 3ABMC 1H2LA 4U7OA 1YHQV 3CC4V 4JI8O 3GVMA 4DV0O 4FLZA 3OGCC 1N32O 2JRIA 2F1MA 4ZI7A 3E8GA 1W59A 3ZMSA 2ZKOA 1R3LC 2YIDA 1FS0G 2Q69A 4DV6O 4PD4F 5BY1A 2JEXA 3B4SA 3H01A 1WP7A 3K0GA 1K8AW 5IJ9A 3ABMB 2IM9A 4B3SO 5JH7A 5IT9N 1DGSA 3IC7A 2LP7A 2DWDC 4DV1B 4QE7A 1XNRO 4X1IB 1XUQA 3HKEB 2KSDA 1XMQO 2M6YA 1PNMA 3LDEA 2IU3A 3STLC 4B3RO 1P7BA 2RNBA 5L3FA 3ETGA 1RSOA 1VF7A 4MVZA 3J81N 4PI0A 5LMNB 1G1XB 2EIMC 2OIGA 4MTXA 1SF9A 3CRQA 1GTOA 2LW1A 4FMTA 3JSLA 3K5OA 2AHYA 4BW5A 5IJ0A 3BCCH 3K08A 3T1CA 3CXCU 4F6EA 2Q68A 2GV9A 4GX2A 2EIJC 1QVFU 3BFRA 1COWG 1YIJV 1F23A 3SGIA 5KAFZ 3FB5C 1YF2A 5BMVA 4LFBO 4UV9A 5FNVB 2EIMB 3ETDA 4GZRB 2AXTZ 4JI4B 1MOFA 3IJ4A 4XDLA 2EJ7A 3JD3A 3ZHQA 3DXRA 2EIJB 4I55B 2N04A 3T4ZA 2MW2B 5KA5A 3W7XA 2KG7B 2UXCB 4YIPA 1AI6A 5B5EZ 1Q86W 3F7YC 1HNWB 2V7QG 2Z5UA 4UCUA 1EZVH 3T1HB 4NXMO 4TV9A 4X66O 4JPRA 1J95A 5KMGA 3CPWU 1QLEC 3WG7C 3K04A 5H2FZ 4LFAB 3FFQA 1FKAO 4K8ZA 1EN5A 1KMIZ 3D3QA 4KL1A 4JI2O 4PA6A 1MZEA 3CCUV 4HAMA 1I94O 1CPYA 1FXKA 2DWEC 3JCZA 4PA4A 3DGEA 1QLEB 4DK0A 3WG7B 1S3JA 1YXBA 1M93A 4O2AB 3HKBB 3NXSA 1AI7A 5LGTA 1KYOF 3J80N 1JQ0A 1SRYA 3HB3B 3HKDA 4ZHQA 4JI6O 1IBLB 2B1GA
chains in the Genus database with same CATH topology
3BVOA 2CTWA 2DMXA 2OCHA 2Y4TA 1N4CA 2QSAA 2L6LA 2LO1A 2Y4UA 4IT5A 2GUZA 1HDJA 2PF4E 1IURA 2N05A 2QWNB 1BQZA 2CTQA 2QWRB 4J7ZA 3AG7A 2QWOB 3UCSC 3APOA 1FAFA 2EJ7A 1NZ6A 2QWQB 2M6YA 4J80A 2CTRA 2KQXA 3APQA 1WJZA 3UO3A 2CTPA 2CUGA 2YUAA 1BQ0A 2QWPB 2YS8A 2N04A 3UO2A 2LGWA 4RWUA 1FPOA 1GH6A 1XBLA 2DN9A 2GUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVO A;  2CTW A;  2DMX A;  2OCH A;  2Y4T A;  1N4C A;  2QSA A;  2L6L A;  2LO1 A;  2Y4U A;  4IT5 A;  2GUZ A;  1HDJ A;  2PF4 E;  1IUR A;  2N05 A;  2QWN B;  1BQZ A;  2CTQ A;  2QWR B;  4J7Z A;  3AG7 A;  2QWO B;  3UCS C;  3APO A;  1FAF A;  2EJ7 A;  1NZ6 A;  2QWQ B;  2M6Y A;  4J80 A;  2CTR A;  2KQX A;  3APQ A;  1WJZ A;  3UO3 A;  2CTP A;  2CUG A;  2YUA A;  1BQ0 A;  2QWP B;  2YS8 A;  2N04 A;  3UO2 A;  2LGW A;  4RWU A;  1FPO A;  1GH6 A;  1XBL A;  2DN9 A;  2GUZ B; 
#chains in the Genus database with same CATH topology
 2Q0A A;  1R6N A;  1DTO A;  2EJR A;  2KB1 A;  1GN6 A;  3RVZ A;  1IZ3 A;  4FJC C;  4MTG A;  5LYJ A;  2BCC H;  1KBH A;  4TT3 G;  2Q8V A;  4JI8 B;  4JAV A;  3SYO A;  5LGU A;  3B8N A;  2YS8 A;  4UFZ A;  4MVO A;  2E76 B;  1NQT A;  3UO2 A;  4LF9 O;  3SYP A;  1YJN V;  4LC1 A;  2ZT9 B;  3LDC A;  1WAZ A;  4J9Y B;  3RW0 A;  4LWS A;  5IYZ B;  5ITZ B;  2ADQ B;  5L3E A;  2BOC C;  1UFI A;  1P4R A;  1JJ2 U;  3P3N A;  2UUA O;  1Y66 A;  4YY3 O;  2A9H A;  4P9O A;  1FPO A;  4FIP C;  4PJ0 Z;  3T1Y B;  2XAQ A;  4KFM A;  2XOK G;  1GM8 A;  1GRJ A;  2OT5 A;  1YTF D;  4LH6 A;  1WNS A;  4PI2 A;  5LL6 Y;  4MS2 A;  3G67 A;  3N2K A;  2DYS C;  4B3R B;  1N33 B;  1AB3 A;  3JAT A;  4NXN O;  3CWB H;  4PA7 A;  5CBG A;  1ZSP A;  1AR1 B;  4UB8 Z;  1PL0 A;  1VEW A;  1K33 A;  1KD1 W;  2WLN A;  2GUZ B;  2CTW A;  4O4J A;  3K06 A;  3ZX6 A;  5JCO C;  1MAB G;  2LFR A;  3J7A U;  3X2Q C;  2DYS B;  3CHX A;  2YEV A;  4X64 O;  4GCZ A;  3CS5 A;  3EFF K;  1XL4 A;  4LFB B;  4RQF A;  2IU0 A;  1DF5 A;  3ZIA G;  3B8M A;  4LFC O;  1KP3 A;  4O2B B;  3X2Q B;  1GAX A;  3RYI B;  2X6A A;  3P30 A;  1IXM A;  4D7T A;  2QA4 V;  2DJV A;  3P3P A;  1YEW A;  4K35 A;  1FD9 A;  3RWR D;  4NXM B;  2JS3 A;  4JTD B;  1GN2 A;  4X66 B;  5E79 Z;  3ASO C;  3MAQ A;  1WB8 A;  4PDV A;  1NKD A;  2HR3 A;  4I4T A;  4GX1 A;  3SJQ C;  1K4D C;  1Q43 A;  4WFF A;  2A0L A;  3HPL C;  2JVD A;  3JAW B;  3SPI A;  2JDI G;  2WA4 A;  3UM7 A;  1S76 D;  4I9W A;  1YDX A;  4IL6 Z;  1H8H G;  3OMI B;  3WB0 A;  1I94 B;  2X6C A;  3ASO B;  3QG5 A;  4PHZ A;  1URF A;  5LOV B;  2DQ0 A;  4OPA A;  1Q81 W;  3ZBH A;  5KUM A;  3KG2 A;  2F66 C;  2HEP A;  3K5N A;  4KHP O;  1DLB A;  1Q6H A;  2XND G;  3K3W A;  4JI6 B;  2LW7 A;  2XT9 A;  4AI8 A;  1EM1 A;  1D5N A;  2CTP A;  4TQD A;  1VQK V;  5GW7 A;  4JI5 B;  3BHP A;  2YC0 A;  3O65 A;  4JTA B;  4DV3 O;  4WBN B;  2OWO A;  4DR6 O;  3E35 A;  3C90 A;  2WLM A;  3JAL B;  5FNV A;  2DQ3 A;  3OMN B;  4CH6 A;  4R7C A;  2ZIN A;  4LF9 B;  3OUS A;  2CE4 A;  4DXW A;  1I5Y A;  2YUA A;  2QTO A;  2ILM A;  3JD2 A;  4I55 A;  1N34 B;  3BA8 A;  2KG7 A;  2UXD B;  1H38 A;  2OIE A;  1KKC A;  4OX9 B;  2JGU A;  4JI0 O;  4QE9 A;  4MVS A;  5KA6 A;  2EIN C;  1A32 A;  1TGO A;  1K9M W;  2UUA B;  2ITD C;  4EFE A;  4ICG A;  4BWA A;  4I50 B;  3JYC A;  3FAV B;  2QM8 A;  1BQ0 A;  2WLI A;  5AG2 A;  1PV0 A;  4J9Z B;  4CH4 A;  2YIB D;  3VQW A;  2JGD B;  2FYU H;  1NI8 A;  1LUV A;  2EIN B;  4NXN B;  2JJ1 G;  5FL7 G;  3MHS C;  3B40 A;  2ZM6 O;  2QM7 A;  2QJ1 A;  4B3M O;  2QTS A;  4YJ3 B;  3C3T A;  4O2A A;  3HKB A;  4DV5 O;  3IFX A;  2QWP B;  4X1Y A;  2NR5 A;  1AR5 A;  2BSK B;  3LSQ A;  5CA0 B;  2AHZ A;  4LCU C;  1K73 W;  4LF7 O;  1AP5 A;  2PYL A;  3S3W A;  4JYA O;  4LH7 A;  2UXX A;  2IBZ H;  2YIB A;  3ZHV A;  5KHH A;  1Q6U A;  1WJZ A;  5LGN A;  3ZCC A;  1R1B A;  4X65 B;  3H1L H;  4LFC B;  5GTH Z;  3NR7 A;  1AJN A;  4H0L B;  5IYC O;  2Y0I A;  3HKC B;  4TUY A;  4DR1 O;  2QM4 A;  3D36 C;  4RO2 A;  4MW8 A;  3FYE B;  4O4I B;  4ZKI A;  3CB2 A;  4LF5 B;  1S77 D;  4C7U A;  3TXQ A;  1R3J C;  4BIO A;  4DR3 B;  4DR4 O;  1E79 G;  3CRC A;  4X62 O;  1M9N A;  3RYC B;  3FYI B;  4PDR A;  2WLK A;  2VS0 A;  1KP2 A;  1QR8 A;  4TV8 A;  3OFN G;  3ASN C;  4DUZ O;  1XMO O;  4DR2 O;  1H2G A;  5GTI Z;  3UT5 B;  3DTU B;  3L73 H;  4ASU G;  3H1H H;  1Q5O A;  3A8T A;  2N05 A;  4K0K B;  1VQ5 V;  1D5A A;  4DV4 B;  4FLU A;  4O4H B;  1XHX A;  1ORQ C;  1YSC A;  3CCJ V;  3QNE A;  1VQ9 V;  3ASN B;  4LF4 O;  2F95 B;  4DV3 B;  4YJ2 B;  1P84 F;  4DR6 B;  3SJA C;  1PL4 A;  5D5Q A;  1M57 C;  2HJD A;  2ZNI A;  2CDY A;  2F4V B;  5JCO A;  4JF3 A;  1YJ9 V;  4O2B A;  1OHH G;  4TSF G;  1QNM A;  4K3A A;  5DED A;  3RYF A;  3RYI A;  1Q7Y W;  4TWK A;  1B3Q A;  4CZZ A;  2ZE8 A;  3FKS G;  1JFF B;  2Y0P A;  3JAK A;  2UUB O;  4H37 A;  4DUY O;  2CH7 A;  1YJW V;  5FPO A;  1HNZ O;  1M57 B;  4EKW A;  2IJH A;  4WF9 V;  2P90 A;  3CX5 F;  2B1I A;  2P67 A;  3BPZ A;  2JIZ G;  2PY5 A;  2UXB O;  3CRM A;  3JAW A;  5LBQ A;  1N8R W;  3TK1 A;  2Y69 C;  4X9Q A;  4ZIB A;  4N21 A;  2PZS A;  2ZCE A;  3TCU A;  4J7K A;  3ICX A;  2Z3Y A;  1VP7 A;  2ZDI A;  4E4E A;  2JJ2 G;  5EC1 C;  4CS2 A;  1Q3E A;  4PA3 A;  3RFR A;  1K92 A;  2ZM6 B;  2Q7H A;  5EIB C;  4DW1 A;  3M7M X;  4DV5 B;  1JMK C;  3O9O A;  2VQF B;  2Y69 B;  4I0X B;  4JI3 B;  4FZ1 A;  4LF6 B;  1U96 A;  3UO3 A;  3E86 A;  4X8A A;  4LF7 B;  1SET A;  1SQB H;  3LUT B;  1YCI A;  3AG2 C;  3OTO O;  4EEQ A;  4GLX A;  2Q7E A;  2QKA A;  3N27 A;  5B1A C;  2QEX V;  1L0L H;  3SPJ A;  4ZOL B;  2C2A A;  3QO7 A;  1VAR A;  1SZX A;  1MNG A;  3JAL A;  2YI8 A;  1D2D A;  2Q5Z A;  1KC8 W;  1BL8 A;  4LR3 A;  5EC2 C;  3LDD A;  4JAS A;  1ZUQ A;  1H2S B;  5IWA B;  3AG2 B;  1OCO C;  3BA9 A;  4AQY B;  3THO A;  1XNQ O;  4DV2 O;  5B1A B;  4DR7 O;  1LR1 A;  2WAM A;  3H9V A;  5KHI A;  2ZNJ A;  4NKG B;  2W0X A;  4U3J B;  3SPG A;  4IIJ B;  4XDK A;  1ZL8 B;  1AR4 A;  4G2K A;  4B3T O;  3F5T A;  2RCV A;  2EIK C;  5JQG B;  5BR8 O;  1OCO B;  1GK9 A;  2A06 H;  4DR4 B;  2V1D A;  3ZS8 C;  1N0J A;  5EYP B;  2JGD A;  4B7E A;  1FFT B;  4GKJ O;  1NTK H;  3VQV A;  3H1J H;  4OXS A;  5C8Y B;  1VQM V;  4LNU A;  4R50 A;  1FAF A;  2X7R B;  5BXZ A;  1YI2 V;  5J2T A;  2EIK B;  1ZX3 A;  2CAZ C;  1BHA A;  5E1A C;  1QCE A;  3EHB B;  4LP8 A;  1TAE A;  5CA0 A;  3Q4H B;  1E1R G;  3AEI A;  1ZLZ A;  3ZN1 A;  2IJJ A;  5KAI Z;  5KX5 B;  1H2M A;  3ZMT A;  4MVR A;  4ABM A;  1MA1 A;  2D3O W;  5J2U B;  3CJH A;  3E83 A;  4XBF A;  3IGA C;  2WLH A;  1NH2 B;  2M7W A;  3FD9 A;  1AVM A;  3ZMZ A;  4LF4 B;  3LNN A;  1WN7 A;  3CCV V;  4HNA B;  5B1N A;  2PTM A;  1KU9 A;  3JSN A;  1XBL A;  3AK3 A;  2IH3 C;  5BZB A;  3CCQ V;  3ABK C;  2HFE C;  1NBM G;  1NR7 A;  3OMA B;  4YHH B;  4GX0 A;  2QKS A;  2YI9 A;  2WLL B;  2UU9 O;  4CS3 A;  3HKC A;  2UUB B;  4DUY B;  2V4D A;  4AIL C;  4NR1 A;  2YIC A;  3K59 A;  4UCS A;  3SJC C;  4JYY A;  3B09 A;  4DV0 B;  1N32 B;  1VQ4 V;  1XHZ A;  2FTK A;  4O4I A;  2YXY A;  1EFR G;  2BTQ B;  4P2Z A;  1JJO A;  4QGP A;  4DV6 B;  2XTA A;  5B66 Z;  4FFK A;  3ABK B;  1GO3 F;  1P49 A;  3GWO A;  2UXB B;  1V54 C;  3SYC A;  4EB6 A;  4L87 A;  5LMU O;  1QBZ A;  4B3S B;  2VQE O;  4FFB A;  5LA6 B;  1TVK B;  3TGU H;  1QR9 A;  4WFA V;  3U10 A;  3ZRX A;  3JAR B;  1XNR B;  1AI5 A;  4OGQ B;  3UT5 A;  2LO1 A;  1V54 B;  1XMQ B;  1SA0 A;  4IHJ B;  5EBM C;  4D6T H;  3K03 A;  2Q6A A;  1NZ6 A;  1O9H A;  1AJQ A;  1JOY A;  4MW3 A;  5A9G A;  1THZ A;  4OPH A;  3EVK A;  1GH6 A;  4RAI A;  3A0B Z;  3RT3 C;  5DN6 G;  3PJS K;  5EZY B;  3A0R A;  1N4C A;  2QSA A;  1UPG A;  3PN1 A;  3CCE V;  4Q20 A;  1V55 C;  4CH5 A;  1K5S A;  3E8B A;  1S72 V;  1B06 A;  2ITC C;  3JAM N;  2GDS A;  1RFY A;  2QWO B;  4D7S A;  4Z2W A;  3RYH B;  2PI4 A;  4YXW G;  4DV2 B;  3JAS B;  2DOS A;  4QJF B;  1UJW B;  4UUJ C;  1EZJ A;  1H8E G;  1WA8 B;  3OR7 C;  5KLV H;  2H94 A;  4DW0 A;  1H2K A;  1V55 B;  1ZAU A;  1IDS A;  5IDJ A;  4UCT A;  3D3I A;  3CCS V;  3IAY A;  3A2F A;  4Q6G A;  2YDE A;  3SDL A;  2WWW A;  5EIB D;  1XEQ A;  4K8X A;  2P5O A;  1FFX B;  1VF5 B;  4I9Q A;  2B5U A;  4GX5 A;  2JK5 C;  3CE2 A;  3BEH A;  2R9A A;  2HG5 C;  3SR2 C;  4J41 A;  2ODM A;  1US6 A;  4X1I A;  4F6R B;  5H9C A;  3HKE A;  1LUW A;  3W7W A;  3U0Z A;  1EN6 A;  4JI2 B;  3ZJZ A;  5JJE B;  3L74 H;  1SES A;  1WPX A;  1FJG O;  5LP6 C;  1BHB A;  5JJN B;  3CP1 A;  1VQ6 V;  1SQG A;  3OR6 C;  4FLX A;  5EK0 A;  2ZXW C;  2QWN B;  5LHG A;  4LBE C;  1NT2 B;  1VQN V;  5IJ9 B;  1L8D A;  5JH7 B;  3L71 H;  5IE9 A;  4W4L A;  4WFG A;  1N36 O;  3K0D A;  3KCY A;  5LP6 B;  1I08 A;  3RGB A;  2IH1 C;  3H1I H;  3OEE G;  2ZXW B;  2H8P C;  3DC6 A;  2PF4 E;  2E5L O;  3E2E A;  4CBC A;  5H6R A;  3LNM B;  3UCS C;  5A2Q N;  2EX3 A;  1ZL8 A;  4MTF A;  5B1B C;  4NYK A;  5GON B;  3G4S V;  5JQG A;  1NH2 D;  2W0F C;  2X6B A;  4UCO A;  1W0K G;  1F4M A;  3VQY A;  1E1Q G;  4GUN A;  4TOI A;  5EYP A;  2PGG A;  3QTC A;  2WSS G;  2RQ6 A;  3K57 A;  1R6K A;  3MD0 A;  4G28 B;  4PA9 A;  1G8M A;  3ZHS A;  5C8Y A;  3CCL V;  3VQX A;  2Q9L A;  4YY3 B;  5B1B B;  3DSQ A;  1EN4 A;  3SPH A;  4FVM A;  4DR5 O;  1Z2G A;  2LGQ A;  3IC9 A;  1Q6I A;  1JVM A;  1XL6 A;  3E22 B;  1R3I C;  1CP9 A;  3OT7 A;  4L8J A;  1MMM A;  1FXV A;  1R6T A;  4QIW F;  1AI4 A;  3Q4H A;  1VQO V;  2ARH A;  2KKW A;  3HR0 A;  1BCC H;  2CGN A;  1JA8 A;  3F5W C;  5C93 A;  1BQZ A;  4X89 A;  1WP8 A;  1R73 A;  2L35 A;  3STZ C;  3DXR B;  1V9P A;  4GKK O;  4HNA A;  2ZR2 A;  2F93 B;  1PD3 A;  4TV9 B;  4FLV A;  2Y4U A;  5KMG B;  4PEL A;  3UKM A;  4P9P A;  2ETN A;  3CYO A;  3N2G B;  1F51 A;  4X64 B;  4DV1 O;  1S5H C;  4FPP A;  1XOU A;  2P06 A;  4J10 A;  5TIS Z;  2FML A;  1B6Q A;  3BRC A;  5JVD B;  4JYB A;  4A5U B;  1OCZ C;  3AG1 C;  1M90 W;  3ZRS A;  1Y76 B;  2A79 B;  4AHC A;  4RQE A;  2ZE5 A;  4X1K B;  3I5D A;  3W7U A;  3JCU Z;  3AG7 A;  5IYZ A;  2NN4 A;  5EBL C;  4BIZ A;  5ITZ A;  4E2L A;  2XAS A;  1H2N A;  2HLD G;  1TVK A;  1VQ8 V;  3BAA A;  4HBN A;  1GN4 A;  2RDC A;  1OCZ B;  3AG1 B;  5LXT B;  4WFE A;  3JAR A;  2L6L A;  2P7T C;  4TQF A;  5LYJ B;  2Q73 A;  1PP9 H;  4DRX B;  2QWR B;  4IHJ A;  1BGY H;  2Z0A A;  3MHH C;  3L75 H;  4O4L B;  1PNK A;  3H1K H;  3CMA V;  2KQX A;  3OD4 A;  4NVP A;  1GM7 A;  1SER A;  2R9I A;  4WCE V;  4H13 B;  1SS3 A;  5EZY A;  4KHP B;  2GUZ A;  1Q90 D;  4LWS B;  5L3C A;  1IUR A;  3T1H O;  1CEZ A;  1SQX H;  3MDS A;  3ZRW B;  3GWK C;  1Q82 W;  1KKD A;  4FLT A;  4IYI A;  1TUB B;  2LGW A;  1U97 A;  4LFA O;  2OTL V;  1MSW D;  2H3O A;  1RPR A;  1NTZ H;  4Z1M G;  1GM9 A;  3FB8 C;  1ENV A;  1VMG A;  3W7S A;  3JAT B;  4J7Z A;  3WB1 A;  3ZMV A;  2QWQ B;  3P32 A;  1NJI W;  4FM0 A;  4BR6 A;  1KB9 F;  5HFL A;  4JI0 B;  1S5L Z;  4DYL A;  4RWU A;  1BT8 A;  1FFX A;  1QHT A;  2ZIM A;  4XDJ A;  1QVG U;  3R65 A;  1HDJ A;  3RN4 A;  2JEU A;  1Z5W A;  3RVY A;  1HR0 O;  2RJZ A;  1Y67 A;  2YEV B;  5JJJ B;  5CA1 B;  1YTF B;  3ML0 A;  1SZT A;  3ZRV A;  3K58 A;  2EBO A;  4HYO A;  3G6E V;  1YZB A;  1JCH A;  4RUE A;  1GKF A;  2HVK C;  3I55 V;  1M4U A;  3TXS A;  5LOV A;  1I5X A;  4B3M B;  3T2M A;  2XHB A;  1LNQ A;  1VQ7 V;  2A7W A;  5CMU A;  2Q67 A;  1AJP A;  4GKK B;  2P6J A;  3JD0 A;  2GBO A;  3K5L A;  2ZQM A;  1IX9 A;  4H44 B;  3TET A;  4I4T B;  1MZF A;  5LP6 A;  4JYA B;  2AGA A;  1WLE A;  1HW7 A;  2ZR3 A;  5JWP A;  1BSM A;  3JD1 A;  3T1Y O;  3CD6 V;  1S5J A;  4WBN A;  5L3B A;  4NB5 A;  1G4Y B;  2OTJ V;  2RN9 A;  1IVS A;  2OYQ A;  4U7N A;  4J7J A;  1N33 O;  5GON A;  1PPJ H;  2CGO A;  3B77 A;  3ZHT A;  5KHJ A;  4DO2 A;  3CCR V;  1VIB A;  5CN0 A;  2Y4T A;  3A0H Z;  4DR1 B;  2B9Z A;  5IY5 C;  5CA3 A;  3CRA A;  4JYC A;  4N23 A;  1VQP V;  4Z1V A;  1JX9 A;  3DC5 A;  1K34 A;  1ROP A;  4MSW C;  2UUC O;  2Q4P A;  3EXA A;  1EBO A;  2BE3 A;  3QO8 A;  3S3X A;  4I50 A;  2XAH A;  3FAV A;  3E22 A;  3ETQ A;  1NTM H;  3D8C A;  1BS3 A;  3T4D A;  2OCH A;  1QU7 A;  5IY5 B;  4X62 B;  3K79 A;  1SQV H;  3FB6 C;  4I7Z B;  4UB6 Z;  2A3Q A;  3ABL C;  1GMG A;  4DK1 A;  5CB4 B;  4DUZ B;  1XMO B;  4DR2 B;  3QVN A;  1OV9 A;  4FK5 C;  3I56 V;  4YJ3 A;  3E8F A;  3RBZ A;  4X20 B;  4MVQ A;  4NTW A;  2BSK A;  3K9S A;  3OTF A;  4R6Z A;  4JV5 O;  3GB7 C;  3W7T A;  4IT5 A;  1OCC C;  5B3S C;  4QPJ A;  3ABL B;  2N74 A;  4MT8 A;  3N2G A;  1NVP B;  4UV8 A;  2CK3 G;  2QR4 A;  2WLI B;  2BTO A;  1K97 A;  4ZBM A;  4NTY A;  5JVD A;  4I5S A;  5EBW C;  1Y76 A;  5D5P A;  1OCC B;  5B3S B;  4BW9 A;  1KEC A;  4JI1 O;  1X4T A;  4IGG A;  2ZE7 A;  4BAY A;  2EIL C;  2IJK A;  4PDM A;  1Y6X A;  1VF6 C;  4X1K A;  3K5M A;  4GYC B;  4MVM A;  4UXN A;  2WLJ A;  1SKV A;  4X1Y B;  2G38 A;  3CME V;  1HNZ B;  1IBK O;  1QLN A;  4U3F H;  2IJI A;  2EZO A;  5LXT A;  2DMX A;  4JI5 O;  1RPO A;  1PKX A;  1TA8 A;  1HR0 B;  3CC7 V;  2EIL B;  3ABU A;  2AZ2 A;  3FX7 A;  4DRX A;  1K7D A;  2ATK C;  2DYR C;  3D36 A;  3RYC A;  4O4L A;  2NNU A;  3CXH F;  4UVB A;  2Q7G A;  3OUF A;  4YIO A;  4UCR A;  3ETE A;  1FXH A;  2NLJ C;  2F23 A;  1M56 C;  4MVU A;  1N34 O;  2E74 B;  2E75 B;  4TUY B;  3BAB A;  2JS5 A;  2UXD O;  2FKX A;  3KCX A;  4OX9 O;  4KP4 A;  2W6J G;  2VWJ A;  1JPX A;  2HJF C;  2FL4 A;  2DYR B;  2VWK A;  3ZRW A;  2AW9 A;  2GHY A;  5FLX N;  1ZWI C;  2UXN A;  4O4H A;  3OTO B;  2YIA A;  2CUG A;  5LHI A;  3E8H A;  1TUB A;  4YJ2 A;  1K3E A;  3B2E E;  1M56 B;  4RUF A;  2VRZ A;  1I7F A;  4PV1 B;  2WA3 A;  5L3G A;  5DEC A;  4JZG A;  1HWY A;  3QF7 A;  1X59 A;  3VBB A;  1Y74 B;  3CC2 V;  4TV8 B;  3K9A A;  3L9D A;  4QNH B;  1XNQ B;  2GTA A;  1GN3 A;  4DR7 B;  2ZIO A;  5KHG A;  3AK2 A;  1JFF A;  1SQP H;  1R3K C;  2DN9 A;  2ZD9 A;  1Z5V A;  4B08 A;  3OEH G;  2YXH A;  3ZED A;  2UUC B;  2QGN A;  4B3T B;  1NS1 A;  2XAG A;  3JD4 A;  2QKC A;  2YXL A;  5BR8 B;  3OAA G;  2EUL A;  5CA1 A;  4LF8 O;  2AZ0 A;  3ZHU A;  5FPR A;  3CCM V;  4X65 O;  4GKJ B;  3BVO A;  1MG1 A;  1AIL A;  2HVJ C;  5KUK A;  1Y4M A;  2QE7 G;  3RYF B;  2GTS A;  1OJH A;  5KHK A;  5IYD O;  3FB7 C;  1BMF G;  3JAK B;  4MTO A;  2K9P A;  3U11 A;  4KUM A;  2CH7 B;  1DF4 A;  4I0X A;  4JV5 B;  1OCR C;  3OE7 G;  4ZI7 B;  4DV7 O;  2ZDI C;  4B7K A;  4LF5 O;  2DE0 X;  2HHH O;  4G27 B;  5DM6 V;  4UVA A;  4ZOL A;  4DR3 O;  1PM9 A;  4CS4 A;  4JI7 O;  4BIU A;  2P22 C;  1YIT V;  2Q0O C;  4R8C A;  4UVC A;  5L3D A;  2X0L A;  1SC5 B;  2QDO A;  5CBF A;  1JR9 A;  1OCR B;  2E3C A;  3KKY A;  4EFB A;  4JI1 B;  2DW4 A;  3QO5 A;  1WPB A;  2UU9 B;  1KUQ A;  2XUM A;  2LFS A;  4JAU A;  2LJ2 A;  3SYQ A;  1S0V A;  4U3J A;  1DK1 A;  3R66 A;  4GT1 A;  1IBK B;  1IBM O;  4IIJ A;  1IXB A;  4WFB V;  4K0K O;  2Y48 A;  4UCV A;  4DV4 O;  1J5E O;  3CEI A;  3SPC A;  5J9P C;  1RSO B;  3OM3 B;  1NVP D;  2R9R B;  3L72 H;  5LMU B;  4P30 A;  4X88 A;  1O9G A;  3KZI Z;  2VQE B;  4W4K A;  4FZ0 A;  2CTQ A;  2RMK B;  3AG3 C;  4CH3 A;  2F4V O;  4QPK A;  5IJ0 B;  3BY6 A;  5CB4 A;  2YSU B;  4FM1 A;  5BMV B;  1HNX O;  4X20 A;  1BE3 H;  2K1E A;  4J42 A;  5KX5 A;  1HP8 A;  5J2U A;  1SQQ H;  3C3S A;  3AG3 B;  5H6Q A;  2GSM B;  5CBH A;  3APO A;  1F4N A;  1XIL A;  1OZ0 A;  1NR1 A;  4JZ2 A;  1N0N A;  1I0H A;  4FLY A;  1XQ8 A;  3AK1 A;  2XAJ A;  3WFV A;  1FYJ A;  1K4C C;  1FXK C;  2P4V A;  2PYJ A;  4LNU B;  5IYB O;  2D2C B;  3G80 A;  4KXR A;  2WLL A;  5J2T B;  2P4K A;  5HFM A;  1NU1 H;  3CSX A;  4JAA A;  4FM2 A;  3OGI B;  2VQF O;  4LF6 O;  4JI3 O;  3ABT A;  4H33 A;  3APQ A;  2BTQ A;  3CJH B;  3M99 B;  1AP6 A;  1FXK B;  1M5I A;  5F2V O;  2R72 A;  2OCC C;  3CRR A;  2HP8 A;  1VF6 A;  4LF8 B;  2WPD G;  1W2B U;  3LSU A;  1VQL V;  5LMN O;  2XAF A;  2CTR A;  2BOB C;  5LA6 A;  4ZHQ B;  3HKD B;  1F7Y A;  3OW2 U;  1RP3 B;  3UQ8 A;  2ZE6 A;  1SQF A;  5IWA O;  4WFH A;  2IW5 A;  4CC5 A;  4AQY O;  2EZP A;  1G6U A;  2OCC B;  2FB5 A;  3VOU A;  1RM1 C;  1CXZ B;  4F4L A;  1P7G A;  1L1F A;  5K1X A;  4DV7 B;  1MSD A;  4JI4 O;  1FJG B;  4JGS A;  5K1P A;  3SJB C;  2HHH B;  1KQS U;  1XDC A;  4HZ3 A;  1WB7 A;  1TUE B;  1ZTE A;  5B1O A;  4JI7 B;  3ZHR A;  4EB6 B;  1XRE A;  2HKO A;  3E89 A;  4NTX A;  3WB2 A;  2UXC O;  1RM1 B;  1HNW O;  5H5N A;  3LSS A;  4FFB B;  3ZN0 A;  1PNL A;  1N36 B;  2O57 A;  1W0J G;  3F7V C;  2PUS A;  2W6I G;  1Y74 A;  4J80 A;  3RYH A;  3JAS A;  1ARO P;  3AG4 C;  2R70 A;  2E5L B;  4PDL A;  1WA8 A;  3G6B A;  1M1K W;  1IBM B;  1SA0 B;  3SYA A;  1Q8I A;  3N2K B;  1K5Q A;  1J5E B;  4IYH A;  3ZMU A;  1T5E A;  5LHH A;  4JTC B;  3TJT A;  1QQC A;  3AG4 B;  1L0N H;  1YVW A;  2F43 G;  4O4J B;  3M8A A;  4CC6 A;  2PI5 A;  1IBL O;  1B04 A;  3WU2 Z;  1XI1 A;  2MK3 A;  3G71 V;  2LQT A;  4DR5 B;  4YHH O;  2ADP A;  1BZK A;  4FLW A;  3L70 H;  4F6R A;  1HNX B;  4J11 A;  3ABM C;  1H2L A;  4U7O A;  1YHQ V;  3CC4 V;  4JI8 O;  3GVM A;  4DV0 O;  4FLZ A;  3OGC C;  1N32 O;  2JRI A;  2F1M A;  4ZI7 A;  3E8G A;  1W59 A;  3ZMS A;  2ZKO A;  1R3L C;  2YID A;  1FS0 G;  2Q69 A;  4DV6 O;  4PD4 F;  5BY1 A;  2JEX A;  3B4S A;  3H01 A;  1WP7 A;  3K0G A;  1K8A W;  5IJ9 A;  3ABM B;  2IM9 A;  4B3S O;  5JH7 A;  5IT9 N;  1DGS A;  3IC7 A;  2LP7 A;  2DWD C;  4DV1 B;  4QE7 A;  1XNR O;  4X1I B;  1XUQ A;  3HKE B;  2KSD A;  1XMQ O;  2M6Y A;  1PNM A;  3LDE A;  2IU3 A;  3STL C;  4B3R O;  1P7B A;  2RNB A;  5L3F A;  3ETG A;  1RSO A;  1VF7 A;  4MVZ A;  3J81 N;  4PI0 A;  5LMN B;  1G1X B;  2EIM C;  2OIG A;  4MTX A;  1SF9 A;  3CRQ A;  1GTO A;  2LW1 A;  4FMT A;  3JSL A;  3K5O A;  2AHY A;  4BW5 A;  5IJ0 A;  3BCC H;  3K08 A;  3T1C A;  3CXC U;  4F6E A;  2Q68 A;  2GV9 A;  4GX2 A;  2EIJ C;  1QVF U;  3BFR A;  1COW G;  1YIJ V;  1F23 A;  3SGI A;  5KAF Z;  3FB5 C;  1YF2 A;  5BMV A;  4LFB O;  4UV9 A;  5FNV B;  2EIM B;  3ETD A;  4GZR B;  2AXT Z;  4JI4 B;  1MOF A;  3IJ4 A;  4XDL A;  2EJ7 A;  3JD3 A;  3ZHQ A;  3DXR A;  2EIJ B;  4I55 B;  2N04 A;  3T4Z A;  2MW2 B;  5KA5 A;  3W7X A;  2KG7 B;  2UXC B;  4YIP A;  1AI6 A;  5B5E Z;  1Q86 W;  3F7Y C;  1HNW B;  2V7Q G;  2Z5U A;  4UCU A;  1EZV H;  3T1H B;  4NXM O;  4TV9 A;  4X66 O;  4JPR A;  1J95 A;  5KMG A;  3CPW U;  1QLE C;  3WG7 C;  3K04 A;  5H2F Z;  4LFA B;  3FFQ A;  1FKA O;  4K8Z A;  1EN5 A;  1KMI Z;  3D3Q A;  4KL1 A;  4JI2 O;  4PA6 A;  1MZE A;  3CCU V;  4HAM A;  1I94 O;  1CPY A;  1FXK A;  2DWE C;  3JCZ A;  4PA4 A;  3DGE A;  1QLE B;  4DK0 A;  3WG7 B;  1S3J A;  1YXB A;  1M93 A;  4O2A B;  3HKB B;  3NXS A;  1AI7 A;  5LGT A;  1KYO F;  3J80 N;  1JQ0 A;  1SRY A;  3HB3 B;  3HKD A;  4ZHQ A;  4JI6 O;  1IBL B;  2B1G A; 
#chains in the Genus database with same CATH homology
 3BVO A;  2CTW A;  2DMX A;  2OCH A;  2Y4T A;  1N4C A;  2QSA A;  2L6L A;  2LO1 A;  2Y4U A;  4IT5 A;  2GUZ A;  1HDJ A;  2PF4 E;  1IUR A;  2N05 A;  2QWN B;  1BQZ A;  2CTQ A;  2QWR B;  4J7Z A;  3AG7 A;  2QWO B;  3UCS C;  3APO A;  1FAF A;  2EJ7 A;  1NZ6 A;  2QWQ B;  2M6Y A;  4J80 A;  2CTR A;  2KQX A;  3APQ A;  1WJZ A;  3UO3 A;  2CTP A;  2CUG A;  2YUA A;  1BQ0 A;  2QWP B;  2YS8 A;  2N04 A;  3UO2 A;  2LGW A;  4RWU A;  1FPO A;  1GH6 A;  1XBL A;  2DN9 A;  2GUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...