1QVFU

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvfU00
1VQKV 3G71V 1Q82W 3CMAV 1QVGU 1M1KW 3CC4V 3CCUV 4WCEV 1YHQV 1VQ4V 1KD1W 1M90W 1Q7YW 3CCRV 1VQ9V 1S72V 1KQSU 2OTLV 1QVFU 3CCJV 3CPWU 3CCLV 2OTJV 4WFAV 1VQLV 1YJ9V 1K73W 3CCMV 1K9MW 1KC8W 3CD6V 1VQ6V 1VQ7V 1YIJV 3CCVV 3CXCU 1YJNV 4WFBV 4WF9V 3CCSV 3I56V 2D3OW 3I55V 3G6EV 1NJIW 2QEXV 3CCEV 1VQNV 1VQ5V 3CCQV 3G4SV 1JJ2U 1VQ8V 1N8RW 3CC2V 1VQOV 1YI2V 3CC7V 1K8AW 1YJWV 1Q86W 3CMEV 1VQMV 5DM6V 1W2BU 2QA4V 3OW2U 1VQPV 1R73A 1YITV 1Q81W
chains in the Genus database with same CATH superfamily
1GH6A 4OX9B 1XMQB 1H8HG 5FPRA 2ZXWB 1Y66A 4JI0B 5JCOA 1PNLA 2QKSA 3AG4B 3ABMB 3D3IA 4IIJA 1MSDA 1JR9A 4OGQB 2Q0OC 4I50B 4HNAB 3DXRB 2ZM6B 1SC5B 4GZRB 4JPRA 1AJPA 2A7WA 4PELA 1AJNA 2BCCH 2W6JG 1RPRA 4CC5A 1SERA 5LHHA 4LF7O 1CEZA 3AG7A 5JQGB 2CE4A 3E8BA 4WBNB 1P84F 3G67A 1QLEB 4PD4F 4IHJB 4C7UA 1JOYA 1AP5A 4FM0A 2JJ1G 2QKAA 2ZR2A 3OUFA 3H1KH 1Z5WA 4DV3O 4QGPA 1DTOA 4RUEA 3LDCA 4DV4B 3ZHTA 1ENVA 3UT5A 4OX9O 1XMQO 1S0VA 4JI0O 4DV7B 1GN3A 4PI0A 3RGBA 2DYSB 5EBWC 4DV2B 4X9QA 1VQOV 3FB6C 2Z5UA 2Y0IA 3KCXA 2GV9A 1D5NA 1LUWA 3T2MA 1LUVA 2L6LA 4JYBA 3OT7A 4FLUA 4CZZA 3E83A 1RFYA 4K8ZA 4FJCC 2ZM6O 1FD9A 5HFLA 4WCEV 3B09A 3B8NA 1VQ9V 1YTFD 4X88A 4WFFA 1NKDA 4XDKA 2W0FC 4YJ3B 1EN5A 2QE7G 3JAKA 3R65A 1JX9A 2PYJA 2XOKG 2GBOA 2UU9B 5ITZA 1SQFA 3WU2Z 3OFNG 1Y67A 2XAGA 4LNUA 5BXZA 5IJ0A 1XOUA 2EZPA 1QR9A 2ZXWC 4UV8A 1CXZB 4UVCA 2QWPB 3E8GA 3AG4C 5J2TB 4FLWA 3PJSK 1HNXB 4DV4O 1I08A 4LWSA 2CAZC 3TGUH 3K5MA 1YCIA 1W2BU 2JGUA 4DV7O 5H2FZ 1YITV 4BIOA 3OD4A 4DR1B 4DV2O 1EZVH 1E1QG 4U7NA 3IFXA 4IIJB 4N21A 4UUJC 2N04A 2WLKA 4J9ZB 2LGWA 5GONB 3LNMB 3F7VC 4NR1A 4U3FH 5EIBC 1KKDA 1FXHA 4TQDA 5L3EA 2CK3G 1QLEC 1AJQA 4R7CA 2UU9O 3SJAC 1U97A 2E3CA 5EZYA 2ZINA 4RQEA 2YXHA 3K59A 1IBKB 4O4LA 5FLXN 5EK0A 2N74A 1B6QA 3VBBA 4UCUA 3JD0A 1THZA 3GWKC 3E86A 3G80A 3UM7A 4UV9A 1ZWIC 1HNXO 2B9ZA 4UVBA 3ZRWB 2BOBC 3P3PA 1Z5VA 3BPZA 2X6CA 5L3FA 4I9WA 2XHBA 3UT5B 4DR1O 3FAVA 4KXRA 3ZHRA 1MG1A 3CE2A 2FMLA 1KC8W 3SYOA 1QLNA 1Q6UA 5JH7A 2EJRA 4H33A 3E35A 4O2BA 4F4LA 2EULA 1VMGA 5DM6V 2YICA 3WB0A 4MT8A 2H94A 2IM9A 2B5UA 4CH3A 4UB8Z 5DEDA 2BTQA 2UUAB 3KG2A 1WNSA 4FFBA 2OWOA 2P67A 5JVDA 3JCUZ 3L72H 2R70A 2H3OA 3JAKB 4CC6A 2P7TC 1SQGA 1IBKO 4TUYB 3VQWA 5BMVA 4J11A 1M56B 2WAMA 1H2SB 4R8CA 1V54B 2R9AA 1GM8A 4TQFA 3SPGA 5B66Z 4LNUB 4J7ZA 4DK1A 2F43G 1YHQV 2MW2B 4UCSA 1Z2GA 4K8XA 2O57A 1NQTA 4WFBV 5B1NA 3CCEV 4HAMA 4QPKA 1YZBA 4DV1B 4ZOLA 3ZMSA 1RSOA 2YI8A 3APOA 1ZLZA 2HKOA 3BFRA 4PHZA 1WN7A 1VF6A 4Q6GA 1VQ4V 1KD1W 1NVPD 5J9PC 3CCJV 5IE9A 1NI8A 2UUAO 2QWRB 4CBCA 2QEXV 4B3RB 3I55V 1N33B 3G4SV 5EIBD 3J81N 2F93B 3TETA 2CTQA 2OCCC 4QIWF 2QJ1A 1Q82W 2OT5A 4QPJA 3STLC 3HKDA 5EZYB 4NXMB 1QU7A 3CRAA 1SZTA 2KSDA 1AI7A 1O9HA 1BHAA 3M99B 3RYIA 1U96A 4O4LB 3CX5F 1OZ0A 3M7MX 1YDXA 1Q90D 2ZIOA 2DQ0A 2HHHB 2UXXA 3SPJA 3Q4HB 4DV1O 4LF6B 3K3WA 2HR3A 1Q7YW 3FAVB 2ZNJA 3B77A 2OIEA 3T1CA 3K9AA 4MVSA 4K3AA 3L73H 5LA6B 4O2BB 2A79B 5CMUA 4IYHA 5KHGA 3LDEA 2HEPA 4QE9A 4B3RO 1N33O 3SJBC 2F95B 4UCTA 1Y74B 1M56C 5LXTA 4KUMA 3ASNB 2ODMA 2CTPA 1SQBH 4H0LB 5JVDB 2ARHA 5B1BB 2HVJC 5CBFA 4NXMO 3WB2A 1Q8IA 4PDMA 1L0NH 3HKBB 4FK5C 3CMEV 5BMVB 4O2AB 4E2LA 3HPLC 2XTAA 2RJZA 4DR4B 3CCUV 2QM4A 1BL8A 1NTZH 3OMNB 1UFIA 3HB3B 2EIMC 4X1IA 3DTUB 5KHKA 2HHHO 4CH4A 1GAXA 2GHYA 4TOIA 1CP9A 4ICGA 5K1XA 5CA1A 4MVQA 4P2ZA 2EILB 2IU0A 4WFHA 1V55C 5IT9N 3ZHSA 3K03A 1RSOB 4PV1B 2V7QG 2JIZG 3UKMA 3QVNA 2PUSA 1CPYA 2ADQB 3CWBH 2DQ3A 4PJ0Z 3KKYA 2PZSA 1AI4A 5FNVA 5LMNB 2QKCA 1S77D 2IJHA 2UXCB 1N8RW 4RWUA 1IXBA 2ZT9B 4D7SA 3D8CA 2XT9A 3H1JH 4GT1A 4X1YA 1MZFA 4DV5B 1QQCA 5KAIZ 1AILA 2WA4A 1PNMA 3HKDB 1S5LZ 3SJQC 2CGOA 3K5NA 2LFRA 3EHBB 3FD9A 4DR4O 1YJ9V 1D2DA 3RYHA 1FYJA 2YIBD 5IYZA 1X4TA 1GN6A 3R66A 1TAEA 2P5OA 1Y4MA 3OAAG 2KB1A 2EJ7A 1JJ2U 2RN9A 4Q20A 4QE7A 4B7EA 1H2KA 2G38A 5B3SB 2YIDA 5C8YB 1L0LH 4G27B 2YXYA 3JASA 2WSSG 3DSQA 4MTFA 1K33A 3CPWU 2NN4A 3IC9A 4GX5A 3CS5A 3AG2C 3ASNC 3EVKA 3LSQA 3QF7A 3JCZA 1SQQH 4D6TH 4DUYB 3MDSA 3OE7G 5KA6A 2DN9A 5LMNO 3TXQA 4RUFA 3DC5A 3WG7B 2UXCO 1GN4A 2QR4A 5LXTB 3JAWA 3CCRV 4LFBB 4AHCA 4R50A 4DV5O 4O4IB 5KHIA 5LP6A 3JALA 3D36C 2Y4UA 1AR5A 1JVMA 3STZC 1IXMA 3FB8C 2P4VA 1AI6A 4N23A 5LL6Y 5E1AC 4B3MB 1N0JA 2Q67A 4ZKIA 4RO2A 1NTKH 1OCCC 4JYCA 1XL4A 1T5EA 5LHGA 4X62B 1VQ6V 2LW1A 1LNQA 1FXKA 4TV8A 1IBMB 1OCZB 1W0JG 3SR2C 4K0KB 3BVOA 4O4HA 3AEIA 3AG3B 3UQ8A 4B7KA 4DUYO 2K9PA 3OM3B 1VARA 2KG7A 5LOVA 1TVKA 2PGGA 2Z3YA 5BY1A 2JVDA 5FNVB 4PA4A 1BQ0A 2ZIMA 1NH2D 4X8AA 1N34B 3QG5A 2HFEC 4YHHB 4K35A 4LFBO 3H1LH 3B2EE 3IGAC 1XBLA 5IY5B 3E8FA 1OHHG 4DYLA 2N05A 1QBZA 4PDVA 1R3LC 2UUBB 2KQXA 1NBMG 1TUBA 5EC2C 3IC7A 5B1OA 1PKXA 1WAZA 1XEQA 3JARA 4B3MO 3A0BZ 4LH6A 1V9PA 3ZMVA 5CA0A 3JD1A 2ZE8A 2Y48A 1SZXA 3CRMA 2AZ2A 3L75H 5CN0A 1OCOB 4X62O 2BSKB 3RYFA 2WPDG 1Q81W 1IBMO 1WB8A 4YIOA 1K34A 1XHXA 3MHHC 2IJIA 3CRQA 4PDLA 2LJ2A 4K0KO 4LFAB 5B1AB 3JASB 2OCHA 2E5LB 3ZS8C 1M5IA 5KAFZ 2Q7GA 1XI1A 2WLIA 1I5YA 3RWRD 4UCVA 2IH3C 1B04A 1N34O 4OPAA 2YUAA 4YHHO 3N2GA 3OGCC 3JAWB 4BWAA 3ZMUA 2Q73A 3I5DA 2YC0A 1YVWA 5LP6B 2UUBO 3JALB 1RM1B 1F51A 5JJEB 1VQ5V 3ETDA 4TV9B 2XNDG 1NR1A 4J41A 2QM8A 2A3QA 2QA4V 1YF2A 1OCZC 1JJOA 2Q5ZA 2QTOA 4X89A 4Z1VA 1JFFA 1SQVH 3SJCC 4CS3A 1R3KC 4JTCB 1EN6A 4J7JA 1US6A 2W0XA 4LFAO 1FXKB 1IBLB 2PF4E 2QSAA 3S3WA 4DR2B 4DR6B 4JZ2A 3KZIZ 3UO3A 2E5LO 1OV9A 4FLTA 4KP4A 2Q7HA 2IH1C 3CJHA 1ZAUA 2IJKA 2FTKA 5H6QA 4EB6A 4LP8A 2BTOA 2EX3A 1YXBA 5IY5C 1M57B 3FX7A 2RNBA 1BSMA 1TVKB 3CD6V 4YXWG 1YJNV 3ABMC 3B40A 1DF4A 3RYCA 3A8TA 2ADPA 2ILMA 4FIPC 5JJJB 3UCSC 3SPIA 1G1XB 3H01A 1ROPA 4UCRA 2XAJA 5J2UB 2CUGA 1YEWA 4YY3B 4MTXA 1OCOC 2UUCB 3ML0A 1TUBB 4U3JA 1KP2A 4FZ0A 3JARB 4FVMA 4H37A 1XL6A 3S3XA 2WWWA 4GLXA 5CA0B 1G4YB 1K3EA 4GKKB 3CXHF 4JI2B 1WB7A 3SGIA 2F1MA 1UPGA 1IBLO 3RYFB 4DR2O 1SQXH 4DR6O 2OYQA 4DV0B 1DK1A 3MHSC 3LSSA 5KMGA 1GKFA 1XDCA 1KKCA 2CTWA 5A2QN 1WA8A 5L3GA 1K4DC 4O4JA 3B4SA 4DW0A 1ZX3A 4PA7A 3QO5A 2WLHA 4ZI7A 1RM1C 2EIKB 2DYSC 3N2GB 5BZBA 1P4RA 4MW8A 5H6RA 3ASOB 1OJHA 3W7SA 1WP8A 4YY3O 5L3CA 1K4CC 3OEHG 2UUCO 2LFSA 3GWOA 4WFGA 2YS8A 5KHJA 2QTSA 1SRYA 1MNGA 2QDOA 3RW0A 2Y0PA 3OW2U 1HR0B 4GKKO 4JI2O 2WLJA 2GUZA 4G28B 4PI2A 4MSWC 1SQPH 3AK1A 2OTLV 4DV0O 3BRCA 3O65A 4JI1B 1BT8A 1M57C 5GW7A 4J10A 4MVMA 5EBMC 1BS3A 4X1KA 4B3SB 1RP3B 1KECA 3CJHB 2ZR3A 2ZDIA 2RMKB 4FMTA 4EB6B 5ITZB 4JV5B 2JGDA 5E79Z 1XQ8A 5IJ0B 2P4KA 5FL7G 4KHPB 3ABKB 5JCOC 4JYYA 4PA6A 4BW5A 2VWJA 3T4ZA 3ZJZA 1JPXA 4LWSB 2E74B 3LDDA 4JI4B 3O9OA 1VQPV 1VF7A 3DGEA 4MVUA 1N4CA 5TISZ 3J80N 1VP7A 3ABLB 1WPBA 3JATA 4U3JB 3T1YB 1HR0O 2QWNB 1BGYH 2OTJV 1K9MW 4QJFB 2ZE5A 3NR7A 4WF9V 5LGNA 2HVKC 4FZ1A 1M93A 4JI1O 5CBGA 3QO8A 4GCZA 2DYRB 3RVZA 5LBQA 4B3SO 1OCRB 1NU1H 3IJ4A 1S5JA 1KB9F 5KMGB 2A0LA 4JAUA 1H38A 4JV5O 1VF5B 3CCMV 2UXDB 1WA8B 4YJ2A 4O4JB 4NXNB 3ZCCA 4BIZA 1FAFA 4KHPO 3ABTA 1MSWD 4ZI7B 3C3SA 1VQKV 3CMAV 4LFCB 1QVGU 4H44B 4JI4O 1HNZB 4LC1A 1Q5OA 1D5AA 4I55A 4DRXA 2EZOA 2NLJC 4MW3A 3ZHUA 5JH7B 3CRRA 2HJFC 1HP8A 3T1YO 5IJ9A 1YI2V 1GM7A 1P7BA 2BTQB 3ABUA 4P9OA 3ZBHA 4FFBB 2D2CB 1V54C 4Z2WA 2JEUA 1F4MA 5AG2A 1VQ8V 4X1KB 3QNEA 3JYCA 3THOA 2A9HA 5EBLC 2UXDO 4JI6B 4NXNO 1NS1A 2LGQA 4EEQA 1Y6XA 4IT5A 2JGDB 3UO2A 1FFXA 3F5WC 3AG1B 2GTSA 1B3QA 2DJVA 1S3JA 2HLDG 4X64B 4LFCO 2R72A 3ABLC 1HNZO 4LF6O 4NTWA 3E89A 4ZOLB 1K92A 1R1BA 3MAQA 2YIAA 4DR3B 1GM9A 3DC6A 2HJDA 1I5XA 4CS4A 2DYRC 1FS0G 4E4EA 3SDLA 3W7WA 3NXSA 2E76B 1HDJA 1R6KA 5D5PA 1GTOA 2IW5A 2ITDC 1Q86W 3A0HZ 3H1IH 1VQMV 3BY6A 5LGUA 4DK0A 1K5SA 3RN4A 1L1FA 3ETQA 1YTFB 4JYAB 1R6NA 2YEVA 4JI6O 4ZIBA 2V4DA 2PTMA 3D3QA 1FKAO 2WA3A 2VQEB 2EINB 2ZE6A 3RYIB 2VQFB 1G8MA 3VQVA 1BCCH 3BEHA 3K04A 4X64O 1H2NA 5JJNB 5CB4A 4JF3A 4XBFA 3CC4V 3FFQA 4GUNA 4L8JA 3TCUA 3AK3A 4CH6A 4I0XA 1HNWB 2JDIG 3LUTB 4I55B 3K57A 1PL4A 4I50A 4HNAA 4DR3O 4DRXB 2AGAA 4YIPA 1PP9H 4LCUC 1JMKC 5IJ9B 3CC2V 1WP7A 1ORQC 1SF9A 1BE3H 4ZHQA 5B1BC 3L9DA 2XUMA 3QTCA 4UCOA 5K1PA 3ETGA 1MMMA 1XHZA 4AQYB 4P30A 4JYAO 3AG1C 2Z0AA 1VIBA 2XAQA 1SETA 1E1RG 5EYPA 3N2KA 2VQEO 4B08A 1M4UA 4XDLA 2BOCC 2E75B 3ZRXA 3OTFA 2W6IG 2VQFO 4P9PA 3ZN0A 5BR8B 2EILC 2ZKOA 2LP7A 1FFXB 5L3DA 4UXNA 1FJGB 2PYLA 4JI3B 4X1IB 5LYJA 3CCLV 1MOFA 1VF6C 1Y76A 5HFMA 1HNWO 1X59A 2Q4PA 5CA1B 4KFMA 3P30A 3K79A 5CBHA 4FLZA 3SYAA 4BW9A 1AB3A 5IYCO 1QVFU 4RAIA 4YJ3A 1B06A 4HYOA 5C93A 1NTMH 1R3IC 2JS5A 2LW7A 2IJJA 1AR4A 5L3BA 4AQYO 2DW4A 1S76D 4NB5A 2ITCC 1EZJA 1TUEB 4X1YB 1TA8A 3H9VA 5B3SC 2B1GA 3B8MA 5BR8O 4GX2A 1BMFG 3RYHB 1FJGO 5IYZB 1BZKA 4JI3O 3G6EV 2UXBB 4DUZB 2QWOB 1K7DA 2YI9A 2ZD9A 1VEWA 5IYDO 4I0XB 1ZTEA 1FFTB 4LR3A 3QO7A 1WPXA 3WG7C 2AHYA 2LO1A 4BIUA 2ZE7A 3KCYA 5GONA 2P6JA 3W7UA 4NYKA 2L35A 3ZN1A 2JS3A 3GB7C 1SA0A 2WLLA 4ZHQB 4JTDB 4IYIA 1NVPB 2ETNA 1SKVA 2CGNA 3OR6C 1O9GA 2DWDC 3CHXA 2MK3A 4ABMA 4IGGA 3JD3A 1MA1A 3CP1A 5EYPB 3L70H 3N2KB 4JI8B 2P06A 3U10A 3FKSG 3ZMZA 2UXBO 3ZRWA 4DUZO 4JGSA 1SESA 3BA9A 1AI5A 2X6AA 3E8HA 4I5SA 2YIBA 5LYJB 3AG3C 1KUQA 2ATKC 4AILC 1YIJV 1Y76B 3GVMA 3FYIB 2OIGA 4TV8B 2Q68A 3OR7C 4U7OA 4EFBA 4O4HB 4JAVA 4JZGA 1R73A 1J95A 1WLEA 2R9RB 3CEIA 3W7XA 1LR1A 1RPOA 3ZIAG 2QGNA 5LOVB 2KG7B 2Y69B 1JQ0A 1XNQB 1QCEA 4X66B 1SS3A 1PL0A 3HKEA 3I56V 2FB5A 2HP8A 4HZ3A 4TUYA 4J42A 3ZEDA 4DW1A 1R3JC 1M1KW 4FM2A 3BA8A 4JI8O 1FPOA 1K5QA 4LF8B 4TSFG 4EFEA 1NR7A 5B1AC 1KP3A 1COWG 4UVAA 3K58A 2IU3A 2KKWA 1H2MA 3F5TA 3U11A 3WFVA 3BABA 1E79G 2F4VB 4GYCB 2FYUH 4MVOA 1QR8A 4ZBMA 4MVZA 3SYCA 2PI5A 2Q69A 3FB7C 4WFAV 4PA9A 1Q3EA 2WLIB 4TT3G 4WFEA 4FPPA 1XNQO 1SA0B 2WLLB 2YSUB 4X66O 4DR7B 3K5OA 2AXTZ 5LP6C 3W7TA 3SYQA 2QWQB 4PA3A 3CYOA 1W0KG 3SYPA 1Q6IA 2JK5C 4NTYA 4J9YB 5LMUB 3OGIB 2RCVA 2C2AA 2OCCB 1H2LA 4XDJA 1PPJH 3CXCU 4D7TA 4FLYA 2RDCA 3U0ZA 3OTOB 1NT2B 4F6EA 4ASUG 2B1IA 3JSLA 4LF8O 1M9NA 2X7RB 1FXKC 1I94B 1PM9A 1P49A 3Q4HA 1AROP 4JTAB 3EXAA 1JFFB 1EN4A 1ZSPA 2LQTA 3CRCA 2F4VO 5LA6A 3K0GA 1NJIW 1DLBA 3AK2A 2Y69C 2WLNA 2M6YA 1I0HA 1L8DA 1DGSA 3H1HH 1Y74A 4LH7A 4F6RA 5IYBO 3ZHQA 4DR7O 2FKXA 1F23A 4NTXA 5LGTA 4W4KA 1HWYA 1BHBA 2ZCEA 3HKEB 3E2EA 5LMUO 3HKBA 4DR5B 2Q6AA 2VWKA 1H8EG 3RYCB 3FB5C 2GDSA 4LF4B 4I7ZB 3OEEG 4O2AA 3P3NA 4TWKA 3L71H 3OTOO 3D36A 1N36B 2WLMA 1GRJA 4X20A 5A9GA 2VRZA 2M7WA 1I94O 3RBZA 5KA5A 3BCCH 5DECA 3X2QB 4NKGB 4NVPA 5GTHZ 2PI4A 2EIMB 3E22A 4DXWA 3RFRA 1M90W 2K1EA 1HW7A 2EIKC 1K73W 1V55B 2YXLA 3APQA 3LNNA 1JCHA 3ASOC 1KYOF 2A06H 1VQNV 3SPCA 2GTAA 2PY5A 1GK9A 5B5EZ 3N27A 2X6BA 3PN1A 1S5HC 3JSNA 3ETEA 1N0NA 2Y4TA 2VS0A 1PNKA 3G71V 4DR5O 4LF4O 1NH2B 3T4DA 2CDYA 1YSCA 1N36O 4J80A 3HR0A 2AHZA 3G6BA 3ZRVA 2YDEA 3OMIB 1IURA 4QNHB 3TJTA 2P90A 3CC7V 1Q43A 5C8YA 4DO2A 5KLVH 1K97A 4LBEC 4B3TB 4CS2A 2IBZH 2GUZB 5EC1C 2AZ0A 1TGOA 2V1DA 5IDJA 1URFA 5H9CA 5IWAB 3TXSA 5CA3A 3CCVV 5DN6G 3OMAB 1KBHA 4L87A 4DV6B 1XUQA 3ABKC 4OPHA 4CH5A 1IX9A 1PD3A 1ZUQA 2CH7A 4F6RB 3SPHA 1R6TA 3AG2B 3LSUA 3ZX6A 4O4IA 3T1HB 4PDRA 4BR6A 1MZEA 1XREA 2UXNA 4H13B 5FPOA 4I4TA 5H5NA 1ZL8A 1GN2A 3BHPA 3X2QC 4JI7B 5KUKA 2F66C 3WB1A 1I7FA 4FLVA 2HG5C 3JATB 4X20B 1XNRB 1XMOB 5KX5A 4B3TO 4RQFA 4LF5B 3RT3C 1OCRC 2Q8VA 3L74H 3ZMTA 3FYEB 4JI5B 2DMXA 5JWPA 5IWAO 1AR1B 2EBOA 1OCCB 4BAYA 3E22B 3ZHVA 2F23A 3K08A 4DV6O 1EBOA 2NR5A 2ZQMA 1NZ6A 4OXSA 1JA8A 1EM1A 4MTOA 2X0LA 2QM7A 2EIJB 3OUSA 3HKCA 3ZRSA 3CCSV 1N32B 4R6ZA 4YJ2B 3JAMN 3JD2A 4GX0A 4G2KA 4LF9B 3T1HO 2NNUA 3F7YC 2H8PC 3K5LA 4JASA 4HBNA 4X65B 5F2VO 4MTGA 4GKJB 4MS2A 3TK1A 1Q6HA 5KUMA 2XASA 3EFFK 4FLXA 4JI7O 1W59A 1S72V 1KQSU 1AVMA 1J5EB 3RVYA 1A32A 1VQ7V 4KL1A 1G6UA 1KU9A 1XNRO 2XAHA 3CB2A 3DXRA 1BQZA 4FFKA 1XMOO 2BSKA 3IAYA 3K9SA 4LF5O 1F4NA 1EFRG 4UFZA 4JI5O 4J7KA 1WJZA 2JEXA 4A5UB 4Z1MG 2ZDIC 5JQGA 2DE0X 4FM1A 1AP6A 4MVRA 2DOSA 1GO3F 4GX1A 4WBNA 5D5QA 1IZ3A 3JD4A 2Q7EA 3ICXA 4IHJA 1K8AW 2R9IA 2ZNIA 1N32O 1QNMA 1MABG 2BE3A 1F7YA 2XAFA 5KHHA 2CH7B 2P22C 4I9QA 4LF9O 1GMGA 1KMIZ 4X65O 5GTIZ 1DF5A 1IVSA 1QHTA 4GKJO 1VQLV 2DWEC 2AW9A 3A0RA 2GSMB 3CCQV 4TV9A 4I4TB 1J5EO 1ZL8B 2Q9LA 1XILA 3VOUA 2CTRA 2RQ6A 4EKWA 4W4LA 3K06A 3J7AU 3VQYA 2FL4A 4UB6Z 3A2FA 5KX5B 1PV0A 3P32A 2EIJC 2JJ2G 3MD0A 3K0DA 2EINC 4LF7B 1FXVA 3CSXA 1UJWB 1IDSA 4JAAA 2YEVB 3M8AA 5LHIA 4AI8A 1H2GA 3C90A 4IL6Z 5J2TA 3HKCB 2D3OW 3BAAA 2Q0AA 4DV3B 1P7GA 3C3TA 2JRIA 5J2UA 3VQXA 1YJWV 5CB4B
chains in the Genus database with same CATH topology
4GT1A 3WFVA 1H8HG 5LBQA 2ZXWB 1Y66A 1E79G 1PNLA 2QKSA 3AG4B 1PNMA 3ABMB 1OCRB 3D3IA 3SJQC 4MVOA 1QR8A 4ZBMA 4MVZA 3SYCA 2PI5A 2Q69A 2LFRA 3EHBB 2A0LA 4JAUA 3FB7C 1H38A 4WFAV 1YJ9V 4PA9A 3CCMV 2WLIB 4TT3G 1Y4MA 4WFEA 3ZCCA 3OAAG 2KB1A 1JJ2U 4BIZA 4Q20A 4FPPA 2WLLB 2YSUB 4QE7A 3ABTA 5B3SB 1MSWD 4JPRA 3W7TA 3SYQA 1AJPA 4PELA 1AJNA 4PA3A 3CYOA 1VQKV 4G27B 3CMAV 1W0KG 2W6JG 1QVGU 3SYPA 1RPRA 4LC1A 1SERA 2JK5C 5LHHA 4J9YB 1CEZA 2WSSG 4MTFA 1K33A 3CPWU 3E8BA 2C2AA 2OCCB 4GX5A 2EZOA 2NLJC 3AG2C 3ASNC 3LSQA 4MW3A 4XDJA 3CXCU 2HJFC 3JCZA 1QLEB 4ASUG 2B1IA 1YI2V 1JOYA 3OE7G 1M9NA 5KA6A 2X7RB 1FXKC 4RUFA 2JJ1G 3OUFA 2ZR2A 3WG7B 1GM7A 1AROP 1DTOA 1P7BA 4JTAB 4P9OA 3ABUA 4RUEA 3LDCA 1ENVA 1V54C 3CCRV 1S0VA 4R50A 2JEUA 3K0GA 1NJIW 1F4MA 1DLBA 2DYSB 2Y69C 2WLNA 1JVMA 1VQ8V 5EBWC 3STZC 1IXMA 3FB8C 3QNEA 1VQOV 3FB6C 2Z5UA 3JYCA 2A9HA 5EBLC 1AI6A 3T2MA 4N23A 4JYBA 5E1AC 4CZZA 3E83A 4FJCC 5IYBO 2Q67A 5HFLA 4ZKIA 3F5WC 3AG1B 4RO2A 4WCEV 1F23A 1OCCC 1S3JA 2HLDG 3B8NA 1XL4A 4JYCA 1VQ9V 5LGTA 1YTFD 4X88A 4WFFA 5LHGA 1VQ6V 1NKDA 3ABLC 4XDKA 1LNQA 1HWYA 2W0FC 1BHBA 1FXKA 2QE7G 3R65A 3E2EA 1JX9A 2Q6AA 2XOKG 1H8EG 1OCZB 1W0JG 3FB5C 3E89A 3OEEG 3AEIA 1K92A 4TWKA 3AG3B 3OFNG 2XAGA 3D36A 1GM9A 2EZPA 1I5XA 2WLMA 1QR9A 2DYRC 3OM3B 1FS0G 2M7WA 2Z3YA 2ZXWC 4UV8A 3RBZA 4UVCA 5KA5A 3E8GA 3AG4C 4PA4A 3W7WA 1NH2D 3NXSA 4X8AA 3X2QB 3PJSK 1R6KA 2HFEC 1GTOA 2IW5A 2ITDC 3IGAC 1Q86W 2PI4A 1VQMV 2EIMB 3BY6A 5IY5B 1W2BU 3E8FA 1OHHG 5LGUA 1YITV 1K5SA 1L1FA 4DXWA 1QBZA 4PDVA 1R3LC 1YTFB 1E1QG 4U7NA 5EC2C 1NBMG 1R6NA 2YEVA 3IFXA 3IC7A 5B1OA 1PKXA 1M90W 2K1EA 4N21A 4UUJC 2EIKC 2WLKA 1K73W 1V55B 2EINB 3ZMVA 1JCHA 4J9ZB 3ASOC 3JD1A 1VQNV 1G8MA 3BEHA 3SPCA 2Y48A 1GK9A 3K04A 3LNMB 3F7VC 1KKDA 5CN0A 1OCOB 2X6BA 1S5HC 3ETEA 4JF3A 1FXHA 2WPDG 5L3EA 1Q81W 2CK3G 1QLEC 4XBFA 1PNKA 3G71V 1AJQA 1K34A 4R7CA 3MHHC 3CC4V 3TCUA 2IJIA 4PDLA 1NH2B 2JDIG 5B1AB 3T4DA 3LUTB 4RQEA 1YSCA 2WLIA 1I5YA 5EK0A 2AHZA 3ZRVA 4LCUC 1B6QA 3OMIB 3VBBA 4QNHB 3CC2V 3JD0A 1THZA 2P90A 2IH3C 3CC7V 1ORQC 3E86A 5B1BC 4UV9A 1ZWIC 3UM7A 4DO2A 3OGCC 4UVBA 3ZRWB 1K97A 2BOBC 4LBEC 2X6CA 5L3FA 5EC1C 3ZMUA 2V1DA 5IDJA 4I9WA 3ETGA 5H9CA 1MG1A 1KC8W 3SYOA 1QLNA 4P30A 5CA3A 3AG1C 3CCVV 5DN6G 2EJRA 1RM1B 1F51A 4H33A 3OMAB 3E35A 1VQ5V 4F4LA 2XAQA 3ETDA 1SETA 1E1RG 4L87A 2XNDG 2BOCC 3ABKC 1NR1A 4XDLA 3ZRXA 2QM8A 5DM6V 2QA4V 2W6IG 4MT8A 2H94A 4P9PA 2B5UA 3ZN0A 1PD3A 1OCZC 2QTOA 4X89A 2EILC 2LP7A 3SPHA 3KG2A 5L3DA 4UXNA 3AG2B 1R3KC 4JTCB 2P67A 3CCLV 4PDRA 1MOFA 5HFMA 1FXKB 2UXNA 4KFMA 2P7TC 3P30A 3K79A 4KP4A 5CBHA 2IH1C 1M56B 2IJKA 3X2QC 2WAMA 2FTKA 4R8CA 1V54B 5KUKA 1GM8A 5H6QA 3SPGA 3SYAA 4LP8A 5IY5C 1M57B 2F43G 1YHQV 2HG5C 5IYCO 1QVFU 4RAIA 3CD6V 4RQFA 1NQTA 4YXWG 1YJNV 3ABMC 4WFBV 1OCRC 5B1NA 3CCEV 4HYOA 3ZMTA 5C93A 1R3IC 1DF4A 3FYEB 4HAMA 4QPKA 2IJJA 5L3BA 4FIPC 3ZMSA 1AR1B 2EBOA 3SPIA 3H01A 1ROPA 2DW4A 1S76D 1OCCB 2XAJA 4BAYA 2HKOA 2ITCC 1EZJA 1TUEB 4MTXA 1OCOC 3K08A 1EBOA 3ML0A 2ZQMA 5B3SC 4OXSA 1VQ4V 1KD1W 2B1GA 1NVPD 1KP2A 3B8MA 4H37A 2X0LA 4GX2A 4MTOA 1XL6A 2QM7A 5J9PC 3CCJV 2EIJB 2WWWA 1BMFG 4CBCA 3OUSA 3ZRSA 3CCSV 2QEXV 1G4YB 1K3EA 4R6ZA 3I55V 3G6EV 3G4SV 3JD2A 4GCZA 4GX0A 4G2KA 3TETA 2OCCC 2NNUA 1K7DA 2H8PC 3F7YC 4QIWF 2ZD9A 4JASA 4MTGA 1Q82W 5IYDO 2OT5A 4MS2A 4QPJA 3STLC 3TK1A 5KUMA 3MHSC 2XASA 3EFFK 3LSSA 1FFTB 1S72V 3QO7A 1KQSU 1WPXA 1SZTA 3WG7C 1GKFA 2AHYA 3RVYA 1AI7A 1BHAA 3M99B 4BIUA 1VQ7V 2P6JA 1K4DC 5L3GA 3W7UA 1OZ0A 2XAHA 3ZN1A 3GB7C 2WLLA 4PA7A 3QO5A 4JTDB 2WLHA 1RM1C 2DQ0A 1F4NA 1EFRG 2EIKB 2DYSC 5BZBA 2UXXA 3SPJA 1NVPB 1P4RA 4MW8A 5H6RA 2JEXA 3ASOB 3OR6C 4Z1MG 3W7SA 3K3WA 2ZDIC 2HR3A 1Q7YW 2DWDC 2MK3A 5L3CA 3B77A 1K4CC 3OEHG 4MVRA 3T1CA 3K9AA 2LFSA 4MVSA 1GO3F 4GX1A 3JD3A 3GWOA 4WFGA 3CP1A 2A79B 3JD4A 5CMUA 1SRYA 1K8AW 3RW0A 3LDEA 4QE9A 2R9IA 3FKSG 3ZMZA 3OW2U 3ZRWA 1MABG 2WLJA 2XAFA 4JGSA 1SESA 1AI5A 1GMGA 2X6AA 3E8HA 4I5SA 4G28B 1M56C 4MSWC 4KUMA 3ASNB 3AG3C 1DF5A 2ATKC 2OTLV 1VQLV 1YIJV 5B1BB 1M57C 2HVJC 5CBFA 2DWEC 5GW7A 3A0RA 4PDMA 2GSMB 3FYIB 3CCQV 4MVMA 5EBMC 2Q68A 3OR7C 4U7OA 4FK5C 1KECA 3CMEV 3VOUA 2ZR3A 3HPLC 4JAVA 2ZDIA 4E2LA 1R73A 1J95A 1WLEA 2R9RB 4FMTA 3W7XA 4EKWA 3CCUV 1BL8A 3K06A 3OMNB 1RPOA 3HB3B 2EIMC 3ZIAG 3DTUB 2Y69B 5FL7G 1JQ0A 2GHYA 1QCEA 1CP9A 3ABKB 1PL0A 4PA6A 4BW5A 4MVQA 3P32A 3T4ZA 3I56V 4P2ZA 4HZ3A 1JPXA 3ZJZA 2EIJC 2EILB 2JJ2G 2IU0A 4WFHA 1V55C 3LDDA 3MD0A 3K0DA 2EINC 3K03A 1VQPV 2V7QG 2JIZG 3DGEA 4MVUA 3UKMA 1R3JC 1FXVA 1M1KW 1CPYA 1UJWB 2DQ3A 3ABLB 2YEVB 5LHIA 1K5QA 1H2GA 2OTJV 1AI4A 1K9MW 4TSFG 4QJFB 1NR7A 4WF9V 2D3OW 1S77D 5B1AC 5LGNA 2IJHA 1KP3A 1N8RW 1COWG 4UVAA 2HVKC 2IU3A 5CBGA 3QO8A 2DYRB 3RVZA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK V;  3G71 V;  1Q82 W;  3CMA V;  1QVG U;  1M1K W;  3CC4 V;  3CCU V;  4WCE V;  1YHQ V;  1VQ4 V;  1KD1 W;  1M90 W;  1Q7Y W;  3CCR V;  1VQ9 V;  1S72 V;  1KQS U;  2OTL V;  1QVF U;  3CCJ V;  3CPW U;  3CCL V;  2OTJ V;  4WFA V;  1VQL V;  1YJ9 V;  1K73 W;  3CCM V;  1K9M W;  1KC8 W;  3CD6 V;  1VQ6 V;  1VQ7 V;  1YIJ V;  3CCV V;  3CXC U;  1YJN V;  4WFB V;  4WF9 V;  3CCS V;  3I56 V;  2D3O W;  3I55 V;  3G6E V;  1NJI W;  2QEX V;  3CCE V;  1VQN V;  1VQ5 V;  3CCQ V;  3G4S V;  1JJ2 U;  1VQ8 V;  1N8R W;  3CC2 V;  1VQO V;  1YI2 V;  3CC7 V;  1K8A W;  1YJW V;  1Q86 W;  3CME V;  1VQM V;  5DM6 V;  1W2B U;  2QA4 V;  3OW2 U;  1VQP V;  1R73 A;  1YIT V;  1Q81 W; 
#chains in the Genus database with same CATH topology
 1GH6 A;  4OX9 B;  1XMQ B;  1H8H G;  5FPR A;  2ZXW B;  1Y66 A;  4JI0 B;  5JCO A;  1PNL A;  2QKS A;  3AG4 B;  3ABM B;  3D3I A;  4IIJ A;  1MSD A;  1JR9 A;  4OGQ B;  2Q0O C;  4I50 B;  4HNA B;  3DXR B;  2ZM6 B;  1SC5 B;  4GZR B;  4JPR A;  1AJP A;  2A7W A;  4PEL A;  1AJN A;  2BCC H;  2W6J G;  1RPR A;  4CC5 A;  1SER A;  5LHH A;  4LF7 O;  1CEZ A;  3AG7 A;  5JQG B;  2CE4 A;  3E8B A;  4WBN B;  1P84 F;  3G67 A;  1QLE B;  4PD4 F;  4IHJ B;  4C7U A;  1JOY A;  1AP5 A;  4FM0 A;  2JJ1 G;  2QKA A;  2ZR2 A;  3OUF A;  3H1K H;  1Z5W A;  4DV3 O;  4QGP A;  1DTO A;  4RUE A;  3LDC A;  4DV4 B;  3ZHT A;  1ENV A;  3UT5 A;  4OX9 O;  1XMQ O;  1S0V A;  4JI0 O;  4DV7 B;  1GN3 A;  4PI0 A;  3RGB A;  2DYS B;  5EBW C;  4DV2 B;  4X9Q A;  1VQO V;  3FB6 C;  2Z5U A;  2Y0I A;  3KCX A;  2GV9 A;  1D5N A;  1LUW A;  3T2M A;  1LUV A;  2L6L A;  4JYB A;  3OT7 A;  4FLU A;  4CZZ A;  3E83 A;  1RFY A;  4K8Z A;  4FJC C;  2ZM6 O;  1FD9 A;  5HFL A;  4WCE V;  3B09 A;  3B8N A;  1VQ9 V;  1YTF D;  4X88 A;  4WFF A;  1NKD A;  4XDK A;  2W0F C;  4YJ3 B;  1EN5 A;  2QE7 G;  3JAK A;  3R65 A;  1JX9 A;  2PYJ A;  2XOK G;  2GBO A;  2UU9 B;  5ITZ A;  1SQF A;  3WU2 Z;  3OFN G;  1Y67 A;  2XAG A;  4LNU A;  5BXZ A;  5IJ0 A;  1XOU A;  2EZP A;  1QR9 A;  2ZXW C;  4UV8 A;  1CXZ B;  4UVC A;  2QWP B;  3E8G A;  3AG4 C;  5J2T B;  4FLW A;  3PJS K;  1HNX B;  4DV4 O;  1I08 A;  4LWS A;  2CAZ C;  3TGU H;  3K5M A;  1YCI A;  1W2B U;  2JGU A;  4DV7 O;  5H2F Z;  1YIT V;  4BIO A;  3OD4 A;  4DR1 B;  4DV2 O;  1EZV H;  1E1Q G;  4U7N A;  3IFX A;  4IIJ B;  4N21 A;  4UUJ C;  2N04 A;  2WLK A;  4J9Z B;  2LGW A;  5GON B;  3LNM B;  3F7V C;  4NR1 A;  4U3F H;  5EIB C;  1KKD A;  1FXH A;  4TQD A;  5L3E A;  2CK3 G;  1QLE C;  1AJQ A;  4R7C A;  2UU9 O;  3SJA C;  1U97 A;  2E3C A;  5EZY A;  2ZIN A;  4RQE A;  2YXH A;  3K59 A;  1IBK B;  4O4L A;  5FLX N;  5EK0 A;  2N74 A;  1B6Q A;  3VBB A;  4UCU A;  3JD0 A;  1THZ A;  3GWK C;  3E86 A;  3G80 A;  3UM7 A;  4UV9 A;  1ZWI C;  1HNX O;  2B9Z A;  4UVB A;  3ZRW B;  2BOB C;  3P3P A;  1Z5V A;  3BPZ A;  2X6C A;  5L3F A;  4I9W A;  2XHB A;  3UT5 B;  4DR1 O;  3FAV A;  4KXR A;  3ZHR A;  1MG1 A;  3CE2 A;  2FML A;  1KC8 W;  3SYO A;  1QLN A;  1Q6U A;  5JH7 A;  2EJR A;  4H33 A;  3E35 A;  4O2B A;  4F4L A;  2EUL A;  1VMG A;  5DM6 V;  2YIC A;  3WB0 A;  4MT8 A;  2H94 A;  2IM9 A;  2B5U A;  4CH3 A;  4UB8 Z;  5DED A;  2BTQ A;  2UUA B;  3KG2 A;  1WNS A;  4FFB A;  2OWO A;  2P67 A;  5JVD A;  3JCU Z;  3L72 H;  2R70 A;  2H3O A;  3JAK B;  4CC6 A;  2P7T C;  1SQG A;  1IBK O;  4TUY B;  3VQW A;  5BMV A;  4J11 A;  1M56 B;  2WAM A;  1H2S B;  4R8C A;  1V54 B;  2R9A A;  1GM8 A;  4TQF A;  3SPG A;  5B66 Z;  4LNU B;  4J7Z A;  4DK1 A;  2F43 G;  1YHQ V;  2MW2 B;  4UCS A;  1Z2G A;  4K8X A;  2O57 A;  1NQT A;  4WFB V;  5B1N A;  3CCE V;  4HAM A;  4QPK A;  1YZB A;  4DV1 B;  4ZOL A;  3ZMS A;  1RSO A;  2YI8 A;  3APO A;  1ZLZ A;  2HKO A;  3BFR A;  4PHZ A;  1WN7 A;  1VF6 A;  4Q6G A;  1VQ4 V;  1KD1 W;  1NVP D;  5J9P C;  3CCJ V;  5IE9 A;  1NI8 A;  2UUA O;  2QWR B;  4CBC A;  2QEX V;  4B3R B;  3I55 V;  1N33 B;  3G4S V;  5EIB D;  3J81 N;  2F93 B;  3TET A;  2CTQ A;  2OCC C;  4QIW F;  2QJ1 A;  1Q82 W;  2OT5 A;  4QPJ A;  3STL C;  3HKD A;  5EZY B;  4NXM B;  1QU7 A;  3CRA A;  1SZT A;  2KSD A;  1AI7 A;  1O9H A;  1BHA A;  3M99 B;  3RYI A;  1U96 A;  4O4L B;  3CX5 F;  1OZ0 A;  3M7M X;  1YDX A;  1Q90 D;  2ZIO A;  2DQ0 A;  2HHH B;  2UXX A;  3SPJ A;  3Q4H B;  4DV1 O;  4LF6 B;  3K3W A;  2HR3 A;  1Q7Y W;  3FAV B;  2ZNJ A;  3B77 A;  2OIE A;  3T1C A;  3K9A A;  4MVS A;  4K3A A;  3L73 H;  5LA6 B;  4O2B B;  2A79 B;  5CMU A;  4IYH A;  5KHG A;  3LDE A;  2HEP A;  4QE9 A;  4B3R O;  1N33 O;  3SJB C;  2F95 B;  4UCT A;  1Y74 B;  1M56 C;  5LXT A;  4KUM A;  3ASN B;  2ODM A;  2CTP A;  1SQB H;  4H0L B;  5JVD B;  2ARH A;  5B1B B;  2HVJ C;  5CBF A;  4NXM O;  3WB2 A;  1Q8I A;  4PDM A;  1L0N H;  3HKB B;  4FK5 C;  3CME V;  5BMV B;  4O2A B;  4E2L A;  3HPL C;  2XTA A;  2RJZ A;  4DR4 B;  3CCU V;  2QM4 A;  1BL8 A;  1NTZ H;  3OMN B;  1UFI A;  3HB3 B;  2EIM C;  4X1I A;  3DTU B;  5KHK A;  2HHH O;  4CH4 A;  1GAX A;  2GHY A;  4TOI A;  1CP9 A;  4ICG A;  5K1X A;  5CA1 A;  4MVQ A;  4P2Z A;  2EIL B;  2IU0 A;  4WFH A;  1V55 C;  5IT9 N;  3ZHS A;  3K03 A;  1RSO B;  4PV1 B;  2V7Q G;  2JIZ G;  3UKM A;  3QVN A;  2PUS A;  1CPY A;  2ADQ B;  3CWB H;  2DQ3 A;  4PJ0 Z;  3KKY A;  2PZS A;  1AI4 A;  5FNV A;  5LMN B;  2QKC A;  1S77 D;  2IJH A;  2UXC B;  1N8R W;  4RWU A;  1IXB A;  2ZT9 B;  4D7S A;  3D8C A;  2XT9 A;  3H1J H;  4GT1 A;  4X1Y A;  1MZF A;  4DV5 B;  1QQC A;  5KAI Z;  1AIL A;  2WA4 A;  1PNM A;  3HKD B;  1S5L Z;  3SJQ C;  2CGO A;  3K5N A;  2LFR A;  3EHB B;  3FD9 A;  4DR4 O;  1YJ9 V;  1D2D A;  3RYH A;  1FYJ A;  2YIB D;  5IYZ A;  1X4T A;  1GN6 A;  3R66 A;  1TAE A;  2P5O A;  1Y4M A;  3OAA G;  2KB1 A;  2EJ7 A;  1JJ2 U;  2RN9 A;  4Q20 A;  4QE7 A;  4B7E A;  1H2K A;  2G38 A;  5B3S B;  2YID A;  5C8Y B;  1L0L H;  4G27 B;  2YXY A;  3JAS A;  2WSS G;  3DSQ A;  4MTF A;  1K33 A;  3CPW U;  2NN4 A;  3IC9 A;  4GX5 A;  3CS5 A;  3AG2 C;  3ASN C;  3EVK A;  3LSQ A;  3QF7 A;  3JCZ A;  1SQQ H;  4D6T H;  4DUY B;  3MDS A;  3OE7 G;  5KA6 A;  2DN9 A;  5LMN O;  3TXQ A;  4RUF A;  3DC5 A;  3WG7 B;  2UXC O;  1GN4 A;  2QR4 A;  5LXT B;  3JAW A;  3CCR V;  4LFB B;  4AHC A;  4R50 A;  4DV5 O;  4O4I B;  5KHI A;  5LP6 A;  3JAL A;  3D36 C;  2Y4U A;  1AR5 A;  1JVM A;  3STZ C;  1IXM A;  3FB8 C;  2P4V A;  1AI6 A;  4N23 A;  5LL6 Y;  5E1A C;  4B3M B;  1N0J A;  2Q67 A;  4ZKI A;  4RO2 A;  1NTK H;  1OCC C;  4JYC A;  1XL4 A;  1T5E A;  5LHG A;  4X62 B;  1VQ6 V;  2LW1 A;  1LNQ A;  1FXK A;  4TV8 A;  1IBM B;  1OCZ B;  1W0J G;  3SR2 C;  4K0K B;  3BVO A;  4O4H A;  3AEI A;  3AG3 B;  3UQ8 A;  4B7K A;  4DUY O;  2K9P A;  3OM3 B;  1VAR A;  2KG7 A;  5LOV A;  1TVK A;  2PGG A;  2Z3Y A;  5BY1 A;  2JVD A;  5FNV B;  4PA4 A;  1BQ0 A;  2ZIM A;  1NH2 D;  4X8A A;  1N34 B;  3QG5 A;  2HFE C;  4YHH B;  4K35 A;  4LFB O;  3H1L H;  3B2E E;  3IGA C;  1XBL A;  5IY5 B;  3E8F A;  1OHH G;  4DYL A;  2N05 A;  1QBZ A;  4PDV A;  1R3L C;  2UUB B;  2KQX A;  1NBM G;  1TUB A;  5EC2 C;  3IC7 A;  5B1O A;  1PKX A;  1WAZ A;  1XEQ A;  3JAR A;  4B3M O;  3A0B Z;  4LH6 A;  1V9P A;  3ZMV A;  5CA0 A;  3JD1 A;  2ZE8 A;  2Y48 A;  1SZX A;  3CRM A;  2AZ2 A;  3L75 H;  5CN0 A;  1OCO B;  4X62 O;  2BSK B;  3RYF A;  2WPD G;  1Q81 W;  1IBM O;  1WB8 A;  4YIO A;  1K34 A;  1XHX A;  3MHH C;  2IJI A;  3CRQ A;  4PDL A;  2LJ2 A;  4K0K O;  4LFA B;  5B1A B;  3JAS B;  2OCH A;  2E5L B;  3ZS8 C;  1M5I A;  5KAF Z;  2Q7G A;  1XI1 A;  2WLI A;  1I5Y A;  3RWR D;  4UCV A;  2IH3 C;  1B04 A;  1N34 O;  4OPA A;  2YUA A;  4YHH O;  3N2G A;  3OGC C;  3JAW B;  4BWA A;  3ZMU A;  2Q73 A;  3I5D A;  2YC0 A;  1YVW A;  5LP6 B;  2UUB O;  3JAL B;  1RM1 B;  1F51 A;  5JJE B;  1VQ5 V;  3ETD A;  4TV9 B;  2XND G;  1NR1 A;  4J41 A;  2QM8 A;  2A3Q A;  2QA4 V;  1YF2 A;  1OCZ C;  1JJO A;  2Q5Z A;  2QTO A;  4X89 A;  4Z1V A;  1JFF A;  1SQV H;  3SJC C;  4CS3 A;  1R3K C;  4JTC B;  1EN6 A;  4J7J A;  1US6 A;  2W0X A;  4LFA O;  1FXK B;  1IBL B;  2PF4 E;  2QSA A;  3S3W A;  4DR2 B;  4DR6 B;  4JZ2 A;  3KZI Z;  3UO3 A;  2E5L O;  1OV9 A;  4FLT A;  4KP4 A;  2Q7H A;  2IH1 C;  3CJH A;  1ZAU A;  2IJK A;  2FTK A;  5H6Q A;  4EB6 A;  4LP8 A;  2BTO A;  2EX3 A;  1YXB A;  5IY5 C;  1M57 B;  3FX7 A;  2RNB A;  1BSM A;  1TVK B;  3CD6 V;  4YXW G;  1YJN V;  3ABM C;  3B40 A;  1DF4 A;  3RYC A;  3A8T A;  2ADP A;  2ILM A;  4FIP C;  5JJJ B;  3UCS C;  3SPI A;  1G1X B;  3H01 A;  1ROP A;  4UCR A;  2XAJ A;  5J2U B;  2CUG A;  1YEW A;  4YY3 B;  4MTX A;  1OCO C;  2UUC B;  3ML0 A;  1TUB B;  4U3J A;  1KP2 A;  4FZ0 A;  3JAR B;  4FVM A;  4H37 A;  1XL6 A;  3S3X A;  2WWW A;  4GLX A;  5CA0 B;  1G4Y B;  1K3E A;  4GKK B;  3CXH F;  4JI2 B;  1WB7 A;  3SGI A;  2F1M A;  1UPG A;  1IBL O;  3RYF B;  4DR2 O;  1SQX H;  4DR6 O;  2OYQ A;  4DV0 B;  1DK1 A;  3MHS C;  3LSS A;  5KMG A;  1GKF A;  1XDC A;  1KKC A;  2CTW A;  5A2Q N;  1WA8 A;  5L3G A;  1K4D C;  4O4J A;  3B4S A;  4DW0 A;  1ZX3 A;  4PA7 A;  3QO5 A;  2WLH A;  4ZI7 A;  1RM1 C;  2EIK B;  2DYS C;  3N2G B;  5BZB A;  1P4R A;  4MW8 A;  5H6R A;  3ASO B;  1OJH A;  3W7S A;  1WP8 A;  4YY3 O;  5L3C A;  1K4C C;  3OEH G;  2UUC O;  2LFS A;  3GWO A;  4WFG A;  2YS8 A;  5KHJ A;  2QTS A;  1SRY A;  1MNG A;  2QDO A;  3RW0 A;  2Y0P A;  3OW2 U;  1HR0 B;  4GKK O;  4JI2 O;  2WLJ A;  2GUZ A;  4G28 B;  4PI2 A;  4MSW C;  1SQP H;  3AK1 A;  2OTL V;  4DV0 O;  3BRC A;  3O65 A;  4JI1 B;  1BT8 A;  1M57 C;  5GW7 A;  4J10 A;  4MVM A;  5EBM C;  1BS3 A;  4X1K A;  4B3S B;  1RP3 B;  1KEC A;  3CJH B;  2ZR3 A;  2ZDI A;  2RMK B;  4FMT A;  4EB6 B;  5ITZ B;  4JV5 B;  2JGD A;  5E79 Z;  1XQ8 A;  5IJ0 B;  2P4K A;  5FL7 G;  4KHP B;  3ABK B;  5JCO C;  4JYY A;  4PA6 A;  4BW5 A;  2VWJ A;  3T4Z A;  3ZJZ A;  1JPX A;  4LWS B;  2E74 B;  3LDD A;  4JI4 B;  3O9O A;  1VQP V;  1VF7 A;  3DGE A;  4MVU A;  1N4C A;  5TIS Z;  3J80 N;  1VP7 A;  3ABL B;  1WPB A;  3JAT A;  4U3J B;  3T1Y B;  1HR0 O;  2QWN B;  1BGY H;  2OTJ V;  1K9M W;  4QJF B;  2ZE5 A;  3NR7 A;  4WF9 V;  5LGN A;  2HVK C;  4FZ1 A;  1M93 A;  4JI1 O;  5CBG A;  3QO8 A;  4GCZ A;  2DYR B;  3RVZ A;  5LBQ A;  4B3S O;  1OCR B;  1NU1 H;  3IJ4 A;  1S5J A;  1KB9 F;  5KMG B;  2A0L A;  4JAU A;  1H38 A;  4JV5 O;  1VF5 B;  3CCM V;  2UXD B;  1WA8 B;  4YJ2 A;  4O4J B;  4NXN B;  3ZCC A;  4BIZ A;  1FAF A;  4KHP O;  3ABT A;  1MSW D;  4ZI7 B;  3C3S A;  1VQK V;  3CMA V;  4LFC B;  1QVG U;  4H44 B;  4JI4 O;  1HNZ B;  4LC1 A;  1Q5O A;  1D5A A;  4I55 A;  4DRX A;  2EZO A;  2NLJ C;  4MW3 A;  3ZHU A;  5JH7 B;  3CRR A;  2HJF C;  1HP8 A;  3T1Y O;  5IJ9 A;  1YI2 V;  1GM7 A;  1P7B A;  2BTQ B;  3ABU A;  4P9O A;  3ZBH A;  4FFB B;  2D2C B;  1V54 C;  4Z2W A;  2JEU A;  1F4M A;  5AG2 A;  1VQ8 V;  4X1K B;  3QNE A;  3JYC A;  3THO A;  2A9H A;  5EBL C;  2UXD O;  4JI6 B;  4NXN O;  1NS1 A;  2LGQ A;  4EEQ A;  1Y6X A;  4IT5 A;  2JGD B;  3UO2 A;  1FFX A;  3F5W C;  3AG1 B;  2GTS A;  1B3Q A;  2DJV A;  1S3J A;  2HLD G;  4X64 B;  4LFC O;  2R72 A;  3ABL C;  1HNZ O;  4LF6 O;  4NTW A;  3E89 A;  4ZOL B;  1K92 A;  1R1B A;  3MAQ A;  2YIA A;  4DR3 B;  1GM9 A;  3DC6 A;  2HJD A;  1I5X A;  4CS4 A;  2DYR C;  1FS0 G;  4E4E A;  3SDL A;  3W7W A;  3NXS A;  2E76 B;  1HDJ A;  1R6K A;  5D5P A;  1GTO A;  2IW5 A;  2ITD C;  1Q86 W;  3A0H Z;  3H1I H;  1VQM V;  3BY6 A;  5LGU A;  4DK0 A;  1K5S A;  3RN4 A;  1L1F A;  3ETQ A;  1YTF B;  4JYA B;  1R6N A;  2YEV A;  4JI6 O;  4ZIB A;  2V4D A;  2PTM A;  3D3Q A;  1FKA O;  2WA3 A;  2VQE B;  2EIN B;  2ZE6 A;  3RYI B;  2VQF B;  1G8M A;  3VQV A;  1BCC H;  3BEH A;  3K04 A;  4X64 O;  1H2N A;  5JJN B;  5CB4 A;  4JF3 A;  4XBF A;  3CC4 V;  3FFQ A;  4GUN A;  4L8J A;  3TCU A;  3AK3 A;  4CH6 A;  4I0X A;  1HNW B;  2JDI G;  3LUT B;  4I55 B;  3K57 A;  1PL4 A;  4I50 A;  4HNA A;  4DR3 O;  4DRX B;  2AGA A;  4YIP A;  1PP9 H;  4LCU C;  1JMK C;  5IJ9 B;  3CC2 V;  1WP7 A;  1ORQ C;  1SF9 A;  1BE3 H;  4ZHQ A;  5B1B C;  3L9D A;  2XUM A;  3QTC A;  4UCO A;  5K1P A;  3ETG A;  1MMM A;  1XHZ A;  4AQY B;  4P30 A;  4JYA O;  3AG1 C;  2Z0A A;  1VIB A;  2XAQ A;  1SET A;  1E1R G;  5EYP A;  3N2K A;  2VQE O;  4B08 A;  1M4U A;  4XDL A;  2BOC C;  2E75 B;  3ZRX A;  3OTF A;  2W6I G;  2VQF O;  4P9P A;  3ZN0 A;  5BR8 B;  2EIL C;  2ZKO A;  2LP7 A;  1FFX B;  5L3D A;  4UXN A;  1FJG B;  2PYL A;  4JI3 B;  4X1I B;  5LYJ A;  3CCL V;  1MOF A;  1VF6 C;  1Y76 A;  5HFM A;  1HNW O;  1X59 A;  2Q4P A;  5CA1 B;  4KFM A;  3P30 A;  3K79 A;  5CBH A;  4FLZ A;  3SYA A;  4BW9 A;  1AB3 A;  5IYC O;  1QVF U;  4RAI A;  4YJ3 A;  1B06 A;  4HYO A;  5C93 A;  1NTM H;  1R3I C;  2JS5 A;  2LW7 A;  2IJJ A;  1AR4 A;  5L3B A;  4AQY O;  2DW4 A;  1S76 D;  4NB5 A;  2ITC C;  1EZJ A;  1TUE B;  4X1Y B;  1TA8 A;  3H9V A;  5B3S C;  2B1G A;  3B8M A;  5BR8 O;  4GX2 A;  1BMF G;  3RYH B;  1FJG O;  5IYZ B;  1BZK A;  4JI3 O;  3G6E V;  2UXB B;  4DUZ B;  2QWO B;  1K7D A;  2YI9 A;  2ZD9 A;  1VEW A;  5IYD O;  4I0X B;  1ZTE A;  1FFT B;  4LR3 A;  3QO7 A;  1WPX A;  3WG7 C;  2AHY A;  2LO1 A;  4BIU A;  2ZE7 A;  3KCY A;  5GON A;  2P6J A;  3W7U A;  4NYK A;  2L35 A;  3ZN1 A;  2JS3 A;  3GB7 C;  1SA0 A;  2WLL A;  4ZHQ B;  4JTD B;  4IYI A;  1NVP B;  2ETN A;  1SKV A;  2CGN A;  3OR6 C;  1O9G A;  2DWD C;  3CHX A;  2MK3 A;  4ABM A;  4IGG A;  3JD3 A;  1MA1 A;  3CP1 A;  5EYP B;  3L70 H;  3N2K B;  4JI8 B;  2P06 A;  3U10 A;  3FKS G;  3ZMZ A;  2UXB O;  3ZRW A;  4DUZ O;  4JGS A;  1SES A;  3BA9 A;  1AI5 A;  2X6A A;  3E8H A;  4I5S A;  2YIB A;  5LYJ B;  3AG3 C;  1KUQ A;  2ATK C;  4AIL C;  1YIJ V;  1Y76 B;  3GVM A;  3FYI B;  2OIG A;  4TV8 B;  2Q68 A;  3OR7 C;  4U7O A;  4EFB A;  4O4H B;  4JAV A;  4JZG A;  1R73 A;  1J95 A;  1WLE A;  2R9R B;  3CEI A;  3W7X A;  1LR1 A;  1RPO A;  3ZIA G;  2QGN A;  5LOV B;  2KG7 B;  2Y69 B;  1JQ0 A;  1XNQ B;  1QCE A;  4X66 B;  1SS3 A;  1PL0 A;  3HKE A;  3I56 V;  2FB5 A;  2HP8 A;  4HZ3 A;  4TUY A;  4J42 A;  3ZED A;  4DW1 A;  1R3J C;  1M1K W;  4FM2 A;  3BA8 A;  4JI8 O;  1FPO A;  1K5Q A;  4LF8 B;  4TSF G;  4EFE A;  1NR7 A;  5B1A C;  1KP3 A;  1COW G;  4UVA A;  3K58 A;  2IU3 A;  2KKW A;  1H2M A;  3F5T A;  3U11 A;  3WFV A;  3BAB A;  1E79 G;  2F4V B;  4GYC B;  2FYU H;  4MVO A;  1QR8 A;  4ZBM A;  4MVZ A;  3SYC A;  2PI5 A;  2Q69 A;  3FB7 C;  4WFA V;  4PA9 A;  1Q3E A;  2WLI B;  4TT3 G;  4WFE A;  4FPP A;  1XNQ O;  1SA0 B;  2WLL B;  2YSU B;  4X66 O;  4DR7 B;  3K5O A;  2AXT Z;  5LP6 C;  3W7T A;  3SYQ A;  2QWQ B;  4PA3 A;  3CYO A;  1W0K G;  3SYP A;  1Q6I A;  2JK5 C;  4NTY A;  4J9Y B;  5LMU B;  3OGI B;  2RCV A;  2C2A A;  2OCC B;  1H2L A;  4XDJ A;  1PPJ H;  3CXC U;  4D7T A;  4FLY A;  2RDC A;  3U0Z A;  3OTO B;  1NT2 B;  4F6E A;  4ASU G;  2B1I A;  3JSL A;  4LF8 O;  1M9N A;  2X7R B;  1FXK C;  1I94 B;  1PM9 A;  1P49 A;  3Q4H A;  1ARO P;  4JTA B;  3EXA A;  1JFF B;  1EN4 A;  1ZSP A;  2LQT A;  3CRC A;  2F4V O;  5LA6 A;  3K0G A;  1NJI W;  1DLB A;  3AK2 A;  2Y69 C;  2WLN A;  2M6Y A;  1I0H A;  1L8D A;  1DGS A;  3H1H H;  1Y74 A;  4LH7 A;  4F6R A;  5IYB O;  3ZHQ A;  4DR7 O;  2FKX A;  1F23 A;  4NTX A;  5LGT A;  4W4K A;  1HWY A;  1BHB A;  2ZCE A;  3HKE B;  3E2E A;  5LMU O;  3HKB A;  4DR5 B;  2Q6A A;  2VWK A;  1H8E G;  3RYC B;  3FB5 C;  2GDS A;  4LF4 B;  4I7Z B;  3OEE G;  4O2A A;  3P3N A;  4TWK A;  3L71 H;  3OTO O;  3D36 A;  1N36 B;  2WLM A;  1GRJ A;  4X20 A;  5A9G A;  2VRZ A;  2M7W A;  1I94 O;  3RBZ A;  5KA5 A;  3BCC H;  5DEC A;  3X2Q B;  4NKG B;  4NVP A;  5GTH Z;  2PI4 A;  2EIM B;  3E22 A;  4DXW A;  3RFR A;  1M90 W;  2K1E A;  1HW7 A;  2EIK C;  1K73 W;  1V55 B;  2YXL A;  3APQ A;  3LNN A;  1JCH A;  3ASO C;  1KYO F;  2A06 H;  1VQN V;  3SPC A;  2GTA A;  2PY5 A;  1GK9 A;  5B5E Z;  3N27 A;  2X6B A;  3PN1 A;  1S5H C;  3JSN A;  3ETE A;  1N0N A;  2Y4T A;  2VS0 A;  1PNK A;  3G71 V;  4DR5 O;  4LF4 O;  1NH2 B;  3T4D A;  2CDY A;  1YSC A;  1N36 O;  4J80 A;  3HR0 A;  2AHZ A;  3G6B A;  3ZRV A;  2YDE A;  3OMI B;  1IUR A;  4QNH B;  3TJT A;  2P90 A;  3CC7 V;  1Q43 A;  5C8Y A;  4DO2 A;  5KLV H;  1K97 A;  4LBE C;  4B3T B;  4CS2 A;  2IBZ H;  2GUZ B;  5EC1 C;  2AZ0 A;  1TGO A;  2V1D A;  5IDJ A;  1URF A;  5H9C A;  5IWA B;  3TXS A;  5CA3 A;  3CCV V;  5DN6 G;  3OMA B;  1KBH A;  4L87 A;  4DV6 B;  1XUQ A;  3ABK C;  4OPH A;  4CH5 A;  1IX9 A;  1PD3 A;  1ZUQ A;  2CH7 A;  4F6R B;  3SPH A;  1R6T A;  3AG2 B;  3LSU A;  3ZX6 A;  4O4I A;  3T1H B;  4PDR A;  4BR6 A;  1MZE A;  1XRE A;  2UXN A;  4H13 B;  5FPO A;  4I4T A;  5H5N A;  1ZL8 A;  1GN2 A;  3BHP A;  3X2Q C;  4JI7 B;  5KUK A;  2F66 C;  3WB1 A;  1I7F A;  4FLV A;  2HG5 C;  3JAT B;  4X20 B;  1XNR B;  1XMO B;  5KX5 A;  4B3T O;  4RQF A;  4LF5 B;  3RT3 C;  1OCR C;  2Q8V A;  3L74 H;  3ZMT A;  3FYE B;  4JI5 B;  2DMX A;  5JWP A;  5IWA O;  1AR1 B;  2EBO A;  1OCC B;  4BAY A;  3E22 B;  3ZHV A;  2F23 A;  3K08 A;  4DV6 O;  1EBO A;  2NR5 A;  2ZQM A;  1NZ6 A;  4OXS A;  1JA8 A;  1EM1 A;  4MTO A;  2X0L A;  2QM7 A;  2EIJ B;  3OUS A;  3HKC A;  3ZRS A;  3CCS V;  1N32 B;  4R6Z A;  4YJ2 B;  3JAM N;  3JD2 A;  4GX0 A;  4G2K A;  4LF9 B;  3T1H O;  2NNU A;  3F7Y C;  2H8P C;  3K5L A;  4JAS A;  4HBN A;  4X65 B;  5F2V O;  4MTG A;  4GKJ B;  4MS2 A;  3TK1 A;  1Q6H A;  5KUM A;  2XAS A;  3EFF K;  4FLX A;  4JI7 O;  1W59 A;  1S72 V;  1KQS U;  1AVM A;  1J5E B;  3RVY A;  1A32 A;  1VQ7 V;  4KL1 A;  1G6U A;  1KU9 A;  1XNR O;  2XAH A;  3CB2 A;  3DXR A;  1BQZ A;  4FFK A;  1XMO O;  2BSK A;  3IAY A;  3K9S A;  4LF5 O;  1F4N A;  1EFR G;  4UFZ A;  4JI5 O;  4J7K A;  1WJZ A;  2JEX A;  4A5U B;  4Z1M G;  2ZDI C;  5JQG A;  2DE0 X;  4FM1 A;  1AP6 A;  4MVR A;  2DOS A;  1GO3 F;  4GX1 A;  4WBN A;  5D5Q A;  1IZ3 A;  3JD4 A;  2Q7E A;  3ICX A;  4IHJ A;  1K8A W;  2R9I A;  2ZNI A;  1N32 O;  1QNM A;  1MAB G;  2BE3 A;  1F7Y A;  2XAF A;  5KHH A;  2CH7 B;  2P22 C;  4I9Q A;  4LF9 O;  1GMG A;  1KMI Z;  4X65 O;  5GTI Z;  1DF5 A;  1IVS A;  1QHT A;  4GKJ O;  1VQL V;  2DWE C;  2AW9 A;  3A0R A;  2GSM B;  3CCQ V;  4TV9 A;  4I4T B;  1J5E O;  1ZL8 B;  2Q9L A;  1XIL A;  3VOU A;  2CTR A;  2RQ6 A;  4EKW A;  4W4L A;  3K06 A;  3J7A U;  3VQY A;  2FL4 A;  4UB6 Z;  3A2F A;  5KX5 B;  1PV0 A;  3P32 A;  2EIJ C;  2JJ2 G;  3MD0 A;  3K0D A;  2EIN C;  4LF7 B;  1FXV A;  3CSX A;  1UJW B;  1IDS A;  4JAA A;  2YEV B;  3M8A A;  5LHI A;  4AI8 A;  1H2G A;  3C90 A;  4IL6 Z;  5J2T A;  3HKC B;  2D3O W;  3BAA A;  2Q0A A;  4DV3 B;  1P7G A;  3C3T A;  2JRI A;  5J2U A;  3VQX A;  1YJW V;  5CB4 B; 
#chains in the Genus database with same CATH homology
 4GT1 A;  3WFV A;  1H8H G;  5LBQ A;  2ZXW B;  1Y66 A;  1E79 G;  1PNL A;  2QKS A;  3AG4 B;  1PNM A;  3ABM B;  1OCR B;  3D3I A;  3SJQ C;  4MVO A;  1QR8 A;  4ZBM A;  4MVZ A;  3SYC A;  2PI5 A;  2Q69 A;  2LFR A;  3EHB B;  2A0L A;  4JAU A;  3FB7 C;  1H38 A;  4WFA V;  1YJ9 V;  4PA9 A;  3CCM V;  2WLI B;  4TT3 G;  1Y4M A;  4WFE A;  3ZCC A;  3OAA G;  2KB1 A;  1JJ2 U;  4BIZ A;  4Q20 A;  4FPP A;  2WLL B;  2YSU B;  4QE7 A;  3ABT A;  5B3S B;  1MSW D;  4JPR A;  3W7T A;  3SYQ A;  1AJP A;  4PEL A;  1AJN A;  4PA3 A;  3CYO A;  1VQK V;  4G27 B;  3CMA V;  1W0K G;  2W6J G;  1QVG U;  3SYP A;  1RPR A;  4LC1 A;  1SER A;  2JK5 C;  5LHH A;  4J9Y B;  1CEZ A;  2WSS G;  4MTF A;  1K33 A;  3CPW U;  3E8B A;  2C2A A;  2OCC B;  4GX5 A;  2EZO A;  2NLJ C;  3AG2 C;  3ASN C;  3LSQ A;  4MW3 A;  4XDJ A;  3CXC U;  2HJF C;  3JCZ A;  1QLE B;  4ASU G;  2B1I A;  1YI2 V;  1JOY A;  3OE7 G;  1M9N A;  5KA6 A;  2X7R B;  1FXK C;  4RUF A;  2JJ1 G;  3OUF A;  2ZR2 A;  3WG7 B;  1GM7 A;  1ARO P;  1DTO A;  1P7B A;  4JTA B;  4P9O A;  3ABU A;  4RUE A;  3LDC A;  1ENV A;  1V54 C;  3CCR V;  1S0V A;  4R50 A;  2JEU A;  3K0G A;  1NJI W;  1F4M A;  1DLB A;  2DYS B;  2Y69 C;  2WLN A;  1JVM A;  1VQ8 V;  5EBW C;  3STZ C;  1IXM A;  3FB8 C;  3QNE A;  1VQO V;  3FB6 C;  2Z5U A;  3JYC A;  2A9H A;  5EBL C;  1AI6 A;  3T2M A;  4N23 A;  4JYB A;  5E1A C;  4CZZ A;  3E83 A;  4FJC C;  5IYB O;  2Q67 A;  5HFL A;  4ZKI A;  3F5W C;  3AG1 B;  4RO2 A;  4WCE V;  1F23 A;  1OCC C;  1S3J A;  2HLD G;  3B8N A;  1XL4 A;  4JYC A;  1VQ9 V;  5LGT A;  1YTF D;  4X88 A;  4WFF A;  5LHG A;  1VQ6 V;  1NKD A;  3ABL C;  4XDK A;  1LNQ A;  1HWY A;  2W0F C;  1BHB A;  1FXK A;  2QE7 G;  3R65 A;  3E2E A;  1JX9 A;  2Q6A A;  2XOK G;  1H8E G;  1OCZ B;  1W0J G;  3FB5 C;  3E89 A;  3OEE G;  3AEI A;  1K92 A;  4TWK A;  3AG3 B;  3OFN G;  2XAG A;  3D36 A;  1GM9 A;  2EZP A;  1I5X A;  2WLM A;  1QR9 A;  2DYR C;  3OM3 B;  1FS0 G;  2M7W A;  2Z3Y A;  2ZXW C;  4UV8 A;  3RBZ A;  4UVC A;  5KA5 A;  3E8G A;  3AG4 C;  4PA4 A;  3W7W A;  1NH2 D;  3NXS A;  4X8A A;  3X2Q B;  3PJS K;  1R6K A;  2HFE C;  1GTO A;  2IW5 A;  2ITD C;  3IGA C;  1Q86 W;  2PI4 A;  1VQM V;  2EIM B;  3BY6 A;  5IY5 B;  1W2B U;  3E8F A;  1OHH G;  5LGU A;  1YIT V;  1K5S A;  1L1F A;  4DXW A;  1QBZ A;  4PDV A;  1R3L C;  1YTF B;  1E1Q G;  4U7N A;  5EC2 C;  1NBM G;  1R6N A;  2YEV A;  3IFX A;  3IC7 A;  5B1O A;  1PKX A;  1M90 W;  2K1E A;  4N21 A;  4UUJ C;  2EIK C;  2WLK A;  1K73 W;  1V55 B;  2EIN B;  3ZMV A;  1JCH A;  4J9Z B;  3ASO C;  3JD1 A;  1VQN V;  1G8M A;  3BEH A;  3SPC A;  2Y48 A;  1GK9 A;  3K04 A;  3LNM B;  3F7V C;  1KKD A;  5CN0 A;  1OCO B;  2X6B A;  1S5H C;  3ETE A;  4JF3 A;  1FXH A;  2WPD G;  5L3E A;  1Q81 W;  2CK3 G;  1QLE C;  4XBF A;  1PNK A;  3G71 V;  1AJQ A;  1K34 A;  4R7C A;  3MHH C;  3CC4 V;  3TCU A;  2IJI A;  4PDL A;  1NH2 B;  2JDI G;  5B1A B;  3T4D A;  3LUT B;  4RQE A;  1YSC A;  2WLI A;  1I5Y A;  5EK0 A;  2AHZ A;  3ZRV A;  4LCU C;  1B6Q A;  3OMI B;  3VBB A;  4QNH B;  3CC2 V;  3JD0 A;  1THZ A;  2P90 A;  2IH3 C;  3CC7 V;  1ORQ C;  3E86 A;  5B1B C;  4UV9 A;  1ZWI C;  3UM7 A;  4DO2 A;  3OGC C;  4UVB A;  3ZRW B;  1K97 A;  2BOB C;  4LBE C;  2X6C A;  5L3F A;  5EC1 C;  3ZMU A;  2V1D A;  5IDJ A;  4I9W A;  3ETG A;  5H9C A;  1MG1 A;  1KC8 W;  3SYO A;  1QLN A;  4P30 A;  5CA3 A;  3AG1 C;  3CCV V;  5DN6 G;  2EJR A;  1RM1 B;  1F51 A;  4H33 A;  3OMA B;  3E35 A;  1VQ5 V;  4F4L A;  2XAQ A;  3ETD A;  1SET A;  1E1R G;  4L87 A;  2XND G;  2BOC C;  3ABK C;  1NR1 A;  4XDL A;  3ZRX A;  2QM8 A;  5DM6 V;  2QA4 V;  2W6I G;  4MT8 A;  2H94 A;  4P9P A;  2B5U A;  3ZN0 A;  1PD3 A;  1OCZ C;  2QTO A;  4X89 A;  2EIL C;  2LP7 A;  3SPH A;  3KG2 A;  5L3D A;  4UXN A;  3AG2 B;  1R3K C;  4JTC B;  2P67 A;  3CCL V;  4PDR A;  1MOF A;  5HFM A;  1FXK B;  2UXN A;  4KFM A;  2P7T C;  3P30 A;  3K79 A;  4KP4 A;  5CBH A;  2IH1 C;  1M56 B;  2IJK A;  3X2Q C;  2WAM A;  2FTK A;  4R8C A;  1V54 B;  5KUK A;  1GM8 A;  5H6Q A;  3SPG A;  3SYA A;  4LP8 A;  5IY5 C;  1M57 B;  2F43 G;  1YHQ V;  2HG5 C;  5IYC O;  1QVF U;  4RAI A;  3CD6 V;  4RQF A;  1NQT A;  4YXW G;  1YJN V;  3ABM C;  4WFB V;  1OCR C;  5B1N A;  3CCE V;  4HYO A;  3ZMT A;  5C93 A;  1R3I C;  1DF4 A;  3FYE B;  4HAM A;  4QPK A;  2IJJ A;  5L3B A;  4FIP C;  3ZMS A;  1AR1 B;  2EBO A;  3SPI A;  3H01 A;  1ROP A;  2DW4 A;  1S76 D;  1OCC B;  2XAJ A;  4BAY A;  2HKO A;  2ITC C;  1EZJ A;  1TUE B;  4MTX A;  1OCO C;  3K08 A;  1EBO A;  3ML0 A;  2ZQM A;  5B3S C;  4OXS A;  1VQ4 V;  1KD1 W;  2B1G A;  1NVP D;  1KP2 A;  3B8M A;  4H37 A;  2X0L A;  4GX2 A;  4MTO A;  1XL6 A;  2QM7 A;  5J9P C;  3CCJ V;  2EIJ B;  2WWW A;  1BMF G;  4CBC A;  3OUS A;  3ZRS A;  3CCS V;  2QEX V;  1G4Y B;  1K3E A;  4R6Z A;  3I55 V;  3G6E V;  3G4S V;  3JD2 A;  4GCZ A;  4GX0 A;  4G2K A;  3TET A;  2OCC C;  2NNU A;  1K7D A;  2H8P C;  3F7Y C;  4QIW F;  2ZD9 A;  4JAS A;  4MTG A;  1Q82 W;  5IYD O;  2OT5 A;  4MS2 A;  4QPJ A;  3STL C;  3TK1 A;  5KUM A;  3MHS C;  2XAS A;  3EFF K;  3LSS A;  1FFT B;  1S72 V;  3QO7 A;  1KQS U;  1WPX A;  1SZT A;  3WG7 C;  1GKF A;  2AHY A;  3RVY A;  1AI7 A;  1BHA A;  3M99 B;  4BIU A;  1VQ7 V;  2P6J A;  1K4D C;  5L3G A;  3W7U A;  1OZ0 A;  2XAH A;  3ZN1 A;  3GB7 C;  2WLL A;  4PA7 A;  3QO5 A;  4JTD B;  2WLH A;  1RM1 C;  2DQ0 A;  1F4N A;  1EFR G;  2EIK B;  2DYS C;  5BZB A;  2UXX A;  3SPJ A;  1NVP B;  1P4R A;  4MW8 A;  5H6R A;  2JEX A;  3ASO B;  3OR6 C;  4Z1M G;  3W7S A;  3K3W A;  2ZDI C;  2HR3 A;  1Q7Y W;  2DWD C;  2MK3 A;  5L3C A;  3B77 A;  1K4C C;  3OEH G;  4MVR A;  3T1C A;  3K9A A;  2LFS A;  4MVS A;  1GO3 F;  4GX1 A;  3JD3 A;  3GWO A;  4WFG A;  3CP1 A;  2A79 B;  3JD4 A;  5CMU A;  1SRY A;  1K8A W;  3RW0 A;  3LDE A;  4QE9 A;  2R9I A;  3FKS G;  3ZMZ A;  3OW2 U;  3ZRW A;  1MAB G;  2WLJ A;  2XAF A;  4JGS A;  1SES A;  1AI5 A;  1GMG A;  2X6A A;  3E8H A;  4I5S A;  4G28 B;  1M56 C;  4MSW C;  4KUM A;  3ASN B;  3AG3 C;  1DF5 A;  2ATK C;  2OTL V;  1VQL V;  1YIJ V;  5B1B B;  1M57 C;  2HVJ C;  5CBF A;  2DWE C;  5GW7 A;  3A0R A;  4PDM A;  2GSM B;  3FYI B;  3CCQ V;  4MVM A;  5EBM C;  2Q68 A;  3OR7 C;  4U7O A;  4FK5 C;  1KEC A;  3CME V;  3VOU A;  2ZR3 A;  3HPL C;  4JAV A;  2ZDI A;  4E2L A;  1R73 A;  1J95 A;  1WLE A;  2R9R B;  4FMT A;  3W7X A;  4EKW A;  3CCU V;  1BL8 A;  3K06 A;  3OMN B;  1RPO A;  3HB3 B;  2EIM C;  3ZIA G;  3DTU B;  2Y69 B;  5FL7 G;  1JQ0 A;  2GHY A;  1QCE A;  1CP9 A;  3ABK B;  1PL0 A;  4PA6 A;  4BW5 A;  4MVQ A;  3P32 A;  3T4Z A;  3I56 V;  4P2Z A;  4HZ3 A;  1JPX A;  3ZJZ A;  2EIJ C;  2EIL B;  2JJ2 G;  2IU0 A;  4WFH A;  1V55 C;  3LDD A;  3MD0 A;  3K0D A;  2EIN C;  3K03 A;  1VQP V;  2V7Q G;  2JIZ G;  3DGE A;  4MVU A;  3UKM A;  1R3J C;  1FXV A;  1M1K W;  1CPY A;  1UJW B;  2DQ3 A;  3ABL B;  2YEV B;  5LHI A;  1K5Q A;  1H2G A;  2OTJ V;  1AI4 A;  1K9M W;  4TSF G;  4QJF B;  1NR7 A;  4WF9 V;  2D3O W;  1S77 D;  5B1A C;  5LGN A;  2IJH A;  1KP3 A;  1N8R W;  1COW G;  4UVA A;  2HVK C;  2IU3 A;  5CBG A;  3QO8 A;  2DYR B;  3RVZ A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...