1WJZA

Soluiotn structure of j-domain of mouse dnaj like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Soluiotn structure of J-domain of mouse DnaJ like protein
rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords 1700030A21Rik protein
total genus 14
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1wjzA00
2QWOB 2QWRB 1BQZA 2DMXA 1NZ6A 3AG7A 2CTRA 2CTQA 2CTPA 2N04A 2YS8A 3APQA 1IURA 2CUGA 1FAFA 2DN9A 1BQ0A 4RWUA 3UO2A 1XBLA 2QWPB 2PF4E 2QWNB 2GUZB 4IT5A 3BVOA 4J80A 2CTWA 2Y4TA 1GH6A 1FPOA 1N4CA 2LO1A 2M6YA 2KQXA 2QWQB 2YUAA 2L6LA 3UCSC 2Y4UA 3UO3A 4J7ZA 2N05A 3APOA 1HDJA 2EJ7A 2OCHA 2LGWA 2GUZA 1WJZA 2QSAA
chains in the Genus database with same CATH superfamily
4WF9V 2EILB 4JYCA 1YTFD 2JVDA 3B8MA 2IU0A 4O4LB 1Y74B 1BE3H 4JF3A 5IT9N 2JK5C 4NXNB 5F2VO 4DW1A 1YI2V 1VQNV 4JI5B 4GKKO 5HFMA 2RN9A 2YXHA 1XNQB 1BSMA 2YIDA 1W2BU 4DO2A 1TVKA 2OYQA 4NTYA 5CBFA 3ABUA 3HPLC 2PYLA 3DXRA 4DK0A 3IC9A 4HBNA 4MT8A 2X0LA 2QWQB 1VF6A 3B8NA 3CE2A 4DV6B 4LF8O 3M7MX 1X59A 1UPGA 3P30A 1UJWB 2VQFO 1I94B 4GKJB 3HKBA 4PA6A 3NXSA 3OMAB 4PDMA 1NTZH 1G4YB 4PELA 4RWUA 1KP3A 4QE9A 4MVUA 1PV0A 1ZL8A 4TOIA 3FYIB 4I5SA 1MA1A 1HNXB 4DV6O 4MVSA 1SF9A 4MVMA 1IX9A 1UFIA 3IGAC 5GTIZ 4MTFA 5EZYA 4LFBO 1SQFA 2ZKOA 1AJQA 4LF5O 3K5LA 1AI7A 1J5EB 2EIKC 2AZ2A 2CTRA 4LF7B 2YS8A 4O2BA 4I55B 2Q9LA 1IURA 1K34A 3UO2A 3K06A 4N23A 1FYJA 3BVOA 4QPKA 3LNNA 3MHSC 4F6EA 3JAKA 3F7YC 1PD3A 3G71V 4W4KA 3WG7C 1XNRO 4NXNO 3CMEV 1K7DA 2A06H 1QVGU 4UCTA 1R3LC 2QR4A 2ZIMA 2UXDB 4X64B 1H38A 2NNUA 2Q4PA 3W7UA 1QU7A 4X9QA 3ZMVA 3MAQA 3J80N 1WLEA 4LC1A 1B3QA 1YF2A 2D3OW 2UUAB 1JX9A 3OE7G 4JAAA 4IL6Z 3FAVB 4JI0B 2VS0A 4CS3A 4WFGA 4L87A 2FKXA 2Q67A 5JJNB 4X64O 1H8HG 4JI7O 1BHAA 2NLJC 4JTDB 3UKMA 3OTOB 3N2KA 2A79B 2VQEB 4ZI7A 2H3OA 3SPHA 3U11A 3TETA 2KQXA 3JALB 2IM9A 4X62B 4IHJB 3JAMN 2ILMA 2N04A 3LDEA 3ZRSA 2DYSB 4J7JA 1XOUA 4QNHB 2OCCC 1U97A 4K8XA 3JALA 2QKSA 4X1IB 1K5QA 1VQ8V 3OR6C 4H13B 1NKDA 2Z5UA 1K33A 3RWRD 2ZNJA 5IWAB 3ZBHA 1K8AW 4KHPB 3FB8C 3HKDA 4FJCC 1FXKA 4H33A 3UT5A 2CGOA 4FM0A 1GO3F 1F7YA 2JEXA 1JR9A 2PZSA 2V7QG 5CA1B 1GMGA 5LYJB 3CX5F 4UB6Z 1IZ3A 1IXBA 1IBKO 2PUSA 4I0XB 4EFEA 1XI1A 2BCCH 1QLNA 2P4VA 3R65A 1VF5B 3KG2A 2Q0AA 3MD0A 1CP9A 3LDCA 3TXSA 3VQWA 2X6AA 1SQPH 2QWPB 4NXMO 4OXSA 1GH6A 1FPOA 1K5SA 1AR5A 3E89A 1ZX3A 4K35A 3RGBA 3L9DA 1KKCA 5EC1C 1NJIW 4YHHO 5JQGB 2W6IG 4DR2B 5IYBO 3BPZA 4DV4B 1KU9A 3OUSA 3C3TA 4NR1A 1XBLA 3LSQA 4X1KB 3K0GA 1K92A 1WPXA 4LWSB 5GONA 3CXCU 1GN6A 4MTGA 3APOA 3JATB 4W4LA 5LA6B 1NVPB 1YEWA 4I4TB 4ZBMA 4DR2O 1WJZA 1MSWD 2JS3A 1EZVH 5JVDB 1ZLZA 1B6QA 5KAIZ 5IWAO 2VQFB 3E22B 5BR8B 1Q7YW 3ABKB 3VQYA 2LJ2A 5IJ9A 2P5OA 2PYJA 1GTOA 1BQZA 5KMGA 2QE7G 3HKDB 2WLLA 2P06A 5EBMC 1IBMO 3S3WA 1KMIZ 4JI3B 2KG7A 1CXZB 1WNSA 3ASOC 5KHHA 1Y76B 2IU3A 3CSXA 4KXRA 2CAZC 2WSSG 3DSQA 3N27A 3HKCB 2DMXA 5IDJA 2CTQA 2O57A 2EBOA 5EBLC 3LNMB 4DV7O 1MMMA 2QWNB 2HG5C 2XT9A 4AILC 1EBOA 1OCZB 4DR5O 1AR1B 1HR0B 2YICA 2XASA 2HJDA 1PNMA 4FFKA 1BS3A 1AB3A 1BT8A 3APQA 5B3SB 3AG3B 1VF6C 3T4DA 4KUMA 1JJ2U 1LR1A 4MVRA 2BTOA 5JH7A 4PHZA 3CB2A 3T1YB 2Q0OC 1QR8A 1FJGO 2AXTZ 1F4MA 2EIMC 1QBZA 5CA3A 4R6ZA 1AJNA 3ABMC 1GRJA 3KCYA 2PTMA 1I08A 4JI4B 3OMNB 1V55B 4FLYA 4WCEV 1XREA 3EFFK 4DR3B 3RFRA 1D5NA 3RVYA 2QTSA 4J80A 4JI2O 2XAFA 3TGUH 2UXBO 2GV9A 5FNVA 1NR1A 3B40A 5EK0A 3JAWA 3RYIB 1ZUQA 3ETDA 5JH7B 2Y0PA 3SPGA 4FM2A 1FXKB 1HNWO 2YI8A 1ZTEA 3AK3A 1NU1H 4PA7A 1M57B 4ZKIA 3T4ZA 4DV2B 4WFFA 2EULA 2KSDA 3UQ8A 2EILC 3W7XA 2JEUA 4TV9A 4DUYB 4LBEC 3UO3A 5BMVA 2A0LA 1DK1A 2LQTA 3Q4HA 5JCOC 5BXZA 2LGWA 2EZOA 4NYKA 1F51A 1SQGA 2UU9B 1SA0A 2QM7A 4JI6O 3OEEG 3GWOA 3OD4A 4L8JA 5L3BA 4JTAB 4DV0B 3RYCA 2ZR3A 3HKBB 1FD9A 4PI0A 1EM1A 2OT5A 5JQGA 4JI1B 4B08A 2GSMB 4BWAA 2KG7B 2QGNA 4LNUB 2WLIB 2EJ7A 1URFA 1JA8A 4X62O 4LP8A 2HEPA 4NXMB 5LOVB 1NR7A 1T5EA 5K1PA 1VMGA 4UXNA 2QEXV 1OCRB 4CS4A 2R9IA 1K73W 4HZ3A 3ZMSA 4RQEA 3QTCA 3BA8A 4LNUA 2B5UA 4FLZA 1WA8A 4IYIA 3WG7B 2E5LO 5J9PC 4Z2WA 3H1HH 3ZHRA 2HHHB 3DGEA 3LSSA 3DC5A 2UXBB 1XDCA 3E86A 1G1XB 4MTXA 4U7NA 3B77A 3UM7A 1MG1A 5H2FZ 4OPHA 5IYDO 1N32O 1JOYA 4I4TA 4G28B 3F5TA 3ICXA 3A0RA 3WU2Z 5BZBA 1P7GA 2XOKG 2QTOA 3AG3C 3K59A 1G6UA 1M1KW 2XHBA 2Q8VA 4HNAB 1YCIA 2WAMA 1R3JC 5ITZB 1W0JG 3OUFA 1QVFU 1A32A 1IBLO 1SERA 1K3EA 3N2KB 3E8GA 3OMIB 2ADPA 3RYHB 4OX9B 3MDSA 3JD2A 5CB4B 4Z1VA 4F4LA 3A2FA 3FD9A 3TCUA 3BY6A 1OV9A 4PD4F 3H1JH 2IJIA 4H0LB 5JJJB 4ICGA 3ABLC 2ITCC 3IAYA 2F66C 3DXRB 3GWKC 1W59A 3ZEDA 3O65A 4GCZA 3I56V 3BFRA 3VOUA 4U3FH 1P84F 4ABMA 5J2TA 2W6JG 2JJ1G 5B1AB 3OR7C 4X88A 4RO2A 4B7EA 1KUQA 5LA6A 3RBZA 1KKDA 3F5WC 1E1RG 4DV1O 4EFBA 2CE4A 3CCJV 2EZPA 1H2LA 3JSNA 1NBMG 1VQ6V 1Q81W 4UB8Z 3JASA 2QSAA 1YITV 4O4HA 2OCCB 4B3RO 2ZNIA 4UVAA 1FAFA 2GBOA 3D3QA 5EYPA 2D2CB 1LNQA 3ZS8C 4ZIBA 1Q6HA 4I9WA 1YTFB 4DV1B 3SYOA 2OTJV 1FKAO 1AR4A 1WB7A 3OFNG 4CH3A 2OCHA 4UVBA 4JZ2A 2JS5A 3PN1A 1FFTB 1D2DA 2Q69A 5C8YA 4TV8A 3JD0A 5LMUB 4B3SB 2EIKB 3O9OA 3RYIA 2YIBD 4LFBB 2WLKA 2LO1A 2QM4A 1HNWB 1YDXA 4G2KA 4O4JB 1S76D 3ZN0A 1K97A 2E3CA 2N05A 2LW1A 2FYUH 4MVQA 1Q8IA 1O9HA 4FK5C 5HFLA 4OPAA 5LMUO 4B3SO 4J11A 5EBWC 2XAJA 5LGUA 1WN7A 4DW0A 4WBNB 1MZEA 2Q73A 3ABKC 4BW9A 1N34B 1US6A 1SRYA 3SJAC 1TAEA 4RUEA 1AI6A 3BRCA 1OCCC 4DV0O 1KD1W 5KHKA 5H6RA 1JQ0A 4EEQA 1VQ4V 5H9CA 1GKFA 1JCHA 2UUCB 4JI8O 4LF9O 4AQYO 2PI5A 2CUGA 4KP4A 4PDVA 4D6TH 4LF4O 1VIBA 3K0DA 1QNMA 2DJVA 4I50B 1HNXO 3B09A 4LCUC 3RW0A 1S0VA 4E4EA 2HLDG 2IBZH 3N2GA 4IIJB 2Q7HA 2DN9A 2JIZG 2PF4E 4X20B 4IT5A 1GM7A 1K4CC 4DK1A 5FNVB 4F6RA 4U3JB 1H2NA 1AJPA 1PP9H 1IDSA 2F43G 5KHJA 1V54B 1HDJA 4BIOA 2BTQB 2F1MA 4JV5B 1GK9A 3MHHC 4TQFA 4FLTA 4JI6B 3AG7A 2VWKA 1F23A 1M56B 2UXDO 1WPBA 4TV8B 2YEVB 1ROPA 2A7WA 4JI1O 3HB3B 3WB0A 3RYHA 1SQQH 5KA6A 5CN0A 3U10A 1M56C 1QLEC 1M93A 4X20A 2F95B 3AG2C 4E2LA 1VF7A 2A9HA 3UT5B 3JARB 5IJ0B 3RYCB 5LHGA 1R1BA 5IE9A 3J81N 3CPWU 1Q43A 3K5MA 5L3DA 3AG2B 3IJ4A 3JATA 4JYAO 4JAVA 2OIEA 3JD1A 3K3WA 4YJ3B 2ZE7A 3HR0A 2YIBA 5FL7G 1M5IA 3CRCA 4YJ3A 1ZL8B 5EYPB 1JMKC 3PJSK 3JCUZ 5IY5B 1N0NA 3SPCA 1EZJA 1SQXH 3ZCCA 1P4RA 2LGQA 1RSOB 4K0KB 2BSKB 4O4IB 4JI4O 2K9PA 5KX5A 3FAVA 3JSLA 2ETNA 3OT7A 3AG1B 3ZJZA 1IVSA 4PA3A 2ITDC 3CD6V 3D36A 1VARA 4NTWA 2WLLB 1XEQA 1BCCH 2NR5A 4HAMA 3FYEB 4K0KO 4JV5O 3AK2A 3BAAA 3P32A 4BIZA 1WP7A 3VBBA 4F6RB 5L3GA 1FXVA 1OJHA 3ZX6A 1OHHG 3L72H 3CS5A 1Z5VA 2P4KA 1KP2A 2RQ6A 3N2GB 3CCVV 4P2ZA 1V9PA 3SR2C 3QO7A 1Q5OA 1XHZA 2DQ0A 4RQFA 2OIGA 2UU9O 2R9RB 1DTOA 2HVJC 2NN4A 2DOSA 3ASOB 5LXTB 4B3TB 4GLXA 4X1KA 1RM1C 1H2SB 4JI3O 4CS2A 2XAQA 3B4SA 3T1CA 1NI8A 5JWPA 2QKAA 1NVPD 4UCSA 1RM1B 4QPJA 4R50A 1M4UA 4QE7A 1QHTA 2LW7A 4Z1MG 5B5EZ 4MTOA 1TUBA 2EIJC 3CC2V 3OGIB 5GW7A 3SYAA 1VQOV 2ZE8A 4O2AB 3K5NA 1XUQA 5E79Z 5DM6V 3CCRV 3KZIZ 2BTQA 1H8EG 1IXMA 4R7CA 5LHIA 1AI4A 3CCEV 3ASNB 4D7SA 5EC2C 5CA1A 1AROP 5A9GA 4TUYB 5JJEB 4GX2A 5H6QA 2ZE5A 3X2QC 4QGPA 4GX1A 2ZXWB 2CH7B 4KFMA 3K9AA 5C8YB 2LP7A 4J42A 2G38A 1V55C 2UXCB 4PI2A 4YIOA 4PDRA 2Y48A 4QIWF 4LWSA 3UCSC 4CH4A 2ZXWC 4FVMA 3G6EV 2DWDC 1CPYA 3ETQA 5ITZA 2VRZA 5L3FA 2Q6AA 3QVNA 1SS3A 4OGQB 3CYOA 2Q7GA 1LUWA 1IBLB 2F4VO 1HP8A 5L3CA 2ADQB 1Q6UA 3TXQA 1PL0A 2VWJA 1SESA 2RNBA 4K8ZA 5IYZA 1XL6A 4PV1B 1J95A 4A5UB 1Q82W 3SJBC 1Q3EA 3EXAA 4JI5O 4DV2O 4XDLA 2EJRA 4CH5A 4WBNA 4UCVA 2F4VB 1GAXA 1AP6A 3W7TA 2DYSC 4JGSA 1MSDA 2LFRA 3SJQC 1JJOA 4R8CA 5LMNB 3C3SA 2Y4TA 1OCOC 3R66A 5CBHA 4J7ZA 1QR9A 1G8MA 3ABTA 4B3MO 3SPIA 1I94O 4JYAB 4C7UA 4GX0A 2AHYA 3H1KH 1SC5B 1SZTA 5JVDA 4IIJA 3SYPA 1HW7A 1XMOO 2PI4A 1OCRC 2WLIA 4YY3O 3JAKB 3KKYA 4RAIA 1RFYA 5LL6Y 1TGOA 5B1NA 5LP6A 1NQTA 2ZM6O 5AG2A 3K9SA 3H9VA 4D7TA 3X2QB 4O4HB 2YC0A 5CMUA 3Q4HB 5D5PA 4YY3B 4XDJA 1SZXA 4AI8A 4ZOLB 3BCCH 4DYLA 1YJ9V 1NH2D 4UCRA 3AG4B 1B04A 4J9ZB 4ZI7B 4DV5B 4X66B 2E75B 2Y69B 3M8AA 2CDYA 4LFCO 1YJNV 2LFSA 3HKCA 4FM1A 2ZIOA 3FX7A 3SYCA 2OTLV 4X1YB 3A8TA 2Y69C 2IH3C 3BABA 5IY5C 1Y66A 4IGGA 3IC7A 1RPRA 2UUBB 2UUAO 3ZRWB 2ATKC 1S5HC 4X66O 1GN4A 4DV3O 5CB4A 1TVKB 5KHIA 1NTMH 2XAGA 3AG1C 1IBMB 4BR6A 3L74H 2QKCA 1Y67A 5JCOA 4FZ0A 4LF9B 4AHCA 3OGCC 2R72A 4OX9O 2VQEO 2CK3G 4DR7O 1V54C 4JAUA 3ABLB 2Z0AA 3CEIA 3KCXA 4HNAA 1JFFB 2AHZA 2DYRC 1QQCA 1P7BA 4MW3A 3W7WA 4CH6A 4O4LA 2WA3A 5C93A 1GM8A 3JASB 4K3AA 3ZHSA 3LUTB 1P49A 3T2MA 4UVCA 5B1AC 4LFAO 4DUZB 2BOBC 2DE0X 1HR0O 5B1BB 4NKGB 3ZHTA 4J10A 1COWG 1M9NA 2W0XA 1NZ6A 4KHPO 3F7VC 3ZRVA 2FTKA 3CCLV 4J41A 3SJCC 4DRXB 3OAAG 5FPRA 4P9OA 4ZHQB 5FLXN 1N33B 1WA8B 1IBKB 1PPJH 1S5LZ 3E8HA 5EIBD 5KMGB 2N74A 2WLNA 3JD4A 3CXHF 1SQVH 1ZAUA 2EIJB 5J2UA 1N36O 4MVZA 4EKWA 5DEDA 1TUBB 5LHHA 3E8FA 1E1QG 4TT3G 1BL8A 4FZ1A 2ZINA 5DN6G 1MABG 5KAFZ 4J7KA 4UCOA 3RYFB 2HKOA 3E35A 3H01A 5KLVH 4YHHB 4DXWA 4JASA 4LF7O 2QWRB 1XQ8A 3ASNC 3CC4V 3ZMUA 3DTUB 3TK1A 4DR7B 5TISZ 4JPRA 1F4NA 5D5QA 4X1IA 1EN4A 2H94A 4LF6B 5K1XA 4DUYO 5GONB 2YIAA 4ZOLA 1XNRB 4CBCA 3ZIAG 3SYQA 1M90W 3FFQA 1N34O 5IYCO 4ASUG 2DYRB 2A3QA 4FLXA 3RYFA 3P3NA 3JARA 3M99B 2FB5A 4AQYB 2ZQMA 3QG5A 3K5OA 1XMQB 2Q5ZA 2Q7EA 3E8BA 5H5NA 4JI0O 2PY5A 3D36C 5J2TB 2Y0IA 2ARHA 2W0FC 2P22C 3CJHA 1SETA 2QWOB 1N33O 1Y6XA 4UCUA 2GHYA 4LH6A 3WFVA 1D5AA 4CC5A 2FL4A 1L8DA 2YDEA 3STLC 3OTOO 1RPOA 3L71H 4FFBB 1HNZO 1MNGA 3CCSV 3VQVA 2K1EA 3L73H 5LBQA 5KX5B 1OCZC 4DRXA 4ZHQA 3CCQV 2GDSA 3GVMA 4O4IA 1KYOF 3ZMTA 2GTAA 3S3XA 2XNDG 2CTPA 5B3SC 2UXNA 1PKXA 1L0LH 1KC8W 1VQPV 4P30A 3QF7A 5EZYB 3I55V 5LMNO 3ZMZA 5LGNA 3CRQA 2IJJA 1TUEB 1O9GA 5BMVB 2KKWA 4TV9B 2ZR2A 4DR5B 4FLWA 4UV9A 3ETEA 2GUZA 5BY1A 2UUCO 4JI8B 1NT2B 3CRAA 3JYCA 4I7ZB 2P6JA 3JD3A 4I9QA 1WP8A 3WB2A 4WFBV 1H2KA 4NB5A 1JFFA 1EFRG 3STZC 3T1YO 1HWYA 3D8CA 4PJ0Z 2YI9A 4DR6B 4CZZA 3AEIA 2FMLA 3HKEA 4LR3A 2L35A 1FXKC 3I5DA 2KB1A 3FB7C 2IJHA 1CEZA 3CHXA 1M57C 1U96A 4O2AA 3T1HO 2EINC 2V4DA 2XUMA 1PL4A 1YZBA 5A2QN 5FPOA 1JPXA 1I7FA 1AVMA 4JI2B 1R6NA 1VP7A 2YUAA 4X8AA 2R70A 3E22A 4O4JA 3G67A 1FFXB 5CA0B 2QJ1A 1BHBA 5KUMA 4DV5O 1YJWV 4RUFA 4DV4O 4LFCB 4IYHA 4DR1O 5EIBC 2F23A 3B2EE 4FMTA 3THOA 3T1HB 3HKEB 2ZT9B 4GKJO 4MSWC 4BIUA 2WLHA 4MS2A 1LUVA 4NVPA 2ODMA 3BA9A 2HR3A 3ZHUA 2EX3A 2JGDB 4PA4A 3J7AU 3LDDA 3K04A 3CP1A 5LXTA 3C90A 3ML0A 3EVKA 5LP6B 1B06A 1XHXA 1Z5WA 4TSFG 4LF5B 1NS1A 3RT3C 1J5EO 5KHGA 3G4SV 1K9MW 1OCOB 3L70H 3OM3B 3ETGA 2YEVA 3E2EA 4TUYA 4DR6O 2ZDIC 3SPJA 5B66Z 1BQ0A 1PM9A 2YXLA 4QJFB 4X65O 2CTWA 4NTXA 1BMFG 4B3TO 4I0XA 1R6KA 4LFAB 2RCVA 2X6CA 2ZDIA 2QA4V 2JRIA 2XAHA 4LH7A 3ZRWA 3FB6C 5LYJA 1N0JA 3RVZA 3ZHVA 1YSCA 1DF5A 1ZWIC 2E74B 1R6TA 4DV7B 2IJKA 1ENVA 2ZM6B 3CCMV 2ZCEA 3FKSG 3SDLA 2JGUA 2ZE6A 1VQLV 1YIJV 4GKKB 3OTFA 5IYZB 2P90A 1XNQO 3SGIA 1YXBA 2RJZA 2CGNA 2P67A 2YSUB 1Q90D 4GUNA 4UUJC 2QDOA 4O2BB 4WFEA 3AG4C 4GYCB 1OZ0A 1GM9A 1H2MA 5E1AC 2AGAA 1SQBH 3CCUV 3ZRXA 1YHQV 1S5JA 2QM8A 2JJ2G 4GZRB 3W7SA 1FJGB 1SKVA 1OCCB 3A0BZ 1DF4A 4LF8B 4H37A 5L3EA 2ZD9A 1QCEA 1KBHA 2C2AA 3ZHQA 1K4DC 1HNZB 1VQKV 3CRRA 1YVWA 1MZFA 2Q68A 5GTHZ 4WFAV 3CC7V 4EB6B 2BE3A 3NR7A 4DV3B 3U0ZA 5LP6C 2F93B 1AI5A 1DLBA 2Y4UA 4H44B 5B1BC 4X65B 3BHPA 2JDIG 4B7KA 2WLJA 1Z2GA 3EHBB 3G80A 1FS0G 1VQ7V 3BEHA 4CC6A 2YXYA 4PDLA 1Y4MA 4TQDA 5LOVA 3DC6A 1GN3A 1WAZA 3K79A 5B1OA 4DR4O 4BW5A 1R73A 2OWOA 3CRMA 4U3JA 1XMQO 2GTSA 1RSOA 1S72V 2X6BA 5KUKA 1JVMA 4DUZO 4GT1A 2WWWA 3CWBH 4B3RB 2B9ZA 4DR4B 1BGYH 4B3MB 4X89A 1DGSA 4I50A 5DECA 4FPPA 4XDKA 4UFZA 1MOFA 1QLEB 4DR3O 2HJFC 3WB1A 4BAYA 2IW5A 4TWKA 1BZKA 3JCZA 5IJ0A 1FFXA 4MW8A 2BOCC 1E79G 1GN2A 4YJ2B 4Q20A 4MVOA 2R9AA 4UV8A 4JYYA 5LGTA 4DR1B 2L6LA 2E5LB 4FFBA 1N36B 4YIPA 1I5XA 3GB7C 1KB9F 2MW2B 2B1GA 4HYOA 4KL1A 1PNLA 4PA9A 4X1YA 1S3JA 2V1DA 2Z3YA 4JZGA 1N32B 4WFHA 4FIPC 2HFEC 5IJ9B 4U7OA 4JYBA 1FXHA 4N21A 1VQ9V 2M6YA 1Q86W 1NH2B 5KA5A 4EB6A 3FB5C 3G6BA 3LSUA 1L0NH 1R3KC 4LF6O 2MK3A 4G27B 3H1IH 1SA0B 1KECA 1NTKH 3D3IA 1VEWA 2AZ0A 1XILA 1XMOB 4FLUA 4FLVA 4LF4B 4JTCB 4JI7B 1VQMV 1Q6IA 2DWEC 3VQXA 2PGGA 3K08A 1EN5A 1EN6A 2CH7A 3IFXA 1L1FA 3K57A 2HVKC 2M7WA 2DW4A 4YXWG 4IHJA 3JAWB 2HHHO 5CBGA 1AP5A 3OW2U 5CA0A 4P9PA 1Y76A 1R3IC 3ZN1A 2H8PC 5J2UB 2WPDG 2AW9A 4J9YB 1I5YA 3E83A 1RP3B 1ZSPA 1WB8A 3OEHG 1N8RW 3RN4A 3CJHB 2B1IA 3QO5A 1PNKA 3AK1A 1S77D 2RDCA 3ABMB 2DQ3A 3CMAV 1N4CA 2UXXA 1X4TA 1KQSU 4GX5A 2UUBO 4YJ2A 2BSKA 3H1LH 1TA8A 2XTAA 2RMKB 1I0HA 3QNEA 3QO8A 3K03A 2IH1C 3L75H 4Q6GA 4XBFA 4I55A 1Y74A 1AILA 2EINB 2JGDA 5BR8O 2UXCO 2GUZB 2HP8A 2P7TC 2E76B 2X7RB 1W0KG 1ORQC 3P3PA 1XL4A 2WA4A 2EIMB 1THZA 3TJTA 3K58A 1VQ5V 2WLMA 3A0HZ 1H2GA
chains in the Genus database with same CATH topology
2QWOB 2QWRB 1BQZA 2DMXA 1NZ6A 3AG7A 2CTRA 2CTQA 2CTPA 2N04A 2YS8A 3APQA 1IURA 2CUGA 1FAFA 2DN9A 1BQ0A 4RWUA 3UO2A 1XBLA 2QWPB 2PF4E 2QWNB 2GUZB 4IT5A 3BVOA 4J80A 2CTWA 2Y4TA 1GH6A 1FPOA 1N4CA 2LO1A 2M6YA 2KQXA 2QWQB 2YUAA 2L6LA 3UCSC 2Y4UA 3UO3A 4J7ZA 2N05A 3APOA 1HDJA 2EJ7A 2OCHA 2LGWA 2GUZA 1WJZA 2QSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  2QWR B;  1BQZ A;  2DMX A;  1NZ6 A;  3AG7 A;  2CTR A;  2CTQ A;  2CTP A;  2N04 A;  2YS8 A;  3APQ A;  1IUR A;  2CUG A;  1FAF A;  2DN9 A;  1BQ0 A;  4RWU A;  3UO2 A;  1XBL A;  2QWP B;  2PF4 E;  2QWN B;  2GUZ B;  4IT5 A;  3BVO A;  4J80 A;  2CTW A;  2Y4T A;  1GH6 A;  1FPO A;  1N4C A;  2LO1 A;  2M6Y A;  2KQX A;  2QWQ B;  2YUA A;  2L6L A;  3UCS C;  2Y4U A;  3UO3 A;  4J7Z A;  2N05 A;  3APO A;  1HDJ A;  2EJ7 A;  2OCH A;  2LGW A;  2GUZ A;  1WJZ A;  2QSA A; 
#chains in the Genus database with same CATH topology
 4WF9 V;  2EIL B;  4JYC A;  1YTF D;  2JVD A;  3B8M A;  2IU0 A;  4O4L B;  1Y74 B;  1BE3 H;  4JF3 A;  5IT9 N;  2JK5 C;  4NXN B;  5F2V O;  4DW1 A;  1YI2 V;  1VQN V;  4JI5 B;  4GKK O;  5HFM A;  2RN9 A;  2YXH A;  1XNQ B;  1BSM A;  2YID A;  1W2B U;  4DO2 A;  1TVK A;  2OYQ A;  4NTY A;  5CBF A;  3ABU A;  3HPL C;  2PYL A;  3DXR A;  4DK0 A;  3IC9 A;  4HBN A;  4MT8 A;  2X0L A;  2QWQ B;  1VF6 A;  3B8N A;  3CE2 A;  4DV6 B;  4LF8 O;  3M7M X;  1X59 A;  1UPG A;  3P30 A;  1UJW B;  2VQF O;  1I94 B;  4GKJ B;  3HKB A;  4PA6 A;  3NXS A;  3OMA B;  4PDM A;  1NTZ H;  1G4Y B;  4PEL A;  4RWU A;  1KP3 A;  4QE9 A;  4MVU A;  1PV0 A;  1ZL8 A;  4TOI A;  3FYI B;  4I5S A;  1MA1 A;  1HNX B;  4DV6 O;  4MVS A;  1SF9 A;  4MVM A;  1IX9 A;  1UFI A;  3IGA C;  5GTI Z;  4MTF A;  5EZY A;  4LFB O;  1SQF A;  2ZKO A;  1AJQ A;  4LF5 O;  3K5L A;  1AI7 A;  1J5E B;  2EIK C;  2AZ2 A;  2CTR A;  4LF7 B;  2YS8 A;  4O2B A;  4I55 B;  2Q9L A;  1IUR A;  1K34 A;  3UO2 A;  3K06 A;  4N23 A;  1FYJ A;  3BVO A;  4QPK A;  3LNN A;  3MHS C;  4F6E A;  3JAK A;  3F7Y C;  1PD3 A;  3G71 V;  4W4K A;  3WG7 C;  1XNR O;  4NXN O;  3CME V;  1K7D A;  2A06 H;  1QVG U;  4UCT A;  1R3L C;  2QR4 A;  2ZIM A;  2UXD B;  4X64 B;  1H38 A;  2NNU A;  2Q4P A;  3W7U A;  1QU7 A;  4X9Q A;  3ZMV A;  3MAQ A;  3J80 N;  1WLE A;  4LC1 A;  1B3Q A;  1YF2 A;  2D3O W;  2UUA B;  1JX9 A;  3OE7 G;  4JAA A;  4IL6 Z;  3FAV B;  4JI0 B;  2VS0 A;  4CS3 A;  4WFG A;  4L87 A;  2FKX A;  2Q67 A;  5JJN B;  4X64 O;  1H8H G;  4JI7 O;  1BHA A;  2NLJ C;  4JTD B;  3UKM A;  3OTO B;  3N2K A;  2A79 B;  2VQE B;  4ZI7 A;  2H3O A;  3SPH A;  3U11 A;  3TET A;  2KQX A;  3JAL B;  2IM9 A;  4X62 B;  4IHJ B;  3JAM N;  2ILM A;  2N04 A;  3LDE A;  3ZRS A;  2DYS B;  4J7J A;  1XOU A;  4QNH B;  2OCC C;  1U97 A;  4K8X A;  3JAL A;  2QKS A;  4X1I B;  1K5Q A;  1VQ8 V;  3OR6 C;  4H13 B;  1NKD A;  2Z5U A;  1K33 A;  3RWR D;  2ZNJ A;  5IWA B;  3ZBH A;  1K8A W;  4KHP B;  3FB8 C;  3HKD A;  4FJC C;  1FXK A;  4H33 A;  3UT5 A;  2CGO A;  4FM0 A;  1GO3 F;  1F7Y A;  2JEX A;  1JR9 A;  2PZS A;  2V7Q G;  5CA1 B;  1GMG A;  5LYJ B;  3CX5 F;  4UB6 Z;  1IZ3 A;  1IXB A;  1IBK O;  2PUS A;  4I0X B;  4EFE A;  1XI1 A;  2BCC H;  1QLN A;  2P4V A;  3R65 A;  1VF5 B;  3KG2 A;  2Q0A A;  3MD0 A;  1CP9 A;  3LDC A;  3TXS A;  3VQW A;  2X6A A;  1SQP H;  2QWP B;  4NXM O;  4OXS A;  1GH6 A;  1FPO A;  1K5S A;  1AR5 A;  3E89 A;  1ZX3 A;  4K35 A;  3RGB A;  3L9D A;  1KKC A;  5EC1 C;  1NJI W;  4YHH O;  5JQG B;  2W6I G;  4DR2 B;  5IYB O;  3BPZ A;  4DV4 B;  1KU9 A;  3OUS A;  3C3T A;  4NR1 A;  1XBL A;  3LSQ A;  4X1K B;  3K0G A;  1K92 A;  1WPX A;  4LWS B;  5GON A;  3CXC U;  1GN6 A;  4MTG A;  3APO A;  3JAT B;  4W4L A;  5LA6 B;  1NVP B;  1YEW A;  4I4T B;  4ZBM A;  4DR2 O;  1WJZ A;  1MSW D;  2JS3 A;  1EZV H;  5JVD B;  1ZLZ A;  1B6Q A;  5KAI Z;  5IWA O;  2VQF B;  3E22 B;  5BR8 B;  1Q7Y W;  3ABK B;  3VQY A;  2LJ2 A;  5IJ9 A;  2P5O A;  2PYJ A;  1GTO A;  1BQZ A;  5KMG A;  2QE7 G;  3HKD B;  2WLL A;  2P06 A;  5EBM C;  1IBM O;  3S3W A;  1KMI Z;  4JI3 B;  2KG7 A;  1CXZ B;  1WNS A;  3ASO C;  5KHH A;  1Y76 B;  2IU3 A;  3CSX A;  4KXR A;  2CAZ C;  2WSS G;  3DSQ A;  3N27 A;  3HKC B;  2DMX A;  5IDJ A;  2CTQ A;  2O57 A;  2EBO A;  5EBL C;  3LNM B;  4DV7 O;  1MMM A;  2QWN B;  2HG5 C;  2XT9 A;  4AIL C;  1EBO A;  1OCZ B;  4DR5 O;  1AR1 B;  1HR0 B;  2YIC A;  2XAS A;  2HJD A;  1PNM A;  4FFK A;  1BS3 A;  1AB3 A;  1BT8 A;  3APQ A;  5B3S B;  3AG3 B;  1VF6 C;  3T4D A;  4KUM A;  1JJ2 U;  1LR1 A;  4MVR A;  2BTO A;  5JH7 A;  4PHZ A;  3CB2 A;  3T1Y B;  2Q0O C;  1QR8 A;  1FJG O;  2AXT Z;  1F4M A;  2EIM C;  1QBZ A;  5CA3 A;  4R6Z A;  1AJN A;  3ABM C;  1GRJ A;  3KCY A;  2PTM A;  1I08 A;  4JI4 B;  3OMN B;  1V55 B;  4FLY A;  4WCE V;  1XRE A;  3EFF K;  4DR3 B;  3RFR A;  1D5N A;  3RVY A;  2QTS A;  4J80 A;  4JI2 O;  2XAF A;  3TGU H;  2UXB O;  2GV9 A;  5FNV A;  1NR1 A;  3B40 A;  5EK0 A;  3JAW A;  3RYI B;  1ZUQ A;  3ETD A;  5JH7 B;  2Y0P A;  3SPG A;  4FM2 A;  1FXK B;  1HNW O;  2YI8 A;  1ZTE A;  3AK3 A;  1NU1 H;  4PA7 A;  1M57 B;  4ZKI A;  3T4Z A;  4DV2 B;  4WFF A;  2EUL A;  2KSD A;  3UQ8 A;  2EIL C;  3W7X A;  2JEU A;  4TV9 A;  4DUY B;  4LBE C;  3UO3 A;  5BMV A;  2A0L A;  1DK1 A;  2LQT A;  3Q4H A;  5JCO C;  5BXZ A;  2LGW A;  2EZO A;  4NYK A;  1F51 A;  1SQG A;  2UU9 B;  1SA0 A;  2QM7 A;  4JI6 O;  3OEE G;  3GWO A;  3OD4 A;  4L8J A;  5L3B A;  4JTA B;  4DV0 B;  3RYC A;  2ZR3 A;  3HKB B;  1FD9 A;  4PI0 A;  1EM1 A;  2OT5 A;  5JQG A;  4JI1 B;  4B08 A;  2GSM B;  4BWA A;  2KG7 B;  2QGN A;  4LNU B;  2WLI B;  2EJ7 A;  1URF A;  1JA8 A;  4X62 O;  4LP8 A;  2HEP A;  4NXM B;  5LOV B;  1NR7 A;  1T5E A;  5K1P A;  1VMG A;  4UXN A;  2QEX V;  1OCR B;  4CS4 A;  2R9I A;  1K73 W;  4HZ3 A;  3ZMS A;  4RQE A;  3QTC A;  3BA8 A;  4LNU A;  2B5U A;  4FLZ A;  1WA8 A;  4IYI A;  3WG7 B;  2E5L O;  5J9P C;  4Z2W A;  3H1H H;  3ZHR A;  2HHH B;  3DGE A;  3LSS A;  3DC5 A;  2UXB B;  1XDC A;  3E86 A;  1G1X B;  4MTX A;  4U7N A;  3B77 A;  3UM7 A;  1MG1 A;  5H2F Z;  4OPH A;  5IYD O;  1N32 O;  1JOY A;  4I4T A;  4G28 B;  3F5T A;  3ICX A;  3A0R A;  3WU2 Z;  5BZB A;  1P7G A;  2XOK G;  2QTO A;  3AG3 C;  3K59 A;  1G6U A;  1M1K W;  2XHB A;  2Q8V A;  4HNA B;  1YCI A;  2WAM A;  1R3J C;  5ITZ B;  1W0J G;  3OUF A;  1QVF U;  1A32 A;  1IBL O;  1SER A;  1K3E A;  3N2K B;  3E8G A;  3OMI B;  2ADP A;  3RYH B;  4OX9 B;  3MDS A;  3JD2 A;  5CB4 B;  4Z1V A;  4F4L A;  3A2F A;  3FD9 A;  3TCU A;  3BY6 A;  1OV9 A;  4PD4 F;  3H1J H;  2IJI A;  4H0L B;  5JJJ B;  4ICG A;  3ABL C;  2ITC C;  3IAY A;  2F66 C;  3DXR B;  3GWK C;  1W59 A;  3ZED A;  3O65 A;  4GCZ A;  3I56 V;  3BFR A;  3VOU A;  4U3F H;  1P84 F;  4ABM A;  5J2T A;  2W6J G;  2JJ1 G;  5B1A B;  3OR7 C;  4X88 A;  4RO2 A;  4B7E A;  1KUQ A;  5LA6 A;  3RBZ A;  1KKD A;  3F5W C;  1E1R G;  4DV1 O;  4EFB A;  2CE4 A;  3CCJ V;  2EZP A;  1H2L A;  3JSN A;  1NBM G;  1VQ6 V;  1Q81 W;  4UB8 Z;  3JAS A;  2QSA A;  1YIT V;  4O4H A;  2OCC B;  4B3R O;  2ZNI A;  4UVA A;  1FAF A;  2GBO A;  3D3Q A;  5EYP A;  2D2C B;  1LNQ A;  3ZS8 C;  4ZIB A;  1Q6H A;  4I9W A;  1YTF B;  4DV1 B;  3SYO A;  2OTJ V;  1FKA O;  1AR4 A;  1WB7 A;  3OFN G;  4CH3 A;  2OCH A;  4UVB A;  4JZ2 A;  2JS5 A;  3PN1 A;  1FFT B;  1D2D A;  2Q69 A;  5C8Y A;  4TV8 A;  3JD0 A;  5LMU B;  4B3S B;  2EIK B;  3O9O A;  3RYI A;  2YIB D;  4LFB B;  2WLK A;  2LO1 A;  2QM4 A;  1HNW B;  1YDX A;  4G2K A;  4O4J B;  1S76 D;  3ZN0 A;  1K97 A;  2E3C A;  2N05 A;  2LW1 A;  2FYU H;  4MVQ A;  1Q8I A;  1O9H A;  4FK5 C;  5HFL A;  4OPA A;  5LMU O;  4B3S O;  4J11 A;  5EBW C;  2XAJ A;  5LGU A;  1WN7 A;  4DW0 A;  4WBN B;  1MZE A;  2Q73 A;  3ABK C;  4BW9 A;  1N34 B;  1US6 A;  1SRY A;  3SJA C;  1TAE A;  4RUE A;  1AI6 A;  3BRC A;  1OCC C;  4DV0 O;  1KD1 W;  5KHK A;  5H6R A;  1JQ0 A;  4EEQ A;  1VQ4 V;  5H9C A;  1GKF A;  1JCH A;  2UUC B;  4JI8 O;  4LF9 O;  4AQY O;  2PI5 A;  2CUG A;  4KP4 A;  4PDV A;  4D6T H;  4LF4 O;  1VIB A;  3K0D A;  1QNM A;  2DJV A;  4I50 B;  1HNX O;  3B09 A;  4LCU C;  3RW0 A;  1S0V A;  4E4E A;  2HLD G;  2IBZ H;  3N2G A;  4IIJ B;  2Q7H A;  2DN9 A;  2JIZ G;  2PF4 E;  4X20 B;  4IT5 A;  1GM7 A;  1K4C C;  4DK1 A;  5FNV B;  4F6R A;  4U3J B;  1H2N A;  1AJP A;  1PP9 H;  1IDS A;  2F43 G;  5KHJ A;  1V54 B;  1HDJ A;  4BIO A;  2BTQ B;  2F1M A;  4JV5 B;  1GK9 A;  3MHH C;  4TQF A;  4FLT A;  4JI6 B;  3AG7 A;  2VWK A;  1F23 A;  1M56 B;  2UXD O;  1WPB A;  4TV8 B;  2YEV B;  1ROP A;  2A7W A;  4JI1 O;  3HB3 B;  3WB0 A;  3RYH A;  1SQQ H;  5KA6 A;  5CN0 A;  3U10 A;  1M56 C;  1QLE C;  1M93 A;  4X20 A;  2F95 B;  3AG2 C;  4E2L A;  1VF7 A;  2A9H A;  3UT5 B;  3JAR B;  5IJ0 B;  3RYC B;  5LHG A;  1R1B A;  5IE9 A;  3J81 N;  3CPW U;  1Q43 A;  3K5M A;  5L3D A;  3AG2 B;  3IJ4 A;  3JAT A;  4JYA O;  4JAV A;  2OIE A;  3JD1 A;  3K3W A;  4YJ3 B;  2ZE7 A;  3HR0 A;  2YIB A;  5FL7 G;  1M5I A;  3CRC A;  4YJ3 A;  1ZL8 B;  5EYP B;  1JMK C;  3PJS K;  3JCU Z;  5IY5 B;  1N0N A;  3SPC A;  1EZJ A;  1SQX H;  3ZCC A;  1P4R A;  2LGQ A;  1RSO B;  4K0K B;  2BSK B;  4O4I B;  4JI4 O;  2K9P A;  5KX5 A;  3FAV A;  3JSL A;  2ETN A;  3OT7 A;  3AG1 B;  3ZJZ A;  1IVS A;  4PA3 A;  2ITD C;  3CD6 V;  3D36 A;  1VAR A;  4NTW A;  2WLL B;  1XEQ A;  1BCC H;  2NR5 A;  4HAM A;  3FYE B;  4K0K O;  4JV5 O;  3AK2 A;  3BAA A;  3P32 A;  4BIZ A;  1WP7 A;  3VBB A;  4F6R B;  5L3G A;  1FXV A;  1OJH A;  3ZX6 A;  1OHH G;  3L72 H;  3CS5 A;  1Z5V A;  2P4K A;  1KP2 A;  2RQ6 A;  3N2G B;  3CCV V;  4P2Z A;  1V9P A;  3SR2 C;  3QO7 A;  1Q5O A;  1XHZ A;  2DQ0 A;  4RQF A;  2OIG A;  2UU9 O;  2R9R B;  1DTO A;  2HVJ C;  2NN4 A;  2DOS A;  3ASO B;  5LXT B;  4B3T B;  4GLX A;  4X1K A;  1RM1 C;  1H2S B;  4JI3 O;  4CS2 A;  2XAQ A;  3B4S A;  3T1C A;  1NI8 A;  5JWP A;  2QKA A;  1NVP D;  4UCS A;  1RM1 B;  4QPJ A;  4R50 A;  1M4U A;  4QE7 A;  1QHT A;  2LW7 A;  4Z1M G;  5B5E Z;  4MTO A;  1TUB A;  2EIJ C;  3CC2 V;  3OGI B;  5GW7 A;  3SYA A;  1VQO V;  2ZE8 A;  4O2A B;  3K5N A;  1XUQ A;  5E79 Z;  5DM6 V;  3CCR V;  3KZI Z;  2BTQ A;  1H8E G;  1IXM A;  4R7C A;  5LHI A;  1AI4 A;  3CCE V;  3ASN B;  4D7S A;  5EC2 C;  5CA1 A;  1ARO P;  5A9G A;  4TUY B;  5JJE B;  4GX2 A;  5H6Q A;  2ZE5 A;  3X2Q C;  4QGP A;  4GX1 A;  2ZXW B;  2CH7 B;  4KFM A;  3K9A A;  5C8Y B;  2LP7 A;  4J42 A;  2G38 A;  1V55 C;  2UXC B;  4PI2 A;  4YIO A;  4PDR A;  2Y48 A;  4QIW F;  4LWS A;  3UCS C;  4CH4 A;  2ZXW C;  4FVM A;  3G6E V;  2DWD C;  1CPY A;  3ETQ A;  5ITZ A;  2VRZ A;  5L3F A;  2Q6A A;  3QVN A;  1SS3 A;  4OGQ B;  3CYO A;  2Q7G A;  1LUW A;  1IBL B;  2F4V O;  1HP8 A;  5L3C A;  2ADQ B;  1Q6U A;  3TXQ A;  1PL0 A;  2VWJ A;  1SES A;  2RNB A;  4K8Z A;  5IYZ A;  1XL6 A;  4PV1 B;  1J95 A;  4A5U B;  1Q82 W;  3SJB C;  1Q3E A;  3EXA A;  4JI5 O;  4DV2 O;  4XDL A;  2EJR A;  4CH5 A;  4WBN A;  4UCV A;  2F4V B;  1GAX A;  1AP6 A;  3W7T A;  2DYS C;  4JGS A;  1MSD A;  2LFR A;  3SJQ C;  1JJO A;  4R8C A;  5LMN B;  3C3S A;  2Y4T A;  1OCO C;  3R66 A;  5CBH A;  4J7Z A;  1QR9 A;  1G8M A;  3ABT A;  4B3M O;  3SPI A;  1I94 O;  4JYA B;  4C7U A;  4GX0 A;  2AHY A;  3H1K H;  1SC5 B;  1SZT A;  5JVD A;  4IIJ A;  3SYP A;  1HW7 A;  1XMO O;  2PI4 A;  1OCR C;  2WLI A;  4YY3 O;  3JAK B;  3KKY A;  4RAI A;  1RFY A;  5LL6 Y;  1TGO A;  5B1N A;  5LP6 A;  1NQT A;  2ZM6 O;  5AG2 A;  3K9S A;  3H9V A;  4D7T A;  3X2Q B;  4O4H B;  2YC0 A;  5CMU A;  3Q4H B;  5D5P A;  4YY3 B;  4XDJ A;  1SZX A;  4AI8 A;  4ZOL B;  3BCC H;  4DYL A;  1YJ9 V;  1NH2 D;  4UCR A;  3AG4 B;  1B04 A;  4J9Z B;  4ZI7 B;  4DV5 B;  4X66 B;  2E75 B;  2Y69 B;  3M8A A;  2CDY A;  4LFC O;  1YJN V;  2LFS A;  3HKC A;  4FM1 A;  2ZIO A;  3FX7 A;  3SYC A;  2OTL V;  4X1Y B;  3A8T A;  2Y69 C;  2IH3 C;  3BAB A;  5IY5 C;  1Y66 A;  4IGG A;  3IC7 A;  1RPR A;  2UUB B;  2UUA O;  3ZRW B;  2ATK C;  1S5H C;  4X66 O;  1GN4 A;  4DV3 O;  5CB4 A;  1TVK B;  5KHI A;  1NTM H;  2XAG A;  3AG1 C;  1IBM B;  4BR6 A;  3L74 H;  2QKC A;  1Y67 A;  5JCO A;  4FZ0 A;  4LF9 B;  4AHC A;  3OGC C;  2R72 A;  4OX9 O;  2VQE O;  2CK3 G;  4DR7 O;  1V54 C;  4JAU A;  3ABL B;  2Z0A A;  3CEI A;  3KCX A;  4HNA A;  1JFF B;  2AHZ A;  2DYR C;  1QQC A;  1P7B A;  4MW3 A;  3W7W A;  4CH6 A;  4O4L A;  2WA3 A;  5C93 A;  1GM8 A;  3JAS B;  4K3A A;  3ZHS A;  3LUT B;  1P49 A;  3T2M A;  4UVC A;  5B1A C;  4LFA O;  4DUZ B;  2BOB C;  2DE0 X;  1HR0 O;  5B1B B;  4NKG B;  3ZHT A;  4J10 A;  1COW G;  1M9N A;  2W0X A;  1NZ6 A;  4KHP O;  3F7V C;  3ZRV A;  2FTK A;  3CCL V;  4J41 A;  3SJC C;  4DRX B;  3OAA G;  5FPR A;  4P9O A;  4ZHQ B;  5FLX N;  1N33 B;  1WA8 B;  1IBK B;  1PPJ H;  1S5L Z;  3E8H A;  5EIB D;  5KMG B;  2N74 A;  2WLN A;  3JD4 A;  3CXH F;  1SQV H;  1ZAU A;  2EIJ B;  5J2U A;  1N36 O;  4MVZ A;  4EKW A;  5DED A;  1TUB B;  5LHH A;  3E8F A;  1E1Q G;  4TT3 G;  1BL8 A;  4FZ1 A;  2ZIN A;  5DN6 G;  1MAB G;  5KAF Z;  4J7K A;  4UCO A;  3RYF B;  2HKO A;  3E35 A;  3H01 A;  5KLV H;  4YHH B;  4DXW A;  4JAS A;  4LF7 O;  2QWR B;  1XQ8 A;  3ASN C;  3CC4 V;  3ZMU A;  3DTU B;  3TK1 A;  4DR7 B;  5TIS Z;  4JPR A;  1F4N A;  5D5Q A;  4X1I A;  1EN4 A;  2H94 A;  4LF6 B;  5K1X A;  4DUY O;  5GON B;  2YIA A;  4ZOL A;  1XNR B;  4CBC A;  3ZIA G;  3SYQ A;  1M90 W;  3FFQ A;  1N34 O;  5IYC O;  4ASU G;  2DYR B;  2A3Q A;  4FLX A;  3RYF A;  3P3N A;  3JAR A;  3M99 B;  2FB5 A;  4AQY B;  2ZQM A;  3QG5 A;  3K5O A;  1XMQ B;  2Q5Z A;  2Q7E A;  3E8B A;  5H5N A;  4JI0 O;  2PY5 A;  3D36 C;  5J2T B;  2Y0I A;  2ARH A;  2W0F C;  2P22 C;  3CJH A;  1SET A;  2QWO B;  1N33 O;  1Y6X A;  4UCU A;  2GHY A;  4LH6 A;  3WFV A;  1D5A A;  4CC5 A;  2FL4 A;  1L8D A;  2YDE A;  3STL C;  3OTO O;  1RPO A;  3L71 H;  4FFB B;  1HNZ O;  1MNG A;  3CCS V;  3VQV A;  2K1E A;  3L73 H;  5LBQ A;  5KX5 B;  1OCZ C;  4DRX A;  4ZHQ A;  3CCQ V;  2GDS A;  3GVM A;  4O4I A;  1KYO F;  3ZMT A;  2GTA A;  3S3X A;  2XND G;  2CTP A;  5B3S C;  2UXN A;  1PKX A;  1L0L H;  1KC8 W;  1VQP V;  4P30 A;  3QF7 A;  5EZY B;  3I55 V;  5LMN O;  3ZMZ A;  5LGN A;  3CRQ A;  2IJJ A;  1TUE B;  1O9G A;  5BMV B;  2KKW A;  4TV9 B;  2ZR2 A;  4DR5 B;  4FLW A;  4UV9 A;  3ETE A;  2GUZ A;  5BY1 A;  2UUC O;  4JI8 B;  1NT2 B;  3CRA A;  3JYC A;  4I7Z B;  2P6J A;  3JD3 A;  4I9Q A;  1WP8 A;  3WB2 A;  4WFB V;  1H2K A;  4NB5 A;  1JFF A;  1EFR G;  3STZ C;  3T1Y O;  1HWY A;  3D8C A;  4PJ0 Z;  2YI9 A;  4DR6 B;  4CZZ A;  3AEI A;  2FML A;  3HKE A;  4LR3 A;  2L35 A;  1FXK C;  3I5D A;  2KB1 A;  3FB7 C;  2IJH A;  1CEZ A;  3CHX A;  1M57 C;  1U96 A;  4O2A A;  3T1H O;  2EIN C;  2V4D A;  2XUM A;  1PL4 A;  1YZB A;  5A2Q N;  5FPO A;  1JPX A;  1I7F A;  1AVM A;  4JI2 B;  1R6N A;  1VP7 A;  2YUA A;  4X8A A;  2R70 A;  3E22 A;  4O4J A;  3G67 A;  1FFX B;  5CA0 B;  2QJ1 A;  1BHB A;  5KUM A;  4DV5 O;  1YJW V;  4RUF A;  4DV4 O;  4LFC B;  4IYH A;  4DR1 O;  5EIB C;  2F23 A;  3B2E E;  4FMT A;  3THO A;  3T1H B;  3HKE B;  2ZT9 B;  4GKJ O;  4MSW C;  4BIU A;  2WLH A;  4MS2 A;  1LUV A;  4NVP A;  2ODM A;  3BA9 A;  2HR3 A;  3ZHU A;  2EX3 A;  2JGD B;  4PA4 A;  3J7A U;  3LDD A;  3K04 A;  3CP1 A;  5LXT A;  3C90 A;  3ML0 A;  3EVK A;  5LP6 B;  1B06 A;  1XHX A;  1Z5W A;  4TSF G;  4LF5 B;  1NS1 A;  3RT3 C;  1J5E O;  5KHG A;  3G4S V;  1K9M W;  1OCO B;  3L70 H;  3OM3 B;  3ETG A;  2YEV A;  3E2E A;  4TUY A;  4DR6 O;  2ZDI C;  3SPJ A;  5B66 Z;  1BQ0 A;  1PM9 A;  2YXL A;  4QJF B;  4X65 O;  2CTW A;  4NTX A;  1BMF G;  4B3T O;  4I0X A;  1R6K A;  4LFA B;  2RCV A;  2X6C A;  2ZDI A;  2QA4 V;  2JRI A;  2XAH A;  4LH7 A;  3ZRW A;  3FB6 C;  5LYJ A;  1N0J A;  3RVZ A;  3ZHV A;  1YSC A;  1DF5 A;  1ZWI C;  2E74 B;  1R6T A;  4DV7 B;  2IJK A;  1ENV A;  2ZM6 B;  3CCM V;  2ZCE A;  3FKS G;  3SDL A;  2JGU A;  2ZE6 A;  1VQL V;  1YIJ V;  4GKK B;  3OTF A;  5IYZ B;  2P90 A;  1XNQ O;  3SGI A;  1YXB A;  2RJZ A;  2CGN A;  2P67 A;  2YSU B;  1Q90 D;  4GUN A;  4UUJ C;  2QDO A;  4O2B B;  4WFE A;  3AG4 C;  4GYC B;  1OZ0 A;  1GM9 A;  1H2M A;  5E1A C;  2AGA A;  1SQB H;  3CCU V;  3ZRX A;  1YHQ V;  1S5J A;  2QM8 A;  2JJ2 G;  4GZR B;  3W7S A;  1FJG B;  1SKV A;  1OCC B;  3A0B Z;  1DF4 A;  4LF8 B;  4H37 A;  5L3E A;  2ZD9 A;  1QCE A;  1KBH A;  2C2A A;  3ZHQ A;  1K4D C;  1HNZ B;  1VQK V;  3CRR A;  1YVW A;  1MZF A;  2Q68 A;  5GTH Z;  4WFA V;  3CC7 V;  4EB6 B;  2BE3 A;  3NR7 A;  4DV3 B;  3U0Z A;  5LP6 C;  2F93 B;  1AI5 A;  1DLB A;  2Y4U A;  4H44 B;  5B1B C;  4X65 B;  3BHP A;  2JDI G;  4B7K A;  2WLJ A;  1Z2G A;  3EHB B;  3G80 A;  1FS0 G;  1VQ7 V;  3BEH A;  4CC6 A;  2YXY A;  4PDL A;  1Y4M A;  4TQD A;  5LOV A;  3DC6 A;  1GN3 A;  1WAZ A;  3K79 A;  5B1O A;  4DR4 O;  4BW5 A;  1R73 A;  2OWO A;  3CRM A;  4U3J A;  1XMQ O;  2GTS A;  1RSO A;  1S72 V;  2X6B A;  5KUK A;  1JVM A;  4DUZ O;  4GT1 A;  2WWW A;  3CWB H;  4B3R B;  2B9Z A;  4DR4 B;  1BGY H;  4B3M B;  4X89 A;  1DGS A;  4I50 A;  5DEC A;  4FPP A;  4XDK A;  4UFZ A;  1MOF A;  1QLE B;  4DR3 O;  2HJF C;  3WB1 A;  4BAY A;  2IW5 A;  4TWK A;  1BZK A;  3JCZ A;  5IJ0 A;  1FFX A;  4MW8 A;  2BOC C;  1E79 G;  1GN2 A;  4YJ2 B;  4Q20 A;  4MVO A;  2R9A A;  4UV8 A;  4JYY A;  5LGT A;  4DR1 B;  2L6L A;  2E5L B;  4FFB A;  1N36 B;  4YIP A;  1I5X A;  3GB7 C;  1KB9 F;  2MW2 B;  2B1G A;  4HYO A;  4KL1 A;  1PNL A;  4PA9 A;  4X1Y A;  1S3J A;  2V1D A;  2Z3Y A;  4JZG A;  1N32 B;  4WFH A;  4FIP C;  2HFE C;  5IJ9 B;  4U7O A;  4JYB A;  1FXH A;  4N21 A;  1VQ9 V;  2M6Y A;  1Q86 W;  1NH2 B;  5KA5 A;  4EB6 A;  3FB5 C;  3G6B A;  3LSU A;  1L0N H;  1R3K C;  4LF6 O;  2MK3 A;  4G27 B;  3H1I H;  1SA0 B;  1KEC A;  1NTK H;  3D3I A;  1VEW A;  2AZ0 A;  1XIL A;  1XMO B;  4FLU A;  4FLV A;  4LF4 B;  4JTC B;  4JI7 B;  1VQM V;  1Q6I A;  2DWE C;  3VQX A;  2PGG A;  3K08 A;  1EN5 A;  1EN6 A;  2CH7 A;  3IFX A;  1L1F A;  3K57 A;  2HVK C;  2M7W A;  2DW4 A;  4YXW G;  4IHJ A;  3JAW B;  2HHH O;  5CBG A;  1AP5 A;  3OW2 U;  5CA0 A;  4P9P A;  1Y76 A;  1R3I C;  3ZN1 A;  2H8P C;  5J2U B;  2WPD G;  2AW9 A;  4J9Y B;  1I5Y A;  3E83 A;  1RP3 B;  1ZSP A;  1WB8 A;  3OEH G;  1N8R W;  3RN4 A;  3CJH B;  2B1I A;  3QO5 A;  1PNK A;  3AK1 A;  1S77 D;  2RDC A;  3ABM B;  2DQ3 A;  3CMA V;  1N4C A;  2UXX A;  1X4T A;  1KQS U;  4GX5 A;  2UUB O;  4YJ2 A;  2BSK A;  3H1L H;  1TA8 A;  2XTA A;  2RMK B;  1I0H A;  3QNE A;  3QO8 A;  3K03 A;  2IH1 C;  3L75 H;  4Q6G A;  4XBF A;  4I55 A;  1Y74 A;  1AIL A;  2EIN B;  2JGD A;  5BR8 O;  2UXC O;  2GUZ B;  2HP8 A;  2P7T C;  2E76 B;  2X7R B;  1W0K G;  1ORQ C;  3P3P A;  1XL4 A;  2WA4 A;  2EIM B;  1THZ A;  3TJT A;  3K58 A;  1VQ5 V;  2WLM A;  3A0H Z;  1H2G A; 
#chains in the Genus database with same CATH homology
 2QWO B;  2QWR B;  1BQZ A;  2DMX A;  1NZ6 A;  3AG7 A;  2CTR A;  2CTQ A;  2CTP A;  2N04 A;  2YS8 A;  3APQ A;  1IUR A;  2CUG A;  1FAF A;  2DN9 A;  1BQ0 A;  4RWU A;  3UO2 A;  1XBL A;  2QWP B;  2PF4 E;  2QWN B;  2GUZ B;  4IT5 A;  3BVO A;  4J80 A;  2CTW A;  2Y4T A;  1GH6 A;  1FPO A;  1N4C A;  2LO1 A;  2M6Y A;  2KQX A;  2QWQ B;  2YUA A;  2L6L A;  3UCS C;  2Y4U A;  3UO3 A;  4J7Z A;  2N05 A;  3APO A;  1HDJ A;  2EJ7 A;  2OCH A;  2LGW A;  2GUZ A;  1WJZ A;  2QSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...