1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
4BIOA 2WA3A 3D8CA 4Z2WA 2W0XA 1YCIA 2CGNA 1H2KA 2YDEA 4NR1A 2WA4A 4B7KA 3KCXA 3KCYA 1MZFA 1MZEA 3P3NA 2CGOA 2XUMA 1H2MA 2ILMA 4AI8A 4B7EA 5JWPA 1IZ3A 2Y0IA 3OD4A 2YC0A 1H2LA 1H2NA 4Z1VA 3P3PA 4JAAA 4QU2A
chains in the Genus database with same CATH superfamily
2ZE7A 4A7KA 1NXMA 1PO21 3HEIA 4WFBV 2R30A 1AVBA 2UU9B 4H2AA 4YW1A 4BHPA 4UT5A 1AP6A 4PHZA 5A6XA 4JKLA 2PHUA 4GT1A 2W6JG 1UWWA 4MGQA 3A7QA 4QIWF 1FV3A 1NH2D 4DV1B 3M7MX 1SZBA 2IWGB 1HRV2 1XOUA 2GH8A 3RVHA 4CA9A 2WNEA 4DUZB 2JGUA 1CAUA 1F7YA 1Z7S3 4RFRB 3PJQA 2WKKA 3CCEV 2UUCB 1AX0A 3IIIA 3DSQA 3I5DA 3QO8A 5FYMA 2K9PA 4NAOA 4DR5B 1RUE2 3ACIA 3BU0A 5FXVA 4XETA 2BU9A 1JVMA 5JQGA 5KC5A 3H7YA 2EAAA 1BEV3 4XQ4A 1GWKA 3ML0A 4CEWB 2OT5A 1ZA7A 4CS4A 1ZNPA 3RRDA 3RNSA 2ZTNA 2Q8DA 3MFCA 5L19A 1R6KA 1ZZCA 4YGDA 3ZVXA 3AP5A 2A6ZA 4ET7A 3R05A 1GZWB 3K4ZA 3GDBA 3ON7A 5EP9A 5FK8A 3DL3A 4ZI7B 4GLXA 3FZ3A 1RUH3 3T2TA 1XNQB 2CYFA 1TA8A 3MIFA 4ATEA 4EYUA 4B3SO 1RUF1 3M70A 2RHPA 3MLJA 5CAZA 3BODA 1AR61 2BTVC 5IJ9A 2VMCA 1KKCA 1OQDA 3AKRA 2QM8A 5DG1A 4GKJB 3ZYJB 3AL5A 1P7GA 1QLEB 2RR12 4FFGA 5CBGA 4DUVA 2W47A 2HWF3 3CE2A 1PL4A 5FZ4A 1S55A 5HXVA 4ITCA 1E1QG 4UAPA 3UK9A 5C8YB 4XHXA 4YY3O 1EY2A 2R072 4HG6B 2YXHA 5KXBA 1NYWA 1S0FA 1DYOA 4F4LA 4LIUA 4EN8B 1MSDA 1ENVA 2AH2A 4EWDA 3VBBA 1HNWO 4KU8A 3WHUA 2VZRA 2VZ1A 4LOTA 3ABUA 5AFBA 1ZTEA 1QU7A 1W6NB 4COYA 3OM3B 3HKDB 4HN1A 4R9DA 4PDRA 2Y4TA 2Y8KA 1YTFD 1DIWA 2Y0PA 2V4DA 1DZTA 5ACA1 1N0JA 4P2ZA 4DXRA 1NG0A 1JZ5A 5DUVA 3T2PA 2WQZC 1KQRA 1RUG1 5JR7B 5JPMB 4X65B 3THDA 2DYSC 4FQZA 2EINB 4R6ZA 2NYYA 3SYOA 3J7LA 3ILRA 1M56B 1OCCB 3QG5A 2QUOA 1O5LA 4K1ZA 3PU8A 5C6CA 3CMAV 4NHKA 2WSVA 3E22A 1BXHA 1D4M2 3PIGA 2IFWA 1OCZC 2WSUA 4YWAA 3K5NA 4Y4RA 1BS3A 4HL0A 2LQTA 1CVNA 2NR5A 5A6QA 2BTQB 4XEZA 4IV3C 1YXWA 4MS2A 1G4YB 3B02A 4D6RA 2VQEB 3O12A 4DV7O 5F39A 2V7QG 5LOVA 4TV8B 4RQPB 4DR6B 2ARAA 4XILA 4CH4A 2XUMA 4D69A 3NJVA 5HPOA 1VE0A 2CTPA 1W8WA 4QM8A 1FXVA 3CZJA 4IGGA 2YBKA 2FDIA 3DTUB 1IQAA 1TE1B 4AE2A 4BCUA 4J42A 1JU4A 1PMHX 2B1IA 4Q4Y3 2R9RB 2E31A 3FLPA 1MACA 1GRJA 1OKQA 3ZXGA 2P3YA 1ND3B 4KGQA 1NQJA 4XZPA 4LE4A 3DF0A 1PZ9A 4CDQA 3A0HZ 2YSUB 3ZN1A 1W6OB 5GALA 2K2SA 4ICGA 2LO1A 4O65A 5B1BB 2JS3A 3VKOA 1KUQA 1JTZX 2X10A 1M93A 2WUHA 1HX6A 5EIBD 2GC1A 4XDLA 4GUNA 4GX1A 2ZPXA 5FYZA 3WCSA 2YFZA 3EXAA 1H8TC 2RJKA 1I5ZA 2XKPA 5EBLC 4NYKA 5DDJ2 2RR11 2UUAO 2WR9A 3EO6A 1WJZA 4N8MA 3H3LA 5IAXA 3Q4HB 1MS0A 1MA1A 1UYYA 1GANA 1WP7A 3IGAC 1UMZA 2DCYA 1YJLA 4IYHA 5FYTA 4NB5A 2ZABA 1GMGA 1ZRIA 5IWFA 2WS91 5CMUA 1X7NA 3I3DA 1XXNA 1IX9A 1O7FA 2QM7A 4CCCA 1KRIA 4GD4A 2XOKG 2C5DA 3H3ZA 1R083 4ZHQA 4DINB 3AG3C 1XNBA 3QNEA 1XNCA 4DR6O 2JG9B 1FI2A 3WDVA 5F1RA 3GBGA 3V0AA 5D1IA 3CPWU 1HKDA 1WW5A 4JGYC 4ISRA 1GP6A 3E2EA 5CKMA 1C8M1 2OYZA 5IYDO 1BMV1 3S7EA 4M3CB 5DXDA 4H37A 1RUNA 5A2QN 2ETEA 2ZQMA 1K8AW 1KS4A 5FZKA 3IDBB 2DUQA 3OTFA 3CC7V 4OMCA 2D44A 1JA8A 1ASJ3 2GH2A 2VQFB 4W4KA 1OOPC 3ZFEA 1BK1A 1ZBA3 1D7PM 4M01A 1J95A 4B1LA 3UT0A 1UZWA 5C5UA 3CEWA 3UM7A 5JZGA 3RS6A 4NOTA 4DR3B 4LLFA 4CCMA 3QCWA 4FLXA 2ARCA 3J8F1 4K8XA 4U7OA 3OEAA 2UY8A 2F4VO 2JXAA 2BOIA 4U7NA 5G04L 1YYNA 4EKWA 1HW7A 1G6UA 1Z5WA 1VBA3 2VVDA 2HWC3 3VDAA 1EPWA 4GB33 2BEOA 4FQ4A 1SQXH 3L9JT 1OKOA 1H8EG 4DEQA 5HV4A 2YDEA 2XKOA 5CU1A 3ZX6A 1WW6A 5JOXA 4HVOA 5CEHA 5SV5A 5BNOB 5KUKA 1H0BA 4Z8BA 1LUVA 1PNLA 3SJBC 5ABJA 4YZ4A 4XFFA 5HI0A 3URFA 3LSQA 1Q8PA 4LF6B 1NUKA 4LBEC 1F15A 4R50A 4M0HA 3WB2A 3SCHA 1DGRN 4B3RB 1JYTA 2ZGOA 1QQCA 1VF6A 4XDQA 2R49A 2DCTA 4X20B 1OFNA 1NTMH 2JDNA 1AR91 1EV12 5EJ1B 4MW8A 1SQ4A 4LNVA 5IE9A 3K4DA 1HJGA 2A70A 4JZRA 1JZ8A 3J7MA 4C91A 2EZOA 1YJNV 1PIV2 4INDA 5DDJ1 5AC93 1M90W 5F3CA 1JUHA 1N34B 1W9TA 4I0XA 4FMTA 3CDZB 2X8KA 1IBMB 3N2KA 4MTXA 1WMDA 2ZZQA 3H9AA 2ZA9A 2ZAHA 4EFEA 3NV3A 1K5JA 1COV1 3ZSJA 1SPPA 1I7FA 1XBLA 2Q7HA 4RUEA 1F5FA 2Z42A 3B01A 1R3IC 3TYJA 5F5QA 5LBFA 2UUBO 4RR3A 1G1XB 3K46A 1WLDA 4WM8B 2J22A 3BYWA 2R041 1NR7A 2GC3A 1FPOA 2TNFA 4YG3A 4GX5A 1N4CA 1IS4A 1XC6A 1DHKB 3WHTA 4LBMA 3RYFA 2HHHB 5HCFA 2VBDA 2LTNA 4DV4O 3HBKA 2ARBA 4IHJB 5KHGA 1LKNA 2VC9A 1XNRO 2VVEA 4B3NA 3E5XA 4Z1VA 1N1SA 3AG2B 1URXA 2JKBA 1CAXB 1C1LA 2ZR3A 3K51A 3O0VA 3A0KA 2PAEA 3B93A 4P9GA 5GLTA 1W8FA 2Z5UA 1IKPA 4EJRA 4TV9B 1YSCA 1I94B 4HZ3A 5C4WA 4CVUA 1O91A 2P3JA 3H50A 5C7GA 3RZZA 3VBRA 3WU2Z 1BBT3 3UL2A 2P6JA 3VDCA 2LUWA 5CZKA 3N3HA 4JQRA 3EMRA 4C90A 4NRQA 1W9WA 4H7LA 2LW8A 2WT1A 1XREA 1MZ5A 1H2NA 4UFLA 3ZHQA 4K21A 1OVPA 3AKSA 4BW9A 1BBT2 4RS5A 3RZKA 3AJZA 1E57A 1AJKA 2QJVA 3ZMVA 2D43A 2QKCA 2XVGA 4GKJO 2IW5A 4FTEA 1GBGA 4D7YA 2AXTZ 1P49A 1QJX1 2VQTA 2RCVA 1PGW2 4I09A 4LA3A 1RUE1 2X05A 2YU1A 2XASA 3OY8B 4GH4A 4YY3B 2VBPA 5A32A 2JB8A 2J1RA 2RV9A 2LS6A 3SISA 2FDHA 1VF6C 4RL7A 1HNWB 4HXCA 1RB8G 3E1F1 1AR73 4J9YB 5FP7A 1ONAA 3KZIZ 2FTKA 1DGLA 1S0VA 3T1HO 2GNBA 4JASA 1YLLA 1NR1A 3BTYA 1QQP1 3DYPA 3MICA 1DQ0A 1EV11 1XSRA 1W0NA 4AEDA 1VRBA 4XF4A 1BE3H 3JASA 2B9UA 4JI6B 4TUYB 3H1LH 2D5HA 2WWUA 2ZJCA 4X66B 2DOSA 3TJTA 1NCQC 4G4FA 4NN0A 1FFXA 5C4WB 1UD1A 5BNNA 3UKTA 1ACCA 4OXSA 2I2SA 3D0JA 3WNNA 3JATB 1AYM2 1JN2P 4TQDA 4QX7A 5IT6A 4LFCB 4KHPO 2JG9C 3J7NA 2UU8A 5DAPA 3U11A 3ZXJA 1GN6A 2MK3A 3GWKC 3JBG3 1COWG 1NKDA 1RVF3 3FX3A 4YIOA 4E9KA 2DWEC 1MSWD 2IUWA 5DEDA 1D5NA 3BPZA 4JRLA 4JV4A 1GM8A 1G9FA 1A32A 3CRCA 1JJOA 3JD2A 4Y1YA 4CDQC 2WA3A 3K59A 3SR2C 1L0LH 1QQP2 1AUYA 4X9QA 1VBB3 2P17A 2WQ8A 2ZMLA 2WLMA 3E86A 4Q1RA 3WX5A 3BA8A 2BBAA 5FZ9A 1XUQA 1JPXA 5LA0A 1OHFA 1CP9A 2WZR3 4CPBD 2Z2SB 1O5UA 3UT5B 2A7WA 2D6LX 5FZGA 5C8CC 2YEVB 3ES1A 4RYDA 4ZS3A 4V2WA 2ZEXA 2F23A 3N7LA 1GYKA 2VZVA 1QY4A 3ALQA 2HYXA 4FK5C 2LFSA 3I56V 3N7KA 4CUCA 3RJRA 2KR2A 5IYCO 4P14A 4DEVA 4JC1A 3KHBA 4B4PA 1UY1A 5IJ9B 5GZCA 2XVKA 2WO3A 4XE9A 1WLCA 4IEXA 3POJA 4NXMB 2RG4A 3R4DB 5KHIA 1K5SA 3RW0A 1VB2A 2VZSA 2XTAA 2EA7A 3SC7X 1REDA 2F93B 4LBQB 4RS5C 5C8YA 2BOBC 4UVBA 3RMXA 5F8PA 2K46A 4TUYA 4E2QA 4F83A 4XXAA 2WZEA 4FPOB 3RVZA 4MV2A 2N7GA 5BNNB 1ZL8B 2WNUB 4QX3A 1WBLA 5FP4A 1QF3A 2J1UA 3PVOA 4XBLA 4I55B 1DBNA 5BXZA 4XZUG 1XI1A 1UN1A 1ULCA 4GH4C 5KX5A 2ZBJA 3VD7A 1KDMA 1S0DA 5IK8A 1EN6A 3BVOA 3A0BZ 1W0JG 2D3SA 3HKDA 1HW5A 3APOA 3E8GA 1UW8A 2BCCH 4XOGA 2VJXA 1JOBA 5D8AA 1O4YA 2V5DA 2GZWA 3NNFA 1FX5A 2Q8VA 4XHBA 4PDLA 3OGVA 4K0KB 5JCOA 2FDJA 4LF8O 1X9PA 2B46X 2FMLA 4S2FA 5DZGA 2YU2A 1WLEA 1FOD2 2K0GA 2QGNA 5JJEB 1ASJ1 3DXTA 3JSLA 2ARXA 4CE8A 4OX9B 1VBB2 1RUG3 4RQFA 3JD1A 5H9SA 3B09A 4JGYB 3SJQC 3ASNC 4B4RA 2YMZA 3V65A 2ZIOA 3UCSC 3G71V 2VU9A 4KFMA 4E4DX 4QWNA 1TVKB 4N53B 3GHMA 4TLFA 1N1VA 4U3JB 4EB6B 4DV6O 5L9VA 4ZXKA 5IFPA 3JB8A 2B7YA 3WF4A 4LNUB 2ZGUA 1XRUA 4X1KA 5K9YA 5F5CA 5FYHA 5I8TA 4HYOA 2TEPA 1RM1C 2ADEA 1NH2B 1PGSA 2RS12 4JTAB 1QBZA 2Q68A 5IWAB 2D5FA 2E9QA 2BUKA 4I0BA 4JI1B 1W6MB 4LTAA 3ZFGB 2UYAA 5J7MA 2P6CA 1JH5A 4GWIA 4L97A 4OUSA 2PY5A 1FMD1 4IIJA 3SITA 3H8OA 4RWUA 3ACFA 1Y67A 1UOGA 2X5IC 1D2DA 5FXZA 3WQ1A 5FMOL 3WEZA 1U12A 3LA3A 4X66O 4Q8LA 3OBRA 3WDXA 4Q1PA 2JEXA 1E5IA 4FJCC 3NJYA 3KS7A 3NJZA 4JZGA 4OGQB 1N32B 2ZZJA 5HCHA 3HNMA 5FBZA 2EIJC 5IK7A 4Q4V3 3HT1A 4DUZO 4N43B 3VD5A 1HRI3 4XDOA 1XNQO 1VQ9V 3V64A 3ZEDA 5FZ6A 4Q4W3 3ZKUA 1LR5A 2L6LA 3M1HA 3K57A 3PUSA 4MVTA 4K8FA 1ZZBA 2JG8C 1UKRA 4FLVA 3CSXA 3Q4HA 1SLTA 2ZX4A 4GJYA 3F95A 1A34A 2ZGQA 3EB7A 2WYSA 3N7JA 3NJXA 1MZFA 4BIZA 1VAKA 4ES8A 4O4LB 1KGYA 3P30A 5EPAA 1PGL1 4Q4W1 2EIMB 5C93A 4HT1T 2VOKA 1S4CA 2GNMA 2D97A 3GWOA 3KGLA 3M8AA 4NPRA 1Q6IA 3PVEA 3W5NA 3H0OA 4FTBA 4IEVA 1YCIA 3IB3A 4NXMO 2PYJA 3KD4A 5JSPA 1RUH1 2PQSA 4CU8A 4J9ZB 4YW5A 5FP9A 2XJVA 2HP8A 3GBFA 3M3CA 1QVGU 1XMQO 3ZXLA 4BOWA 1HP8A 4ZI7A 5C3OA 1J5EB 2VCCA 2IXJA 2RS53 1U5YA 4A7ZA 3ZMTA 2JB4A 3GB7C 2GNTA 3WCRA 3WP4A 1K33A 2RS13 2YY1A 3OG2A 1BQPA 2GMMA 4I2OA 4RD7A 3KGZA 5FZDA 2JGDB 2ZD9A 4XJUA 4NIAA 5A80A 1ULOA 3L2YA 2ES3A 3W58A 1S2KA 4CU7A 4E8DA 3O65A 1JXNA 1RUC2 2AGAA 3JYCA 1W8NA 4DV2B 1OI6A 1Y6XA 4ARXA 1VBC2 4BIFA 3GCWA 5C8CB 4W6XA 3GGLA 4MSVA 3OYWB 3AKQA 3KZ4C 4K3UA 2ZNJA 3FLRA 1BJQA 5IYZA 1YUDA 3NKGA 3C7EA 2H0VA 1K5MC 5L36A 4Y1XA 2VY0A 3T2MA 3RI8A 4XBFA 3WG7B 3B2EE 2QTSA 1W04A 1IDSA 4J7ZA 2E7QA 4LUMA 5H9QA 5T55A 1G86A 3U14A 3H8XA 3RWKX 1UYXA 5FZIA 4XYXA 4CCKA 4NRPA 4E2GA 1XU2A 4ZOLB 2P3IA 3B40A 4R7CA 4FP2A 2GU9A 3WG4A 3OT7A 2ORXA 5LCWL 5FQ0B 2QDRA 3ZMNA 2ZOEB 5BNOA 5B2GB 5F3GA 3H9VA 4YM3A 2YB7A 5L7OC 4UI9L 1S0GA 1TQ5A 4J10A 4MTOA 2BQPA 2AC1A 5BNPC 3AZZA 5GZFA 2DCKA 3B9IA 2HWB3 1COV3 1FMD2 3FUQA 3G6BA 5I0DA 5IVJA 4KG8A 1YJ9V 2QQNA 4XF9A 1D2SA 1EP0A 5CKNA 1H8VA 5L3DA 3KQRA 1FJGO 5LZ6A 2C26A 2HJFC 3L72H 4YZ1A 2CH7B 4B3MB 2JDYA 2HWB2 3WG3A 1UZVA 3KQ4B 4IYIA 5JCOC 1ZUQA 5FZFA 2EXHA 3SEPA 1RUF3 3JQXA 4A7YA 4FPYA 2EINC 1MS1A 5KHKA 1IBLO 2XMLA 5DZEA 2F6BA 1HV0A 4QXCA 2JD9A 1OCCC 2WNVA 1OFSA 2RS32 4AVBA 1HQNA 3QF7A 3T4HB 1OLRA 2PTMA 3OGJA 3OYWA 3TXSA 1NA1A 2J1VA 2DVFA 5LEKA 1FKAO 4AF9A 4JI7B 4I4TB 2W52A 1ND2A 3FL7A 4L2NA 4PLOA 5FV3A 4WM8A 3RGBA 2J42A 2EICA 4HVRA 2QWPB 4A5UB 1NZCA 5KR7A 3ZN0A 4Y5TA 3JCIA 5F6LB 2NQYA 3ZSMA 1ENQA 3H1KH 3RYFB 1PIV1 4Y33A 2B39A 1RL3A 2GDFA 4I0WB 1YITV 4LPLA 4IEYA 2VMFA 2R073 3W20A 2W46A 4GB31 3UKNA 2EULA 3CJHA 4HNAB 1EYBA 2UWCA 2HEVF 5FJHA 4S2GA 1PNMA 1CJPA 1RUJ1 4HANA 3ETPA 2EAKA 1M57C 1PL0A 3CLPA 5F32A 2BSKB 1TME1 3Q9OA 2UWBA 5IK5A 5CFCA 3JBG2 4DV5O 1RYYA 1AR72 3H7JA 4UV8A 4X1IB 1ND3A 1ULEA 2JENA 2NPIA 4DR7O 1RXFA 2W9XA 1SS3A 2Q0AA 4BMEA 2YPJA 1A8MA 3C8XA 3RVYA 4AQ6A 2HLDG 3L70H 1SERA 1ODMA 3D3AA 4QKDA 4ISQA 1M4WA 2BVVA 3JUUA 3DECA 4BM8A 4PDWC 1GO3F 3AP9A 3UO2A 1NZIA 3K0GA 3K48A 4AEKA 1QJU1 3VHPA 2WO2A 4RS5B 3RZMA 1YJWV 4AHWA 4O4IB 1NE6A 1NU1H 3ILFA 1JOJA 1TVGA 1FAFA 1CAWB 3B94A 5IY5C 4JI4O 1LOFA 2AHZA 5B4NA 2WDBA 1U5XA 2A5ZA 3CX5F 1CR7A 2YHJA 1NA1B 1VP7A 3OUJA 3WF2A 4DR3O 1W8UA 4GH4B 1BVP1 2NMOA 2MEV3 5JPNB 1R081 1V6NA 4PI0A 4Z1MG 5CB7A 2CL2A 4BZ4A 1QQP3 4Q0QA 2WNOA 4Y26A 3WW1A 4DRVA 1RPOA 1SACA 3P6BA 1B3QA 5DPNA 5LW9A 1I5YA 2W3JA 3SH3A 3HN1A 2HWD3 1EZVH 2OX0A 3F5WC 5LEJA 4LKEA 4JGZB 1K3EA 4JI0O 5FTTC 2QQJA 5HV0A 3ZXKA 4LO4B 4DV1O 4LLOA 4PLMA 1NXD1 1H2MA 3W7XA 1Q7YW 2BSKA 4NIIA 5LK7B 2XQRA 1UU5A 3ETQA 2UUCO 1KS5A 4GCZA 1W59A 3VHRA 2GP3A 4HK9A 2ZKNA 5IATA 3KV4A 1FFXB 5T5JA 4NTYA 1GN4A 4IUGA 4B08A 1SZXA 2GAUA 2BERA 3LDRA 3ASNB 2OA2A 4IE5A 2JE9A 3ZFEB 3WT3A 1WLTA 2WJSA 2XHKA 1WCKA 4Y24A 2CTWA 3WQ0A 4OVEA 2PI4A 3ZN4A 4BQ3A 4KNCA 5HCBA 1IG0A 3T09A 2QR4A 1ENSA 5FY4A 4UV9A 4CP9A 5IVVA 5A7NA 3GNEA 2W68A 5FKCA 5TISZ 4BQ5A 2I07B 1PZ7A 1D4M3 1YO8A 3S7IA 3CCLV 1W9SA 1D0GA 3ZR6A 2VG9A 3UT5A 2LALA 3ZFFC 3ABLC 1G8MA 1S5HC 1RUE3 1FJGB 3FFQA 4GB32 2YV8A 3AVRA 4PA3A 1JHNA 3THOA 2FKXA 3APQA 2B42B 3TNQA 3UKVA 3O14A 1L7RA 1A78A 2GALA 2VOWA 3CZUA 3K77A 4YZ5A 2DYRB 5LXTB 1AL0G 3K0DA 2BGOA 4QPIB 1HLCA 3VBHB 2P37A 5JAXA 4LBQA 3LSEA 1MR5A 4NMIA 1AR5A 4BQYA 5GLWA 4DV4B 4GKYA 1ZM1A 2YBPA 4FXKB 3EVKA 1ZBA2 3SJCC 4GYCB 4AXOA 4TOIA 1H1IA 4UFJA 3LDBA 1UY2A 3UJQA 3UGFA 1QMJA 1XSQA 4TN7A 4AWDA 1BBT1 5FK7A 2RM21 2E6VA 2QQIA 4CP1A 1BHGA 2ITDC 4OZOA 2CAUA 4P5YA 1U5ZA 5KXEA 2W94A 4UFMA 4C8DA 1S0IA 3ZN5A 2B4KA 2OT7A 2BRTA 1ZA4A 3ZPYA 1Q43A 3LDDA 1CD3G 2RDQA 4CYDA 1NCRA 1NKGA 1Y74B 5A3OA 4LMFA 2PHDA 3WDWA 4J7JA 1KQSU 4AL9A 3F7YC 4KU7A 3R66A 4TQFA 1OC1A 3WW4A 3FBYA 1TAEA 4QKFA 1YZBA 5ACA3 2ZXWB 4O7XA 3LE0A 3ZKYA 2FMYA 3HWJA 1MS3A 3PDQA 3Q8FA 2OZJA 5FZ0A 4FM1A 4WCEV 2VULA 5E79Z 1W0OA 1VAMA 4MXWB 1I94O 1Q8SA 3MIDA 3M2MA 2ZHNA 4JYAB 4O2AB 3TEWA 3S0MA 4WM8C 2FHRA 4CDUC 5CIRA 3KLSA 3RZHA 3ZX7A 2F17A 2NP0A 2Z69A 1AR82 4JI5O 2XJPA 4C0HA 4LCUC 5I0TA 4AFMA 1H2GA 3OCPA 3B3QE 4X1KB 1AZDA 1UZYA 3CRQA 3EYPA 1OH3A 1GLHA 5FDBA 2ZAAA 1N33B 2N04A 1VMFA 1JZ6A 4WVZA 4LORA 4CXYA 4XURA 5B4XA 3W7TA 2IU3A 4QX5A 1UPIA 5LHIA 3APBA 3AK1A 5LA1A 3NR7A 4P9OA 4JF3A 3T30A 4ZONA 1QH7A 3GZEA 4PDWA 3LNNA 2WN2A 4W4LA 1YVWA 4O4HB 4JDMA 2DWRA 4RA0A 1R093 4RN5A 3AB0A 1AR81 3I2JA 1HDJA 4CCOA 1GUIA 1ZX3A 3MHZA 3H1JH 3BN6A 4UBHA 2HWB1 3EBRA 1M5IA 1F51A 3RYIB 3ZXDA 4AI0A 2CGPA 3JAMN 3RSJA 3SPIA 1ZRRA 3EHBB 2QKAA 3W7WA 1G9DA 3T1MA 3B9CA 4HPKB 4A4AA 2QWOB 2PHRA 2IM9A 2BVBA 3E83A 1S0JA 4BR6A 1RUH2 1S0EA 1MQTA 3RWNA 5LATA 4H14A 1LOBA 3ZPOA 3A2FA 3I97A 4FLWA 1PMIA 1UOJA 4I01A 1B04A 4AEDB 1W8HA 1J84A 5E1AC 4QDQA 5EIBC 3CXHF 1YF2A 2D6KA 1ODNA 3SPHA 2NMNA 2H0BA 5HXMA 3C3SA 4PV1B 3ZMUA 4JHTA 3FB5C 5JXIA 5DUWA 3AMHA 3F7VC 1PV0A 2QCSB 1CXZB 5FO7B 2PA7A 1HQLA 2LM3A 1WUVA 4Q5OA 4TSVA 3H42B 4JTOA 4LFAO 5A1AA 4XQWA 4EWAA 4H33A 4AAXA 1POQA 4NPLA 2Z5WA 1QDCA 3B69A 1VP6A 1ZZ9A 4JAVA 4M3CE 1MZEA 1XYPA 1DF4A 4FP3A 3RQ0A 4YZ2A 3W5MA 4MGKE 3AL6A 3POYA 3JCZA 2OQ7A 1IURA 3R65A 4WBBA 2ZE8A 4LXLA 3AG4B 4QX0A 5A3UA 3ZR5A 4P9JA 4YW2A 3N9MA 4TYSA 2QM4A 1GZ9A 1J3PA 1WMFA 2VNRA 3D5OA 4JAUA 1M57B 1NTKH 1L8DA 3GZAA 2GUZA 2P06A 3H8RA 4PA6A 4UCSA 4XFCA 1XYOA 2B5UA 1HDKA 3OPTA 4MUVA 4V1PA 4KMQA 2QWRB 4O4JA 1NLQA 4ZKTB 4CXXA 3HNBM 5LA6B 2A3WA 4P9YA 5FYCA 2QQWA 5KXDA 2QWNB 3MDSA 3HMYA 2LFRA 3PIJA 3P32A 4XPVA 5DZFA 2EJRA 2RS11 4AHYA 1QJX2 3I2HA 2B5HA 3DPRC 3T0AA 4Y22B 4LBKA 1XDCA 2JKXA 3PHMA 3NNMA 3CC2V 5CFDC 2DJVA 2P1BA 3OBZA 4JI3B 1I3HA 4LF7B 4Y20B 3J80N 1ZYBA 5T3NA 4Q27A 2LW7A 4JYAO 1Q3EA 4MADA 4R4ZA 1TMF3 3D6EA 2YXYA 5J36A 3ZCCA 5LASA 2IJIA 4P5HA 4U36A 2D3OW 2DU0A 3KCXA 1DLLA 3NAPA 2P4KA 1YFXA 4AEMA 1JS9A 5A33A 5LYJA 5D8AB 4QPWA 4XFAA 3I2IA 3VHOA 3V0BA 3FB7C 4JI4B 2JIZG 5B1NA 1OCOB 2ERFA 4K1YA 2QTOA 4AHZA 2A6XA 3AMPA 1YIJV 1XOYA 4B7KA 3WOGA 4OPHA 5EBWC 4BWOA 1Q6UA 3HR0A 1V9PA 3HNYM 4ZU4A 5JCTA 4MG2A 1AR93 4CH5A 3K5LA 1SZTA 3POBA 4C0BA 1YHFA 5FZAA 3NNLA 3X2QC 1N3PA 2UXCO 3PJYA 3D4KA 1IGOA 5FNVB 2HBUA 2IVJA 3OMIB 3LDEA 4AI9A 2BOJA 1PD3A 5LWBA 3LWCA 2VTXJ 3EJKA 4CDXC 2Y64A 5ERLA 3WINE 3AFGA 3B5LB 5FP8A 3WUCA 1GN3A 4CDUA 5FUPA 1TVKA 4N53A 5DAXA 2A3XA 1W2AX 4U3JA 4LULA 1AYN1 1OPOA 2JRIA 3ZJZA 2XPJA 3CWBH 4OHWA 4A6OA 5BXXA 3QVNA 4URAA 5L73A 5FAXA 2IH1C 5A7PA 4GWNA 1H9PA 4R9AA 4D6SA 2YS8A 4NKGB 3WF1A 3STLC 1W0PA 3E8FA 1AI6A 5EZWA 1Y4MA 3E6DA 4U3FH 1RUF2 2LW1A 4XJ9A 2VECA 5C70A 4E2LA 1LENA 3VBRC 4DRXA 4QE9A 3BCWA 5EHDA 1MS9A 5J2TB 1DDLA 5IYBO 5BY1A 1PX3A 3CJHB 2E5LO 3RBZA 3ZFFB 1UX7A 2GTAA 3ABLB 1OSGA 2HWE3 2ZGTA 4DR1O 4JTDB 4XAEA 1RHI2 2LRPA 4OUMA 5BYNA 4D94A 3V0BB 5I0SA 2JE7A 4AVSA 4YW4A 4X89A 3ZO0B 4QPGA 2D40A 1YFUA 2MW2B 4LF5B 2PAKA 1C8M3 3OTOO 3OE7G 2VW2A 3EFFK 3VKLA 4ASLA 4IV1B 2ZS6B 1OF3A 3UYJA 2C4XA 1PVC3 1UMIA 1F4HA 3I59B 2QE3A 3M4FA 2F4LA 4QHBA 4EQVA 1QOOA 3ZDVA 1ORQC 1Y9QA 4J41A 4IDZA 1R64A 1UMHA 4AVTA 2R32A 2Y26A 2ADDA 3SH5A 2GTSA 4KXRA 1YWKA 3HN3A 3WNMA 4PIXA 4AI2A 1W6PB 3LOIA 4CP2A 4HZFA 1NY72 4KBBA 1O3RA 4B3TB 1Y76A 1S77D 2KG7A 3WNLA 1RTVA 2JE8A 3I2GA 2C0ZA 4CH6A 4BW5A 1GV9A 3SQOA 5J96B 3VBOB 1F35A 3D3IA 3NWKA 3BA9A 2VMGA 4AR2A 1HB2A 3CCQV 3MFAA 4X1YA 3MF6A 1O4TA 4QPKA 3S5AA 4Q20A 4FTSA 1L3JA 3NRUA 4MXVA 1YJKA 3WQBA 3H3UA 3A0RA 1B06A 5F3IA 4X88A 1C8NA 2JIJA 3JD0A 3HQRA 2NZ9A 4Q0SA 3PURA 3TEXA 2F1MA 3ACHA 4LK7A 3K58A 4LF7O 2YYOA 3AG7A 1ZRFA 1CIWA 2QQUA 4CU6A 4Z07A 4XBNA 2NLRA 3I59A 4X8PA 1OD5A 1JR9A 3WP5A 4RSUA 2PN5A 1EUTA 4MHUA 5DAVA 3FB8C 2VS0A 2DTWA 1N3OA 3ICXA 3HAGA 2RM22 4GWMA 3B77A 5FPOA 5J1XA 4KWKA 5JJJB 1JZ2A 2YUEA 3USSA 1WCDJ 2V72A 2EX3A 1TME3 4IL6Z 2MNGA 1MQTC 4BQ2A 3MPBA 3W21A 4MGTA 1P4RA 5E6HA 1QJY2 3U0ZA 1MEC1 3DPRA 5EIYB 2FB5A 4NTWA 1LGCA 1PM7A 1O9GA 5LBEA 1X50A 3T3YA 4N9IA 3RYRA 1AR71 2J1EA 1CX4A 1EM1A 1LNSA 4NUBA 5T5OA 1UOBA 5K0UB 1RHI1 3U07A 2EIBA 4TTGA 1WBFA 2WLKA 2VZUA 2UWAA 1KFUL 1Y9MA 4PA7A 4MOAA 4CPBA 4C1WA 2R9IA 1MOFA 4OCTA 5KA6A 4OQ8A 3LAGA 1N33O 3EQEA 5L7OB 5LA2A 4GA9A 2OS2A 2P90A 4XAAA 2C9KA 3FLTA 4FFHA 1X4TA 1OA2A 4JRAA 4CZZA 3ZYHA 3ABMB 4PJ0Z 2V4AA 4I50A 2V73A 3KT7A 1NA1C 2W1SA 3HT2A 1FXZA 1HXS3 4P00B 2OPWA 5FZLA 4FVVA 1SFYA 4XC9A 3VOUA 5FZ8A 5FYSA 2VZTA 4BYYA 2ZHLA 1OZ0A 4CS2A 1SFNA 3N9OA 4DUYB 1VQLV 2Q8EA 1WGPA 2G19A 4FPJA 2XL7A 4QQHA 1JYXA 5FWJA 1I08A 1K97A 4LO6B 1VBD3 2E74B 2ZMNA 2WABA 2Y38A 2P7TC 3ELNA 4IL7A 4LWSB 4COWA 3TEZA 2IXLA 4JI2O 3Q8AA 2ZM6O 3WP6A 2B8MA 2FBEA 4ORFA 2WZR1 1ND3C 1TUBA 1N0NA 5H5NA 4DR7B 4I02A 1Q8OA 4Q2FA 2VUDA 3GZTB 1B6QA 2FZ2A 4HONA 3SCGA 4YSFA 1RUC1 5DMYA 4PF5A 3L2HA 4QB6A 3ZFEC 5FCCA 2C2AA 4DR4O 5J48A 5CB4B 1SQFA 4DV6B 3T2QA 1M1KW 4R8HA 4LR4A 1VEWA 4UCOA 2RMU3 1IG3A 4B3RO 5FPUA 4NXNO 4NPMA 2OTLV 4WM7C 3EXUA 1PNFA 4F6RB 1Q6HA 2Y33A 3HVDA 3POFA 4I50B 2GC2A 4ATFA 2UUBB 3K5OA 1VPHA 2ZX0A 1AJPA 1MZ6A 5FUIA 1X33A 1V0AA 1UYZA 3AG1B 1BK0A 3B4SA 1OF4A 2OTJV 5KC6A 1M56C 3FC0A 4PDWB 4GWJA 4HKWA 1K5QA 4P9XA 4NIHA 1CAWA 3J9SA 3WXPA 5F2WA 5CA0A 2DYRC 2JJ2G 3W7UA 3O1RA 2GC0A 2C6SA 1K92A 3KV6A 2EIEA 1QDOA 2PHLA 3G80A 1V6IA 1IPKA 1EN5A 3WV6A 3ZLIA 3CCJV 1RUD3 5B5EZ 1GMMA 3MIHA 4OQ9A 4XMAA 4JDNA 3SDLA 1BHAA 4IV3B 2XR4A 4AK3A 4NHLA 1YIFA 1HR0B 1JMUB 4HPKA 4J6GA 5CADA 4QAWA 1JZ3A 4KWLA 4YVSA 1M9NA 4JGZA 1AYN2 3AP7A 1OCOC 4M4PA 5B66Z 3SPCA 1VMJA 4BK4A 4PLNA 2PAMA 1AI4A 4G27B 3CBNA 4N90A 3VLBB 3OF1A 3WR0A 4FPKA 1XNRB 5CB4A 4LF4B 4URTA 4K3AA 1VBE1 4OLLA 4E4ZA 4W8JA 3LF7A 2LP7A 5C9AB 3X2QB 3E6BA 1R1BA 4OI0A 1KB9F 3FD9A 4OYUA 2HH9A 4G3YC 4EZ4A 5FZHA 2EXIA 1S72V 4EE2A 4GXLA 2VZPA 1W2TA 3CD6V 4CEWA 4FLUA 3PMEA 2DFBA 3THTA 1AVMA 5DECA 2A3QA 2DUOA 5C5TA 4XCAA 2VRZA 3CMEV 2X53S 2VQUA 1KKDA 5L9BA 4IEOA 1TEIA 4OZXA 2HEWF 4CP9B 1DCSA 1QH6A 1P8JA 3DYMA 3LDCA 4QB2A 2ZGRA 2Y6JA 2BTOA 3E8HA 2YIBD 2VW0A 4YGCA 5BR8B 4LT5A 4AFCA 2WO7A 3ENRA 1SLLA 1ZWIC 2QSAA 4OHVA 2ZGLA 2WLNA 3OGRA 4LKDA 2R043 4TSFG 2G9FA 2WBKA 1PZ8A 4OHXA 2WLPA 2UURA 1ZREA 4K20A 2GUZB 1Y9GA 2VQ0A 4UYBA 3AK3A 5JIUA 1AXKA 3D36C 3SKJE 3DEMA 2QQVA 4YVSB 1BQZA 2WZPP 2QQOA 5KLVH 1ASJ2 1WNSA 1OT5A 1A3KA 2VUJA 3VBHA 3KT4A 1PIV3 4TT3G 2G9ZA 4L8QA 4COZA 2XL9A 2Y34A 2AREA 4W4ZA 1EZJA 1H8HG 2PELA 2R0FA 2XBO1 3USUB 2VUCA 4CDWB 2D7FA 4FZ0A 3MEPA 4FO9A 1KFXL 4DO2A 4LE3A 3ZIXA 5FMCA 1H6YA 5JI7A 2PLV1 2RR13 2Z3YA 4AFBA 1NY71 1RVF2 2CSGA 2J1TA 3MD0A 3FFZA 1QKQA 2QQPA 4CUBA 5L3EA 2VNOA 1NBMG 2R7EB 1FNYA 4L8JA 4RHV1 5CG8A 3SYAA 2A9HA 4NTXA 3AYDA 1ULPA 4HMZA 3AYCA 4K40A 3PN1A 2CWMA 4Y1VA 2RMU2 5F7UA 4AEDC 2WA4A 1F31A 5APAA 4L87A 3X29B 1O3QA 2XLFA 3LZZA 4MXWA 2JGDA 2VQFO 3M8LA 5FZOB 5FNVA 1GZTA 1ZBE3 4O2AA 2OPKA 2YGLA 4MVMA 2DVGA 4MVZA 1AYN3 1PMJX 1DYKA 1BZKA 2HKXA 5FLIA 2TUNA 4LR3A 5F5AA 1JUIA 1VBE2 2BTQA 5IT9N 3H1WA 4QD2A 4CDUB 5IVCA 4BQ4A 1SFPA 5IUQA 1FS0G 1IHMA 4QGMA 1SHWB 4B3TO 5A70A 5FPRA 5H9PA 4JGSA 1VBE3 1S76D 3FMGA 4NROA 2LJ2A 4I55A 2ZX3A 4HAMA 4HETA 3N27A 3BEHA 5DM6V 1S5JA 3ZHVA 1OPMA 2W87A 5KBFA 1IXBA 1E1RG 1LGBA 3BRCA 1JYIA 1R1ZA 4WVMA 1VF5B 4E4SA 1CZTA 1PGW1 5J2TA 4CSWA 3O1OA 3WDTA 3TNPB 4DV5B 3IKWA 1BMV2 1XMOO 1WA8A 2CTQA 2RN9A 1W2UA 4NWWA 1DFQA 4X65O 2ZEYA 2AEZA 3ACGA 1QXRA 2TBVA 3TK1A 3VN4A 5GZGA 4IE6A 3HJRA 3LEGA 2FDGA 2VCBA 4BMBA 1UCXA 3PTYA 2CH7A 2C1FA 1LJ7A 2W92A 3PUHA 4GAZA 3K5MA 1CAVA 4IV1A 2CGNA 3MLKA 1YHQV 3PMSA 5CFDB 4F6EA 3C90A 2BFUL 2O14A 2R72A 2CE4A 1B35C 4ZIBA 3GXUA 5T52A 1B09A 3IIAA 2BW8A 5FZEA 3E89A 3G6JB 2WIIB 3T4VA 5LMUB 2HEYF 1RSOA 2BE3A 3WDUA 5B1OA 1W0KG 5FP3A 1HRV3 3LOBA 3IAYA 4FOQA 5FWEA 2PF4E 4NO4A 1NTZH 2JEUA 2JJ1G 2Q67A 4LITA 1EUUA 3VBOA 4CC5A 1TNFA 1SESA 3OMNB 1R1A1 5E8AA 3BTAA 1GNHA 3PVBB 2JS5A 4QMAA 1GN2A 3POSA 4PJYA 3JD72 4UB8Z 5B1AC 3JZVA 1SEFA 3GYDA 3BABA 3VGIA 4LHNA 3INAA 4D7SA 2CK3G 4CEYC 5FUNA 4FPLA 1H38A 1WA8B 2UXDO 4M3CA 4X64B 1HB4A 3B7MA 3NQHA 3DN7A 1UNBA 3AP4A 4QKBA 5GTIZ 1SQBH 2P22C 5JLVA 5FO8B 4I9WA 4FOWA 3OEEG 1RHI3 3AG4C 4N43A 5ABJB 4LK6A 4QX1A 1RGSA 3WNXA 4DRRA 1TZOA 4G28B 2JECA 1GQGA 3FBMA 4WVVA 3BTXA 3V56A 1D0HA 1NLSA 3SCFA 5CFDA 4BIUA 5GW7A 4IE0A 5JR2A 4MVRA 3SNMA 1UIKA 2HWC1 4YHHB 1FYJA 1R73A 1DTOA 4WBNA 5LB6A 1NVPD 3FYEB 4OMDA 2IJKA 4DPNA 3ZYBA 5I0RA 1NQTA 3NAPC 5LK5A 4E27A 4Y4YA 2PLV3 3ZRVA 4JI2B 2I45A 2R061 2RE9A 3VBUB 2IH3C 4W6YA 3IDAA 5A1FA 1T2XA 5CBFA 2YZ4A 1PK6A 5FOBB 1AXYA 3DPRB 5K7PA 5J2UA 1NCQB 4HK8A 3RYHB 4KWUA 3ZXFA 1JODA 1OV9A 2A6VA 3SXWA 5FLJA 3H1IH 1C5HA 3JBG1 1SPPB 3ZHRA 1G8WA 2UU9O 4LA2A 4CUAA 3BY6A 3KF3A 4BDVB 5DAWA 1MPXA 1Q82W 1V6LA 2KSDA 3FHAA 3BVCA 4CEWC 1TME2 3H8UA 2E76B 2HBTA 3ZBHA 1NCRC 4OUEA 4XFIA 2PHFA 3O1TA 3J7HA 4N53C 2XGXA 4IEQA 2WFPA 4AGVA 3HKCB 4TLGA 2W1UA 2Z79A 1V55B 4RQPC 5LGNA 5D5PA 4BXFA 3ZYIB 4EV0A 2CHHA 3AZYA 3MZHA 4W50A 5AC91 2OIGA 4WZFA 2ZKOA 4HVQA 1UF2C 2A0LA 4UFHA 1QWRA 5FY1A 5C8CA 1SRYA 4NHXA 3KMHA 4UCUA 5EQUA 1JJ2U 1GTOA 3VBOC 2WINB 1AR1B 4UCVA 4M3CF 1V70A 4HKLA 1T6GC 1LULA 1T5EA 4RR3B 4XFHA 2GN7A 3VZOA 3I2FA 2VXJA 3VD4A 1ENRA 2UXBB 2BNMA 3I2KA 3MIEA 3AK0A 4IHJA 4EWEA 3RI9A 2BDRA 2AUYA 3WZ1A 1AILA 3HKEB 1QLEC 3VUOA 1Y7BA 5FQ0A 4BA6A 1I1EA 4AQYB 2XUEA 4DRXB 4E4HA 3AJYA 1GM7A 3ABKC 3IDCB 2ETNA 3CXCU 4FSJA 3HD8B 4L11A 1JYCA 4I0AA 3L74H 1F23A 1LOCA 1OH4A 2PQQA 4GMP1 2DDUA 4N43C 2FDFA 2M6YA 2VMIA 3OY8A 1F4AA 2Y48A 2ZT9B 5FYBA 1AYM1 2N74A 3C3VA 3O9OA 4P9IA 1TMF1 3WQ7A 1GP4A 4XIKA 3AEIA 2MEV2 4LO8A 5CNAA 1K73W 2ADQB 3E8BA 2P4EA 2HWE2 4EEQA 2H94A 4I30A 4KGGA 2WL1A 3POGA 1KXGA 5JH7B 3OR7C 1H4HA 1PVXA 5DG2A 3I8TA 2E51A 4DMIA 1AX1A 2WNVB 2O8OA 1DYPA 2VH9A 4BPZA 3FN9A 4B4QA 1IZ3A 4B3MO 3NW4A 2EIMC 1US3A 2QKSA 1WW4A 3SEEA 3KCCA 4PT6A 1A8DA 3T0DA 2Q8OA 2X6BA 3C7GA 3OGSA 4HKOA 1BLZA 3GJBA 5JVDB 2M7WA 1VRH1 2DQ0A 4K8RB 1MEC2 1E5HA 2KG7B 1CIYA 1YDXA 1OCZB 1U96A 2F4VB 1NOVA 2A71A 4N7UA 1GSLA 2EXKA 5BY5A 4NR1A 2AHYA 4BQ1A 3DUIA 3F5TA 3BTZA 2DBIA 4HNAA 2HJIA 2WLHA 3NKTA 5EYPA 1OOPB 3UV9A 1UOFA 4L99A 3N35A 4Z92B 4XFGA 1BMFG 1VBD1 1S2EA 4FFIA 1GNYA 1FXKB 3OR6C 1DP0A 1DQ1A 4Q4X2 5FO9B 2HYKA 5BNQA 3SH4A 5BZBA 5IDJA 3E5QA 1FFTB 4CEYA 4FCAA 1R1A3 2QEXV 1N1TA 4DXWA 2CUGA 4MT8A 4COVA 2IVIB 5E16A 4AVCA 3I2OA 2X5IB 2W1WA 3AVSA 4H7MA 2WAOA 2ZMKA 3WNKA 3CCMV 3CEIA 3J7AU 5GZEA 1UO9A 5D2AA 3BOPA 3GHNA 1CPYA 2VOTA 3G7DA 2XAJA 5JOWA 5FZ1A 2ZKLA 4PQ9A 4D6TH 5LRRA 2Z4FA 3NV2A 1FYUA 1PVC2 3KVAA 4QXKA 5B1BC 1W2OA 1PO11 3ZXEA 5H2FZ 1JW6A 5EJ3A 1V54C 4AQTA 1I5XA 5DDJ3 4NRMA 4AVVA 1VIBA 1JMKC 3GBWA 2W2IA 4F8AA 1MVQA 4CCEA 2BV4A 3D8CA 1DGWA 4P02B 5I93A 3K9SA 2EIKC 1KP3A 1MQTB 3WP3A 1LHVA 3QBQA 3K3NA 2PYLA 3TN92 2ZM6B 3GCXA 4BH9A 2RMU1 4F3JA 2CAZC 3M7AA 5CA1B 2YXLA 2EXJA 2H6CA 1P7BA 5FMDA 2DURA 4MGZE 4DXTA 2WPDG 1SETA 4OHZA 2CTVA 4HN0A 4MVQA 3USUA 2DV9A 4CDWA 1ALYA 3Q8BA 2ZACA 1N32O 4Q29A 1WCQA 3AG3B 4GZ9A 1VQ5V 3IC9A 1OCRB 3CU7A 3ZRWB 1COV2 1FMD3 4A42A 1RUI1 3MI8A 4AQSA 2YIDA 4FLYA 1J1LA 1FT9A 1S1AA 1CZVA 1TGOA 1VIWB 3ZRSA 3E5UA 2VMHA 4DW0A 2H8PC 1QJY3 3IBMA 4UUJC 2W91A 4Z2AA 1LEDA 5FZBA 2Q4SA 1QR8A 3ZMZA 4DV7B 2MHFA 1C5IA 3KSCA 1A6CA 3KF5A 4LWSA 1YQCA 1W03A 2DU1A 4FPFA 3VL9A 3CKHA 2CDYA 2VWJA 2XONA 2XJQA 3MHSC 2ITCC 1VF7A 4LBLA 1DQ5A 5A7QA 3ZFGA 5FPZA 4Y5SA 5GTHZ 5FREA 2VNVA 2F43G 5JWPA 1H6XA 2WFF2 4W65A 5CA6A 4K9SA 5GLVA 4NXNB 5LGUA 1URFA 3MUY1 2CU5A 3ETGA 3JD4A 5LA6A 4GIQA 4RHV3 1W99A 5IVEA 4QQ2A 1SA0A 2E33A 5CA1A 4DK1A 3D0SA 2Q1FA 4MLOA 2BBVA 5BNOC 1BYHA 4DR5O 1R091 2IBZH 2P4VA 3ABKB 3WG2A 1V00A 5IVBA 3K79A 1KYOF 2DUPA 3SGIA 3JARA 1BCCH 1RJ7A 3NL1A 3UJOA 3TAYA 1SDWA 1ZBE2 1LESA 5JSOA 3MBWA 1EN4A 5J09A 2UXXA 5EC2C 1Y74A 1JCHA 1KITA 1AR62 1LU2A 1KMIZ 5IK4A 3NAPB 3TBDA 1K4DC 4YHHO 1CONA 5JXHA 1W90A 3N9NA 5BMVA 1K7DA 4L0PA 4YVSC 4JGZC 4YFZA 4JYBA 1DQ6A 3DXUA 3JD73 5LOVB 2EJ7A 3PUAA 4CU9A 2WAMA 5C3SA 1XNTA 2WNVC 5JDBA 1QLNA 3LSDA 2WQ4A 1QIQA 5FY5A 1QEXA 3A22A 1LCLA 1IS3A 3IN9A 1JOPA 3ZDSA 1QR9A 1IBLB 4A44A 5BR8O 3B8MA 3GM8A 5ITZB 4YJ2A 1SQGA 4KQ7A 2WAAA 1UYPA 4OFGA 2VOVA 5H6QA 1H9WA 5F2SA 1CESA 5M0TA 1FV2A 3L75H 2BGCA 3IZOA 4XUNA 5LGTA 4S2DA 1Z5VA 3ECQA 2VMDA 2YC0A 5LBQA 3C3TA 3U10A 1RUI2 1VBB1 1EPZA 4HBNA 1O9HA 2XT9A 3H1YA 1WAZA 2XBO2 3N2GB 5T5PA 3PU3A 3JARB 4NJ4A 1XQNA 3TCUA 3RPQA 5E89A 1WA6X 4ZZ8A 1DG6A 3CHXA 1QJFA 2I74A 2PLV2 4YJ3A 5HFMA 1ULDA 3MLLA 3RYPA 3JB4C 5EV7A 3WNPA 1DGWX 4F7ZA 2WLLB 1AR92 5AFEA 2B45X 1GFF2 1AJOA 4AEJA 5A6ZA 5FZ7A 2E32A 4IEUA 4YG6A 1QJX3 4JQTA 2ZE6A 4YYOA 2KB1A 3RYIA 1VQ7V 5AVPA 1NT2B 1SKVA 2FL4A 3VBHC 5FR3A 2UXBO 1DQ4A 2JDIG 5I8SA 4H55A 4PA4A 5F3EA 3WY6A 4ZOLA 1DF0A 4R9BA 1QJZA 2Q8CA 1TMF2 3M3IA 2WNUC 1LOFC 3J4UH 2AW9A 1GAXA 4OI2A 4NHMA 2KXLA 1VR3A 4DUXA 4M4RA 4DW1A 1Q86W 2H6BA 3RZGA 4WBNB 1UPSA 4Q4Y1 1N1YA 5JJNB 4IQPA 2CWSA 5FJKA 5JXJA 4BU2A 1ZAUA 3D3QA 1AL22 1FPN3 4UFZA 4MZUA 3IPVA 1SDDB 1HNZB 3K2OA 2OQ6A 2Q7EA 2PXJA 3VBUA 3BB6A 4FM2A 1V9U3 3FYIB 2X29A 1WWYA 2EBOA 5EJZB 4GKKO 3ACLA 3U4SA 4YM1A 3ZYFA 3MGUA 2WLQA 1ST8A 4R52A 4HFSA 1C1FA 4EZHA 3I55V 2JIGA 2HWF1 2R9AA 2E7AA 4EN7B 3RMYA 4R4XA 2SBAA 4E2SA 4JDOA 4CCLA 1NT0A 4N21A 1RITA 2R0HA 1W39A 2VM9A 3VQVA 4JTCB 3TRSB 1OCRC 3T1HB 1EBOA 4QGPA 4CBCA 1ND2B 4ES9A 4FBFA 3ZMOA 1AX2A 5K1XA 1WKYA 3NV4A 3ZSKA 2A73B 2WLJA 4JI6O 5LHHA 1AXZA 2RMKB 5KMGA 4BAYA 1GKBA 1RFYA 3HKCA 2VQAA 3OOXA 1HIXA 1DLCA 2Y6LA 1MVEA 3HQXA 2X0LA 1GH6A 1IPJA 4BK5A 3ZM8A 1C8M2 1POV3 3GF6A 3L71H 4LHLA 4UW6A 3NV1A 3ZFGC 3AMQA 3QO5A 5IJRA 4JI3O 2DN9A 4YARA 4X20A 4DIQA 1UJWB 2ZGMA 4E8CA 3SKVA 4JZ2A 3UQ8A 5BV6A 2W39A 2MEV1 4D3WA 4EROA 1BEV1 1JBCA 2Q6AA 1LODA 4PA9A 3IPVB 4JPRA 4NVPA 5DQ0A 4AGGA 4D8MA 1NLRA 1LNQA 4QPIC 4H3WA 5SV8A 2LGWA 3HR9A 3ZYRA 4XUQA 5BUVA 3NVCA 4FOVA 3W9AA 4LF9B 2E75B 1YI7A 3N2KB 5EYXA 2HJDA 1GK9A 4Q0VA 5FRAA 1CGPA 4O4IA 1OMIA 5JI9A 2DE0X 2ZR2A 4FFKA 4FPCA 2PHWA 2XJSA 1CQ9A 3I3EA 3ITQA 4KUMA 4MYEA 5ISLA 1UKGA 4K35A 4XDJA 2QA4V 3KT1A 3VBFB 1J59A 4X1IA 2GP5A 2R6QA 4IEWA 4PI2A 1WPXA 3TB0A 3KG2A 2ZHMA 1B35A 2JVDA 3P1IA 1H30A 2JG8B 2ZGNA 4WVWA 2VL4A 4MVOA 3LNMB 1MEC3 1BEV2 2YROA 4DK0A 4DUWA 1VRH3 1E5RA 3MO4A 1YI2V 5C33A 4RHV2 3K04A 3LGRA 1GQHA 3MW4A 2HWC2 1J1TA 4YGBA 2ZHKA 5DAQA 3VBUC 2DYSB 1AJNA 3JU9A 2VWKA 3IWZA 1QJU3 2MPFA 2KQXA 2HVKC 1RVF1 1HB3A 2FCUA 5FOJB 3TXQA 5IJ0B 2WRAA 5FMOS 2CV6A 4OPAA 3CO2A 1VQNV 1QJY1 2G38A 2QKDA 2E5LB 2EIDA 2DTYA 1UAIA 2EZPA 1U0AA 2R1DA 1W6QB 2WFF1 3A8TA 2QTWB 1NVPB 1AL23 2YG0A 3I3QA 1TUBB 2OIEA 3A21A 1CAXA 3VZKA 4AVAA 1LU1A 1BVVA 1N47A 2P6HA 2A6WA 3WB1A 2ZX2A 1K9MW 2WT0A 3PUIA 2Y69C 4JKMA 2R1BA 2J1SA 2VCMA 2UYBA 2HWF2 1O3SA 1US2A 4XJ8A 1SLAA 3M3EA 4WFEA 4KH9A 5JZGC 1WLWA 1HNXO 3RJ2X 2D6MA 1SBDA 3JAWA 4CDXA 2RS31 5FY7A 4QDSA 2E7TA 1CPMA 5L3CA 3LEKA 2VD7A 1K5MB 1SLCA 3SJAC 3N9QA 1RUJ2 1ZX5A 3KVBA 1MABG 5LHGA 1VQ6V 4QQLA 2X5IA 4F6RA 1C57A 3ZOIA 1O8PA 4HSJA 2V1DA 3WF3A 5GJ6A 2GDSA 4J1WA 5FKBA 5LXTA 4QE7A 4QPIA 5A7OA 4UB6Z 1PNGA 3O1VA 4ASUG 3CP1A 3JASB 3O5SA 3NMBA 1PX4A 5ABJC 1D2QA 5IJ0A 5KUMA 2OWOA 1PM4A 4X6RB 1Y43B 1BGYH 5CA0B 4W6WA 3KKYA 3RYCB 1Z78A 1OUXA 2FDKA 4J11A 2YUAA 1PM9A 2VGDA 5FY8A 3R4UA 5FMBA 5BNPA 2WZR2 3D36A 4UW4A 1Y76B 1WD3A 2UY9A 3AZWA 4GULA 1DZRA 3WNOA 1R6TA 3BKZA 2V5YA 3C7HA 4WFGA 1PK6B 5GZDA 2JWPA 1IS5A 2RVAA 1QGLA 4K7JA 4ZBMA 4FLTA 3T2OA 4IV3A 1APNA 1K42A 2XG3A 4Q4W2 2QQMA 2HG5C 1S3JA 3AMMA 5FYIA 2SLIA 4J25A 4TWKA 3ZYPA 4YVWB 3MUZ1 4FVMA 4ZU7A 2WFF3 3AX4A 5IVYA 1YQ8A 3RYKA 4C7UA 4LQRA 2XWJB 3LKJA 3OUHA 4JYYA 4RGAA 5KWRA 4OI4A 1QHTA 1WMEA 1PO22 1JQ0A 2HLEA 1UXZA 3DKQA 4XF0A 1PVC1 3N9PA 1UIJA 1TNRA 2QE7G 3ST7A 5E1RA 3FWEA 3IJ4A 2XHNA 3TETA 1CN1A 3VD9A 3JATA 4ASMB 4IESA 1NS1A 1W8ZA 1L1FA 3TEYA 2VW1A 1UL9A 2VQEO 3NSTA 1G9CA 4OX9O 2WWSA 4FFBA 5A7WB 1NCRB 1YFYA 2HWE1 1YNAA 3POEA 3STZC 2RJZA 5CN0A 4V2VA 1VQKV 1AF9A 2VMEA 3RFRA 3BCCH 4P08A 3QTCA 3QO7A 4O2BB 1VBC1 1V55C 1QNYA 1OBNA 3P5BA 4AAPA 5J3UA 1V9U2 3FJSA 3CB2A 2E63A 5CFCC 1ZL8A 2WNUA 5KA5A 4Q0UA 3T4DA 5DABA 1AI7A 4XUOA 2RS51 1L0NH 2W1QA 1PPJH 3OB8A 4JI1O 2R063 2KKWA 3OEBA 1DZQA 2HWD2 2ZINA 2DVDA 3WG1A 2A6YA 3VDDC 4IGOA 2XAFA 2XAHA 1FPN1 4AI8A 3N7MA 4O4HA 5K0UA 3AXEA 3WG7C 5JMCA 4WFAV 3K3WA 4XXPA 1QU0A 1AR4A 3KV9A 4NE9A 5L3GA 1SA0B 2ATFA 2YI8A 2BNOA 5DN6G 3LIGA 1GR3A 3ASOB 5FPLA 2Q5ZA 2LROA 1RMU1 1DLBA 3ATGA 3ZRXA 2O1QA 3LEMA 3VZMA 1WB8A 5C3QA 1W6OA 4LC1A 1VBA1 2QDOA 4IGQA 5A3LA 3PVNA 4FAGA 2Y60A 2KD7A 1ENXA 1LTEA 4LHSA 1YFWA 4DUYO 3ORJA 3QH6A 2OCCC 1U5IA 1EFRG 4LKSA 1W3VA 1AP5A 5JH7A 1G9AA 1VBC3 4P9LA 4UXNA 4ZPIA 5KAFZ 4FFFA 1GNZA 1U97A 5LRSA 4MTFA 4QPJA 5BMVB 1CAUB 5FFOC 1OA4A 1Z0HA 4A3ZA 2OIIA 1XMOB 4O9EA 4QXBA 2EIKB 2AYHA 5J37A 3LEIA 4LNUA 1R082 2XWBB 3BALA 3CRRA 5IHRA 3A4UA 4AYUA 4ZKIA 1R1A2 4FPHA 2DQ3A 2P34A 3SYQA 4GKKB 4KG0A 3BUCA 4QX2A 2VZOA 2XLGA 3Q8CA 2WT2A 1W6MA 4R9CA 4ZHQB 1GWLA 1HN0A 2XJUA 4FPGA 1YC61 1WN7A 4DYLA 3AXDA 3T0BA 3VL8A 1RUG2 4UW3A 4ZXEA 5AG2A 3HQUA 3TN93 1LGNA 3CIHA 3P3PA 2K9ZA 2JG9A 3U4XA 2PYTA 1ND2C 1MS4A 5ITZA 3K3OA 1FOD3 4L9BA 4A45A 3CQOA 5LMUO 1GICA 1V6JA 4DR2B 5BPXA 1VQ8V 1X8MA 5K4LA 3N36A 3BHPA 1VQ4V 5KHHA 3KV5A 4CS3A 5J9PC 5LBCA 1D4M1 3K4AA 3N2GA 5FL7G 2Q4PA 2VTFA 1TUEB 2Y69B 2QDNA 3IMMA 4FAHA 3MAQA 3D82A 2ZEZA 3MDPA 2NN4A 4GMP3 2WWWA 4B8EA 3RZJA 5CBHA 1NAEA 1RUC3 2BZDA 1UFIA 1JOYA 4Q4Y2 4PELA 1ZRDA 2BJSA 4CTEA 4YJ3B 2YXSA 1J3RA 2VZ3A 5KHJA 5LMNB 1SBFA 1GQPA 3J81N 1P84F 1G9BA 4GZRB 3O1PA 2QWQB 2QBXA 2WLLA 1JFFB 2E53A 1PKXA 5JXGA 2GV9A 3WFVA 2QVSB 1W06A 2XHBA 3AZVA 1S0CA 5IYYA 5K0UC 2A75A 1UQXA 1UU6A 4LF5O 4IEZA 1X8EA 4KI5M 3UO3A 2B1GA 1XEQA 1OQ1A 2LGQA 3GALA 1HQWA 3OUIA 1V54B 1S0BA 3WW2A 5E88A 3DXRB 1LOAA 3T1LA 3J26N 2CGOA 4O4JB 5LL6Y 4AILC 1VALA 3ABMC 2A7AA 2JICA 3O1MA 4IT5A 2R16A 2RDRA 4CCDA 3AP6A 5A33B 3IAPA 1F2NA 3R4SA 3POWA 1AI5A 3T4ZA 2IU0A 4RGGA 4K0KO 3I7DA 5C9AA 1RSOB 2KM2A 4XTMA 2P2KA 3S57A 4D0QA 3OTOB 1XL4A 3LQCA 4NIGA 4O4LA 2ZXWC 5B1AB 1YXBA 1FNZA 4Y20A 3JAKB 3PLQA 1G6NA 3ZIAG 3NNGA 5LA9A 1QNMA 1SC5B 1BT8A 2X7RB 4K8ZA 1VBD2 3PUQA 4UFIA 1WD4A 1DU3D 3SYPA 3QACA 5JOYA 2RDSA 5L3BA 3VQXA 4RUFA 4Y1ZA 2JDPA 3CF6E 1N34O 2GSYA 5FBJA 2XAQA 2RNBA 1UZ0A 4RQPA 1VMGA 4JI0B 1HXS2 3RWRD 2FMDA 4JI8O 4Z82A 1FOD1 2NNUA 3CC4V 1O8SA 2DCZA 4Q26A 1POV0 2JK5C 2DBNA 4B29A 3IC7A 3KM5A 3FX7A 1OUSA 1F4NA 3E97A 4LO5B 4MO3M 4QGLA 4DXZA 3G6EV 1R3JC 4XTPA 1GKFA 5LP6A 3DKWA 1ZZ6A 4LUKA 3O0XA 3H1HH 1PGL2 4UWDA 3DXRA 1RMU3 5EBMC 4WM7B 1Q8VA 4TV9A 2KA3A 3AMNA 2YI9A 2ET7A 1R6NA 1Q8QA 3ZIWA 4XIOA 3I54A 5IYZB 3KB5A 4J1XA 5D5QA 2CTRA 4IERA 3ES4A 5DN2A 3O0WA 3A23A 1XNDA 3DC5A 3U37A 4IE4A 4AOCA 3VDDB 1REFA 3C7OA 1IBKB 3M99B 4KL1A 1L7LA 3RG0A 3PL0A 4DY3A 3VBSC 1F8VA 1KBHA 1BKZA 1XB9A 2OZ6A 4SLIA 1YQ2A 4EN9B 4Q8KA 1OVSA 5J2UB 4BWAA 4DS0A 1CJDA 3VBFA 1LOEA 1QVFU 2EIJB 1H8TB 1MS5A 2DCJA 5GLUA 4LFAB 3CCUV 4E4EA 4A2UA 4QM9A 2ZGKA 1LB2A 4DV0O 2B9ZA 2WO1A 4DFSA 2YBSA 5IAVA 3FUOA 2VPVA 2IXIA 3ASIA 2XJTA 4YM2A 1XE8A 2AZ0A 4PBOA 4K6BA 1BQ0A 3LA2A 2Q1MA 2XDVA 1CEZA 3SMHA 1REEA 3ABZA 4LIVA 2JG8A 1RJ8A 2DMXA 2ILMA 4I3PA 2D3RA 4YVWC 2IJHA 1O3TA 3AYEA 4X62O 5C9AC 2OVUA 4IETA 1KC8W 2GSMB 3M3QA 4XACA 1SQVH 1MS8A 4ARYA 4PDVA 2F4PA 4J7KA 4S2HA 4YJ2B 4JV5O 3V0AB 4WZCA 3W59A 4IW3A 2W5FA 4A41A 5GONA 3LA7A 4LJHA 4JAAA 5EC1C 2IXHA 3OAAG 3ZN6A 3WVJA 2ZE5A 1W6PA 2JJ6A 3DV8A 1JI6A 1O4ZA 4CC6A 5AVAA 5IFTA 5EYYA 4I4TA 4RFT0 4DY5A 2ZDIC 2NLJC 3FE5A 1HRI1 1ZZ7A 4EN6B 1V9U1 1W6QA 3HKBA 4YIPA 5F5IA 1IOAA 1H4GA 4XUTA 2RJLA 5JIAA 3S6PA 5A6YA 1PP9H 4DV2O 2G9GA 1SBEA 3MW2A 1FATA 2WC2A 3VKMA 3K08A 3UNPA 1LECA 3BOWA 2OUJA 1RM1B 1S5LZ 2HWD1 3OBTA 2IXCA 2Z0AA 3CL1A 4GMP0 4DR4B 5CFCB 1YIPA 4JKKA 2XBO3 1L7QA 2R071 4D7TA 3R0RA 1KD7A 4OULA 4DOUA 1PO23 4FZ1A 2L9LA 4YG0A 2VTXA 1H1MA 1NQDA 3I3BA 5A3TA 3JAWB 1RMU2 5FZCA 2VOXA 1W3XA 5CG9A 5LY1A 2RDNA 4DQAA 4QKNA 4TZDA 1HXS1 1IXMA 1UXXX 2WN3A 2BGPA 1KU9A 4XJZA 4OHYA 1K12A 4ZHNA 2EILB 4AFAA 3HPNA 5FZ3A 4BJ0A 3ASOC 4LKFA 1W28A 3UGGA 1N36B 1Q90D 1LHWA 3AM2A 4QGNA 4IEPA 2WWJA 3ZSLA 5L9RA 3RYCA 3LFIA 3MV01 1M06G 1KJRA 1D4VB 2W0XA 3BIEA 3ZN6B 4Q4X3 4G2KA 5L7OA 3T1CA 4JI8B 3OGIB 4YZ3A 2YIAA 4QB1A 1GOGA 2C9AA 2A3YA 3VBFC 1QJU2 3MV11 2Y6HA 5BNPB 2RQ6A 3B8NA 2WS92 4MH0E 4YW6A 2AEYA 2CDOA 3HKBB 3HBZA 4XJAA 5KX5B 1VMHA 4UCTA 2EVXA 1THZA 2FZ1A 2VXRA 1XL6A 1FXKC 4XFBA 3IDEA 5EYPB 1OOPA 4YVWA 3FHIB 1Q56A 3RZLA 1XE7A 1J83A 3MW3A 4N23A 2ZNIA 4LO7A 3VZJA 2XNDG 4KWJA 5A3MA 4LF4O 2DYCA 4GKXA 5H6RA 5F37A 4UF0A 1MMMA 4IXLA 2Q5TA 2J7MA 3C7FA 2ORZA 2ZXQA 4QJFB 3FAVA 1DF5A 2ZCEA 4JTNA 2IZWA 3LSSA 4FPPA 1ULGA 2PGGA 3N9LA 4PD4F 5JMOA 4LEJA 2Y0IA 4LFBB 5EFUA 1XNKA 2V09A 2Q73A 2BWCA 3VKNA 3OBAA 1HJFA 1VLNA 5CISA 3IMNA 3CRAA 1JU3A 1C3HA 5IW0A 4LF8B 3LCPA 4BISA 1Y4WA 5LP6C 1BSMA 1H2LA 3VBRB 4JYCA 3L73H 4N9HA 5FXXA 5IVFA 4LF9O 3QD6A 4DV0B 4XDPA 4L92A 3O1SA 1K3IA 2QNKA 1K34A 4Y1UA 4PBPA 2A06H 4EN0A 3CS5A 2DWDC 2JX9A 4X8AA 2PHXA 2D3PA 3ZSEA 2IXKA 1W6NA 4QPGC 3OEHG 1IBMO 1HRI2 5EWSA 2GN3A 4WV8A 3U75A 2QJ1A 4MGYE 3LB9A 4PQQA 3CJIA 1SLIA 1J58A 3HOBA 2R70A 4PDMA 4JV5B 3GZUC 4I5SA 1NZ6A 2XOMA 1YRZA 5TSWA 3AKTA 5A3WA 1X82A 3WF0A 3E35A 2XJRA 4AI1A 2PUSA 4AFDA 5C3PA 3ZHTA 5A32B 4DNYA 4XQDA 1XNAA 3BPSA 3VBSB 3OFNG 4LBNA 5FLHA 1B35B 2W0FC 4QX8A 2RS33 3AC0A 1SCSA 3LPFA 3H01A 1Z2GA 4AHCA 2DVAA 1KJLA 1PHMA 1DGSA 2WS93 5IY5B 4Q4X1 1QJEA 1GZCA 2R062 1FXHA 2W95A 3M3OA 1WMXA 3E22B 1ULFA 2EIGA 2H3OA 4XVHA 3ZRWA 3ZYGA 5CA3A 3OUSA 4MX3A 4YGEA 3PNAA 1XHXA 2E3CA 1OLMA 1PK6C 4P9WA 1UY4A 2JDHA 5KAIZ 4UW5A 5JVVA 4B7EA 1W8TA 5ANQA 3BFRA 3J8F3 4LFBO 2VNGA 2BP6A 3RN4A 5T54A 1EV13 1QXJA 4UVAA 2QFEA 4LOSA 5JOZA 3HB3B 4AQYO 1F9KA 1NX9A 1JX9A 5FLXN 1ZBA1 1H1AA 4BQXA 3TGUH 2Y4UA 4LP8A 4H44B 5C4WC 3F2ZA 1Z7S2 4YLZA 2OKXA 3CYOA 5FIXA 3ETEA 1HRV1 3OGCC 4WF9V 1TG7A 4RAIA 4MVSA 5JSRA 2DFCA 4YRDA 5DUXA 3OUFA 4D6QA 1KECA 4COUA 5DUUA 2DW4A 2G4IA 2JDZA 1MNGA 1UY0A 5AC92 4Z2WA 4NHYA 5FZMA 4X6QB 3ZXAC 5KXCA 1XU1A 4ZU5A 2UXCB 1OA3A 1OJHA 4BLJA 4CDQB 2PI5A 2VO5A 1UY3A 3VBSA 1C4RA 1NI8A 3EHKA 2O8QA 4NWVA 5B3SB 4JHZA 1RUD1 1XMQB 2VVFA 4ZS2A 5GLZA 1I5PA 1QNWA 1PO13 3CCRV 4ZZ5A 2QZ2A 4LH6A 2JDMA 4GQ7A 1I0HA 3VV1A 1AHSA 1JHJA 1WCSA 2Q30A 1H2SB 4IE7A 1OHHG 1ZLZA 2Y0OA 5JUVA 4QHZA 3UGHA 4CP0A 5FPBA 1M4UA 2BOCC 4KBZA 1JYWA 3VQWA 2Y6KA 5EZYB 5A9GA 1E5SA 2A79B 4WFHA 3O1UA 4QXHA 4SBVA 4IV1C 4M00A 1FD9A 2GHYA 5JQGB 5JVDA 4AHXA 1WW7A 1VARA 4LFCO 4KHPB 1DQ2A 3U1XA 1AB3A 1QOSA 2B9VA 3Q8EA 3WD5A 3BGAA 3SPJA 3LDKA 4O61A 3GVMA 3I3MA 4DV3O 2OW4A 2FYUH 1POV1 4GALA 5BNNC 5FPAA 1OXCA 5C71A 3NO8A 4CXWA 2VBBA 1I6XA 2AZ2A 1WA4A 3QH7A 3B00A 3JD3A 3E6CC 2OCCB 1HB1A 2VE1A 2ZDIA 1QOTA 2XQXA 3I2DA 2YC2A 1R092 4QNHB 2XH6A 1FXKA 2ZX1A 2J1AA 5J98B 3CCVV 1LR1A 2BFUS 4QQOA 5ANNA 2UXNA 3ZHUA 4MVUA 1GOFA 3O7OA 4FPEA 4I3GA 4YM0A 3JAKA 2G1MA 5F9TA 1ZBE1 1SQQH 3LFMA 1W2BU 3RDIA 2L35A 2CY6A 2YIBA 3KCYA 5FZOA 2HKOA 1BL8A 3JALA 3RT3C 1XBFA 1O6UA 2WZ8A 1KD1W 4JGYA 5LY2A 5T5LA 4FFBB 5A7WA 4FXGB 4MHRA 1OQEA 3LIHA 2PHTA 1V6OA 1V6KA 2NN8A 2PMWB 2HEPA 3ME2A 4EB6A 3ILNA 3ETDA 4UBGA 2YPDA 5HBAA 4O2BA 1W9FA 3HIFA 4LBOA 2FQPA 1HWYA 4CCJA 5EZYA 1GU3A 4A6SA 1SQPH 4Y22A 5K1PA 3K9AA 5GM0A 1KP2A 2WLIB 1Z7S1 1IKQA 1JYVA 4QHOA 2W6IG 2JEMA 1DGRA 2V4VA 4QPYA 2VR4A 5LP6B 2VUAA 2FCTA 2OCHA 3K06A 4X8NA 2E26A 1G7YA 1R3KC 5HCAA 4GX2A 4IIJB 1W8OA 1X36A 5H9RA 4CZSA 2ET1A 4WM7A 4JI7O 3JQWA 4WVMB 3JSNA 4IGPA 3ZS8C 1O59A 3T1YB 2Q7GA 2AGSA 4YPJA 3I4IA 5LYJB 3K75B 4DXSA 3WW3A 3AG1C 4YXWG 3CJIC 4OI1A 2VCAA 4LF6O 2JDUA 4XJWA 4H13B 2UXDB 4HOOA 4PF1A 1RINA 1WCUA 4RGKA 2D93A 5A7SA 3FB6C 3LSUA 4UCRA 2EILC 2NM1A 4EFBA 2PZSA 1RIRA 3JCUZ 4FOYA 4FI9A 3J8F2 3S5QA 2HVJC 1CAVB 3TN91 1CX1A 4O9GA 1C28A 2D98A 3JALB 4BE3A 2YFUA 2ZEWA 4MW3A 1WZXA 3UESA 2VZQA 2XVLA 4MSWC 3VHNA 2Q1ZB 4RO2A 1MG1A 1SCRA 3OSDA 1FAYA 2X6CA 1SMVA 4QU1A 3MIGA 3MF9A 1PNKA 3SLIA 4UOJA 4TWTA 3IT8A 1Q5OA 2CNAA 3SPGA 1IS6A 4XF3A 2BWAA 1AR83 3TOJA 4AZZA 2P3KA 1XJAA 4QQPA 1Q81W 1SG3A 3BAAA 1AROP 3KWVA 3NNJA 4LBJA 4TV8A 2WLIA 1QHDA 2BYVE 3BU7A 1EAH2 3S3WA 1RUJ3 4DR2O 4YW3A 5A1LA 4R8CA 5KMGB 1I9RA 4RR3C 2ID4A 2QQKA 2OXBA 1OLME 5I91A 2Q0OC 5FYUA 4YNIA 1N36O 4FIPC 4HLTA 3ZFFA 3G67A 2O0OA 3SYCA 2Y6GA 3KHCA 4CH3A 2P5OA 4BIOA 2IJJA 5D21A 5GONB 1N8RW 2JD4A 4PIZA 4P9PA 3VQYA 4GJZA 4XABA 3OW2U 3ABTA 2XXZA 4NIDA 4LBQD 1GP5A 2FD8A 1YI9A 2A1XA 3T1YO 4C1XA 2RDCA 2VAUA 3AFKA 4JX0A 4U2AA 3BI3A 3WDYA 2CDPA 2AZ5A 5LMNO 4AQ2A 4G9SB 1HV1A 5A3PA 3AZXA 3NXSA 2RM23 2PFWA 3VZLA 2GMPA 2P5BA 1F4MA 1LAJA 4ONUA 1KEXA 4XF1A 2R042 1Q8IA 3FKSG 2HHHO 1RC6A 5B3SC 4UVCA 5FYVA 1GWMA 1FPN2 5L3FA 1JFFA 1AJQA 2EF6A 3MIBA 1Y3TA 1LHNA 1HNXB 1STMA 1JZ7A 3CNAA 4QPGB 4I9QA 2HFEC 5I8YA 1XHZA 1JZ4A 1H2KA 3DC6A 1NJIW 5CYYA 5F2VO 1XPWA 3POIA 4Y3OA 5EK0A 4TXWA 1NE4A 5G05L 2ADPA 5ACA2 3VB9A 1WB7A 3OPZA 3RYHA 3L9DA 3THPA 3OD0A 4PIYA 3UKMA 3LUTB 4I7ZB 3W7SA 3A0NA 5K8SA 1D5AA 4X1YB 1VB4A 1VAVA 4DZGA 3PJSK 2X6AA 3S3XA 3GJAA 1LRHA 1DK1A 4LH7A 2QQLA 4AGRA 1ZVFA 4WFFA 1US6A 4PCRA 1J5EO 4META 3IAQA 2GNDA 3DCQA 5C3RA 3AG2C 4XUPA 1WP8A 2N05A 3VKFC 1QCEA 4MGIE 4FT8A 1E79G 1XILA 1ROPA 1RPRA 4YW7A 2D6OX 5CVRA 1LHOA 3OMAB 3P3NA 2DF7A 1NCQA 2JDKA 5CBLA 4BB3A 2XLAA 5JZGB 1RUI3 1X9TA 2UUAB 2DVBA 4ABMA 4Q6GA 2OYQA 1UZZA 2F95B 2WYFA 3CJXA 4DR1B 4P30A 2CAVA 4AG4A 2JDAA 1RUOA 2D6NA 4M0NA 3QLQA 2IC1A 3MPPG 3G4SV 3FAVB 1N3QA 2Q9LA 4H0LB 3SHRA 2Q69A 5HFLA 4X64O 3R6SA 1AR63 4DB5A 1VJ2A 5FPVA 2AR6A 3N4MA 4UF0B 4JI5B 4CDXB 4XBQA 1S2BA 2YEVA 5F6KA 1IVSA 3FHQA 1YQ5A 2O57A 2ZCWA 1WPBA 1V6MA 2P67A 2W08A 4MGSA 3WUDA 2RJ2A 2YC4A 3CCSV 3AKPA 2ODMA 2D6PA 1JYNA 1LHUA 4Q4V2 1IQDC 1W9YA 1K5MA 5CKQA 5FYYA 2HR3A 4B1MA 3U78A 2WSSG 1K4CC 4XMIA 3OJBA 3ROUA 2ARHA 3VZNA 4ZY9A 3I49A 4BLIA 1EAH1 1AYM3 4QT6A 2Y6FA 1X59A 3UETA 2ATKC 1BZWA 1EAH3 3VDBA 3IFXA 1IBKO 3ZHSA 1ZSPA 3HPLC 3CMGA 1GOHA 2X09A 3PTRB 1YQ6A 5EXOA 1XYNA 1VBA2 3LD8A 1VQPV 4CRQA 1OLQA 1W2NA 1YEWA 4DO0A 3WB0A 2EALA 4GX0A 3C2UA 3S30A 3VDDA 3BIWE 4I0XB 4NAMA 4HSLA 1HN1A 4UFKA 1VRH2 4BXSV 3HKEA 5FXWA 2IFRA 3CJIB 3MYXA 4Q4V1 1HNZO 3QOPA 5LBBA 3OD4A 4BQWA 1AL21 1BCXA 2GBOA 2F66C 4CCNA 5FY0A 1KDKA 3T08A 4A3XA 2XB6C 1UU4A 1F5JA 5T50A 4KP4A 3THCA 4CDWC 1H8TA 2ZGPA 2FCVA 2OUHA 1R3LC 5FY9A 4QDRA 4J80A 4X62B 1UX6A 2GMEA 4JCKA 1K45A 2ENRA 2AACA 4MTGA 4Q0PA 1T6BX 3H1MA 3AK2A 3CRMA 1RP3B 3IM0A 1XQ8A 5C8WA 1ZRCA 1GM9A 1IPSA 1CZSA 1RXGA 4DV3B 5D8AC 4JVAA 1HR0O 2XAGA 1LEMA 2RS52 1LOGA 2D2CB 4AW7A 1VQMV 5H9CA 4XCBA 3AYAA 4AI3A 2AENA 2BPA2 1QXPA 1PO12 3VD3A 1OD3A 2ZIMA 3DGTA 4YFWA 1OURA 1ZZ8A 4Y5Z0 3K03A 1VQOV 1RUD2 2BNNA 3OPWA 4N7IA 3TWIA 4CUGA 1XE0A 1LUWA 1CPNA 4CEYB 3MHHC 1UPGA 3DGEA 2C24A 1SF9A 3JD71 1W05A 1SLBA 1CWPA 4XDKA 1J3QA 5GKAC 2QZ3A 3WSOA 2K1EA 1GZWA 4B3SB 4XW3A 5IWAO 3ZMSA 4FM0A 4RQEA 3LPGA 4QU2A 3JXSA 4ASKA 4LHKA 2YICA 3DYOA 2ZGSA 2YGMA 3WLUA 1YTFB 5A3NA 1Y66A 4FLZA 1BHBA 5I0UA 4UXAA 5FPXA 3OGGA
chains in the Genus database with same CATH topology
4A7KA 1R081 4FOQA 1V6NA 1D4M1 1NXMA 1PO21 5CB7A 4NO4A 2CL2A 2R30A 1AVBA 4BZ4A 1QQP3 4Q0QA 2QDNA 4YW1A 4Y26A 4BHPA 3WW1A 4DRVA 4FAHA 1SACA 3VBOA 1TNFA 1R1A1 3D82A 2PHUA 5E8AA 3BTAA 1GNHA 3PVBB 3SH3A 3MDPA 4QMAA 3HN1A 4GMP3 2HWD3 4B8EA 5LEJA 1RUC3 3POSA 4JGZB 4PJYA 5FTTC 3JD72 1FV3A 4Q4Y2 3JZVA 3ZXKA 1ZRDA 1SEFA 4CTEA 2IWGB 1HRV2 3GYDA 4LO4B 2GH8A 4LLOA 2YXSA 4PLMA 1J3RA 1SBFA 5KHJA 3VGIA 1NXD1 1H2MA 1G9BA 2WNEA 4LHNA 1CAUA 3INAA 4D7SA 4CEYC 5LK7B 2E53A 1UU5A 1Z7S3 3ETQA 4FPLA 1KS5A 3PJQA 2WKKA 3VHRA 1AX0A 4HK9A 2ZKNA 4M3CA 2QVSB 3B7MA 3AZVA 3DN7A 1S0CA 5K0UC 1RUE2 5T5JA 3AP4A 2A75A 1UU6A 4XETA 2WBQA 4IEZA 5KC5A 3H7YA 1X8EA 2GAUA 2EAAA 1BEV3 4XQ4A 5JLVA 2OA2A 2JE9A 3ZFEB 4CEWB 5FO8B 4FOWA 1ZNPA 3RRDA 1OQ1A 3WT3A 1RHI3 3GALA 3RNSA 1WLTA 1HQWA 4N43A 2WJSA 2XHKA 5ABJB 2ZTNA 1WCKA 3WW2A 1S0BA 1RGSA 4Y24A 3WNXA 4DRRA 5E88A 3MFCA 2JECA 1GQGA 3FBMA 4WVVA 1LOAA 3T1LA 3WQ0A 4OVEA 3V56A 1D0HA 3ZN4A 3J26N 1NLSA 2CGOA 4KNCA 5HCBA 3SCFA 5L19A 5CFDA 1ZZCA 4YGDA 1VALA 3ZVXA 3AP5A 2A6ZA 1ENSA 2A7AA 3R05A 3SNMA 2JICA 1GZWB 1NX4A 2R16A 1UIKA 3AP6A 2HWC1 5A33B 3GNEA 2W68A 1F2NA 3DL3A 2I07B 3R4SA 3POWA 1PZ7A 1D4M3 1YO8A 3S7IA 4BG1A 3FZ3A 1RUH3 4RGGA 3T2TA 4DPNA 1D0GA 2VG9A 2CYFA 5I0RA 3I7DA 2LALA 3ZFFC 5C9AA 3MIFA 2KM2A 4XTMA 4ATEA 3NAPC 5LK5A 2P2KA 4E27A 1RUE3 4Y4YA 2PLV3 3FFQA 2I45A 4GB32 2YV8A 1RUF1 2R061 3M70A 2RE9A 2RHPA 3VBUB 1JHNA 4W6YA 2YZ4A 3MLJA 5CAZA 1FNZA 4Y20A 1PK6A 2B42B 3BODA 1AR61 2BTVC 3TNQA 3PLQA 5FOBB 1G6NA 1AXYA 1OQDA 3AKRA 3UKVA 5DG1A 3O14A 3DPRB 1VBD2 5K7PA 1NCQB 1A78A 4HK8A 2GALA 2VOWA 1WD4A 4YZ5A 1DU3D 3QACA 5JOYA 3ZXFA 1AL0G 2A6VA 4QPIB 3ZYJB 1HLCA 3SXWA 5FLJA 2P37A 3VBHB 1C5HA 3JBG1 1G8WA 5JAXA 4LBQA 3LSEA 4CVYA 1MR5A 2RR12 4LA2A 5GLWA 4GKYA 1ZM1A 4Y1ZA 4FXKB 2HWF3 1ZBA2 3CF6E 1S55A 5HXVA 4AXOA 2GSYA 4ITCA 1V6LA 1H1IA 3UK9A 4XHXA 1EY2A 4RQPA 3UJQA 2R072 4CEWC 1TME2 1QMJA 3H8UA 1HXS2 2FMDA 4AWDA 1NYWA 5KXBA 1BBT1 1S0FA 1FOD1 4Z82A 3O2GA 2DCZA 1NCRC 2RM21 4Q26A 4EN8B 1POV0 4EWDA 2AH2A 4XFIA 2E6VA 2PHFA 4CP1A 4N53C 2XGXA 4KU8A 4B29A 4IEQA 3WHUA 3KM5A 2WFPA 4AGVA 2CAUA 1U5ZA 3E97A 5AFBA 5KXEA 1W6NB 4COYA 4LO5B 4QGLA 2Z79A 4DXZA 4RQPC 1S0IA 3ZN5A 4XTPA 1OIKA 1ZA4A 3ZPYA 4HN1A 4R9DA 1CD3G 1Q43A 4CYDA 3DKWA 3ZYIB 1NCRA 4EV0A 1ZZ6A 3AZYA 4LUKA 3O0XA 3MZHA 2PHDA 1DIWA 3WDWA 1PGL2 5AC91 4WZFA 4HVQA 1UF2C 1RMU3 5ACA1