1QVFU

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvfU00
3CCJV 1VQ7V 3G6EV 4WFAV 3CMAV 3CMEV 1Q81W 3CXCU 3CCMV 1K8AW 1VQMV 1YITV 1VQ6V 1VQNV 1M90W 1N8RW 1YJWV 1R73A 4WFBV 1KD1W 2OTJV 1VQLV 3CCUV 1YJ9V 1VQOV 1S72V 3CCSV 3I55V 1NJIW 1M1KW 1QVFU 1YIJV 2QEXV 1K73W 1VQ5V 1YI2V 1VQ4V 3CCVV 1QVGU 1VQPV 4WF9V 5DM6V 3G71V 3CCLV 2QA4V 3OW2U 1Q7YW 1KQSU 1JJ2U 1VQ8V 3CC4V 1VQ9V 3I56V 3CC7V 1W2BU 3CC2V 3CCEV 1Q82W 2OTLV 3CD6V 3G4SV 2D3OW 1KC8W 1K9MW 1Q86W 4WCEV 3CPWU 3CCQV 1VQKV 1YHQV 1YJNV 3CCRV
chains in the Genus database with same CATH superfamily
4CS4A 1WB7A 3RYCA 3W7TA 2PI4A 5CBFA 4DUZO 4LP8A 4X88A 3B8NA 3T1HO 2EIKC 5JH7B 4FPPA 3K5LA 2PTMA 3GWKC 2D2CB 1GN6A 1XNRO 5IYBO 2Y4UA 3N27A 4MW8A 2F4VB 4FM2A 5LOVA 5BR8O 1L8DA 2GUZB 4FLYA 4H13B 3S3XA 1FD9A 3SR2C 5KUKA 1I5XA 4LNUB 5EYPA 2CH7B 1TUEB 2AZ0A 4MTFA 4JI7O 1XHXA 1VIBA 1GM8A 2UUCB 4LF7O 2JJ2G 4Q6GA 3G71V 3TCUA 3K9AA 4X1KA 4F6RA 2JGUA 4AQYO 5CB4B 3CCMV 5CA3A 1OCCB 2X6CA 2GHYA 4TV8B 1MSWD 3K9SA 2WPDG 1AR1B 2ADPA 5DEDA 1UPGA 1SQFA 4B3SO 5C8YA 3KG2A 3K3WA 1MZFA 3ZBHA 1ZAUA 1ZLZA 3E22B 3JCUZ 3M7MX 1Z2GA 3CP1A 4YJ3A 1G6UA 5B66Z 1OCCC 1HR0O 4JTDB 3E8GA 3Q4HA 5HFLA 1W0KG 3JATB 1PNKA 5B1NA 1F4MA 2QM7A 1P4RA 2DE0X 3A0HZ 5ITZA 2VWJA 1OCRC 1NI8A 1F7YA 5KHJA 3LDCA 2D3OW 3K5NA 3R66A 4NXMB 2JDIG 4DV5B 2EILB 4ZHQA 1YITV 4UXNA 1IBLO 5KAIZ 3ZX6A 3ABKC 4UCUA 4I9QA 3WB1A 4MVSA 2YXYA 2DQ3A 4BWAA 1WJZA 4D7TA 1Q3EA 2A7WA 1KECA 4J11A 4LF9O 2PI5A 4LFCO 2EINB 1MZEA 3WB0A 4DR7O 2JEXA 3ABLB 4AILC 2EILC 4MVMA 2NNUA 3JARB 3OR6C 1DF5A 4LBEC 1M93A 3NXSA 3L73H 3O9OA 1NZ6A 2EINC 2YS8A 3JASB 2BSKA 4DV0B 3ABLC 1KQSU 3IC7A 5IJ9B 3UT5A 4DR1O 4I50A 2P90A 4DV2B 4DRXA 2B1GA 4LF5B 4YHHO 2IU0A 1VQNV 3DXRB 4PV1B 2ZT9B 4QJFB 3QO7A 2F1MA 2AZ2A 1JCHA 4LC1A 4A5UB 4GX5A 1PP9H 2DQ0A 2ADQB 2IJHA 4GKJB 3D3IA 2OIGA 4J10A 3WB2A 2ZE6A 5D5QA 4FFKA 2CAZC 3FB8C 4PELA 4C7UA 3F7VC 3JAKA 1FJGB 4DK0A 3BAAA 2KKWA 3I55V 2LGWA 4JI3O 1XMQB 1EZJA 5JJJB 3BA9A 1P49A 5L3BA 1SETA 3CPWU 1X59A 3EFFK 4LCUC 2JS5A 1QLEB 1XQ8A 4HNAA 2Y69B 2Z5UA 3FYIB 4X66B 4DV7O 4DW1A 2UUCO 3OEEG 1H2MA 1NS1A 2JK5C 3LSUA 3RYCB 4FLXA 1QLEC 3HKBA 3RYFA 4W4LA 2ETNA 4K8XA 3BY6A 4DV3B 1OZ0A 4JPRA 5KA6A 3A0RA 5B1AB 3T1YB 3OR7C 3D8CA 5LOVB 3CRCA 3STZC 2QWQB 3GB7C 1R3LC 3AG4C 1D5NA 3ZRVA 3G6BA 1HW7A 3JALA 2HR3A 4TUYA 3K59A 1CXZB 5B1AC 3WFVA 1VP7A 3T4ZA 4J41A 1S72V 4X1KB 4JI5O 4F6RB 1R6TA 5JWPA 2IW5A 1L0LH 1BGYH 2QWOB 3W7UA 3RYIA 4DUYO 1K34A 1WP7A 4NXMO 4DV5O 5LA6A 1W59A 1IXMA 1H2LA 2DMXA 4GZRB 2YXHA 3A8TA 1SF9A 1SC5B 3OAAG 1B3QA 1SQGA 2PUSA 4FLWA 3Q4HB 4LF8B 4D6TH 2QGNA 4GLXA 5LHGA 5H6RA 2R9RB 5ITZB 5LHHA 2JIZG 1OCZC 2FMLA 5EC2C 1XOUA 4TT3G 2OYQA 2CTPA 3RBZA 2CE4A 1H2NA 1M1KW 2AHYA 2YEVA 3RFRA 2Q7GA 5JH7A 3LSSA 5LYJB 1NH2D 4ZHQB 1CEZA 2A79B 4JAVA 4JAAA 3KZIZ 3CXCU 1B06A 3K0GA 5AG2A 2WLMA 4Z1MG 2GUZA 1D2DA 1M56C 2EJRA 3EHBB 3IC9A 1QR9A 2F66C 1MMMA 2QEXV 3E2EA 4H33A 2NLJC 4LNUA 3BFRA 4BIOA 4GKJO 1MOFA 3ZMVA 4GX0A 3K06A 1QNMA 4B3RB 1S3JA 1SA0A 5HFMA 2YDEA 4WFAV 1VQ7V 1AI4A 1BHAA 3OMAB 5IJ0A 3OEHG 4DUZB 3U11A 2BSKB 1L1FA 4I55A 4YJ2B 4P9PA 3T1HB 1XMQO 3UT5B 4I50B 2IJIA 3N2KA 4DR3O 2ZKOA 4JI1O 2B5UA 4DRXB 2DYSB 2CGOA 5BR8B 1W0JG 4Z2WA 5JVDA 2QKCA 4PA4A 4UCVA 2Q0AA 4GCZA 4JTAB 4ZOLA 4TWKA 3ZN1A 2VWKA 1I0HA 4JI7B 1JJ2U 1AJPA 4LF7B 5L3GA 1HP8A 2LO1A 1AJNA 5GTIZ 1JA8A 3ZHSA 1FXKA 1FFTB 3JAKB 4LWSB 4AQYB 1B6QA 4LF4B 5BXZA 2YIDA 4P2ZA 1H2SB 4WFBV 5DN6G 1FS0G 2O57A 4WFHA 4J9YB 4FLTA 2Q0OC 2VRZA 1MNGA 1V54C 4PDLA 2E74B 4CC5A 3BVOA 2C2AA 1VMGA 2UUBO 3JD3A 1VQKV 5KAFZ 3HR0A 4PI0A 1HR0B 3FYEB 5H5NA 1S76D 2E75B 3UO2A 2XAJA 2EIMB 4I9WA 4CH5A 1K5QA 3C3TA 5LHIA 2QR4A 2CTWA 5H6QA 3P30A 3SPIA 2IJJA 3HKBB 3K0DA 3K08A 2ITCC 4UCRA 3CE2A 2AXTZ 4U7OA 3H9VA 3JASA 4J7ZA 5C93A 5IT9N 1ZX3A 3CCRV 1GTOA 2W6JG 1QBZA 3AG7A 4GT1A 3FFQA 4R50A 1IBLB 1SRYA 4Q20A 2XNDG 2FB5A 4MTOA 4OX9B 1Z5VA 3DXRA 3VOUA 3DTUB 1CP9A 1K5SA 4NVPA 3JALB 3VQYA 5CA0A 1LUVA 4LF9B 4LFCB 4DR7B 1ORQC 3JAMN 1Q43A 2IJKA 3ETGA 4JYBA 4CH4A 5LL6Y 2VQEB 1EBOA 3AG1B 3QO8A 1YIJV 3ZRXA 3A0BZ 3E35A 2P06A 5LA6B 3DC5A 4DR1B 5H2FZ 1YJNV 3ZRWA 4BW5A 1KP3A 2LFRA 3SYQA 1D5AA 1IXBA 3IAYA 4YHHB 3CWBH 4DYLA 2HP8A 3UO3A 1XHZA 1RM1B 1L0NH 3CRRA 2UXNA 5JJEB 4DR6B 3TXSA 2RN9A 1ROPA 4JAUA 2OWOA 4B3RO 3BPZA 2HFEC 3CMAV 2Z3YA 1K97A 1NTZH 1RM1C 3F5TA 1M4UA 2UXXA 2CDYA 2YEVB 1G4YB 4FZ0A 3CB2A 1A32A 3HPLC 4JI3B 1JFFA 3QG5A 3QO5A 1S5HC 3OUFA 3CCLV 1GKFA 4K3AA 4LFBO 4J9ZB 3SYAA 2OCCB 5JJNB 4WFGA 2BTOA 2P4KA 4JI4B 2PYLA 4H37A 4RWUA 4IIJA 4F4LA 3CMEV 3ETDA 4JZ2A 3UCSC 4MTXA 3QVNA 1DGSA 4NXNO 1HDJA 3UQ8A 4DV7B 1VQ5V 3RVZA 2OCCC 1XMOO 2JEUA 1FXVA 1X4TA 1XILA 1SA0B 2ZCEA 3MAQA 3G4SV 1TA8A 4QPKA 4XDJA 5IJ0B 1EFRG 4I55B 4LF4O 2NR5A 5IYZA 2F23A 3N2KB 4KP4A 4X65B 4X89A 1HWYA 1F23A 2CGNA 1UJWB 5CBHA 1EN4A 3K5OA 3N2GA 1K4CC 2YUAA 1HNZO 1DLBA 2CK3G 2B9ZA 5JVDB 3B4SA 3OGIB 2RCVA 1R6NA 2EJ7A 4ZOLB 1F51A 3H1JH 1CPYA 4FMTA 2UXDO 1UFIA 3P3PA 1OHHG 2VS0A 2HVJC 2HHHB 3ZN0A 2OIEA 3CCVV 4JI5B 3AK2A 4I0XA 1FXKB 1IBKO 2DOSA 1SESA 4NKGB 4QGPA 3K5MA 1KC8W 4KXRA 1NH2B 4DUYB 3H1LH 1YSCA 5FLXN 2LFSA 1BQ0A 1Q81W 3JD0A 5LYJA 4H44B 4JI0O 4MVOA 5JQGA 3FB6C 3ASNB 3G67A 1SZTA 3X2QB 2GSMB 3SPGA 2DWEC 4OX9O 1FXKC 1K73W 2ILMA 5GTHZ 5BZBA 1VQPV 3E8FA 2GDSA 4LR3A 4N23A 4I4TA 2XUMA 3IGAC 1F4NA 3ASNC 2HEPA 1YZBA 4LH7A 5CN0A 2VQEO 2MK3A 3SPJA 3CCUV 3BHPA 4KUMA 3OTOB 5E1AC 5EZYA 2XAGA 1Y66A 4G27B 3WU2Z 4YJ2A 3CC2V 2WLHA 2ZE8A 4JGSA 1H8HG 5KHHA 4HYOA 3I5DA 4BW9A 1G1XB 4TOIA 3NR7A 2MW2B 4K0KO 3F5WC 1K8AW 3OMIB 4G2KA 5IYDO 2WLLB 2BCCH 2R9IA 5LXTB 1N0JA 5CA0B 5KUMA 4QNHB 2Q68A 4DR6O 3GWOA 5J2UA 4E4EA 3S3WA 4UCTA 2PZSA 2ZNJA 1E1RG 4BAYA 4JYCA 2XAQA 5EC1C 3G6EV 4PD4F 4X20A 4FLUA 1THZA 3H1KH 5FPOA 2A0LA 2XOKG 5IE9A 2OCHA 4LWSA 3FX7A 5B1BB 2YSUB 1JMKC 5DM6V 2RJZA 3ABMB 4DR3B 3F7YC 3ZRWB 1I5YA 3AK1A 4JI1B 4JI4O 3W7XA 3CCJV 4NR1A 5LP6A 1HNWO 4O2BA 3O65A 4FLVA 5B1BC 2ITDC 4CS2A 2H8PC 1GN4A 3ABMC 2W0XA 4JI6O 2K1EA 3LDDA 2QM4A 3I56V 3SDLA 1EN6A 3B77A 3L72H 5L3DA 2P4VA 1S5LZ 1FYJA 1PL0A 2Y69C 4ZI7A 1QCEA 4PDVA 1GH6A 5TISZ 1VQ6V 2FTKA 4NTXA 4B3MO 5KHGA 3RYHA 1JFFB 3E89A 4G28B 2PY5A 2W6IG 4X65O 2AW9A 2UXCO 1S77D 5D5PA 1BSMA 1JOYA 4IIJB 3QNEA 2UUBB 2JGDB 2HG5C 1BCCH 3AG2B 4RQFA 1KYOF 4O4LB 1I7FA 1R3KC 2QWRB 2ZNIA 1URFA 2Q67A 3FAVA 1IBMB 4UCOA 3ZMZA 2HHHO 3AEIA 1VF6A 4JV5O 1K92A 3ZJZA 2P22C 3ETQA 1BS3A 2YI9A 4DR2O 3P32A 4WCEV 4WBNA 3RWRD 5IYZB 4K8ZA 2CUGA 3DGEA 1N32O 4RQEA 1P7GA 5B1OA 1OV9A 4YY3O 3TK1A 1FPOA 1I08A 2OTJV 3N2GB 2AHZA 1YJ9V 3HKDA 2JVDA 1QVGU 5FL7G 1RPRA 2UXBO 1KB9F 3IFXA 3JCZA 3CJHA 1GM7A 1P84F 5BY1A 3TGUH 2EIJB 1T5EA 1BE3H 3BA8A 5EIBD 4NB5A 1S5JA 4I0XB 5A9GA 2AGAA 3T2MA 3OTOO 4DW0A 1KUQA 2WAMA 3MHSC 1Y76B 4IL6Z 4HAMA 3OE7G 3QTCA 2WLNA 5JQGB 1PL4A 4DV4O 4MVUA 1YHQV 2EIJC 2XAFA 4YXWG 1AR5A 2NN4A 3MHHC 1AP6A 1DK1A 2ZXWB 4TQDA 4WFEA 4CC6A 1V55B 2M6YA 2IU3A 2RQ6A 3BCCH 4OPHA 4ICGA 3JAWA 4I4TB 4RO2A 4W4KA 1I94B 4KHPB 4PA7A 2P67A 4XBFA 1M5IA 3ZHUA 4IHJA 3A2FA 2R72A 2HJDA 1ZWIC 4NYKA 4UVCA 3H01A 1N0NA 3W7SA 2N74A 5DECA 5EZYB 4FM1A 4MVQA 1YEWA 4PA3A 1VF5B 3VQXA 4LFBB 5CBGA 1JJOA 3APQA 3D36A 1R1BA 2LQTA 2PF4E 3KCXA 2A3QA 4O4HA 3BEHA 2CTQA 5L3FA 4JYYA 3K79A 1IX9A 2KG7A 5J2UB 1AR4A 2G38A 4NXNB 3P3NA 2Y0PA 1YI2V 5KX5B 3CRAA 1XMOB 2DYSC 5BMVA 3TXQA 4CS3A 3AG3B 4X20B 1Q86W 2KSDA 3J80N 4U7NA 2VQFB 1N36B 1M57B 1K7DA 4J80A 4L8JA 2BTQA 2PYJA 1H2GA 4CBCA 4UB6Z 3FKSG 3EVKA 1VQ8V 3OGCC 1PV0A 3AG3C 4I5SA 3ASOB 1MSDA 1MABG 1XDCA 3ZMSA 1HNZB 1Y4MA 4RAIA 1BQZA 5LP6B 1AI7A 1Q6HA 4O2BB 3TETA 3H1IH 1M57C 4HZ3A 1AROP 4DXWA 3CX5F 4FJCC 2BOBC 5B3SB 3UKMA 1KP2A 4TV9A 1AVMA 2UXDB 2EZPA 1KKDA 5K1PA 4OPAA 4JASA 1IBMO 1TAEA 3ASOC 1NTKH 1QHTA 1SS3A 5LP6C 1O9GA 4ZI7B 1IBKB 5IDJA 1LR1A 2F93B 1SQQH 4QIWF 2UUAB 3WG7B 3RYHB 3ZMTA 3BABA 2EIMC 4JI0B 2R9AA 1NT2B 5FPRA 1IZ3A 5LGUA 3UM7A 3OMNB 1J5EB 3RN4A 5EBMC 5IY5B 1GAXA 2WLLA 2WLJA 1M9NA 1N34B 5F2VO 2BE3A 5LXTA 1AILA 2E5LO 3K58A 5E79Z 1OJHA 2H94A 2HVKC 2ZD9A 3FAVB 4YIOA 2Q9LA 1VARA 5IY5C 5J2TA 5L3EA 3SJAC 3FB5C 1WN7A 4WBNB 2LGQA 2YXLA 4MTGA 1TVKA 1NQTA 3ZHQA 1B04A 4K0KB 1U97A 1VF6C 3AG1C 3ZMUA 5KMGB 3HKDB 4CZZA 2W0FC 4JYAO 1VQOV 4K35A 1NJIW 5LMNO 2Y0IA 4KHPO 1I94O 2JJ1G 3CJHB 1S0VA 4JI2B 3CC7V 3L71H 1W2BU 4E2LA 4UB8Z 2OTLV 4O2AA 2FYUH 1JVMA 2M7WA 4J7JA 2IM9A 5LGTA 1US6A 3RGBA 3SJBC 1VQMV 1YXBA 4J42A 4Z1VA 2R70A 4RUEA 1E79G 1WP8A 3B8MA 2RDCA 1JPXA 3SYCA 2LJ2A 3B2EE 2JRIA 3ML0A 5EK0A 4PI2A 3JD4A 1ZUQA 1ENVA 4U3JB 3ZHRA 4O4JB 4D7SA 1IVSA 4JI8O 1MG1A 2V1DA 1AI5A 3HB3B 3HKEB 4H0LB 1HNWB 1FFXA 2JGDA 1G8MA 3JAWB 2LW1A 1R6KA 4ASUG 2FL4A 3IJ4A 3OTFA 3C90A 4O4LA 1WA8B 4IHJB 4MVZA 4JI6B 3VQWA 2GTSA 4X9QA 2P6JA 4GUNA 1VEWA 3ETEA 1QQCA 2ZE7A 3LNNA 2Y48A 2VQFO 1N36O 4B3TO 3CS5A 4BIZA 1R73A 4B3MB 3L75H 3E8HA 1SERA 4R8CA 4P30A 2QWNB 1FXHA 1JX9A 2UXCB 3CC4V 2X6BA 1GMGA 4X1IA 1Z5WA 4O4HB 3B09A 2X7RB 2KG7B 2QM8A 3D3QA 4JTCB 1XI1A 4GYCB 4JZGA 2HLDG 2WWWA 5CMUA 4LFAO 3OD4A 3D36C 3CHXA 3THOA 1WPXA 5BMVB 2EZOA 1Q6UA 1Q90D 1OCRB 2UU9O 1ZTEA 2ATKC 4JV5B 4OGQB 2IBZH 1SQPH 1Y76A 2UUAO 3JYCA 4DR2B 2DYRB 2P7TC 1R3IC 2BTQB 2Q69A 1N32B 1E1QG 5EIBC 4YY3B 3RVYA 4DO2A 3ABKB 1J5EO 2N05A 2HKOA 1N34O 3OM3B 3HKCA 2DYRC 1Q82W 3JD2A 5K1XA 3CD6V 2UXBB 4ZIBA 2QDOA 1AP5A 3ZCCA 4TV9B 1ZL8B 2Q6AA 1Q6IA 1N4CA 1XNQO 3X2QC 4DV1O 1PNLA 1TUBA 1Y74A 3SJQC 5LMUB 3RW0A 5L3CA 4X64B 5JCOA 2XHBA 4O4IA 3E86A 1WLEA 2YC0A 1VQ4V 2PGGA 1JR9A 2QSAA 1TGOA 1IDSA 2HJFC 4EKWA 4LH6A 3VBBA 1AJQA 3J81N 4DV4B 3JD1A 3MD0A 1JQ0A 2CTRA 4X8AA 5FNVA 2WLIA 2F95B 3CYOA 4DV6O 4ABMA 2Q7EA 1NTMH 4B08A 1QR8A 3DC6A 4JI2O 1AI6A 5KLVH 2QKSA 4X1YA 5KX5A 1RPOA 2EX3A 4IGGA 1H8EG 3SJCC 5J2TB 4CH6A 5KA5A 1KBHA 1BHBA 4X62O 1WPBA 3JSLA 1TVKB 1GO3F 4GKKO 1Q8IA 1NR1A 2B1IA 2ZDIA 3ZS8C 2WLKA 1N33O 4FLZA 2XT9A 3STLC 2RNBA 5A2QN 2DJVA 2Q7HA 4AHCA 1GN3A 4FVMA 1H38A 1NVPD 3T4DA 1PM9A 3OUSA 4L87A 4GX1A 2ZR3A 4O2AB 4UVBA 1YTFD 5IWAB 2F4VO 3CCEV 1H2KA 4PA6A 2N04A 2ZM6B 4BR6A 3JSNA 4PHZA 4EFEA 1FAFA 4BIUA 1YCIA 5LGNA 3TJTA 1SZXA 1HNXB 1VQLV 3FB7C 4QE7A 4QPJA 3ZEDA 4WF9V 1KKCA 1XREA 2QTOA 3OW2U 1Y6XA 3T1CA 4DR4B 2ZINA 2Y4TA 2YIAA 3R65A 3PN1A 3CCQV 2YI8A 5GONA 3AG4B 1FFXB 3SPHA 2WA4A 4UUJC 2RMKB 2LW7A 4PDRA 4UVAA 1XL6A 3C3SA 1IURA 3U10A 1PKXA 4MS2A 2X6AA 4MT8A 3DSQA 1EM1A 5CA1A 1DF4A 4P9OA 1RSOA 2V4DA 3AG2C 4FFBA 1SKVA 5EYPB 3SYPA 2JS3A 1KMIZ 1YJWV 1GM9A 3LSQA 4J7KA 1XBLA 3CCSV 3ZRSA 4B7EA 5KMGA 1SQXH 4X1IB 2Z0AA 1VQ9V 2Q5ZA 3OT7A 1PPJH 4XDLA 2E5LB 3K03A 3M99B 4XDKA 5C8YB 3SPCA 4EB6A 5LMUO 4MSWC 4N21A 2QTSA 4X64O 2X0LA 1OCZB 1Y67A 4KFMA 3ZHTA 4YJ3B 4RUFA 3L70H 1RFYA 3KCYA 1NBMG 3SYOA 2ODMA 1MA1A 4LF6B 1WB8A 4PA9A 2Q73A 4U3JA 4EFBA 4O4JA 5KHKA 1NKDA 4WFFA 4GX2A 3CRMA 1QLNA 4JYAB 3E83A 3HKCB 1M56B 3HKEA 2IH3C 5LMNB 4DV0O 3EXAA 1COWG 2A06H 4IT5A 3ZIAG 4FM0A 1WA8A 4DV2O 2QWPB 3PJSK 1TUBB 1Y74B 3CSXA 4LF5O 1GRJA 3SGIA 2ZXWC 4AI8A 4O4IB 2DN9A 4DR5B 3KKYA 3CEIA 1V55C 3FD9A 2WA3A 4CH3A 2E3CA 2Q4PA 3ZHVA 2EBOA 1PNMA 1BT8A 1YF2A 1U96A 1GN2A 4EEQA 4F6EA 3K57A 2CH7A 2EULA 2LP7A 4MW3A 4NTYA 5FNVB 2WLIB 4ZKIA 5JCOC 1K33A 3M8AA 3ABUA 4JI8B 2YICA 1FJGO 4QE9A 2DW4A 5CB4A 1QVFU 1OCOB 4TV8A 4OXSA 2A9HA 3CRQA 1NU1H 1VF7A 1XUQA 4X1YB 4HBNA 5IWAO 1XNRB 2WSSG 4B7KA 1FKAO 2F43G 2QJ1A 2IH1C 2ZM6O 3E22A 4KL1A 3E8BA 3W7WA 3B40A 1OCOC 1PD3A 1N8RW 2K9PA 4X66O 1HNXO 4B3TB 3QF7A 5KHIA 3JATA 5J9PC 3G80A 4JF3A 1LNQA 3LUTB 4FZ1A 4UFZA 1Q7YW 1AB3A 4DR4O 1NR7A 5EBWC 2ZQMA 1K3EA 2XTAA 1V54B 2KB1A 1WAZA 4DV3O 1M90W 1J95A 5EBLC 1P7BA 2ZDIC 3LDEA 3T1YO 1ZL8A 4FIPC 2GV9A 1R3JC 4B3SB 3J7AU 4LFAB 4ZBMA 4TQFA 1ZSPA 2KQXA 2ZIOA 4NTWA 5H9CA 1SQVH 4UV8A 2UU9B 4U3FH 1LUWA 1BL8A 5IYCO 4HNAB 2GBOA 3U0ZA 2P5OA 5B3SC 1V9PA 3OFNG 2ZIMA 2Q8VA 4R7CA 5GW7A 3JARA 5LBQA 2FKXA 2XAHA 2YIBD 2GTAA 4IYHA 4MVRA 1DTOA 3RYFB 4TSFG 2DWDC 2ARHA 2E76B 5GONB 3WG7C 4UCSA 1K9MW 4IYIA 3K04A 5IJ9A 1XL4A 1XNQB 4DV1B 5CA1B 3L9DA 1GK9A 1RSOB 4LF8O 4I7ZB 4TUYB 4FFBB 4PJ0Z 1KU9A 3ICXA 3ABTA 1BZKA 4LF6O 2QKAA 4PDMA 3GVMA 4R6ZA 4DV6B 1KD1W 4DK1A 1K4DC 1NVPB 1QU7A 2ZR2A 3RYIB 2V7QG 3APOA 1RP3B 2L35A 1WNSA 1YTFB 1EN5A 4YIPA 2QE7G 3RT3C 4EB6B 2BOCC 4UV9A 3L74H 1XEQA 3AK3A 4DR5O 1YVWA 1O9HA 2ZE5A 1SQBH 1BMFG 1YDXA 3H1HH 2OT5A 4X62B 5B5EZ 1EZVH 2XASA 2EIKB 2H3OA 2L6LA 3VQVA 2QA4V 3LNMB 4GKKB 4FK5C 1Q5OA 2YIBA 3MDSA 1N33B 3BRCA 3CXHF
chains in the Genus database with same CATH topology
3DGEA 3JD1A 1JQ0A 3MD0A 4RQEA 3W7TA 1B6QA 5B1OA 4X8AA 3TK1A 2WLIA 5CBFA 2PI4A 3CYOA 4P2ZA 4WFBV 5DN6G 4LP8A 1FS0G 4X88A 2OTJV 2AHZA 1YJ9V 3B8NA 2EIKC 4FPPA 4WFHA 1QVGU 1QR8A 4J9YB 5IYBO 1AI6A 5FL7G 1RPRA 2QKSA 1V54C 4MW8A 4PDLA 2C2AA 3IFXA 1RPOA 3JCZA 3JD3A 1VQKV 1H8EG 1GM7A 3FYEB 1S76D 5KA5A 2EIJB 1BHBA 2XAJA 2EIMB 4I9WA 5KUKA 1I5XA 1K5QA 1TUEB 5LHIA 4MTFA 3T2MA 2WAMA 3MHSC 3P30A 1GM8A 1GO3F 5H6QA 2JJ2G 4HAMA 3SPIA 3G71V 1NR1A 2B1IA 2IJJA 3TCUA 3K9AA 3OE7G 2ZDIA 3K0DA 3K08A 2ITCC 2WLKA 2WLNA 4U7OA 3STLC 5C93A 4MVUA 1YHQV 2EIJC 2XAFA 3CCRV 4YXWG 1GTOA 1H38A 2W6JG 3CCMV 1QBZA 5CA3A 1OCCB 2X6CA 3MHHC 2GHYA 1MSWD 4GT1A 4R50A 2WPDG 1NVPD 1AR1B 1SRYA 2ZXWB 3T4DA 4Q20A 4WFEA 2XNDG 3OUSA 1V55B 2IU3A 4L87A 4MTOA 4GX1A 3VOUA 3DTUB 3KG2A 2ZR3A 3K3WA 4RO2A 4UVBA 1YTFD 1CP9A 4PA7A 1K5SA 2P67A 4XBFA 3CCEV 4PA6A 3CP1A 1ORQC 1OCCC 1ZWIC 4JTDB 4UVCA 3H01A 3W7SA 3E8GA 5HFLA 1W0KG 1PNKA 4BIUA 2IJKA 3ETGA 4JYBA 5B1NA 1F4MA 2QM7A 1P4RA 5LGNA 1EBOA 3AG1B 3QO8A 1VQLV 3FB7C 4QE7A 1OCRC 1YIJV 4MVQA 3ZRXA 4PA3A 4QPJA 3E35A 4WF9V 2QTOA 3OW2U 3LDCA 3T1CA 5CBGA 2D3OW 3R65A 3D36A 3CCQV 3AG4B 2JDIG 1YJNV 3ZRWA 4BW5A 1KP3A 2LFRA 3SPHA 3SYQA 4UUJC 2EILB 1YITV 4UXNA 4PDRA 4UVAA 1XL6A 3ABKC 3BEHA 5L3FA 1PKXA 3K79A 4MVSA 1RM1B 4MS2A 2DQ3A 2X6AA 4MT8A 1YI2V 1KECA 2UXNA 2DYSC 2PI5A 2EINB 2JEXA 1ROPA 3ABLB 1DF4A 3AG3B 4JAUA 2EILC 4MVMA 4P9OA 1Q86W 3AG2C 2NNUA 2HFEC 3CMAV 2Z3YA 3OR6C 1DF5A 3SYPA 4U7NA 1K97A 4LBEC 1M57B 1K7DA 3NXSA 1RM1C 1YJWV 2UXXA 1GM9A 2YEVB 3LSQA 3CCSV 1G4YB 1H2GA 3ZRSA 4CBCA 3HPLC 3FKSG 3QO5A 2EINC 1S5HC 3OUFA 3CCLV 1GKFA 3OGCC 3ABLC 1KQSU 1VQ8V 3IC7A 3AG3C 4I5SA 1VQ9V 3ASOB 4J9ZB 3SYAA 1MABG 2OCCB 3ZMSA 4WFGA 1Y4MA 2P90A 4RAIA 1AI7A 3TETA 4XDLA 3K03A 4H37A 1M57C 4HZ3A 1AROP 3M99B 4DXWA 4F4LA 2B1GA 4XDKA 3CMEV 3ETDA 2IU0A 1VQNV 4FJCC 3SPCA 2BOBC 5B3SB 4MTXA 4MSWC 4N21A 1KP2A 3QO7A 3UKMA 4QJFB 2X0LA 1OCZB 2EZPA 1KKDA 1JCHA 4KFMA 4LC1A 4JASA 3ASOC 1VQ5V 3RVZA 2OCCC 2JEUA 4GX5A 1FXVA 4RUFA 2DQ0A 2IJHA 5IDJA 3G4SV 3D3IA 4QIWF 4QPKA 4XDJA 1NBMG 3WG7B 3SYOA 1EFRG 3FB8C 4PA9A 4PELA 3ZMTA 2EIMC 3F7VC 1NKDA 4WFFA 4GX2A 4KP4A 5LGUA 3I55V 1QLNA 4X89A 3E83A 1HWYA 1F23A 3OMNB 3UM7A 1UJWB 1M56B 5EBMC 5IY5B 2IH3C 5CBHA 1EZJA 2WLLA 2WLJA 1M9NA 1K4CC 1COWG 1DLBA 2CK3G 5L3BA 1SETA 3ZIAG 3PJSK 3CPWU 1R6NA 3EFFK 4LCUC 1QLEB 2H94A 2ZXWC 2Y69B 1F51A 2HVKC 1CPYA 2ZD9A 1V55C 4FMTA 1OHHG 2Z5UA 3FYIB 5IY5C 5L3EA 2HVJC 2EBOA 3OEEG 1PNMA 3ZN0A 3CCVV 1FXKB 3FB5C 2JK5C 4MTGA 1SESA 2LP7A 4MW3A 1KC8W 4ZKIA 2WLIB 1NH2B 1QLEC 1K33A 1NQTA 1YSCA 3ABUA 2LFSA 1Q81W 3JD0A 4MVOA 3AG1C 3BY6A 3ZMUA 4QE9A 3FB6C 3ASNB 2DW4A 4CZZA 1SZTA 1OZ0A 2W0FC 4JPRA 2GSMB 3X2QB 5KA6A 3A0RA 1VQOV 3SPGA 1OCOB 5B1AB 1NJIW 2DWEC 1QVFU 4OXSA 2A9HA 3OR7C 1FXKC 1K73W 5BZBA 1VQPV 2JJ1G 1S0VA 3E8FA 2WSSG 3CC7V 3STZC 1W2BU 4E2LA 2OTLV 3GB7C 1R3LC 2F43G 3AG4C 4N23A 3ZRVA 1JVMA 2M7WA 3IGAC 2IH1C 1F4NA 5LGTA 2HR3A 3ASNC 3E8BA 1VQMV 3W7WA 1OCOC 5B1AC 1PD3A 5CN0A 3WFVA 4RUEA 1N8RW 1E79G 2MK3A 3T4ZA 3SPJA 3CCUV 1S72V 3B8MA 4KUMA 5J9PC 5E1AC 4JF3A 1JPXA 1LNQA 2XAGA 1Y66A 3SYCA 3LUTB 1Q7YW 2IW5A 4G27B 3ML0A 3CC2V 5EK0A 1NR7A 2WLHA 2ZQMA 3JD4A 5EBWC 3W7UA 4JGSA 1H8HG 1K3EA 1ENVA 1K34A 1V54B 4HYOA 1MG1A 1IXMA 2V1DA 3F5WC 1K8AW 2KB1A 1AI5A 3HB3B 1M90W 3OMIB 4G2KA 1J95A 5IYDO 2WLLB 3OAAG 1G8MA 5EBLC 1P7BA 2ZDIC 2R9IA 3LDEA 1R6KA 4FIPC 4ASUG 1R3JC 4ZBMA 5KUMA 4MVZA 4QNHB 2Q68A 5H9CA 3GWOA 4UV8A 2P6JA 1BL8A 5IYCO 1E1RG 4BAYA 3ETEA 4JYCA 5LHGA 5H6RA 2XAQA 2R9RB 5EC1C 3G6EV 5LHHA 5B3SC 2JIZG 2Y48A 3OFNG 1THZA 2A0LA 1OCZC 4BIZA 5GW7A 4R7CA 5EC2C 1R73A 2XOKG 4TT3G 3RBZA 3E8HA 5LBQA 1M1KW 1SERA 2AHYA 4R8CA 5B1BB 4P30A 2XAHA 2YSUB 2YEVA 1FXHA 1JX9A 4MVRA 5DM6V 3CC4V 1DTOA 4TSFG 2DWDC 3ABMB 3F7YC 2X6BA 3ZRWB 1GMGA 3LSSA 1I5YA 1NH2D 3WG7C 1K9MW 1CEZA 3W7XA 3K04A 2A79B 4JAVA 3CCJV 2X7RB 3CXCU 1XL4A 2QM8A 3K0GA 2WLMA 4JTCB 5B1BC 4Z1MG 2ITDC 2HLDG 2WWWA 1M56C 2EJRA 5CMUA 2H8PC 3EHBB 1GK9A 1QR9A 1WPXA 3ABMC 2QEXV 3E2EA 2K1EA 2EZOA 4H33A 3LDDA 2NLJC 1OCRB 2ATKC 3I56V 1MOFA 3ZMVA 3B77A 4GX0A 5L3DA 3K06A 3JYCA 3ABTA 2DYRB 1PL0A 2P7TC 2Y69C 1S3JA 1R3IC 5HFMA 1VQ7V 1QCEA 4WFAV 4PDVA 1AI4A 1BHAA 4PDMA 2Q69A 3OMAB 1E1QG 2FTKA 1VQ6V 3RVYA 4DO2A 4R6ZA 1KD1W 3E89A 3OEHG 1K4DC 3ABKB 4G28B 1NVPB 1L1FA 2W6IG 4P9PA 2ZR2A 2V7QG 1S77D 2HKOA 2IJIA 3OM3B 1YTFB 1JOYA 2B5UA 2DYRC 1Q82W 3JD2A 2QE7G 3QNEA 3CD6V 2DYSB 1W0JG 2BOCC 4UV9A 2HG5C 3ZCCA 2Q6AA 3AG2B 4RQFA 3X2QC 4PA4A 1PNLA 3SJQC 4GCZA 4JTAB 3RW0A 1R3KC 5L3CA 1BMFG 2Q67A 2OT5A 3E86A 4TWKA 3ZN1A 1WLEA 3ZMZA 3AEIA 1VQ4V 2XASA 1JJ2U 1AJPA 2EIKB 2QA4V 1K92A 3LNMB 2HJFC 5L3GA 4EKWA 3ZJZA 1AJNA 3VBBA 1AJQA 4FK5C 3P32A 4WCEV 1FXKA 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  1VQ7 V;  3G6E V;  4WFA V;  3CMA V;  3CME V;  1Q81 W;  3CXC U;  3CCM V;  1K8A W;  1VQM V;  1YIT V;  1VQ6 V;  1VQN V;  1M90 W;  1N8R W;  1YJW V;  1R73 A;  4WFB V;  1KD1 W;  2OTJ V;  1VQL V;  3CCU V;  1YJ9 V;  1VQO V;  1S72 V;  3CCS V;  3I55 V;  1NJI W;  1M1K W;  1QVF U;  1YIJ V;  2QEX V;  1K73 W;  1VQ5 V;  1YI2 V;  1VQ4 V;  3CCV V;  1QVG U;  1VQP V;  4WF9 V;  5DM6 V;  3G71 V;  3CCL V;  2QA4 V;  3OW2 U;  1Q7Y W;  1KQS U;  1JJ2 U;  1VQ8 V;  3CC4 V;  1VQ9 V;  3I56 V;  3CC7 V;  1W2B U;  3CC2 V;  3CCE V;  1Q82 W;  2OTL V;  3CD6 V;  3G4S V;  2D3O W;  1KC8 W;  1K9M W;  1Q86 W;  4WCE V;  3CPW U;  3CCQ V;  1VQK V;  1YHQ V;  1YJN V;  3CCR V; 
#chains in the Genus database with same CATH topology
 4CS4 A;  1WB7 A;  3RYC A;  3W7T A;  2PI4 A;  5CBF A;  4DUZ O;  4LP8 A;  4X88 A;  3B8N A;  3T1H O;  2EIK C;  5JH7 B;  4FPP A;  3K5L A;  2PTM A;  3GWK C;  2D2C B;  1GN6 A;  1XNR O;  5IYB O;  2Y4U A;  3N27 A;  4MW8 A;  2F4V B;  4FM2 A;  5LOV A;  5BR8 O;  1L8D A;  2GUZ B;  4FLY A;  4H13 B;  3S3X A;  1FD9 A;  3SR2 C;  5KUK A;  1I5X A;  4LNU B;  5EYP A;  2CH7 B;  1TUE B;  2AZ0 A;  4MTF A;  4JI7 O;  1XHX A;  1VIB A;  1GM8 A;  2UUC B;  4LF7 O;  2JJ2 G;  4Q6G A;  3G71 V;  3TCU A;  3K9A A;  4X1K A;  4F6R A;  2JGU A;  4AQY O;  5CB4 B;  3CCM V;  5CA3 A;  1OCC B;  2X6C A;  2GHY A;  4TV8 B;  1MSW D;  3K9S A;  2WPD G;  1AR1 B;  2ADP A;  5DED A;  1UPG A;  1SQF A;  4B3S O;  5C8Y A;  3KG2 A;  3K3W A;  1MZF A;  3ZBH A;  1ZAU A;  1ZLZ A;  3E22 B;  3JCU Z;  3M7M X;  1Z2G A;  3CP1 A;  4YJ3 A;  1G6U A;  5B66 Z;  1OCC C;  1HR0 O;  4JTD B;  3E8G A;  3Q4H A;  5HFL A;  1W0K G;  3JAT B;  1PNK A;  5B1N A;  1F4M A;  2QM7 A;  1P4R A;  2DE0 X;  3A0H Z;  5ITZ A;  2VWJ A;  1OCR C;  1NI8 A;  1F7Y A;  5KHJ A;  3LDC A;  2D3O W;  3K5N A;  3R66 A;  4NXM B;  2JDI G;  4DV5 B;  2EIL B;  4ZHQ A;  1YIT V;  4UXN A;  1IBL O;  5KAI Z;  3ZX6 A;  3ABK C;  4UCU A;  4I9Q A;  3WB1 A;  4MVS A;  2YXY A;  2DQ3 A;  4BWA A;  1WJZ A;  4D7T A;  1Q3E A;  2A7W A;  1KEC A;  4J11 A;  4LF9 O;  2PI5 A;  4LFC O;  2EIN B;  1MZE A;  3WB0 A;  4DR7 O;  2JEX A;  3ABL B;  4AIL C;  2EIL C;  4MVM A;  2NNU A;  3JAR B;  3OR6 C;  1DF5 A;  4LBE C;  1M93 A;  3NXS A;  3L73 H;  3O9O A;  1NZ6 A;  2EIN C;  2YS8 A;  3JAS B;  2BSK A;  4DV0 B;  3ABL C;  1KQS U;  3IC7 A;  5IJ9 B;  3UT5 A;  4DR1 O;  4I50 A;  2P90 A;  4DV2 B;  4DRX A;  2B1G A;  4LF5 B;  4YHH O;  2IU0 A;  1VQN V;  3DXR B;  4PV1 B;  2ZT9 B;  4QJF B;  3QO7 A;  2F1M A;  2AZ2 A;  1JCH A;  4LC1 A;  4A5U B;  4GX5 A;  1PP9 H;  2DQ0 A;  2ADQ B;  2IJH A;  4GKJ B;  3D3I A;  2OIG A;  4J10 A;  3WB2 A;  2ZE6 A;  5D5Q A;  4FFK A;  2CAZ C;  3FB8 C;  4PEL A;  4C7U A;  3F7V C;  3JAK A;  1FJG B;  4DK0 A;  3BAA A;  2KKW A;  3I55 V;  2LGW A;  4JI3 O;  1XMQ B;  1EZJ A;  5JJJ B;  3BA9 A;  1P49 A;  5L3B A;  1SET A;  3CPW U;  1X59 A;  3EFF K;  4LCU C;  2JS5 A;  1QLE B;  1XQ8 A;  4HNA A;  2Y69 B;  2Z5U A;  3FYI B;  4X66 B;  4DV7 O;  4DW1 A;  2UUC O;  3OEE G;  1H2M A;  1NS1 A;  2JK5 C;  3LSU A;  3RYC B;  4FLX A;  1QLE C;  3HKB A;  3RYF A;  4W4L A;  2ETN A;  4K8X A;  3BY6 A;  4DV3 B;  1OZ0 A;  4JPR A;  5KA6 A;  3A0R A;  5B1A B;  3T1Y B;  3OR7 C;  3D8C A;  5LOV B;  3CRC A;  3STZ C;  2QWQ B;  3GB7 C;  1R3L C;  3AG4 C;  1D5N A;  3ZRV A;  3G6B A;  1HW7 A;  3JAL A;  2HR3 A;  4TUY A;  3K59 A;  1CXZ B;  5B1A C;  3WFV A;  1VP7 A;  3T4Z A;  4J41 A;  1S72 V;  4X1K B;  4JI5 O;  4F6R B;  1R6T A;  5JWP A;  2IW5 A;  1L0L H;  1BGY H;  2QWO B;  3W7U A;  3RYI A;  4DUY O;  1K34 A;  1WP7 A;  4NXM O;  4DV5 O;  5LA6 A;  1W59 A;  1IXM A;  1H2L A;  2DMX A;  4GZR B;  2YXH A;  3A8T A;  1SF9 A;  1SC5 B;  3OAA G;  1B3Q A;  1SQG A;  2PUS A;  4FLW A;  3Q4H B;  4LF8 B;  4D6T H;  2QGN A;  4GLX A;  5LHG A;  5H6R A;  2R9R B;  5ITZ B;  5LHH A;  2JIZ G;  1OCZ C;  2FML A;  5EC2 C;  1XOU A;  4TT3 G;  2OYQ A;  2CTP A;  3RBZ A;  2CE4 A;  1H2N A;  1M1K W;  2AHY A;  2YEV A;  3RFR A;  2Q7G A;  5JH7 A;  3LSS A;  5LYJ B;  1NH2 D;  4ZHQ B;  1CEZ A;  2A79 B;  4JAV A;  4JAA A;  3KZI Z;  3CXC U;  1B06 A;  3K0G A;  5AG2 A;  2WLM A;  4Z1M G;  2GUZ A;  1D2D A;  1M56 C;  2EJR A;  3EHB B;  3IC9 A;  1QR9 A;  2F66 C;  1MMM A;  2QEX V;  3E2E A;  4H33 A;  2NLJ C;  4LNU A;  3BFR A;  4BIO A;  4GKJ O;  1MOF A;  3ZMV A;  4GX0 A;  3K06 A;  1QNM A;  4B3R B;  1S3J A;  1SA0 A;  5HFM A;  2YDE A;  4WFA V;  1VQ7 V;  1AI4 A;  1BHA A;  3OMA B;  5IJ0 A;  3OEH G;  4DUZ B;  3U11 A;  2BSK B;  1L1F A;  4I55 A;  4YJ2 B;  4P9P A;  3T1H B;  1XMQ O;  3UT5 B;  4I50 B;  2IJI A;  3N2K A;  4DR3 O;  2ZKO A;  4JI1 O;  2B5U A;  4DRX B;  2DYS B;  2CGO A;  5BR8 B;  1W0J G;  4Z2W A;  5JVD A;  2QKC A;  4PA4 A;  4UCV A;  2Q0A A;  4GCZ A;  4JTA B;  4ZOL A;  4TWK A;  3ZN1 A;  2VWK A;  1I0H A;  4JI7 B;  1JJ2 U;  1AJP A;  4LF7 B;  5L3G A;  1HP8 A;  2LO1 A;  1AJN A;  5GTI Z;  1JA8 A;  3ZHS A;  1FXK A;  1FFT B;  3JAK B;  4LWS B;  4AQY B;  1B6Q A;  4LF4 B;  5BXZ A;  2YID A;  4P2Z A;  1H2S B;  4WFB V;  5DN6 G;  1FS0 G;  2O57 A;  4WFH A;  4J9Y B;  4FLT A;  2Q0O C;  2VRZ A;  1MNG A;  1V54 C;  4PDL A;  2E74 B;  4CC5 A;  3BVO A;  2C2A A;  1VMG A;  2UUB O;  3JD3 A;  1VQK V;  5KAF Z;  3HR0 A;  4PI0 A;  1HR0 B;  3FYE B;  5H5N A;  1S76 D;  2E75 B;  3UO2 A;  2XAJ A;  2EIM B;  4I9W A;  4CH5 A;  1K5Q A;  3C3T A;  5LHI A;  2QR4 A;  2CTW A;  5H6Q A;  3P30 A;  3SPI A;  2IJJ A;  3HKB B;  3K0D A;  3K08 A;  2ITC C;  4UCR A;  3CE2 A;  2AXT Z;  4U7O A;  3H9V A;  3JAS A;  4J7Z A;  5C93 A;  5IT9 N;  1ZX3 A;  3CCR V;  1GTO A;  2W6J G;  1QBZ A;  3AG7 A;  4GT1 A;  3FFQ A;  4R50 A;  1IBL B;  1SRY A;  4Q20 A;  2XND G;  2FB5 A;  4MTO A;  4OX9 B;  1Z5V A;  3DXR A;  3VOU A;  3DTU B;  1CP9 A;  1K5S A;  4NVP A;  3JAL B;  3VQY A;  5CA0 A;  1LUV A;  4LF9 B;  4LFC B;  4DR7 B;  1ORQ C;  3JAM N;  1Q43 A;  2IJK A;  3ETG A;  4JYB A;  4CH4 A;  5LL6 Y;  2VQE B;  1EBO A;  3AG1 B;  3QO8 A;  1YIJ V;  3ZRX A;  3A0B Z;  3E35 A;  2P06 A;  5LA6 B;  3DC5 A;  4DR1 B;  5H2F Z;  1YJN V;  3ZRW A;  4BW5 A;  1KP3 A;  2LFR A;  3SYQ A;  1D5A A;  1IXB A;  3IAY A;  4YHH B;  3CWB H;  4DYL A;  2HP8 A;  3UO3 A;  1XHZ A;  1RM1 B;  1L0N H;  3CRR A;  2UXN A;  5JJE B;  4DR6 B;  3TXS A;  2RN9 A;  1ROP A;  4JAU A;  2OWO A;  4B3R O;  3BPZ A;  2HFE C;  3CMA V;  2Z3Y A;  1K97 A;  1NTZ H;  1RM1 C;  3F5T A;  1M4U A;  2UXX A;  2CDY A;  2YEV B;  1G4Y B;  4FZ0 A;  3CB2 A;  1A32 A;  3HPL C;  4JI3 B;  1JFF A;  3QG5 A;  3QO5 A;  1S5H C;  3OUF A;  3CCL V;  1GKF A;  4K3A A;  4LFB O;  4J9Z B;  3SYA A;  2OCC B;  5JJN B;  4WFG A;  2BTO A;  2P4K A;  4JI4 B;  2PYL A;  4H37 A;  4RWU A;  4IIJ A;  4F4L A;  3CME V;  3ETD A;  4JZ2 A;  3UCS C;  4MTX A;  3QVN A;  1DGS A;  4NXN O;  1HDJ A;  3UQ8 A;  4DV7 B;  1VQ5 V;  3RVZ A;  2OCC C;  1XMO O;  2JEU A;  1FXV A;  1X4T A;  1XIL A;  1SA0 B;  2ZCE A;  3MAQ A;  3G4S V;  1TA8 A;  4QPK A;  4XDJ A;  5IJ0 B;  1EFR G;  4I55 B;  4LF4 O;  2NR5 A;  5IYZ A;  2F23 A;  3N2K B;  4KP4 A;  4X65 B;  4X89 A;  1HWY A;  1F23 A;  2CGN A;  1UJW B;  5CBH A;  1EN4 A;  3K5O A;  3N2G A;  1K4C C;  2YUA A;  1HNZ O;  1DLB A;  2CK3 G;  2B9Z A;  5JVD B;  3B4S A;  3OGI B;  2RCV A;  1R6N A;  2EJ7 A;  4ZOL B;  1F51 A;  3H1J H;  1CPY A;  4FMT A;  2UXD O;  1UFI A;  3P3P A;  1OHH G;  2VS0 A;  2HVJ C;  2HHH B;  3ZN0 A;  2OIE A;  3CCV V;  4JI5 B;  3AK2 A;  4I0X A;  1FXK B;  1IBK O;  2DOS A;  1SES A;  4NKG B;  4QGP A;  3K5M A;  1KC8 W;  4KXR A;  1NH2 B;  4DUY B;  3H1L H;  1YSC A;  5FLX N;  2LFS A;  1BQ0 A;  1Q81 W;  3JD0 A;  5LYJ A;  4H44 B;  4JI0 O;  4MVO A;  5JQG A;  3FB6 C;  3ASN B;  3G67 A;  1SZT A;  3X2Q B;  2GSM B;  3SPG A;  2DWE C;  4OX9 O;  1FXK C;  1K73 W;  2ILM A;  5GTH Z;  5BZB A;  1VQP V;  3E8F A;  2GDS A;  4LR3 A;  4N23 A;  4I4T A;  2XUM A;  3IGA C;  1F4N A;  3ASN C;  2HEP A;  1YZB A;  4LH7 A;  5CN0 A;  2VQE O;  2MK3 A;  3SPJ A;  3CCU V;  3BHP A;  4KUM A;  3OTO B;  5E1A C;  5EZY A;  2XAG A;  1Y66 A;  4G27 B;  3WU2 Z;  4YJ2 A;  3CC2 V;  2WLH A;  2ZE8 A;  4JGS A;  1H8H G;  5KHH A;  4HYO A;  3I5D A;  4BW9 A;  1G1X B;  4TOI A;  3NR7 A;  2MW2 B;  4K0K O;  3F5W C;  1K8A W;  3OMI B;  4G2K A;  5IYD O;  2WLL B;  2BCC H;  2R9I A;  5LXT B;  1N0J A;  5CA0 B;  5KUM A;  4QNH B;  2Q68 A;  4DR6 O;  3GWO A;  5J2U A;  4E4E A;  3S3W A;  4UCT A;  2PZS A;  2ZNJ A;  1E1R G;  4BAY A;  4JYC A;  2XAQ A;  5EC1 C;  3G6E V;  4PD4 F;  4X20 A;  4FLU A;  1THZ A;  3H1K H;  5FPO A;  2A0L A;  2XOK G;  5IE9 A;  2OCH A;  4LWS A;  3FX7 A;  5B1B B;  2YSU B;  1JMK C;  5DM6 V;  2RJZ A;  3ABM B;  4DR3 B;  3F7Y C;  3ZRW B;  1I5Y A;  3AK1 A;  4JI1 B;  4JI4 O;  3W7X A;  3CCJ V;  4NR1 A;  5LP6 A;  1HNW O;  4O2B A;  3O65 A;  4FLV A;  5B1B C;  2ITD C;  4CS2 A;  2H8P C;  1GN4 A;  3ABM C;  2W0X A;  4JI6 O;  2K1E A;  3LDD A;  2QM4 A;  3I56 V;  3SDL A;  1EN6 A;  3B77 A;  3L72 H;  5L3D A;  2P4V A;  1S5L Z;  1FYJ A;  1PL0 A;  2Y69 C;  4ZI7 A;  1QCE A;  4PDV A;  1GH6 A;  5TIS Z;  1VQ6 V;  2FTK A;  4NTX A;  4B3M O;  5KHG A;  3RYH A;  1JFF B;  3E89 A;  4G28 B;  2PY5 A;  2W6I G;  4X65 O;  2AW9 A;  2UXC O;  1S77 D;  5D5P A;  1BSM A;  1JOY A;  4IIJ B;  3QNE A;  2UUB B;  2JGD B;  2HG5 C;  1BCC H;  3AG2 B;  4RQF A;  1KYO F;  4O4L B;  1I7F A;  1R3K C;  2QWR B;  2ZNI A;  1URF A;  2Q67 A;  3FAV A;  1IBM B;  4UCO A;  3ZMZ A;  2HHH O;  3AEI A;  1VF6 A;  4JV5 O;  1K92 A;  3ZJZ A;  2P22 C;  3ETQ A;  1BS3 A;  2YI9 A;  4DR2 O;  3P32 A;  4WCE V;  4WBN A;  3RWR D;  5IYZ B;  4K8Z A;  2CUG A;  3DGE A;  1N32 O;  4RQE A;  1P7G A;  5B1O A;  1OV9 A;  4YY3 O;  3TK1 A;  1FPO A;  1I08 A;  2OTJ V;  3N2G B;  2AHZ A;  1YJ9 V;  3HKD A;  2JVD A;  1QVG U;  5FL7 G;  1RPR A;  2UXB O;  1KB9 F;  3IFX A;  3JCZ A;  3CJH A;  1GM7 A;  1P84 F;  5BY1 A;  3TGU H;  2EIJ B;  1T5E A;  1BE3 H;  3BA8 A;  5EIB D;  4NB5 A;  1S5J A;  4I0X B;  5A9G A;  2AGA A;  3T2M A;  3OTO O;  4DW0 A;  1KUQ A;  2WAM A;  3MHS C;  1Y76 B;  4IL6 Z;  4HAM A;  3OE7 G;  3QTC A;  2WLN A;  5JQG B;  1PL4 A;  4DV4 O;  4MVU A;  1YHQ V;  2EIJ C;  2XAF A;  4YXW G;  1AR5 A;  2NN4 A;  3MHH C;  1AP6 A;  1DK1 A;  2ZXW B;  4TQD A;  4WFE A;  4CC6 A;  1V55 B;  2M6Y A;  2IU3 A;  2RQ6 A;  3BCC H;  4OPH A;  4ICG A;  3JAW A;  4I4T B;  4RO2 A;  4W4K A;  1I94 B;  4KHP B;  4PA7 A;  2P67 A;  4XBF A;  1M5I A;  3ZHU A;  4IHJ A;  3A2F A;  2R72 A;  2HJD A;  1ZWI C;  4NYK A;  4UVC A;  3H01 A;  1N0N A;  3W7S A;  2N74 A;  5DEC A;  5EZY B;  4FM1 A;  4MVQ A;  1YEW A;  4PA3 A;  1VF5 B;  3VQX A;  4LFB B;  5CBG A;  1JJO A;  3APQ A;  3D36 A;  1R1B A;  2LQT A;  2PF4 E;  3KCX A;  2A3Q A;  4O4H A;  3BEH A;  2CTQ A;  5L3F A;  4JYY A;  3K79 A;  1IX9 A;  2KG7 A;  5J2U B;  1AR4 A;  2G38 A;  4NXN B;  3P3N A;  2Y0P A;  1YI2 V;  5KX5 B;  3CRA A;  1XMO B;  2DYS C;  5BMV A;  3TXQ A;  4CS3 A;  3AG3 B;  4X20 B;  1Q86 W;  2KSD A;  3J80 N;  4U7N A;  2VQF B;  1N36 B;  1M57 B;  1K7D A;  4J80 A;  4L8J A;  2BTQ A;  2PYJ A;  1H2G A;  4CBC A;  4UB6 Z;  3FKS G;  3EVK A;  1VQ8 V;  3OGC C;  1PV0 A;  3AG3 C;  4I5S A;  3ASO B;  1MSD A;  1MAB G;  1XDC A;  3ZMS A;  1HNZ B;  1Y4M A;  4RAI A;  1BQZ A;  5LP6 B;  1AI7 A;  1Q6H A;  4O2B B;  3TET A;  3H1I H;  1M57 C;  4HZ3 A;  1ARO P;  4DXW A;  3CX5 F;  4FJC C;  2BOB C;  5B3S B;  3UKM A;  1KP2 A;  4TV9 A;  1AVM A;  2UXD B;  2EZP A;  1KKD A;  5K1P A;  4OPA A;  4JAS A;  1IBM O;  1TAE A;  3ASO C;  1NTK H;  1QHT A;  1SS3 A;  5LP6 C;  1O9G A;  4ZI7 B;  1IBK B;  5IDJ A;  1LR1 A;  2F93 B;  1SQQ H;  4QIW F;  2UUA B;  3WG7 B;  3RYH B;  3ZMT A;  3BAB A;  2EIM C;  4JI0 B;  2R9A A;  1NT2 B;  5FPR A;  1IZ3 A;  5LGU A;  3UM7 A;  3OMN B;  1J5E B;  3RN4 A;  5EBM C;  5IY5 B;  1GAX A;  2WLL A;  2WLJ A;  1M9N A;  1N34 B;  5F2V O;  2BE3 A;  5LXT A;  1AIL A;  2E5L O;  3K58 A;  5E79 Z;  1OJH A;  2H94 A;  2HVK C;  2ZD9 A;  3FAV B;  4YIO A;  2Q9L A;  1VAR A;  5IY5 C;  5J2T A;  5L3E A;  3SJA C;  3FB5 C;  1WN7 A;  4WBN B;  2LGQ A;  2YXL A;  4MTG A;  1TVK A;  1NQT A;  3ZHQ A;  1B04 A;  4K0K B;  1U97 A;  1VF6 C;  3AG1 C;  3ZMU A;  5KMG B;  3HKD B;  4CZZ A;  2W0F C;  4JYA O;  1VQO V;  4K35 A;  1NJI W;  5LMN O;  2Y0I A;  4KHP O;  1I94 O;  2JJ1 G;  3CJH B;  1S0V A;  4JI2 B;  3CC7 V;  3L71 H;  1W2B U;  4E2L A;  4UB8 Z;  2OTL V;  4O2A A;  2FYU H;  1JVM A;  2M7W A;  4J7J A;  2IM9 A;  5LGT A;  1US6 A;  3RGB A;  3SJB C;  1VQM V;  1YXB A;  4J42 A;  4Z1V A;  2R70 A;  4RUE A;  1E79 G;  1WP8 A;  3B8M A;  2RDC A;  1JPX A;  3SYC A;  2LJ2 A;  3B2E E;  2JRI A;  3ML0 A;  5EK0 A;  4PI2 A;  3JD4 A;  1ZUQ A;  1ENV A;  4U3J B;  3ZHR A;  4O4J B;  4D7S A;  1IVS A;  4JI8 O;  1MG1 A;  2V1D A;  1AI5 A;  3HB3 B;  3HKE B;  4H0L B;  1HNW B;  1FFX A;  2JGD A;  1G8M A;  3JAW B;  2LW1 A;  1R6K A;  4ASU G;  2FL4 A;  3IJ4 A;  3OTF A;  3C90 A;  4O4L A;  1WA8 B;  4IHJ B;  4MVZ A;  4JI6 B;  3VQW A;  2GTS A;  4X9Q A;  2P6J A;  4GUN A;  1VEW A;  3ETE A;  1QQC A;  2ZE7 A;  3LNN A;  2Y48 A;  2VQF O;  1N36 O;  4B3T O;  3CS5 A;  4BIZ A;  1R73 A;  4B3M B;  3L75 H;  3E8H A;  1SER A;  4R8C A;  4P30 A;  2QWN B;  1FXH A;  1JX9 A;  2UXC B;  3CC4 V;  2X6B A;  1GMG A;  4X1I A;  1Z5W A;  4O4H B;  3B09 A;  2X7R B;  2KG7 B;  2QM8 A;  3D3Q A;  4JTC B;  1XI1 A;  4GYC B;  4JZG A;  2HLD G;  2WWW A;  5CMU A;  4LFA O;  3OD4 A;  3D36 C;  3CHX A;  3THO A;  1WPX A;  5BMV B;  2EZO A;  1Q6U A;  1Q90 D;  1OCR B;  2UU9 O;  1ZTE A;  2ATK C;  4JV5 B;  4OGQ B;  2IBZ H;  1SQP H;  1Y76 A;  2UUA O;  3JYC A;  4DR2 B;  2DYR B;  2P7T C;  1R3I C;  2BTQ B;  2Q69 A;  1N32 B;  1E1Q G;  5EIB C;  4YY3 B;  3RVY A;  4DO2 A;  3ABK B;  1J5E O;  2N05 A;  2HKO A;  1N34 O;  3OM3 B;  3HKC A;  2DYR C;  1Q82 W;  3JD2 A;  5K1X A;  3CD6 V;  2UXB B;  4ZIB A;  2QDO A;  1AP5 A;  3ZCC A;  4TV9 B;  1ZL8 B;  2Q6A A;  1Q6I A;  1N4C A;  1XNQ O;  3X2Q C;  4DV1 O;  1PNL A;  1TUB A;  1Y74 A;  3SJQ C;  5LMU B;  3RW0 A;  5L3C A;  4X64 B;  5JCO A;  2XHB A;  4O4I A;  3E86 A;  1WLE A;  2YC0 A;  1VQ4 V;  2PGG A;  1JR9 A;  2QSA A;  1TGO A;  1IDS A;  2HJF C;  4EKW A;  4LH6 A;  3VBB A;  1AJQ A;  3J81 N;  4DV4 B;  3JD1 A;  3MD0 A;  1JQ0 A;  2CTR A;  4X8A A;  5FNV A;  2WLI A;  2F95 B;  3CYO A;  4DV6 O;  4ABM A;  2Q7E A;  1NTM H;  4B08 A;  1QR8 A;  3DC6 A;  4JI2 O;  1AI6 A;  5KLV H;  2QKS A;  4X1Y A;  5KX5 A;  1RPO A;  2EX3 A;  4IGG A;  1H8E G;  3SJC C;  5J2T B;  4CH6 A;  5KA5 A;  1KBH A;  1BHB A;  4X62 O;  1WPB A;  3JSL A;  1TVK B;  1GO3 F;  4GKK O;  1Q8I A;  1NR1 A;  2B1I A;  2ZDI A;  3ZS8 C;  2WLK A;  1N33 O;  4FLZ A;  2XT9 A;  3STL C;  2RNB A;  5A2Q N;  2DJV A;  2Q7H A;  4AHC A;  1GN3 A;  4FVM A;  1H38 A;  1NVP D;  3T4D A;  1PM9 A;  3OUS A;  4L87 A;  4GX1 A;  2ZR3 A;  4O2A B;  4UVB A;  1YTF D;  5IWA B;  2F4V O;  3CCE V;  1H2K A;  4PA6 A;  2N04 A;  2ZM6 B;  4BR6 A;  3JSN A;  4PHZ A;  4EFE A;  1FAF A;  4BIU A;  1YCI A;  5LGN A;  3TJT A;  1SZX A;  1HNX B;  1VQL V;  3FB7 C;  4QE7 A;  4QPJ A;  3ZED A;  4WF9 V;  1KKC A;  1XRE A;  2QTO A;  3OW2 U;  1Y6X A;  3T1C A;  4DR4 B;  2ZIN A;  2Y4T A;  2YIA A;  3R65 A;  3PN1 A;  3CCQ V;  2YI8 A;  5GON A;  3AG4 B;  1FFX B;  3SPH A;  2WA4 A;  4UUJ C;  2RMK B;  2LW7 A;  4PDR A;  4UVA A;  1XL6 A;  3C3S A;  1IUR A;  3U10 A;  1PKX A;  4MS2 A;  2X6A A;  4MT8 A;  3DSQ A;  1EM1 A;  5CA1 A;  1DF4 A;  4P9O A;  1RSO A;  2V4D A;  3AG2 C;  4FFB A;  1SKV A;  5EYP B;  3SYP A;  2JS3 A;  1KMI Z;  1YJW V;  1GM9 A;  3LSQ A;  4J7K A;  1XBL A;  3CCS V;  3ZRS A;  4B7E A;  5KMG A;  1SQX H;  4X1I B;  2Z0A A;  1VQ9 V;  2Q5Z A;  3OT7 A;  1PPJ H;  4XDL A;  2E5L B;  3K03 A;  3M99 B;  4XDK A;  5C8Y B;  3SPC A;  4EB6 A;  5LMU O;  4MSW C;  4N21 A;  2QTS A;  4X64 O;  2X0L A;  1OCZ B;  1Y67 A;  4KFM A;  3ZHT A;  4YJ3 B;  4RUF A;  3L70 H;  1RFY A;  3KCY A;  1NBM G;  3SYO A;  2ODM A;  1MA1 A;  4LF6 B;  1WB8 A;  4PA9 A;  2Q73 A;  4U3J A;  4EFB A;  4O4J A;  5KHK A;  1NKD A;  4WFF A;  4GX2 A;  3CRM A;  1QLN A;  4JYA B;  3E83 A;  3HKC B;  1M56 B;  3HKE A;  2IH3 C;  5LMN B;  4DV0 O;  3EXA A;  1COW G;  2A06 H;  4IT5 A;  3ZIA G;  4FM0 A;  1WA8 A;  4DV2 O;  2QWP B;  3PJS K;  1TUB B;  1Y74 B;  3CSX A;  4LF5 O;  1GRJ A;  3SGI A;  2ZXW C;  4AI8 A;  4O4I B;  2DN9 A;  4DR5 B;  3KKY A;  3CEI A;  1V55 C;  3FD9 A;  2WA3 A;  4CH3 A;  2E3C A;  2Q4P A;  3ZHV A;  2EBO A;  1PNM A;  1BT8 A;  1YF2 A;  1U96 A;  1GN2 A;  4EEQ A;  4F6E A;  3K57 A;  2CH7 A;  2EUL A;  2LP7 A;  4MW3 A;  4NTY A;  5FNV B;  2WLI B;  4ZKI A;  5JCO C;  1K33 A;  3M8A A;  3ABU A;  4JI8 B;  2YIC A;  1FJG O;  4QE9 A;  2DW4 A;  5CB4 A;  1QVF U;  1OCO B;  4TV8 A;  4OXS A;  2A9H A;  3CRQ A;  1NU1 H;  1VF7 A;  1XUQ A;  4X1Y B;  4HBN A;  5IWA O;  1XNR B;  2WSS G;  4B7K A;  1FKA O;  2F43 G;  2QJ1 A;  2IH1 C;  2ZM6 O;  3E22 A;  4KL1 A;  3E8B A;  3W7W A;  3B40 A;  1OCO C;  1PD3 A;  1N8R W;  2K9P A;  4X66 O;  1HNX O;  4B3T B;  3QF7 A;  5KHI A;  3JAT A;  5J9P C;  3G80 A;  4JF3 A;  1LNQ A;  3LUT B;  4FZ1 A;  4UFZ A;  1Q7Y W;  1AB3 A;  4DR4 O;  1NR7 A;  5EBW C;  2ZQM A;  1K3E A;  2XTA A;  1V54 B;  2KB1 A;  1WAZ A;  4DV3 O;  1M90 W;  1J95 A;  5EBL C;  1P7B A;  2ZDI C;  3LDE A;  3T1Y O;  1ZL8 A;  4FIP C;  2GV9 A;  1R3J C;  4B3S B;  3J7A U;  4LFA B;  4ZBM A;  4TQF A;  1ZSP A;  2KQX A;  2ZIO A;  4NTW A;  5H9C A;  1SQV H;  4UV8 A;  2UU9 B;  4U3F H;  1LUW A;  1BL8 A;  5IYC O;  4HNA B;  2GBO A;  3U0Z A;  2P5O A;  5B3S C;  1V9P A;  3OFN G;  2ZIM A;  2Q8V A;  4R7C A;  5GW7 A;  3JAR A;  5LBQ A;  2FKX A;  2XAH A;  2YIB D;  2GTA A;  4IYH A;  4MVR A;  1DTO A;  3RYF B;  4TSF G;  2DWD C;  2ARH A;  2E76 B;  5GON B;  3WG7 C;  4UCS A;  1K9M W;  4IYI A;  3K04 A;  5IJ9 A;  1XL4 A;  1XNQ B;  4DV1 B;  5CA1 B;  3L9D A;  1GK9 A;  1RSO B;  4LF8 O;  4I7Z B;  4TUY B;  4FFB B;  4PJ0 Z;  1KU9 A;  3ICX A;  3ABT A;  1BZK A;  4LF6 O;  2QKA A;  4PDM A;  3GVM A;  4R6Z A;  4DV6 B;  1KD1 W;  4DK1 A;  1K4D C;  1NVP B;  1QU7 A;  2ZR2 A;  3RYI B;  2V7Q G;  3APO A;  1RP3 B;  2L35 A;  1WNS A;  1YTF B;  1EN5 A;  4YIP A;  2QE7 G;  3RT3 C;  4EB6 B;  2BOC C;  4UV9 A;  3L74 H;  1XEQ A;  3AK3 A;  4DR5 O;  1YVW A;  1O9H A;  2ZE5 A;  1SQB H;  1BMF G;  1YDX A;  3H1H H;  2OT5 A;  4X62 B;  5B5E Z;  1EZV H;  2XAS A;  2EIK B;  2H3O A;  2L6L A;  3VQV A;  2QA4 V;  3LNM B;  4GKK B;  4FK5 C;  1Q5O A;  2YIB A;  3MDS A;  1N33 B;  3BRC A;  3CXH F; 
#chains in the Genus database with same CATH homology
 3DGE A;  3JD1 A;  1JQ0 A;  3MD0 A;  4RQE A;  3W7T A;  1B6Q A;  5B1O A;  4X8A A;  3TK1 A;  2WLI A;  5CBF A;  2PI4 A;  3CYO A;  4P2Z A;  4WFB V;  5DN6 G;  4LP8 A;  1FS0 G;  4X88 A;  2OTJ V;  2AHZ A;  1YJ9 V;  3B8N A;  2EIK C;  4FPP A;  4WFH A;  1QVG U;  1QR8 A;  4J9Y B;  5IYB O;  1AI6 A;  5FL7 G;  1RPR A;  2QKS A;  1V54 C;  4MW8 A;  4PDL A;  2C2A A;  3IFX A;  1RPO A;  3JCZ A;  3JD3 A;  1VQK V;  1H8E G;  1GM7 A;  3FYE B;  1S76 D;  5KA5 A;  2EIJ B;  1BHB A;  2XAJ A;  2EIM B;  4I9W A;  5KUK A;  1I5X A;  1K5Q A;  1TUE B;  5LHI A;  4MTF A;  3T2M A;  2WAM A;  3MHS C;  3P30 A;  1GM8 A;  1GO3 F;  5H6Q A;  2JJ2 G;  4HAM A;  3SPI A;  3G71 V;  1NR1 A;  2B1I A;  2IJJ A;  3TCU A;  3K9A A;  3OE7 G;  2ZDI A;  3K0D A;  3K08 A;  2ITC C;  2WLK A;  2WLN A;  4U7O A;  3STL C;  5C93 A;  4MVU A;  1YHQ V;  2EIJ C;  2XAF A;  3CCR V;  4YXW G;  1GTO A;  1H38 A;  2W6J G;  3CCM V;  1QBZ A;  5CA3 A;  1OCC B;  2X6C A;  3MHH C;  2GHY A;  1MSW D;  4GT1 A;  4R50 A;  2WPD G;  1NVP D;  1AR1 B;  1SRY A;  2ZXW B;  3T4D A;  4Q20 A;  4WFE A;  2XND G;  3OUS A;  1V55 B;  2IU3 A;  4L87 A;  4MTO A;  4GX1 A;  3VOU A;  3DTU B;  3KG2 A;  2ZR3 A;  3K3W A;  4RO2 A;  4UVB A;  1YTF D;  1CP9 A;  4PA7 A;  1K5S A;  2P67 A;  4XBF A;  3CCE V;  4PA6 A;  3CP1 A;  1ORQ C;  1OCC C;  1ZWI C;  4JTD B;  4UVC A;  3H01 A;  3W7S A;  3E8G A;  5HFL A;  1W0K G;  1PNK A;  4BIU A;  2IJK A;  3ETG A;  4JYB A;  5B1N A;  1F4M A;  2QM7 A;  1P4R A;  5LGN A;  1EBO A;  3AG1 B;  3QO8 A;  1VQL V;  3FB7 C;  4QE7 A;  1OCR C;  1YIJ V;  4MVQ A;  3ZRX A;  4PA3 A;  4QPJ A;  3E35 A;  4WF9 V;  2QTO A;  3OW2 U;  3LDC A;  3T1C A;  5CBG A;  2D3O W;  3R65 A;  3D36 A;  3CCQ V;  3AG4 B;  2JDI G;  1YJN V;  3ZRW A;  4BW5 A;  1KP3 A;  2LFR A;  3SPH A;  3SYQ A;  4UUJ C;  2EIL B;  1YIT V;  4UXN A;  4PDR A;  4UVA A;  1XL6 A;  3ABK C;  3BEH A;  5L3F A;  1PKX A;  3K79 A;  4MVS A;  1RM1 B;  4MS2 A;  2DQ3 A;  2X6A A;  4MT8 A;  1YI2 V;  1KEC A;  2UXN A;  2DYS C;  2PI5 A;  2EIN B;  2JEX A;  1ROP A;  3ABL B;  1DF4 A;  3AG3 B;  4JAU A;  2EIL C;  4MVM A;  4P9O A;  1Q86 W;  3AG2 C;  2NNU A;  2HFE C;  3CMA V;  2Z3Y A;  3OR6 C;  1DF5 A;  3SYP A;  4U7N A;  1K97 A;  4LBE C;  1M57 B;  1K7D A;  3NXS A;  1RM1 C;  1YJW V;  2UXX A;  1GM9 A;  2YEV B;  3LSQ A;  3CCS V;  1G4Y B;  1H2G A;  3ZRS A;  4CBC A;  3HPL C;  3FKS G;  3QO5 A;  2EIN C;  1S5H C;  3OUF A;  3CCL V;  1GKF A;  3OGC C;  3ABL C;  1KQS U;  1VQ8 V;  3IC7 A;  3AG3 C;  4I5S A;  1VQ9 V;  3ASO B;  4J9Z B;  3SYA A;  1MAB G;  2OCC B;  3ZMS A;  4WFG A;  1Y4M A;  2P90 A;  4RAI A;  1AI7 A;  3TET A;  4XDL A;  3K03 A;  4H37 A;  1M57 C;  4HZ3 A;  1ARO P;  3M99 B;  4DXW A;  4F4L A;  2B1G A;  4XDK A;  3CME V;  3ETD A;  2IU0 A;  1VQN V;  4FJC C;  3SPC A;  2BOB C;  5B3S B;  4MTX A;  4MSW C;  4N21 A;  1KP2 A;  3QO7 A;  3UKM A;  4QJF B;  2X0L A;  1OCZ B;  2EZP A;  1KKD A;  1JCH A;  4KFM A;  4LC1 A;  4JAS A;  3ASO C;  1VQ5 V;  3RVZ A;  2OCC C;  2JEU A;  4GX5 A;  1FXV A;  4RUF A;  2DQ0 A;  2IJH A;  5IDJ A;  3G4S V;  3D3I A;  4QIW F;  4QPK A;  4XDJ A;  1NBM G;  3WG7 B;  3SYO A;  1EFR G;  3FB8 C;  4PA9 A;  4PEL A;  3ZMT A;  2EIM C;  3F7V C;  1NKD A;  4WFF A;  4GX2 A;  4KP4 A;  5LGU A;  3I55 V;  1QLN A;  4X89 A;  3E83 A;  1HWY A;  1F23 A;  3OMN B;  3UM7 A;  1UJW B;  1M56 B;  5EBM C;  5IY5 B;  2IH3 C;  5CBH A;  1EZJ A;  2WLL A;  2WLJ A;  1M9N A;  1K4C C;  1COW G;  1DLB A;  2CK3 G;  5L3B A;  1SET A;  3ZIA G;  3PJS K;  3CPW U;  1R6N A;  3EFF K;  4LCU C;  1QLE B;  2H94 A;  2ZXW C;  2Y69 B;  1F51 A;  2HVK C;  1CPY A;  2ZD9 A;  1V55 C;  4FMT A;  1OHH G;  2Z5U A;  3FYI B;  5IY5 C;  5L3E A;  2HVJ C;  2EBO A;  3OEE G;  1PNM A;  3ZN0 A;  3CCV V;  1FXK B;  3FB5 C;  2JK5 C;  4MTG A;  1SES A;  2LP7 A;  4MW3 A;  1KC8 W;  4ZKI A;  2WLI B;  1NH2 B;  1QLE C;  1K33 A;  1NQT A;  1YSC A;  3ABU A;  2LFS A;  1Q81 W;  3JD0 A;  4MVO A;  3AG1 C;  3BY6 A;  3ZMU A;  4QE9 A;  3FB6 C;  3ASN B;  2DW4 A;  4CZZ A;  1SZT A;  1OZ0 A;  2W0F C;  4JPR A;  2GSM B;  3X2Q B;  5KA6 A;  3A0R A;  1VQO V;  3SPG A;  1OCO B;  5B1A B;  1NJI W;  2DWE C;  1QVF U;  4OXS A;  2A9H A;  3OR7 C;  1FXK C;  1K73 W;  5BZB A;  1VQP V;  2JJ1 G;  1S0V A;  3E8F A;  2WSS G;  3CC7 V;  3STZ C;  1W2B U;  4E2L A;  2OTL V;  3GB7 C;  1R3L C;  2F43 G;  3AG4 C;  4N23 A;  3ZRV A;  1JVM A;  2M7W A;  3IGA C;  2IH1 C;  1F4N A;  5LGT A;  2HR3 A;  3ASN C;  3E8B A;  1VQM V;  3W7W A;  1OCO C;  5B1A C;  1PD3 A;  5CN0 A;  3WFV A;  4RUE A;  1N8R W;  1E79 G;  2MK3 A;  3T4Z A;  3SPJ A;  3CCU V;  1S72 V;  3B8M A;  4KUM A;  5J9P C;  5E1A C;  4JF3 A;  1JPX A;  1LNQ A;  2XAG A;  1Y66 A;  3SYC A;  3LUT B;  1Q7Y W;  2IW5 A;  4G27 B;  3ML0 A;  3CC2 V;  5EK0 A;  1NR7 A;  2WLH A;  2ZQM A;  3JD4 A;  5EBW C;  3W7U A;  4JGS A;  1H8H G;  1K3E A;  1ENV A;  1K34 A;  1V54 B;  4HYO A;  1MG1 A;  1IXM A;  2V1D A;  3F5W C;  1K8A W;  2KB1 A;  1AI5 A;  3HB3 B;  1M90 W;  3OMI B;  4G2K A;  1J95 A;  5IYD O;  2WLL B;  3OAA G;  1G8M A;  5EBL C;  1P7B A;  2ZDI C;  2R9I A;  3LDE A;  1R6K A;  4FIP C;  4ASU G;  1R3J C;  4ZBM A;  5KUM A;  4MVZ A;  4QNH B;  2Q68 A;  5H9C A;  3GWO A;  4UV8 A;  2P6J A;  1BL8 A;  5IYC O;  1E1R G;  4BAY A;  3ETE A;  4JYC A;  5LHG A;  5H6R A;  2XAQ A;  2R9R B;  5EC1 C;  3G6E V;  5LHH A;  5B3S C;  2JIZ G;  2Y48 A;  3OFN G;  1THZ A;  2A0L A;  1OCZ C;  4BIZ A;  5GW7 A;  4R7C A;  5EC2 C;  1R73 A;  2XOK G;  4TT3 G;  3RBZ A;  3E8H A;  5LBQ A;  1M1K W;  1SER A;  2AHY A;  4R8C A;  5B1B B;  4P30 A;  2XAH A;  2YSU B;  2YEV A;  1FXH A;  1JX9 A;  4MVR A;  5DM6 V;  3CC4 V;  1DTO A;  4TSF G;  2DWD C;  3ABM B;  3F7Y C;  2X6B A;  3ZRW B;  1GMG A;  3LSS A;  1I5Y A;  1NH2 D;  3WG7 C;  1K9M W;  1CEZ A;  3W7X A;  3K04 A;  2A79 B;  4JAV A;  3CCJ V;  2X7R B;  3CXC U;  1XL4 A;  2QM8 A;  3K0G A;  2WLM A;  4JTC B;  5B1B C;  4Z1M G;  2ITD C;  2HLD G;  2WWW A;  1M56 C;  2EJR A;  5CMU A;  2H8P C;  3EHB B;  1GK9 A;  1QR9 A;  1WPX A;  3ABM C;  2QEX V;  3E2E A;  2K1E A;  2EZO A;  4H33 A;  3LDD A;  2NLJ C;  1OCR B;  2ATK C;  3I56 V;  1MOF A;  3ZMV A;  3B77 A;  4GX0 A;  5L3D A;  3K06 A;  3JYC A;  3ABT A;  2DYR B;  1PL0 A;  2P7T C;  2Y69 C;  1S3J A;  1R3I C;  5HFM A;  1VQ7 V;  1QCE A;  4WFA V;  4PDV A;  1AI4 A;  1BHA A;  4PDM A;  2Q69 A;  3OMA B;  1E1Q G;  2FTK A;  1VQ6 V;  3RVY A;  4DO2 A;  4R6Z A;  1KD1 W;  3E89 A;  3OEH G;  1K4D C;  3ABK B;  4G28 B;  1NVP B;  1L1F A;  2W6I G;  4P9P A;  2ZR2 A;  2V7Q G;  1S77 D;  2HKO A;  2IJI A;  3OM3 B;  1YTF B;  1JOY A;  2B5U A;  2DYR C;  1Q82 W;  3JD2 A;  2QE7 G;  3QNE A;  3CD6 V;  2DYS B;  1W0J G;  2BOC C;  4UV9 A;  2HG5 C;  3ZCC A;  2Q6A A;  3AG2 B;  4RQF A;  3X2Q C;  4PA4 A;  1PNL A;  3SJQ C;  4GCZ A;  4JTA B;  3RW0 A;  1R3K C;  5L3C A;  1BMF G;  2Q67 A;  2OT5 A;  3E86 A;  4TWK A;  3ZN1 A;  1WLE A;  3ZMZ A;  3AEI A;  1VQ4 V;  2XAS A;  1JJ2 U;  1AJP A;  2EIK B;  2QA4 V;  1K92 A;  3LNM B;  2HJF C;  5L3G A;  4EKW A;  3ZJZ A;  1AJN A;  3VBB A;  1AJQ A;  4FK5 C;  3P32 A;  4WCE V;  1FXK A;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...