1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
1H2LA 2Y0IA 1MZEA 2ILMA 3KCYA 4NR1A 1H2MA 4B7EA 4AI8A 4B7KA 2WA3A 5JWPA 4Z1VA 3D8CA 2YC0A 1MZFA 4Z2WA 4JAAA 2WA4A 2W0XA 2CGOA 3P3NA 1YCIA 1H2NA 1H2KA 2YDEA 4QU2A 3KCXA 4BIOA 3OD4A 3P3PA 1IZ3A 2XUMA 2CGNA
chains in the Genus database with same CATH superfamily
4BQYA 5C9AA 1WCKA 1H1MA 2JGUA 5F5QA 4JKKA 3OGSA 1LUVA 4Y1YA 4UCRA 1MACA 1U97A 1BQPA 3LDDA 3ZMUA 4GX0A 4E8CA 1UOFA 1NOVA 2EX3A 5JXGA 4DV4O 3WSOA 5K0UC 4QPGA 4DR7B 1PK6C 4FM0A 5KWRA 1YF2A 3K3WA 5BNNB 3S0MA 2X09A 3K51A 3VD3A 3IAPA 4J6GA 1MOFA 2Y6GA 1CAUA 1AP6A 1RHI1 1WPBA 2GU9A 2K0GA 3M3EA 4KHPB 2HEWF 3D0SA 3N3HA 4UT5A 5H9CA 2Y33A 4YW3A 4LFAO 2H0VA 4YGBA 1VBC2 1W0KG 4QNHB 1AL23 2QTOA 2OUHA 3VZLA 3WB1A 5FZKA 2X6AA 5L3BA 3HKBA 3N2KB 4AEDA 5LB6A 2VNOA 4XF3A 4TLFA 5KLVH 2CUGA 4TV9A 1V00A 3VHPA 5IJ0B 1U12A 4UVAA 1E57A 2WNUC 3HPNA 3V0AB 2TUNA 2JD9A 4X62O 2CDOA 1HDJA 2I2SA 1M57C 4PELA 3CL1A 3CC2V 3EQEA 1CVNA 1GM8A 4KUMA 5F3CA 1XNBA 3VKOA 2WQ8A 1QU0A 4LO4B 3RG0A 4EYUA 3OGVA 1ULEA 4WCEV 1JOYA 3K5LA 1F4AA 2VZ1A 1BVP1 2VQEB 2Z5WA 2PLV3 3AMMA 1ST8A 3MUZ1 3F5WC 1VQ8V 2YGLA 4D3WA 5DAVA 1OQEA 1RYYA 3N9PA 1RM1C 1DQ4A 1TG7A 2QM7A 5CKMA 3ZYFA 3EXAA 4KU7A 4D8MA 1IS4A 3RZZA 2ZT9B 3JCUZ 2EIEA 3H9VA 4KXRA 4LWSB 3GJBA 4X1KB 1QJX3 2XQRA 1DYKA 2YPJA 4YGDA 2JWPA 2VZQA 1LJ7A 1EY2A 1NCQB 3WNKA 3ZFEA 2PFWA 3L73H 5JJJB 4CH3A 2ZR2A 4MT8A 3ABLC 1WW4A 5FP8A 1IXBA 1POQA 2R073 2FL4A 2WINB 5CB4B 3MIFA 1I5YA 1WA8B 2A3QA 4L11A 1E1QG 2P2KA 2Z3YA 2UU9B 4QJFB 5J37A 3OW2U 2HWE2 1NZCA 5AFBA 3MLLA 4FFFA 5LHGA 1YQ5A 3W7XA 5FYUA 3MLJA 2EICA 3QG5A 1PO23 1O7FA 4Q2FA 1HXS3 4IV3A 2EULA 3LNMB 3ZMTA 4R6ZA 1LOGA 3DC6A 1AJQA 3F95A 1YI9A 4IE6A 2HEPA 2QQVA 5ITZA 2OVUA 1K42A 4L0PA 4XXPA 2FDHA 2WN2A 2EZPA 4CDXC 4MYEA 5GZGA 2NYYA 2ADEA 4IGGA 1SKVA 3B7MA 3OAAG 3POBA 2Q1ZB 3O1TA 5JXJA 1LRHA 4LOSA 1N32O 2JE9A 1AR72 3ETQA 5LXTB 4EE2A 1F4HA 4CCNA 2Y0PA 4Q4V1 2RMKB 1GANA 4Q4X1 1HNZO 4HAMA 5HXMA 4Y22A 4J1WA 2WO3A 3NO8A 1CD3G 3VBRA 2AR6A 4EB6B 4AHXA 5J96B 5KBFA 2J1RA 1Y9QA 2D5FA 2RS32 3UO2A 1C5IA 3J4UH 3WG3A 4I0AA 4J9YB 1I08A 1RPRA 1SLTA 1QJY1 5FLIA 1QOSA 3CJIC 3I54A 2YG0A 3DECA 1PGL2 4GKYA 2A9HA 5CMUA 4XJ9A 5EXOA 3ZYGA 4YVSC 2P06A 4COUA 3DV8A 4FQZA 5JXHA 3FUOA 4O61A 4NPLA 3LB9A 4QQHA 4JPRA 2RS33 1X4TA 2QKSA 4UAPA 4AWDA 4JI4B 4AI9A 1UYYA 2WLMA 4W4LA 5D8AC 3QH7A 5IVYA 5LGNA 5FZCA 3LFMA 5C4WA 3WNMA 1KDKA 3HKBB 3VBBA 1NTMH 3J9SA 5EJ1B 4N90A 3T08A 2BGCA 4COVA 4BQ5A 1S1AA 5DABA 2B1IA 4LBOA 2VQEO 3MFCA 4DS0A 5B1BC 4AEJA 5JSRA 4DY5A 1VIWB 3T1CA 1EBOA 1S72V 1EYBA 3VHRA 3UYJA 1XMOO 4AVTA 1K3IA 1UIKA 5B5EZ 2PYTA 2NPIA 3WLUA 5J2UB 3FYIB 3V65A 4K8RB 4AAXA 3N7JA 4AEDC 1JYTA 2OX0A 4EWEA 4UCTA 1ACCA 1H2GA 2RHPA 4H33A 3CC7V 1RUNA 1UY0A 1RSOA 3O12A 4XDKA 5FP9A 2ZE6A 2B39A 3DCQA 4MUVA 1V6MA 1IS6A 2WZR1 2EXJA 1K5MB 2LFSA 3H1IH 3ECQA 4WVMB 5FYVA 4AGVA 1ZLZA 3O1RA 4FPPA 4YVWB 5FDBA 2E3CA 3VOUA 2ZJCA 1D4M1 3I3QA 4BISA 2RJKA 2ZABA 2WR9A 2WN3A 3WP5A 4FLWA 4WVWA 2D7FA 4A41A 3LSSA 4MVZA 2Q8CA 1AR92 5FLHA 3TEXA 1XU1A 3I3DA 2HP8A 3AFKA 5FJHA 1UOGA 2AHYA 1JCHA 3BEHA 1OA2A 4J7ZA 2GNBA 4ZZ8A 4K0KO 3Q8EA 1VMJA 2AC1A 2UUCO 4LHLA 4DNYA 2GDFA 1PZ7A 5ANQA 3VDDB 1BCCH 4JAVA 4JVAA 4AL9A 5JSPA 4FM2A 4XETA 2WLIA 4LUKA 3OE7G 1PM4A 3VBHC 3CPWU 4YVWA 2RE9A 2ETNA 2PAEA 4IEQA 4OLLA 2JK5C 5LOVA 3E86A 2E33A 3PNAA 1Q6UA 1SBEA 3N36A 1OLME 1JYIA 1L8DA 3BU7A 4UFLA 2ZEWA 4KFMA 2SLIA 5C8YB 1WD4A 1N4CA 3OYWB 2PHFA 2PA7A 4LF9B 1OOPC 4GWNA 3ZXFA 4EN8B 2VZUA 4UCVA 4ZIBA 4EFBA 2Y4UA 2LALA 2EXKA 5FPVA 4IEOA 2ZIMA 2XGXA 4Q27A 1OJHA 4CH5A 1CIWA 4CP9B 3OBZA 5I0RA 1H9WA 1WW7A 3HNBM 2ZEXA 5SV5A 4AFBA 4RQFA 2D6LX 4OI1A 4ARXA 1AR73 4MV2A 4QB6A 2VZ3A 5EP9A 1E5IA 2RM23 3ZRSA 2ZX2A 3PTRB 3G7DA 1UYXA 4TWKA 5F3EA 1VBE1 3KV5A 1SETA 4QD2A 2FZ1A 2CGOA 2FBEA 2UURA 1UMHA 1PGSA 1NR7A 5JH7A 2PHDA 2ZAHA 3CX5F 2B1GA 3PHMA 1CZSA 1ZZCA 1PO22 1VF5B 4N53B 1K7DA 3CZUA 4OVEA 1K9MW 5LA0A 2R6QA 4R8HA 2MHFA 4DR6B 4RQPC 3RRDA 4LR3A 2Y60A 4Y20B 5FZ6A 3JARB 1CX1A 2R063 1EUUA 3N27A 3TJTA 2YYOA 5IVCA 1UO9A 2J42A 3C7HA 4QAWA 5KA5A 3HN1A 4A6SA 4JGYA 3WU2Z 4UFKA 1UMZA 5IUQA 3SR2C 1I6XA 2BZDA 2O1QA 4XJWA 5CA1B 2R72A 2D3RA 2HYKA 5B1AC 5DN2A 4MXWB 1OVSA 1ZX3A 2WBKA 3RZJA 1UYZA 3JAMN 1TME1 2I07B 5DZEA 1VIBA 3POGA 1MQTB 1W6QA 4A44A 1GQHA 2AZ5A 1NE6A 5EPAA 3USSA 3EYPA 4PF1A 4YNIA 2XOMA 2QVSB 4AE2A 3I2GA 4DR5B 1PZ9A 2WQ4A 3VQYA 1GFF2 4X8NA 1CX4A 3BN6A 4DMIA 4H7LA 2WFPA 4LMFA 5EHDA 1W39A 1ZRCA 3AK1A 2W1WA 2LGWA 3JQXA 2W3JA 2D3SA 2VTXJ 1K5MC 4E2SA 3ZN1A 2VBDA 4ZHQB 4HETA 1CWPA 3B3QE 1RUH1 1EZJA 2C5DA 3OD4A 3TB0A 2HWE1 4YG3A 2H0BA 1BMV2 4PA4A 3ZXGA 5FK7A 2VCBA 4QXHA 3PU8A 1F8VA 2K1EA 1Q6HA 5FY0A 3SC7X 2D3OW 5ABJB 3GVMA 5GLUA 2ZMLA 2UXDB 3OY8A 1WW6A 4W6YA 3ETDA 4RS5B 2R071 1HKDA 3KV4A 4JHTA 3EJKA 1QJY2 5H9SA 3JUUA 2DN9A 3D82A 5IVBA 2YS8A 3POEA 1NH2B 4CCOA 4TZDA 2V4AA 1WB7A 4X1YB 1X50A 2XASA 3J7LA 4NIAA 5FQ0B 3D36C 3UKNA 1AI6A 4DW1A 1EN6A 3OT7A 2MPFA 1G7YA 5FZHA 1S0EA 4JQRA 4D6QA 1PIV3 2LFRA 5FXVA 3UJQA 3WF4A 3G4SV 4WF9V 2UY9A 4QX1A 1L7RA 4YIPA 2RVAA 5FLJA 2Y8KA 3ZOIA 4XJAA 3PTYA 3Q8BA 2QUOA 3E22B 2EF6A 1BK0A 4E4EA 1JMKC 4KQ7A 2DUPA 2O8QA 1ULDA 3I8TA 4AHYA 4MSWC 2YPDA 4B3MO 1XNQO 1Z7S2 5L9BA 1EFRG 2P6CA 4OHYA 1D2QA 4GX1A 4YW5A 4O4IA 1PGL1 3H8OA 2ZGLA 1ZZ6A 5C3PA 3IB3A 1EZVH 1K5QA 1SA0B 3LWCA 4AI1A 3GZEA 3TOJA 1OURA 2EBOA 3FWEA 4YW6A 3MFAA 3SJBC 1US6A 5D21A 1W9SA 4PDWA 1BLZA 3IZOA 4IL6Z 4IE5A 4IYIA 1QH6A 2GSYA 4HMZA 4YHHO 1IBMB 3I55V 2PY5A 5GZFA 5D5QA 5A3TA 2ZGKA 5K7PA 2RJLA 4TTGA 3H1JH 2W68A 1U5IA 2AGAA 2BERA 1J3RA 4X88A 1OV9A 1IQAA 4G4FA 3ETEA 3LA3A 2M6YA 5FMBA 4A4AA 2R30A 5L3CA 3QO5A 5KA6A 5E89A 3BOPA 3BHPA 3HVDA 3IC9A 4U7OA 3R4DB 1H2MA 1R3KC 3NRUA 1CAVB 4FI9A 3WB2A 3I4IA 3I3BA 1Y67A 1RUF3 4ET7A 4Q4X3 4P9LA 1LKNA 1DQ0A 2VNGA 2EA7A 5IVEA 1W3VA 2XDVA 3W7WA 1Q8QA 5IFTA 1FS0G 1GMMA 1GWLA 1EAH1 4GMP3 2DYSB 1TMF2 2VUAA 2JEUA 1JZ8A 4O9EA 2VGDA 2DTYA 5CEHA 4NR1A 5JI9A 2WWWA 5FZAA 1TAEA 3NV3A 4BK5A 4Y24A 4LK7A 1RMU3 3WR0A 1H2SB 2H8PC 2A6XA 1L0NH 3HWJA 1DZRA 3AL5A 1ENVA 2UYAA 5L36A 2ADDA 4GAZA 2ZXWC 2E51A 1SPPA 4LHKA 3BTYA 1H8TC 3EO6A 1KQRA 2HWB1 5GLTA 1VBB3 3F5TA 2CH7B 2VG9A 5FMDA 2GC1A 4JI1O 2YHJA 3BGAA 1OPOA 3Q8FA 4XFCA 3U14A 4Y1ZA 1ZA7A 3M3QA 4UW6A 2DCKA 2FCUA 1QHDA 4DV2O 5A6YA 4AEMA 3R65A 1US3A 1AXZA 1NY72 2VCCA 4IYHA 4LLOA 5IT6A 2WLJA 1UL9A 1O3RA 1JUIA 2ZXQA 5A7NA 3WF1A 4SLIA 4LNUB 1REDA 3VB9A 4J11A 2N7GA 1N32B 5FLXN 1NVPB 1XQNA 1W9TA 1LEDA 2IJKA 4RFRB 2ZIOA 1LCLA 5H2FZ 1PO11 5KHJA 4WV8A 3ZR5A 4Y5SA 4DQAA 2YC0A 4A7ZA 5K9YA 3VBHA 3O1OA 3BOWA 1AX1A 2W87A 4XF9A 3ZMZA 5KX5B 5CFDC 4WM8A 4J10A 3G67A 4QGPA 4U3FH 5FYBA 2BOBC 2LP7A 5JVDA 4M4PA 4Y5TA 1K33A 4YW1A 5FL7G 1VBB1 1US2A 2RS52 1W8HA 4X20B 2GMMA 4V2VA 2CSGA 3AKPA 1OCOC 1S77D 2J1UA 4RHV1 4NRPA 1AR4A 3WD5A 1AJOA 1O5UA 2Y6HA 4U36A 2XBO1 1SLAA 3N2GB 3T2OA 1VEWA 5ISLA 3ORJA 1YXWA 1LODA 1JN2P 4LK6A 4FM1A 3P6BA 4BIUA 1NQTA 4DR2O 4TSVA 4YGCA 4M3CA 4QM8A 1OXCA 1V9U2 3IIIA 2Z79A 2IM9A 4YHHB 3SQOA 1OVPA 1RUJ1 5A3OA 4ASMB 1W6NB 5DXDA 1YTFD 3ILFA 3IC7A 1GOFA 3PUSA 1XI1A 3LDRA 4OHWA 1F35A 5CB4A 3K9AA 5BZBA 1KC8W 4ZPIA 1G8MA 5JMOA 1QLNA 1QJX2 2ZPXA 2PELA 4LOTA 4LFCO 4QQLA 3U10A 2ZGSA 1HRI3 4YVWC 2WLPA 4XCBA 4XURA 5JVVA 1YRZA 2ARBA 2FCVA 4JF3A 4DV4B 1RJ8A 4YW4A 1LGNA 1X9PA 2NZ9A 2QZ2A 3H1YA 1OF4A 1CIYA 3OB8A 2PHTA 2XBO3 3LF7A 1SG3A 1RUG3 1VB2A 4HFSA 5LL6Y 2Y6KA 3IM0A 3H1HH 1GN4A 4O4IB 4XFAA 4AI3A 1O8SA 2IH1C 2HJIA 2VMGA 1VMGA 4I50A 1JOPA 1RVF3 4Y3OA 1UPGA 3OGIB 5LA6A 2E32A 4WFGA 5K0UA 1RUG2 2G19A 1U5XA 3MGUA 1AJNA 4OGQB 4NHMA 1M90W 4N43C 3T2PA 4MTFA 2JJ2G 3RW0A 2HVKC 3MF9A 5GTHZ 4X1KA 3ZSEA 3K59A 4HK9A 2EAAA 5JWPA 2XLAA 3KV6A 3URFA 1NE4A 5LBBA 5LP6A 3SXWA 4D6RA 5F7UA 4TWTA 4BE3A 1BBT1 4LH7A 1Y9MA 3UETA 5AVAA 1ROPA 4KG0A 3HEIA 3GDBA 1ND2C 2BE3A 2DURA 3QF7A 4JI6B 5GLZA 2ITCC 4ZU7A 1Z0HA 4CUAA 2P4EA 1FAYA 1EN4A 4IW3A 2VMFA 4YW2A 4A7YA 4FPGA 3NW4A 4IGOA 2FTKA 4KWLA 2YSUB 1ODMA 4WBNA 3A7QA 3Q4HA 1XSQA 4YWAA 5A3UA 1GR3A 1LR1A 3NAPA 5JOWA 5DZGA 1LHUA 1UY2A 3UT5B 4C90A 2R16A 3QO7A 2D2CB 1YJLA 3EFFK 4MGYE 2Q9LA 3ACIA 3ATGA 1PMHX 3HAGA 2JG8A 2VL4A 2A73B 3EXUA 1JH5A 3SPIA 4UXNA 3ALQA 5DAXA 3CDZB 2F95B 5JZGC 1N33B 4AFDA 1N34B 3OUHA 2TNFA 3I2FA 2FDJA 5FYYA 3GCWA 1JQ0A 1PNFA 3T4DA 2SBAA 2LROA 4RFT0 1OCRB 2VVFA 2E5LB 4PV1B 1YQCA 4DB5A 1XDCA 4CU9A 4LF7B 5KXDA 1RUH3 4JV5O 4M3CB 1PL4A 3RI8A 3OSDA 4KBZA 1AYN1 4TYSA 1NAEA 2UUBO 2YBPA 1EV11 1KKCA 4COYA 4Q8LA 4DR1B 1GO3F 3QBQA 3LE0A 2TBVA 1WLEA 4IE7A 2XJTA 5C3QA 1VQ5V 3HPLC 3HBZA 3M8LA 1NA1B 4Z07A 5ACA2 5FPLA 5B3SC 4GA9A 1WBFA 2BNNA 2XLFA 3APBA 5FO9B 5JCOC 1IKQA 2A7WA 1S2BA 1IQDC 2WL1A 4RYDA 2R0HA 5BNOC 1PVC2 2JDKA 3LAGA 2OT5A 3AYAA 1CESA 3WNLA 1Q43A 1JMUB 2WFF1 5CADA 4FLZA 2Z4FA 4BW9A 1VJ2A 4PIXA 3B01A 4GX5A 4GZ9A 4FAGA 1FV3A 5D2AA 4ZKTB 3PVOA 4OI4A 5KXCA 1RFYA 1V54C 4PA3A 1BHGA 4RA0A 1GM9A 4CBCA 1W8UA 5LWBA 4OX9O 1LU2A 2HBTA 4CA9A 1YFWA 3OGCC 2KXLA 2DVDA 1KECA 2XVGA 3L2HA 3WV6A 1FI2A 5E88A 3H0OA 2CV6A 3NV4A 1DYOA 3H7JA 1EAH2 3H8RA 1CZVA 4DXSA 2YZ4A 1N1VA 4TV8B 4CRQA 2G38A 1WAZA 3CXHF 1LHVA 2BVBA 2GDSA 3WY6A 1H8VA 1PVC3 2ZHLA 2OUJA 2PAMA 4XAAA 2FDIA 4N21A 5I0UA 4XVHA 5L19A 1YSCA 5BR8B 5CFCB 1UOJA 3CJHB 1GV9A 1FPOA 4Q5OA 3AC0A 4QX5A 4NKGB 3LSDA 1QNYA 4IDZA 1OA4A 4UVBA 1XNCA 2JB8A 3L9DA 3ELNA 5LBFA 1W9WA 1W04A 4IEWA 2GNTA 4WZCA 4RGKA 1LUWA 3NJXA 5E6HA 3RT3C 5EZYB 3WCRA 1MA1A 4ATFA 2EIJB 2JE8A 2LGQA 1WD3A 1DZTA 3WHTA 3QNEA 4B8EA 4I01A 1RUH2 2F66C 4Q4W2 1XU2A 1R3IC 2JKBA 5D8AA 2BVVA 5A6XA 5DAWA 3H3ZA 1AJPA 4ISQA 1OD3A 3T4VA 4YM3A 3RYCA 1LGCA 3FB8C 1G9AA 4AAPA 4KMQA 5CFDB 1AR83 1XBLA 4C0HA 2QWPB 2EINB 5I0DA 1JZ4A 3SPCA 4XDOA 4RHV2 1WKYA 2QWNB 3Q4HB 4CDWB 1LULA 1UU6A 4CEYA 2CDYA 5KMGA 1VRH2 3A0RA 4ZZ5A 1AR1B 1PVC1 5GM0A 3U75A 3W9AA 3U07A 4OHZA 4AYUA 2E75B 4ZOLB 1J5EB 3VBUA 2IJHA 4CEYC 3VBRC 3ZYIB 2ZDIA 4QWNA 3ES4A 3WUDA 5IVJA 2QDOA 3CNAA 2F4LA 5I8SA 3POWA 3M2MA 5FXXA 3T2TA 4BPZA 5A7OA 2OYQA 1W6OA 3USUA 2PAKA 1DK1A 4L87A 2X5IB 2OIIA 4DV6O 1TE1B 1GICA 3A2FA 4XJ8A 5B1AB 2A6ZA 1D5AA 4LBKA 5L7OB 3JBG2 3P32A 2D5HA 3OJBA 2QE7G 2BOCC 4CPBA 4QIWF 1FYUA 3FAVB 1V6KA 4L99A 4GYCB 1OCCC 4IV1A 1ASJ1 1OCCB 1W6QB 4DRXB 5IVFA 2ZX0A 2VQ0A 3DN7A 4XFGA 4FTEA 2GMEA 4MVQA 4DRRA 5L9RA 4WBNB 4H13B 4NRMA 4XW3A 1RUC2 1AL22 4FLXA 3RPQA 4NO4A 1AP5A 1OLRA 2Q7GA 4NJ4A 3OTFA 3FFQA 5C9AC 3HKEB 1UZZA 1OOPB 4D7SA 2VZOA 1QJEA 4JDMA 3RMYA 3EBRA 1OLQA 1UU4A 5JLVA 3CCLV 5C93A 1TNRA 2X6CA 1UPIA 2X7RB 1OCZB 4FOQA 5FP3A 3UKMA 3JXSA 2RR11 3V0BB 1RUJ3 3TXQA 3DXRA 2EIMC 3CCRV 2F43G 1F2NA 3T1YO 3I59B 4HLTA 1PX4A 2EILB 2FB5A 3WW1A 3E83A 5E16A 1YLLA 5A7SA 3NMBA 2UXCB 4IE4A 5FYHA 1JZ5A 3UO3A 5LYJB 1D2DA 4BWOA 4R9CA 3GHNA 4Y20A 1FNYA 5HCAA 3B93A 5JR2A 1VF6C 3RWKX 1ZSPA 1FMD2 1ZX5A 1HR0O 4CCJA 2CDPA 2C4XA 3SPHA 2KKWA 1GH6A 4DV0B 2JX9A 2QQPA 4HL0A 3LOIA 4B1MA 3WDWA 3VN4A 4BB3A 1MZ6A 3SCFA 2WLLB 4D7TA 1REFA 3W20A 4UFMA 3ZFGC 2LS6A 5C3SA 3CC4V 3VBRB 1F15A 1IHMA 1CPNA 2KSDA 2ENRA 2BW8A 1K8AW 5FV3A 3ZFGB 1RVF1 4K8XA 4LULA 5BNPC 1SQXH 1V6OA 5LHHA 2H3OA 1KD7A 4YG6A 5A3WA 2ZMKA 3MIGA 5FZBA 4K35A 3JBG1 4FZ0A 3CXCU 4QM9A 2BSKA 4NIGA 3KT7A 1G9BA 2R043 2JKXA 3TAYA 2WT0A 5EWSA 3BA8A 4RR3A 1Y74B 2WRAA 1ND3B 4XQDA 4C1WA 3AG3B 4KWJA 1JTZX 3VHNA 1XYPA 2VH9A 3SH3A 4CDXB 1Q3EA 2BBVA 1I0HA 3UGFA 5DM6V 5H9QA 3VKLA 1Q8PA 1OA3A 1DU3D 3ST7A 4XE9A 2Q8DA 3BRCA 2DBNA 3Q9OA 3ACGA 3FB5C 4XPVA 4MO3M 1W9FA 4YM1A 4JZ2A 4LFAB 4Z82A 4FPEA 3M7AA 3RYPA 3JALA 2G9GA 4AW7A 2RM21 2B9ZA 4LIUA 1S0VA 4AILC 2VW1A 4PHZA 4ES9A 3K5NA 2OWOA 3P30A 3ZXLA 2J22A 4C91A 5L7OA 4R9BA 3HT2A 3C2UA 4UW3A 3GXUA 1JZ7A 4CDWC 4ZBMA 3MW4A 3CO2A 3WP6A 3W7UA 4AG4A 1HJFA 2FD8A 4JGZB 2PTMA 1UKGA 3K5MA 3E8HA 4J42A 2FQPA 2JECA 2PLV2 3IPVA 5BMVA 3MZHA 3WF2A 4GULA 5BY1A 3KGZA 2AEZA 2QR4A 5B1NA 2BJSA 1GNYA 5JXIA 1AYN3 4BJ0A 5I0SA 1DLLA 2J1EA 5CG8A 2RDNA 2BV4A 4XZPA 3O1UA 1TVGA 4NAOA 1SACA 1NR1A 4B1LA 3BABA 4RAIA 3OGJA 4CCMA 3VLBB 5IJ0A 2PHWA 4X64B 3OOXA 5D8AB 3PJSK 4O4JB 5JJNB 5C8YA 3O5SA 2BRTA 4NXNB 4AFCA 5EYYA 2LW7A 4DV5B 3T3YA 1FOD2 1BS3A 1XMQB 4X66O 1R1A1 1DLBA 3S5AA 2GP3A 4LFBO 2WAAA 1CPMA 2CYFA 4NROA 3VL9A 3M3CA 4MSVA 2VOKA 1V6NA 2ZE5A 1NLQA 2CE4A 1UX6A 2AHZA 1RMU2 3HOBA 5CBHA 3ILRA 3LSEA 3J81N 5HXVA 2R9RB 4M01A 2IW5A 3OMAB 1FPN2 1X36A 1T5EA 1YFXA 3IPVB 2O57A 2BTQA 1U0AA 1DTOA 4UBGA 4TUYA 3I49A 2XQXA 5BPXA 2VQAA 2OYZA 1RUF1 1EV13 4K1ZA 1XXNA 3ZRWB 3M3IA 3AMQA 4AQSA 4W4KA 1W0NA 2ARHA 4QHBA 2BNOA 3PJYA 5IYYA 2ITDC 3RMXA 5HPOA 2QWRB 4O4HA 5JPMB 2PYLA 3U37A 4Q4W3 4BQ1A 2Q8VA 4FVMA 4CDQA 1RXFA 1W0PA 2J7MA 4GMP1 2K2SA 3EHKA 1YO8A 1R1A3 2L35A 2WT1A 3OEAA 3RBZA 3WXPA 1GN6A 2WAMA 3JB8A 2YIBD 3ZIAG 3IAQA 5BNOA 4XUPA 4XUOA 3KB5A 4DV1B 5KC6A 2BUKA 1H6XA 1VBD3 1O5LA 2WZR2 1NY71 4FVVA 3AK2A 3MIDA 3LEMA 1O3QA 1S3JA 1ZRRA 1PIV1 3AM2A 2XAGA 4XJUA 3W59A 1MS4A 3KQ4B 2V73A 1KYOF 1WMEA 3A23A 4LBEC 3CCVV 3M99B 3ZMOA 3W7SA 2D3PA 3AK0A 1AR81 1GQGA 3T2QA 5LXTA 5H6QA 2YICA 1AR61 1F7YA 4DR4O 1PNLA 3RZHA 4CYDA 1WGPA 1QXPA 4RUFA 1H1AA 1E5HA 1SHWB 3CMGA 4U3JA 1RUD1 1M1KW 4MADA 2VD7A 4COZA 1W6NA 3NNGA 4CE8A 4UV8A 3WDTA 1XNKA 4P9JA 2A71A 3JQWA 3I7DA 4YRDA 2XUMA 5FOJB 2RS51 4LBQA 2ZMNA 3I56V 1RUC3 1V6IA 1YXBA 1YFUA 1N36O 4QDQA 3E6BA 5GZEA 2R49A 1N47A 1KFXL 2RR12 3B5LB 2R0FA 4B3SB 2WNUB 3U11A 1NJIW 1UF2C 1L3JA 4O2AA 4WBBA 5ABJC 3B77A 1B35B 1DDLA 2VQTA 4EWDA 4CU7A 3ME2A 1URXA 5IT9N 3CJIA 1BE3H 4YZ3A 4JV4A 1AI4A 2JDNA 1U5YA 3ABZA 2EILC 1UOBA 3JCZA 5FPOA 2EIJC 1XE7A 3JCIA 2QQUA 3NVCA 4NTWA 2YIAA 1WN7A 1ZYBA 4Q20A 2F23A 1GYKA 5LASA 5J2TA 2IXHA 1SDDB 4QGMA 3V0AA 4XQWA 5LA6B 2Y6LA 2ZCEA 5J3UA 3IDAA 4I5SA 1LECA 4FFIA 4A45A 4ZHNA 4GJYA 3DKQA 1Y7BA 4NHLA 1C4RA 4XUQA 2F1MA 1YQ2A 1JFFA 2DF7A 3ZX7A 3N4MA 1YQ8A 1W9YA 2HVJC 2UWBA 1Z2GA 1AYM1 5JZGA 3SHRA 4JI5B 1FX5A 4UVCA 3RWRD 5BNPB 1SQPH 1ZAUA 3ABUA 5LHIA 3I3EA 4B4PA 3T30A 4LF6O 2Y6FA 4O65A 5EZYA 1K4CC 1TEIA 5M0TA 3PMSA 5B1BB 3ZN4A 1KP3A 3SYQA 3AJYA 2ZS6B 4I2OA 4XF4A 1HJGA 1PMJX 2GALA 1WP7A 4KHPO 1X8EA 1WMXA 1NCQA 1JI6A 3PUQA 3WT3A 4EV0A 4AQ2A 4XHBA 1ASJ3 4AQYB 4DRXA 1WMFA 2GAUA 5SV8A 1SQGA 1X7NA 1S0GA 5DECA 4JTOA 5FBZA 5CZKA 5FWEA 4JTCB 4MGKE 3TWIA 2D6NA 3VV1A 2RNBA 3TNPB 3CCJV 2UU9O 2A6VA 2UWCA 2ADQB 1ENSA 2OCHA 1AB3A 3DEMA 3FL7A 1GP5A 2CWSA 4S2GA 1OQ1A 2HEYF 3E5UA 4BH9A 3QH6A 3LFIA 3MHZA 4LBLA 3B69A 5JI7A 1YITV 5BXXA 3G6EV 4LF4O 1FPN3 1Z7S1 5C9AB 2K9PA 3AG4B 1RJ7A 1H9PA 5K1XA 4QGNA 2XH6A 3TN92 5L9VA 4N53A 4W6WA 2YBSA 5F3GA 1YWKA 2QKDA 4DZGA 3MLKA 4LHNA 3W7TA 4RQPB 1JBCA 4Q29A 4YVSA 1MS5A 4HPKB 1WCDJ 4D6SA 4XUNA 3EB7A 1S0DA 1JS9A 1SLBA 2DV9A 1K12A 4WM8C 4Z2WA 2YU1A 4Q4X2 1L0LH 4DV6B 5T54A 2UUAO 2MEV1 3ZHRA 2RDCA 3AG3C 4GB32 3R4SA 1W6MA 2VNRA 5KR7A 5IK5A 1YHQV 4XIOA 4TV9B 2Q8EA 4JYYA 4JHZA 1IBKO 4XF1A 4KL1A 3BKZA 5FY7A 2JRIA 3CMEV 2HR3A 4B29A 4QPIB 2Y64A 3A4UA 4GJZA 1HN0A 5FPZA 4ATEA 4FAHA 5FPRA 2VTFA 1TVKA 1ZL8A 2DOSA 1WBLA 3TCUA 3ABKB 4HVQA 4HKLA 1VLNA 2F4VB 3ZN5A 5EYXA 1KJRA 4HSJA 5C33A 3AK3A 3ZXKA 4I30A 4EZHA 2WSSG 1K5MA 4PJ0Z 5J2UA 2R041 3ZEDA 4A3XA 1GWKA 4ICGA 1IS3A 2VOTA 3MF6A 4FQ4A 1R1ZA 1GP4A 3WW4A 4ZXEA 5EYPB 1Q82W 2YROA 2JB4A 4D69A 2HWE3 3OM3B 4W4ZA 4GB31 4X8AA 2C24A 3HB3B 3ZM8A 2Y0OA 2HWF2 2MEV3 4LKDA 1FV2A 1C8M2 4N7IA 3ZYBA 5A32B 4H14A 5JZGB 4I09A 2XBO2 2A75A 1N0NA 1AR91 1ZL8B 1K45A 2P90A 3IT8A 3OMIB 3O1MA 1PNGA 4EROA 3K2OA 4HOOA 1O4ZA 1VBC1 2OT7A 1LHWA 1CAXB 2IC1A 2RJ2A 4WVZA 2XLGA 2JS3A 4BLIA 3LCPA 4ABMA 3VZKA 4P9IA 4W65A 3EMRA 3AYDA 2PGGA 1FFTB 1JYVA 1SESA 4PT6A 4BQ2A 1RUJ2 1UKRA 2Q0OC 3OUIA 5B3SB 4ONUA 1M4UA 1RUI2 1VRH3 3SGIA 4QXCA 4BM8A 2RN9A 3U0ZA 2VTXA 3APQA 4OPHA 2AACA 1ZBE2 2VVEA 5A1AA 3ZSLA 1A32A 3RJRA 1W2TA 4Y4YA 2HJFC 4HVRA 5FPAA 3OGGA 3C8XA 2E74B 4Z1VA 3ZLIA 3KHCA 2VMHA 4S2DA 5A33A 2NM1A 1LHNA 2FHRA 1XNRB 1HQWA 5DPNA 3ZHSA 4NPMA 1XYNA 1NTKH 4QPKA 4K0KB 2G4IA 1NH2D 4ZXKA 4Q6GA 3UT0A 1RTVA 3H1WA 3K9SA 1LHOA 3NXSA 1UIJA 3RQ0A 1JR9A 1I5ZA 5IYBO 3ZS8C 4AEKA 2XKPA 3R66A 1RVF2 2HG5C 3M3OA 2IJIA 2EIBA 5K1PA 3AXDA 1XHXA 5APAA 2HHHO 4Q4W1 3NJYA 3ACLA 4AK3A 3AJZA 1VBC3 1MG1A 1VBB2 1POV0 2R042 1VQPV 1R73A 1GP6A 3GZAA 3ZMNA 3C3SA 3IBMA 2BBAA 4DEQA 2XR4A 4RUEA 2XVLA 3BUCA 1N0JA 1CAWA 4FPHA 4GKJB 4UYBA 5KC5A 1SQQH 1VBD1 1UXZA 4Z1MG 3QTCA 2DQ3A 4FP3A 4JC1A 1VRH1 4YZ2A 4DK1A 1TMF3 5HI0A 1ZNPA 5FP7A 2X05A 1W2NA 1PPJH 1WJZA 4GZRB 2DYRC 4DUVA 2IXJA 1I94B 4FCAA 3ZSJA 5BY5A 3G6BA 3ZRVA 3ZXJA 5CFCC 1NU1H 3AKTA 4DOUA 2W0XA 4AFAA 2RS12 3X2QB 3V64A 1HRV2 5A9GA 4X20A 1ZREA 4C7UA 3FFZA 4CCKA 1FKAO 3HR0A 3JARA 3VBFC 4X64O 3DYPA 1O4TA 4X62B 2PHUA 4NOTA 5CKNA 1YUDA 3OBAA 4RO2A 2JIZG 2IXCA 5A7WA 4ZI7B 2OA2A 4Y33A 3N9LA 4I50B 2WUHA 2O8OA 2QQLA 1S2KA 4QQPA 1KS5A 2YMZA 4IETA 2WZPP 3CJIB 3DXRB 4AGRA 1N1TA 4R4ZA 4AI2A 4XJZA 4QX0A 5KX5A 1K3EA 5BYNA 4QQOA 2OW4A 3J26N 2BTQB 4DV5O 1V6LA 1K97A 1Y76A 3IMMA 3VDCA 2WA4A 4LF7O 3F2ZA 2UYBA 1COV1 1SS3A 2JG8C 3ML0A 5L3FA 4TQDA 1AUYA 2DBIA 1E1RG 4FFHA 1W28A 1RUE1 4IV3C 4ASUG 4AQTA 1P4RA 3RZGA 1QGLA 4GKKO 4G27B 1QLEB 1VPHA 4JQTA 3FHQA 3RYFB 2VU9A 1RUF2 2VM9A 5HFLA 4GH4C 4JI3B 2WS91 3W5MA 3O1VA 1OUXA 3HKEA 4BK4A 4XDJA 5LOVB 4JX0A 1G9CA 4B7KA 2HLDG 3MICA 3KHBA 1AX0A 2XONA 2UXBB 2HWD2 2EIKC 4INDA 4TV8A 2HJDA 3FLTA 3H1MA 1HQLA 3C3VA 4PIYA 1HV1A 3VBUB 3QVNA 2DW4A 5EJ3A 2JDHA 5LBQA 3ILNA 4GKKB 4OQ9A 4MGQA 1HNXB 5ANNA 4DR3O 3KGLA 5KAIZ 2HWC3 5EV7A 1REEA 3CHXA 1LOFA 2OPKA 5F37A 2YXHA 3HKDA 2GBOA 2RDRA 4D7YA 2VWKA 1L1FA 2JJ6A 1LAJA 4RQEA 5IK8A 2QA4V 2ETEA 3U78A 2WSUA 2EXHA 1H1IA 1DGRA 2GH8A 3FB6C 3TEYA 4YLZA 2RS13 2XJQA 1C8M3 2Q5TA 3N2KA 4HANA 1KJLA 5DG1A 5FYIA 5FUPA 2B8MA 3BYWA 4JI2O 3UQ8A 1V70A 2J1AA 2UXNA 4YARA 1PKXA 1MQTC 4CXWA 3JBG3 1XL6A 2VMDA 1C1FA 1ND2B 4AEDB 4CZSA 2JXAA 2VOVA 3TBDA 5CA3A 1VAKA 4FLVA 2ZGOA 5F5AA 1HB1A 3CEWA 1BZWA 1W0JG 5HFMA 2JENA 1O4YA 3SKJE 1GMGA 2QBXA 4CH4A 1SA0A 4C1XA 4XYXA 5GONA 5L73A 1O59A 5DUVA 4QPGB 4B3TB 1POV3 4JRAA 3AZWA 3ZMVA 4DUZO 1MS1A 4DINB 4JYAO 3D3IA 1S5LZ 1WLTA 2CH7A 3KCCA 5H9PA 3RJ2X 2FDFA 1PD3A 3WQ1A 1QOOA 5CBGA 2QQWA 1WA6X 4QDSA 5LMNB 4GUNA 2JDZA 1V9U3 3H50A 1M93A 1NI8A 4B08A 1A3KA 4QDRA 2ORZA 3PJQA 3FE5A 5GTIZ 3CCUV 3KVBA 3DYOA 1W3XA 4MW8A 4LBNA 1BXHA 1OH4A 2RR13 4H7MA 4F8AA 2ZTNA 4A7KA 4JKLA 3THPA 4J80A 2CU5A 3RSJA 2A6YA 2W2IA 2W1SA 2A06H 5E79Z 4H2AA 4LE3A 2AW9A 2GC2A 2QDRA 3L70H 2ZKNA 4EJRA 2BGOA 1GKFA 4HNAB 2XJUA 3DKWA 1Y66A 2VPVA 3D5OA 4X1YA 3APOA 3E8GA 2BOIA 1QH7A 5GALA 5F2WA 4CH6A 4NE9A 4TSFG 4JI0B 3FHAA 1RM1B 1NS1A 2IVJA 3PN1A 1S0CA 5A2QN 1D7PM 1UMIA 1M9NA 3VZMA 4QE9A 3NWKA 5L3EA 4A3ZA 1YIFA 1CXZB 1PM9A 4RD7A 2ZNIA 3OPZA 2FKXA 2CTVA 2JE7A 2WA3A 3G80A 4Z2AA 4QE7A 3THOA 4MG2A 4XMIA 2Y34A 3BVOA 4J1XA 4OX9B 3RYFA 4KGQA 1XJAA 4RR3C 2YV8A 4IV3B 3VBOA 4D0QA 3O14A 5FRAA 2OTJV 2P1BA 4QPIC 1ZBE1 3VBSB 4CZZA 5ABJA 4BAYA 1YC61 4CC6A 4N9HA 4WFEA 1HB4A 4NXMB 3CRRA 3GYDA 3R4UA 1WA8A 2LW8A 3G6JB 1V6JA 3O9OA 3O0VA 4XUTA 4BOWA 2UXDO 4CUCA 2PN5A 1OZ0A 3MHSC 5DUWA 4PA9A 3WDYA 5JJEB 1NCRA 4J41A 2QTSA 1AZDA 2F4PA 3JAKA 4LR4A 4F6EA 1QU7A 4NHYA 4HVOA 1Q81W 2X53S 1NZIA 5FNVA 3TEZA 1DLCA 2J1SA 2PQQA 3WG7C 3WFVA 2DWEC 3BTXA 4MXWA 4G3YC 4GCZA 3P3PA 1S4CA 4HSLA 1AR93 3RNSA 5CYYA 3AG1C 3MIBA 2Z5UA 4M0HA 3E2EA 4ZOLA 5J7MA 4MTGA 4OQ8A 3HKCB 4O4HB 4Q0PA 1AJKA 3Q8AA 3ZN0A 2WYSA 1L7LA 5DG2A 3SEEA 4FPCA 4WFAV 1CPYA 4B3RO 5FZ9A 1BVVA 5HCFA 3ZHTA 1DF0A 1KXGA 2B45X 4XFBA 4DUYO 1XL4A 3OTOB 3JAWB 3SPJA 2ZGQA 1B04A 3RWNA 3WOGA 4XIKA 4HZ3A 2NP0A 5ITZB 5EIBD 3JD2A 3AEIA 2BOJA 2ZGMA 4L8QA 1U5ZA 3ZHUA 2OCCC 4Q4V3 3NV1A 3ASOB 1NQJA 1O8PA 3E8BA 4CP1A 4X6QB 4CP2A 4O9GA 4TXWA 3CD6V 3GB7C 4MTOA 4DEVA 1KQSU 1F4MA 1GZWA 1YNAA 4LBQB 1ORQC 1QJY3 3WCSA 4Q4V2 3ABMC 3CS5A 1MNGA 1GU3A 3JD71 2RS53 3SEPA 2R1BA 5FWJA 3MUY1 2RS31 2H94A 3K3OA 2QQKA 2PMWB 1ALYA 4HKOA 3JATB 2WABA 2QJ1A 4LWSA 1FXVA 2YI8A 5FAXA 1IGOA 4P02B 3S3WA 4LTAA 4F3JA 2Q67A 2DU0A 4LFCB 4XEZA 1VQMV 4PCRA 5IHRA 4NWWA 3RYIB 5CFDA 1DFQA 3UKVA 2WAOA 1VQ6V 2VAUA 5A6ZA 2XAQA 3GZTB 4YYOA 2A3XA 2YY1A 2LO1A 2P4VA 2VW0A 1W8NA 3BFRA 1WLDA 2GN3A 3B8NA 5FFOC 1IOAA 1L7QA 3AP6A 2E63A 1W59A 2P22C 2HKXA 3L74H 5FZ0A 4DR4B 4ASLA 3JD73 2WZR3 1QQCA 2GUZB 3S6PA 1IS5A 1UPSA 3K4DA 2W47A 5F39A 2JS5A 4G2KA 3ZSMA 3LPGA 1UCXA 3RVZA 2A5ZA 1D4M3 2ZX1A 2WZEA 4MGSA 3RVHA 3VBHB 4CP9A 5C71A 1EUTA 4GIQA 3PUHA 4KI5M 1AX2A 4CTEA 4JGZA 2GP5A 1JW6A 1NX9A 5FZ8A 1N36B 2VW2A 5J1XA 1GNZA 4AVVA 1AI7A 3N9NA 3O65A 2UXXA 3HJRA 1GK9A 1SQBH 2JVDA 2C2AA 1GOGA 1H8TB 5C3OA 1NCRB 3ZVXA 4XMAA 2RDQA 4AI0A 2X8KA 3DF0A 1R6NA 1QKQA 5GONB 5B66Z 4B3NA 1GQPA 4IEVA 2ERFA 2YFZA 5FJKA 4O2BA 3VQWA 3BVCA 3CJXA 2RS11 2VC9A 4DO0A 3K3NA 4QKFA 4B3MB 1XNQB 4BXFA 2G1MA 4GWIA 1W6PB 4FSJA 3X2QC 3C7OA 3OGRA 1PV0A 4YJ2B 3CZJA 3RYHB 4H0LB 1IKPA 2WLIB 3HN3A 2CGPA 3LSUA 5IYZB 3VKNA 2M7WA 2D44A 1RL3A 4CEWC 5F1RA 3V56A 1K34A 1DCSA 3AKRA 1VQKV 2IWGB 3VZJA 2P37A 4LBMA 5LP6B 3FLRA 3R05A 1A78A 3OPWA 4LBJA 2GNDA 1A8MA 1HB3A 3K0GA 2Z69A 4QKBA 1VBA1 5JIUA 2ZKLA 1O3TA 1WCUA 5FYSA 3MYXA 1JHJA 1WCSA 1T6BX 3H7YA 4DIQA 3MDSA 1E5SA 1IURA 1R64A 4NTXA 5BMVB 1WLWA 2I45A 4IUGA 4YJ3B 4UCSA 4XC9A 1V9U1 5IJ9B 2ZM6B 1DQ1A 3E1F1 1QXRA 3WF3A 3A8TA 1QCEA 3ZIWA 4YIOA 2DCYA 3RYHA 2WLNA 5F9TA 1MZFA 5L3GA 2AENA 4CDUB 2HYXA 1AYM3 1PO13 1HNWO 5GW7A 2E6VA 3I5DA 1BYHA 4KH9A 3MBWA 2Y0IA 4CCDA 1M56C 2V4VA 3CF6E 3VUOA 5CG9A 2WO1A 4IGQA 4IE0A 4I4TA 3KMHA 2FYUH 5LY2A 3FLPA 2FDGA 1ZZBA 4I55A 1MVEA 2RMU1 2E26A 1Q8VA 2WNVB 2CWMA 2QNKA 5C8CB 4Q1RA 1FD9A 3AG7A 2R061 3LEKA 2YFUA 2GV9A 1OKOA 1AXKA 4M00A 3MEPA 3BU0A 5GKAC 1GZ9A 1POV1 4FXKB 3KS7A 2XHKA 1BHBA 3S57A 2JG9B 4RHV3 3NKTA 2AH2A 2Z42A 4LF9O 3CRCA 3GNEA 2XOKG 1LGBA 4CCEA 4LA2A 2CL2A 2ILMA 2VMEA 3GGLA 4A6OA 1HDKA 2WS92 2P3IA 3VL8A 1SCSA 1OBNA 2VOXA 2E53A 1S0FA 2XJVA 3ZFGA 1JZ2A 4JI2B 4IV1C 1WCQA 4N53C 1X82A 1N3QA 2QGNA 1GBGA 2VRZA 3SJAC 5HBAA 5EBLC 1XHZA 5FKBA 2WDBA 1X8MA 3T2MA 1K5SA 1ZBE3 1RC6A 4NN0A 5T50A 1ZBA1 1FXKC 4ZU5A 3RYKA 2JDUA 1FJGO 1ULFA 4JI8B 4E2GA 4CVUA 2X0LA 5CA0B 4H44B 4WFHA 2XWBB 4GALA 5FMOL 5FZOB 1CP9A 5DAPA 4NB5A 4GX2A 5J36A 3ABLB 3TYJA 2A70A 2CHHA 4EKWA 5A3PA 1IPSA 2VZRA 4PDVA 4XFFA 2Y69B 4AOCA 5C3RA 1VMFA 1XQ8A 4ES8A 5GZDA 1JYXA 4HN0A 2VCAA 3PDQA 2VQUA 5KHKA 3CCQV 4K40A 2UUAB 2GH2A 1MZ5A 1J5EO 2GZWA 1OT5A 3BIWE 2VY0A 2FMYA 5C8WA 4LXLA 4WVVA 4K21A 4KP4A 3VQVA 3LZZA 1ZBA2 3FC0A 2W6JG 2XWJB 1BT8A 3KF3A 4P2ZA 4PI2A 4PI0A 3LPFA 3AYCA 4XOGA 2VOWA 4W6XA 5KXEA 2EALA 3G71V 1WLCA 3O0WA 4F4LA 2Q8OA 4PDLA 2F17A 1DHKB 5LZ6A 1OOPA 2ZHNA 4BZ4A 1GN3A 3BODA 4LO7A 1KD1W 3ZXEA 3NNJA 3VKMA 1AF9A 4L92A 3M7MX 4HKWA 5LA2A 2FDKA 2IBZH 5LBCA 2CNAA 5FZDA 1UX7A 2ARXA 5FY9A 4LC1A 1G6UA 3AZVA 2YC2A 1UJWB 4YJ3A 5IJRA 3LOBA 3ZX6A 1ASJ2 2WFF2 1Y4MA 1W03A 3JD1A 2B46X 5LY1A 4B4QA 1CQ9A 3NNFA 1W6OB 1JX9A 3JD0A 3ZYHA 4AR2A 5KMGB 4BQ3A 1UY1A 5JUVA 2FCTA 3POSA 3PUAA 1VQ9V 4FTSA 2PUSA 3K0DA 3E89A 2XJRA 4FFGA 1MMMA 4BA6A 2YIBA 2D43A 1YDXA 2AUYA 2IU3A 2AEYA 1UFIA 3OUJA 4DXTA 4K1YA 4Y1VA 3T1YB 4XQ4A 3ZKUA 1FXKA 3ABTA 1BL8A 2F93B 4LUMA 1KMIZ 2BP6A 1SQFA 1GLHA 1J95A 3ZRXA 3KM5A 3E8FA 1IX9A 1HB2A 3N7KA 2VXJA 5TSWA 2YDEA 2NLJC 2LUWA 3MIHA 1SBDA 4Z8BA 5LW9A 4GD4A 3LDBA 1U96A 2RQ6A 3K03A 1JU3A 3UL2A 1XYOA 4JYAB 3HNYM 4OXSA 1AHSA 1DGWX 1Y3TA 2K46A 4Y1UA 5IK4A 2YEVA 1NA1A 3CU7A 2PF4E 1JU4A 2B5HA 2D6OX 5JOZA 4MHUA 1LNSA 3DSQA 4QPJA 4EN9B 1TVKB 3KCXA 1P8JA 1QY4A 2D97A 3KV9A 2WS93 5FBJA 3MW2A 4QHOA 4GT1A 3ZFFA 1S5JA 3BB6A 5K8SA 4JASA 3MI8A 3MV01 2DVAA 3B02A 4LF5O 2WNOA 2EVXA 4X9QA 1RGSA 1LU1A 2VO5A 2CAUA 4B3RB 4JTNA 1IG3A 4LIVA 2XHBA 5CAZA 5LEJA 4DXWA 2ZHMA 1TMF1 4GH4B 1R6KA 4RS5C 1ODNA 3WP3A 5DQ0A 5JQGB 5F2SA 1H38A 2OS2A 1QDOA 4XAEA 1D0HA 1IBMO 1LOCA 2KD7A 4MZUA 2Y48A 2B9VA 4Z92B 1NUKA 4OMCA 1BK1A 3ZIXA 5BNQA 2HWC1 4UUJC 2ET7A 1HW5A 1W8TA 4XILA 3WQ0A 4R52A 1C8NA 3HKDB 3J7AU 3QOPA 3E5XA 2UWAA 1S0JA 4QU2A 1CEZA 1QWRA 4HPKA 2H6BA 1QEXA 4EFEA 1N1SA 3S7EA 3ITQA 1G6NA 3GBFA 4J25A 5AC91 2AGSA 1SQVH 2W1QA 3OF1A 4HT1T 2MK3A 4YFZA 4Q0QA 3PVEA 3T1LA 2DWRA 3CKHA 4BR6A 1AR71 4NHKA 2A79B 3KCYA 1EN5A 2XJPA 3B09A 5FR3A 4P5HA 4AGGA 5LCWL 1QQP1 1LOFC 3ZDVA 3RZMA 1MEC2 4BDVB 3GZUC 3K77A 2QWQB 4ZKIA 1YHFA 1OC1A 3K46A 3AZYA 5HV4A 3BCWA 4XZUG 3HNMA 4CDXA 1AYN2 2HWC2 3DYMA 5JDBA 3S7IA 3ICXA 3JALB 1PM7A 4BWAA 4U2AA 4K8ZA 1YJWV 2PLV1 4P14A 2BNMA 1S0IA 5IWAO 1LENA 3OEBA 2VS0A 4AVCA 3ZBHA 4Y5Z0 5I8YA 2KB1A 1RUE3 1BZKA 3LNNA 2OXBA 4M0NA 3WINE 1W8FA 1HW7A 4UF0A 1F5JA 4ZY9A 5FZ7A 4CSWA 2AYHA 1HNXO 4EN0A 3P5BA 5FO7B 2GN7A 1RHI2 1ZWIC 3CCMV 4JKMA 5FZ1A 5FP4A 4HZFA 3D6EA 3AVSA 2XXZA 4YVSB 1Z7S3 3N2GA 3OBRA 1YIJV 4PLNA 3AP9A 4I0XB 1XILA 3WF0A 5C5TA 1A6CA 1OD5A 2K9ZA 1KB9F 5LATA 3TXSA 4X65B 1SDWA 1UWWA 1JA8A 4MGZE 5LEKA 1ZRDA 1OMIA 3J8F1 4QKNA 4PA7A 1EPWA 3DPRA 4FOWA 1Q86W 4XDLA 2DUQA 4BQWA 4HK8A 1SFYA 3KZIZ 1HXS1 4NIIA 3CIHA 4C0BA 5BNOB 1AROP 2KA3A 2DYSC 2OPWA 3SCGA 3AMPA 4O4LB 2UUBB 1OFNA 5A3NA 4JAUA 3UGGA 3L75H 4DPNA 4FK5C 1P7GA 4QKDA 4BMEA 3IDCB 2Q0AA 1AVMA 1XEQA 1H8EG 4LO8A 4OI0A 1M06G 2Y69C 3QACA 4YY3B 2QDNA 1C8M1 2Z0AA 1LNQA 1VQOV 4R9AA 1JYWA 3SJCC 1FJGB 1DQ6A 3ZHQA 3HIFA 3OY8B 4FXGB 1XMQO 3DUIA 1D0GA 3WP4A 5KUKA 4LFBB 1BQ0A 1G8WA 3CCEV 1Z78A 2YUEA 1APNA 4I4TB 2RMU3 4U3JB 3T4ZA 1CR7A 5JCTA 4N8MA 3FJSA 3ZPYA 1NZ6A 5KHHA 5CBLA 1CAWB 3FKSG 3W21A 4N23A 1AR82 3C7GA 4XFHA 3LA7A 3ETPA 2AREA 1QVFU 3A21A 2WNVC 5KAFZ 1BEV1 2OTLV 3ZYJB 3IAYA 5EBWC 4R9DA 3ZYRA 4MHRA 3KG2A 3ZSKA 2IXLA 1XUQA 1TUBA 2IJJA 1XNTA 4CDUA 4GKJO 5IVVA 5BNNA 3ROUA 3LEIA 1HRI2 3VZNA 2QQOA 2X6BA 1NKGA 4LO6B 1J84A 2YXSA 3D3AA 4P30A 1W2UA 3KT4A 1O9HA 5EC1C 1DGLA 4YZ5A 3HKCA 3HQUA 4P9WA 4NAMA 4GKXA 2PHRA 1VBA2 3MD0A 2ES3A 2ZD9A 1LOEA 4Q0VA 1AR5A 4WFBV 3VBUC 3BALA 2RM22 1UQXA 5AFEA 4R4XA 2P7TC 4CDQB 1MS8A 3NJZA 5A7WB 2IUWA 3FZ3A 5A1FA 5T55A 3CSXA 3LDEA 4I3GA 4DV3O 3H42B 2Y26A 2QWOB 4YXWG 4MS2A 1IDSA 2JIJA 5F3IA 5CIRA 2VQFO 2E7TA 1QNMA 1LESA 4K6BA 1VF7A 2KQXA 4X65O 5BR8O 1YYNA 1FMD3 4HYOA 3T4HB 5J9PC 4P9XA 3B40A 2DCJA 4OPAA 3CBNA 3NKGA 2ARCA 4LBQD 3M70A 2GC0A 4MVRA 2IU0A 2ZKOA 4I0XA 2J1TA 4OUSA 3ZHVA 4UFZA 3ZXDA 3WNXA 2YXLA 1PMIA 5EYPA 4BW5A 1LOBA 1A34A 5IAXA 4QXKA 3B9CA 4I7ZB 3LDKA 1XE0A 2BFUS 3CCSV 1CAUB 2QZ3A 4BCUA 4QX7A 1F9KA 4TOIA 1H6YA 2Q1FA 3H1LH 4ZONA 4O2BB 2CAVA 1XSRA 2WFF3 2E76B 4PQ9A 5GZCA 1VR3A 5A6QA 4AHCA 1I5PA 4LORA 4AHZA 1KITA 1NT2B 2Q73A 2W1UA 4FBFA 2VQFB 3JD3A 1UU5A 1IVSA 2H6CA 1H30A 3E22A 1TME2 2DMXA 2CGNA 2RG4A 1BEV2 1Z5WA 2QQMA 1FXHA 5J09A 4ORFA 4PDMA 1HQNA 4BQXA 1MS0A 4P5YA 2XAHA 2WO7A 1RMU1 4HN1A 2R7EB 1VQ7V 2ZQMA 1XREA 1Q6IA 2C9KA 3UESA 1W2OA 4IT5A 5FUIA 2YGMA 2ZAAA 3M8AA 1CJDA 4NUBA 4W50A 3T1HO 3H1KH 1FMD1 3AG1B 1YFYA 4I02A 1WNSA 4IXLA 4JTDB 2WLLA 1O9GA 4N43B 2HWB3 5JMCA 2ORXA 4K20A 2QQNA 4S2FA 4DK0A 1NTZH 3GJAA 4NTYA 4I9WA 4TQFA 1DQ2A 2HLEA 1SMVA 3RDIA 1W06A 4AI8A 1HX6A 2YU2A 5FZGA 3PL0A 3ON7A 4D94A 4F83A 4E9KA 4CS3A 1NBMG 1H8HG 2Q30A 1RB8G 5C7GA 4MGTA 1AR62 4URTA 1LB2A 3B2EE 3I2JA 5J48A 1SC5B 1B6QA 5JR7B 2N74A 5IW0A 4DV3B 4XACA 4L8JA 3B94A 3UM7A 2ZCWA 1ULCA 3LKJA 2G9FA 2BWCA 1VBE3 4JYCA 1ENRA 3POYA 1KU9A 1KGYA 1FAFA 1EM1A 4LF6B 2PZSA 4PLOA 1TUBB 1YTFB 5JOXA 3F7YC 4PA6A 2V1DA 3IGAC 3NJVA 4LF8B 3PVBB 3VBOC 4BHPA 1KUQA 2HWD3 1CAVA 3IWZA 1WUVA 3CB2A 5IFPA 2JICA 1SLCA 1YVWA 1B3QA 5FXZA 1YZBA 5B2GB 1ZTEA 4F7ZA 1JYCA 3ZJZA 3FB7C 2IFRA 4PBOA 1IBKB 4META 2OIGA 1QDCA 5FY8A 2P6JA 2DQ0A 4YSFA 3AB0A 2VBPA 4P9OA 4PDWB 3HQXA 1DYPA 3BA9A 1DQ5A 1HNZB 2XKOA 2QTWB 3C7FA 5CVRA 5B1OA 4E4DX 4JI8O 3B00A 3J7MA 5IWAB 1AL0G 4UWDA 1HR0B 1N8RW 3DGTA 1TZOA 3I2KA 3CP1A 2DDUA 2X5IA 2ET1A 2ID4A 3KVAA 2P3KA 3K57A 4V1PA 2VUJA 1I7FA 2GSMB 3USUB 1URFA 1FYJA 2V5DA 1GZCA 2DVGA 2PI5A 2QFEA 1H2LA 4K9SA 2ATFA 1AR63 2J1VA 2DCTA 2HWF1 4FT8A 1KRIA 3CLPA 1LTEA 1OCOB 1OH3A 1JVMA 2Y6JA 3OD0A 5AVPA 4FLUA 2YUAA 2NQYA 4XBLA 4RN5A 1JZ6A 4XBNA 5AC93 5FNVB 2YIDA 4J9ZB 2W46A 4MVTA 5FYZA 5F32A 4MVMA 2WZ8A 5I8TA 3W5NA 1RUC1 2Q4PA 5DMYA 2DJVA 3DTUB 1J59A 5H5NA 4X66B 2VBBA 4NHXA 1RUG1 3OUSA 1YJNV 1S76D 2Q1MA 4PLMA 1VQLV 1G9DA 1VE0A 1HRV3 1W8OA 3I59A 3OUFA 2UU8A 4BIOA 2V09A 3JAKB 2X29A 1WWYA 3BTAA 5CB7A 2RV9A 4OMDA 4WZFA 1I3HA 5FPUA 3HBKA 1K4DC 4YZ1A 1TGOA 1XNDA 2CTWA 4GQ7A 3VBOB 1RIRA 1YJKA 4ZS3A 2UXBO 3IMNA 2V72A 5BNNC 3OYWA 3Q8CA 3WUCA 4NIHA 1BMV1 2PYJA 3ZDSA 1I9RA 2NN4A 2CY6A 3BI3A 5FZFA 1BBT3 3FAVA 2LJ2A 1H4GA 3TNQA 3SPGA 4JGSA 2BFUL 1JJ2U 4H55A 2VZTA 4AF9A 4LPLA 1W90A 2NLRA 1ENXA 1JJOA 1WB8A 1GZTA 4XDPA 3CE2A 2OQ7A 2GTSA 2DTWA 3VBSA 3THDA 1E79G 3H8XA 5LMNO 5FREA 4LCUC 1VBD2 4EEQA 1M57B 5F5CA 4SBVA 4MLOA 4PD4F 1LEMA 4OCTA 3BY6A 2ZM6O 2R1DA 3JSNA 4FFBB 2ZDIC 3GBWA 4MVOA 4JZRA 1NG0A 5DAQA 2ZGPA 5FPXA 3PURA 5CNAA 3WG7B 3D36A 2A3WA 5EJZB 2ZXWB 2WO2A 4LJHA 1JODA 1VALA 3PIJA 4OULA 4OYUA 1H4HA 3K4ZA 5ERLA 1PHMA 5CA0A 2B5UA 4JI1B 1GUIA 3U1XA 4Q8KA 2R9AA 2FZ2A 2ZINA 1VBA3 1COWG 1QJU1 5BV6A 3AMHA 1HP8A 4WFFA 1W6PA 1W05A 1X59A 1TUEB 1QHTA 4KWUA 4QPYA 4CUGA 3ASNC 3WDUA 5DN6G 3I2HA 2X5IC 3WX5A 4FLTA 2TEPA 2YC4A 5IATA 4QX3A 4K3UA 5JVDB 4DO2A 1UAIA 1IXMA 1GAXA 3UV9A 1AXYA 3ZRWA 3GWOA 5E1AC 1SFPA 4MOAA 3ZCCA 3MPBA 4E4SA 1UW8A 3VKFC 3GCXA 4FPFA 1SLLA 2DWDC 4I0BA 5FCCA 3DXUA 3RI9A 1EPZA 4CU8A 1CZTA 4PQQA 5CU1A 5EQUA 1C28A 2DVFA 4KU8A 2ZR3A 5F6LB 2WYFA 2EJRA 4JI6O 4IESA 1SZBA 1RUI3 1V0AA 4IEPA 4YZ4A 2QE3A 2CAZC 5A3MA 1RXGA 2WIIB 3AKQA 1K5JA 3D0JA 4RL7A 3WW3A 2JG8B 5IDJA 3WQBA 3E5QA 4GMP0 4XBFA 2WT2A 2OZ6A 4KWKA 1KKDA 2Q5ZA 1G86A 2RJZA 4O4JA 3J80N 1SERA 3ETGA 4R50A 3KSCA 4CS2A 2YEVB 3BAAA 3ZFEC 3PU3A 4HNAA 4ZU4A 4GWJA 4DR5O 3EHBB 5CA6A 3E6CC 2VUDA 1D5NA 1W0OA 4QT6A 1VP6A 2DFCA 1P49A 2A7AA 3O1SA 5FTTC 1FXKB 1NVPD 1R081 3OTOO 2BTOA 1IBLO 4N9IA 4CXYA 4DUWA 4FOYA 4NMIA 1ZBA3 3T0AA 3PMEA 1ZZ9A 4Q4Y3 1A8DA 5IYDO 1Q8SA 2YB7A 1RUOA 2EIGA 3POIA 3AVRA 4RWUA 4P08A 2OCCB 3ZO0B 2NMOA 3ENRA 5F2VO 3D8CA 4R8CA 3E97A 4Q0UA 2HKOA 1VMHA 4DFSA 1BHAA 1YI7A 1ZRIA 3IDEA 3OR6C 4IIJB 1R3JC 4KBBA 2E5LO 1VB4A 3KZ4C 2FMDA 2L9LA 3AL6A 1M56B 4W8JA 4CEWA 1PX3A 3ACFA 3ZFFB 1PK6B 1NT0A 1FFXA 1DF4A 2C9AA 4Q0SA 3IKWA 2XJSA 4A42A 2G9ZA 1R083 5CN0A 3ABMB 4BIFA 1SZTA 2EZOA 3P3NA 3VBSC 3UKTA 1H2NA 1OSGA 1YIPA 5DUUA 4XTMA 5LA9A 2C0ZA 1SLIA 5CKQA 5DDJ2 1MSWD 3I97A 3RGBA 3SYPA 3JSLA 4LLFA 4FPYA 4J7KA 4ZS2A 2D6PA 2C1FA 2HH9A 3H8UA 1CJPA 4XFIA 4KG8A 2BGPA 2EINC 2F4VO 1AVBA 5FY4A 4DR7O 2BEOA 1N33O 2B7YA 5A7PA 5T52A 1F51A 2ZX3A 4E27A 1P7BA 1JFFB 1JYNA 2OIEA 5LGTA 2ZACA 4OZXA 4WM7C 3K4AA 1KDMA 4PDRA 2ZHKA 4UB6Z 1P84F 4IEUA 1OCZC 5C70A 2R072 4JV5B 2ZEZA 2DFBA 3WDVA 3VD9A 5IY5B 5FY1A 4LEJA 4E2QA 2W39A 4Y22B 1UN1A 2VULA 3LA2A 1HRI1 3MIEA 2WJSA 4UW5A 4IEYA 1B09A 1Y9GA 2FMLA 3INAA 3WNOA 2A1XA 3FN9A 1VP7A 5JOYA 3KD4A 4NIDA 1BSMA 5EZWA 1COV2 4UW4A 1SF9A 5BXZA 2Q6AA 3VZOA 5B4XA 5AG2A 2EJ7A 1VF6A 4JI3O 4URAA 4XDQA 2IFWA 2ADPA 4BIZA 1I1EA 4FFBA 1S5HC 3POJA 2QKAA 4P9PA 3TK1A 1UZVA 1OUSA 3HT1A 3V0BA 3SYAA 1G9FA 1MPXA 5LYJA 3A0HZ 4JTAB 4MW3A 1S55A 4DV7B 4FP2A 1NCRC 3NNMA 2VXRA 2WNVA 5C8CA 4DV1O 3AKSA 3LEGA 3F7VC 3ES1A 4JI0O 3N9MA 2L6LA 2B9UA 5EFUA 1QR9A 3RN4A 3SDLA 4MVUA 1RUD2 4CPBD 5JSOA 3ZFFC 1GTOA 3STLC 3M1HA 3A22A 1MQTA 5A1LA 4I55B 1V55B 4QB1A 1NA1C 3BCCH 1Q90D 3CRMA 4X8PA 3UNPA 1B35C 2EIDA 2XMLA 2WWJA 3VQXA 5FO8B 3FBYA 1OPMA 3JD4A 1HXS2 3THTA 2NR5A 3WZ1A 2BCCH 4CU6A 3TEWA 1VBE2 3R6SA 1UD1A 4AXOA 5LMUO 5FKCA 3ZPOA 3B9IA 4JI7O 2JD4A 3M4FA 3ZN6A 2A3YA 2PI4A 4S2HA 3L72H 4UCOA 4IHJA 3SYOA 5KUMA 5I93A 1WZXA 3A0NA 4B3SO 3DPRB 1ZVFA 2BWAA 2ZOEB 1NLRA 4WM7B 3N9QA 3TRSB 5DEDA 3VD7A 1UY3A 4NWVA 1YEWA 2KG7B 5EBMC 4LO5B 1V9PA 1XB9A 4PBPA 4KGGA 1J1TA 4C8DA 1UZWA 1DF5A 2BDRA 1EP0A 1I94O 4Q26A 4QHZA 4CXXA 4BXSV 4QX2A 2PQSA 1ULOA 3QCWA 2WNUA 4GH4A 3MHHC 1BBT2 2DCZA 3FUQA 2LTNA 2ZGUA 5K0UB 1FPN1 1TQ5A 1Y4WA 1CGPA 1QF3A 2NN8A 3SISA 1GWMA 3AG2C 1D4M2 4GLXA 1ZUQA 3H01A 3THCA 4CDUC 5TISZ 2VECA 1TME3 2JDYA 3AYEA 1CAXA 4LQRA 1OF3A 2BPA2 2W9XA 3MW3A 2HFEC 1WMDA 4XABA 3K06A 2QM4A 2WLKA 1PO21 4MGIE 3FD9A 3D4KA 1OFSA 2WSVA 1PL0A 3GF6A 5C8CC 5FZMA 3SKVA 1R1A2 4MTXA 3KF5A 2PHLA 5C6CA 1GNHA 2ODMA 3ASOC 4ITCA 4AZZA 5C4WC 4FIPC 1QJU3 1FFXB 3AFGA 3NAPC 2IVIB 2XT9A 2C26A 3LD8A 1IG0A 2VE1A 4FO9A 2JDAA 3S5QA 4IIJA 4QMAA 1N3OA 2GHYA 4H37A 4LP8A 2XTAA 2LRPA 2VZPA 3VDAA 3IJ4A 1FOD3 4R7CA 1GKBA 1STMA 2VVDA 4P9GA 5B4NA 2KR2A 2OZJA 4IL7A 2V7QG 1R093 1CN1A 1R082 1XNAA 3GWKC 1ND2A 1KBHA 4V2WA 1AI5A 2GUZA 4UFJA 3I2OA 5IYCO 5G04L 4I3PA 2RCVA 3CRAA 3OMNB 3VBFB 4B4RA 3RYIA 1OI6A 3WNNA 3J8F3 2BTVC 4EWAA 5LP6C 1C57A 2IXKA 5FZIA 3A0KA 2QKCA 2Y38A 4YW7A 4DUYB 3K04A 3ASIA 1OKQA 3KWVA 4MXVA 5IWFA 2ZZJA 5ACA3 2N04A 2ARAA 3CQOA 3T1MA 2P5OA 4LITA 1JPXA 3ZXAC 4MX3A 1SFNA 1NKDA 2AZ0A 4YM0A 3AP4A 4JYBA 2B4KA 2W91A 2WWSA 5LMUB 2GNMA 1UY4A 3WEZA 2D40A 1BMFG 5KXBA 5FMCA 4RQPA 2JEMA 4QU1A 3RZKA 4NRQA 1WW5A 1QJX1 5FYCA 3LSQA 1SBFA 1QBZA 3BPSA 2QM8A 2BYVE 2CTRA 5LA1A 2P3YA 3LQCA 2EXIA 3RFRA 1R091 2IXIA 4H3WA 3TN91 3NQHA 4GWMA 2XAFA 4PIZA 5FYTA 3POFA 1O3SA 1Z5VA 2UUCB 3N7LA 4TN7A 3ZMSA 3RYRA 1H8TA 2VMIA 4AFMA 4F6RB 4PJYA 2PHXA 3SITA 4RR3B 1V55C 2VNVA 4A2UA 3J8F2 4QPIA 3NR7A 1PIV2 2QQIA 4L97A 2WWUA 1JOJA 1T2XA 3FX3A 4DUZB 4NXNO 4E4HA 5H6RA 3J7NA 3SJQC 4X1IB 3NAPB 3N9OA 1XMOB 5D1IA 1W2AX 4EN7B 1AYM2 3JYCA 3DXTA 3KT1A 5T5LA 4E4ZA 4IEZA 2LM3A 3OCPA 2GC3A 5FK8A 3CMAV 4ZI7A 3DPRC 4LKFA 3AG4C 2D6MA 4YPJA 1QJU2 3AP5A 1OQDA 3AX4A 3UK9A 5FQ0A 3PLQA 3TN93 3OFNG 3JAWA 4JGZC 5JPNB 3E35A 1KFUL 2I74A 4A5UB 1RUD3 3N7MA 2ZE7A 5DZFA 1ULGA 1PNKA 5GLWA 2ZEYA 4OUEA 4Q4Y1 1DP0A 1B35A 1OHHG 1KS4A 4WM7A 2CTPA 1ZZ7A 3MO4A 2IZWA 1QJZA 1F4NA 2W6IG 3I2IA 3CWBH 4X89A 1W2BU 4UBHA 3HMYA 3ZN6B 5FY5A 3JU9A 2W94A 1FT9A 1OHFA 3T09A 3LUTB 2KG7A 2JDPA 4PDWC 3WHUA 3WNPA 4DY3A 1WPXA 2VJXA 3FHIB 1OCRC 2JDIG 4E2LA 1QXJA 1PO12 4AVBA 2MNGA 4K8FA 3WG1A 2E7QA 3D3QA 1FXZA 1ONAA 2XVKA 1K92A 5FYMA 1KP2A 5C5UA 4HBNA 1YQ6A 1H0BA 1GM7A 5T3NA 1HLCA 2O0OA 1R1BA 4IEXA 4DR1O 4EZ4A 4FPKA 4NYKA 1M5IA 3DGEA 5LGUA 3WVJA 4RGAA 1Q8OA 4AQ6A 2JGDA 4DV7O 1DGSA 5GLVA 1MZEA 1BQZA 4XHXA 5BNPA 5T5JA 2DE0X 4IV1B 1QLEC 3GM8A 4DUXA 1RPOA 4YM2A 4G28B 1MEC3 2R062 4BLJA 3O0XA 5F6KA 1C1LA 2WNEA 1Y43B 4E8DA 1COV3 4CEWB 4XTPA 3LGRA 4I0WB 5JAXA 3K79A 4L2NA 3FYEB 1THZA 1V54B 5EK0A 4JGYB 1DG6A 2BQPA 4TT3G 4OFGA 2IH3C 4QPWA 3CEIA 4OHVA 2WQZC 1B06A 1QVGU 2ZGNA 1RP3B 4JGYC 2Q7HA 4DW0A 1QIQA 3K58A 4B7EA 3TGUH 4CDQC 1SRYA 5KHGA 3PVNA 1Q56A 4AHWA 3O7OA 3OBTA 2W08A 1UZYA 1PP9H 4LH6A 4DR2B 2ZE8A 2WPDG 2MW2B 3S3XA 3EVKA 4CEYB 2Q69A 2KM2A 2XL9A 2XG3A 5J98B 4FPJA 4CUBA 4XBQA 3HR9A 1DIWA 1QQP3 3RZLA 4WM8B 2DVBA 3JB4C 2NMNA 1AILA 3JASA 1UXXX 4DR6O 3AG2B 2VR4A 2O14A 3R0RA 1DGWA 5LK7B 1W8ZA 1MEC1 2OQ6A 4UFIA 3W58A 4LF5B 4LE4A 3WB0A 3GHMA 3B4SA 4OHXA 1KEXA 4WVMA 4X1IA 1LOAA 5T5OA 4BU2A 4YFWA 3AXEA 3CYOA 4M4RA 3DC5A 1FNZA 2W0FC 4RGGA 2HWD1 1NYWA 1N1YA 5G05L 2A6WA 1J3PA 4RSUA 4QB2A 1PNMA 2JG9C 2XAJA 5A3LA 4YJ2A 4DV0O 4AVSA 3L71H 4FLYA 3HD8B 1VARA 2HHHB 1PZ8A 5LK5A 4J7JA 3UCSC 1TA8A 4F6RA 4FPLA 5FUNA 2B42B 4YY3O 4JAAA 3H9AA 4LNUA 4QPGC 1XOUA 1JHNA 1QOTA 1O6UA 3PUIA 2P4KA 5FXWA 2E7AA 4QX8A 2DYRB 1IPKA 1J3QA 3WDXA 3C90A 3TETA 5FPBA 4CCCA 4CS4A 1SZXA 1C3HA 5IJ9A 3QLQA 1VAVA 3VDDA 4FMTA 1S2EA 5A33B 1MS3A 2X10A 4CC5A 2E9QA 4LF8O 2AZ2A 2YXYA 1PVXA 3LDCA 1XNRO 1BGYH 2QEXV 4JI5O 4I9QA 1C5HA 1YCIA 1XC6A 4DYLA 1W8WA 2UY8A 2XNDG 4BMBA 5EC2C 2UXCO 5L3DA 2CTQA 3KQRA 3IN9A 3IDBB 1RHI3 3S30A 4P00B 4N43A 4QGLA 4L9BA 3MAQA 2HBUA 3FBMA 2WKKA 3FX7A 3K08A 1J83A 1GN2A 4EB6A 2E31A 5EIYB 1FOD1 4NPRA 2P17A 4ISRA 5A7QA 4G9SB 3AZZA 3K5OA 4IQPA 4OI2A 1Q8IA 2JDMA 1WP8A 1BKZA 2GTAA 2JGDB 2Q7EA 1NQDA 1JXNA 3NV2A 1WA4A 5A80A 1XE8A 4U7NA 1HRV1 1NXMA 5IYZA 1RSOB 3HQRA 1RUI1 1RINA 3B8MA 2W92A 3AP7A 4EQVA 1TNFA 3CRQA 3VD4A 4MH0E 2Y4TA 3SLIA 4FZ1A 4EN6B 1UZ0A 2W52A 3K75B 4JDOA 2A0LA 5ACA1 3UT5A 2D6KA 4O7XA 1GRJA 1ND3A 1NCQC 3OG2A 1BEV3 2ZX4A 3JATA 3OEEG 4MVSA 5EIBC 4UFHA 5DDJ3 1S0BA 2WC2A 3ACHA 3T0DA 4UI9L 1J58A 4Y1XA 2ATKC 2VUCA 4Y26A 2EIKB 3GBGA 2YI9A 4M3CF 1EV12 1NLSA 5C4WB 2P34A 3MPPG 3JASB 2LQTA 2ZGTA 3NL1A 5FMOS 5FZOA 1LR5A 3C3TA 4ASKA 1RITA 1SEFA 1ZA4A 2Z2SB 4JCKA 2JJ1G 5HCHA 2AXTZ 1RUE2 4HG6B 2P5BA 2PXJA 1XPWA 1NXD1 2ZZQA 1EAH3 1VQNV 4YGEA 2P67A 2QCSB 2DUOA 2CK3G 3RS6A 5A70A 2R70A 1Q7YW 4IHJB 1HN1A 1QNWA 3SCHA 2LW1A 3BTZA 1E5RA 1N34O 1BJQA 3WG2A 4PF5A 1GSLA 5FOBB 5JCOA 5H9RA 5FZLA 1QQP2 4Y4RA 1YJ9V 1DGRN 4UXAA 2R9IA 4UCUA 4HXCA 4UB8Z 1PGW2 3H3LA 2F6BA 4YG0A 5DDJ1 1SQ4A 5BUVA 1MS9A 1G1XB 2VZVA 1F31A 1IBLB 4XF0A 3JZVA 3OR7C 2XPJA 4LA3A 4IERA 3VGIA 1JZ3A 4B3TO 5LRSA 3ZKYA 3KKYA 5D5PA 4LNVA 4XCAA 2QJVA 3I3MA 1F23A 4FTBA 4AQYO 2RDSA 3SNMA 4CP0A 5AC92 4IGPA 1Y6XA 5FZ3A 4LF4B 2BSKB 2ZGRA 1T6GC 1IZ3A 3X29B 4O2AB 5I0TA 2JEXA 4K7JA 2ZA9A 2QSAA 3STZC 1ULPA 2XL7A 3MV11 5E1RA 4RS5A 1Y74A 4UOJA 2V4DA 5CISA 3OPTA 3T1HB 2N05A 1DZQA 4JI7B 3KLSA 1QJFA 1D4VB 1M4WA 3AZXA 1VQ4V 1PK6A 3WG4A 3PIGA 1HV0A 4N7UA 1Y76B 5GJ6A 1HNWB 2D93A 4DR3B 1JUHA 1QR8A 1PGW1 2R32A 1QMJA 3ZFEB 1IPJA 1MR5A 1W99A 1HIXA 1UNBA 3NNLA 5LRRA 1GZWB 2VCMA 2P6HA 3SH4A 3VDBA 1XBFA 5E8AA 4JI4O 5CA1A 1H2KA 2OKXA 4JDNA 4JZGA 1GOHA 4CDWA 2C6SA 4LKSA 3VDDC 2V5YA 4DXZA 3NSTA 1R6TA 4FPOB 1HWYA 2VMCA 4FJCC 4OZOA 3ABKC 2WLQA 1ENQA 5IE9A 2HEVF 1X33A 5A32A 2YBKA 2D98A 4BQ4A 3C7EA 1VRBA 4XXAA 3BPZA 4TUYB 3QD6A 5HCBA 4LHSA 4DXRA 3VD5A 4QQ2A 3IFXA 2NNUA 4O4LA 4FOVA 5J2TB 1VAMA 3MDPA 5JIAA 3QO8A 2VWJA 2XHNA 1I5XA 1XOYA 3JD72 3ZR6A 4LT5A 1CONA 1R3LC 4DV2B 3IIAA 4HONA 2P3JA 3UGHA 3SH5A 3GALA 5F5IA 5FIXA 2JIGA 1F5FA 2WLHA 2JG9A 4Q1PA 3FMGA 3ASNB 4OUMA 4QXBA 5I91A 1MSDA 4JRLA 3SYCA 4FFKA 2Q4SA 1OLMA 2ZBJA 3VBFA 5F8PA 3O1PA 4P9YA 1ND3C 5K4LA 3I2DA 5JH7B 4UF0B 4ZHQA 1SPPB 1D2SA 1N3PA 3SMHA 3RVYA 5L7OC 5DUXA 3WW2A 3L2YA 1JOBA 1R092 5JQGA 4LKEA 1BCXA 5CFCA 3CJHA 2RMU2 3P1IA 4CCLA 4COWA 2W95A 4AVAA 1X9TA 2XB6C 1J1LA 2HWB2 2QQJA 5T5PA 1SCRA 3N35A 4BYYA 3U4XA 3WQ7A 2ZNJA 1W6MB 1YI2V 3T0BA 4DRVA 3ZYPA 1ZZ8A 5FZ4A 4K3AA 1MABG 1UYPA 4NXMO 5LBEA 1XRUA 3J7HA 2GMPA 1ZM1A 5HV0A 1ZRFA 4TLGA 5IAVA 2W5FA 2EIMB 3A0BZ 3VHOA 1G4YB 2XUEA 2DYCA 1K73W 1DBNA 4UV9A 4GXLA 3H3UA 3K48A 3LIGA 5IY5C 2HWF3 2MEV2 2DU1A 4ARYA 4NVPA 1Q5OA 5KHIA 4Q4Y2 3U4SA 1MVQA 2Q68A 3AMNA 1AL21 3OEHG 1O91A 3L9JT 2VZSA 4M3CE 2BU9A 1FATA 3BIEA 4GB33 4D6TH 5CBFA 5FZEA 4KNCA 3UJOA 5IK7A 3DL3A 3E6DA 3LIHA 4X6RB 3RYCB 2EAKA
chains in the Genus database with same CATH topology
4QPYA 5C9AA 3M2MA 3T2TA 4BPZA 1WCKA 3WDUA 3WX5A 2X5IC 1W6OA 2ZGQA 2TEPA 3USUA 1H1MA 4K3UA 2PAKA 5F5QA 3RWNA 3WOGA 4XIKA 1UAIA 4Y1YA 2NP0A 3UV9A 1AXYA 2X5IB 1MACA 2OIIA 2ZGMA 4L8QA 1U5ZA 1BQPA 1TE1B 1GICA 4Q4V3 4XJ8A 2A6ZA 3NV1A 1NOVA 4LBKA 5L7OB 1NQJA 3JBG2 2D5HA 3OJBA 3MPBA 4CP1A 4X6QB 5K0UC 4E4SA 1UW8A 4QPGA 1FYUA 4CP2A 4O9GA 3VKFC 1V6KA 4FPFA 1SLLA 1PK6C 4L99A 5KWRA 4I0BA 5FCCA 5BNNB 3S0MA 3K51A 3RI9A 1GZWA 1EPZA 4IV1A 1YNAA 4LBQB 5CU1A 1QJY3 4J6GA 1C28A 2DVFA 4KU8A 1ASJ1 5F6LB 3WCSA 4IESA 1W6QB 4Q4V2 2ZX0A 1RUI3 2VQ0A 3DN7A 4XFGA 4FTEA 2GMEA 4DRRA 1CAUA 4IEPA 4YZ4A 3JD71 2QE3A 2RS53 1OIIA 1RHI1 2R1BA 2GU9A 5A3MA 2K0GA 2WIIB 4XW3A 3M3EA 1RUC2 1AL22 2HEWF 3D0SA 3AKQA 2RS31 3RPQA 3N3HA 4NO4A 4YW3A 3D0JA 4RL7A 3WW3A 1OLRA 2JG8B 2H0VA 4YGBA 3OTFA 1VBC2 3FFQA 1AL23 3E5QA 5C9AC 4GMP0 1ALYA 4HKOA 1UZZA 2OUHA 3VZLA 4BG1A 1OOPB 2WT2A 4D7SA 2OZ6A 4KWKA 4JDMA 3RMYA 3EBRA 1G86A 4AEDA 1OLQA 1UU4A 5FAXA 1IGOA 2VNOA 4CWDA 4XF3A 4LTAA 4TLFA 5JLVA 1TNRA 4F3JA 3KSCA 1UPIA 2DU0A 1V00A 4FOQA 3ZFEC 3VHPA 2RR11 1U12A 3V0BB 1RUJ3 1E57A 4ZU4A 2WNUC 4XEZA 3V0AB 2TUNA 5CA6A 1F2NA 4PCRA 3E6CC 2I2SA 3I59B 4NWWA 4HLTA 3CL1A 1W0OA 4QT6A 3EQEA 5CFDA 1CVNA 1VP6A 1DFQA 3UKVA 1XNBA 2DFCA 3VKOA 4LO4B 1QU0A 3WW1A 3RG0A 2A7AA 5E16A 1ULEA 1YLLA 5FTTC 3GZTB 4YYOA 2A3XA 2YY1A 1R081 2VW0A 1WLDA 1BVP1 2GN3A 4BWOA 4R9CA 2Z5WA 3GHNA 5FFOC 2PLV3 3AMMA 1IOAA 4Y20A 1FNYA 4N9IA 5HCAA 2YGLA 3B93A 4D3WA 3AP6A 1OQEA 4FOYA 1ZBA3 2E63A 1DQ4A 3PMEA 1FMD2 1ZX5A 1ZZ9A 2HKXA 4Q4Y3 1A8DA 4ASLA 3JD73 4KU7A 2WZR3 1Q8SA 1RUOA 3S6PA 2EIGA 1IS5A 2JX9A 1UPSA 1IS4A 2QQPA 4HL0A 3RZZA 3LOIA 4OI0A 4FFAA 3WDWA 3VN4A 3ZO0B 2NMOA 3ZSMA 1MZ6A 3ENRA 3SCFA 3D8CA 3SWTA 4D7TA 1REFA 1UCXA 3ZFGC 3E97A 1QJX3 2A5ZA 4Q0UA 3VBRB 1VZ4A 1D4M3 4DFSA 1IHMA 1CPNA 1DYKA 2YPJA 4YGDA 2ZX1A 2ENRA 2BW8A 1YI7A 3VBHB 1LJ7A 3ZFGB 1RVF1 1EY2A 1NCQB 4GIQA 3ZFEA 2PFWA 3IDEA 4LULA 5BNPC 1AX2A 1V6OA 4CTEA 4JGZA 4KBBA 1VB4A 1JW6A 1KD7A 3KZ4C 2FMDA 1WW4A 2ZMKA 3MIGA 4YG6A 3JBG1 2R073 2WINB 4QM9A 4CEWA 2VW2A 3MIFA 3ZFFB 1GNZA 1PK6B 4AVVA 3KT7A 1G9BA 2R043 4L11A 3TAYA 2WT0A 2P2KA 5EWSA 2C9AA 4Q0SA 5J37A 2HWE2 4RR3A 3IKWA 1NZCA 5AFBA 1ND3B 4XQDA 2XJSA 3MLLA 4C1WA 4KWJA 1JTZX 1H8TB 1NCRB 3ZVXA 3VHNA 1XYPA 4XMAA 2VH9A 3SH3A 4AI0A 2X8KA 1R083 3MLJA 1PO23 4BIFA 1O7FA 4CDXB 3DF0A 1Q3EA 1QKQA 4Q2FA 2BBVA 3P3NA 3VBSC