1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
2Y0IA 1YCIA 1MZFA 3P3NA 4NR1A 3KCXA 4B7EA 1H2MA 3OD4A 4B7KA 2YDEA 5JWPA 2CGOA 2CGNA 3KCYA 1MZEA 2YC0A 4Z1VA 4Z2WA 2WA4A 2W0XA 1H2KA 4QU2A 4JAAA 2WA3A 1H2NA 1IZ3A 3P3PA 2XUMA 2ILMA 4AI8A 4BIOA 1H2LA 3D8CA
chains in the Genus database with same CATH superfamily
4G2KA 1S0JA 1FATA 5LHGA 5CEHA 1W9WA 3RSJA 1NJIW 1NLQA 3HQXA 3O1OA 1QH7A 1V9U1 3AZVA 4JKKA 2SBAA 3QF7A 3NKTA 3MICA 2V5YA 3A8TA 5FZ4A 1ZVFA 3LNNA 3DPRC 1L7RA 3PMSA 4EZ4A 2FDHA 1W2TA 1C8NA 3HR0A 1VRH3 4FAGA 1BXHA 2EIJB 1PGW2 5FO8B 2XAGA 1KB9F 4PQQA 5FY8A 2ZAAA 4BIZA 1GP6A 1VQKV 2VBDA 3F7YC 2BGPA 4LHNA 2X10A 4AFMA 1RYYA 2QKCA 3U4SA 4DS0A 4DV2O 2GC1A 1OPOA 4HKOA 3INAA 1AJKA 4Y5Z0 3ZYPA 1YJKA 5FNVB 2E63A 2JDIG 5DN2A 2CAUA 2ZEXA 4LO4B 3KV4A 1GANA 2ZZJA 1Y3TA 2XHBA 4YZ1A 1W0NA 1R081 1SRYA 2P34A 3MLKA 5AC93 4LKSA 1HW7A 3SITA 5F8PA 3KT7A 4CDXA 4Q1RA 3IGAC 1QNYA 3K04A 1AI4A 3WEZA 2AW9A 3X2QB 3E8HA 2PYLA 3K08A 4XAAA 5KC6A 2BSKB 4R8HA 1A32A 3ABKC 1OFSA 2RHPA 4GWIA 3U37A 3EB7A 3OGSA 2L9LA 4J80A 4HFSA 4AHYA 2RJKA 4XZUG 2GNTA 5FCCA 4DUYO 1EV13 2D40A 3RJRA 1H8TA 4AOCA 2BERA 1Q5OA 2NLJC 3R05A 5A9GA 4GJZA 1GLHA 2IUWA 3KHBA 5FP7A 1VBD2 3JSLA 3ASNB 2E32A 1LNQA 3SKVA 4LBEC 1AYM2 4DRVA 5E1AC 1WW6A 1C1LA 3EBRA 3N9OA 4HPKA 2I07B 3AG3B 1YJNV 4PLNA 4FFBB 1WP8A 5F39A 3AKSA 4UW5A 4GB33 5LBCA 2ZKOA 1Y7BA 1W8FA 4IE7A 4TWTA 3TWIA 1TME3 3S7EA 2Q8VA 5ITZA 1PMJX 3IB3A 4BW9A 4BW5A 1MMMA 3WG4A 1VQ5V 1REFA 2GH8A 5FY5A 1V6LA 3L73H 3STZC 3FJSA 3SYAA 3S3XA 2HWD3 3U0ZA 3MI8A 4NO4A 4LF9O 3BY6A 4QQPA 1S72V 3G6EV 4GKYA 4OI1A 5C4WC 1UPSA 3MUZ1 3UM7A 2DUPA 1K3EA 2P3IA 4FVVA 1BEV2 3FB6C 2VMGA 1YRZA 2JENA 4HZFA 4ISRA 2BTQB 2JDYA 4LBJA 1DBNA 5KWRA 3CCVV 1CP9A 5LY1A 4UYBA 3F95A 2LS6A 4IV1C 4C1XA 4Y1VA 3R0RA 3EYPA 3VHNA 3WP5A 4LF4O 3FAVB 5A7OA 1NE6A 4MTXA 5FY9A 3PURA 1VF7A 3H1JH 1E5IA 4DNYA 3VDDC 5HBAA 3WP4A 4BQ1A 4BR6A 4CS3A 2WT1A 1R6NA 3AX4A 5C3QA 1TUEB 4NHYA 3LDKA 2I2SA 5FP8A 4Y22B 3MIDA 1D0GA 5B4NA 4M4RA 1DTOA 2WZ8A 3MPBA 3AK3A 5E1RA 3RPQA 3J80N 2QKAA 2PQQA 3CCEV 4AGGA 5FOJB 1WCSA 3CSXA 1RUD1 1LESA 4CTEA 2WWWA 2WLNA 3AG1B 3CXHF 1ZZCA 5C93A 1OF4A 1LUWA 2DYSC 2PHUA 2Y26A 1REDA 1CPYA 3RZLA 1E1QG 1ZNPA 3USSA 1U5IA 5LCWL 3UJQA 4KWJA 1CN1A 4LO7A 1W99A 4TLGA 4ABMA 1V54C 3RI8A 4MVRA 4ZU5A 4NOTA 5CFDB 1US3A 4LFCB 2Y0PA 4I7ZB 5A7WB 3J8F2 5JJEB 3JAKB 4FSJA 4CDQB 4CEYA 3ZXEA 5FBZA 4KXRA 5EBWC 2QGNA 2XVLA 3ENRA 5F5IA 1PO21 4AFDA 4JYCA 4JYAO 2RVAA 3AFKA 2J1TA 4ORFA 1RUH2 4ATFA 3UYJA 1LODA 1SBFA 3Q8EA 1HLCA 1XNRB 4DRRA 3NAPB 4FI9A 2X5IC 4X62B 3I2KA 1QJU3 2RS51 1ASJ1 2R041 4HYOA 1SC5B 5CKNA 4PA4A 4FCAA 5T54A 1DF0A 1YNAA 2YC0A 4V1PA 3O1SA 2AACA 3MUY1 3HAGA 2XJQA 3ZCCA 5CADA 2HFEC 5IVBA 4G28B 4FBFA 2CGPA 3NSTA 1UPIA 2WLKA 3KV5A 3B8NA 3ZS8C 3H1HH 4NR1A 3DKQA 1OHFA 3UL2A 3B8MA 2GP3A 3JD0A 1DZRA 3ZKYA 4IHJA 3K9SA 1X8MA 4K6BA 4ITCA 3ZHUA 4TN7A 1YC61 1X33A 1QJEA 5F3GA 4WVZA 4JTDB 1CX4A 4MGQA 4CP9B 5IVJA 1W6MB 3AXDA 5ACA1 4FJCC 1R1A2 3S6PA 4FT8A 2E53A 3T1HO 3V65A 1RGSA 3CP1A 3S57A 3D8CA 2HR3A 1RP3B 4ZOLA 1FMD2 1NZIA 1VBB1 4N8MA 3OMNB 4DV0B 1RPOA 3VOUA 2YUEA 2EULA 1I08A 3PJYA 4CH4A 1E5RA 3POFA 2YROA 2GNDA 2R9AA 4AE2A 2VVFA 4LIVA 4GKJB 3LFIA 3F5WC 2GDFA 2HH9A 2QBXA 3D5OA 4KU7A 4P9OA 5I8TA 5JSPA 2HJFC 1BK0A 2YXSA 2VUDA 3M1HA 2EIEA 3AM2A 5DG2A 2UUCO 4JAVA 4WM7B 3VBUA 1QY4A 1AR73 1RUE3 5GLZA 5G04L 5FAXA 1VAVA 3OB8A 5JI7A 2VZRA 1PHMA 4UCVA 4CUAA 3OGCC 4QPGC 3DXRB 4QPIC 2WLPA 2WQ8A 2XONA 4DUZB 1K5JA 4AI3A 2P3JA 4O2AA 1I6XA 2IXIA 3BIEA 1IOAA 1Q8IA 1BKZA 2WLIB 3CHXA 2DW4A 2ZEZA 4CCDA 2WAOA 1TMF1 1ZZ7A 1WJZA 3LA3A 4YFWA 2E75B 1JMKC 3GCWA 4UFLA 4YM0A 3E97A 4CXYA 3NKGA 3NRUA 1UCXA 1MZEA 1FFXB 1XMOO 2B9VA 1US2A 3HOBA 4WFHA 4GX5A 4FOYA 1G9FA 3OEEG 4E4EA 5FPBA 1AHSA 4XUQA 4NXNO 5GJ6A 4NAOA 4CEWB 4HSJA 5IJRA 1X4TA 1SF9A 2GALA 3I3DA 1RTVA 4GKXA 2F23A 4FPEA 3RZGA 1HJGA 4HANA 1F7YA 3I2FA 3BA9A 3AP9A 1PNFA 4XYXA 2GNBA 1RUC2 5A32B 3FWEA 3FYEB 2ZM6B 4CRQA 5DM6V 3B77A 4FXKB 4JASA 4B4QA 2Q73A 5FREA 2HKOA 5EZWA 3OGVA 4IIJB 4JTAB 4WBNA 4FOVA 3RYFB 4B3NA 3ZLIA 2BOJA 1P84F 4MGZE 3H0OA 4KBZA 4FLVA 1GWMA 1RVF2 4XVHA 2C5DA 3WNXA 5L7OB 5BNOA 3OYWB 1SQ4A 3NW4A 3LFMA 1TVKB 1XOYA 5C5UA 4LE4A 3GZAA 3CCMV 4TSVA 1U12A 1AJNA 4PDRA 3P5BA 4DO0A 4M3CF 4QT6A 2WYFA 1CPMA 1STMA 3AJZA 1PNLA 4XUOA 5C8CB 4QPWA 2ZT9B 4N7IA 4LBOA 2VQFO 2BGCA 4OHVA 2A6ZA 5HFLA 1O4YA 4XFCA 4EYUA 5KUMA 4MTOA 4DV1O 2JVDA 1JZ8A 2FD8A 2DMXA 3IMNA 3ACFA 5AG2A 4LQRA 2IXJA 2R32A 5JZGA 2EBOA 1ZBE3 2IH3C 3L9JT 1US6A 5J96B 2W87A 4XDPA 5FWEA 1OUXA 3ZSEA 1W6PB 2UXDO 4NIHA 3AP6A 4EN8B 2EIDA 4LR3A 2PZSA 3NV3A 1FXKC 1FYJA 5HCFA 3CD6V 1VF6A 5T5OA 3ZXJA 3ZO0B 4TV8B 4ASUG 4WFBV 4IGQA 3I3QA 1W8NA 2UYBA 1D2QA 3JD4A 4O7XA 1UU4A 2QTOA 3OF1A 2Y6JA 4MSWC 4GD4A 3RYHA 3AYAA 3SPGA 3GVMA 3ZFFA 1OH4A 5JDBA 1ENRA 3G67A 3CJIC 1W9SA 4NWVA 2EINB 2Y6FA 3RQ0A 1WB7A 4MSVA 5GLUA 4JGSA 1SLLA 2XBO1 1ND2B 1A8MA 2ZX4A 4Q4W2 5K8SA 1EPWA 3JQXA 3MAQA 4NUBA 2FMYA 1H2LA 3R4UA 4GULA 4GAZA 2F17A 4U2AA 1W6NB 5BXXA 3KVAA 3ZYRA 1AR5A 4DY3A 1DFQA 4P9YA 2VQAA 5EFUA 2VVEA 4FPYA 4ARYA 4PCRA 3WUCA 1ZX3A 2UXBO 4UW4A 2LW7A 2UWAA 4X66O 3APBA 1AF9A 2P3KA 3HIFA 3AMHA 4RGAA 3SKJE 1VBC2 2WPDG 4U3FH 3AP5A 3PTRB 1UIJA 4QX8A 4J6GA 4KHPO 3K77A 5BY5A 1XHXA 2L35A 4UW6A 5JJNB 1ONAA 3ZFEC 1SPPA 3I59B 4NIAA 4QM9A 5FYBA 4B7EA 2Z5UA 3OW2U 4E8DA 4FPCA 4A7KA 3ZYFA 1HV1A 3B40A 5BNNC 4XXAA 3GZTB 2NM1A 2RR12 2GSYA 4FPFA 4KBBA 1VMGA 1V6KA 1MEC1 5IVYA 4Y1YA 4NRQA 4FPPA 3IZOA 3JZVA 4CDWC 4YY3O 3WNPA 1BMFG 1Y74B 2RJLA 3DV8A 4IT5A 3VQVA 1AXYA 4YVSA 1ZBA1 5LGTA 3H1KH 4SBVA 3HQRA 5FOBB 5FUNA 3M3IA 1R082 5LRRA 5BXZA 4DV4B 2ZE7A 2VQTA 1QJY2 5EBLC 2JD4A 2VNOA 4DR5B 1VQ9V 1OJHA 5KMGA 3D36A 4CP2A 2QR4A 5FXVA 1GM8A 4LF5O 3JALB 3KF3A 3CCQV 2WNUC 2WWUA 3T2OA 1A3KA 1PVC3 4O4JA 4QKFA 1JOJA 5BR8O 5FK8A 3FUOA 2YIBA 4URTA 2RS31 3GM8A 3OTOB 3USUA 3MHZA 3AFGA 4XIOA 2Y34A 3A22A 4QQLA 4TSFG 1VE0A 1OZ0A 2UUAO 3CYOA 3AMNA 4J10A 1UXZA 2CK3G 5FPVA 2PYJA 2GZWA 1MS0A 2LRPA 3I4IA 1VQOV 1KRIA 2F4LA 2V72A 2OXBA 5CBLA 1JS9A 2WQ4A 2BW8A 2JJ2G 5KX5A 1HNXB 3AKPA 3O1VA 1MS3A 5K0UB 1JJ2U 3C7GA 1YFXA 1VRBA 1G9BA 3QG5A 4M01A 3ZYHA 4RO2A 2ZA9A 2DN9A 1LRHA 4FVMA 4MUVA 3W7TA 5DN6G 4Q0VA 2WA3A 4Q0QA 4LF7O 1G8MA 1XNKA 1OCZB 5IYDO 4CU6A 2ZE6A 4F6EA 2UUBO 2E3CA 3ZMNA 4DO2A 3D0JA 1E1RG 1SDDB 1KS5A 4L8JA 1RUJ1 2ATFA 5DUVA 1POV3 5FZKA 3APOA 4D7YA 3LA2A 1OLMA 4PA6A 5EC2C 2JG8B 4FTSA 2R063 2VCAA 3BU7A 1F31A 4M0HA 1HRI2 3O12A 4JDOA 2VR4A 1RSOA 1IPKA 4HETA 4NIDA 3PU8A 3RZKA 5L36A 2JB8A 3TJTA 4MHRA 2YYOA 1PIV1 5LB6A 4C0HA 5F7UA 3FLTA 3GXUA 3C3TA 4K8RB 3I8TA 1HKDA 4LR4A 5C9AC 2BVVA 4LBQD 3GYDA 2K0GA 3LDRA 4TV9B 4BJ0A 2VMFA 1OQDA 4Q8KA 3BI3A 4YHHB 2MEV2 4RS5C 5H9PA 4BHPA 1R64A 1GZCA 1H30A 3HBZA 1IS6A 4GJYA 4JI4O 1ZZ6A 5GW7A 3VDAA 2WO1A 4B8EA 3I54A 3CKHA 3AK1A 3IIIA 2DCZA 4JI8O 1OC1A 3FUQA 5FP4A 5FPRA 1CQ9A 3LSQA 1N34O 3FZ3A 3KCXA 1SFPA 1FPN2 1AR1B 2VXJA 2UXXA 2GC0A 1NVPD 3OPTA 2Y8KA 2BCCH 3WB0A 1AR93 3E5UA 1IPSA 4AI9A 2EVXA 4NXMB 1F4AA 4COUA 5TSWA 4ZXKA 1UIKA 2VM9A 1TEIA 4LNVA 2VBBA 3MW2A 4XACA 4H44B 5FLHA 3WP3A 5JSRA 5H5NA 2EXIA 4CCKA 2JDAA 1QJX3 3WHUA 4HT1T 3BA8A 3ELNA 2DCTA 3PDQA 5LYJB 5FXXA 1ENQA 3KHCA 4YLZA 2ODMA 2VOXA 2D98A 2J1VA 4LBQB 2YG0A 2OIGA 2ZGTA 3HKEB 1N32O 2XWBB 4YWAA 4LJHA 1EAH3 2KSDA 3T1YB 2XJPA 1OCRB 4W4ZA 3SPIA 5FXZA 4P9XA 1IKPA 3H1WA 2JG9C 4BH9A 2HEWF 3ZSLA 2IW5A 4YM1A 2JS3A 4UT5A 5FPZA 2G1MA 3LGRA 2ZR2A 2YIBD 5LK7B 2A5ZA 1W6OB 1R091 3NNGA 4LBKA 3U78A 5L9RA 1VRH2 2JRIA 3WT3A 1UF2C 1N36O 3T4VA 3ZYJB 4CCOA 3SYCA 1NTZH 5BNPC 3ZPOA 2VWKA 5JPMB 1A34A 1VBE3 2VQ0A 5FBJA 4I9QA 3BN6A 3TEWA 5BUVA 3DTUB 5FYHA 5KHJA 3K4AA 1SQFA 1V0AA 1Q7YW 2BU9A 4WVMB 3QACA 5KXCA 2K1EA 3C7FA 4Q26A 2WQZC 1S0FA 1PO13 2Y64A 1NI8A 2YBSA 3HR9A 3L72H 4JGYA 3FX7A 2Y69C 4ZPIA 3LOBA 4MLOA 2VOVA 1HXS1 1V6IA 4WVWA 3ZN6B 4QQOA 2R1BA 4ES9A 2WLHA 4QKDA 5FZLA 2EAKA 4YZ4A 5AC92 2IZWA 4X8NA 2JIJA 1OCCB 3LWCA 2WFF3 4KG0A 2BNMA 3H3UA 3A0BZ 3AYEA 2H8PC 4J1XA 4R4XA 4DMIA 2YXHA 4DR2B 3SEPA 2JGDA 1W03A 3DSQA 4UV9A 2A3QA 5CA1A 2E5LO 2Y6HA 1N0JA 3H3ZA 3AG2B 1Y4MA 3B93A 2W94A 5EYXA 3ZMTA 5CFCA 1JHNA 5J2UB 2AEYA 3ABUA 3F2ZA 1XOUA 1VQ6V 2VCCA 1JZ3A 1BZKA 1I0HA 1EV12 4K0KO 4JHZA 2BOCC 1L7LA 1VP6A 3SC7X 4I55A 5F3EA 1XJAA 1GU3A 3HKCB 2YHJA 1BK1A 3VQWA 4Q4V1 3ZIXA 1HQLA 2VOTA 2R9IA 4Y1XA 1UYPA 2WZR3 5DG1A 2QWNB 5JWPA 3I5DA 5LA6B 1C3HA 2E7QA 3ZFGB 1AILA 3T1CA 1UAIA 4XABA 5IYZB 4GB32 2ZGNA 3K03A 4QNHB 1SZXA 1UFIA 1Y43B 2R0FA 3N9MA 3ILFA 2E9QA 1TME2 5FYCA 4QE9A 2HLEA 2WFPA 3UETA 3FLPA 4DV7B 3CJHB 1S1AA 5FR3A 4MXVA 1O3SA 2HWD2 4QJFB 1RM1B 4UVBA 5EJ3A 3RT3C 2JE8A 3ON7A 1XMQO 1OOPB 2WWSA 2QQOA 4LBNA 2RQ6A 3MYXA 1O91A 3GZEA 4XUTA 4J7ZA 4CE8A 5IJ0A 3UT5B 3ZRSA 4GIQA 1KQSU 4CU8A 4FPGA 3QO5A 5FQ0A 4EE2A 3DGTA 5EIBD 2P4EA 3U10A 4AL9A 3K0DA 4R9DA 2PAKA 5B1BC 1YCIA 5BZBA 1THZA 1WN7A 1PV0A 1N33O 1X7NA 1JHJA 2VU9A 4LUKA 2ARAA 3E8GA 2A6WA 2AHZA 2Q7GA 1S76D 3CC7V 2VNRA 4A4AA 4UOJA 2FZ1A 1WB8A 2WUHA 1XE7A 1M57B 2FCVA 2Q1MA 4RFT0 3FL7A 2WO7A 2AZ5A 4QB2A 2FDFA 1WW7A 5LBFA 1FNZA 4WM7C 2VXRA 1M4UA 4I0XA 2OZ6A 3LEGA 4F83A 2JKXA 3MEPA 2YBKA 1GMMA 3AZWA 1QXRA 2VQEO 1UX7A 4R52A 2R073 3DC5A 5CKQA 3ABTA 5L3BA 3UGHA 3ZM8A 5BV6A 5FJKA 1N3PA 3JAMN 1W2BU 3AL5A 3WG7B 4CC6A 1JOYA 2V09A 4CCEA 4Y20A 2ADPA 3FX3A 1H9WA 3CC4V 2DYCA 5HXMA 1ZRFA 2OT5A 4NMIA 4TUYB 5ANNA 1LEMA 1T5EA 4JX0A 5FYIA 3JD71 1H1MA 1W2UA 3T4HB 1PVXA 4C1WA 3CWBH 2GU9A 3D3IA 1IQAA 5C7GA 2UURA 2WNVA 2CYFA 1E57A 5E16A 1B09A 2IM9A 1Q6IA 3VBSB 1GUIA 1FV2A 1JUHA 1G6NA 4CEWC 5A3TA 1BLZA 1OCOC 4F7ZA 1DYKA 4IEOA 3ASIA 3G6JB 3CEIA 2ZINA 1VIWB 1EZJA 1QJU2 4HKLA 5CNAA 4EKWA 3MW3A 4QU2A 4N43C 4XF9A 3LEMA 2ARBA 4EN6B 4UXAA 5DMYA 1HNWB 2WDBA 4J9YB 2WWJA 3U4XA 1MR5A 3VHPA 2NQYA 5E8AA 2WNEA 4CDXB 1XBLA 1RJ8A 1GNZA 2UYAA 2XH6A 5L3GA 3HPNA 3P30A 1P49A 2HWC1 1D4M1 4JI2B 1T6BX 2ZEWA 3VBFB 5FZEA 1KP2A 2CDOA 4DXWA 3S5AA 3W7XA 4RN5A 3VD4A 4OI4A 3B00A 5JCOA 3FLRA 2PQSA 3ZHTA 2W6IG 1DLLA 5C8CC 3ZN1A 3AYCA 3NQHA 4IW3A 2IWGB 2W39A 3D82A 2ARCA 2WN3A 1W2NA 3UESA 2RMU1 4YZ5A 4W8JA 3CE2A 4X1KA 3B5LB 3SYOA 3J7LA 1M56C 3SJCC 2RS13 2ZMLA 1NR7A 4MX3A 1FV3A 3IDCB 2GHYA 4RQEA 4HPKB 1VQ7V 3OOXA 4LBMA 2F93B 4YZ3A 1GBGA 4JZRA 4J1WA 4X65B 1GOFA 3T0DA 1SQQH 4HBNA 5KBFA 4GA9A 3NWKA 3UK9A 1H1AA 4JHTA 4ES8A 1U5YA 2R72A 1U0AA 1FX5A 1POQA 3SCFA 1SMVA 4L97A 4EEQA 1AR63 2VCBA 5AFBA 2XJVA 1J3QA 4YVWB 4N9IA 4Q4Y3 1QOTA 4OFGA 3DYPA 4QX0A 4JI6B 3IPVA 1CGPA 4XJWA 1ZYBA 4OX9B 1JZ4A 3VN4A 1AR72 4P02B 1LOBA 1RUE2 2EX3A 3HT1A 2F66C 4LFCO 4RR3C 4C8DA 4CEYC 3POJA 3H1MA 1CAXB 4UV8A 1YUDA 1HNZB 2Q30A 5CN0A 2HVJC 3RDIA 1B6QA 2DQ0A 2VZTA 2DV9A 3DN7A 4LH6A 4MVMA 3J26N 5FZ3A 4PJYA 4LBLA 1K5SA 3OJBA 1XNRO 1CAVB 2Q8DA 4J9ZB 1K33A 2FDKA 2V1DA 2OT7A 2V73A 4K35A 2DUQA 4AVCA 4IV3B 1XNQB 1DGWX 3WR0A 2Q68A 2DCYA 2QKDA 3SH3A 4D7TA 1DQ2A 2IXLA 3WVJA 3S30A 3WF2A 5C8WA 4GCZA 3RBZA 2JDZA 4I50B 1XNAA 4ASLA 1BMV2 3JD3A 4GKKO 2CUGA 3I56V 2AZ2A 2C9AA 3ZBHA 1J5EB 4I09A 2KXLA 2ITCC 2ERFA 2ZE8A 3AEIA 4LCUC 3ZDVA 3WXPA 3TCUA 5EQUA 1UPGA 1ULCA 2VVDA 2ZACA 4LHKA 2O57A 2B46X 2WS93 3N9QA 5LHIA 3FHAA 2B1IA 4JTCB 2ZGLA 4D6TH 2YBPA 2IC1A 1JBCA 2UU9B 2W1UA 4DV0O 3DGEA 2DYRC 4X1YA 4RUEA 4O2BA 1UOJA 1X59A 1KKDA 4JKLA 3OD4A 3MDPA 3MPPG 1VBA1 2FB5A 4B29A 2Y33A 4I5SA 4NTWA 5I0TA 2VMIA 1TVGA 4GKJO 1R6TA 5IK7A 2W91A 4A3ZA 1WD4A 3UKNA 2ZR3A 1YDXA 1NH2B 1NCQB 2K2SA 2WLQA 2Z42A 1TNRA 2FYUH 1QH6A 5IYBO 5CB4A 2ZOEB 3LPGA 2BFUS 2VTFA 2CTQA 3OFNG 3WQBA 3TK1A 3M8LA 2ITDC 3PVEA 4CCLA 4R50A 5LA1A 4HLTA 2OTJV 2VQUA 3OGGA 5LL6Y 1K5MC 1ZBE2 3WDWA 3TN91 1OURA 1R1ZA 1WLWA 3Q8AA 3UKMA 4S2HA 2LROA 4AEJA 2CTVA 4QPGA 2PHDA 2YC2A 3CF6E 1L0NH 3Q8BA 1S0GA 4DUZO 1NLSA 4FQZA 4RA0A 3JCZA 2VMHA 1OKOA 2ZX3A 1CAUA 2JD9A 4FFKA 1CZVA 5TISZ 1AXKA 2DCKA 4PDWB 1J1LA 2JDPA 4NYKA 1HP8A 1LECA 4XJAA 3KKYA 1ODNA 1BE3H 1PGL1 2X6CA 4XF1A 3OUIA 1Z7S1 5JIUA 1ZSPA 4LK6A 1HRV3 5IFPA 3O1TA 1RHI1 3FYIB 2JE7A 2PLV1 4KP4A 1UOFA 2E7TA 1T2XA 5D1IA 2ZCEA 4O4LA 4QGPA 5I93A 5KAFZ 4R7CA 3ZMUA 1QIQA 1HWYA 4AGRA 3AZXA 4JC1A 1N3OA 1VB2A 3VBUB 1VP7A 4G4FA 3ZYGA 1S55A 3PJQA 3UNPA 2EZOA 4BWAA 1ALYA 2Q67A 3KQ4B 4JQTA 5FY0A 4ZIBA 4Z07A 4CH3A 5EYPA 3L70H 1GFF2 4TT3G 1COV1 2BEOA 1TGOA 2IJHA 3BRCA 1Y76A 4Q5OA 3C90A 3RMXA 3L9DA 4BCUA 3PL0A 1EY2A 1AYN1 2EXHA 4BXSV 5IK4A 3AK2A 1SQPH 1VQMV 4MYEA 2YY1A 1MS8A 3PUAA 1I94B 4YM2A 3RWRD 1OBNA 3JARB 1NE4A 4XBLA 3VBRB 1WAZA 1GTOA 3K3OA 3B94A 1XXNA 4TQFA 4Z1VA 2XQXA 2R30A 1H2SB 4AAXA 5JZGC 4YG0A 3BYWA 1IBKB 1I7FA 2OA2A 4EQVA 1BQPA 3H9VA 3CS5A 2QQLA 2Q0OC 3FHQA 3VUOA 2QJ1A 3L74H 4MVTA 3DUIA 3N7LA 4FZ1A 1WA8A 3BGAA 1SQVH 4LULA 3EJKA 2Q7EA 1VF6C 4GWNA 4Y3OA 3PU3A 3SISA 4WBNB 1FXKA 2YB7A 1PVC2 5HXVA 4JI1O 5BMVA 2ADDA 5DUUA 3HVDA 1YXWA 4COYA 1IKQA 2EXKA 3CX5F 1QU7A 5F37A 2XG3A 1AUYA 3JBG3 4MT8A 1MVEA 5AFEA 1REEA 3ZFFC 3ILRA 5BNOB 2B1GA 3AVRA 3N2GB 1JZ5A 5FZFA 3MIEA 4DZGA 1OLRA 2XB6C 1J84A 3CRCA 4W4LA 4CDUC 2PYTA 2ATKC 4AHCA 1M1KW 2OUHA 5JVVA 2QQNA 2D3RA 1OQEA 1B04A 1ND3B 4L2NA 1FFTB 1GNYA 3K58A 4KL1A 3H9AA 1G9DA 1NCRC 1TUBA 1HW5A 3WQ0A 2HWB3 4MG2A 5D5QA 1F4NA 4NB5A 1XNBA 1B35A 2DQ3A 5GTHZ 1NA1C 4JI7O 1HR0B 3VKOA 3D6EA 3I55V 1I5XA 4AR2A 2JWPA 1WA4A 1HX6A 3M7MX 1RB8G 2ZXQA 1PK6C 3BVCA 2LALA 4HOOA 4MTFA 2F95B 3M3EA 3M3OA 4JF3A 3B2EE 3AVSA 1SZTA 5KUKA 3ETQA 4OGQB 1S2BA 4QHZA 5FYZA 3NNLA 1UQXA 2R062 1C8M3 2PMWB 4ASMB 1LR5A 5IWFA 3PIGA 2RM21 3AMMA 3FN9A 3ZXFA 5CA6A 4PELA 1PMIA 1RUI3 4RUFA 3RYHB 1AZDA 4AI1A 3R4SA 5FPUA 4M3CB 3A0HZ 3P6BA 1IXBA 3G4SV 4CDWA 1IS5A 1EUTA 4NHKA 3ECQA 2G9ZA 3LEIA 2EILB 5A7NA 2A6VA 1SQGA 1FPOA 1M9NA 2D3PA 1IBMB 1DLBA 2VTXJ 5FMDA 3D36C 4DV4O 4DOUA 3N4MA 1RUG1 1K42A 4C0BA 4WZFA 1SZBA 1AXZA 1QLEB 4QPKA 2XJTA 3SH4A 4FLUA 5I0DA 1FOD3 2PXJA 1N1VA 4BQYA 2WNUA 1S0VA 1LHVA 4ZU4A 3TNQA 1QMJA 2ADQB 4AAPA 1UN1A 3T30A 2O14A 4CC5A 3LB9A 4TTGA 4B1MA 5JVDA 2WAMA 4Q4X1 3GJBA 4CU7A 4LFAB 5IY5B 4I0AA 5JH7A 4DV5O 2Z69A 4Z1MG 5J9PC 1YFWA 1XU2A 2JKBA 4FLXA 3ORJA 3ZX6A 3CMAV 2AREA 3ACLA 2HBTA 5DDJ3 1FKAO 3NJXA 1XI1A 1AR92 5B3SB 2VY0A 1VMFA 3U07A 2YMZA 1HNXO 1UWWA 2GUZA 2WIIB 5FYSA 5LWBA 1UOBA 4NKGB 3VQYA 2MHFA 1QJX2 1H38A 1PM4A 2J7MA 4CPBA 4UFMA 1V9U3 3DKWA 1YIFA 2W1WA 4YVSB 3TNPB 1Q82W 1KJRA 4NTXA 5HPOA 3IBMA 3NV2A 2ZHLA 1JYNA 4QDQA 1EAH2 3TB0A 2VW0A 3K3WA 2QQUA 2DCJA 1DGRN 1LOGA 3EXUA 1HQNA 2AYHA 4GMP1 5JMCA 4O4JB 2UXCB 3JB8A 5D8AC 4AFCA 1QQP1 3AKTA 2ES3A 1WPXA 2J1RA 1TG7A 4AGVA 1M57C 4PA7A 1S0DA 5D21A 2DVAA 3ABZA 3WG2A 1H2GA 4QXCA 2DWDC 2A0LA 1YSCA 1VBE2 1EUUA 2WO2A 3N35A 4XHXA 3H01A 2J42A 1OI6A 1ZZBA 4HVRA 4MVZA 5JSOA 1UNBA 1V70A 5C9AA 1BHBA 3KGLA 4F4LA 4QKNA 3O1RA 2BSKA 1BBT1 5LBEA 4YJ2B 4ZBMA 1PO12 2BTVC 3E35A 3CJXA 1JW6A 2RDRA 1WKYA 2VULA 3KLSA 4QMAA 2WABA 1RXGA 1S0BA 1AI7A 3HNBM 2AENA 3OPZA 2ZJCA 1S3JA 4AEKA 3KQRA 3AG4B 1KQRA 1D0HA 3OTFA 3IAPA 1ZX5A 5C8YB 1RUF1 4W65A 5CMUA 1JA8A 1Q8QA 2JX9A 1FXHA 2WFF2 5I0SA 1AX2A 3AYDA 4FOWA 4X8AA 3I2GA 1DYPA 4KGGA 4YZ2A 4EN7B 4CXWA 3LSUA 4DV2B 5IJ9B 5EIBC 4WBBA 5IAXA 3VBSC 4IDZA 3KS7A 5JMOA 4FFBA 4IEQA 1HV0A 1MS4A 5FZ8A 1JZ6A 1G4YB 2ZGKA 3WF0A 4UW3A 3VHRA 4GH4B 3RS6A 2Y4UA 4JZGA 3ZSJA 4OUSA 2JJ1G 3TRSB 4PF5A 4RWUA 5ABJC 4CCJA 1E5SA 1NY71 1Q3EA 5FZOA 2WZR2 1QBZA 3B9IA 4G9SB 4I4TB 1H9PA 3BEHA 3EQEA 3I2JA 4NRMA 4WFAV 2ZNJA 4D69A 3OG2A 4IGOA 4HN0A 3VBFC 4E2SA 2BTQA 1GRJA 4ZHNA 2NZ9A 2YEVA 2QQPA 3CRRA 3E6DA 1C4RA 1ZA7A 2O0OA 3RG0A 2JG9A 2XMLA 3WY6A 2YPDA 1VQNV 3FAVA 1ENXA 3ZXGA 4HNAA 3VKMA 3ASOB 4DUYB 2VG9A 1F23A 3J7HA 3AKQA 4K3AA 4CP1A 5EJ1B 3W5NA 1KEXA 4RQPC 1QLNA 4Y22A 2H6CA 2B39A 2BGOA 5C3PA 3WZ1A 3LD8A 1RFYA 4D6QA 4DR3B 1OLQA 2HWF1 2CE4A 1WLEA 2Q1ZB 5IDJA 3PUHA 4LHSA 4XBNA 3OY8B 2PI5A 1UU5A 2QQVA 1POV0 4CXXA 1M06G 4Q20A 2WLMA 4Y1UA 2G19A 1LHWA 4NROA 2A75A 4R9AA 1RUD3 1L1FA 1PMHX 2ADEA 5FPLA 1W6QA 4LF9B 4RHV1 5IW0A 5A80A 1WCQA 3N27A 3IDBB 3PVBB 3P1IA 1YYNA 1WP7A 5CFDA 3N2KB 5GM0A 1U96A 2YIDA 1V6MA 4AYUA 2R072 4R9BA 1AR4A 5LW9A 3ZOIA 4P30A 4DR2O 4CDQA 5HFMA 5DZGA 2JGUA 1VR3A 1W0OA 4DINB 2DUOA 4FFHA 3I97A 3WU2Z 1XU1A 1QHTA 1W28A 3H1IH 2F4PA 3VHOA 3ETGA 3WNOA 2VUAA 5JXIA 1PO23 4PIYA 3NAPA 1A8DA 4KQ7A 3VBHC 4IV3C 3POGA 1BVVA 5J36A 4LIUA 3B4SA 3OMAB 5FXWA 1GP4A 1RC6A 5LASA 2RS53 2ZABA 4O4IB 1ASJ3 2VUJA 2R043 4GQ7A 2JDMA 3QOPA 4JTNA 1UZZA 4AK3A 4QX5A 3EMRA 4FFIA 3KZ4C 1OFNA 1HB1A 4INDA 4LT5A 1F2NA 4UBGA 4UVCA 1QHDA 2AUYA 4JGYB 3W7SA 3CEWA 4BMBA 4BQXA 4UFIA 2W68A 2EALA 4TZDA 4YJ3B 2VZ3A 5F2VO 4CP9A 5F6KA 3R6SA 2A6XA 5FKCA 4EN0A 4F8AA 3WFVA 1W6MA 3NR7A 4NTYA 5EK0A 3B01A 5C33A 3VL9A 2QNKA 2DWEC 1W8OA 4D3WA 2JGDB 2OTLV 4QX3A 5ACA3 4LPLA 5CA1B 2BNOA 3VZOA 4AVAA 3H3LA 4DV6B 3C7HA 2ENRA 4JPRA 3ACHA 3JD1A 1J83A 2C1FA 3AMPA 5CFCB 3HB3B 4MVUA 3M3CA 4JYAB 2XUMA 3OBAA 1VBB3 2JXAA 3K3NA 1AR81 2QCSB 3FKSG 1R1BA 2A3YA 2VOWA 4I55B 4NVPA 3THCA 1BZWA 1H6YA 2XKPA 1P4RA 4P5YA 3N3HA 4Y4YA 1NR1A 3UV9A 2RS12 4H14A 1ZLZA 1ZWIC 4WM7A 4N53B 3GBWA 2WNOA 4KI5M 4HMZA 1EBOA 1GZWB 3JU9A 2XHNA 5FP9A 5I0UA 1ROPA 4MOAA 1AR62 2BPA2 4AF9A 4BWOA 3O0WA 4Q4Y2 3DPRB 2DVDA 2DBIA 4JGZC 4EZHA 4XMAA 4A6OA 2J1EA 4DRXA 4JTOA 5FFOC 1MZFA 5T5PA 2EIKC 3VZJA 1FJGB 3IIAA 2W0FC 3E2EA 3MIGA 4PDWC 5IJ0B 2WNVC 1TMF3 5FQ0B 4O9GA 3C8XA 4NE9A 2CU5A 4RL7A 1Q43A 2VMEA 3OCPA 3V0BB 3I3BA 4LP8A 4S2GA 5A3NA 2P2KA 1LB2A 1LU1A 3HKBB 3HJRA 2EZPA 4PQ9A 2JJ6A 1UZ0A 4CEWA 4OUMA 3GWKC 1QGLA 3WB1A 1DIWA 3WCSA 1RINA 2XLGA 4COWA 4PBPA 1Y9MA 2A73B 1VALA 1MVQA 3WHTA 3ZHQA 1GWLA 3JATA 5A32A 3VDBA 2UUCB 5JUVA 2VGDA 4I0XB 4N43A 1YVWA 2J22A 2EIMC 4IIJA 4ZONA 3IAYA 1RMU1 2CDPA 1RUOA 3RYFA 4XHBA 3WQ7A 5H9SA 2XWJB 3AXEA 1LTEA 1EM1A 4GXLA 2B5UA 3KWVA 2XL7A 3JXSA 3E22A 5L7OA 4JI2O 2B8MA 3ABKB 4BPZA 5JCOC 1W0JG 1TVKA 2HEYF 4ZS3A 4DUXA 2D6KA 1URXA 3SEEA 1COWG 1JYXA 3J81N 1AL21 1F5FA 4Q0UA 2WS92 2ZXWC 3OR6C 5C8CA 2VMDA 1SG3A 3QNEA 4AQTA 1XMOB 2B42B 3J7MA 1FD9A 4I0BA 2MK3A 2D93A 4HL0A 4GWMA 4AW7A 3E6CC 4ZHQA 3MLJA 1AX0A 4NXNB 1X8EA 3NJZA 4FPKA 2QEXV 4FPJA 3O0VA 4X65O 1WBFA 5F32A 1V6JA 3IKWA 1O5UA 3O0XA 4XAEA 1W6PA 2CSGA 4UCTA 4LLOA 2QZ3A 3KF5A 5T3NA 4EFBA 1PGW1 4YFZA 5ERLA 1WMEA 4OX9O 3U11A 3WSOA 1LOFA 1SBEA 1CEZA 3ZIWA 5C4WB 2FCUA 2H94A 5H6QA 2RG4A 3AC0A 4RR3A 1XQNA 3WUDA 3A0KA 2ETNA 3OEBA 1N1TA 5LP6C 3AMQA 1IVSA 4DYLA 2A7AA 2X7RB 5CAZA 5L3FA 4IV1B 1ULEA 3AG7A 1ND2A 3ETPA 2BWCA 1J59A 4TXWA 3VDDB 3UO3A 1DZQA 2W3JA 4HONA 5A3PA 4MXWB 1MSDA 2VQFB 1E5HA 1QOOA 2XBO3 3C2UA 1W6NA 3CRQA 4BXFA 3ZDSA 2GN7A 1CD3G 1CZTA 2DFBA 4CVUA 1HRV2 3PTYA 1ZRIA 2MNGA 2PHRA 3KT4A 2WN2A 2CHHA 2WT0A 4J7JA 4JYYA 3FC0A 4MHUA 2UXDB 1G1XB 4MGSA 1R6KA 5CKMA 3ALQA 4CSWA 2ZE5A 2DYSB 1DP0A 5LXTA 4PDLA 2W6JG 3IPVB 2OIEA 1SLCA 4FQ4A 1BL8A 1VBD1 3I59A 2BV4A 4B3MB 4B3TO 1FNYA 1V55B 3NL1A 3WG1A 1V54B 5FRAA 3Q8CA 2WA4A 1AYM1 3FHIB 2RNBA 5I8YA 1L7QA 3WNLA 4DK1A 2OYQA 4AI0A 2YFZA 2BNNA 1D5NA 5A1FA 3AK0A 1M4WA 3NJYA 4OHXA 1MEC3 1F35A 4I02A 4DXRA 5EZYB 2UU9O 5FTTC 2CH7A 2HP8A 4AQYB 2QQJA 4NJ4A 4NWWA 3G80A 3ZMSA 4S2DA 1H1IA 4B4PA 4MVOA 4Y33A 2GH2A 2X5IB 3T2PA 1ZBA3 2Q1FA 4LWSB 3DYMA 5IK8A 4R8CA 1IS3A 3QD6A 1BEV1 5DABA 1O8SA 3K5NA 4AZZA 1AX1A 1W3XA 2UXBB 2TBVA 4BISA 4XCBA 3U1XA 1UKGA 1SLIA 2O1QA 2GTSA 1I9RA 1K5MA 3G6BA 4LK7A 3VBOC 5IY5C 4PD4F 4LF8B 4WV8A 3K79A 2HG5C 1DQ6A 1CX1A 2EF6A 2RS33 5L9VA 3LSDA 3H8UA 3L75H 4DXZA 1R3IC 3H7YA 5L9BA 1TE1B 1MS9A 2O8OA 1SKVA 5JQGB 3MIBA 1C28A 2W47A 2K46A 3KVBA 4Y1ZA 5FKBA 3JBG2 1MQTC 3GBFA 1K12A 4YW4A 5K0UA 4A7YA 2QQWA 2QA4V 4AHWA 1YIJV 2WLLA 4YY3B 4IQPA 4BM8A 2ZZQA 1W0KG 2WC2A 4HXCA 2I74A 2OIIA 3O1MA 3FMGA 2XTAA 4P5HA 5KC5A 5FZ6A 1PZ8A 2LGWA 1W06A 3TOJA 4MVQA 3LA7A 1LOCA 1SLAA 5KHKA 5F5AA 2OCCC 2HWB2 1DHKB 3CIHA 1JU3A 4LF5B 1F9KA 4LKDA 3J8F1 1RUJ3 2IBZH 4UFHA 3VLBB 5CB4B 2JG8A 1W05A 1JPXA 3CZUA 2GDSA 2VZOA 4IL6Z 2YI8A 3JUUA 3C7EA 2DDUA 2Q5TA 1RUH1 4GALA 2OCHA 1WCKA 1D4VB 3ROUA 4QPIB 4E2GA 2YGMA 1H0BA 2XJRA 2XAFA 3MFAA 2ZIMA 1SCSA 5KAIZ 1S0CA 1A78A 3KGZA 1JN2P 1C8M2 1PIV3 4BA6A 1CAUB 4Y4RA 3RYCB 2X09A 3J4UH 1I94O 3WNMA 1RUI2 4NPMA 1R3JC 4MS2A 4BLIA 4RSUA 1D2SA 2FMDA 4FPLA 4E27A 4ZI7A 5JXGA 5JOYA 3RZHA 1LKNA 4X1IB 4XF4A 3O9OA 1Y4WA 1IBKO 2UUBB 1CESA 2CNAA 3BUCA 1LOAA 3LDCA 1AJPA 5DZEA 4O4LB 1VARA 4UB8Z 2W1SA 2E6VA 1NQJA 2D43A 5IHRA 1YQCA 4U7NA 1R1A1 1OA4A 2CTRA 4HK8A 4PI2A 1LU2A 2BDRA 1FOD2 3JD2A 1FMD1 3DYOA 2OPKA 1JUIA 3NNMA 2LFRA 3ETEA 3ZYIB 4QPJA 4OPAA 5F3IA 1OA3A 3GB7C 2WSVA 2PA7A 1O4ZA 5LGUA 3NNJA 2YI9A 3E86A 3RGBA 3ES1A 4ZZ8A 2Q4PA 1VMHA 3BABA 4C91A 5SV5A 1MACA 3WDTA 4YSFA 4HN1A 3MZHA 4CDUA 1WCDJ 2RJZA 3B9CA 3FE5A 5DDJ2 4DIQA 1DF4A 2R70A 4LBQA 4M00A 1DG6A 1PL0A 3HKEA 3RZMA 1VIBA 4BLJA 4CUCA 2HHHO 4IYHA 5EC1C 4TYSA 3SDLA 1VJ2A 2PAEA 4AEDB 1AB3A 1B35C 1IXMA 3I3EA 1F15A 1OQ1A 4DW0A 2EICA 2LW1A 1NCRA 4YRDA 1SLBA 4CH6A 2XLAA 1HR0O 3JSNA 2WSSG 1V9U2 1NA1A 3ML0A 4D7SA 4XIKA 3ABMC 3K5MA 3IAQA 4YARA 2WR9A 4JI8B 2QQKA 3BALA 1H6XA 2C9KA 2VC9A 1N34B 2D97A 4J41A 1PK6A 3RYRA 3GHNA 5GONA 1KDKA 1R093 3HNMA 4LH7A 1DQ1A 2LJ2A 2GV9A 4UF0A 4E4HA 3T0BA 3AZZA 3W21A 2Q5ZA 2FTKA 4WVMA 2ETEA 3IDEA 2ZHNA 2GMMA 3WNNA 3CRAA 1X9PA 1CZSA 2Y0IA 2YV8A 2FL4A 3ZEDA 1ULDA 4BMEA 3O5SA 3WW3A 3CJIB 5KHGA 1IURA 1SBDA 3WINE 1JOBA 4O4HA 3ZSKA 2X8KA 2A9HA 1LHUA 1RUC1 2QUOA 1HXS3 3N7KA 3IDAA 4BQ4A 1IBMO 5GTIZ 2YPJA 2JIZG 4XDOA 5A6QA 3MDSA 3WW4A 1CPNA 5FZHA 3IC7A 2LFSA 1L8DA 1FAFA 4AFAA 4IXLA 1DCSA 1RVF1 3E6BA 1JYCA 3ZXLA 1S4CA 1WLTA 4PA3A 3ICXA 2XJSA 3QBQA 3BOWA 2ZX0A 4FP3A 4SLIA 1SQBH 2P67A 3FBMA 1N36B 2JK5C 4ZS2A 1KBHA 3BCWA 1ZTEA 4QIWF 3LDBA 1IHMA 4XURA 2IVJA 3ZSMA 2X6BA 1K4DC 5F2WA 1NG0A 4Q4V3 3GZUC 5FLIA 3T0AA 3ZFGA 3ZFEB 1HB2A 1AI5A 1WMDA 5IYZA 5LMNO 1GR3A 2TUNA 2QWPB 5BNNB 4YG6A 3OSDA 5LEJA 1HB3A 3I3MA 4E4SA 1GYKA 4CDWB 1B06A 3OM3B 2VWJA 1H2NA 5KLVH 1OVSA 3RRDA 4IEXA 5IUQA 5JCTA 2K9PA 2RCVA 2PHXA 2EIJC 5DPNA 1N3QA 4DR7B 5FPXA 1QU0A 1I5ZA 2IXHA 1IGOA 3JQWA 2E26A 1XNDA 4QX1A 1DQ4A 1W2AX 2QZ2A 4ARXA 2E5LB 3THPA 5IFTA 1CAWB 2F1MA 4JQRA 2R0HA 1QDCA 5A33A 2ZIOA 5A6XA 4PDVA 2P4VA 3L71H 2WNUB 4Q1PA 3H42B 3SNMA 4JI3O 2UXCO 4H0LB 1YO8A 3ZXDA 5D8AA 3UT0A 2BUKA 4OLLA 5KHHA 4ZU7A 2XL9A 4IE4A 1ZL8A 5JH7B 3IC9A 4Q4W1 1S5LZ 1LNSA 1W2OA 3ZMVA 2XR4A 1AJOA 4OHWA 3W59A 2C24A 2BFUL 5IATA 3WF4A 3X2QC 4UBHA 2AGAA 3E89A 1GNHA 1MPXA 2A71A 4DR6O 4LLFA 4XFBA 1SA0B 2GUZB 3FB8C 5L19A 1UZYA 3IWZA 5I91A 4XJUA 3TXQA 2OKXA 5F5CA 1KU9A 1C1FA 4BQ3A 3N9PA 5EPAA 5A6YA 5DAPA 1RUD2 2V4VA 4KNCA 1K8AW 2A3WA 1N0NA 2IXCA 2YU2A 3VZLA 1VBC1 5FZ7A 4LOSA 1IBLB 1KXGA 4MZUA 2ARXA 3K57A 1KITA 1XMQB 3PMEA 4A45A 4TUYA 4D6RA 3E5XA 3F7VC 1JYWA 4P9LA 5FZMA 3ASNC 1QNMA 2H6BA 2PI4A 3K4DA 4FM0A 1UO9A 3GJAA 1O6UA 4FK5C 4ISQA 4W6YA 3SPJA 2E33A 2YXLA 3JD73 3AG3C 1N33B 2RR11 3S5QA 2M7WA 3VBSA 1JZ2A 1GN4A 4XFFA 3ME2A 1PO22 1WUVA 3IJ4A 5HCAA 5CA0A 1NS1A 4I2OA 3N36A 3IM0A 3ETDA 4BK5A 5ABJA 1ZZ8A 3NV4A 1QJY1 4Z8BA 2RS52 1O9HA 2QJVA 5LEKA 1ASJ2 2R042 4DQAA 3DF0A 2VQEB 3QTCA 3KB5A 5C9AB 1YFYA 1L3JA 5KA6A 3IN9A 2OZJA 3WX5A 2YZ4A 1XYPA 2Y6GA 1HIXA 1RL3A 3RYPA 3SQOA 4HSLA 3ZN5A 3VBFA 5H9RA 1YLLA 4Q0SA 5SV8A 3WD5A 2HWC3 3PUQA 1EFRG 2YUAA 2OQ6A 1D4M3 1NOVA 3ZRWB 2P6CA 2GMPA 4RS5B 2QQIA 3HKDB 4JI5B 4AG4A 1ULOA 4CS4A 1NQTA 1A6CA 1XPWA 2JEMA 1I5PA 1PPJH 3P3NA 3KZIZ 2ZGQA 2CTWA 2HKXA 4YNIA 3K46A 1KGYA 3GF6A 3CNAA 4NN0A 3POEA 5ACA2 3AB0A 1NZ6A 1GMGA 4RQPA 1NLRA 4OPHA 5A6ZA 1F4HA 5FO9B 1Q81W 4PJ0Z 4Q0PA 4LFBB 2RMU3 1BGYH 2XAHA 1IG3A 1XNCA 1GWKA 1BT8A 1PKXA 2QDOA 3IT8A 4DR3O 1J3RA 1VBB2 5IT6A 3OD0A 3V56A 2BOIA 3AG1C 3LKJA 1UD1A 4Q29A 2WLJA 5T55A 3OBRA 4WM8B 1NKGA 5BY1A 1Q8OA 1XYNA 3GDBA 1S2EA 5K9YA 5KA5A 2DURA 1W39A 2N05A 4YVWA 1LGBA 4BB3A 3PUSA 3WW2A 5CFDC 5FZOB 4KH9A 1NTKH 5C5TA 2D5HA 4IEWA 4XFIA 1QF3A 1MZ5A 5I0RA 2AHYA 2IJIA 4AI2A 4QHOA 4COVA 1PD3A 1YHFA 3R4DB 4CDQC 5FY7A 1CAXA 4PT6A 1HRI1 1R73A 4NHMA 2B4KA 4MGTA 3HMYA 2YEVB 5D2AA 2CV6A 3JCUZ 4L8QA 2JG9B 3Q4HB 4V2WA 3VKLA 4HNAB 3LZZA 3NAPC 4KUMA 3M4FA 2WZPP 3QCWA 3Q8FA 4JDMA 3JASA 2AR6A 2YDEA 3WB2A 1F8VA 1CAVA 5KXBA 1JQ0A 1NBMG 3VBHA 2IH1C 4IV3A 1TMF2 3G71V 2YFUA 1SFNA 5DAXA 2W46A 5BNPB 4X64B 1VB4A 2LGQA 1C5HA 2VL4A 4B3RB 2BYVE 4YIPA 3QO7A 2ZNIA 4EB6B 1IS4A 2GAUA 2MEV1 1QR9A 4H7LA 4I50A 1FXZA 1JXNA 1L0LH 1YF2A 1GZ9A 1YWKA 4PV1B 4ET7A 3SYQA 2Y69B 4PF1A 1W6QB 2ZCWA 3SMHA 3PIJA 3BTAA 5HV4A 1V55C 1MG1A 2JEUA 4PLOA 3JAWA 3ATGA 2UWCA 2KR2A 1FPN1 3N9NA 4L92A 2WJSA 5B1NA 3KMHA 4D6SA 2QWRB 3SXWA 3TXSA 4N90A 1QJZA 5IVEA 4YGBA 1YQ8A 3ZRVA 5A3WA 3RYIB 3HEIA 4L11A 3QO8A 1ORQC 4DV6O 4PI0A 4UVAA 4QXKA 4U3JA 4A44A 3V0AA 2DU0A 1JFFB 3W9AA 4LMFA 3SJAC 4GWJA 1BYHA 3BAAA 2QWQB 4OXSA 1X82A 2WZEA 2Y0OA 4CZSA 5T50A 3SJQC 1OVPA 2J1UA 1VBA3 5EBMC 2EIBA 1YJ9V 4GZRB 4Z92B 1NCQA 1MS5A 1GP5A 4CH5A 2YS8A 5CBGA 1N47A 4G27B 2EA7A 5KR7A 5CZKA 3VB9A 4P14A 1XRUA 1G8WA 4N9HA 1GM7A 3I49A 1GM9A 2ET1A 4BQWA 3TEZA 5J7MA 5FMOL 2HEPA 5CG9A 2YIAA 4GKKB 2A3XA 3WDVA 2ZQMA 1OUSA 3GWOA 3RVZA 3TN93 2XT9A 3MHHC 2IFRA 1VRH1 4YW2A 3LSSA 3ACGA 3BTZA 2P3YA 3LEKA 3DEMA 5FYMA 4IYIA 4PA9A 1QVGU 1DGWA 1DZTA 1VLNA 2PHFA 2DWRA 3L2HA 3WP6A 4FLYA 3CCJV 4JGZA 1H8EG 1Z0HA 1T6GC 1FJGO 2BWAA 2VNVA 5FLJA 1OA2A 1TA8A 3FBYA 1UZVA 4PDWA 3AP7A 3A23A 1EP0A 5CA3A 4CCMA 4DV3B 4H7MA 2P7TC 3MHSC 4CU9A 4GUNA 5B1BB 5IK5A 1QXPA 1GSLA 3BODA 1FT9A 1YQ6A 4XF0A 1Z7S3 1JMUB 2JECA 2O8QA 3EXAA 2QFEA 1O5LA 1RHI3 5CIRA 5E89A 1D5AA 5A3MA 1CIWA 5AC91 4BQ2A 1PNGA 3K48A 2IVIB 1BSMA 2Q4SA 3S0MA 1P7GA 2PLV3 2XBO2 4XUPA 5KHIA 2XXZA 2RN9A 3PJSK 2VJXA 2WYSA 5LA2A 3K06A 2Q8CA 3ZJZA 3GCXA 2RMKB 2YC4A 2OS2A 2BJSA 2RDNA 5JIAA 5L7OC 3K2OA 3UQ8A 3HN1A 3FFQA 1XILA 1N1YA 3O1PA 2W08A 3U75A 3LQCA 4DW1A 3H8RA 2BOBC 1EV11 4OULA 1Z78A 1PM9A 2HLDG 1COV3 2A79B 4TQDA 1HJFA 1PX3A 4H37A 2XVKA 1O7FA 1H8TB 3ZRXA 4DRXB 1AYN3 5DXDA 2B9ZA 4TWKA 4FIPC 2KG7A 3JARA 2BTOA 3VBRA 4D94A 2AH2A 1YFUA 1F4MA 4YPJA 1QKQA 2V5DA 1PNKA 3OR7C 4GB31 3ZR6A 3VV1A 4NHXA 3LNMB 1CONA 4DR1B 3X29B 1MEC2 1O4TA 3T4ZA 1TME1 3GNEA 1GKFA 3VBBA 4Y24A 2D5FA 3PLQA 1OCOB 5ITZB 1SACA 2HWD1 2C4XA 4P9WA 3R65A 5FZ0A 4PBOA 3BHPA 4LKFA 4PLMA 4XF3A 1ZBA2 3I2IA 3JATB 5LMUB 1Q6UA 4IERA 4UCOA 3VD5A 1BHAA 1LOFC 2WL1A 4N43B 4IUGA 4DPNA 3OMIB 3RFRA 2DOSA 3AJYA 3BCCH 4E4ZA 4CBCA 4A3XA 4MGIE 1UYXA 1VQPV 4K3UA 2EAAA 1RIRA 3CC2V 3BFRA 1S5HC 2QE3A 2ZGUA 4HKWA 3OGJA 3E22B 2CY6A 1HN1A 4X6QB 1ZREA 1S2KA 3ZYBA 3N2GA 5IE9A 4KU8A 3VD7A 5APAA 3CRMA 2AEZA 2EINC 3ZPYA 1LUVA 5LP6A 2RS32 3W5MA 4IE5A 3O7OA 1LEDA 4A5UB 3VGIA 4DR4B 2PAMA 1ND2C 4YW3A 1V9PA 3HQUA 3THOA 4QB6A 1ND3A 3CO2A 1KYOF 3LDDA 2P6JA 4QQ2A 2CGOA 4X62O 4AEDC 4R9CA 1NH2D 4OQ8A 1N8RW 4DEVA 2SLIA 3A7QA 4XCAA 3SYPA 4NPRA 1M56B 4UFJA 4BZ4A 4BOWA 4ZHQB 2XAJA 1DQ0A 3RI9A 4JRLA 3IMMA 5EV7A 1R3KC 4CCNA 1BVP1 4JRAA 4K20A 2XVGA 3FFZA 2ZKNA 1OHHG 3N7JA 2VECA 4K40A 5BPXA 1AVMA 1RUJ2 1IZ3A 2PHTA 2VO5A 3KT1A 4LKEA 4JI1B 3D3QA 4FTEA 3K9AA 2B7YA 1G7YA 4B3MO 2WBKA 2NN4A 2V7QG 2R1DA 5A3UA 4RR3B 5J2TA 4LOTA 4CEYB 3K4ZA 3H7JA 4F6RA 3E83A 4MGYE 2RM23 1W59A 4M3CA 3LIGA 2HYKA 1RITA 2PN5A 1BCXA 1KDMA 4HVOA 2D44A 2ZGOA 3P32A 2XLFA 3KSCA 1UKRA 1QJU1 3J7AU 4AQYO 3STLC 3WNKA 1PIV2 1AJQA 2NP0A 3LDEA 3SCHA 1KECA 3J7NA 1AP6A 3CCLV 5L3EA 4OZOA 3FB7C 2PGGA 2R49A 3OBTA 4K1ZA 5D5PA 4XJ9A 1UW8A 1ENSA 2J1SA 3Q9OA 1O3QA 4JI7B 4LO6B 3WG3A 4BAYA 2IU3A 1RUG3 2ILMA 1Q8SA 2VOKA 1UY3A 1GZTA 1LENA 1O9GA 4K8ZA 4IEPA 2W95A 3T2QA 2EIGA 4IHJB 1GICA 2ZX2A 4LF8O 4LTAA 3VBOA 5G05L 5LXTB 3H1LH 1LR1A 2YICA 2VBPA 4META 4QB1A 1WLDA 4Q4X3 3T08A 4XETA 3BKZA 5DAQA 2PFWA 4QE7A 2JICA 2QVSB 2Q7HA 2RDSA 1F5JA 5K0UC 3OAAG 1UJWB 4P9GA 1ULPA 4ZOLB 3DC6A 1G86A 4QGNA 1MQTA 3EO6A 4XC9A 3NMBA 1OCZC 4XEZA 2ZS6B 1OV9A 2CH7B 1GN6A 4XBFA 5H6RA 1PGSA 2DYRB 2VPVA 3NV1A 4XJZA 1VQ8V 2PHLA 5GZFA 2UY9A 4W6XA 1ACCA 1DDLA 1SCRA 1SLTA 3H1YA 4L9BA 1J58A 4YW6A 1QCEA 1AL0G 1AR71 2B45X 1K9MW 1ST8A 1RUE1 2JG8C 2ZM6O 5IWAB 1XL6A 4KFMA 2CL2A 1JZ7A 1JH5A 5HI0A 1BQZA 1AROP 2V4DA 4IEZA 5ISLA 4Z82A 1FXVA 3HWJA 2Y4TA 1G6UA 1UYZA 2X53S 4W50A 5FYYA 5GZGA 2LM3A 4GMP3 2E7AA 1WW4A 4LNUA 2NPIA 1JTZX 1K5MB 1UY2A 2ZX1A 1XDCA 1QQP3 1NTMH 5HV0A 4DV5B 2W5FA 3HT2A 4AQSA 1R092 4O2AB 1PZ9A 2B9UA 1UMHA 2VRZA 4B3SB 2PHWA 3OUHA 5IYCO 3ZMZA 4KG8A 4GT1A 2Y38A 4EFEA 3OE7G 2H3OA 4EWEA 2Q9LA 2CWMA 3POSA 2X05A 1MNGA 1NXMA 2DVFA 2AZ0A 5GKAC 4YJ2A 2WLLB 3O14A 5FV3A 1JOPA 4UAPA 3ST7A 2OWOA 1BBT3 1BMV1 3TEYA 4A2UA 3ES4A 5C8YA 3KM5A 5EJZB 3S7IA 1HXS2 2XDVA 4I3GA 4K7JA 4NPLA 1GOGA 1RUF3 2Q8OA 3BOPA 5C3SA 5L73A 5IJ9A 4AEMA 5KXEA 1W90A 3DXTA 4X20A 3OT7A 5EP9A 4XFHA 1AI6A 5DEDA 4RQFA 1QR8A 2OVUA 4LITA 4ICGA 4BIFA 4JV5B 3NVCA 1JYIA 3RJ2X 1P7BA 1BS3A 2QTWB 4XBQA 4H3WA 3M70A 3NXSA 2P37A 4GH4A 2A06H 4CUBA 4QXBA 5A7QA 1OD3A 3T2TA 4BU2A 1K73W 3FD9A 4X89A 4B7KA 4UCRA 5B1AB 5LBBA 5GLWA 2HVKC 4QPYA 1MSWD 1SQXH 5B5EZ 4Q4V2 1H8VA 4QU1A 4I4TA 5LOVA 4OYUA 5IVVA 2QSAA 1OCRC 4WFEA 2HBUA 1M5IA 3K59A 2ZMNA 5C3RA 2FMLA 3CLPA 5FWJA 3WDUA 4ZI7B 4E4DX 3AZYA 3RWNA 1ZBE1 5J1XA 4FFGA 4NIGA 1WBLA 4OVEA 3UGGA 5JZGB 3RZZA 2JIGA 1KUQA 3WW1A 4QKBA 1Y9QA 3T1MA 2IJKA 4YGDA 3O1UA 2ZHMA 2Y48A 2HJDA 4AILC 3MIFA 4JAUA 4DXTA 1XSRA 3VL8A 1ENVA 2E76B 3GGLA 4L87A 1FYUA 3BU0A 2AGSA 1LGCA 2Z4FA 3RVHA 4D0QA 5FPAA 4LF6B 5GALA 1BJQA 2KA3A 1UU6A 1Z2GA 4LEJA 3OY8A 4WM8C 4MTGA 1DYOA 4OHYA 3R66A 5FUPA 1PL4A 3ZFFB 2HWF3 4AQ6A 2QWOB 2P6HA 1W8WA 1KMIZ 2Z5WA 4AI8A 4BIOA 3POBA 1EN4A 3DECA 1KJLA 2VZSA 3CXCU 4CDUB 1OCCC 2EJRA 5IVCA 1ZAUA 5EXOA 4JI0B 2QQMA 3N2KA 1KKCA 4RHV3 3MV11 2ZDIA 2ORXA 5LHHA 3PUIA 4BQ5A 1DQ5A 1H4HA 4DR5O 3AG2C 5GZDA 1MABG 5JOXA 3E8BA 1NCRB 1XSQA 3CCUV 3CPWU 5FYVA 4HZ3A 1D7PM 4A41A 4X88A 2D6MA 2XJUA 1NA1B 1IX9A 1Q6HA 5DAVA 3B69A 4FLZA 5LATA 1WPBA 1IDSA 1WZXA 4E9KA 4AVSA 1CVNA 1JR9A 4EJRA 3OTOO 1Z5VA 2ZGRA 1BHGA 3JCIA 1BCCH 2G9FA 1PK6B 5GONB 2C6SA 4B4RA 3DXUA 1WD3A 3JD72 3ZFGC 1SPPB 4DK0A 3SPCA 3A0NA 4O4IA 2F4VB 4UF0B 3CU7A 1JODA 5IT9N 2VZPA 1CJPA 1NVPB 5A1LA 4HVQA 1J1TA 3A2FA 3LUTB 4Q2FA 1S0IA 1Y66A 4EROA 3HD8B 1SS3A 2R6QA 5K4LA 3T3YA 3QH6A 2F43G 1HN0A 4YJ3A 1RM1C 3MO4A 2UWBA 4Y26A 2Q0AA 4O4HB 1OOPC 5AVAA 5FYTA 5H9CA 5B1OA 1NAEA 1GN2A 3WLUA 4DR7O 1XBFA 1EN5A 1W04A 2W2IA 1VQ4V 1Q8VA 3PNAA 2DTYA 5KMGB 1PVC1 3DCQA 1OF3A 1XYOA 5FZIA 2DBNA 2QDRA 5LA0A 2HWC2 4CYDA 3ZHRA 1D4M2 1TZOA 5FNVA 2IFWA 4CA9A 3USUB 2I45A 3H50A 2VUCA 3THTA 1AR83 3MFCA 2Q8EA 3SCGA 1UOGA 3ITQA 2Y60A 2P90A 2VCMA 2UY8A 4NRPA 3K75B 2WKKA 4OMCA 4URAA 3IFXA 1YI2V 2FQPA 5FY4A 4LO8A 4XDJA 2XUEA 4HG6B 4GX0A 2RMU2 4IGGA 4N53A 1HDJA 2WT2A 4ONUA 3KG2A 5KX5B 1GZWA 3M3QA 3W58A 5LBQA 1CWPA 2G38A 5A70A 1UY4A 3WG7C 1Q8PA 3PVOA 5IVFA 1W9YA 4YHHO 2VZ1A 1NZCA 4OCTA 3CL1A 2R9RB 3DPRA 4YW7A 1DU3D 1POV1 1URFA 1IBLO 2P06A 5LGNA 3UKVA 4DB5A 4OMDA 1XQ8A 2ZMKA 3B7MA 4B08A 2R061 3POYA 2W9XA 4P00B 3MBWA 3TETA 3TBDA 2BZDA 4IEYA 5A33B 1UMZA 4I0WB 4BE3A 2C26A 1NX9A 3V0BA 4NIIA 3WDYA 1BQ0A 3ABLB 3HKBA 1RSOB 3CBNA 1U5ZA 1ZA4A 1RUNA 1B3QA 2D3SA 5T5LA 4BYYA 4NXMO 5D8AB 2P22C 5BNQA 4MW3A 1EPZA 4XE9A 5FZAA 5A7SA 1CIYA 3OUSA 1ZL8B 2HWE3 4HK9A 4XTPA 5EHDA 1KP3A 1MA1A 2GMEA 1KFXL 3K51A 4CDXC 1W8HA 4PHZA 3I7DA 3VD9A 3ZN0A 1JVMA 3B02A 5CVRA 2A1XA 4J7KA 1JYTA 3T1YO 1GAXA 5IAVA 4QX7A 4QGLA 1YITV 1RMU3 3E1F1 5L3CA 4OI0A 2VW2A 4RFRB 3V64A 2V4AA 1AVBA 1Q90D 3S3WA 1H8TC 4JI5O 3VKFC 2OUJA 5F1RA 5JXHA 4Q27A 3RNSA 2G4IA 4TOIA 2OPWA 2CTPA 2C0ZA 4RAIA 3BTYA 1FI2A 2FBEA 1AL23 3KCCA 1AR91 1VAKA 2Z79A 2W1QA 4I3PA 3ZXAC 1O3TA 4QHBA 4LFBO 2YU1A 4FP2A 4U36A 1V6NA 1X36A 5FP3A 4L0PA 3RYKA 2VZUA 1WW5A 1QJX1 2LP7A 2K9ZA 5GZEA 4IEUA 4UUJC 4YVWC 1UY1A 5CA0B 1GK9A 1GO3F 2D6NA 1VBA2 5FZ1A 4CCCA 4FXGB 1X50A 4FPHA 5ABJB 3KD4A 3RVYA 2YSUB 2HEVF 1OT5A 1EAH1 4CZZA 1U97A 1W8UA 5A7WA 2HYXA 5C4WA 4JV4A 1QWRA 3JAKA 2VAUA 4M3CE 4AHZA 1DLCA 3PVNA 2IXKA 3WV6A 4KWLA 1W8ZA 3WQ1A 1H4GA 5LA9A 1VEWA 4QQHA 1UXXX 4MGKE 4Y5SA 3TN92 1EZVH 4LF4B 4XUNA 4IV1A 2ARHA 3E5QA 3MW4A 4X8PA 1U5XA 2TNFA 1K7DA 3ZHVA 1VBE1 1I5YA 4WVVA 4A7ZA 3VDDA 3BPZA 2RV9A 1WMFA 1ZRCA 3APQA 2Z2SB 4N7UA 2QE7G 1WGPA 2JDUA 3I2HA 4MXWA 4XXPA 2AC1A 4RQPB 4XFAA 4LE3A 4H13B 4X6RB 2XASA 4X64O 2EJ7A 5FPOA 2QM7A 2Y6LA 1LHOA 1PO11 4B3RO 2NMOA 2ZGPA 1N1SA 3BPSA 5FZCA 1K34A 5F6LB 3N7MA 4E8CA 1PGL2 2FDIA 1Z7S2 3BTXA 1JU4A 3T1LA 2BVBA 1RHI2 1J95A 4GX1A 4EWAA 2PLV2 1V00A 4AVBA 4DV7O 4W6WA 2WFF1 2HJIA 3LCPA 2XQRA 4YYOA 4DEQA 3MD0A 4YGEA 5FL7G 3K5LA 2F6BA 4UI9L 2GC2A 4K8FA 3SPHA 1VBD3 2XKOA 1AYM3 4XQWA 4FMTA 3WCRA 4Z2AA 4P08A 2PELA 1C5IA 5EZYA 3D0SA 3PHMA 1Q86W 1NUKA 1COV2 2R16A 2XPJA 3JASB 3E8FA 1NT2B 4XDLA 1AYN2 2P1BA 1IG0A 4FZ0A 2VS0A 1XL4A 2WZR1 3VBHB 2CDYA 2X5IA 1NCQC 1QDOA 4LWSA 1F51A 1KS4A 1WMXA 2JEXA 3UGFA 2E31A 1Q56A 3C7OA 5A3OA 1H2MA 5GLTA 1UL9A 4IE6A 4XFGA 1BEV3 4IL7A 2JS5A 3A0RA 3HBKA 4YIOA 4OZXA 2W52A 1K4CC 1GQHA 1ULFA 3ZHSA 3JB4C 3M7AA 4DXSA 4QXHA 4RYDA 4AWDA 4P2ZA 3DXRA 2DE0X 4XW3A 5EIYB 3MGUA 2P5OA 2VZQA 1WLCA 4XQ4A 2WLIA 3DL3A 1OD5A 2VNGA 3K0GA 5FJHA 4B3TB 3JAWB 5JQGA 2ZKLA 1QEXA 1ZRRA 3HPLC 3T1HB 3ZR5A 5DZFA 2Y6KA 4H33A 3OBZA 3ACIA 1SDWA 1UY0A 1ULGA 3QLQA 3SHRA 1FFXA 2KD7A 4ZKIA 4WCEV 4C7UA 3M8AA 1QVFU 4DV3O 1LHNA 1GH6A 4U3JB 1YI7A 3V0AB 2HWE1 3EHBB 2KB1A 2ZPXA 3CZJA 4Q6GA 4K21A 2W92A 4Y5TA 3ZN4A 4AVTA 1IQDC 3C3VA 2WO3A 3F5TA 1OLME 2DTWA 2KKWA 2VW1A 1OSGA 3AL6A 1MZ6A 3VBUC 5F9TA 1EN6A 1GV9A 3JYCA 2E74B 2R071 4NHLA 1HNWO 2RJ2A 3OPWA 4XPVA 1OH3A 3MLLA 2LW8A 1R3LC 1LCLA 2BBAA 1UZWA 3J8F3 1OPMA 4J11A 3A4UA 3ZXKA 1SEFA 2WRAA 1YJLA 5LY2A 3OYWA 2JE9A 5LK5A 4KGQA 2Q6AA 3KCYA 3T2MA 2WSUA 2IJJA 4K8XA 2XOKG 4AXOA 2Z0AA 4QPIA 3RMYA 4Y20B 1OXCA 3MV01 3PN1A 1RUH3 5FZ9A 1DF5A 2ORZA 5JLVA 3GHMA 5HCHA 4XQDA 3VBRC 4JGZB 1XB9A 3RYCA 5FZBA 1I1EA 1H2KA 2EIKB 1JX9A 4QAWA 3WF1A 2RM22 1GN3A 2WNVB 2CGNA 3NO8A 4DR1O 3OGRA 3KV6A 4QDRA 4NAMA 3D4KA 4X1IA 1EYBA 2VD7A 2DJVA 2GN3A 1XHZA 2L6LA 2PF4E 3QVNA 4FOQA 4LA3A 3C3SA 2ZGMA 5CYYA 4X9QA 1APNA 3MIHA 3CDZB 4H2AA 5LMUO 2NN8A 1SFYA 4F3JA 4JI6O 3TEXA 1WNSA 5FO7B 5K7PA 4TV8A 1YTFD 1YQ2A 5K1PA 1R1A3 1PZ7A 1RUG2 3B09A 2EIMB 4QDSA 4R4ZA 5BNOC 4KMQA 1NXD1 1QQCA 5J37A 4BK4A 1FMD3 4LHLA 4MO3M 3RZJA 1QOSA 2CWSA 4IESA 5JOZA 1HNZO 5B1AC 3CMEV 1WA6X 5T52A 5C71A 2NLRA 2PY5A 2D3OW 3MF6A 1ND3C 4Q4X2 3KV9A 4FLWA 1PNMA 4DR4O 4CP0A 5F2SA 3SH5A 1ZM1A 4RGKA 1GKBA 2ZBJA 1M90W 4I9WA 2RS11 5CU1A 2B5HA 4PIZA 2KG7B 2MPFA 2ZD9A 2JB4A 4FPOB 2ZXWB 4X1KB 3H8XA 4AEDA 1XNQO 4OUEA 1K3IA 2A6YA 2NNUA 4DV1B 4FO9A 4DUWA 4PIXA 4EN9B 4FAHA 2OW4A 2FHRA 4XDKA 5BYNA 1AR61 4FTBA 2FKXA 3TGUH 4Q4Y1 4UFZA 3M2MA 4XILA 1J5EO 3WF3A 1SESA 5JR7B 4J42A 5FZDA 3L2YA 4MV2A 2LTNA 5FUIA 5F5QA 3LAGA 3VZMA 2KQXA 2UU8A 1YTFB 3HN3A 1WWYA 4CUGA 2NMNA 3P3PA 4WFFA 3B3QE 5B4XA 2P4KA 4IGPA 3I2OA 1QQP2 2C2AA 5IYYA 5LP6B 4BDVB 5KXDA 5E79Z 4PDMA 1QNWA 1G9CA 2EILC 2BP6A 4E2LA 1Y74A 1ZUQA 1LJ7A 4DUVA 1H8HG 2P17A 3CJIA 2N04A 2VTXA 1IPJA 4TLFA 3ZIAG 2X0LA 4EV0A 2QTSA 5DQ0A 3LIHA 2HHHB 1XUQA 5HCBA 4O61A 3VD3A 1J3PA 1UMIA 1RUC3 3RWKX 1QLEC 5B2GB 2JDKA 4LA2A 1MOFA 4L99A 3JALA 2BBVA 1E79G 1JI6A 2DFCA 4ZKTB 2OX0A 1BBT2 4X66B 3CMGA 5CBHA 1YJWV 1RVF3 1W9TA 4R6ZA 1JYVA 4WFGA 1S5JA 5JPNB 3LPFA 3OGIB 1O59A 3MF9A 4E2QA 1GOHA 1DK1A 1RUF2 4K9SA 2OQ7A 5H9QA 2M6YA 1DGRA 3G7DA 4KHPB 3AP4A 2WS91 3ILNA 4XTMA 1MS1A 1JCHA 5B3SC 3VZNA 3ZFEA 1O8PA 2GBOA 1SETA 2XGXA 3NJVA 5J2TB 5BNNA 4JZ2A 2KM2A 4P9IA 5EWSA 5JJJB 1WCUA 5T5JA 4F6RB 1RXFA 5GLVA 5J48A 4GZ9A 5C70A 2FDJA 3LSEA 4JVAA 2ZAHA 5L3DA 5M0TA 1YQ5A 1JJOA 4X1YB 4O2BB 4YVSC 4M0NA 4LO5B 4YGCA 4AHXA 4I01A 4AVVA 1NYWA 1NY72 2QDNA 1G9AA 4LORA 4UWDA 2X29A 3OUJA 4MADA 4S2FA 1Y67A 1W9FA 2FDGA 2N74A 4C90A 1W3VA 1QXJA 4JDNA 1Y9GA 3A21A 1CAWA 5IWAO 3SGIA 1CJDA 4LXLA 2XHKA 5BR8B 2G9GA 3GALA 5FMOS 4H55A 2D6LX 3THDA 4ASKA 3K5OA 3ZMOA 2UUAB 2VZVA 4QPGB 1W0PA 3VBOB 4UCUA 5JI9A 1XC6A 2CAVA 4Z2WA 2RDQA 4YG3A 4B3SO 3O65A 4Q4W3 3VQXA 2D6PA 4N23A 5FZGA 5LMNB 2WAAA 1X9TA 4TV9A 3NNFA 4U7OA 4WF9V 1SA0A 1GQGA 1HRV1 3J9SA 1MQTB 3M99B 4XJ8A 2HWF2 4ZXEA 4K1YA 1VPHA 1HQWA 2PUSA 4LF7B 3AG4C 3VZKA 3WOGA 1NU1H 1AP5A 5F3CA 5FMBA 3TAYA 4ATEA 3VDCA 2AXTZ 1KD1W 4KWUA 3TYJA 2R7EB 1N4CA 2RE9A 4RHV2 3EFFK 1VBC3 1FS0G 5FK7A 1OKQA 2WINB 5CBFA 1P8JA 3BIWE 1HDKA 2OCCB 1YI9A 5LRSA 3ABLC 4BIUA 3FB5C 4JKMA 4B1LA 3N9LA 3POIA 4WZCA 4JI3B 1RJ7A 1YHQV 5FMCA 5J09A 2PTMA 1DGSA 4GYCB 4JV5O 4GH4C 1S77D 2BRTA 2RR13 2VMCA 4LNUB 5EYPB 4DFSA 4AQ2A 1Y6XA 1QJFA 1YXBA 1Y76B 2GNMA 1FAYA 4MH0E 2XOMA 1XE0A 5A3LA 2JDHA 2YXYA 5J3UA 4N21A 5J98B 5LYJA 1DGLA 1OMIA 3RW0A 1UYYA 1R083 3AKRA 1UX6A 1SERA 5I8SA 2ZTNA 4ZZ5A 1RPRA 4I30A 1QJY3 4DR6B 3OEAA 4D8MA 3W20A 5C3OA 3QH7A 3D3AA 5FDBA 5E6HA 4FFFA 1SHWB 4UB6Z 1ODMA 3UKTA 1YIPA 3EHKA 3UJOA 2W0XA 4JI4B 3ASOC 4CS2A 4JAAA 2MW2B 4QGMA 2X6AA 3ZRWA 4RS5A 1VQLV 1S0EA 5FIXA 3HKDA 5DAWA 4JYBA 2OYZA 5GZCA 4EWDA 1W6OA 4IETA 4A6SA 4FLTA 3BVOA 4RGGA 1WA8B 2H0VA 5EYYA 4LUMA 4OHZA 1LGNA 1Z5WA 5DUXA 4OQ9A 2QKSA 1W8TA 4X20B 2IU0A 2D2CB 4JCKA 4O9EA 3JBG1 1VMJA 1FXKB 1NKDA 4GX2A 4HAMA 3UCSC 5BMVB 3GBGA 1ZZ9A 1GQPA 2Z3YA 4LF6O 5DECA 2QM4A 2FCTA 5DUWA 5JAXA 4UXNA 4QD2A 3RN4A 1NT0A 2VH9A 4WM8A 2H0BA 5A2QN 4YW1A 4YXWG 1AR82 1PX4A 2BE3A 4FM2A 3ZN6A 4M4PA 3SLIA 5FY1A 2EXJA 2ID4A 2N7GA 2NYYA 2ZDIC 2HWB1 1XEQA 4GMP0 4QX2A 5LOVB 1N32B 4JI0O 4DY5A 2CAZC 4ZY9A 2GSMB 3OEHG 1CXZB 3LE0A 1TUBB 2LO1A 4IEVA 5K1XA 4RD7A 2LQTA 3CCSV 5LZ6A 2DU1A 1B35B 2DF7A 1O3RA 3CCRV 1XNTA 2NR5A 3H8OA 5J2UA 4G3YC 1HRI3 3Q4HA 1YEWA 1K5QA 1VF5B 5AVPA 2ET7A 3UO2A 4V2VA 4P9PA 4XOGA 5E88A 4UFKA 2UXNA 5CB7A 5B66Z 4W4KA 1YZBA 4O65A 1HB4A 4UCSA 3ABMB 3POWA 4XZPA 3HKCA 4LFAO 4QWNA 1C8M1 3SJBC 3EVKA 4IE0A 2J1AA 4GLXA 2ZEYA 2LUWA 3ZVXA 2QM8A 2GP5A 3SR2C 2E51A 5BNPA 1TNFA 2BQPA 2D6OX 4KWKA 1KD7A 5FLXN 1RUI1 5LA6A 3T4DA 5CG8A 2F4VO 2FZ2A 1K92A 1TQ5A 1PP9H 4EB6A 4J25A 4JGYC 2GTAA 1PM7A 4AFBA 3U14A 2XAQA 3W7WA 3CQOA 2HWE2 4CPBD 2MEV3 1KFUL 3URFA 4QM8A 4XMIA 5A7PA 1LAJA 3CJHA 4MW8A 1ZRDA 4OI2A 4LC1A 4P9JA 4XDQA 2GC3A 2ZHKA 4YM3A 3BB6A 2YGLA 2D7FA 5H2FZ 1D2DA 5FYUA 1CR7A 2DVBA 1OOPA 4YW5A 3VKNA 1FOD1 1V6OA 1LULA 3UT5A 1FPN3 5CISA 5CFCC 1RMU2 5JXJA 5ANQA 1KC8W 3RYIA 4A42A 5A1AA 1VAMA 3W7UA 1I3HA 1K97A 2RDCA 2XNDG 2VE1A 5JR2A 2TEPA 3WDXA 1JFFA 2A7WA 3CB2A 4K0KB 1TAEA 5JOWA 1XREA 2DVGA 4MVSA 3HNYM 4FM1A 5JVDB 1M93A 2JDNA 3ZKUA 3LOIA 5C6CA 2A70A 4COZA 1K45A 3ZX7A 1NQDA 5DDJ1 3T09A 1XE8A 1AL22 2Q69A 2ZGSA 3I2DA 4N53C 4Q8LA 2P5BA 3OUFA 3LF7A 1LOEA 1C57A
chains in the Genus database with same CATH topology
3AYCA 1DQ6A 1S0JA 1FATA 1WBLA 2IWGB 2EF6A 2W39A 3D82A 4OVEA 4YZ5A 2RMU1 2RS33 3LSDA 3H8UA 5JZGB 3RSJA 4DXZA 3B5LB 3H7YA 1TE1B 3RZZA 3HQXA 1MS9A 2O8OA 3WW1A 1QH7A 2RS13 1V9U1 2ZMLA 3AZVA 1Y9QA 2SBAA 1FV3A 3MIBA 3NKTA 3IDCB 3MICA 4MX3A 3T1MA 2V5YA 4HPKB 4YGDA 1C28A 1ZVFA 3DPRC 4Y1ZA 2ZHMA 4LBMA 4YZ3A 1GBGA 3JBG2 1MQTC 3GBFA 3MIFA 4J1WA 4YW4A 5K0UA 4A7YA 3VL8A 4HBNA 5KBFA 4GA9A 3PMSA 1FYUA 3NWKA 3UK9A 4AHWA 1C8NA 1H1AA 2AGSA 4ES8A 1LGCA 1U5YA 1U0AA 1FX5A 3SCFA 4FAGA 1SMVA 1VRH3 4IQPA 1BXHA 4L97A 4BM8A 1AR63 1PGW2 5AFBA 5FO8B 2ZAAA 5GALA 2ZZQA 2XJVA 1J3QA 4YVWB 2WC2A 1BJQA 2KA3A 1UU6A 4N9IA 4Q4Y3 1QOTA 4LHNA 4LEJA 4OFGA 2I74A 3OY8A 4WM8C 3IPVA 4AFMA 2OIIA 1CGPA 3FMGA 4OHYA 4P5HA 4DS0A 4XJWA 5KC5A 1PZ8A 1ZYBA 2GC1A 1OPOA 4HKOA 3ZFFB 2HWF3 1OIKA 4AQ6A 3VN4A 3INAA 1AJKA 1AR72 1LOBA 1RUE2 3TOJA 3HT1A 4Y5Z0 3ZYPA 4RR3C 2Z5WA 3LA7A 4AI8A 1LOCA 4BIOA 1SLAA 1YJKA 4CEYC 5KHKA 2E63A 3H1MA 1CAXB 1OTJA 2HWB2 2CAUA 1DHKB 1KJLA 4LO4B 4CDUB 1F9KA 3J8F1 1YUDA 1GANA 1RUJ3 3VLBB 5EXOA 2JG8A 2Q30A 3RDIA 2ZZJA 4RHV3 1Y3TA 2DV9A 3DN7A 4YZ1A 1DQ5A 3J26N 1H4HA 1R081 5GZDA 4PJYA 3JUUA 2P34A 5JOXA 3MLKA 4LBLA 5AC93 1NCRB 2Q5TA 3OJBA 3SITA 1RUH1 4GALA 1CAVB 3KT7A 4CDXA 4Q1RA 1QNYA 1WCKA 1D4VB 2V73A 3ROUA 4QPIB 4E2GA 2D6MA 2XJUA 2DUQA 4AVCA 1NA1B 4IV3B 2YGMA 1H0BA 5KC6A 3B69A 1DGWX 4R8HA 1OFSA 2XJRA 3MFAA 3WR0A 2DCYA 1SCSA 2QKDA 3SH3A 1S0CA 1A78A 3KGZA 1JN2P 1C8M2 1PIV3 2RHPA 4AVSA 4D7TA 1CVNA 4E9KA 4EJRA 4BA6A 1DQ2A 1CAUB 2ZGRA 2IXLA 3WVJA 3JCIA 3S30A 2G9FA 4M25A 1PK6B 3J4UH 5C8WA 4HFSA 4AHYA 1RUI2 4B4RA 4BLIA 2JDZA 1WD3A 4RSUA 2RJKA 3JD72 3ZFGC 1D2SA 2FMDA 2GNTA 3A0NA 5FCCA 4FPLA 1EV13 4ASLA 2D40A 4E27A 1BMV2 3RJRA 1H8TA 5JOYA 3CU7A 1Q5OA 2C9AA 1CJPA 4I09A 1LKNA 4HVQA 2KXLA 1J1TA 3R05A 1GLHA 2ERFA 1VBD2 4XF4A 3WXPA 1CESA 2CNAA 4Q2FA 1AYM2 1OIHA 1S0IA 1LOAA 5DZEA 4EROA 3HD8B 1ULCA 4DRVA 2VVDA 2R6QA 1WW6A 1C1LA 2ZACA 3EBRA 3QH6A 4LHKA 4HPKA 2I07B 2B46X 2E6VA 4PLNA 2WS93 1NQJA 2D43A 2UWBA 3AKSA 4UW5A 1R1A1 4GB33 4Y26A 1OA4A 2Q0AA 1Y7BA 4TWTA 3TWIA 2ZGLA 1OOPC 4HK8A 5AVAA 2IC1A 1TME3 1JBCA 1LU2A 3S7EA 1FOD2 1FMD1 3WG4A 2OPKA 3WLUA 4M27A 1REFA 1JUIA 2GH8A 3ZYIB 1Q8VA 1V6LA 3PNAA 2DTYA 1PVC1 3FJSA 2HWD3 3OD4A 1OA3A 3U0ZA 1XYOA 2WSVA 3MDPA 1VBA1 3MI8A 3MPPG 4NO4A 2PA7A 4B29A 4QQPA 2QDRA 1O4ZA 4GKYA 4OI1A 5I0TA 5C4WC 1UPSA 2VMIA 2HWC2 3ES1A <