1QVFU

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvfU00
1NJIW 3CC2V 3OW2U 1VQ7V 1VQOV 1VQ8V 1VQ6V 1KC8W 4WCEV 4WFAV 1VQLV 1K8AW 1K9MW 2QEXV 3CCRV 3CC4V 1KD1W 1Q7YW 1VQ9V 3CXCU 3CD6V 2D3OW 1VQKV 3CMEV 3CCSV 1R73A 1Q82W 1VQ4V 3CPWU 3CMAV 1VQMV 3G6EV 3I55V 3CCMV 1YHQV 1YJNV 1VQPV 1W2BU 3I56V 3G71V 1QVFU 4WFBV 3CCUV 4WF9V 1Q81W 1YJWV 3CCVV 2QA4V 1YJ9V 1S72V 1KQSU 1VQ5V 1Q86W 3CCEV 3CCLV 2OTJV 1M90W 1YI2V 1JJ2U 1K73W 3CC7V 3G4SV 3CCJV 1YIJV 1QVGU 3CCQV 1VQNV 2OTLV 1M1KW 5DM6V 1YITV 1N8RW
chains in the Genus database with same CATH superfamily
4DR1O 1VQOV 4WFAV 4TSFG 4O4HA 3ZCCA 4O4IB 2WLLA 3C90A 4RUFA 4JYYA 3T2MA 3WFVA 4YIOA 3CRCA 2HG5C 1JFFB 4BIZA 2GHYA 1YI2V 1Q90D 4QE9A 1EBOA 4TOIA 2KSDA 4PI0A 5DM6V 5H6RA 5LHHA 2A9HA 3QTCA 4WBNB 4AQYO 5CA0B 3K03A 3JSNA 5L3DA 3E86A 5JH7A 4BIUA 1BQ0A 2WLNA 1Y74B 2RJZA 2ZE6A 1XI1A 3E89A 2ARHA 1WB7A 3F5WC 1E1QG 1OCRB 3ZN0A 3K06A 1XNQO 2P5OA 2X0LA 3EHBB 1N36B 4H0LB 1SQXH 3JALA 4XDJA 5EBWC 1WNSA 2F4VB 4FIPC 1ZL8B 1H8HG 3UKMA 2R9IA 1Q6IA 1W0KG 2P22C 5KA6A 2LFSA 3ASNC 1YIJV 1TUBA 2YIDA 5IY5B 1S0VA 1VP7A 2IM9A 2R70A 1FS0G 3WU2Z 4DUZO 1FAFA 3ZRSA 1D5AA 3SGIA 1NR7A 1FKAO 5JJEB 1M57B 1BHAA 1HW7A 1THZA 4DV6B 4UB8Z 2QWQB 3I5DA 2WLHA 4CC6A 4QIWF 2DYRC 3ZHUA 1G8MA 4O4JA 3ZHVA 2Q8VA 3X2QB 4DW1A 1VEWA 3ZRWA 1QU7A 5JJJB 4OXSA 2Q73A 5AG2A 2AW9A 1FJGB 1KD1W 3WB1A 3FB6C 4EB6B 1XMQB 5IYBO 1QLEB 2BSKB 1ZX3A 1XDCA 1HNXO 2Q7HA 3N2GA 1Q81W 1XNRB 4TQFA 1FD9A 1DTOA 3ZHRA 4RAIA 2H3OA 2P90A 3L73H 3DXRA 1BQZA 1AR4A 1JMKC 4O4LA 5JCOC 3ZMZA 3LDEA 4JI5B 2HLDG 4JTAB 1Z2GA 1S5LZ 1F7YA 3FD9A 2YXYA 4B3SB 3I56V 4G28B 2UXDB 3CCUV 2RDCA 2HKOA 4EKWA 2Q69A 3NXSA 2AGAA 4YJ2B 2XNDG 3M99B 1NR1A 1K97A 1R6TA 1P84F 2IBZH 1GM9A 4IYIA 1JR9A 4FM1A 2ETNA 4F4LA 1SQGA 3FYEB 4TV9B 4DV0O 4NTXA 1IDSA 5CBGA 4I4TB 5C93A 4GKKO 2YEVB 2QR4A 4JI2B 4F6RB 4QPKA 3E8GA 2JDIG 5L3FA 5CBFA 2JGDB 3VQXA 3AG7A 2DQ0A 2IJKA 2JGUA 3E8HA 3CCSV 4CH4A 4PA6A 3FB8C 1F51A 4ZI7A 4X20A 2JGDA 2F23A 1LUWA 4O2AB 5B3SC 3W7WA 2F4VO 5FNVB 4IIJA 2ZINA 1QLEC 1PD3A 4PA9A 3R65A 5B3SB 4FLYA 5LMNO 4MVRA 4IGGA 1K3EA 2XHBA 4JI3O 3CMEV 3SJCC 4AILC 2DJVA 3J7AU 4JI0B 2Z5UA 2VQEO 4WFHA 2X6BA 1S72V 5L3EA 2ZM6O 5L3CA 4CS3A 3RYFB 5KHJA 4FPPA 1JFFA 4NR1A 2MW2B 5GW7A 4GX5A 2N04A 4JI6O 2W6JG 4R6ZA 4L8JA 2R9RB 1XBLA 2LQTA 5LP6C 2HJFC 3U0ZA 3VBBA 2EIKB 5EBMC 2Y0PA 4HZ3A 1CXZB 4YJ3B 2UXBO 3SJBC 2P06A 2YIBD 3G6BA 2D2CB 1SA0B 4KHPB 1PL0A 3Q4HA 1EN6A 3JD1A 5C8YA 5B1BC 1NI8A 2IJIA 4X88A 3DSQA 1COWG 5CMUA 4K0KO 1SQPH 1FXKA 1FPOA 2IH1C 2MK3A 4J42A 4LC1A 1GRJA 2L6LA 3UQ8A 4X65B 2Y69B 4HYOA 1D5NA 1XEQA 3CP1A 1OJHA 4ZHQB 5K1XA 3HKDB 5H6QA 1AVMA 2ILMA 1VQKV 4C7UA 1GKFA 5EBLC 1I7FA 1R3KC 5BXZA 2V7QG 4WF9V 1NVPB 4KHPO 1KQSU 2Q6AA 5JH7B 4OPAA 5J2TA 4LCUC 5L3GA 4KUMA 4MVSA 2IJHA 3OT7A 4JYCA 3CD6V 2Q68A 3E8FA 2OCCB 3A0RA 3B8NA 1PP9H 5LXTA 5LL6Y 2B5UA 5JVDB 4OX9O 4KXRA 1URFA 4DR3B 5EYPB 3F5TA 1Q6HA 4J11A 4AHCA 3L75H 1WAZA 4J41A 2RNBA 3CYOA 1QNMA 4ASUG 4PA7A 4FFBA 3CC2V 3OM3B 2DN9A 3ETQA 1I5XA 3KCYA 2P4VA 1N32B 4ZKIA 5B1AC 5CN0A 1YSCA 4X20B 2WPDG 3B40A 2GDSA 1TGOA 1IBLO 4YY3O 3BABA 3N2KA 4EEQA 1HP8A 4DUYB 3E22B 1GK9A 4J10A 2ITDC 3RGBA 1RM1C 2OYQA 2JEUA 3G67A 4YHHO 4X1YB 2QKAA 1V55C 5FNVA 2VS0A 1KECA 3ZN1A 1I08A 3B09A 4JI5O 1R6KA 5IWAB 2XTAA 1WPXA 3SPCA 2LGWA 2QEXV 3A0BZ 2YDEA 4GLXA 1H2SB 2RMKB 4E2LA 3SYPA 3G6EV 2IH3C 1X4TA 2PF4E 1XREA 1US6A 5KX5B 4NXNO 3CCVV 2QA4V 5KHHA 2WA4A 3MHHC 4X66B 4DR1B 3CRRA 3ZBHA 4PA4A 2ZQMA 5LGUA 4X1KA 3CC7V 3JAKA 1OCCC 4DV5B 4JI3B 3OMNB 3HR0A 3D36A 1SC5B 3JARA 1PM9A 1IXBA 4D6TH 4FLZA 4QE7A 5EZYB 3M8AA 4DV6O 4MTXA 5FLXN 4MTFA 1EN4A 3K9AA 1NTKH 3RVYA 2W0XA 2PYJA 4XBFA 1S76D 3JD2A 1N36O 3TGUH 1B3QA 2LP7A 4JYAB 2VQEB 4J9YB 2KB1A 2ITCC 2WLJA 4LF4B 4NXNB 4DV2O 1Q7YW 4F6RA 2R9AA 1AI4A 1VQ4V 4B3RB 2Y48A 3AG2B 3OTOO 1M4UA 1YJNV 1TUEB 4DV5O 2CUGA 1ZUQA 2G38A 3JCUZ 2LO1A 1OCZB 4QPJA 2CTRA 3FX7A 1QR9A 2A7WA 5E79Z 3CB2A 1I94B 2CTWA 1IVSA 1LUVA 2EJ7A 5J2TB 1FFTB 1R3JC 3HKBB 4DR2O 2E5LB 2HHHB 2LGQA 3VQWA 3UCSC 3OUSA 4UVCA 2YICA 4DV2B 3T1HB 2EIKC 3EVKA 1N34O 4I4TA 3QNEA 1ORQC 3CC4V 3BVOA 1SETA 1GTOA 1J95A 5D5PA 2AZ0A 2UXXA 1P7GA 3RVZA 3L70H 1QR8A 4TWKA 1J5EB 2EULA 3B77A 1PL4A 1HNZO 2JK5C 3N2KB 1IBKO 1XILA 4JI7B 5EC1C 5H2FZ 1IXMA 4RUEA 4JGSA 5KUMA 2YI8A 1AROP 1K9MW 5A2QN 2ZT9B 2CTQA 5IYDO 2ZE7A 4UVBA 2X7RB 3R66A 2UXNA 1FXKC 1VQ5V 1R3IC 4D7TA 3UM7A 3BA9A 3JASA 4PA3A 4LF7O 1VQ7V 2EBOA 4LF5B 4EB6A 4G27B 1XL6A 2BSKA 5LBQA 2B1IA 2JJ2G 5JQGB 1GN4A 1TUBB 2Q0AA 3ETGA 2NR5A 3HB3B 4O4JB 3TK1A 1NKDA 3W7UA 2OCHA 4Z2WA 4I0XB 4PDRA 4JTDB 4DV4O 4JPRA 4GZRB 3PJSK 3BPZA 1K5SA 3KG2A 2CK3G 2HVKC 1Q82W 1SERA 5IJ9B 2CGNA 5KA5A 5LGNA 3OTOB 5ITZB 3D3QA 1Y76A 1FXVA 3SR2C 4ZIBA 3CSXA 3QF7A 2OTLV 4LF5O 2UUBB 4TUYB 4FLUA 1E1RG 3ZIAG 4DK1A 1FXKB 1PV0A 4MW3A 1PNLA 1CPYA 2Q5ZA 4X64B 2A3QA 4DUYO 1FYJA 4J7KA 1BL8A 4KFMA 3CJHA 3CCEV 5KX5A 3ASOC 1M90W 2XASA 1B04A 3H1KH 3U11A 1KYOF 3RYCA 1Y74A 4FLVA 1Y66A 3KZIZ 2P67A 2EINB 1MA1A 3RYCB 1VF5B 2DYSC 3N27A 3GB7C 1UFIA 2PI5A 4Z1VA 4YJ2A 4X1YA 3FAVB 3E8BA 3HKEB 2DWDC 5KMGB 3CCLV 2QSAA 4H13B 4OPHA 2DOSA 1BGYH 2CDYA 1VQ6V 2XAHA 4DV3B 1FFXA 2X6AA 2QDOA 2Q9LA 4X1IA 2ZIOA 5IYZA 4UV9A 5EIBC 4B3MB 3AG3C 4GX0A 1NBMG 3L71H 2WLLB 4JYBA 1XOUA 3T1YO 1R1BA 5DEDA 2C2AA 4NVPA 3A2FA 2DQ3A 2HR3A 3VOUA 2UUCO 1S77D 2Z3YA 2QWNB 3K0DA 4GUNA 2JVDA 2F93B 1Q43A 1VF6A 3AG4B 5B66Z 3IFXA 3S3XA 5D5QA 1E79G 2KKWA 2QKCA 1VQMV 4TQDA 2EILC 4X65O 3T1HO 4FZ0A 1XQ8A 4UCVA 4CH6A 5LMNB 4I7ZB 4DR2B 2E5LO 4MW8A 3W7SA 1D2DA 3IAYA 1G4YB 1NH2B 2YSUB 4F6EA 4JV5B 1XMOB 1JA8A 3E83A 2PYLA 3A8TA 4OGQB 1RPRA 3MDSA 2LFRA 3SJAC 2FMLA 1U96A 3WB0A 4YJ3A 1S3JA 3FFQA 2E76B 5EC2C 4ZBMA 3WG7C 1OHHG 1KUQA 1N4CA 5CA0A 4AI8A 2WLKA 3EXAA 2XOKG 1L1FA 2FL4A 3H9VA 2B1GA 1QBZA 3JAWB 1VQPV 1YXBA 2CE4A 2CH7B 3HKEA 4LF9O 5KMGA 5H9CA 5KLVH 2LW1A 3Q4HB 1AP6A 1XUQA 3P30A 4O4IA 3FKSG 2IU0A 3JAMN 2UXCO 3ZHQA 3IC7A 3ZRVA 2Y4TA 2YEVA 1MMMA 4ZHQA 2RCVA 5CA1A 2QM7A 3I55V 2QJ1A 1O9GA 2ZE8A 1DLBA 4XDLA 4K8XA 2GV9A 2XAFA 4DV4B 2GUZA 2ZXWB 2JJ1G 3ZMVA 2HJDA 4H44B 3RT3C 3T4ZA 3H1IH 4I55A 3RYIB 2CGOA 1OCZC 4U3JB 1BHBA 3X2QC 3CRAA 3SYOA 1VMGA 2DWEC 2PY5A 2F66C 4JZ2A 2ZKOA 2DYSB 4MT8A 1HR0O 3K5NA 2K1EA 5BMVA 3GVMA 4LFBB 5KUKA 3JD4A 1TVKA 4WFFA 1SESA 3OW2U 1NQTA 1VQ8V 4B3SO 1K8AW 1X59A 3MHSC 4JI7O 1FFXB 1M93A 3RN4A 1MZEA 2Q7EA 3RW0A 3APOA 3EFFK 5TISZ 3DXRB 1RSOA 3CCJV 3BAAA 3D36C 1VQNV 4DV7B 2QWPB 2ZDIC 3BCCH 3AEIA 2Y0IA 4X89A 2CH7A 1NS1A 4GKKB 2BE3A 1BSMA 4GKJB 1H8EG 2OWOA 3LSQA 4R7CA 1YZBA 5HFMA 1PNKA 2ZR2A 1Q6UA 2VRZA 2YXLA 4BIOA 1W59A 2P4KA 4IT5A 3K57A 4DO2A 1AB3A 1DK1A 1H2LA 5BR8O 3K58A 3RWRD 1AR1B 1I94O 4LWSA 4X1KB 4N23A 5LYJA 2CTPA 2AHZA 4ZOLA 3AG1C 3DTUB 4PD4F 3K59A 1RFYA 3ABMB 4CBCA 4HBNA 2BTQA 3JAWA 3GWKC 3AG1B 2WAMA 1UJWB 3P3NA 1TAEA 5F2VO 4PHZA 1N32O 1G1XB 1F4NA 2ZDIA 1VF6C 3CEIA 4X64O 1FXHA 5CB4A 2BTQB 1JJ2U 3JYCA 2VQFO 1ZLZA 4R8CA 1BS3A 3BFRA 3APQA 1AI6A 5LP6B 1NJIW 2VWJA 3SJQC 1Y76B 4U7NA 3JATA 1XHZA 4JI4O 4PV1B 4PDMA 3JSLA 2RQ6A 1IBMO 2FKXA 1JQ0A 1HNWO 1YHQV 3ABKC 4UCSA 1YJWV 4KL1A 3J81N 3BRCA 4NYKA 2YUAA 2BCCH 1FJGO 1M57C 1Z5VA 3CCQV 4DYLA 3TETA 3FYIB 2F43G 3W7TA 2WLIB 3H01A 4KP4A 3RYHA 4WBNA 3CJHB 1M56B 5LMUO 2UU9O 1OCOB 3LUTB 5DN6G 2YXHA 3CMAV 2EZPA 2FTKA 2BOBC 2JEXA 1BMFG 4K3AA 4MVZA 4J9ZB 3ML0A 5LGTA 1XMOO 4PELA 4JF3A 1HDJA 4UUJC 1HWYA 4PDVA 1ZWIC 2DW4A 3HKCB 4O2BB 2HFEC 2EIJC 3ZX6A 4WFBV 3OAAG 1PPJH 1MG1A 1S5HC 2FB5A 1R6NA 1TVKB 4GKJO 3STLC 1K73W 1BZKA 4WFEA 1VIBA 1AJNA 2GUZB 1KMIZ 4FFBB 1B6QA 2ZD9A 1RPOA 3LSSA 1T5EA 4U3JA 1W2BU 4EFEA 4DUZB 1HNZB 1UPGA 3CHXA 3ZJZA 5LHGA 3ZHSA 1G6UA 2KQXA 2WWWA 5C8YB 2QKSA 3SDLA 1P49A 5LP6A 1MNGA 3ABUA 1WPBA 1YITV 5B1AB 3K08A 1QCEA 3ASOB 2Z0AA 1NTMH 4DV1B 1HNXB 5LA6B 1H2NA 3CPWU 2PI4A 4X9QA 4IYHA 1K92A 2LW7A 4EFBA 4P9OA 1WLEA 1NH2D 3B8MA 1Y6XA 5JCOA 3TXSA 5J9PC 2DE0X 1I5YA 4LF7B 1AJPA 4L87A 1EFRG 1AP5A 2EX3A 3ETDA 3K5LA 3T1YB 2EJRA 4DRXA 1WJZA 1NVPD 3L9DA 4JAVA 3ZMTA 2XAJA 5IJ9A 4TV8B 5IWAO 2YIBA 2Q67A 4YXWG 4MS2A 3C3SA 4I9QA 2NN4A 4R50A 5J2UA 4NTWA 2E3CA 2OIEA 4WFGA 1SQFA 1B06A 3D8CA 4I9WA 1IX9A 2EIMB 5LXTB 1K33A 4B3MO 4CH3A 2L35A 1XMQO 3SPHA 1M5IA 3ASNB 1R73A 2QTSA 4FFKA 4W4LA 2EIMC 5EZYA 4DR6B 3AG4C 1CP9A 3T1CA 1BE3H 1H2KA 1GN2A 2UUAO 5IYZB 1EZJA 4ABMA 3JATB 3HPLC 3TCUA 4DR7O 3K04A 4QJFB 3RYHB 2P6JA 2AHYA 1MSDA 3U10A 3C3TA 4O4LB 4QGPA 1GN3A 4LFCB 2HEPA 1QQCA 1IBLB 5B1BB 2YC0A 2JRIA 3RYIA 1RM1B 1ZSPA 4O2AA 4GX2A 4LNUA 4CC5A 4LF4O 5GTHZ 4RO2A 2ZNIA 4DXWA 4K0KB 1BCCH 3UO3A 5BY1A 2B9ZA 1WA8B 2EILB 3SPGA 3TJTA 4DK0A 3ZMSA 4DR6O 3UT5B 4I50B 3FAVA 5IJ0B 3OMIB 3IGAC 3F7VC 3CE2A 3WB2A 4TV9A 1YJ9V 4JI2O 5E1AC 1I0HA 2QWOB 2ODMA 1N33B 4FM2A 2UXDO 5IE9A 4B3TB 3O65A 4CS2A 1SS3A 1ZAUA 1ZL8A 4ZOLB 3K79A 3S3WA 2D3OW 4I0XA 2XUMA 4X62B 2V4DA 4JI4B 4FK5C 3GWOA 1LR1A 4GT1A 1ROPA 2PZSA 1HNWB 1XHXA 4GYCB 2IW5A 3ZS8C 1SA0A 4YY3B 1DF5A 1SKVA 2BTOA 1NU1H 5KHGA 2E74B 2KG7B 4NB5A 1JCHA 3K0GA 4LBEC 4H33A 5CA1B 3G4SV 3M7MX 2ZCEA 4UCOA 1R3LC 4JAAA 3AK2A 4UB6Z 3CCRV 2ZE5A 2A79B 3PN1A 1SRYA 4FZ1A 4LFAO 3DC6A 5BR8B 1YDXA 2Q0OC 1Q3EA 4HNAA 4MVMA 1OCRC 4AQYB 1IURA 4LFBO 3ICXA 3AK1A 4B3RO 1JOYA 1GMGA 2HP8A 3HKDA 2F95B 4JI8B 4HNAB 3LDCA 1F4MA 2QWRB 1A32A 1GH6A 2ZM6B 1SQQH 4IHJA 1Y67A 1XNRO 3DC5A 2OCCC 1H38A 5LA6A 3RYFA 5IDJA 4OX9B 3KCXA 4J7ZA 2UXCB 1N0JA 2AXTZ 2VWKA 3JASB 2WLMA 4BW9A 5BMVB 4LF8O 3CS5A 3W7XA 1KC8W 4B7KA 4DRXB 3FB5C 3G71V 1GN6A 2Y69C 5KAIZ 1OCOC 2V1DA 4UCRA 5J2UB 4MVOA 4K35A 2A0LA 1U97A 1AI5A 3THOA 1AJQA 4DR3O 4PJ0Z 4DR5O 4NKGB 3LNNA 4BR6A 3QO5A 2RN9A 3JALB 2UUAB 2OIGA 2N05A 4LH7A 4QNHB 4Q20A 3RBZA 2ZNJA 5EYPA 4I5SA 1SZXA 4TUYA 4LF9B 1RSOB 3IC9A 2EIJB 1WP8A 5JWPA 1P4RA 3OEHG 4FM0A 4UCUA 2LJ2A 1MABG 4GCZA 4BW5A 1SZTA 2H94A 1VQ9V 1K5QA 4X1IB 5EIBD 3CCMV 2YS8A 3K5MA 3NR7A 1L0NH 5JQGA 2PUSA 2A06H 3ABMC 3JCZA 1OZ0A 2QM4A 1SQBH 5BZBA 3ABKB 3IJ4A 3VQVA 3CX5F 4NXMB 4LF6B 5ITZA 2YI9A 3JAKB 4JAUA 4H37A 3OGCC 4IL6Z 1QHTA 1K4CC 4I50A 3B4SA 4JYAO 3JARB 3ETEA 2Q7GA 3OEEG 1LNQA 4BAYA 4B08A 4ICGA 4DV1O 3B2EE 1GO3F 3OUFA 3P32A 4JI8O 3L72H 1IBKB 3CXCU 4DR4O 1L0LH 1NZ6A 1AI7A 4J7JA 1YTFD 4X66O 4MSWC 1YF2A 1JX9A 2H8PC 5KHIA 1GM7A 1DGSA 3K9SA 4JZGA 1DF4A 3OGIB 2WLIA 4MTGA 4G2KA 5B5EZ 4LF6O 4TV8A 3CWBH 3QO8A 1K34A 1F23A 3K3WA 3O9OA 1YVWA 1MZFA 1ZTEA 4NTYA 5L3BA 5HFLA 1YCIA 5CBHA 3G80A 3UT5A 3BHPA 5EK0A 4MVUA 4B3TO 4LFCO 1MSWD 1M9NA 1N34B 2W6IG 3ABLC 1JPXA 2KG7A 4DR4B 3K5OA 4A5UB 2ATKC 1KP2A 2DMXA 4IHJB 1XL4A 3ABTA 1IBMB 1WB8A 1K4DC 4JI1O 1V54B 5JJNB 4X62O 4LH6A 3OTFA 1QVFU 2OT5A 1EN5A 3H1HH 2K9PA 2GSMB 1V54C 3QVNA 2W0FC 2QTOA 4BWAA 1TA8A 4DR7B 2PGGA 5LHIA 4MTOA 1WN7A 4UV8A 1N33O 5H5NA 5B1OA 3P3PA 3KKYA 4CZZA 2UUBO 4MVQA 1Y4MA 2NNUA 4J80A 1CEZA 2EZOA 2NLJC 3ZMUA 5FPOA 2P7TC 3ZRWB 4E4EA 2CAZC 3MAQA 1Q86W 2EINC 2GBOA 1RP3B 2GTSA 1GM8A 1EM1A 4HAMA 5GONA 1AR5A 4O4HB 4LWSB 5CA3A 4CS4A 5FPRA 2E75B 4P2ZA 1ENVA 1PKXA 4LP8A 5GONB 1BT8A 3VQYA 4UVAA 1KB9F 1PNMA 1O9HA 2IJJA 3ZRXA 1VARA 1KBHA 1NTZH 1NT2B 4TT3G 4X8AA 3SYCA 3CRMA 1QVGU 3T4DA 5GTIZ 2XAQA 2HHHO 4FLTA 4UFZA 1WP7A 1AILA 2M6YA 1OCCB 4U3FH 4N21A 3LSUA 3OR7C 5LOVB 5LMUB 2UU9B 3RFRA 5IY5C 4FVMA 4LF8B 3OD4A 4K8ZA 2XT9A 1H2GA 4PDLA 2BOCC 4XDKA 1KU9A 3FB7C 1J5EO 1IZ3A 3JD3A 4Q6GA 4JI0O 5A9GA 4PI2A 5JVDA 2DYRB 3H1LH 1XNQB 4W4KA 4I55B 2XAGA 5KAFZ 1V55B 1JVMA 2ZIMA 2QE7G 4DV0B 1VQLV 1Q5OA 1KP3A 2ADPA 1SF9A 1Q8IA 1YTFB 4RWUA 1V9PA 4B7EA 2ADQB 2HVJC 4YHHB 1HR0B 1WA8A 2R72A 2Y4UA 1P7BA 5B1NA 3SPIA 1L8DA 5IJ0A 3E22A 1YEWA 2QGNA 3CRQA 1EZVH 4Z1MG 3ABLB 3JD0A 4RQEA 1QLNA 4RQFA 1S5JA 2Q4PA 3QO7A 4FMTA 1GAXA 2UUCB 3SYAA 2M7WA 4DV7O 1H2MA 1OV9A 4P9PA 1W0JG 1KKDA 1VF7A 4JASA 3DGEA 3L74H 2AZ2A 5IT9N 4WCEV 3BY6A 3LNMB 1N0NA 4ZI7B 2O57A 3BA8A 3D3IA 4FLWA 3LDDA 5LOVA 2GTAA 5K1PA 2X6CA 2ZXWC 1MOFA 2JIZG 4JTCB 4IIJB 4LNUB 3ZHTA 4UCTA 5CB4B 2YIAA 3SYQA 2JS3A 3AG2C 4FLXA 3AK3A 1M56C 4LR3A 3N2GB 4JI1B 4FJCC 3OR6C 4D7SA 3H1JH 4LFAB 1M1KW 4DR5B 1SQVH 3CXHF 4YIPA 3MD0A 4DW0A 5IYCO 4GX1A 2F1MA 2ZR3A 4P30A 2UXBB 3SPJA 4JV5O 4UXNA 3A0HZ 2FYUH 3F7YC 3QG5A 3HKCA 4O2BA 2WSSG 4U7OA 3STZC 3E35A 2N74A 3TXQA 1K7DA 2IU3A 5LYJB 3E2EA 3J80N 1JJOA 3OFNG 3AG3B 3ZEDA 4CH5A 2WA3A 3WG7B 3OMAB 5DECA 5FL7G 2QM8A 4DV3O 3BEHA 4JI6B 2JS5A 2VQFB 3UO2A 2PTMA 1Z5WA 3OE7G 2OTJV 1KKCA 3HKBA 4NXMO 5KHKA 1N8RW
chains in the Genus database with same CATH topology
3D36A 1VQOV 3W7XA 1KC8W 2ZDIC 4WFAV 4TSFG 3AEIA 3FB5C 4QE7A 4X89A 3ZCCA 2WLLA 4MTXA 4MTFA 4RUFA 3K9AA 1H8EG 3G71V 3RVYA 2Y69C 3T2MA 3LSQA 3WFVA 4R7CA 4XBFA 1S76D 3JD2A 1OCOC 2HG5C 4BIZA 2V1DA 5HFMA 2GHYA 2LP7A 1PNKA 1YI2V 2ZR2A 4QE9A 1EBOA 4MVOA 2A0LA 5DM6V 1AI5A 4J9YB 5H6RA 2KB1A 2ITCC 5LHHA 2A9HA 1AJQA 2WLJA 1Q7YW 3K03A 1AI4A 5L3DA 1VQ4V 3E86A 2Y48A 3AG2B 3QO5A 4DO2A 1YJNV 4BIUA 1TUEB 4QNHB 4Q20A 3RBZA 2WLNA 1AR1B 4I5SA 1OCZB 2EIJB 4N23A 3E89A 4QPJA 1P4RA 2AHZA 3OEHG 3AG1C 1E1QG 3DTUB 1OCRB 3F5WC 1QR9A 1MABG 4GCZA 3ZN0A 3K06A 4BW5A 1SZTA 2H94A 3ABMB 1VQ9V 2X0LA 4CBCA 3EHBB 1K5QA 5EBWC 3AG1B 4XDJA 2WAMA 1UJWB 4FIPC 3CCMV 1FFTB 1R3JC 1H8HG 3UKMA 2R9IA 2ZDIA 1F4NA 3OUSA 1W0KG 1FXHA 5KA6A 3ABMC 3JCZA 4UVCA 1JJ2U 2LFSA 3JYCA 3ASNC 1YIJV 2EIKC 1OZ0A 4R8CA 5BZBA 3ABKB 1AI6A 5IY5B 1NJIW 3SJQC 1S0VA 3QNEA 1ORQC 4U7NA 3CC4V 1FS0G 1SETA 1GTOA 1J95A 4JAUA 3ZRSA 4PDMA 4H37A 3OGCC 1NR7A 2UXXA 1JQ0A 1K4CC 1M57B 1YHQV 1BHAA 1THZA 3RVZA 1QR8A 4TWKA 3ABKC 1YJWV 3ETEA 2WLHA 3B77A 4QIWF 3OEEG 2DYRC 1G8MA 2JK5C 1LNQA 4BAYA 1M57C 3X2QB 5EC1C 3CCQV 1IXMA 4RUEA 3TETA 4JGSA 5KUMA 3FYIB 3ZRWA 1GO3F 2F43G 3OUFA 3P32A 3W7TA 2WLIB 3H01A 4KP4A 1AROP 4OXSA 1K9MW 1KD1W 1M56B 3FB6C 3CXCU 5IYDO 1OCOB 4UVBA 3LUTB 5DN6G 1AI7A 1YTFD 2X7RB 5IYBO 3CMAV 1QLEB 4MSWC 1JX9A 2EZPA 2FTKA 2H8PC 2UXNA 1GM7A 2BOBC 1FXKC 1DF4A 2JEXA 1BMFG 1Q81W 1VQ5V 1R3IC 2WLIA 4MTGA 4G2KA 4MVZA 1DTOA 4RAIA 2P90A 3ML0A 4J9ZB 5LGTA 4PELA 4JF3A 3UM7A 3QO8A 1K34A 4UUJC 4PA3A 1F23A 3K3WA 1HWYA 1VQ7V 2EBOA 4PDVA 3ZMZA 3LDEA 1ZWIC 2HLDG 4JTAB 5L3BA 2DW4A 5HFLA 4G27B 1XL6A 2HFEC 5CBHA 2EIJC 3I56V 4G28B 4WFBV 3CCUV 5EK0A 2HKOA 4MVUA 4EKWA 3OAAG 2Q69A 5LBQA 1MG1A 1S5HC 1MSWD 2B1IA 1M9NA 1R6NA 2JJ2G 3NXSA 2XNDG 2W6IG 3M99B 3ABLC 3ETGA 3STLC 1NR1A 1K97A 3HB3B 1K73W 1JPXA 3TK1A 1NKDA 4WFEA 3W7UA 1AJNA 1KP2A 2ATKC 1GM9A 1XL4A 3ABTA 4PDRA 4JTDB 4JPRA 1K4DC 4F4LA 1B6QA 1V54B 3KG2A 1K5SA 3PJSK 2CK3G 2HVKC 2ZD9A 1Q82W 1SERA 1RPOA 3FYEB 3LSSA 1W2BU 1QVFU 5KA5A 2OT5A 5LGNA 3ZJZA 5CBGA 2GSMB 5C93A 5LHGA 1V54C 2WWWA 2W0FC 2QTOA 2QKSA 2YEVB 1FXVA 3ABUA 2OTLV 5LHIA 4MTOA 1YITV 1E1RG 4QPKA 3E8GA 5B1AB 2JDIG 4UV8A 3ZIAG 5CBFA 3K08A 1QCEA 5L3FA 1FXKB 3ASOB 5B1OA 2DQ0A 2IJKA 4CZZA 3CCSV 3E8HA 4MW3A 4MVQA 3CPWU 1Y4MA 2NNUA 2PI4A 1PNLA 1CPYA 1K92A 2EZOA 1CEZA 4PA6A 3FB8C 2NLJC 1F51A 4P9OA 3ZMUA 2P7TC 3ZRWB 1WLEA 1BL8A 1Q86W 4KFMA 2EINC 5B3SC 3W7WA 1NH2D 3CCEV 3B8MA 3ASOC 5J9PC 1I5YA 1M90W 2XASA 1AJPA 1QLEC 4L87A 1PD3A 1GM8A 1EFRG 3ETDA 4HAMA 4PA9A 2EJRA 1Y66A 2P67A 3R65A 2EINB 5B3SB 1NVPD 5CA3A 4MVRA 1K3EA 4JAVA 3ZMTA 3CMEV 2XAJA 2DYSC 4P2ZA 1ENVA 1PKXA 3GB7C 4LP8A 2PI5A 2Q67A 4YXWG 4UVAA 2Z5UA 4MS2A 4WFHA 2X6BA 1PNMA 1S72V 3E8BA 4R50A 2DWDC 5L3EA 5L3CA 2IJJA 3ZRXA 3CCLV 4TT3G 4X8AA 4WFGA 3SYCA 1QVGU 4FPPA 3T4DA 2XAQA 4I9WA 5GW7A 4GX5A 2EIMB 1K33A 1VQ6V 2XAHA 2X6AA 3SPHA 3ASNB 1R73A 1OCCB 2W6JG 4N21A 4UV9A 4R6ZA 3OR7C 2R9RB 2HJFC 3AG3C 2EIMC 4GX0A 1NBMG 3VBBA 2EIKB 2WLLB 4JYBA 5EBMC 3AG4C 1CP9A 4HZ3A 3T1CA 5IY5C 2C2AA 1H2GA 4PDLA 2BOCC 2DQ3A 2HR3A 4XDKA 1EZJA 3VOUA 1S77D 3FB7C 2Z3YA 3HPLC 3JD3A 1PL0A 3K0DA 3TCUA 3JD1A 3K04A 4QJFB 5B1BC 2P6JA 3AG4B 2AHYA 3IFXA 2IJIA 1E79G 4X88A 2DYRB 1VQMV 1COWG 5CMUA 2EILC 5B1BB 1RM1B 1FXKA 2IH1C 4GX2A 2MK3A 2XAGA 4LC1A 1V55B 1JVMA 4RO2A 4DXWA 2Y69B 4MW8A 3W7SA 4HYOA 1G4YB 1NH2B 2YSUB 2QE7G 3CP1A 2EILB 1VQLV 3SPGA 3ZMSA 1KP3A 5H6QA 3E83A 1VQKV 1YTFB 1GKFA 5EBLC 1R3KC 3OMIB 3IGAC 1RPRA 2HVJC 3F7VC 2LFRA 2V7QG 4WF9V 1NVPB 1YJ9V 1KQSU 1S3JA 2Q6AA 5E1AC 4LCUC 5L3GA 1P7BA 5B1NA 3SPIA 5EC2C 4KUMA 4MVSA 4ZBMA 2IJHA 1OHHG 3WG7C 4JYCA 3CD6V 3E8FA 2Q68A 2OCCB 3A0RA 3B8NA 4Z1MG 2WLKA 3ABLB 2XOKG 3K79A 1L1FA 3JD0A 2D3OW 4RQEA 2B1GA 1QBZA 1QLNA 2B5UA 4RQFA 1VQPV 3QO7A 4FMTA 5H9CA 3SYAA 3CYOA 2M7WA 1KKDA 4P9PA 1W0JG 3P30A 4FK5C 3GWOA 3FKSG 4JASA 4PA7A 2IU0A 4ASUG 3DGEA 4GT1A 1ROPA 3IC7A 3ZRVA 3CC2V 2YEVA 3OM3B 4WCEV 1I5XA 3BY6A 3LNMB 2IW5A 3D3IA 3LDDA 2QM7A 2X6CA 4ZKIA 1DF5A 2ZXWC 5B1AC 3I55V 5CN0A 1YSCA 1MOFA 2JIZG 4JTCB 1DLBA 4XDLA 2WPDG 3SYQA 2XAFA 3AG2C 1M56C 1JCHA 3K0GA 4LBEC 4H33A 2ZXWB 2JJ1G 4FJCC 3G4SV 3OR6C 3ZMVA 1R3LC 1GK9A 1M1KW 2ITDC 1RM1C 2JEUA 3T4ZA 3MD0A 5IYCO 4GX1A 3CCRV 2A79B 2ZR3A 1OCZC 1SRYA 4P30A 1BHBA 3X2QC 3SPJA 4MVMA 1V55C 4UXNA 1OCRC 3F7YC 3SYOA 2DWEC 2WSSG 4U7OA 3STZC 1JOYA 1GMGA 1KECA 3E35A 3ZN1A 1K7DA 2DYSB 4MT8A 2IU3A 1R6KA 2K1EA 3LDCA 1F4MA 3E2EA 5KUKA 3JD4A 3OFNG 1SESA 4WFFA 1WPXA 3AG3B 3OW2U 1NQTA 3SPCA 1VQ8V 1K8AW 3MHSC 2QEXV 3WG7B 3OMAB 5FL7G 4E2LA 2QM8A 2OCCC 2IH3C 3SYPA 3G6EV 1H38A 3BEHA 5IDJA 3RW0A 3CCVV 2QA4V 3EFFK 3MHHC 3OE7G 2OTJV 4PA4A 2ZQMA 5LGUA 2WLMA 3CC7V 3CCJV 1OCCC 1VQNV 3OMNB 1N8RW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI W;  3CC2 V;  3OW2 U;  1VQ7 V;  1VQO V;  1VQ8 V;  1VQ6 V;  1KC8 W;  4WCE V;  4WFA V;  1VQL V;  1K8A W;  1K9M W;  2QEX V;  3CCR V;  3CC4 V;  1KD1 W;  1Q7Y W;  1VQ9 V;  3CXC U;  3CD6 V;  2D3O W;  1VQK V;  3CME V;  3CCS V;  1R73 A;  1Q82 W;  1VQ4 V;  3CPW U;  3CMA V;  1VQM V;  3G6E V;  3I55 V;  3CCM V;  1YHQ V;  1YJN V;  1VQP V;  1W2B U;  3I56 V;  3G71 V;  1QVF U;  4WFB V;  3CCU V;  4WF9 V;  1Q81 W;  1YJW V;  3CCV V;  2QA4 V;  1YJ9 V;  1S72 V;  1KQS U;  1VQ5 V;  1Q86 W;  3CCE V;  3CCL V;  2OTJ V;  1M90 W;  1YI2 V;  1JJ2 U;  1K73 W;  3CC7 V;  3G4S V;  3CCJ V;  1YIJ V;  1QVG U;  3CCQ V;  1VQN V;  2OTL V;  1M1K W;  5DM6 V;  1YIT V;  1N8R W; 
#chains in the Genus database with same CATH topology
 4DR1 O;  1VQO V;  4WFA V;  4TSF G;  4O4H A;  3ZCC A;  4O4I B;  2WLL A;  3C90 A;  4RUF A;  4JYY A;  3T2M A;  3WFV A;  4YIO A;  3CRC A;  2HG5 C;  1JFF B;  4BIZ A;  2GHY A;  1YI2 V;  1Q90 D;  4QE9 A;  1EBO A;  4TOI A;  2KSD A;  4PI0 A;  5DM6 V;  5H6R A;  5LHH A;  2A9H A;  3QTC A;  4WBN B;  4AQY O;  5CA0 B;  3K03 A;  3JSN A;  5L3D A;  3E86 A;  5JH7 A;  4BIU A;  1BQ0 A;  2WLN A;  1Y74 B;  2RJZ A;  2ZE6 A;  1XI1 A;  3E89 A;  2ARH A;  1WB7 A;  3F5W C;  1E1Q G;  1OCR B;  3ZN0 A;  3K06 A;  1XNQ O;  2P5O A;  2X0L A;  3EHB B;  1N36 B;  4H0L B;  1SQX H;  3JAL A;  4XDJ A;  5EBW C;  1WNS A;  2F4V B;  4FIP C;  1ZL8 B;  1H8H G;  3UKM A;  2R9I A;  1Q6I A;  1W0K G;  2P22 C;  5KA6 A;  2LFS A;  3ASN C;  1YIJ V;  1TUB A;  2YID A;  5IY5 B;  1S0V A;  1VP7 A;  2IM9 A;  2R70 A;  1FS0 G;  3WU2 Z;  4DUZ O;  1FAF A;  3ZRS A;  1D5A A;  3SGI A;  1NR7 A;  1FKA O;  5JJE B;  1M57 B;  1BHA A;  1HW7 A;  1THZ A;  4DV6 B;  4UB8 Z;  2QWQ B;  3I5D A;  2WLH A;  4CC6 A;  4QIW F;  2DYR C;  3ZHU A;  1G8M A;  4O4J A;  3ZHV A;  2Q8V A;  3X2Q B;  4DW1 A;  1VEW A;  3ZRW A;  1QU7 A;  5JJJ B;  4OXS A;  2Q73 A;  5AG2 A;  2AW9 A;  1FJG B;  1KD1 W;  3WB1 A;  3FB6 C;  4EB6 B;  1XMQ B;  5IYB O;  1QLE B;  2BSK B;  1ZX3 A;  1XDC A;  1HNX O;  2Q7H A;  3N2G A;  1Q81 W;  1XNR B;  4TQF A;  1FD9 A;  1DTO A;  3ZHR A;  4RAI A;  2H3O A;  2P90 A;  3L73 H;  3DXR A;  1BQZ A;  1AR4 A;  1JMK C;  4O4L A;  5JCO C;  3ZMZ A;  3LDE A;  4JI5 B;  2HLD G;  4JTA B;  1Z2G A;  1S5L Z;  1F7Y A;  3FD9 A;  2YXY A;  4B3S B;  3I56 V;  4G28 B;  2UXD B;  3CCU V;  2RDC A;  2HKO A;  4EKW A;  2Q69 A;  3NXS A;  2AGA A;  4YJ2 B;  2XND G;  3M99 B;  1NR1 A;  1K97 A;  1R6T A;  1P84 F;  2IBZ H;  1GM9 A;  4IYI A;  1JR9 A;  4FM1 A;  2ETN A;  4F4L A;  1SQG A;  3FYE B;  4TV9 B;  4DV0 O;  4NTX A;  1IDS A;  5CBG A;  4I4T B;  5C93 A;  4GKK O;  2YEV B;  2QR4 A;  4JI2 B;  4F6R B;  4QPK A;  3E8G A;  2JDI G;  5L3F A;  5CBF A;  2JGD B;  3VQX A;  3AG7 A;  2DQ0 A;  2IJK A;  2JGU A;  3E8H A;  3CCS V;  4CH4 A;  4PA6 A;  3FB8 C;  1F51 A;  4ZI7 A;  4X20 A;  2JGD A;  2F23 A;  1LUW A;  4O2A B;  5B3S C;  3W7W A;  2F4V O;  5FNV B;  4IIJ A;  2ZIN A;  1QLE C;  1PD3 A;  4PA9 A;  3R65 A;  5B3S B;  4FLY A;  5LMN O;  4MVR A;  4IGG A;  1K3E A;  2XHB A;  4JI3 O;  3CME V;  3SJC C;  4AIL C;  2DJV A;  3J7A U;  4JI0 B;  2Z5U A;  2VQE O;  4WFH A;  2X6B A;  1S72 V;  5L3E A;  2ZM6 O;  5L3C A;  4CS3 A;  3RYF B;  5KHJ A;  4FPP A;  1JFF A;  4NR1 A;  2MW2 B;  5GW7 A;  4GX5 A;  2N04 A;  4JI6 O;  2W6J G;  4R6Z A;  4L8J A;  2R9R B;  1XBL A;  2LQT A;  5LP6 C;  2HJF C;  3U0Z A;  3VBB A;  2EIK B;  5EBM C;  2Y0P A;  4HZ3 A;  1CXZ B;  4YJ3 B;  2UXB O;  3SJB C;  2P06 A;  2YIB D;  3G6B A;  2D2C B;  1SA0 B;  4KHP B;  1PL0 A;  3Q4H A;  1EN6 A;  3JD1 A;  5C8Y A;  5B1B C;  1NI8 A;  2IJI A;  4X88 A;  3DSQ A;  1COW G;  5CMU A;  4K0K O;  1SQP H;  1FXK A;  1FPO A;  2IH1 C;  2MK3 A;  4J42 A;  4LC1 A;  1GRJ A;  2L6L A;  3UQ8 A;  4X65 B;  2Y69 B;  4HYO A;  1D5N A;  1XEQ A;  3CP1 A;  1OJH A;  4ZHQ B;  5K1X A;  3HKD B;  5H6Q A;  1AVM A;  2ILM A;  1VQK V;  4C7U A;  1GKF A;  5EBL C;  1I7F A;  1R3K C;  5BXZ A;  2V7Q G;  4WF9 V;  1NVP B;  4KHP O;  1KQS U;  2Q6A A;  5JH7 B;  4OPA A;  5J2T A;  4LCU C;  5L3G A;  4KUM A;  4MVS A;  2IJH A;  3OT7 A;  4JYC A;  3CD6 V;  2Q68 A;  3E8F A;  2OCC B;  3A0R A;  3B8N A;  1PP9 H;  5LXT A;  5LL6 Y;  2B5U A;  5JVD B;  4OX9 O;  4KXR A;  1URF A;  4DR3 B;  5EYP B;  3F5T A;  1Q6H A;  4J11 A;  4AHC A;  3L75 H;  1WAZ A;  4J41 A;  2RNB A;  3CYO A;  1QNM A;  4ASU G;  4PA7 A;  4FFB A;  3CC2 V;  3OM3 B;  2DN9 A;  3ETQ A;  1I5X A;  3KCY A;  2P4V A;  1N32 B;  4ZKI A;  5B1A C;  5CN0 A;  1YSC A;  4X20 B;  2WPD G;  3B40 A;  2GDS A;  1TGO A;  1IBL O;  4YY3 O;  3BAB A;  3N2K A;  4EEQ A;  1HP8 A;  4DUY B;  3E22 B;  1GK9 A;  4J10 A;  2ITD C;  3RGB A;  1RM1 C;  2OYQ A;  2JEU A;  3G67 A;  4YHH O;  4X1Y B;  2QKA A;  1V55 C;  5FNV A;  2VS0 A;  1KEC A;  3ZN1 A;  1I08 A;  3B09 A;  4JI5 O;  1R6K A;  5IWA B;  2XTA A;  1WPX A;  3SPC A;  2LGW A;  2QEX V;  3A0B Z;  2YDE A;  4GLX A;  1H2S B;  2RMK B;  4E2L A;  3SYP A;  3G6E V;  2IH3 C;  1X4T A;  2PF4 E;  1XRE A;  1US6 A;  5KX5 B;  4NXN O;  3CCV V;  2QA4 V;  5KHH A;  2WA4 A;  3MHH C;  4X66 B;  4DR1 B;  3CRR A;  3ZBH A;  4PA4 A;  2ZQM A;  5LGU A;  4X1K A;  3CC7 V;  3JAK A;  1OCC C;  4DV5 B;  4JI3 B;  3OMN B;  3HR0 A;  3D36 A;  1SC5 B;  3JAR A;  1PM9 A;  1IXB A;  4D6T H;  4FLZ A;  4QE7 A;  5EZY B;  3M8A A;  4DV6 O;  4MTX A;  5FLX N;  4MTF A;  1EN4 A;  3K9A A;  1NTK H;  3RVY A;  2W0X A;  2PYJ A;  4XBF A;  1S76 D;  3JD2 A;  1N36 O;  3TGU H;  1B3Q A;  2LP7 A;  4JYA B;  2VQE B;  4J9Y B;  2KB1 A;  2ITC C;  2WLJ A;  4LF4 B;  4NXN B;  4DV2 O;  1Q7Y W;  4F6R A;  2R9A A;  1AI4 A;  1VQ4 V;  4B3R B;  2Y48 A;  3AG2 B;  3OTO O;  1M4U A;  1YJN V;  1TUE B;  4DV5 O;  2CUG A;  1ZUQ A;  2G38 A;  3JCU Z;  2LO1 A;  1OCZ B;  4QPJ A;  2CTR A;  3FX7 A;  1QR9 A;  2A7W A;  5E79 Z;  3CB2 A;  1I94 B;  2CTW A;  1IVS A;  1LUV A;  2EJ7 A;  5J2T B;  1FFT B;  1R3J C;  3HKB B;  4DR2 O;  2E5L B;  2HHH B;  2LGQ A;  3VQW A;  3UCS C;  3OUS A;  4UVC A;  2YIC A;  4DV2 B;  3T1H B;  2EIK C;  3EVK A;  1N34 O;  4I4T A;  3QNE A;  1ORQ C;  3CC4 V;  3BVO A;  1SET A;  1GTO A;  1J95 A;  5D5P A;  2AZ0 A;  2UXX A;  1P7G A;  3RVZ A;  3L70 H;  1QR8 A;  4TWK A;  1J5E B;  2EUL A;  3B77 A;  1PL4 A;  1HNZ O;  2JK5 C;  3N2K B;  1IBK O;  1XIL A;  4JI7 B;  5EC1 C;  5H2F Z;  1IXM A;  4RUE A;  4JGS A;  5KUM A;  2YI8 A;  1ARO P;  1K9M W;  5A2Q N;  2ZT9 B;  2CTQ A;  5IYD O;  2ZE7 A;  4UVB A;  2X7R B;  3R66 A;  2UXN A;  1FXK C;  1VQ5 V;  1R3I C;  4D7T A;  3UM7 A;  3BA9 A;  3JAS A;  4PA3 A;  4LF7 O;  1VQ7 V;  2EBO A;  4LF5 B;  4EB6 A;  4G27 B;  1XL6 A;  2BSK A;  5LBQ A;  2B1I A;  2JJ2 G;  5JQG B;  1GN4 A;  1TUB B;  2Q0A A;  3ETG A;  2NR5 A;  3HB3 B;  4O4J B;  3TK1 A;  1NKD A;  3W7U A;  2OCH A;  4Z2W A;  4I0X B;  4PDR A;  4JTD B;  4DV4 O;  4JPR A;  4GZR B;  3PJS K;  3BPZ A;  1K5S A;  3KG2 A;  2CK3 G;  2HVK C;  1Q82 W;  1SER A;  5IJ9 B;  2CGN A;  5KA5 A;  5LGN A;  3OTO B;  5ITZ B;  3D3Q A;  1Y76 A;  1FXV A;  3SR2 C;  4ZIB A;  3CSX A;  3QF7 A;  2OTL V;  4LF5 O;  2UUB B;  4TUY B;  4FLU A;  1E1R G;  3ZIA G;  4DK1 A;  1FXK B;  1PV0 A;  4MW3 A;  1PNL A;  1CPY A;  2Q5Z A;  4X64 B;  2A3Q A;  4DUY O;  1FYJ A;  4J7K A;  1BL8 A;  4KFM A;  3CJH A;  3CCE V;  5KX5 A;  3ASO C;  1M90 W;  2XAS A;  1B04 A;  3H1K H;  3U11 A;  1KYO F;  3RYC A;  1Y74 A;  4FLV A;  1Y66 A;  3KZI Z;  2P67 A;  2EIN B;  1MA1 A;  3RYC B;  1VF5 B;  2DYS C;  3N27 A;  3GB7 C;  1UFI A;  2PI5 A;  4Z1V A;  4YJ2 A;  4X1Y A;  3FAV B;  3E8B A;  3HKE B;  2DWD C;  5KMG B;  3CCL V;  2QSA A;  4H13 B;  4OPH A;  2DOS A;  1BGY H;  2CDY A;  1VQ6 V;  2XAH A;  4DV3 B;  1FFX A;  2X6A A;  2QDO A;  2Q9L A;  4X1I A;  2ZIO A;  5IYZ A;  4UV9 A;  5EIB C;  4B3M B;  3AG3 C;  4GX0 A;  1NBM G;  3L71 H;  2WLL B;  4JYB A;  1XOU A;  3T1Y O;  1R1B A;  5DED A;  2C2A A;  4NVP A;  3A2F A;  2DQ3 A;  2HR3 A;  3VOU A;  2UUC O;  1S77 D;  2Z3Y A;  2QWN B;  3K0D A;  4GUN A;  2JVD A;  2F93 B;  1Q43 A;  1VF6 A;  3AG4 B;  5B66 Z;  3IFX A;  3S3X A;  5D5Q A;  1E79 G;  2KKW A;  2QKC A;  1VQM V;  4TQD A;  2EIL C;  4X65 O;  3T1H O;  4FZ0 A;  1XQ8 A;  4UCV A;  4CH6 A;  5LMN B;  4I7Z B;  4DR2 B;  2E5L O;  4MW8 A;  3W7S A;  1D2D A;  3IAY A;  1G4Y B;  1NH2 B;  2YSU B;  4F6E A;  4JV5 B;  1XMO B;  1JA8 A;  3E83 A;  2PYL A;  3A8T A;  4OGQ B;  1RPR A;  3MDS A;  2LFR A;  3SJA C;  2FML A;  1U96 A;  3WB0 A;  4YJ3 A;  1S3J A;  3FFQ A;  2E76 B;  5EC2 C;  4ZBM A;  3WG7 C;  1OHH G;  1KUQ A;  1N4C A;  5CA0 A;  4AI8 A;  2WLK A;  3EXA A;  2XOK G;  1L1F A;  2FL4 A;  3H9V A;  2B1G A;  1QBZ A;  3JAW B;  1VQP V;  1YXB A;  2CE4 A;  2CH7 B;  3HKE A;  4LF9 O;  5KMG A;  5H9C A;  5KLV H;  2LW1 A;  3Q4H B;  1AP6 A;  1XUQ A;  3P30 A;  4O4I A;  3FKS G;  2IU0 A;  3JAM N;  2UXC O;  3ZHQ A;  3IC7 A;  3ZRV A;  2Y4T A;  2YEV A;  1MMM A;  4ZHQ A;  2RCV A;  5CA1 A;  2QM7 A;  3I55 V;  2QJ1 A;  1O9G A;  2ZE8 A;  1DLB A;  4XDL A;  4K8X A;  2GV9 A;  2XAF A;  4DV4 B;  2GUZ A;  2ZXW B;  2JJ1 G;  3ZMV A;  2HJD A;  4H44 B;  3RT3 C;  3T4Z A;  3H1I H;  4I55 A;  3RYI B;  2CGO A;  1OCZ C;  4U3J B;  1BHB A;  3X2Q C;  3CRA A;  3SYO A;  1VMG A;  2DWE C;  2PY5 A;  2F66 C;  4JZ2 A;  2ZKO A;  2DYS B;  4MT8 A;  1HR0 O;  3K5N A;  2K1E A;  5BMV A;  3GVM A;  4LFB B;  5KUK A;  3JD4 A;  1TVK A;  4WFF A;  1SES A;  3OW2 U;  1NQT A;  1VQ8 V;  4B3S O;  1K8A W;  1X59 A;  3MHS C;  4JI7 O;  1FFX B;  1M93 A;  3RN4 A;  1MZE A;  2Q7E A;  3RW0 A;  3APO A;  3EFF K;  5TIS Z;  3DXR B;  1RSO A;  3CCJ V;  3BAA A;  3D36 C;  1VQN V;  4DV7 B;  2QWP B;  2ZDI C;  3BCC H;  3AEI A;  2Y0I A;  4X89 A;  2CH7 A;  1NS1 A;  4GKK B;  2BE3 A;  1BSM A;  4GKJ B;  1H8E G;  2OWO A;  3LSQ A;  4R7C A;  1YZB A;  5HFM A;  1PNK A;  2ZR2 A;  1Q6U A;  2VRZ A;  2YXL A;  4BIO A;  1W59 A;  2P4K A;  4IT5 A;  3K57 A;  4DO2 A;  1AB3 A;  1DK1 A;  1H2L A;  5BR8 O;  3K58 A;  3RWR D;  1AR1 B;  1I94 O;  4LWS A;  4X1K B;  4N23 A;  5LYJ A;  2CTP A;  2AHZ A;  4ZOL A;  3AG1 C;  3DTU B;  4PD4 F;  3K59 A;  1RFY A;  3ABM B;  4CBC A;  4HBN A;  2BTQ A;  3JAW A;  3GWK C;  3AG1 B;  2WAM A;  1UJW B;  3P3N A;  1TAE A;  5F2V O;  4PHZ A;  1N32 O;  1G1X B;  1F4N A;  2ZDI A;  1VF6 C;  3CEI A;  4X64 O;  1FXH A;  5CB4 A;  2BTQ B;  1JJ2 U;  3JYC A;  2VQF O;  1ZLZ A;  4R8C A;  1BS3 A;  3BFR A;  3APQ A;  1AI6 A;  5LP6 B;  1NJI W;  2VWJ A;  3SJQ C;  1Y76 B;  4U7N A;  3JAT A;  1XHZ A;  4JI4 O;  4PV1 B;  4PDM A;  3JSL A;  2RQ6 A;  1IBM O;  2FKX A;  1JQ0 A;  1HNW O;  1YHQ V;  3ABK C;  4UCS A;  1YJW V;  4KL1 A;  3J81 N;  3BRC A;  4NYK A;  2YUA A;  2BCC H;  1FJG O;  1M57 C;  1Z5V A;  3CCQ V;  4DYL A;  3TET A;  3FYI B;  2F43 G;  3W7T A;  2WLI B;  3H01 A;  4KP4 A;  3RYH A;  4WBN A;  3CJH B;  1M56 B;  5LMU O;  2UU9 O;  1OCO B;  3LUT B;  5DN6 G;  2YXH A;  3CMA V;  2EZP A;  2FTK A;  2BOB C;  2JEX A;  1BMF G;  4K3A A;  4MVZ A;  4J9Z B;  3ML0 A;  5LGT A;  1XMO O;  4PEL A;  4JF3 A;  1HDJ A;  4UUJ C;  1HWY A;  4PDV A;  1ZWI C;  2DW4 A;  3HKC B;  4O2B B;  2HFE C;  2EIJ C;  3ZX6 A;  4WFB V;  3OAA G;  1PPJ H;  1MG1 A;  1S5H C;  2FB5 A;  1R6N A;  1TVK B;  4GKJ O;  3STL C;  1K73 W;  1BZK A;  4WFE A;  1VIB A;  1AJN A;  2GUZ B;  1KMI Z;  4FFB B;  1B6Q A;  2ZD9 A;  1RPO A;  3LSS A;  1T5E A;  4U3J A;  1W2B U;  4EFE A;  4DUZ B;  1HNZ B;  1UPG A;  3CHX A;  3ZJZ A;  5LHG A;  3ZHS A;  1G6U A;  2KQX A;  2WWW A;  5C8Y B;  2QKS A;  3SDL A;  1P49 A;  5LP6 A;  1MNG A;  3ABU A;  1WPB A;  1YIT V;  5B1A B;  3K08 A;  1QCE A;  3ASO B;  2Z0A A;  1NTM H;  4DV1 B;  1HNX B;  5LA6 B;  1H2N A;  3CPW U;  2PI4 A;  4X9Q A;  4IYH A;  1K92 A;  2LW7 A;  4EFB A;  4P9O A;  1WLE A;  1NH2 D;  3B8M A;  1Y6X A;  5JCO A;  3TXS A;  5J9P C;  2DE0 X;  1I5Y A;  4LF7 B;  1AJP A;  4L87 A;  1EFR G;  1AP5 A;  2EX3 A;  3ETD A;  3K5L A;  3T1Y B;  2EJR A;  4DRX A;  1WJZ A;  1NVP D;  3L9D A;  4JAV A;  3ZMT A;  2XAJ A;  5IJ9 A;  4TV8 B;  5IWA O;  2YIB A;  2Q67 A;  4YXW G;  4MS2 A;  3C3S A;  4I9Q A;  2NN4 A;  4R50 A;  5J2U A;  4NTW A;  2E3C A;  2OIE A;  4WFG A;  1SQF A;  1B06 A;  3D8C A;  4I9W A;  1IX9 A;  2EIM B;  5LXT B;  1K33 A;  4B3M O;  4CH3 A;  2L35 A;  1XMQ O;  3SPH A;  1M5I A;  3ASN B;  1R73 A;  2QTS A;  4FFK A;  4W4L A;  2EIM C;  5EZY A;  4DR6 B;  3AG4 C;  1CP9 A;  3T1C A;  1BE3 H;  1H2K A;  1GN2 A;  2UUA O;  5IYZ B;  1EZJ A;  4ABM A;  3JAT B;  3HPL C;  3TCU A;  4DR7 O;  3K04 A;  4QJF B;  3RYH B;  2P6J A;  2AHY A;  1MSD A;  3U10 A;  3C3T A;  4O4L B;  4QGP A;  1GN3 A;  4LFC B;  2HEP A;  1QQC A;  1IBL B;  5B1B B;  2YC0 A;  2JRI A;  3RYI A;  1RM1 B;  1ZSP A;  4O2A A;  4GX2 A;  4LNU A;  4CC5 A;  4LF4 O;  5GTH Z;  4RO2 A;  2ZNI A;  4DXW A;  4K0K B;  1BCC H;  3UO3 A;  5BY1 A;  2B9Z A;  1WA8 B;  2EIL B;  3SPG A;  3TJT A;  4DK0 A;  3ZMS A;  4DR6 O;  3UT5 B;  4I50 B;  3FAV A;  5IJ0 B;  3OMI B;  3IGA C;  3F7V C;  3CE2 A;  3WB2 A;  4TV9 A;  1YJ9 V;  4JI2 O;  5E1A C;  1I0H A;  2QWO B;  2ODM A;  1N33 B;  4FM2 A;  2UXD O;  5IE9 A;  4B3T B;  3O65 A;  4CS2 A;  1SS3 A;  1ZAU A;  1ZL8 A;  4ZOL B;  3K79 A;  3S3W A;  2D3O W;  4I0X A;  2XUM A;  4X62 B;  2V4D A;  4JI4 B;  4FK5 C;  3GWO A;  1LR1 A;  4GT1 A;  1ROP A;  2PZS A;  1HNW B;  1XHX A;  4GYC B;  2IW5 A;  3ZS8 C;  1SA0 A;  4YY3 B;  1DF5 A;  1SKV A;  2BTO A;  1NU1 H;  5KHG A;  2E74 B;  2KG7 B;  4NB5 A;  1JCH A;  3K0G A;  4LBE C;  4H33 A;  5CA1 B;  3G4S V;  3M7M X;  2ZCE A;  4UCO A;  1R3L C;  4JAA A;  3AK2 A;  4UB6 Z;  3CCR V;  2ZE5 A;  2A79 B;  3PN1 A;  1SRY A;  4FZ1 A;  4LFA O;  3DC6 A;  5BR8 B;  1YDX A;  2Q0O C;  1Q3E A;  4HNA A;  4MVM A;  1OCR C;  4AQY B;  1IUR A;  4LFB O;  3ICX A;  3AK1 A;  4B3R O;  1JOY A;  1GMG A;  2HP8 A;  3HKD A;  2F95 B;  4JI8 B;  4HNA B;  3LDC A;  1F4M A;  2QWR B;  1A32 A;  1GH6 A;  2ZM6 B;  1SQQ H;  4IHJ A;  1Y67 A;  1XNR O;  3DC5 A;  2OCC C;  1H38 A;  5LA6 A;  3RYF A;  5IDJ A;  4OX9 B;  3KCX A;  4J7Z A;  2UXC B;  1N0J A;  2AXT Z;  2VWK A;  3JAS B;  2WLM A;  4BW9 A;  5BMV B;  4LF8 O;  3CS5 A;  3W7X A;  1KC8 W;  4B7K A;  4DRX B;  3FB5 C;  3G71 V;  1GN6 A;  2Y69 C;  5KAI Z;  1OCO C;  2V1D A;  4UCR A;  5J2U B;  4MVO A;  4K35 A;  2A0L A;  1U97 A;  1AI5 A;  3THO A;  1AJQ A;  4DR3 O;  4PJ0 Z;  4DR5 O;  4NKG B;  3LNN A;  4BR6 A;  3QO5 A;  2RN9 A;  3JAL B;  2UUA B;  2OIG A;  2N05 A;  4LH7 A;  4QNH B;  4Q20 A;  3RBZ A;  2ZNJ A;  5EYP A;  4I5S A;  1SZX A;  4TUY A;  4LF9 B;  1RSO B;  3IC9 A;  2EIJ B;  1WP8 A;  5JWP A;  1P4R A;  3OEH G;  4FM0 A;  4UCU A;  2LJ2 A;  1MAB G;  4GCZ A;  4BW5 A;  1SZT A;  2H94 A;  1VQ9 V;  1K5Q A;  4X1I B;  5EIB D;  3CCM V;  2YS8 A;  3K5M A;  3NR7 A;  1L0N H;  5JQG A;  2PUS A;  2A06 H;  3ABM C;  3JCZ A;  1OZ0 A;  2QM4 A;  1SQB H;  5BZB A;  3ABK B;  3IJ4 A;  3VQV A;  3CX5 F;  4NXM B;  4LF6 B;  5ITZ A;  2YI9 A;  3JAK B;  4JAU A;  4H37 A;  3OGC C;  4IL6 Z;  1QHT A;  1K4C C;  4I50 A;  3B4S A;  4JYA O;  3JAR B;  3ETE A;  2Q7G A;  3OEE G;  1LNQ A;  4BAY A;  4B08 A;  4ICG A;  4DV1 O;  3B2E E;  1GO3 F;  3OUF A;  3P32 A;  4JI8 O;  3L72 H;  1IBK B;  3CXC U;  4DR4 O;  1L0L H;  1NZ6 A;  1AI7 A;  4J7J A;  1YTF D;  4X66 O;  4MSW C;  1YF2 A;  1JX9 A;  2H8P C;  5KHI A;  1GM7 A;  1DGS A;  3K9S A;  4JZG A;  1DF4 A;  3OGI B;  2WLI A;  4MTG A;  4G2K A;  5B5E Z;  4LF6 O;  4TV8 A;  3CWB H;  3QO8 A;  1K34 A;  1F23 A;  3K3W A;  3O9O A;  1YVW A;  1MZF A;  1ZTE A;  4NTY A;  5L3B A;  5HFL A;  1YCI A;  5CBH A;  3G80 A;  3UT5 A;  3BHP A;  5EK0 A;  4MVU A;  4B3T O;  4LFC O;  1MSW D;  1M9N A;  1N34 B;  2W6I G;  3ABL C;  1JPX A;  2KG7 A;  4DR4 B;  3K5O A;  4A5U B;  2ATK C;  1KP2 A;  2DMX A;  4IHJ B;  1XL4 A;  3ABT A;  1IBM B;  1WB8 A;  1K4D C;  4JI1 O;  1V54 B;  5JJN B;  4X62 O;  4LH6 A;  3OTF A;  1QVF U;  2OT5 A;  1EN5 A;  3H1H H;  2K9P A;  2GSM B;  1V54 C;  3QVN A;  2W0F C;  2QTO A;  4BWA A;  1TA8 A;  4DR7 B;  2PGG A;  5LHI A;  4MTO A;  1WN7 A;  4UV8 A;  1N33 O;  5H5N A;  5B1O A;  3P3P A;  3KKY A;  4CZZ A;  2UUB O;  4MVQ A;  1Y4M A;  2NNU A;  4J80 A;  1CEZ A;  2EZO A;  2NLJ C;  3ZMU A;  5FPO A;  2P7T C;  3ZRW B;  4E4E A;  2CAZ C;  3MAQ A;  1Q86 W;  2EIN C;  2GBO A;  1RP3 B;  2GTS A;  1GM8 A;  1EM1 A;  4HAM A;  5GON A;  1AR5 A;  4O4H B;  4LWS B;  5CA3 A;  4CS4 A;  5FPR A;  2E75 B;  4P2Z A;  1ENV A;  1PKX A;  4LP8 A;  5GON B;  1BT8 A;  3VQY A;  4UVA A;  1KB9 F;  1PNM A;  1O9H A;  2IJJ A;  3ZRX A;  1VAR A;  1KBH A;  1NTZ H;  1NT2 B;  4TT3 G;  4X8A A;  3SYC A;  3CRM A;  1QVG U;  3T4D A;  5GTI Z;  2XAQ A;  2HHH O;  4FLT A;  4UFZ A;  1WP7 A;  1AIL A;  2M6Y A;  1OCC B;  4U3F H;  4N21 A;  3LSU A;  3OR7 C;  5LOV B;  5LMU B;  2UU9 B;  3RFR A;  5IY5 C;  4FVM A;  4LF8 B;  3OD4 A;  4K8Z A;  2XT9 A;  1H2G A;  4PDL A;  2BOC C;  4XDK A;  1KU9 A;  3FB7 C;  1J5E O;  1IZ3 A;  3JD3 A;  4Q6G A;  4JI0 O;  5A9G A;  4PI2 A;  5JVD A;  2DYR B;  3H1L H;  1XNQ B;  4W4K A;  4I55 B;  2XAG A;  5KAF Z;  1V55 B;  1JVM A;  2ZIM A;  2QE7 G;  4DV0 B;  1VQL V;  1Q5O A;  1KP3 A;  2ADP A;  1SF9 A;  1Q8I A;  1YTF B;  4RWU A;  1V9P A;  4B7E A;  2ADQ B;  2HVJ C;  4YHH B;  1HR0 B;  1WA8 A;  2R72 A;  2Y4U A;  1P7B A;  5B1N A;  3SPI A;  1L8D A;  5IJ0 A;  3E22 A;  1YEW A;  2QGN A;  3CRQ A;  1EZV H;  4Z1M G;  3ABL B;  3JD0 A;  4RQE A;  1QLN A;  4RQF A;  1S5J A;  2Q4P A;  3QO7 A;  4FMT A;  1GAX A;  2UUC B;  3SYA A;  2M7W A;  4DV7 O;  1H2M A;  1OV9 A;  4P9P A;  1W0J G;  1KKD A;  1VF7 A;  4JAS A;  3DGE A;  3L74 H;  2AZ2 A;  5IT9 N;  4WCE V;  3BY6 A;  3LNM B;  1N0N A;  4ZI7 B;  2O57 A;  3BA8 A;  3D3I A;  4FLW A;  3LDD A;  5LOV A;  2GTA A;  5K1P A;  2X6C A;  2ZXW C;  1MOF A;  2JIZ G;  4JTC B;  4IIJ B;  4LNU B;  3ZHT A;  4UCT A;  5CB4 B;  2YIA A;  3SYQ A;  2JS3 A;  3AG2 C;  4FLX A;  3AK3 A;  1M56 C;  4LR3 A;  3N2G B;  4JI1 B;  4FJC C;  3OR6 C;  4D7S A;  3H1J H;  4LFA B;  1M1K W;  4DR5 B;  1SQV H;  3CXH F;  4YIP A;  3MD0 A;  4DW0 A;  5IYC O;  4GX1 A;  2F1M A;  2ZR3 A;  4P30 A;  2UXB B;  3SPJ A;  4JV5 O;  4UXN A;  3A0H Z;  2FYU H;  3F7Y C;  3QG5 A;  3HKC A;  4O2B A;  2WSS G;  4U7O A;  3STZ C;  3E35 A;  2N74 A;  3TXQ A;  1K7D A;  2IU3 A;  5LYJ B;  3E2E A;  3J80 N;  1JJO A;  3OFN G;  3AG3 B;  3ZED A;  4CH5 A;  2WA3 A;  3WG7 B;  3OMA B;  5DEC A;  5FL7 G;  2QM8 A;  4DV3 O;  3BEH A;  4JI6 B;  2JS5 A;  2VQF B;  3UO2 A;  2PTM A;  1Z5W A;  3OE7 G;  2OTJ V;  1KKC A;  3HKB A;  4NXM O;  5KHK A;  1N8R W; 
#chains in the Genus database with same CATH homology
 3D36 A;  1VQO V;  3W7X A;  1KC8 W;  2ZDI C;  4WFA V;  4TSF G;  3AEI A;  3FB5 C;  4QE7 A;  4X89 A;  3ZCC A;  2WLL A;  4MTX A;  4MTF A;  4RUF A;  3K9A A;  1H8E G;  3G71 V;  3RVY A;  2Y69 C;  3T2M A;  3LSQ A;  3WFV A;  4R7C A;  4XBF A;  1S76 D;  3JD2 A;  1OCO C;  2HG5 C;  4BIZ A;  2V1D A;  5HFM A;  2GHY A;  2LP7 A;  1PNK A;  1YI2 V;  2ZR2 A;  4QE9 A;  1EBO A;  4MVO A;  2A0L A;  5DM6 V;  1AI5 A;  4J9Y B;  5H6R A;  2KB1 A;  2ITC C;  5LHH A;  2A9H A;  1AJQ A;  2WLJ A;  1Q7Y W;  3K03 A;  1AI4 A;  5L3D A;  1VQ4 V;  3E86 A;  2Y48 A;  3AG2 B;  3QO5 A;  4DO2 A;  1YJN V;  4BIU A;  1TUE B;  4QNH B;  4Q20 A;  3RBZ A;  2WLN A;  1AR1 B;  4I5S A;  1OCZ B;  2EIJ B;  4N23 A;  3E89 A;  4QPJ A;  1P4R A;  2AHZ A;  3OEH G;  3AG1 C;  1E1Q G;  3DTU B;  1OCR B;  3F5W C;  1QR9 A;  1MAB G;  4GCZ A;  3ZN0 A;  3K06 A;  4BW5 A;  1SZT A;  2H94 A;  3ABM B;  1VQ9 V;  2X0L A;  4CBC A;  3EHB B;  1K5Q A;  5EBW C;  3AG1 B;  4XDJ A;  2WAM A;  1UJW B;  4FIP C;  3CCM V;  1FFT B;  1R3J C;  1H8H G;  3UKM A;  2R9I A;  2ZDI A;  1F4N A;  3OUS A;  1W0K G;  1FXH A;  5KA6 A;  3ABM C;  3JCZ A;  4UVC A;  1JJ2 U;  2LFS A;  3JYC A;  3ASN C;  1YIJ V;  2EIK C;  1OZ0 A;  4R8C A;  5BZB A;  3ABK B;  1AI6 A;  5IY5 B;  1NJI W;  3SJQ C;  1S0V A;  3QNE A;  1ORQ C;  4U7N A;  3CC4 V;  1FS0 G;  1SET A;  1GTO A;  1J95 A;  4JAU A;  3ZRS A;  4PDM A;  4H37 A;  3OGC C;  1NR7 A;  2UXX A;  1JQ0 A;  1K4C C;  1M57 B;  1YHQ V;  1BHA A;  1THZ A;  3RVZ A;  1QR8 A;  4TWK A;  3ABK C;  1YJW V;  3ETE A;  2WLH A;  3B77 A;  4QIW F;  3OEE G;  2DYR C;  1G8M A;  2JK5 C;  1LNQ A;  4BAY A;  1M57 C;  3X2Q B;  5EC1 C;  3CCQ V;  1IXM A;  4RUE A;  3TET A;  4JGS A;  5KUM A;  3FYI B;  3ZRW A;  1GO3 F;  2F43 G;  3OUF A;  3P32 A;  3W7T A;  2WLI B;  3H01 A;  4KP4 A;  1ARO P;  4OXS A;  1K9M W;  1KD1 W;  1M56 B;  3FB6 C;  3CXC U;  5IYD O;  1OCO B;  4UVB A;  3LUT B;  5DN6 G;  1AI7 A;  1YTF D;  2X7R B;  5IYB O;  3CMA V;  1QLE B;  4MSW C;  1JX9 A;  2EZP A;  2FTK A;  2H8P C;  2UXN A;  1GM7 A;  2BOB C;  1FXK C;  1DF4 A;  2JEX A;  1BMF G;  1Q81 W;  1VQ5 V;  1R3I C;  2WLI A;  4MTG A;  4G2K A;  4MVZ A;  1DTO A;  4RAI A;  2P90 A;  3ML0 A;  4J9Z B;  5LGT A;  4PEL A;  4JF3 A;  3UM7 A;  3QO8 A;  1K34 A;  4UUJ C;  4PA3 A;  1F23 A;  3K3W A;  1HWY A;  1VQ7 V;  2EBO A;  4PDV A;  3ZMZ A;  3LDE A;  1ZWI C;  2HLD G;  4JTA B;  5L3B A;  2DW4 A;  5HFL A;  4G27 B;  1XL6 A;  2HFE C;  5CBH A;  2EIJ C;  3I56 V;  4G28 B;  4WFB V;  3CCU V;  5EK0 A;  2HKO A;  4MVU A;  4EKW A;  3OAA G;  2Q69 A;  5LBQ A;  1MG1 A;  1S5H C;  1MSW D;  2B1I A;  1M9N A;  1R6N A;  2JJ2 G;  3NXS A;  2XND G;  2W6I G;  3M99 B;  3ABL C;  3ETG A;  3STL C;  1NR1 A;  1K97 A;  3HB3 B;  1K73 W;  1JPX A;  3TK1 A;  1NKD A;  4WFE A;  3W7U A;  1AJN A;  1KP2 A;  2ATK C;  1GM9 A;  1XL4 A;  3ABT A;  4PDR A;  4JTD B;  4JPR A;  1K4D C;  4F4L A;  1B6Q A;  1V54 B;  3KG2 A;  1K5S A;  3PJS K;  2CK3 G;  2HVK C;  2ZD9 A;  1Q82 W;  1SER A;  1RPO A;  3FYE B;  3LSS A;  1W2B U;  1QVF U;  5KA5 A;  2OT5 A;  5LGN A;  3ZJZ A;  5CBG A;  2GSM B;  5C93 A;  5LHG A;  1V54 C;  2WWW A;  2W0F C;  2QTO A;  2QKS A;  2YEV B;  1FXV A;  3ABU A;  2OTL V;  5LHI A;  4MTO A;  1YIT V;  1E1R G;  4QPK A;  3E8G A;  5B1A B;  2JDI G;  4UV8 A;  3ZIA G;  5CBF A;  3K08 A;  1QCE A;  5L3F A;  1FXK B;  3ASO B;  5B1O A;  2DQ0 A;  2IJK A;  4CZZ A;  3CCS V;  3E8H A;  4MW3 A;  4MVQ A;  3CPW U;  1Y4M A;  2NNU A;  2PI4 A;  1PNL A;  1CPY A;  1K92 A;  2EZO A;  1CEZ A;  4PA6 A;  3FB8 C;  2NLJ C;  1F51 A;  4P9O A;  3ZMU A;  2P7T C;  3ZRW B;  1WLE A;  1BL8 A;  1Q86 W;  4KFM A;  2EIN C;  5B3S C;  3W7W A;  1NH2 D;  3CCE V;  3B8M A;  3ASO C;  5J9P C;  1I5Y A;  1M90 W;  2XAS A;  1AJP A;  1QLE C;  4L87 A;  1PD3 A;  1GM8 A;  1EFR G;  3ETD A;  4HAM A;  4PA9 A;  2EJR A;  1Y66 A;  2P67 A;  3R65 A;  2EIN B;  5B3S B;  1NVP D;  5CA3 A;  4MVR A;  1K3E A;  4JAV A;  3ZMT A;  3CME V;  2XAJ A;  2DYS C;  4P2Z A;  1ENV A;  1PKX A;  3GB7 C;  4LP8 A;  2PI5 A;  2Q67 A;  4YXW G;  4UVA A;  2Z5U A;  4MS2 A;  4WFH A;  2X6B A;  1PNM A;  1S72 V;  3E8B A;  4R50 A;  2DWD C;  5L3E A;  5L3C A;  2IJJ A;  3ZRX A;  3CCL V;  4TT3 G;  4X8A A;  4WFG A;  3SYC A;  1QVG U;  4FPP A;  3T4D A;  2XAQ A;  4I9W A;  5GW7 A;  4GX5 A;  2EIM B;  1K33 A;  1VQ6 V;  2XAH A;  2X6A A;  3SPH A;  3ASN B;  1R73 A;  1OCC B;  2W6J G;  4N21 A;  4UV9 A;  4R6Z A;  3OR7 C;  2R9R B;  2HJF C;  3AG3 C;  2EIM C;  4GX0 A;  1NBM G;  3VBB A;  2EIK B;  2WLL B;  4JYB A;  5EBM C;  3AG4 C;  1CP9 A;  4HZ3 A;  3T1C A;  5IY5 C;  2C2A A;  1H2G A;  4PDL A;  2BOC C;  2DQ3 A;  2HR3 A;  4XDK A;  1EZJ A;  3VOU A;  1S77 D;  3FB7 C;  2Z3Y A;  3HPL C;  3JD3 A;  1PL0 A;  3K0D A;  3TCU A;  3JD1 A;  3K04 A;  4QJF B;  5B1B C;  2P6J A;  3AG4 B;  2AHY A;  3IFX A;  2IJI A;  1E79 G;  4X88 A;  2DYR B;  1VQM V;  1COW G;  5CMU A;  2EIL C;  5B1B B;  1RM1 B;  1FXK A;  2IH1 C;  4GX2 A;  2MK3 A;  2XAG A;  4LC1 A;  1V55 B;  1JVM A;  4RO2 A;  4DXW A;  2Y69 B;  4MW8 A;  3W7S A;  4HYO A;  1G4Y B;  1NH2 B;  2YSU B;  2QE7 G;  3CP1 A;  2EIL B;  1VQL V;  3SPG A;  3ZMS A;  1KP3 A;  5H6Q A;  3E83 A;  1VQK V;  1YTF B;  1GKF A;  5EBL C;  1R3K C;  3OMI B;  3IGA C;  1RPR A;  2HVJ C;  3F7V C;  2LFR A;  2V7Q G;  4WF9 V;  1NVP B;  1YJ9 V;  1KQS U;  1S3J A;  2Q6A A;  5E1A C;  4LCU C;  5L3G A;  1P7B A;  5B1N A;  3SPI A;  5EC2 C;  4KUM A;  4MVS A;  4ZBM A;  2IJH A;  1OHH G;  3WG7 C;  4JYC A;  3CD6 V;  3E8F A;  2Q68 A;  2OCC B;  3A0R A;  3B8N A;  4Z1M G;  2WLK A;  3ABL B;  2XOK G;  3K79 A;  1L1F A;  3JD0 A;  2D3O W;  4RQE A;  2B1G A;  1QBZ A;  1QLN A;  2B5U A;  4RQF A;  1VQP V;  3QO7 A;  4FMT A;  5H9C A;  3SYA A;  3CYO A;  2M7W A;  1KKD A;  4P9P A;  1W0J G;  3P30 A;  4FK5 C;  3GWO A;  3FKS G;  4JAS A;  4PA7 A;  2IU0 A;  4ASU G;  3DGE A;  4GT1 A;  1ROP A;  3IC7 A;  3ZRV A;  3CC2 V;  2YEV A;  3OM3 B;  4WCE V;  1I5X A;  3BY6 A;  3LNM B;  2IW5 A;  3D3I A;  3LDD A;  2QM7 A;  2X6C A;  4ZKI A;  1DF5 A;  2ZXW C;  5B1A C;  3I55 V;  5CN0 A;  1YSC A;  1MOF A;  2JIZ G;  4JTC B;  1DLB A;  4XDL A;  2WPD G;  3SYQ A;  2XAF A;  3AG2 C;  1M56 C;  1JCH A;  3K0G A;  4LBE C;  4H33 A;  2ZXW B;  2JJ1 G;  4FJC C;  3G4S V;  3OR6 C;  3ZMV A;  1R3L C;  1GK9 A;  1M1K W;  2ITD C;  1RM1 C;  2JEU A;  3T4Z A;  3MD0 A;  5IYC O;  4GX1 A;  3CCR V;  2A79 B;  2ZR3 A;  1OCZ C;  1SRY A;  4P30 A;  1BHB A;  3X2Q C;  3SPJ A;  4MVM A;  1V55 C;  4UXN A;  1OCR C;  3F7Y C;  3SYO A;  2DWE C;  2WSS G;  4U7O A;  3STZ C;  1JOY A;  1GMG A;  1KEC A;  3E35 A;  3ZN1 A;  1K7D A;  2DYS B;  4MT8 A;  2IU3 A;  1R6K A;  2K1E A;  3LDC A;  1F4M A;  3E2E A;  5KUK A;  3JD4 A;  3OFN G;  1SES A;  4WFF A;  1WPX A;  3AG3 B;  3OW2 U;  1NQT A;  3SPC A;  1VQ8 V;  1K8A W;  3MHS C;  2QEX V;  3WG7 B;  3OMA B;  5FL7 G;  4E2L A;  2QM8 A;  2OCC C;  2IH3 C;  3SYP A;  3G6E V;  1H38 A;  3BEH A;  5IDJ A;  3RW0 A;  3CCV V;  2QA4 V;  3EFF K;  3MHH C;  3OE7 G;  2OTJ V;  4PA4 A;  2ZQM A;  5LGU A;  2WLM A;  3CC7 V;  3CCJ V;  1OCC C;  1VQN V;  3OMN B;  1N8R W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...