1QVFU

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvfU00
1K73W 3CCLV 1K8AW 3CC2V 1VQNV 1Q81W 1N8RW 1KQSU 1QVFU 4WCEV 1W2BU 3CCEV 2OTLV 1KD1W 1YITV 1R73A 1K9MW 3I55V 3CMEV 3CXCU 1VQMV 4WFBV 1YJ9V 3CCMV 1Q7YW 1KC8W 3G6EV 1YJWV 1QVGU 1M1KW 1VQKV 1VQ8V 5DM6V 1VQOV 1M90W 1VQLV 1JJ2U 1VQ9V 3G71V 3CCRV 3OW2U 3CCVV 3CD6V 1YIJV 1Q82W 3I56V 4WFAV 4WF9V 1S72V 1YI2V 3G4SV 1VQPV 3CC7V 1Q86W 3CPWU 3CCSV 2QA4V 1NJIW 3CC4V 1VQ6V 3CMAV 1VQ4V 1VQ5V 1YJNV 1YHQV 2D3OW 3CCJV 3CCQV 2QEXV 3CCUV 1VQ7V 2OTJV
chains in the Genus database with same CATH superfamily
4RAIA 4FM0A 2ZNIA 2EILC 5FL7G 1B3QA 3ZS8C 4GLXA 1HNZB 4I4TB 1VQOV 1B04A 3S3XA 4PA6A 1QQCA 3CEIA 3ZCCA 1K3EA 3ZMVA 2PF4E 2CTWA 2LGWA 4MW8A 3ABMB 4DR1O 1XNQB 3CRMA 2WAMA 3LNNA 3BEHA 1XILA 2E5LO 4ZI7B 1H2GA 1AJPA 4EKWA 5JVDB 4FVMA 3AG4B 2QWNB 3HKBB 1M90W 1JJ2U 3D3QA 1HR0B 4TUYB 1VQ9V 2HJFC 2JVDA 4J10A 5K1XA 4MVRA 4UB8Z 3AG3B 2XAQA 4IIJB 5LHGA 4GYCB 1HNWO 2EINC 2JEXA 2H8PC 2N05A 2DWDC 1CEZA 1QNMA 1J5EB 3WG7C 2LFSA 1XNRB 2WLNA 3ZX6A 1NI8A 1YJ9V 3CSXA 1NU1H 1N34O 5LGTA 4ZHQB 1TUEB 3N2KA 3CCRV 2YEVB 4Q6GA 2N74A 4JI3B 4K8ZA 3E83A 4DW1A 5EZYA 2AHYA 5H6QA 3WG7B 5B5EZ 4FFBA 2NN4A 1E1RG 1K73W 2YIDA 1J95A 5KUKA 4P9PA 3ASNC 2GBOA 4NTYA 5BXZA 2XAGA 4F6RA 2CTRA 2GUZA 3RWRD 1HW7A 1NBMG 1ZLZA 4MVMA 1NS1A 2KB1A 5KAIZ 4JV5O 4J9ZB 1IBKB 2EIKC 3BCCH 4E2LA 4LFBO 4XDLA 2P90A 3T4DA 1AB3A 3L75H 1N0NA 4X20A 3CRQA 5GW7A 3KZIZ 3TCUA 2IJJA 2JRIA 3OAAG 1SS3A 2EIKB 1JA8A 3CD6V 2Y4UA 1IDSA 2HR3A 3SPHA 5CMUA 3G6BA 1ZSPA 1G6UA 1MA1A 4FPPA 1H38A 2LGQA 2BCCH 4WCEV 2WWWA 3SJAC 1YITV 4BIUA 2QDOA 3M99B 1NVPB 2Q69A 3A0RA 2B1IA 4LWSB 1IXBA 4X66O 2DQ3A 4JYCA 2Q67A 2BTOA 5AG2A 4MVUA 2WA3A 5JJJB 5L3GA 3LDEA 4UCUA 2NR5A 4L8JA 4UVCA 1ZUQA 4UB6Z 3ZMSA 2BOCC 2CDYA 4Z1MG 4MTGA 3W7XA 1SQBH 5FLXN 1EZVH 2PYJA 1AI7A 3K5LA 1GN4A 1VF6A 4YJ2B 1WN7A 2K9PA 5K1PA 4DK1A 2H94A 3ABLC 4X89A 3EHBB 1H8EG 5H5NA 1Q6IA 4WFEA 3T2MA 1QR8A 2P5OA 4OX9B 4J42A 3STZC 4B08A 2OT5A 1OCCC 4JASA 3CPWU 4ASUG 3OUSA 4LNUB 3ABLB 1KECA 3K79A 4LF5B 3L72H 2OIGA 2GDSA 4DR7B 3UT5A 1MG1A 2A3QA 3PN1A 4X62O 1OCCB 4JZGA 3B40A 4NXNO 3ZRVA 5IYDO 1WLEA 1OCZC 2QM4A 1YCIA 1FYJA 2MW2B 3VQYA 2DYSC 1SZXA 1P84F 1Y67A 3CCSV 2ZDIC 3ZIAG 3FX7A 3JAKA 4O4HA 4PDLA 5LXTB 3UO2A 2WSSG 4JTCB 1EM1A 4I7ZB 4TQFA 1S5JA 3BHPA 2EULA 1N33O 1K34A 4NYKA 5IWAO 1HP8A 2HKOA 2Y0IA 4DV3B 1YIJV 1RM1B 1EZJA 4DR6O 2UUCO 4ZOLA 3E8FA 4R50A 4EEQA 2R70A 2BTQA 5LOVB 4LF7O 3IC9A 2ZQMA 1A32A 1EN4A 1H2NA 2WLLA 1CPYA 1LUWA 3FFQA 3BA9A 2VRZA 4EB6B 1PNMA 2P06A 2LO1A 4I55B 5EYPA 1JX9A 4FJCC 3CB2A 5KMGA 1XMQB 1YZBA 1ORQC 4J80A 4CC5A 3B8NA 2ZR2A 3ABTA 3OD4A 1N8RW 2UU9O 1OCOC 4KFMA 2Z5UA 1SQPH 3JAWB 4DUYB 1KMIZ 4BR6A 4X1IB 3IJ4A 2X6BA 2P4VA 3JARB 5JCOC 2E5LB 1GH6A 4JI0B 3SPIA 4OPHA 5KA6A 2ETNA 1N36B 4FZ0A 1OCOB 2JGDB 2Q8VA 3N27A 4AQYO 2YIAA 3T4ZA 3T1YO 4DV4B 5LHIA 4JI5O 1L0LH 1KC8W 2DYRC 3ABKB 3APOA 1GKFA 1U97A 2JJ2G 1AR1B 1HNWB 1IURA 2HLDG 3TJTA 1JPXA 1BQ0A 5LMUO 3E8HA 4JI1B 4MSWC 2UXCO 4X1KA 5KAFZ 4DR4B 1V54B 1FFXA 3RBZA 4P9OA 1R6TA 2DYRB 2ATKC 3EFFK 3N2GB 5IYZB 1K97A 4DR2O 3OR7C 1R6KA 3TETA 2F93B 3X2QC 5HFLA 2Q0OC 1U96A 2PI5A 1Q6HA 2EIMC 3P3NA 3CS5A 5HFMA 2CE4A 3FB6C 2Q73A 3IGAC 3HKDA 1DGSA 2ZE6A 5LYJB 4CS2A 2JS3A 4QE7A 4LP8A 2ZM6O 5B1AB 3GB7C 3X2QB 1GN3A 3L9DA 4TV9B 4DV6B 2WA4A 2EIMB 3AK3A 4C7UA 5JJNB 4NXMO 1H2SB 4I4TA 3DC5A 4JI6O 4K0KB 4CS4A 4DW0A 1NZ6A 5JH7A 1KQSU 4MTXA 2ZKOA 1XREA 2Y69C 1MABG 3ZMZA 2RCVA 3FKSG 3OTOO 4MS2A 4BIZA 1XBLA 1XHZA 3T1HB 1D5AA 2HP8A 4KUMA 4PD4F 3TK1A 1PP9H 2Y69B 4I5SA 4OPAA 2AW9A 5KA5A 5A2QN 4LF9B 3UO3A 4DR3O 5JQGB 3KKYA 2G38A 4YY3B 3W7SA 1AILA 4I50B 4NTWA 3JD0A 4X66B 4O4IA 4K35A 1R3JC 1AP6A 1X4TA 2QWPB 1VF7A 3CMAV 2PTMA 1LR1A 3GWKC 2HVKC 3C90A 1EFRG 1QVGU 4GCZA 1QCEA 4MTFA 4U7OA 3SJBC 3E2EA 1SF9A 2KG7A 4YJ3B 3F5TA 2L35A 4X9QA 3HKEB 3SPCA 5CA0B 2CAZC 3JALA 4UVBA 4DO2A 1Z2GA 1Y76A 5B1OA 1Q5OA 5BMVB 3OMIB 1E79G 4FLXA 1WP7A 5KUMA 4FZ1A 1RP3B 2VS0A 4QJFB 4NVPA 4GT1A 2RJZA 5LA6A 3RVZA 5CBHA 3JYCA 5L3EA 2PY5A 1X59A 4ICGA 2ADQB 4G27B 3CRAA 4HNAA 1XEQA 4FLTA 4X88A 3VOUA 1VEWA 5L3BA 2UXXA 4GZRB 5GONA 3CCMV 4U7NA 3SJQC 4UUJC 2EZPA 3OMNB 4YHHO 4L87A 4LH6A 1FXKB 1NH2D 1TA8A 3DXRA 3CJHB 4DV2B 1NJIW 2WPDG 1WPBA 5E79Z 1XDCA 1BE3H 1SQVH 5IWAB 3K0GA 3L73H 4H13B 4DR6B 2E74B 3QO7A 3SGIA 5IY5B 1ZL8B 4WFHA 4DRXB 5ITZB 4J7JA 3B8MA 1OJHA 3ZN1A 4FLUA 3KG2A 3U0ZA 3CC2V 3AG7A 4F4LA 5CA1B 3CMEV 2RQ6A 5J9PC 1JQ0A 2NNUA 3JASB 3OEHG 4FLYA 3KCYA 3A2FA 2IH3C 3NR7A 1LUVA 2OCHA 4OGQB 4JTDB 3SDLA 1BL8A 1XHXA 2K1EA 2F1MA 2EILB 5IJ9A 2EIJC 3QO8A 2VWJA 2JJ1G 4LNUA 5FPRA 4X65O 5D5PA 4B3SO 4IT5A 4JYYA 4LF8O 1FXVA 4KXRA 4MVZA 2D2CB 1YTFD 3T1YB 4TOIA 1ROPA 2O57A 4ZIBA 2QKSA 1XQ8A 2VWKA 3E35A 2WLIA 4GKJB 5IJ0A 4B3TO 4UFZA 1SKVA 5DEDA 3RYIB 1KUQA 4R6ZA 2EINB 4JGSA 4TV8A 5C93A 4DV0O 1VQPV 1N32B 4IHJB 3G80A 2YXYA 3E22A 2ILMA 1H2KA 3O9OA 5J2TB 1PKXA 1JCHA 2X7RB 5LL6Y 4FLWA 3G71V 2IJKA 4D6TH 1P7BA 4EB6A 4JI7B 4WBNA 4I55A 5LP6C 4J41A 3SYQA 2ZR3A 2XT9A 2UXDO 2ZM6B 3UQ8A 3ASNB 2XASA 1K8AW 4EFBA 4DV5B 1V9PA 3GWOA 4DR5O 5EBMC 4PA4A 1P7GA 1WNSA 4RWUA 2Y0PA 4N23A 1K33A 4GX1A 2Q9LA 5LP6B 4PV1B 4U3JA 1KP2A 3M7MX 3MHSC 3RVYA 1MZFA 4UCVA 4X1YB 1QU7A 1GTOA 4HYOA 2RNBA 2ZXWC 1Q90D 5H6RA 4RQFA 3D8CA 2R9AA 4D7TA 2YSUB 5C8YB 4DUZO 1IBMB 4O2BA 4O4JB 3RW0A 2IM9A 1BSMA 4LFCO 1DTOA 2ZT9B 2CGOA 4JI2O 2F4VO 1IXMA 3K9SA 3UM7A 4CBCA 2Y4TA 3RYFA 1SA0A 4QPJA 4CS3A 4KHPB 2W0FC 1I5XA 1K9MW 2F23A 4JI8B 1R3LC 3RYHB 1Y74A 3U11A 3N2GA 2V7QG 5IYZA 1TUBB 1BMFG 2LJ2A 3OUFA 2FMLA 3G4SV 3QNEA 2QA4V 5B1BC 3RFRA 3ZHQA 3K04A 5H2FZ 1Q6UA 1BQZA 2DMXA 1ZTEA 1XMOO 3F5WC 5KX5A 1MOFA 5J2UB 2JK5C 4O2AB 2KSDA 1FD9A 2F66C 2CH7B 4I0XA 1K5SA 1M4UA 3JCZA 3HB3B 1XOUA 3D36A 5B1BB 1GM9A 3H1IH 5CA3A 3MAQA 4TSFG 2GV9A 4TV9A 4PDMA 1ZX3A 2HHHO 1S0VA 5CB4A 2Q7HA 3ZHRA 1BHBA 4JF3A 2V1DA 4LF4O 3M8AA 1AROP 2BSKA 2QR4A 3NXSA 3CX5F 2AHZA 1W0KG 2OCCC 2RN9A 1BT8A 1BS3A 3E86A 3LDDA 2LW1A 5BR8O 1FJGO 4LF6B 1WAZA 5LMNB 4LFAO 3BPZA 3UKMA 1M1KW 2VQEO 1OCZB 4DV7O 1LNQA 4JYAO 4AHCA 1S5LZ 4NTXA 1XUQA 2DYSB 1O9HA 5JQGA 2LFRA 3QTCA 1P4RA 2UUBO 2WLMA 1HNXO 2Q5ZA 5FPOA 3E8GA 2UUAO 4B3MO 2EZOA 2UXBO 1NTMH 4IYHA 2QSAA 1PNLA 4MVSA 1SQFA 1SESA 1R3IC 3KCXA 1BGYH 5EZYB 2RMKB 2X6CA 2YXLA 3K9AA 4FFBB 1VIBA 4JI4O 5L3FA 4JYBA 1PD3A 3ASOC 4MVQA 4GKKO 1I94O 2ZE8A 4YJ3A 4F6RB 1Y4MA 2GUZB 4R8CA 2Q7EA 5D5QA 3JD4A 3A0HZ 3ZEDA 1TVKB 2M7WA 5LBQA 1MZEA 3CE2A 1NVPD 3PJSK 3WFVA 1K4CC 1DF5A 4DR1B 1HNZO 3CCVV 4CH6A 2EJ7A 4WFAV 2QKCA 3HR0A 2ODMA 3W7TA 4X20B 2ZIOA 1YF2A 3GVMA 3HKCA 2VQFO 2F95B 1IBLO 4B3SB 1XNQO 1THZA 3BFRA 1KB9F 4HBNA 3CXCU 3H1JH 3P3PA 2Q4PA 5FNVA 3ZHUA 1QHTA 3L70H 3A0BZ 3EXAA 1IX9A 1HR0O 2DWEC 2YDEA 1M93A 1VQ6V 1SQGA 3F7VC 3ZN0A 4IYIA 3JD1A 1N34B 1P49A 3K5OA 2QWQB 2ZD9A 4QE9A 2BOBC 2JDIG 3ETQA 4BIOA 3B4SA 3H1HH 1VF6C 2IU3A 3Q4HA 5BZBA 4JI3O 2XHBA 1PL0A 1M5IA 3HPLC 3B09A 4TQDA 1F7YA 2HEPA 2OTLV 3QF7A 1VMGA 2IBZH 3JD3A 3MHHC 4JV5B 1QLEC 1RSOA 1PPJH 4GUNA 5GTIZ 3BRCA 2UXDB 1H8HG 4FK5C 2JIZG 4NB5A 4LFBB 3J81N 2Z3YA 2XAHA 4UVAA 4DR5B 2ARHA 1IBKO 1NTZH 1GO3F 2E75B 2YS8A 2OWOA 3OT7A 5IT9N 1DF4A 4ZI7A 1WA8B 2XUMA 4UV9A 4J7KA 5JVDA 1WPXA 5KHKA 2IW5A 3SYPA 5JJEB 3ZBHA 4W4LA 3HKBA 3UT5B 1GK9A 2HFEC 4TUYA 2KQXA 1L8DA 4MTOA 4J9YB 4DUZB 1O9GA 4IIJA 1JVMA 1URFA 2F4VB 4WFBV 1JJOA 1YXBA 3LSQA 2DW4A 5DM6V 1KP3A 4O4HB 3JAKB 3SJCC 3UCSC 4NKGB 4BW5A 1VARA 1FAFA 1D2DA 3ZRSA 4R7CA 2CUGA 4ZHQA 1GM7A 3BY6A 2HVJC 4TT3G 3ETGA 3CHXA 2YEVA 1VF5B 1VP7A 2P6JA 3JD2A 3A8TA 4PELA 1ZWIC 1Q7YW 2L6LA 1JFFB 3ZHTA 2BTQB 3P32A 4DYLA 4RQEA 4Q20A 2XNDG 1Q3EA 2MK3A 2B9ZA 1NTKH 2WLLB 1Z5VA 4Z1VA 3BABA 1WB8A 2WLKA 4XDKA 2YIBD 4CZZA 1E1QG 2IJHA 4H37A 3RGBA 2DQ0A 2DN9A 2ZIMA 5KMGB 2FL4A 2H3OA 4IL6Z 2Z0AA 3AK1A 3B77A 4G28B 4ABMA 1VQKV 3EVKA 3FYEB 1AI5A 2HHHB 4P2ZA 1FS0G 1YI2V 4FFKA 3K08A 1G1XB 2DJVA 3CC7V 4OX9O 3DTUB 1XI1A 1WB7A 4PDVA 1AJNA 4UCTA 4QNHB 4LF4B 2E76B 4X62B 3IAYA 2F43G 3G67A 2B1GA 4GX2A 4NXNB 1VQMV 2WLHA 3ZHSA 3AG1C 1F4MA 5C8YA 4DR7O 5KHJA 4UCSA 2CTPA 1Y6XA 2WLJA 3CCLV 3AG2C 4JYAB 3LNMB 1N33B 4LWSA 1KD1W 4NR1A 3FD9A 3I55V 3AG1B 2R9RB 4X64O 1NQTA 4BAYA 4PA7A 4AILC 3ETDA 4X8AA 4X1KB 2UUCB 2UUAB 1SC5B 4YIOA 1WJZA 3K3WA 1FFXB 3FB5C 4LF7B 1BZKA 2DOSA 2A0LA 2YUAA 4RO2A 1M57C 3FB8C 4JAUA 4DV3O 4YIPA 1B6QA 1UJWB 1ZAUA 3VQXA 1I0HA 1K92A 1NKDA 3QVNA 1OCRC 1BHAA 2C2AA 2FB5A 2ITDC 1US6A 4GKKB 4YJ2A 1M57B 3ICXA 4HAMA 3K5NA 3ZHVA 2UU9B 1V55C 1XMQO 3SPJA 5EIBD 3C3SA 5L3DA 3K57A 5BY1A 1OCRB 4I9WA 2ZINA 3QO5A 3AG4C 1N4CA 4A5UB 2CGNA 5GTHZ 4DUYO 4UXNA 1V55B 2GTSA 1IVSA 2VQFB 1IBLB 4J7ZA 1UFIA 5JH7B 4AQYB 3AG3C 1TAEA 1MNGA 2EIJB 4JI5B 3W7UA 2YI9A 3OTFA 3CCUV 4JI0O 1K7DA 3ZRWB 3DC6A 1N36O 3CWBH 3JATB 1R73A 4DV1O 1COWG 2QKAA 5LMUB 5E1AC 4QIWF 1XL6A 4UCRA 3L71H 4DV4O 5LXTA 4PI0A 4JPRA 3K0DA 2UXCB 4J11A 2P4KA 3E8BA 1Q82W 1AR5A 3DSQA 2E3CA 4DR2B 4CH4A 1AJQA 3CCQV 4JI1O 1DLBA 2ZDIA 1NT2B 1AP5A 4WFGA 4O4IB 1JMKC 4DR4O 5LOVA 1JR9A 4DXWA 1R6NA 2CTQA 1F23A 4WF9V 4CH5A 3RT3C 4EFEA 3CC4V 3OEEG 2D3OW 3OMAB 2ZCEA 2KG7B 5CBGA 4UV8A 5B66Z 3OGIB 2QM8A 1F4NA 2QWOB 3CRRA 3CYOA 4N21A 4NXMB 1TVKA 1WP8A 3JALB 3AEIA 5L3CA 4QGPA 3JAWA 4JI6B 5IDJA 4X1IA 4DV6O 1Y76B 4B3RO 4LC1A 2YICA 3JARA 2A9HA 4BWAA 5KHHA 3OTOB 1GAXA 4K0KO 5LA6B 1YJWV 5IYBO 2JGDA 3OR6C 2R72A 2YIBA 3H1LH 4HNAB 1GM8A 1RPRA 2A79B 2QE7G 2GSMB 2ZXWB 5IE9A 3B2EE 3OGCC 3SYOA 4IGGA 5JCOA 1NR7A 5GONB 3ZRXA 2XAFA 5LGUA 4DR3B 3T1HO 1Z5WA 3VQVA 2LW7A 3JAMN 2B5UA 5JWPA 2W0XA 1SRYA 1YSCA 4CH3A 2P67A 1RFYA 3FAVB 3AK2A 3DXRB 3MD0A 1AI6A 4LF9O 3RN4A 1GN2A 1OV9A 4YY3O 2ZNJA 5EC1C 4GX5A 2HJDA 2LQTA 4K3AA 1YJNV 4RUEA 4H33A 3RYCB 5EBLC 1GMGA 4FM1A 4PI2A 4O4LB 4FLZA 5LYJA 4K8XA 4W4KA 4FMTA 2PI4A 3BA8A 4TWKA 3SYCA 3FYIB 1GN6A 1AVMA 1H2MA 2QM7A 4LCUC 3DGEA 3I5DA 3J7AU 3VBBA 3OFNG 2FTKA 3OE7G 2V4DA 1GRJA 1VQLV 2Q6AA 3LDCA 2YC0A 4LR3A 1XL4A 5IJ9B 1WA8A 1K4DC 4XDJA 2XAJA 1VQ5V 4MW3A 1NR1A 3ETEA 3CCJV 3LUTB 2OTJV 1HWYA 1MMMA 3CCEV 2AZ2A 4YHHB 4CC6A 2P22C 5A9GA 2OCCB 3ZMUA 4UCOA 1DK1A 5B1NA 1RM1C 2WLIB 2BE3A 4I50A 5IJ0B 1JOYA 1VQ4V 4X64B 2NLJC 2XOKG 3VQWA 5DN6G 1G4YB 5IYCO 1M9NA 4DV2O 3N2KB 4H0LB 4HZ3A 4TV8B 2Q68A 3D3IA 4JAVA 3E22B 5H9CA 3ZJZA 1S77D 1JFFA 2QEXV 2PZSA 3CXHF 3K03A 3HKEA 1HDJA 1QVFU 4JTAB 4PA3A 1I7FA 5CA0A 4WBNB 1PL4A 2OYQA 1UPGA 1RPOA 3F7YC 4P30A 3ASOB 5EBWC 2Q7GA 1QBZA 1S72V 5BMVA 2GHYA 3OM3B 2PGGA 2Q0AA 4E4EA 4WFFA 4X65B 4U3JB 1CXZB 2AXTZ 4LF8B 3SR2C 4KP4A 5KHGA 1KU9A 3ABKC 1FPOA 3APQA 1SZTA 2R9IA 4MVOA 4DV1B 1R3KC 5EC2C 5EK0A 1YHQV 1SQXH 4O2BB 4B3TB 1FXKA 3TXQA 2QJ1A 2LP7A 3SPGA 1VQNV 2DE0X 1V54C 1W2BU 2YXHA 3CJHA 4LH7A 3WB1A 3RYFB 5KHIA 1MSDA 1SA0B 3TGUH 1J5EO 3H9VA 1XNRO 4DV0B 2EBOA 4GKJO 1F51A 1Y66A 2PUSA 1N0JA 1PNKA 1KKCA 2ADPA 2QTOA 3K58A 1EN6A 4G2KA 3CP1A 3IFXA 5CN0A 1QR9A 4PDRA 1OZ0A 4KL1A 1ZL8A 1G8MA 5LGNA 1Y74B 3K59A 1L0NH 1N32O 1AR4A 4DRXA 1CP9A 5ITZA 4AI8A 1EN5A 1FKAO 3L74H 2PYLA 2P7TC 1R1BA 5B1AC 3D36C 3P30A 2OIEA 3SYAA 3STLC 4LBEC 3FB7C 5CA1A 3WU2Z 2EJRA 3MDSA 4OXSA 3BAAA 5KX5B 3JASA 1S3JA 1Q86W 1W59A 3J80N 4JI7O 1NH2B 4I0XB 2FKXA 5B3SC 1L1FA 2XTAA 1Q81W 1QLEB 2IU0A 1T5EA 1KBHA 2M6YA 1FXHA 1KKDA 1YVWA 3JCUZ 2JS5A 4DV5O 1SERA 4B3RB 3OW2U 2ZE5A 1SQQH 5CB4B 3BVOA 2QGNA 4B7EA 5B3SB 4PA9A 4RUFA 3THOA 4PJ0Z 3ML0A 1PM9A 4GX0A 2ITCC 2BSKB 3ZMTA 2QWRB 4D7SA 4LFCB 4ZKIA 4JI2B 5EIBC 3WB0A 1KYOF 3ZRWA 2HG5C 2N04A 3JATA 1TGOA 3R65A 1FFTB 4YXWG 1IBMO 3ABUA 1MSWD 2CK3G 1PV0A 4QPKA 4H44B 3RYIA 4JZ2A 3LSUA 1W0JG 4U3FH 4KHPO 1IZ3A 3JSLA 1M56C 4IHJA 4B7KA 4ZOLB 1H2LA 3TXSA 5J2TA 4JI8O 1D5NA 5KLVH 5CBFA 3O65A 1XMOB 3H01A 1YTFB 1EBOA 5EYPB 1M56B 5F2VO 3S3WA 4BW9A 1B06A 3G6EV 2A7WA 4ZBMA 2EX3A 3R66A 2X6AA 2AGAA 2KKWA 2UXNA 3K06A 3I56V 2FYUH 2RDCA 4F6EA 2ZE7A 5LP6A 1VQ7V 4X1YA 3JSNA 4PHZA 2JEUA 4Z2WA 4LF5O 3HKCB 3QG5A 3IC7A 5TISZ 5BR8B 1FXKC 5LHHA 1FJGB 1Q43A 1QLNA 2X0LA 1AI4A 4O4JA 4LFAB 1I08A 4FIPC 5FNVB 1OHHG 2VQEB 1YEWA 4DV7B 2QTSA 4DK0A 4FM2A 1VQ8V 4LF6O 5LMNO 2UUBB 1HNXB 2IH1C 4B3MB 4XBFA 2UXBB 3FAVA 2W6JG 2AZ0A 1I5YA 5IY5C 3RYHA 2W6IG 3W7WA 3AG2B 3WB2A 1Q8IA 3LSSA 2JGUA 3E89A 1TUBA 4MT8A 1S76D 1YDXA 3C3TA 4FLVA 4JI4B 4I9QA 2GTAA 5DECA 1ENVA 3H1KH 3K5MA 3T1CA 3Q4HB 3U10A 3RYCA 3HKDB 1I94B 1SETA 5J2UA 4O2AA 1S5HC 4JAAA 4O4LA 2CH7A 2Y48A 2A06H 1K5QA 2IJIA 3CRCA 2YI8A 1RSOB 3ABMC 1BCCH
chains in the Genus database with same CATH topology
3JD4A 4RAIA 2Y69B 2B5UA 4I5SA 2EILC 1SRYA 5FL7G 2M7WA 1YSCA 5KA5A 5LBQA 2P67A 1NVPD 3MD0A 3PJSK 3W7SA 1VQOV 3WFVA 1K4CC 1AI6A 1DF5A 3JD0A 3CCVV 4PA6A 3ZCCA 4WFAV 1R3JC 1K3EA 5EC1C 3ZMVA 4MW8A 3ABMB 4GX5A 3W7TA 2WAMA 3CMAV 3BEHA 1YJNV 4RUEA 1H2GA 1AJPA 4H33A 1THZA 4EKWA 5EBLC 1GMGA 3AG4B 2HVKC 3CXCU 1EFRG 1QVGU 4GCZA 1QCEA 4MTFA 4U7OA 1M90W 1JJ2U 3E2EA 1VQ9V 2HJFC 4MVRA 3AG3B 4FMTA 2XAQA 3SPCA 4TWKA 5LHGA 2PI4A 3SYCA 2DWEC 2EINC 3FYIB 2JEXA 1VQ6V 2H8PC 4UVBA 2QM7A 3F7VC 4DO2A 3ZN0A 2DWDC 1CEZA 3JD1A 4LCUC 3DGEA 3WG7C 2LFSA 2WLNA 3VBBA 3OFNG 5B1OA 2FTKA 1YJ9V 3OE7G 3OMIB 1E79G 2ZD9A 4QE9A 5LGTA 2Q6AA 1VQLV 3LDCA 2BOBC 5KUMA 1TUEB 3CCRV 2JDIG 1XL4A 4QJFB 2YEVB 4GT1A 3E83A 3RVZA 5CBHA 4XDJA 1K4DC 3JYCA 5L3EA 2AHYA 2XAJA 2IU3A 5H6QA 3WG7B 1VQ5V 4MW3A 1NR1A 3ETEA 5BZBA 3CCJV 1PL0A 4G27B 3HPLC 1E1RG 3LUTB 2OTJV 1K73W 1HWYA 1J95A 4X88A 3VOUA 5KUKA 2OTLV 3CCEV 4P9PA 3ASNC 2UXXA 5L3BA 3JD3A 3MHHC 3CCMV 4U7NA 2XAGA 3SJQC 1QLEC 4UUJC 2EZPA 3OMNB 4L87A 1H8HG 1NBMG 4FK5C 4MVMA 1FXKB 2KB1A 2OCCB 3ZMUA 2JIZG 4J9ZB 1NH2D 2Z3YA 5B1NA 2EIKC 2XAHA 4UVAA 2WLIB 1RM1C 1NJIW 1JOYA 2WPDG 1VQ4V 4E2LA 2XOKG 2NLJC 5DN6G 1G4YB 2P90A 1M9NA 4XDLA 3T4DA 5IYCO 1GO3F 3K0GA 4HZ3A 5GW7A 3TCUA 2IJJA 1DF4A 3OAAG 2Q68A 3D3IA 3QO7A 4UV9A 4JAVA 2EIKB 1WPXA 4WFHA 5IY5B 3CD6V 5H9CA 2IW5A 3SYPA 3ZJZA 1S77D 2HR3A 3SPHA 3B8MA 5CMUA 1GK9A 2HFEC 3ZN1A 4FPPA 1H38A 2QEXV 3KG2A 4J9YB 4MTOA 3K03A 3CC2V 1JVMA 1QVFU 4JTAB 4F4LA 4WCEV 2WWWA 1YITV 4PA3A 3CMEV 4WFBV 4BIUA 1JQ0A 2NNUA 3LSQA 2DW4A 3OEHG 5J9PC 1RPOA 5DM6V 3F7YC 2IH3C 4P30A 3ASOB 3M99B 5EBWC 1NVPB 1KP3A 2Q69A 4BW5A 1QBZA 3A0RA 1S72V 4JTDB 2B1IA 1BL8A 2K1EA 3ZRSA 4R7CA 1GM7A 2DQ3A 2GHYA 3OM3B 3BY6A 2HVJC 2EILB 4JYCA 4TT3G 3ETGA 2YEVA 4WFFA 2EIJC 2Q67A 2P6JA 3JD2A 4MVUA 3QO8A 4PELA 5L3GA 1ZWIC 1Q7YW 2JJ1G 3LDEA 4KP4A 3P32A 3ABKC 4UVCA 4Q20A 4RQEA 2XNDG 1SZTA 2MK3A 2R9IA 1FXVA 3ZMSA 2BOCC 2WLLB 4MVZA 4Z1MG 4MTGA 3W7XA 1YTFD 4MVOA 1R3KC 5EC2C 2WLKA 4XDKA 5EK0A 1ROPA 1YHQV 1AI7A 1FXKA 4CZZA 1E1QG 2IJHA 2QKSA 4H37A 2LP7A 3SPGA 1VQNV 2DQ0A 1V54C 1W2BU 2H94A 3E35A 2WLIA 3ABLC 4X89A 3EHBB 1H8EG 3B77A 4G28B 1VQKV 4WFEA 3T2MA 3FYEB 1QR8A 2EBOA 1AI5A 1F51A 1Y66A 3STZC 2OT5A 4R6ZA 2QTOA 1PNKA 1FS0G 1OCCC 2EINB 4P2ZA 4G2KA 4JGSA 3CP1A 4JASA 5C93A 1YI2V 3K08A 1VQPV 3CC7V 3DTUB 3CPWU 3IFXA 4ASUG 5CN0A 1QR9A 3OUSA 4PDRA 1OZ0A 4PDVA 1AJNA 1G8MA 5LGNA 4QNHB 3ABLB 1KECA 3K79A 1CP9A 1PKXA 2F43G 2B1GA 4GX2A 1VQMV 2WLHA 1MG1A 2P7TC 5B1AC 1JCHA 3P30A 1OCCB 2X7RB 3AG1C 3SYAA 1F4MA 4LBEC 3STLC 3ZRVA 3FB7C 1WLEA 2IJKA 1P7BA 1OCZC 5IYDO 3G71V 2EJRA 4OXSA 2DYSC 1S3JA 2WLJA 2ZR3A 3SYQA 1Q86W 3CCSV 2ZDIC 1NH2B 3ZIAG 5B3SC 3ASNB 2XASA 3AG2C 4PDLA 1L1FA 3CCLV 1Q81W 1K8AW 2WSSG 4JTCB 3LNMB 1KD1W 1QLEB 2IU0A 3I55V 3AG1B 2R9RB 1NQTA 3GWOA 4PA7A 4BAYA 4PA4A 5EBMC 3ETDA 4X8AA 4N23A 1FXHA 1KKDA 1K34A 1K33A 3K3WA 4GX1A 1SERA 2HKOA 3OW2U 3FB5C 1KP2A 3MHSC 3RVYA 1YIJV 1RM1B 1EZJA 2A0LA 4RO2A 1M57C 3E8FA 1GTOA 3FB8C 4R50A 5B3SB 4HYOA 4PA9A 4RUFA 4JAUA 2ZXWC 3ML0A 2ZQMA 4GX0A 2ITCC 5H6RA 4RQFA 2WLLA 1B6QA 1CPYA 1UJWB 3ZMTA 2YSUB 4ZKIA 1K92A 1NKDA 1OCRC 1PNMA 1BHAA 2C2AA 3ZRWA 3RW0A 1JX9A 2HG5C 2ITDC 4FJCC 1DTOA 1M57B 1IXMA 3R65A 4HAMA 3UM7A 4CBCA 1FFTB 4YXWG 1ORQC 3ABUA 1MSWD 2CK3G 4QPKA 4QPJA 1V55C 3B8NA 2ZR2A 3SPJA 3ABTA 1N8RW 2W0FC 5L3DA 1OCOC 1OCRB 4I9WA 1I5XA 4KFMA 2Z5UA 1W0JG 1K9MW 3QO5A 1M56C 2X6BA 3AG4C 1R3LC 2V7QG 4UXNA 1BMFG 1V55B 5CBFA 3OUFA 3SPIA 3G4SV 5KA6A 3AG3C 3QNEA 5B1BC 2QA4V 1OCOB 3H01A 2EIJB 3K04A 1YTFB 3W7UA 3CCUV 1K7DA 1EBOA 3ZRWB 1M56B 3F5WC 3T4ZA 5LHIA 1MOFA 1R73A 2JK5C 1COWG 1KC8W 2DYRC 3ABKB 3G6EV 5E1AC 1GKFA 4QIWF 1XL6A 2JJ2G 1K5SA 1AR1B 2HLDG 4ZBMA 2X6AA 3JCZA 4JPRA 3K0DA 1JPXA 3HB3B 3D36A 5B1BB 2UXNA 3K06A 3E8BA 3I56V 1GM9A 1Q82W 3E8HA 5CA3A 4MSWC 4TSFG 4PDMA 1AJQA 3CCQV 1S0VA 1V54B 3RBZA 1VQ7V 4P9OA 1DLBA 2DYRB 2ATKC 2ZDIA 3EFFK 4WFGA 1K97A 3OR7C 2JEUA 1R6KA 3TETA 4DXWA 4JF3A 1BHBA 2V1DA 1AROP 1R6NA 3X2QC 5HFLA 3NXSA 1F23A 3IC7A 2PI5A 2AHZA 2EIMC 4WF9V 1W0KG 1FXKC 5HFMA 5LHHA 1QLNA 2OCCC 2X0LA 3FB6C 1AI4A 3CC4V 3OEEG 3IGAC 3E86A 3LDDA 2D3OW 3OMAB 4FIPC 1OHHG 5CBGA 4UV8A 4QE7A 4LP8A 5B1AB 3GB7C 3X2QB 2QM8A 1F4NA 3UKMA 1M1KW 3CYOA 4N21A 1VQ8V 1OCZB 1LNQA 2EIMB 3AEIA 5L3CA 2IH1C 2DYSB 4XBFA 2LFRA 5IDJA 2W6JG 1P4RA 1I5YA 2WLMA 5IY5C 3E8GA 2W6IG 2EZOA 3W7WA 4LC1A 3AG2B 2A9HA 3LSSA 3E89A 4MT8A 1PNLA 1S76D 4MVSA 1KQSU 1SESA 1R3IC 4MTXA 2Y69C 1MABG 3ZMZA 1YJWV 5IYBO 1ENVA 3FKSG 3OR6C 2X6CA 3K9AA 3T1CA 1SETA 4MS2A 4BIZA 1GM8A 1RPRA 5L3FA 4JYBA 1PD3A 2A79B 1S5HC 2QE7G 2GSMB 3ASOC 4MVQA 2ZXWB 3OGCC 2Y48A 3SYOA 1NR7A 4KUMA 1K5QA 3TK1A 2IJIA 3ZRXA 2XAFA 5LGUA 1Y4MA 3ABMC 4R8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 W;  3CCL V;  1K8A W;  3CC2 V;  1VQN V;  1Q81 W;  1N8R W;  1KQS U;  1QVF U;  4WCE V;  1W2B U;  3CCE V;  2OTL V;  1KD1 W;  1YIT V;  1R73 A;  1K9M W;  3I55 V;  3CME V;  3CXC U;  1VQM V;  4WFB V;  1YJ9 V;  3CCM V;  1Q7Y W;  1KC8 W;  3G6E V;  1YJW V;  1QVG U;  1M1K W;  1VQK V;  1VQ8 V;  5DM6 V;  1VQO V;  1M90 W;  1VQL V;  1JJ2 U;  1VQ9 V;  3G71 V;  3CCR V;  3OW2 U;  3CCV V;  3CD6 V;  1YIJ V;  1Q82 W;  3I56 V;  4WFA V;  4WF9 V;  1S72 V;  1YI2 V;  3G4S V;  1VQP V;  3CC7 V;  1Q86 W;  3CPW U;  3CCS V;  2QA4 V;  1NJI W;  3CC4 V;  1VQ6 V;  3CMA V;  1VQ4 V;  1VQ5 V;  1YJN V;  1YHQ V;  2D3O W;  3CCJ V;  3CCQ V;  2QEX V;  3CCU V;  1VQ7 V;  2OTJ V; 
#chains in the Genus database with same CATH topology
 4RAI A;  4FM0 A;  2ZNI A;  2EIL C;  5FL7 G;  1B3Q A;  3ZS8 C;  4GLX A;  1HNZ B;  4I4T B;  1VQO V;  1B04 A;  3S3X A;  4PA6 A;  1QQC A;  3CEI A;  3ZCC A;  1K3E A;  3ZMV A;  2PF4 E;  2CTW A;  2LGW A;  4MW8 A;  3ABM B;  4DR1 O;  1XNQ B;  3CRM A;  2WAM A;  3LNN A;  3BEH A;  1XIL A;  2E5L O;  4ZI7 B;  1H2G A;  1AJP A;  4EKW A;  5JVD B;  4FVM A;  3AG4 B;  2QWN B;  3HKB B;  1M90 W;  1JJ2 U;  3D3Q A;  1HR0 B;  4TUY B;  1VQ9 V;  2HJF C;  2JVD A;  4J10 A;  5K1X A;  4MVR A;  4UB8 Z;  3AG3 B;  2XAQ A;  4IIJ B;  5LHG A;  4GYC B;  1HNW O;  2EIN C;  2JEX A;  2H8P C;  2N05 A;  2DWD C;  1CEZ A;  1QNM A;  1J5E B;  3WG7 C;  2LFS A;  1XNR B;  2WLN A;  3ZX6 A;  1NI8 A;  1YJ9 V;  3CSX A;  1NU1 H;  1N34 O;  5LGT A;  4ZHQ B;  1TUE B;  3N2K A;  3CCR V;  2YEV B;  4Q6G A;  2N74 A;  4JI3 B;  4K8Z A;  3E83 A;  4DW1 A;  5EZY A;  2AHY A;  5H6Q A;  3WG7 B;  5B5E Z;  4FFB A;  2NN4 A;  1E1R G;  1K73 W;  2YID A;  1J95 A;  5KUK A;  4P9P A;  3ASN C;  2GBO A;  4NTY A;  5BXZ A;  2XAG A;  4F6R A;  2CTR A;  2GUZ A;  3RWR D;  1HW7 A;  1NBM G;  1ZLZ A;  4MVM A;  1NS1 A;  2KB1 A;  5KAI Z;  4JV5 O;  4J9Z B;  1IBK B;  2EIK C;  3BCC H;  4E2L A;  4LFB O;  4XDL A;  2P90 A;  3T4D A;  1AB3 A;  3L75 H;  1N0N A;  4X20 A;  3CRQ A;  5GW7 A;  3KZI Z;  3TCU A;  2IJJ A;  2JRI A;  3OAA G;  1SS3 A;  2EIK B;  1JA8 A;  3CD6 V;  2Y4U A;  1IDS A;  2HR3 A;  3SPH A;  5CMU A;  3G6B A;  1ZSP A;  1G6U A;  1MA1 A;  4FPP A;  1H38 A;  2LGQ A;  2BCC H;  4WCE V;  2WWW A;  3SJA C;  1YIT V;  4BIU A;  2QDO A;  3M99 B;  1NVP B;  2Q69 A;  3A0R A;  2B1I A;  4LWS B;  1IXB A;  4X66 O;  2DQ3 A;  4JYC A;  2Q67 A;  2BTO A;  5AG2 A;  4MVU A;  2WA3 A;  5JJJ B;  5L3G A;  3LDE A;  4UCU A;  2NR5 A;  4L8J A;  4UVC A;  1ZUQ A;  4UB6 Z;  3ZMS A;  2BOC C;  2CDY A;  4Z1M G;  4MTG A;  3W7X A;  1SQB H;  5FLX N;  1EZV H;  2PYJ A;  1AI7 A;  3K5L A;  1GN4 A;  1VF6 A;  4YJ2 B;  1WN7 A;  2K9P A;  5K1P A;  4DK1 A;  2H94 A;  3ABL C;  4X89 A;  3EHB B;  1H8E G;  5H5N A;  1Q6I A;  4WFE A;  3T2M A;  1QR8 A;  2P5O A;  4OX9 B;  4J42 A;  3STZ C;  4B08 A;  2OT5 A;  1OCC C;  4JAS A;  3CPW U;  4ASU G;  3OUS A;  4LNU B;  3ABL B;  1KEC A;  3K79 A;  4LF5 B;  3L72 H;  2OIG A;  2GDS A;  4DR7 B;  3UT5 A;  1MG1 A;  2A3Q A;  3PN1 A;  4X62 O;  1OCC B;  4JZG A;  3B40 A;  4NXN O;  3ZRV A;  5IYD O;  1WLE A;  1OCZ C;  2QM4 A;  1YCI A;  1FYJ A;  2MW2 B;  3VQY A;  2DYS C;  1SZX A;  1P84 F;  1Y67 A;  3CCS V;  2ZDI C;  3ZIA G;  3FX7 A;  3JAK A;  4O4H A;  4PDL A;  5LXT B;  3UO2 A;  2WSS G;  4JTC B;  1EM1 A;  4I7Z B;  4TQF A;  1S5J A;  3BHP A;  2EUL A;  1N33 O;  1K34 A;  4NYK A;  5IWA O;  1HP8 A;  2HKO A;  2Y0I A;  4DV3 B;  1YIJ V;  1RM1 B;  1EZJ A;  4DR6 O;  2UUC O;  4ZOL A;  3E8F A;  4R50 A;  4EEQ A;  2R70 A;  2BTQ A;  5LOV B;  4LF7 O;  3IC9 A;  2ZQM A;  1A32 A;  1EN4 A;  1H2N A;  2WLL A;  1CPY A;  1LUW A;  3FFQ A;  3BA9 A;  2VRZ A;  4EB6 B;  1PNM A;  2P06 A;  2LO1 A;  4I55 B;  5EYP A;  1JX9 A;  4FJC C;  3CB2 A;  5KMG A;  1XMQ B;  1YZB A;  1ORQ C;  4J80 A;  4CC5 A;  3B8N A;  2ZR2 A;  3ABT A;  3OD4 A;  1N8R W;  2UU9 O;  1OCO C;  4KFM A;  2Z5U A;  1SQP H;  3JAW B;  4DUY B;  1KMI Z;  4BR6 A;  4X1I B;  3IJ4 A;  2X6B A;  2P4V A;  3JAR B;  5JCO C;  2E5L B;  1GH6 A;  4JI0 B;  3SPI A;  4OPH A;  5KA6 A;  2ETN A;  1N36 B;  4FZ0 A;  1OCO B;  2JGD B;  2Q8V A;  3N27 A;  4AQY O;  2YIA A;  3T4Z A;  3T1Y O;  4DV4 B;  5LHI A;  4JI5 O;  1L0L H;  1KC8 W;  2DYR C;  3ABK B;  3APO A;  1GKF A;  1U97 A;  2JJ2 G;  1AR1 B;  1HNW B;  1IUR A;  2HLD G;  3TJT A;  1JPX A;  1BQ0 A;  5LMU O;  3E8H A;  4JI1 B;  4MSW C;  2UXC O;  4X1K A;  5KAF Z;  4DR4 B;  1V54 B;  1FFX A;  3RBZ A;  4P9O A;  1R6T A;  2DYR B;  2ATK C;  3EFF K;  3N2G B;  5IYZ B;  1K97 A;  4DR2 O;  3OR7 C;  1R6K A;  3TET A;  2F93 B;  3X2Q C;  5HFL A;  2Q0O C;  1U96 A;  2PI5 A;  1Q6H A;  2EIM C;  3P3N A;  3CS5 A;  5HFM A;  2CE4 A;  3FB6 C;  2Q73 A;  3IGA C;  3HKD A;  1DGS A;  2ZE6 A;  5LYJ B;  4CS2 A;  2JS3 A;  4QE7 A;  4LP8 A;  2ZM6 O;  5B1A B;  3GB7 C;  3X2Q B;  1GN3 A;  3L9D A;  4TV9 B;  4DV6 B;  2WA4 A;  2EIM B;  3AK3 A;  4C7U A;  5JJN B;  4NXM O;  1H2S B;  4I4T A;  3DC5 A;  4JI6 O;  4K0K B;  4CS4 A;  4DW0 A;  1NZ6 A;  5JH7 A;  1KQS U;  4MTX A;  2ZKO A;  1XRE A;  2Y69 C;  1MAB G;  3ZMZ A;  2RCV A;  3FKS G;  3OTO O;  4MS2 A;  4BIZ A;  1XBL A;  1XHZ A;  3T1H B;  1D5A A;  2HP8 A;  4KUM A;  4PD4 F;  3TK1 A;  1PP9 H;  2Y69 B;  4I5S A;  4OPA A;  2AW9 A;  5KA5 A;  5A2Q N;  4LF9 B;  3UO3 A;  4DR3 O;  5JQG B;  3KKY A;  2G38 A;  4YY3 B;  3W7S A;  1AIL A;  4I50 B;  4NTW A;  3JD0 A;  4X66 B;  4O4I A;  4K35 A;  1R3J C;  1AP6 A;  1X4T A;  2QWP B;  1VF7 A;  3CMA V;  2PTM A;  1LR1 A;  3GWK C;  2HVK C;  3C90 A;  1EFR G;  1QVG U;  4GCZ A;  1QCE A;  4MTF A;  4U7O A;  3SJB C;  3E2E A;  1SF9 A;  2KG7 A;  4YJ3 B;  3F5T A;  2L35 A;  4X9Q A;  3HKE B;  3SPC A;  5CA0 B;  2CAZ C;  3JAL A;  4UVB A;  4DO2 A;  1Z2G A;  1Y76 A;  5B1O A;  1Q5O A;  5BMV B;  3OMI B;  1E79 G;  4FLX A;  1WP7 A;  5KUM A;  4FZ1 A;  1RP3 B;  2VS0 A;  4QJF B;  4NVP A;  4GT1 A;  2RJZ A;  5LA6 A;  3RVZ A;  5CBH A;  3JYC A;  5L3E A;  2PY5 A;  1X59 A;  4ICG A;  2ADQ B;  4G27 B;  3CRA A;  4HNA A;  1XEQ A;  4FLT A;  4X88 A;  3VOU A;  1VEW A;  5L3B A;  2UXX A;  4GZR B;  5GON A;  3CCM V;  4U7N A;  3SJQ C;  4UUJ C;  2EZP A;  3OMN B;  4YHH O;  4L87 A;  4LH6 A;  1FXK B;  1NH2 D;  1TA8 A;  3DXR A;  3CJH B;  4DV2 B;  1NJI W;  2WPD G;  1WPB A;  5E79 Z;  1XDC A;  1BE3 H;  1SQV H;  5IWA B;  3K0G A;  3L73 H;  4H13 B;  4DR6 B;  2E74 B;  3QO7 A;  3SGI A;  5IY5 B;  1ZL8 B;  4WFH A;  4DRX B;  5ITZ B;  4J7J A;  3B8M A;  1OJH A;  3ZN1 A;  4FLU A;  3KG2 A;  3U0Z A;  3CC2 V;  3AG7 A;  4F4L A;  5CA1 B;  3CME V;  2RQ6 A;  5J9P C;  1JQ0 A;  2NNU A;  3JAS B;  3OEH G;  4FLY A;  3KCY A;  3A2F A;  2IH3 C;  3NR7 A;  1LUV A;  2OCH A;  4OGQ B;  4JTD B;  3SDL A;  1BL8 A;  1XHX A;  2K1E A;  2F1M A;  2EIL B;  5IJ9 A;  2EIJ C;  3QO8 A;  2VWJ A;  2JJ1 G;  4LNU A;  5FPR A;  4X65 O;  5D5P A;  4B3S O;  4IT5 A;  4JYY A;  4LF8 O;  1FXV A;  4KXR A;  4MVZ A;  2D2C B;  1YTF D;  3T1Y B;  4TOI A;  1ROP A;  2O57 A;  4ZIB A;  2QKS A;  1XQ8 A;  2VWK A;  3E35 A;  2WLI A;  4GKJ B;  5IJ0 A;  4B3T O;  4UFZ A;  1SKV A;  5DED A;  3RYI B;  1KUQ A;  4R6Z A;  2EIN B;  4JGS A;  4TV8 A;  5C93 A;  4DV0 O;  1VQP V;  1N32 B;  4IHJ B;  3G80 A;  2YXY A;  3E22 A;  2ILM A;  1H2K A;  3O9O A;  5J2T B;  1PKX A;  1JCH A;  2X7R B;  5LL6 Y;  4FLW A;  3G71 V;  2IJK A;  4D6T H;  1P7B A;  4EB6 A;  4JI7 B;  4WBN A;  4I55 A;  5LP6 C;  4J41 A;  3SYQ A;  2ZR3 A;  2XT9 A;  2UXD O;  2ZM6 B;  3UQ8 A;  3ASN B;  2XAS A;  1K8A W;  4EFB A;  4DV5 B;  1V9P A;  3GWO A;  4DR5 O;  5EBM C;  4PA4 A;  1P7G A;  1WNS A;  4RWU A;  2Y0P A;  4N23 A;  1K33 A;  4GX1 A;  2Q9L A;  5LP6 B;  4PV1 B;  4U3J A;  1KP2 A;  3M7M X;  3MHS C;  3RVY A;  1MZF A;  4UCV A;  4X1Y B;  1QU7 A;  1GTO A;  4HYO A;  2RNB A;  2ZXW C;  1Q90 D;  5H6R A;  4RQF A;  3D8C A;  2R9A A;  4D7T A;  2YSU B;  5C8Y B;  4DUZ O;  1IBM B;  4O2B A;  4O4J B;  3RW0 A;  2IM9 A;  1BSM A;  4LFC O;  1DTO A;  2ZT9 B;  2CGO A;  4JI2 O;  2F4V O;  1IXM A;  3K9S A;  3UM7 A;  4CBC A;  2Y4T A;  3RYF A;  1SA0 A;  4QPJ A;  4CS3 A;  4KHP B;  2W0F C;  1I5X A;  1K9M W;  2F23 A;  4JI8 B;  1R3L C;  3RYH B;  1Y74 A;  3U11 A;  3N2G A;  2V7Q G;  5IYZ A;  1TUB B;  1BMF G;  2LJ2 A;  3OUF A;  2FML A;  3G4S V;  3QNE A;  2QA4 V;  5B1B C;  3RFR A;  3ZHQ A;  3K04 A;  5H2F Z;  1Q6U A;  1BQZ A;  2DMX A;  1ZTE A;  1XMO O;  3F5W C;  5KX5 A;  1MOF A;  5J2U B;  2JK5 C;  4O2A B;  2KSD A;  1FD9 A;  2F66 C;  2CH7 B;  4I0X A;  1K5S A;  1M4U A;  3JCZ A;  3HB3 B;  1XOU A;  3D36 A;  5B1B B;  1GM9 A;  3H1I H;  5CA3 A;  3MAQ A;  4TSF G;  2GV9 A;  4TV9 A;  4PDM A;  1ZX3 A;  2HHH O;  1S0V A;  5CB4 A;  2Q7H A;  3ZHR A;  1BHB A;  4JF3 A;  2V1D A;  4LF4 O;  3M8A A;  1ARO P;  2BSK A;  2QR4 A;  3NXS A;  3CX5 F;  2AHZ A;  1W0K G;  2OCC C;  2RN9 A;  1BT8 A;  1BS3 A;  3E86 A;  3LDD A;  2LW1 A;  5BR8 O;  1FJG O;  4LF6 B;  1WAZ A;  5LMN B;  4LFA O;  3BPZ A;  3UKM A;  1M1K W;  2VQE O;  1OCZ B;  4DV7 O;  1LNQ A;  4JYA O;  4AHC A;  1S5L Z;  4NTX A;  1XUQ A;  2DYS B;  1O9H A;  5JQG A;  2LFR A;  3QTC A;  1P4R A;  2UUB O;  2WLM A;  1HNX O;  2Q5Z A;  5FPO A;  3E8G A;  2UUA O;  4B3M O;  2EZO A;  2UXB O;  1NTM H;  4IYH A;  2QSA A;  1PNL A;  4MVS A;  1SQF A;  1SES A;  1R3I C;  3KCX A;  1BGY H;  5EZY B;  2RMK B;  2X6C A;  2YXL A;  3K9A A;  4FFB B;  1VIB A;  4JI4 O;  5L3F A;  4JYB A;  1PD3 A;  3ASO C;  4MVQ A;  4GKK O;  1I94 O;  2ZE8 A;  4YJ3 A;  4F6R B;  1Y4M A;  2GUZ B;  4R8C A;  2Q7E A;  5D5Q A;  3JD4 A;  3A0H Z;  3ZED A;  1TVK B;  2M7W A;  5LBQ A;  1MZE A;  3CE2 A;  1NVP D;  3PJS K;  3WFV A;  1K4C C;  1DF5 A;  4DR1 B;  1HNZ O;  3CCV V;  4CH6 A;  2EJ7 A;  4WFA V;  2QKC A;  3HR0 A;  2ODM A;  3W7T A;  4X20 B;  2ZIO A;  1YF2 A;  3GVM A;  3HKC A;  2VQF O;  2F95 B;  1IBL O;  4B3S B;  1XNQ O;  1THZ A;  3BFR A;  1KB9 F;  4HBN A;  3CXC U;  3H1J H;  3P3P A;  2Q4P A;  5FNV A;  3ZHU A;  1QHT A;  3L70 H;  3A0B Z;  3EXA A;  1IX9 A;  1HR0 O;  2DWE C;  2YDE A;  1M93 A;  1VQ6 V;  1SQG A;  3F7V C;  3ZN0 A;  4IYI A;  3JD1 A;  1N34 B;  1P49 A;  3K5O A;  2QWQ B;  2ZD9 A;  4QE9 A;  2BOB C;  2JDI G;  3ETQ A;  4BIO A;  3B4S A;  3H1H H;  1VF6 C;  2IU3 A;  3Q4H A;  5BZB A;  4JI3 O;  2XHB A;  1PL0 A;  1M5I A;  3HPL C;  3B09 A;  4TQD A;  1F7Y A;  2HEP A;  2OTL V;  3QF7 A;  1VMG A;  2IBZ H;  3JD3 A;  3MHH C;  4JV5 B;  1QLE C;  1RSO A;  1PPJ H;  4GUN A;  5GTI Z;  3BRC A;  2UXD B;  1H8H G;  4FK5 C;  2JIZ G;  4NB5 A;  4LFB B;  3J81 N;  2Z3Y A;  2XAH A;  4UVA A;  4DR5 B;  2ARH A;  1IBK O;  1NTZ H;  1GO3 F;  2E75 B;  2YS8 A;  2OWO A;  3OT7 A;  5IT9 N;  1DF4 A;  4ZI7 A;  1WA8 B;  2XUM A;  4UV9 A;  4J7K A;  5JVD A;  1WPX A;  5KHK A;  2IW5 A;  3SYP A;  5JJE B;  3ZBH A;  4W4L A;  3HKB A;  3UT5 B;  1GK9 A;  2HFE C;  4TUY A;  2KQX A;  1L8D A;  4MTO A;  4J9Y B;  4DUZ B;  1O9G A;  4IIJ A;  1JVM A;  1URF A;  2F4V B;  4WFB V;  1JJO A;  1YXB A;  3LSQ A;  2DW4 A;  5DM6 V;  1KP3 A;  4O4H B;  3JAK B;  3SJC C;  3UCS C;  4NKG B;  4BW5 A;  1VAR A;  1FAF A;  1D2D A;  3ZRS A;  4R7C A;  2CUG A;  4ZHQ A;  1GM7 A;  3BY6 A;  2HVJ C;  4TT3 G;  3ETG A;  3CHX A;  2YEV A;  1VF5 B;  1VP7 A;  2P6J A;  3JD2 A;  3A8T A;  4PEL A;  1ZWI C;  1Q7Y W;  2L6L A;  1JFF B;  3ZHT A;  2BTQ B;  3P32 A;  4DYL A;  4RQE A;  4Q20 A;  2XND G;  1Q3E A;  2MK3 A;  2B9Z A;  1NTK H;  2WLL B;  1Z5V A;  4Z1V A;  3BAB A;  1WB8 A;  2WLK A;  4XDK A;  2YIB D;  4CZZ A;  1E1Q G;  2IJH A;  4H37 A;  3RGB A;  2DQ0 A;  2DN9 A;  2ZIM A;  5KMG B;  2FL4 A;  2H3O A;  4IL6 Z;  2Z0A A;  3AK1 A;  3B77 A;  4G28 B;  4ABM A;  1VQK V;  3EVK A;  3FYE B;  1AI5 A;  2HHH B;  4P2Z A;  1FS0 G;  1YI2 V;  4FFK A;  3K08 A;  1G1X B;  2DJV A;  3CC7 V;  4OX9 O;  3DTU B;  1XI1 A;  1WB7 A;  4PDV A;  1AJN A;  4UCT A;  4QNH B;  4LF4 B;  2E76 B;  4X62 B;  3IAY A;  2F43 G;  3G67 A;  2B1G A;  4GX2 A;  4NXN B;  1VQM V;  2WLH A;  3ZHS A;  3AG1 C;  1F4M A;  5C8Y A;  4DR7 O;  5KHJ A;  4UCS A;  2CTP A;  1Y6X A;  2WLJ A;  3CCL V;  3AG2 C;  4JYA B;  3LNM B;  1N33 B;  4LWS A;  1KD1 W;  4NR1 A;  3FD9 A;  3I55 V;  3AG1 B;  2R9R B;  4X64 O;  1NQT A;  4BAY A;  4PA7 A;  4AIL C;  3ETD A;  4X8A A;  4X1K B;  2UUC B;  2UUA B;  1SC5 B;  4YIO A;  1WJZ A;  3K3W A;  1FFX B;  3FB5 C;  4LF7 B;  1BZK A;  2DOS A;  2A0L A;  2YUA A;  4RO2 A;  1M57 C;  3FB8 C;  4JAU A;  4DV3 O;  4YIP A;  1B6Q A;  1UJW B;  1ZAU A;  3VQX A;  1I0H A;  1K92 A;  1NKD A;  3QVN A;  1OCR C;  1BHA A;  2C2A A;  2FB5 A;  2ITD C;  1US6 A;  4GKK B;  4YJ2 A;  1M57 B;  3ICX A;  4HAM A;  3K5N A;  3ZHV A;  2UU9 B;  1V55 C;  1XMQ O;  3SPJ A;  5EIB D;  3C3S A;  5L3D A;  3K57 A;  5BY1 A;  1OCR B;  4I9W A;  2ZIN A;  3QO5 A;  3AG4 C;  1N4C A;  4A5U B;  2CGN A;  5GTH Z;  4DUY O;  4UXN A;  1V55 B;  2GTS A;  1IVS A;  2VQF B;  1IBL B;  4J7Z A;  1UFI A;  5JH7 B;  4AQY B;  3AG3 C;  1TAE A;  1MNG A;  2EIJ B;  4JI5 B;  3W7U A;  2YI9 A;  3OTF A;  3CCU V;  4JI0 O;  1K7D A;  3ZRW B;  3DC6 A;  1N36 O;  3CWB H;  3JAT B;  1R73 A;  4DV1 O;  1COW G;  2QKA A;  5LMU B;  5E1A C;  4QIW F;  1XL6 A;  4UCR A;  3L71 H;  4DV4 O;  5LXT A;  4PI0 A;  4JPR A;  3K0D A;  2UXC B;  4J11 A;  2P4K A;  3E8B A;  1Q82 W;  1AR5 A;  3DSQ A;  2E3C A;  4DR2 B;  4CH4 A;  1AJQ A;  3CCQ V;  4JI1 O;  1DLB A;  2ZDI A;  1NT2 B;  1AP5 A;  4WFG A;  4O4I B;  1JMK C;  4DR4 O;  5LOV A;  1JR9 A;  4DXW A;  1R6N A;  2CTQ A;  1F23 A;  4WF9 V;  4CH5 A;  3RT3 C;  4EFE A;  3CC4 V;  3OEE G;  2D3O W;  3OMA B;  2ZCE A;  2KG7 B;  5CBG A;  4UV8 A;  5B66 Z;  3OGI B;  2QM8 A;  1F4N A;  2QWO B;  3CRR A;  3CYO A;  4N21 A;  4NXM B;  1TVK A;  1WP8 A;  3JAL B;  3AEI A;  5L3C A;  4QGP A;  3JAW A;  4JI6 B;  5IDJ A;  4X1I A;  4DV6 O;  1Y76 B;  4B3R O;  4LC1 A;  2YIC A;  3JAR A;  2A9H A;  4BWA A;  5KHH A;  3OTO B;  1GAX A;  4K0K O;  5LA6 B;  1YJW V;  5IYB O;  2JGD A;  3OR6 C;  2R72 A;  2YIB A;  3H1L H;  4HNA B;  1GM8 A;  1RPR A;  2A79 B;  2QE7 G;  2GSM B;  2ZXW B;  5IE9 A;  3B2E E;  3OGC C;  3SYO A;  4IGG A;  5JCO A;  1NR7 A;  5GON B;  3ZRX A;  2XAF A;  5LGU A;  4DR3 B;  3T1H O;  1Z5W A;  3VQV A;  2LW7 A;  3JAM N;  2B5U A;  5JWP A;  2W0X A;  1SRY A;  1YSC A;  4CH3 A;  2P67 A;  1RFY A;  3FAV B;  3AK2 A;  3DXR B;  3MD0 A;  1AI6 A;  4LF9 O;  3RN4 A;  1GN2 A;  1OV9 A;  4YY3 O;  2ZNJ A;  5EC1 C;  4GX5 A;  2HJD A;  2LQT A;  4K3A A;  1YJN V;  4RUE A;  4H33 A;  3RYC B;  5EBL C;  1GMG A;  4FM1 A;  4PI2 A;  4O4L B;  4FLZ A;  5LYJ A;  4K8X A;  4W4K A;  4FMT A;  2PI4 A;  3BA8 A;  4TWK A;  3SYC A;  3FYI B;  1GN6 A;  1AVM A;  1H2M A;  2QM7 A;  4LCU C;  3DGE A;  3I5D A;  3J7A U;  3VBB A;  3OFN G;  2FTK A;  3OE7 G;  2V4D A;  1GRJ A;  1VQL V;  2Q6A A;  3LDC A;  2YC0 A;  4LR3 A;  1XL4 A;  5IJ9 B;  1WA8 A;  1K4D C;  4XDJ A;  2XAJ A;  1VQ5 V;  4MW3 A;  1NR1 A;  3ETE A;  3CCJ V;  3LUT B;  2OTJ V;  1HWY A;  1MMM A;  3CCE V;  2AZ2 A;  4YHH B;  4CC6 A;  2P22 C;  5A9G A;  2OCC B;  3ZMU A;  4UCO A;  1DK1 A;  5B1N A;  1RM1 C;  2WLI B;  2BE3 A;  4I50 A;  5IJ0 B;  1JOY A;  1VQ4 V;  4X64 B;  2NLJ C;  2XOK G;  3VQW A;  5DN6 G;  1G4Y B;  5IYC O;  1M9N A;  4DV2 O;  3N2K B;  4H0L B;  4HZ3 A;  4TV8 B;  2Q68 A;  3D3I A;  4JAV A;  3E22 B;  5H9C A;  3ZJZ A;  1S77 D;  1JFF A;  2QEX V;  2PZS A;  3CXH F;  3K03 A;  3HKE A;  1HDJ A;  1QVF U;  4JTA B;  4PA3 A;  1I7F A;  5CA0 A;  4WBN B;  1PL4 A;  2OYQ A;  1UPG A;  1RPO A;  3F7Y C;  4P30 A;  3ASO B;  5EBW C;  2Q7G A;  1QBZ A;  1S72 V;  5BMV A;  2GHY A;  3OM3 B;  2PGG A;  2Q0A A;  4E4E A;  4WFF A;  4X65 B;  4U3J B;  1CXZ B;  2AXT Z;  4LF8 B;  3SR2 C;  4KP4 A;  5KHG A;  1KU9 A;  3ABK C;  1FPO A;  3APQ A;  1SZT A;  2R9I A;  4MVO A;  4DV1 B;  1R3K C;  5EC2 C;  5EK0 A;  1YHQ V;  1SQX H;  4O2B B;  4B3T B;  1FXK A;  3TXQ A;  2QJ1 A;  2LP7 A;  3SPG A;  1VQN V;  2DE0 X;  1V54 C;  1W2B U;  2YXH A;  3CJH A;  4LH7 A;  3WB1 A;  3RYF B;  5KHI A;  1MSD A;  1SA0 B;  3TGU H;  1J5E O;  3H9V A;  1XNR O;  4DV0 B;  2EBO A;  4GKJ O;  1F51 A;  1Y66 A;  2PUS A;  1N0J A;  1PNK A;  1KKC A;  2ADP A;  2QTO A;  3K58 A;  1EN6 A;  4G2K A;  3CP1 A;  3IFX A;  5CN0 A;  1QR9 A;  4PDR A;  1OZ0 A;  4KL1 A;  1ZL8 A;  1G8M A;  5LGN A;  1Y74 B;  3K59 A;  1L0N H;  1N32 O;  1AR4 A;  4DRX A;  1CP9 A;  5ITZ A;  4AI8 A;  1EN5 A;  1FKA O;  3L74 H;  2PYL A;  2P7T C;  1R1B A;  5B1A C;  3D36 C;  3P30 A;  2OIE A;  3SYA A;  3STL C;  4LBE C;  3FB7 C;  5CA1 A;  3WU2 Z;  2EJR A;  3MDS A;  4OXS A;  3BAA A;  5KX5 B;  3JAS A;  1S3J A;  1Q86 W;  1W59 A;  3J80 N;  4JI7 O;  1NH2 B;  4I0X B;  2FKX A;  5B3S C;  1L1F A;  2XTA A;  1Q81 W;  1QLE B;  2IU0 A;  1T5E A;  1KBH A;  2M6Y A;  1FXH A;  1KKD A;  1YVW A;  3JCU Z;  2JS5 A;  4DV5 O;  1SER A;  4B3R B;  3OW2 U;  2ZE5 A;  1SQQ H;  5CB4 B;  3BVO A;  2QGN A;  4B7E A;  5B3S B;  4PA9 A;  4RUF A;  3THO A;  4PJ0 Z;  3ML0 A;  1PM9 A;  4GX0 A;  2ITC C;  2BSK B;  3ZMT A;  2QWR B;  4D7S A;  4LFC B;  4ZKI A;  4JI2 B;  5EIB C;  3WB0 A;  1KYO F;  3ZRW A;  2HG5 C;  2N04 A;  3JAT A;  1TGO A;  3R65 A;  1FFT B;  4YXW G;  1IBM O;  3ABU A;  1MSW D;  2CK3 G;  1PV0 A;  4QPK A;  4H44 B;  3RYI A;  4JZ2 A;  3LSU A;  1W0J G;  4U3F H;  4KHP O;  1IZ3 A;  3JSL A;  1M56 C;  4IHJ A;  4B7K A;  4ZOL B;  1H2L A;  3TXS A;  5J2T A;  4JI8 O;  1D5N A;  5KLV H;  5CBF A;  3O65 A;  1XMO B;  3H01 A;  1YTF B;  1EBO A;  5EYP B;  1M56 B;  5F2V O;  3S3W A;  4BW9 A;  1B06 A;  3G6E V;  2A7W A;  4ZBM A;  2EX3 A;  3R66 A;  2X6A A;  2AGA A;  2KKW A;  2UXN A;  3K06 A;  3I56 V;  2FYU H;  2RDC A;  4F6E A;  2ZE7 A;  5LP6 A;  1VQ7 V;  4X1Y A;  3JSN A;  4PHZ A;  2JEU A;  4Z2W A;  4LF5 O;  3HKC B;  3QG5 A;  3IC7 A;  5TIS Z;  5BR8 B;  1FXK C;  5LHH A;  1FJG B;  1Q43 A;  1QLN A;  2X0L A;  1AI4 A;  4O4J A;  4LFA B;  1I08 A;  4FIP C;  5FNV B;  1OHH G;  2VQE B;  1YEW A;  4DV7 B;  2QTS A;  4DK0 A;  4FM2 A;  1VQ8 V;  4LF6 O;  5LMN O;  2UUB B;  1HNX B;  2IH1 C;  4B3M B;  4XBF A;  2UXB B;  3FAV A;  2W6J G;  2AZ0 A;  1I5Y A;  5IY5 C;  3RYH A;  2W6I G;  3W7W A;  3AG2 B;  3WB2 A;  1Q8I A;  3LSS A;  2JGU A;  3E89 A;  1TUB A;  4MT8 A;  1S76 D;  1YDX A;  3C3T A;  4FLV A;  4JI4 B;  4I9Q A;  2GTA A;  5DEC A;  1ENV A;  3H1K H;  3K5M A;  3T1C A;  3Q4H B;  3U10 A;  3RYC A;  3HKD B;  1I94 B;  1SET A;  5J2U A;  4O2A A;  1S5H C;  4JAA A;  4O4L A;  2CH7 A;  2Y48 A;  2A06 H;  1K5Q A;  2IJI A;  3CRC A;  2YI8 A;  1RSO B;  3ABM C;  1BCC H; 
#chains in the Genus database with same CATH homology
 3JD4 A;  4RAI A;  2Y69 B;  2B5U A;  4I5S A;  2EIL C;  1SRY A;  5FL7 G;  2M7W A;  1YSC A;  5KA5 A;  5LBQ A;  2P67 A;  1NVP D;  3MD0 A;  3PJS K;  3W7S A;  1VQO V;  3WFV A;  1K4C C;  1AI6 A;  1DF5 A;  3JD0 A;  3CCV V;  4PA6 A;  3ZCC A;  4WFA V;  1R3J C;  1K3E A;  5EC1 C;  3ZMV A;  4MW8 A;  3ABM B;  4GX5 A;  3W7T A;  2WAM A;  3CMA V;  3BEH A;  1YJN V;  4RUE A;  1H2G A;  1AJP A;  4H33 A;  1THZ A;  4EKW A;  5EBL C;  1GMG A;  3AG4 B;  2HVK C;  3CXC U;  1EFR G;  1QVG U;  4GCZ A;  1QCE A;  4MTF A;  4U7O A;  1M90 W;  1JJ2 U;  3E2E A;  1VQ9 V;  2HJF C;  4MVR A;  3AG3 B;  4FMT A;  2XAQ A;  3SPC A;  4TWK A;  5LHG A;  2PI4 A;  3SYC A;  2DWE C;  2EIN C;  3FYI B;  2JEX A;  1VQ6 V;  2H8P C;  4UVB A;  2QM7 A;  3F7V C;  4DO2 A;  3ZN0 A;  2DWD C;  1CEZ A;  3JD1 A;  4LCU C;  3DGE A;  3WG7 C;  2LFS A;  2WLN A;  3VBB A;  3OFN G;  5B1O A;  2FTK A;  1YJ9 V;  3OE7 G;  3OMI B;  1E79 G;  2ZD9 A;  4QE9 A;  5LGT A;  2Q6A A;  1VQL V;  3LDC A;  2BOB C;  5KUM A;  1TUE B;  3CCR V;  2JDI G;  1XL4 A;  4QJF B;  2YEV B;  4GT1 A;  3E83 A;  3RVZ A;  5CBH A;  4XDJ A;  1K4D C;  3JYC A;  5L3E A;  2AHY A;  2XAJ A;  2IU3 A;  5H6Q A;  3WG7 B;  1VQ5 V;  4MW3 A;  1NR1 A;  3ETE A;  5BZB A;  3CCJ V;  1PL0 A;  4G27 B;  3HPL C;  1E1R G;  3LUT B;  2OTJ V;  1K73 W;  1HWY A;  1J95 A;  4X88 A;  3VOU A;  5KUK A;  2OTL V;  3CCE V;  4P9P A;  3ASN C;  2UXX A;  5L3B A;  3JD3 A;  3MHH C;  3CCM V;  4U7N A;  2XAG A;  3SJQ C;  1QLE C;  4UUJ C;  2EZP A;  3OMN B;  4L87 A;  1H8H G;  1NBM G;  4FK5 C;  4MVM A;  1FXK B;  2KB1 A;  2OCC B;  3ZMU A;  2JIZ G;  4J9Z B;  1NH2 D;  2Z3Y A;  5B1N A;  2EIK C;  2XAH A;  4UVA A;  2WLI B;  1RM1 C;  1NJI W;  1JOY A;  2WPD G;  1VQ4 V;  4E2L A;  2XOK G;  2NLJ C;  5DN6 G;  1G4Y B;  2P90 A;  1M9N A;  4XDL A;  3T4D A;  5IYC O;  1GO3 F;  3K0G A;  4HZ3 A;  5GW7 A;  3TCU A;  2IJJ A;  1DF4 A;  3OAA G;  2Q68 A;  3D3I A;  3QO7 A;  4UV9 A;  4JAV A;  2EIK B;  1WPX A;  4WFH A;  5IY5 B;  3CD6 V;  5H9C A;  2IW5 A;  3SYP A;  3ZJZ A;  1S77 D;  2HR3 A;  3SPH A;  3B8M A;  5CMU A;  1GK9 A;  2HFE C;  3ZN1 A;  4FPP A;  1H38 A;  2QEX V;  3KG2 A;  4J9Y B;  4MTO A;  3K03 A;  3CC2 V;  1JVM A;  1QVF U;  4JTA B;  4F4L A;  4WCE V;  2WWW A;  1YIT V;  4PA3 A;  3CME V;  4WFB V;  4BIU A;  1JQ0 A;  2NNU A;  3LSQ A;  2DW4 A;  3OEH G;  5J9P C;  1RPO A;  5DM6 V;  3F7Y C;  2IH3 C;  4P30 A;  3ASO B;  3M99 B;  5EBW C;  1NVP B;  1KP3 A;  2Q69 A;  4BW5 A;  1QBZ A;  3A0R A;  1S72 V;  4JTD B;  2B1I A;  1BL8 A;  2K1E A;  3ZRS A;  4R7C A;  1GM7 A;  2DQ3 A;  2GHY A;  3OM3 B;  3BY6 A;  2HVJ C;  2EIL B;  4JYC A;  4TT3 G;  3ETG A;  2YEV A;  4WFF A;  2EIJ C;  2Q67 A;  2P6J A;  3JD2 A;  4MVU A;  3QO8 A;  4PEL A;  5L3G A;  1ZWI C;  1Q7Y W;  2JJ1 G;  3LDE A;  4KP4 A;  3P32 A;  3ABK C;  4UVC A;  4Q20 A;  4RQE A;  2XND G;  1SZT A;  2MK3 A;  2R9I A;  1FXV A;  3ZMS A;  2BOC C;  2WLL B;  4MVZ A;  4Z1M G;  4MTG A;  3W7X A;  1YTF D;  4MVO A;  1R3K C;  5EC2 C;  2WLK A;  4XDK A;  5EK0 A;  1ROP A;  1YHQ V;  1AI7 A;  1FXK A;  4CZZ A;  1E1Q G;  2IJH A;  2QKS A;  4H37 A;  2LP7 A;  3SPG A;  1VQN V;  2DQ0 A;  1V54 C;  1W2B U;  2H94 A;  3E35 A;  2WLI A;  3ABL C;  4X89 A;  3EHB B;  1H8E G;  3B77 A;  4G28 B;  1VQK V;  4WFE A;  3T2M A;  3FYE B;  1QR8 A;  2EBO A;  1AI5 A;  1F51 A;  1Y66 A;  3STZ C;  2OT5 A;  4R6Z A;  2QTO A;  1PNK A;  1FS0 G;  1OCC C;  2EIN B;  4P2Z A;  4G2K A;  4JGS A;  3CP1 A;  4JAS A;  5C93 A;  1YI2 V;  3K08 A;  1VQP V;  3CC7 V;  3DTU B;  3CPW U;  3IFX A;  4ASU G;  5CN0 A;  1QR9 A;  3OUS A;  4PDR A;  1OZ0 A;  4PDV A;  1AJN A;  1G8M A;  5LGN A;  4QNH B;  3ABL B;  1KEC A;  3K79 A;  1CP9 A;  1PKX A;  2F43 G;  2B1G A;  4GX2 A;  1VQM V;  2WLH A;  1MG1 A;  2P7T C;  5B1A C;  1JCH A;  3P30 A;  1OCC B;  2X7R B;  3AG1 C;  3SYA A;  1F4M A;  4LBE C;  3STL C;  3ZRV A;  3FB7 C;  1WLE A;  2IJK A;  1P7B A;  1OCZ C;  5IYD O;  3G71 V;  2EJR A;  4OXS A;  2DYS C;  1S3J A;  2WLJ A;  2ZR3 A;  3SYQ A;  1Q86 W;  3CCS V;  2ZDI C;  1NH2 B;  3ZIA G;  5B3S C;  3ASN B;  2XAS A;  3AG2 C;  4PDL A;  1L1F A;  3CCL V;  1Q81 W;  1K8A W;  2WSS G;  4JTC B;  3LNM B;  1KD1 W;  1QLE B;  2IU0 A;  3I55 V;  3AG1 B;  2R9R B;  1NQT A;  3GWO A;  4PA7 A;  4BAY A;  4PA4 A;  5EBM C;  3ETD A;  4X8A A;  4N23 A;  1FXH A;  1KKD A;  1K34 A;  1K33 A;  3K3W A;  4GX1 A;  1SER A;  2HKO A;  3OW2 U;  3FB5 C;  1KP2 A;  3MHS C;  3RVY A;  1YIJ V;  1RM1 B;  1EZJ A;  2A0L A;  4RO2 A;  1M57 C;  3E8F A;  1GTO A;  3FB8 C;  4R50 A;  5B3S B;  4HYO A;  4PA9 A;  4RUF A;  4JAU A;  2ZXW C;  3ML0 A;  2ZQM A;  4GX0 A;  2ITC C;  5H6R A;  4RQF A;  2WLL A;  1B6Q A;  1CPY A;  1UJW B;  3ZMT A;  2YSU B;  4ZKI A;  1K92 A;  1NKD A;  1OCR C;  1PNM A;  1BHA A;  2C2A A;  3ZRW A;  3RW0 A;  1JX9 A;  2HG5 C;  2ITD C;  4FJC C;  1DTO A;  1M57 B;  1IXM A;  3R65 A;  4HAM A;  3UM7 A;  4CBC A;  1FFT B;  4YXW G;  1ORQ C;  3ABU A;  1MSW D;  2CK3 G;  4QPK A;  4QPJ A;  1V55 C;  3B8N A;  2ZR2 A;  3SPJ A;  3ABT A;  1N8R W;  2W0F C;  5L3D A;  1OCO C;  1OCR B;  4I9W A;  1I5X A;  4KFM A;  2Z5U A;  1W0J G;  1K9M W;  3QO5 A;  1M56 C;  2X6B A;  3AG4 C;  1R3L C;  2V7Q G;  4UXN A;  1BMF G;  1V55 B;  5CBF A;  3OUF A;  3SPI A;  3G4S V;  5KA6 A;  3AG3 C;  3QNE A;  5B1B C;  2QA4 V;  1OCO B;  3H01 A;  2EIJ B;  3K04 A;  1YTF B;  3W7U A;  3CCU V;  1K7D A;  1EBO A;  3ZRW B;  1M56 B;  3F5W C;  3T4Z A;  5LHI A;  1MOF A;  1R73 A;  2JK5 C;  1COW G;  1KC8 W;  2DYR C;  3ABK B;  3G6E V;  5E1A C;  1GKF A;  4QIW F;  1XL6 A;  2JJ2 G;  1K5S A;  1AR1 B;  2HLD G;  4ZBM A;  2X6A A;  3JCZ A;  4JPR A;  3K0D A;  1JPX A;  3HB3 B;  3D36 A;  5B1B B;  2UXN A;  3K06 A;  3E8B A;  3I56 V;  1GM9 A;  1Q82 W;  3E8H A;  5CA3 A;  4MSW C;  4TSF G;  4PDM A;  1AJQ A;  3CCQ V;  1S0V A;  1V54 B;  3RBZ A;  1VQ7 V;  4P9O A;  1DLB A;  2DYR B;  2ATK C;  2ZDI A;  3EFF K;  4WFG A;  1K97 A;  3OR7 C;  2JEU A;  1R6K A;  3TET A;  4DXW A;  4JF3 A;  1BHB A;  2V1D A;  1ARO P;  1R6N A;  3X2Q C;  5HFL A;  3NXS A;  1F23 A;  3IC7 A;  2PI5 A;  2AHZ A;  2EIM C;  4WF9 V;  1W0K G;  1FXK C;  5HFM A;  5LHH A;  1QLN A;  2OCC C;  2X0L A;  3FB6 C;  1AI4 A;  3CC4 V;  3OEE G;  3IGA C;  3E86 A;  3LDD A;  2D3O W;  3OMA B;  4FIP C;  1OHH G;  5CBG A;  4UV8 A;  4QE7 A;  4LP8 A;  5B1A B;  3GB7 C;  3X2Q B;  2QM8 A;  1F4N A;  3UKM A;  1M1K W;  3CYO A;  4N21 A;  1VQ8 V;  1OCZ B;  1LNQ A;  2EIM B;  3AEI A;  5L3C A;  2IH1 C;  2DYS B;  4XBF A;  2LFR A;  5IDJ A;  2W6J G;  1P4R A;  1I5Y A;  2WLM A;  5IY5 C;  3E8G A;  2W6I G;  2EZO A;  3W7W A;  4LC1 A;  3AG2 B;  2A9H A;  3LSS A;  3E89 A;  4MT8 A;  1PNL A;  1S76 D;  4MVS A;  1KQS U;  1SES A;  1R3I C;  4MTX A;  2Y69 C;  1MAB G;  3ZMZ A;  1YJW V;  5IYB O;  1ENV A;  3FKS G;  3OR6 C;  2X6C A;  3K9A A;  3T1C A;  1SET A;  4MS2 A;  4BIZ A;  1GM8 A;  1RPR A;  5L3F A;  4JYB A;  1PD3 A;  2A79 B;  1S5H C;  2QE7 G;  2GSM B;  3ASO C;  4MVQ A;  2ZXW B;  3OGC C;  2Y48 A;  3SYO A;  1NR7 A;  4KUM A;  1K5Q A;  3TK1 A;  2IJI A;  3ZRX A;  2XAF A;  5LGU A;  1Y4M A;  3ABM C;  4R8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...