1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
1H2MA 4NR1A 2Y0IA 1H2LA 3P3PA 4JAAA 4B7KA 2CGOA 1H2KA 1MZFA 3D8CA 3P3NA 1IZ3A 1MZEA 2W0XA 4Z2WA 4QU2A 2WA4A 3OD4A 4AI8A 1YCIA 2CGNA 2ILMA 3KCYA 4Z1VA 4B7EA 2YC0A 3KCXA 4BIOA 1H2NA 2WA3A 5JWPA 2YDEA 2XUMA
chains in the Genus database with same CATH superfamily
2B9UA 2W0FC 3B9CA 1PVC2 5D2AA 1H8TB 2FDFA 4JI8B 2Y6KA 4QQLA 4DV5B 2RR13 5BNPA 3PHMA 4LO7A 2J1RA 3LA3A 2D2CB 2YZ4A 2XJSA 5D1IA 4FPLA 3RNSA 4P02B 1H2MA 1AXZA 2WLPA 3KF3A 5IATA 3CCVV 1RINA 2SLIA 5JCOA 1UIKA 1WW4A 5IAVA 3HKCB 3HN1A 5LXTA 4QE7A 2WSUA 1W28A 4AI0A 2F4LA 1NE4A 1E57A 2Z69A 4MVSA 3DPRC 3HNBM 4E2LA 5EJ1B 3VD7A 2Y8KA 1NCRB 3LFMA 1JZ2A 4ASUG 3HWJA 4JV4A 4CDUC 1SF9A 1V6OA 2PI4A 5EC2C 1H1AA 3CCUV 1FXKC 4E4SA 3SR2C 3DXTA 3DCQA 4DR4O 4KG8A 4UW3A 4CH6A 3E5QA 3AG1B 4HKLA 1WA8A 3D0SA 4UVBA 3RYPA 3BI3A 2JG9A 2QKDA 2PQSA 1GWKA 4XFFA 2NMOA 3UT5A 3GGLA 3D5OA 4GB33 1ZZ9A 1ZRDA 2A6VA 5CISA 3USUA 4LCUC 4WFFA 1W6MB 3T1HB 4YXWG 1VP6A 4PQ9A 3T2TA 1HB2A 3RBZA 1G1XB 5ACA2 5LZ6A 2LROA 2WZ8A 3AK2A 2Q7EA 3APOA 4TV9B 3RZJA 1QR9A 4X1YA 1W0OA 2W95A 1HKDA 1QOOA 2A3WA 1NR1A 1N3OA 5A6ZA 1TMF1 3FX3A 3AB0A 2DVAA 2FZ1A 1ZBE1 5C3OA 2K9PA 2PLV2 4RFRB 1FNYA 1AYM3 1DGRA 3SPGA 2Y48A 2UXBO 4RA0A 1WD4A 2MEV2 3J7MA 4DR2O 4FXGB 1JMKC 4UFLA 3KMHA 2YGLA 1SQXH 4GULA 2D44A 5CBFA 1VBD1 4XFCA 5DQ0A 4Q0UA 2XQRA 3R0RA 1WA4A 4UCSA 2Q1ZB 2W87A 5IYBO 4FLVA 2A06H 4O4IB 1EAH2 5FLXN 1IG3A 1B35B 5KBFA 3OEBA 2B5UA 4JI7O 2QEXV 2V5DA 4Q27A 1R6NA 2HJIA 2Y64A 2QQNA 1CAXA 5JXJA 3JQXA 2AHZA 5LHIA 4YZ5A 4Q8KA 3CLPA 5FZIA 3WUCA 2YIDA 1SQBH 2Z0AA 4IEWA 4YPJA 2Y6LA 3SYAA 5LYJA 1ZX5A 4PI0A 2HWB2 2DWDC 3DXRA 1OLRA 1FYJA 1AR72 1E5SA 3A22A 2FB5A 3B9IA 3RGBA 4CCEA 1ZYBA 4EWDA 1IPSA 5FQ0B 5GZEA 3NV2A 4CZSA 1ODMA 2W1UA 1XEQA 2QJ1A 1HNXO 2RM21 2WSVA 4JQTA 2VQEO 4P08A 5IWAB 1FI2A 5C5UA 1OPOA 4B7EA 1V9PA 1O4ZA 1IS3A 1VF6C 2PY5A 3Q8CA 2CDOA 1SLCA 4IE6A 2ZGOA 3OGCC 4C7UA 4YVWA 3WP4A 4R4XA 5L7OA 4PF5A 2WLLB 4IUGA 4AGGA 3ZSEA 3GALA 2ES3A 5A7WA 3ENRA 1ENVA 4PIYA 1ND3C 5A2QN 5A3LA 3G6EV 1HQNA 2ZNIA 4HVOA 3WEZA 1OF3A 5FV3A 4Q4X1 2ORXA 1AYN3 5BMVB 3WDUA 1LENA 4G4FA 4W6WA 1P7BA 4DXWA 1QJZA 4X64O 4UB8Z 2HH9A 3H1KH 2R30A 2BVVA 4XAAA 5C4WB 3BTXA 2IH3C 3WCRA 4MW8A 5FLIA 1RHI3 4D69A 1ND2C 2QDOA 2VOXA 2VZ1A 4JTDB 2J1VA 2E31A 4H13B 1ASJ1 2AREA 4D3WA 3WDWA 4DUVA 1U0AA 3GCWA 2IH1C 4I0AA 4Y4RA 2Y0IA 5CBLA 3K9SA 1LUWA 4PIXA 2PYJA 3WNKA 1LOEA 4I2OA 1JYXA 4DK0A 4TSFG 4KQ7A 3SCHA 3B5LB 2VMHA 4ET7A 4JI6O 4R6ZA 4DQAA 1C57A 1TVGA 2WQZC 2QM7A 2VOWA 4BIZA 4QU1A 2UUAO 3IC7A 4NRMA 3VKNA 5FLHA 4DR4B 2D5HA 2X10A 1S76D 4R7CA 1NT0A 1Z7S1 3MLKA 4DXRA 1URXA 1NAEA 1RMU3 5CFDA 4RQEA 3VHRA 5LEKA 1XU2A 3CWBH 2VBBA 4E4DX 1AR82 2WWWA 2D6PA 3N2GB 5DAPA 1R082 2AHYA 1S0FA 1CX4A 3GM8A 4A7KA 4UXAA 1PIV3 1WLEA 4AWDA 3WR0A 3AG2B 3CCQV 4AEDA 4AAPA 3CCRV 4XTMA 2JDAA 4K9SA 3AM2A 3VBFC 1KS5A 3OCPA 2GNMA 3J7NA 5KA6A 1IGOA 1VRH3 4IEXA 3IGAC 1UYXA 3ZIWA 1WP7A 2RS53 3UKMA 1AR61 5GZCA 3TRSB 2YXHA 3FMGA 3TXSA 5LA1A 2UWBA 4CZZA 1DF4A 2WJSA 4FPJA 2UXBB 1ZBA2 4F6RB 2OT7A 4DV1O 3NKGA 2EINC 4K6BA 1JZ5A 1Q43A 4EFBA 4LNVA 1S0BA 2Y26A 3A23A 5FZBA 4DR2B 2XJVA 2W52A 1BBT1 2WYFA 2QQOA 3THTA 4BK4A 3VZKA 1AI5A 1DLBA 3PN1A 2XHKA 4BQ2A 2W1SA 1N47A 1HDJA 3DPRA 3LKJA 4Q4Y3 2Z4FA 3AKSA 3HB3B 5B3SB 4YZ1A 4FFKA 3AP9A 5T5JA 4CDUA 3WSOA 4JRAA 5DDJ2 4L0PA 2YV8A 4JI7B 1FXKA 4NUBA 2H0BA 5FMOS 2H3OA 1R1A1 3KKYA 2VNRA 2HWD3 1AP5A 5FNVA 3AVSA 5BNOC 4TLGA 4KWJA 3ZRSA 2VTXJ 1N8RW 1XNQO 1MSDA 4EKWA 2WZR1 1Y74B 1QNMA 3PTRB 2JX9A 2ZX0A 4K40A 3WNPA 4Q6GA 4AFAA 3N2KA 1QHTA 2WLIB 1K7DA 2A3XA 4P9OA 2RS13 5EYXA 1RVF1 4GWJA 1W04A 1XC6A 1DQ0A 3ZLIA 4GMP3 2YFZA 3K57A 4Q4V1 2R72A 2YGMA 4ZHQA 2BZDA 2Y60A 4OHYA 2WPDG 1HNXB 1PO13 3OTOO 2ZDIC 2VQEB 3CRQA 3ZMUA 4FZ1A 3HAGA 5FZMA 1NKGA 2ZE5A 3ACFA 3J9SA 5LOVB 4LIUA 5F3EA 1M1KW 2XJQA 3FHQA 3Q4HA 4B1LA 3B02A 4RYDA 3S7EA 4JTOA 4LIVA 5H9PA 4CXXA 2JG8B 4BLJA 3L75H 1OD5A 4GQ7A 3GF6A 1XQ8A 5C5TA 3E6DA 2ORZA 3AG2C 4FLYA 3ABKC 2ADEA 3CU7A 4IE4A 3OGRA 2OXBA 1HV0A 1PM9A 1K12A 5B1BC 4AHZA 4O61A 5LBEA 1WPXA 3PVEA 5KWRA 1W3VA 4LH6A 4CCCA 3MLLA 5LBFA 3G6BA 4A41A 5FXXA 1H2KA 4X64B 5L3GA 1XRUA 3AEIA 4O7XA 1D2QA 3C7EA 1CPNA 5FO7B 4ORFA 4S2FA 2VW1A 2E74B 2M6YA 2QZ2A 3K08A 3VD4A 3KV4A 1AB3A 1X9TA 1TMF2 4A2UA 2VXRA 1H8VA 3T1CA 2BJSA 1Q86W 5LRRA 4R9AA 1ZBE2 2OX0A 4EFEA 5FPBA 2XH6A 1PO23 4M3CE 5IUQA 3DGTA 3VBUC 4FLZA 4B3TO 5CG9A 2E7QA 2OTLV 1W8ZA 3ZYBA 2HKXA 4LF9O 4JI6B 3L9JT 2C6SA 3M70A 1LOAA 2P3JA 2BGPA 2P5OA 1VBD2 2BTVC 5FPRA 2UUAB 1G6NA 4ES9A 1NU1H 2CE4A 1A6CA 1QH7A 4I02A 5FREA 3IC9A 2ZKOA 3H50A 2A3QA 1VF6A 4UW5A 5H6QA 1K73W 4OZXA 1W6MA 1YDXA 1HX6A 5CU1A 4OI4A 1AJPA 1YIPA 4XXPA 1JYWA 3IPVB 2WO1A 1SFYA 1S1AA 5LBBA 1ND3A 5JVDA 4XCAA 4MTXA 1LNQA 1W9FA 4OX9B 4ARYA 2GH2A 2W39A 4UFJA 2VCBA 3FUOA 1OXCA 3VBBA 3N9MA 2FKXA 5LASA 2VW2A 1G9CA 2ZKNA 2L9LA 3VHPA 2VZSA 5FCCA 4ZHNA 2B46X 1VQPV 4RWUA 3USSA 4DFSA 2HWE1 1F5JA 1K3IA 4DO0A 2VULA 4UCRA 5DECA 1ND2A 2JG8C 3RYKA 2XOKG 2RM22 4DV1B 4O4LA 2VUCA 1COV3 2HBUA 4QQPA 5A33B 4LFCO 5DN6G 4DXSA 2D6LX 3LSQA 3IMNA 2FDIA 4HKWA 4XBQA 4XUQA 3SXWA 1VQKV 1OT5A 2QVSB 1TEIA 4XUNA 4FLWA 1OVSA 2GNDA 1B35A 2FCTA 4KU7A 4XF9A 4NKGB 4FTBA 4IDZA 1JMUB 5AFBA 1Y67A 4Q4X2 1S5JA 4CXYA 4JRLA 2DMXA 4FQZA 3CPWU 3ZMVA 2A0LA 4A44A 4GWMA 1VBB3 5FYZA 1FAYA 3JUUA 3T0DA 2A73B 2WLKA 3TCUA 3ZMOA 3GZAA 1FXVA 1V0AA 4L9BA 1KGYA 1XNQB 3U4SA 3DSQA 3AK0A 1RB8G 1SQ4A 1SC5B 5FPZA 3C3VA 4O4JA 3OGGA 3T1LA 4XUOA 5F32A 3KGLA 1GM8A 1N34O 4F7ZA 1ASJ2 3UYJA 3JU9A 1RITA 1PKXA 4KNCA 4LLFA 5JJEB 3TJTA 5F6KA 3BRCA 4KBBA 3DTUB 5A7QA 4FVMA 4Q0QA 2D43A 3E22A 4QE9A 3OTOB 2ZXQA 4Q0PA 1CPYA 4QXCA 1UXXX 5E89A 1XU1A 1NCQC 4BH9A 2XAGA 1JZ7A 4IEZA 2YC0A 4CCKA 3SYQA 4JZRA 4LHSA 1Z7S2 1POV0 4RHV1 4AI9A 1U12A 1D2SA 3DUIA 4FM1A 5FAXA 1UY3A 4TYSA 4ONUA 4Z2AA 4AF9A 2FMLA 2FTKA 1AX1A 2XQXA 5J2UA 2AYHA 2EIBA 3GZEA 1KS4A 1OFNA 4MO3M 4A6SA 1S5HC 1ZUQA 3H9VA 4F6EA 2LP7A 3KF5A 2HYXA 3SGIA 4YVSC 1GQPA 4WFAV 2B1GA 2RDSA 4I01A 5BNOA 1AR62 3BEHA 3WW2A 1KFUL 1R3IC 3ITQA 2B39A 2PAMA 4K3AA 1JS9A 4DR5O 2XNDG 3D36C 4LKFA 4N7IA 1PVXA 5LBCA 2ZGMA 1RUD1 4B3TB 1BEV3 3QO8A 2IXKA 1LUVA 4LF9B 1L0LH 4XILA 1BBT2 3KHCA 2JDYA 1V6JA 4Z07A 3UJQA 1OCZC 2EXJA 3BU7A 1J58A 1WZXA 2PHFA 4W6XA 3APQA 3DV8A 2ZEXA 1Q5OA 2P5BA 1AILA 1CAVA 5AVPA 4DZGA 3PUHA 4H14A 1AR5A 2WS93 4LFBO 3OT7A 4AVCA 3AZZA 2QKCA 1RUI2 1QU7A 1I08A 4BQ5A 3ATGA 2EIMB 3K58A 4FI9A 3WW3A 3QTCA 3N2GA 2RMU3 4BOWA 1JFFB 1R1A2 2Y4UA 1PD3A 4EN0A 2A71A 1NI8A 3O12A 1JR9A 2I74A 3IZOA 3T2PA 1NXD1 3FFZA 1ZZ8A 4HNAB 1U97A 3H3LA 5DAQA 3VZMA 2RDCA 1PMIA 2ZZQA 4OPAA 2W2IA 3ZO0B 4AEMA 2WZR2 2WFPA 2Q0OC 1O4TA 1IURA 4MGIE 4UCUA 1PVC3 2ZHMA 1LKNA 2YFUA 3A21A 3ZSKA 1KJRA 4HBNA 5EYYA 2ZPXA 1VE0A 5EC1C 3VZNA 1RVF2 3V0BB 5A9GA 3H3ZA 4UWDA 3IN9A 1C3HA 4Q4V2 4F6RA 3ASOB 2RN9A 4MVUA 1R1ZA 3P5BA 4XFBA 3WHTA 1XI1A 2CWSA 1V54C 1LU2A 4AI8A 3QLQA 5LATA 2DVFA 2Q8EA 1H2GA 3GNEA 3I56V 5C3SA 2XPJA 1PL0A 2CNAA 5JQGB 3KT4A 2ARBA 3CP1A 3LSDA 3VBUA 4OZOA 4J7JA 1A3KA 1ZM1A 4H3WA 1L0NH 1U5IA 4GYCB 1R091 4JGZB 3E6CC 5C33A 3MF6A 2XOMA 1LU1A 4JYAB 4LUMA 3AXDA 4W8JA 1VF5B 2RR11 3ABZA 1SMVA 2EBOA 2PYTA 1V55C 4OUEA 3SH3A 4XUPA 1ULOA 1UKGA 4K0KO 3I3BA 1JPXA 1REEA 2Z5UA 1LTEA 1SFPA 2VY0A 1CONA 2W47A 2MW2B 1UZVA 1Y74A 1IKQA 3BVCA 1VB4A 2CAVA 4YJ3A 1M93A 3MPBA 3QH6A 2BPA2 4UUJC 5AG2A 1OI6A 5ACA3 4D6QA 3GZTB 3T4HB 2IJIA 5EIBD 1N34B 3IJ4A 1T6BX 4J9YB 2OIEA 4FIPC 1F8VA 4MVZA 3ZRWB 3Q8AA 1YEWA 4S2GA 4B08A 3QD6A 4G27B 3PIJA 2BTOA 5B2GB 3AG3B 3UGFA 5FP4A 2P4KA 5A80A 1O5UA 5FY1A 5CB4B 2ZA9A 5LOVA 2PLV3 2QQWA 2FQPA 2ZX1A 4LBNA 1GANA 1WUVA 4AHCA 2JG8A 4CPBD 2G19A 2K0GA 2MEV3 3EYPA 4ASKA 1DQ2A 2QUOA 1YFWA 4OI0A 1VBE1 3QOPA 3BCCH 3KWVA 1ZL8B 5FWEA 4J41A 1RUOA 1JOPA 1XE0A 2ETEA 2YYOA 5K7PA 5EQUA 4COUA 3ZHQA 4NIHA 3B00A 4YJ2B 1YXWA 3H9AA 3HQUA 1EAH3 1JW6A 2W94A 2R70A 2RQ6A 2OWOA 5APAA 2DOSA 4URAA 3NAPB 2B9VA 4AHXA 1X7NA 3CZUA 1EYBA 1DQ4A 2JDIG 5LMNO 4EE2A 3HBKA 1MACA 3HNMA 1GN4A 3IT8A 4FAGA 5A3TA 5CKQA 2HWE2 2BFUS 4ZBMA 2VZOA 4DR5B 2YBPA 5KHIA 2ETNA 2HWB3 4LEJA 5F3IA 2ZM6O 5FZGA 1AR73 4M4PA 5HBAA 3U10A 1J1TA 4LFAO 2PZSA 2ZCEA 3IKWA 3QH7A 1M4UA 2JGUA 4HONA 3ZN1A 1JI6A 1G7YA 2W5FA 5EPAA 2E63A 4XFHA 4CYDA 3N9OA 2VS0A 3ZKYA 3K04A 5LP6C 4RQPC 1TUBA 4LFBB 1CESA 2EJRA 2Q67A 5T54A 4PF1A 2A5ZA 3RQ0A 2GH8A 4CP9B 2E33A 3ME2A 1GSLA 4MGYE 1UZYA 3IPVA 4KP4A 1JBCA 3AKPA 4K35A 1XNBA 2VU9A 4JDMA 3TAYA 3D3AA 3LA2A 5FOJB 2CTQA 3EFFK 2KG7A 1KEXA 3MFAA 4H37A 2XG3A 4GJZA 2F66C 1GV9A 4U7OA 3ZMTA 3W7WA 4YM0A 2QZ3A 2IJHA 3ABLB 2XJTA 3KZIZ 5LA6B 5IDJA 2DBIA 2PA7A 3BTAA 3LEMA 4A7ZA 3WNLA 1YIJV 1C1FA 4UFIA 1NJIW 3C7HA 2EICA 3ZHVA 3LEIA 4FFBB 1EBOA 1RP3B 3K3OA 5IT6A 1ZRCA 4Q4W1 4XCBA 5A33A 3JD0A 4BR6A 4IESA 1JZ6A 4DY3A 3AMQA 2IVIB 3D36A 3Q8EA 3E89A 3CCSV 5L19A 3IMMA 1KP2A 3LDBA 4QQHA 3CNAA 3CCMV 3D6EA 3CE2A 4UCVA 1W6QA 4RHV2 3POGA 1AYN1 5L3DA 1K5MC 3G7DA 3JALA 4MHRA 3HEIA 4ATEA 3LDCA 2JD9A 3EMRA 1QKQA 3NNJA 3M3OA 5C6CA 3UGHA 3O0XA 5FMCA 1XREA 2BBVA 4LE4A 4BQXA 4DMIA 4RS5B 1GH6A 4JVAA 4K0KB 5HFMA 2AZ5A 4I3PA 1NR7A 2ZGTA 4V2VA 4CDWB 1AR83 3GWOA 1QU0A 5KXDA 4K3UA 1R083 2GC1A 4Y20B 4DUYO 4IIJB 1VALA 4YGCA 3M4FA 5JSOA 3BALA 2XBO3 1YTFD 3KV9A 2ZINA 3WDXA 5I93A 2N74A 4YW2A 4JI5B 2AGSA 1RL3A 3OUFA 3B93A 2W6JG 5BUVA 1VAKA 3BTYA 2BOJA 1YFUA 3OD4A 3MUY1 4K8FA 1RUD2 1XNDA 1MS9A 1KKCA 4CCMA 2ZMNA 3W7SA 1NA1C 2QA4V 4P2ZA 2X7RB 3EVKA 5F3GA 2HWF1 2DCZA 1AL0G 1NQTA 2W46A 4QX1A 2Q8VA 1G8MA 3VZJA 2IXJA 3I59B 2YPJA 1QOTA 1TG7A 2DTYA 5C8CB 5J9PC 1YJLA 2R1BA 2PTMA 2ZX4A 3RZMA 5FPVA 5LK7B 2CDPA 3ZFFC 5FY8A 4C1WA 3MW2A 2E26A 3MUZ1 2XLGA 1VRH1 1PHMA 4MXVA 4BM8A 4SLIA 2DBNA 5DDJ3 3AP4A 5GLVA 1QXRA 3I4IA 3ZFEC 1F31A 2VECA 2DUOA 3BVOA 4QKNA 2F43G 2RNBA 4MYEA 3ZM8A 3DYOA 2QFEA 1F51A 5LMNB 5JPMB 2HWC1 3OBZA 1ONAA 2EIJC 5KAFZ 4S2DA 4CDXB 3WQ1A 1S0GA 1XYNA 5FYVA 4UW4A 1M56B 1AR91 2YG0A 3ZXFA 1NG0A 1R1BA 4PT6A 4YGDA 4GXLA 2XDVA 5KHGA 1U96A 4XUTA 2Q6AA 4Q4Y1 1OUSA 2UYAA 4LFAB 2CY6A 2ZEZA 3WG7C 1JJ2U 2RE9A 4WZCA 1PGL1 3KCYA 2YICA 2WN2A 3VL8A 4XAEA 5C71A 3S6PA 1C1LA 4PD4F 1FJGO 2WA3A 1W0KG 2VBDA 5IY5B 2JGDB 1R092 1GM7A 1V6MA 1ULDA 2XB6C 2YI8A 2HWD1 4CDWC 4TN7A 4QGNA 2QBXA 4DV2O 4QPIC 3RWNA 1OQEA 5T3NA 4YFZA 1DLLA 3DYPA 4E4HA 4CCDA 2FHRA 1UO9A 4UV8A 3RW0A 2DQ3A 3HKBA 2VJXA 4HNAA 1RJ8A 5C8YB 4X65O 4B8EA 5CNAA 3RYIB 4QX0A 5FYMA 4RD7A 1WNSA 2BNNA 2WO7A 5CA0B 3MO4A 1JOBA 1STMA 2RS31 3ASNB 4JHTA 2TUNA 1W0NA 4WVMA 2OIIA 5FPOA 4GMP1 4Y1ZA 2YEVA 2QQVA 4HANA 3WF1A 3JXSA 3LOBA 1OCCB 1S0CA 4HZFA 2DVDA 3KSCA 5IFPA 1NQJA 2OPWA 4J11A 1PM7A 2C9KA 4A7YA 2DN9A 4I9QA 5JMOA 3K48A 2Q4SA 1JH5A 1TMF3 3NRUA 2NYYA 2NMNA 4JC1A 4XQWA 1OMIA 3JSLA 1U5XA 3WB0A 2ZGQA 1RFYA 2QGNA 1ZBE3 2IXIA 1DGRN 3NV3A 3RJRA 3JCUZ 3AJYA 2HEWF 1CAUA 3IAQA 3CJIC 2XVKA 1VBC1 3L70H 5DG2A 1RUF1 1UX7A 4XMAA 3ZYHA 3AMPA 1BGYH 1UQXA 3OGVA 1VBE2 4K8RB 3O0WA 1FFXB 1N1VA 2JS3A 1SKVA 1SQGA 1VBD3 1BQ0A 1Y6XA 3ON7A 4JQRA 1FNZA 5LP6A 4E8DA 4RQPA 1S72V 4OHVA 3D3IA 1QNWA 1V6LA 4U3JA 2VBPA 3I2GA 1PMJX 2FDJA 4COZA 3BU0A 2ZHKA 1S2BA 2X5IC 4DUYB 4HLTA 1OZ0A 1SETA 1ROPA 1N1SA 4XF1A 2BRTA 5LW9A 3TNQA 2J1SA 1A32A 3I3MA 3VBHB 4ATFA 1ZLZA 4UYBA 1JTZX 5FZ0A 2GP3A 3CRRA 2B1IA 4HVQA 3LF7A 3AZVA 3VUOA 2ET7A 2FZ2A 3BIEA 5CB4A 3AP5A 2LQTA 1SQVH 3A2FA 4EEQA 4O2AB 2WWJA 1VP7A 2PHTA 1QY4A 4DV3O 2QWPB 4FO9A 3QBQA 2RM23 4WCEV 3I3EA 1VRBA 2DUPA 2QR4A 1GRJA 3ZRVA 4OQ9A 1LECA 2IU0A 3HNYM 3A0KA 4TV8B 5JWPA 4YJ2A 3TEZA 2YIBD 1WCSA 1PZ7A 4URTA 3NV1A 1K5MA 3OY8B 2EAKA 3RWKX 4GALA 1JHNA 4MGKE 3LNMB 1S0VA 2EAAA 5M0TA 4Q4X3 3TXQA 5FKBA 5EIBC 5K8SA 5CBGA 3PUAA 1YJWV 2LS6A 3CEIA 3NV4A 3MV11 3WNMA 4CEWB 5H9QA 3NO8A 5H9RA 5IW0A 2XWJB 5LGUA 4DV4B 5FMBA 2RJLA 4LT5A 4OMDA 2WSSG 3K5MA 3LD8A 2FDHA 3VBOC 2EULA 4NHXA 3OM3B 4X1IB 5A3UA 1JZ8A 1OA4A 1Y43B 2E51A 4UFZA 1RUH1 4QMAA 3SISA 4JI3O 1XHZA 4GZ9A 1F4NA 1ASJ3 4Q4W2 2ZHNA 1SPPA 1Y9MA 4NJ4A 4O4HB 1J1LA 2ZZJA 4LBJA 3ZSJA 4CC6A 1FT9A 3ZYJB 4JF3A 1LODA 5IJ0B 1PK6B 1W2AX 4CE8A 5ABJC 3UO3A 1JCHA 1FJGB 2WNUB 4J1XA 4B4QA 1OBNA 1NA1A 3FB7C 1AYN2 4L8JA 4NWWA 1O91A 1MS1A 1B3QA 4XOGA 3ZYPA 3KVBA 3H8RA 3HKDA 2D6NA 4M3CF 4DV2B 5K0UB 2R071 3UGGA 1HRV1 1Z7S3 2EVXA 4FPGA 1KMIZ 3P3NA 4WF9V 2AENA 2KSDA 3I2OA 2AZ2A 4X65B 1E79G 4PIZA 4QM9A 2ZD9A 2UU8A 4N90A 2J22A 2BV4A 3HR0A 3VBRC 1GICA 3ZFFA 2OYQA 4I9WA 1HXS1 4LBQB 3HKEA 1R3LC 5I0RA 3HVDA 3ZFEA 5BYNA 4Z1MG 3SH4A 1TE1B 1WBFA 2VUAA 2ZHLA 4COWA 2XLFA 3RYCB 4EB6A 1N36O 4TTGA 3D8CA 1AR63 1NTKH 4WM8C 5D8AB 1OURA 4IYHA 3C90A 1QQCA 2HWF2 3ZVXA 5I8YA 2Y0PA 5LRSA 4KWKA 5FR3A 3QACA 3W7XA 4AAXA 3ZMNA 1A34A 1J3RA 2WNVB 4P14A 3ZBHA 2BSKB 4AGRA 2DF7A 1R6TA 1E1RG 2QQJA 1BBT3 2W6IG 1SFNA 3N9LA 3CD6V 3CB2A 4YFWA 4NYKA 3ETDA 5FRAA 5D5PA 1W6PB 4RS5A 4CA9A 2F6BA 3J4UH 1MA1A 1W99A 2WN3A 2W68A 4JDOA 1RUI3 2VNOA 3GYDA 1XYOA 4CDWA 4FFGA 3RG0A 3PL0A 4QPIA 4SBVA 2GV9A 3FB5C 2DFBA 1HW7A 1R1A3 1SQFA 4AHYA 5BNPB 4IIJA 1K5JA 5J96B 4X62B 4JI2O 1IQDC 3LE0A 2HWC2 1GBGA 1DCSA 1BEV1 2WZR3 2JXAA 1GOFA 5LXTB 4MX3A 1DBNA 1AR92 3HIFA 1GYKA 1YI9A 5LA2A 3SH5A 1W8OA 2F4VO 4DYLA 3N3HA 1YFYA 4L87A 5L9RA 3MIBA 5K0UC 4UF0A 1DIWA 1A8MA 4Q4V3 1PGL2 4XBLA 2YIAA 4QD2A 2UXXA 4DV3B 2WZEA 2YBSA 2RMU1 1Q8VA 5LEJA 3AG4B 4QM8A 1IBLO 4U36A 1JHJA 3CJIA 5FIXA 2LJ2A 4NTXA 3EHKA 1PMHX 2GNBA 3GHNA 3USUB 1DK1A 3FL7A 4GKJO 1D4M1 3GBFA 3X2QC 2YUAA 2OW4A 1OH4A 4XHBA 1W2NA 2XAJA 2RS32 2J42A 5GTIZ 2RJ2A 1R3JC 3POJA 2WLMA 2GNTA 5FYUA 1MZ5A 2DU0A 3WP6A 3AFGA 5IVJA 1I0HA 1U5YA 4CCLA 5AFEA 1GFF2 4B1MA 4YYOA 1IX9A 3IAPA 3SJAC 2VPVA 4N7UA 1BK1A 2XL9A 4JPRA 4DRXB 3FZ3A 1LHVA 4BYYA 4M3CA 3CL1A 4HZ3A 2X5IA 4UFKA 1OCRB 5IVCA 2VOKA 3MYXA 3ABMB 1YJNV 1V6KA 2R7EB 5B4XA 4JI3B 4U3FH 3ICXA 3E2EA 1HLCA 2ZR3A 4FPCA 1GMGA 1LHNA 3POYA 3HPNA 4BISA 1XDCA 1VBC2 4YY3O 4XW3A 1D5NA 3I55V 1VMGA 4DRRA 4BQ1A 2JGDA 2H8PC 4W4LA 1RUF2 2AW9A 1PZ9A 3HN3A 2BOBC 5HPOA 1AJQA 3ACLA 4XC9A 1AZDA 4AFCA 1RPOA 1UY0A 4K1ZA 4FP3A 3WDTA 1W90A 1CP9A 2P37A 2FL4A 1Q6IA 1M4WA 5C8YA 3RYIA 1CAXB 5CA0A 3ZKUA 3T3YA 1ZTEA 1YHFA 2VMDA 1H6XA 3P1IA 2IC1A 4AGVA 5F8PA 4K8XA 5LYJB 2GC0A 4N21A 5KX5B 2ET1A 3NL1A 3DXRB 3AJZA 4HL0A 4EZHA 1AJKA 4LO6B 1UOGA 4QXKA 3VL9A 3I5DA 4WFBV 1N36B 2GC2A 3PURA 4MSWC 4OCTA 3DECA 3AG4C 3VQWA 3C3SA 4D0QA 3C3TA 4E2GA 1WMEA 1B04A 3LFIA 2HWE3 2YXYA 3S30A 1LGBA 4F3JA 1YHQV 3VBOA 2CV6A 5IVFA 4JI0O 2JVDA 1FS0G 1V9U1 3NNLA 3V64A 1J5EO 1VQ6V 4I0BA 3FJSA 1K9MW 2AGAA 3A0NA 1QJEA 4CPBA 3OMAB 5L7OB 1VQ8V 5TISZ 2MNGA 2SBAA 1MVQA 1DZQA 2A75A 1YWKA 2V73A 4R8CA 5JDBA 3FN9A 3WW1A 3WFVA 3ZYRA 5I8SA 2EIKC 1X50A 5ABJA 1IPJA 2GTSA 4CP2A 4XMIA 3VQXA 5DAVA 1Q82W 1FOD1 4KWUA 1QJY2 3A0HZ 1LEDA 1OCOC 1AP6A 1KKDA 5LHHA 4MVOA 1GZ9A 3NSTA 3N7JA 2L6LA 4XFAA 2RJZA 1WBLA 2YS8A 5CKMA 4JI2B 2Z3YA 5B5EZ 2WABA 4LHNA 5FZFA 3OPTA 3T2OA 2JIZG 3LOIA 3GHMA 3VBRA 5CG8A 1ULGA 4B4PA 1RUH2 3NQHA 2JE8A 3PDQA 3B4SA 2OZ6A 4NROA 2WAOA 1JXNA 4GT1A 2YPDA 2XR4A 3K03A 2F4VB 4UBGA 2ZEYA 1E5IA 4N8MA 4ZS3A 4C91A 4H7LA 1W6OB 1LOGA 5JR7B 2VRZA 1HNZO 3ES1A 4WM8A 1WCUA 4BK5A 1OKOA 5CBHA 2KXLA 3WD5A 1O4YA 4YW5A 4G2KA 2B7YA 1D0GA 5AC93 5H6RA 4GUNA 1IBLB 4FOVA 1OV9A 4FAHA 4FM0A 1G9AA 2R072 4CH4A 3MIGA 3K79A 1HRV2 1EUUA 3T1HO 4RHV3 2CTRA 2FDGA 2HFEC 3OY8A 3K5NA 4DV7O 1QIQA 4GKJB 2DUQA 4Q8LA 3I3DA 4RR3C 1MZ6A 3ES4A 4XJ8A 4AEDB 1WCDJ 1QJU1 4LUKA 2IU3A 1WMXA 1F23A 3FB8C 1HXS2 4XF4A 3O1PA 4OUMA 1RUG1 4AVVA 5GZGA 2D3OW 1H8EG 3CXCU 1I9RA 4KH9A 4N43B 4NVPA 2JECA 3MW4A 3ETGA 1GKBA 4CDQC 2QQIA 1SDDB 1P49A 1GO3F 1UU5A 2E5LO 3CMAV 3AKQA 5IJ0A 1H30A 2ZACA 5CA6A 1RUD3 1YCIA 4YY3B 4WBNB 1AX0A 4LJHA 2R9AA 1RSOB 3DPRB 2JJ6A 1QHDA 4QXBA 1SBDA 1BVP1 4WM7C 1KB9F 5K0UA 5JR2A 4CDUB 4GWNA 4A42A 2WA4A 2BWCA 3ZPOA 2EA7A 3AYDA 2JB4A 4FFHA 1FXKB 3H01A 4HT1T 1SQPH 5FZ3A 1V70A 2DYCA 5KC6A 2UWCA 4UT5A 1R081 5FY4A 3K59A 1UYYA 1A8DA 1UU6A 2XUEA 1XNCA 2WT2A 1GP6A 3N9PA 5FNVB 3ZXAC 4O2BA 2XBO1 3RI8A 2VMFA 5J37A 1FPN1 1LOFC 1SERA 4OHZA 1TNFA 2DTWA 4QJFB 1BMFG 3NJXA 4LULA 1BEV2 2JS5A 2CHHA 1UPIA 2NP0A 1O5LA 3N2KB 1MABG 4QWNA 5FY0A 1TVKA 3MICA 4LXLA 3RYCA 2I07B 3JD3A 1GNHA 3BOWA 2FDKA 1WB7A 4OHWA 4CP1A 1UOFA 3LZZA 5BNNB 3GVMA 2NNUA 1YITV 4XQ4A 5C3RA 1K5SA 4ZHQB 3BB6A 3M7AA 4MSVA 2KKWA 2ITCC 1VAMA 4X8AA 3LIGA 1DGWX 3VQYA 4JI0B 5CEHA 2V4DA 1EP0A 2RMU2 1DGLA 2ATFA 4XEZA 5IVVA 2VWJA 1TME1 1JZ3A 4NR1A 5FZEA 1UFIA 1HV1A 3HMYA 5BNQA 4OYUA 1WMDA 4DEVA 5LCWL 5FZCA 4NPRA 1CAWA 1M06G 3JZVA 3IWZA 5DZEA 3FE5A 3MF9A 2WNEA 1R093 1R64A 1M5IA 1D4M2 5FL7G 3DGEA 3M8LA 4I3GA 5CA1B 2EILC 1C8M1 4N43C 1S3JA 4JKLA 1KQRA 2BGOA 3UL2A 3ZXKA 1MQTB 1AJNA 5DAWA 2ITDC 2XMLA 1XMQO 3WV6A 1K92A 3TK1A 2EX3A 4JDNA 4KG0A 3RS6A 2Y0OA 2IWGB 4NIDA 2ZT9B 1UX6A 3OTFA 2VZPA 4NTYA 3B69A 3FWEA 2VCCA 3DXUA 2ZGKA 3APBA 3T0BA 2WWSA 4E27A 1NH2D 4XDOA 3IDCB 4JZ2A 3FLTA 4L97A 3S5AA 1BXHA 1HNZB 5ANNA 3ECQA 5IK5A 5CA3A 1QDOA 5CN0A 2E32A 5FPAA 4FP2A 2D6MA 4KHPB 4GH4C 4PA9A 4A4AA 3LWCA 2C1FA 5CYYA 1M9NA 1CZSA 5JXHA 2ZX2A 2R041 3DKQA 5EHDA 1X4TA 3BA9A 4NB5A 2F95B 1CQ9A 5F2VO 4DV7B 1VBE3 1LJ7A 3K5LA 3KV6A 3UKTA 1ND3B 5JVDB 1MS0A 4YG3A 2GTAA 1FX5A 3VQVA 1KQSU 5BNNC 5C9AC 3W58A 3JQWA 3ZXEA 3JAKB 2CWMA 5FYSA 4FPHA 5IT9N 5JIAA 4IERA 5GLTA 4DRXA 4AK3A 5FP3A 5EYPA 1QVGU 5IJ9B 1G4YB 4XJAA 3MI8A 3E83A 2X53S 4IGOA 3R05A 5JMCA 2EXIA 4AVAA 2JDUA 3FBMA 4BXFA 1ND2B 1QQP3 3WNOA 5A32A 4O4LB 2E5LB 1J95A 2AR6A 5A6XA 2H94A 2RDQA 1K97A 2ZTNA 3JCZA 1V9U2 3K51A 3RI9A 4OQ8A 3ZYFA 4CBCA 4CS4A 5K4LA 2J1EA 1MQTC 4WV8A 2Y38A 2ADDA 1QLNA 1RYYA 2BFUL 4KBZA 2IJKA 3LDRA 1BK0A 2GAUA 4IEOA 5CMUA 1FOD2 3ZXGA 2HKOA 3M3EA 5F6LB 4AFMA 2V09A 4AI3A 5KX5A 1JVMA 1FV2A 1R6KA 2Y4TA 4XQDA 5I0TA 4LBEC 4W4KA 4C90A 4XDJA 4RR3A 2ZKLA 4J1WA 1K42A 4XJWA 4O4JB 2E75B 3SC7X 2UXDO 3N9QA 3VBFB 2P67A 1FPOA 4TOIA 3K46A 4WVVA 4LO4B 1GK9A 3LDEA 1UYZA 3T1MA 2Q5ZA 4QHOA 3P3PA 4BDVB 4BW5A 1K8AW 2VNVA 4IV1C 1THZA 3U1XA 4HFSA 3E8HA 5E16A 2DQ0A 2EZPA 4YG0A 3E22B 4W6YA 1OHFA 4P9WA 5F9TA 3T4VA 2WDBA 3CHXA 4Q4W3 4ZU4A 4IE0A 1WWYA 4MTFA 4YW1A 2EINB 4AYUA 3SYPA 1W2OA 5A7NA 2G38A 2HP8A 3THDA 3OEEG 5IYYA 4UFHA 1HDKA 5SV5A 1RUE1 4C1XA 3I2JA 5FP8A 3OUJA 4V2WA 4QGLA 3OUIA 4J7KA 4WM7A 5J2UB 2YIBA 4LQRA 4RFT0 4C0HA 4BIUA 3ZOIA 1C5IA 1QJU2 1P8JA 2PELA 1I5PA 3N9NA 3OSDA 3M7MX 2Q4PA 1OKQA 3O1SA 4P9PA 2XHNA 1RUG2 3H0OA 4P9LA 1XMQB 2ARHA 5KMGA 1QEXA 5BNOB 1WLTA 3E35A 1DTOA 5L73A 1LOFA 2I45A 1UY2A 2WBKA 4XPVA 2VQUA 4MUVA 1CR7A 5G04L 1F2NA 4MTGA 1WPBA 1W8TA 4AOCA 2V4VA 1UF2C 3W21A 2R1DA 1F9KA 3K4DA 4RGKA 1CIWA 1O3TA 2CU5A 1GZTA 5T5LA 4AVSA 1W6OA 3VDDC 1Y76A 1UZZA 4LKEA 3AFKA 2Q1FA 1QCEA 2K9ZA 4JTAB 3CRCA 2Q30A 2HWF3 1CAVB 1OVPA 2XJUA 4JYBA 3OMIB 2ZGSA 2G1MA 4J9ZB 3H7JA 4PA7A 2D5FA 2G9ZA 1BSMA 1M90W 1VBA1 2QKAA 2Y6HA 2WR9A 1G9DA 5J7MA 3POEA 1SLLA 4LHLA 1AUYA 3GJAA 5L3BA 4M00A 1DP0A 3ABKB 2XBO2 3O1TA 4Z82A 2P6JA 3AC0A 1FPN2 4KGQA 4OX9O 1XOUA 4EROA 1Q8PA 5B1BB 3PUQA 1DQ1A 4N43A 3WQ0A 1GU3A 2D93A 5J2TB 2YSUB 2QQLA 3LEKA 2WKKA 2QNKA 3RPQA 1ZZCA 1MEC1 4DRVA 4AEJA 4I0XA 1I1EA 2HWC3 4INDA 1XSRA 1DGSA 1DF5A 1CPMA 1GLHA 1ZVFA 4FPYA 2QJVA 3CO2A 4MADA 1FYUA 3N36A 1VARA 5GLZA 4DW1A 4QDQA 3VHOA 1EPZA 4WBNA 3NNMA 1AR93 1NTMH 2N7GA 5HCFA 1O6UA 1TME2 5ITZA 1RSOA 1EN4A 3R66A 1LOBA 3VBUB 3M8AA 1IG0A 3OW2U 2PQQA 2H6CA 4RAIA 4O9EA 5FZOB 1RUI1 3D0JA 1B09A 5LBQA 4MHUA 3ACGA 4IEYA 5KLVH 1GN3A 4GH4A 1OH3A 2YDEA 1CZTA 3RZGA 3A8TA 2XHBA 3OYWB 1C8M2 3GZUC 4JGYC 4I30A 4LF8O 1GZWA 1MS8A 2J1AA 1L1FA 1O3QA 2V5YA 2MK3A 1SZTA 4FSJA 2JDPA 5A3NA 4YJ3B 1JZ4A 1XSQA 4AEKA 3WQBA 4MG2A 2B9ZA 4LF5O 4FBFA 2RS33 2UXDB 2VWKA 2Q5TA 4HPKB 3O1OA 3TETA 5BNNA 3WVJA 2PHRA 1HN1A 1NYWA 2E9QA 1Y9QA 2AC1A 2C5DA 2HG5C 1YQ5A 4I50B 4W65A 1NVPD 4O65A 1WCQA 3TGUH 4AZZA 3W20A 2BE3A 3SLIA 4WBBA 4LBMA 3U4XA 4NXNO 4R8HA 4J7ZA 5IE9A 2ID4A 4XZUG 2AEZA 1XL6A 3ZFGC 5LB6A 2GSYA 2EJ7A 3CZJA 4P5YA 1ZZ6A 2YY1A 1Y66A 1CXZB 1ZAUA 1M57C 1I5ZA 2YC2A 4PHZA 1VBC3 4LC1A 1NZIA 3T2MA 4LHKA 1BT8A 2ZXWB 5A1LA 2R042 2YBKA 5L3FA 4W4ZA 3UM7A 2JD4A 1RUF3 1DYPA 1E1QG 5B1OA 3UETA 5CA1A 2OYZA 1Z0HA 1Q8OA 4YM3A 5E1AC 2P4EA 3TB0A 3JD73 4OGQB 3JB4C 2A7WA 1MQTA 1UU4A 3W5NA 3L2YA 3OPZA 5LHGA 1QVFU 2DURA 1SLAA 5JOYA 1SA0A 2WQ4A 4CH3A 3BGAA 4ZI7B 3BAAA 1ZSPA 1BQZA 4Q20A 4JTNA 4FCAA 1LGNA 2IM9A 4YGBA 2ILMA 3VKLA 5IYCO 3TWIA 4BE3A 1BCXA 1NUKA 4YIOA 2E53A 2XVLA 2ZGLA 1UXZA 4JAUA 4QNHB 4NTWA 3Q8FA 4DV0O 5JZGC 4IV1A 4QX3A 2P2KA 3OEAA 1YC61 3Q8BA 3SJQC 2OCCB 1TUBB 2JJ2G 4YM2A 1N3PA 1NCQB 3LPFA 1RXGA 1OD3A 4JAVA 1AI6A 4HVRA 1U5ZA 3QO7A 4CCOA 4X8NA 3WOGA 1KDMA 2QDRA 5CAZA 2XJPA 4LKDA 4HKOA 1YLLA 5JH7B 4UB6Z 1BHBA 1XNKA 4DS0A 4WVWA 3WG2A 5D5QA 1TGOA 3LEGA 5H5NA 2KG7B 4QX8A 3JAKA 4L8QA 5IHRA 2UUBO 2F23A 5CFCC 1QJY3 4D6SA 2D98A 3ILNA 2NM1A 4GIQA 5IJ9A 4LBOA 2C24A 1OC1A 4X20B 3NW4A 3AKRA 4YVSB 1X33A 4XBFA 2KD7A 3POSA 1OOPC 3RN4A 5IVEA 1W3XA 2Q0AA 5FPLA 2VZUA 1DDLA 2OQ6A 3UO2A 5FPXA 1HB4A 1ZRFA 3MHHC 2GUZB 1EY2A 2ZXWC 1WLDA 1D5AA 2MPFA 1RUH3 4PDMA 2N04A 4DNYA 3SNMA 1KUQA 2O0OA 3S0MA 3ZR5A 5E8AA 3HBZA 5FPUA 2RJKA 2GP5A 5C3QA 1W6QB 2EZOA 4A3ZA 4JYAO 3VDDA 5EZYB 4E8CA 1EUTA 3QG5A 4J42A 3JALB 4AR2A 1RUE2 1OCZB 3RZKA 1CZVA 2VMGA 5GLWA 3OR6C 1LHWA 5E6HA 2C9AA 3FAVA 3CF6E 1WJZA 3VBSC 4FTSA 2WFF1 4AILC 1W6NA 1DFQA 5B66Z 1MVEA 2R073 4Y3OA 3K4ZA 4LF8B 2JEUA 1O8SA 1GN2A 1HRV3 3KCCA 2E7AA 2VVEA 4XTPA 3IIIA 3FUQA 4Z92B 4ZOLB 4U7NA 4KGGA 4M0NA 4LF5B 5DN2A 3VBFA 2HR3A 2BEOA 4PDVA 1HXS3 1PNMA 1W9YA 4COYA 3KS7A 4NHLA 4XJ9A 1UL9A 3TN93 3IB3A 4QXHA 2OCCC 3RVHA 2J7MA 1N33B 3ZYGA 1UN1A 2QKSA 2DDUA 5AC91 4ICGA 4X88A 2D3PA 2ZNJA 3MDSA 4NXNB 3LPGA 2CTPA 1ZNPA 1HB3A 4GKKB 1IBKO 1V54B 4K1YA 1SBEA 2ZQMA 2WINB 4LO8A 4PA6A 3CJXA 1US3A 5A3OA 5BR8B 4BMEA 1IS6A 2XASA 3OFNG 1VBA2 4RL7A 4BZ4A 4QGMA 5BZBA 5EJ3A 3LSUA 4CS3A 3KZ4C 1X8EA 1S5LZ 4NHMA 2OT5A 3UNPA 2YROA 2BYVE 1SESA 4HN1A 3ORJA 1YNAA 4LF7B 4Q0SA 3SPJA 2LTNA 2QTSA 3KT1A 3U37A 4CU8A 2FD8A 2BWAA 1V55B 4IGPA 1REDA 3WP3A 3FKSG 4XDKA 3ZRXA 1UCXA 1N1YA 4JGYA 4GZRB 2OPKA 3ZN6B 1SEFA 1MEC2 1PGW1 1NT2B 3OGJA 3MIHA 5A3MA 3MIDA 1HB1A 3BN6A 3N7MA 1YVWA 1VJ2A 3AMMA 5I0DA 3A0BZ 3RVZA 4DV0B 4PA4A 1CEZA 2GMPA 3ZXJA 2ZDIA 3UV9A 4Y5SA 3RZHA 2VOVA 2A1XA 5LY1A 3WLUA 1OFSA 5CFDC 4XXAA 1GMMA 2P1BA 2NR5A 1VQ5V 2YU2A 4QPWA 1CIYA 3ZFGA 2A70A 2TNFA 2XKPA 2LM3A 1XQNA 3LQCA 3TEWA 1YF2A 2DE0X 2JIGA 4QPGB 3HKBB 3JBG1 4KXRA 3OUHA 4QPKA 2AEYA 2FCVA 4CC5A 2P7TC 3VKMA 2WNOA 1Q8IA 1SZXA 1VQ4V 1D4M3 4QAWA 1ZREA 4X9QA 5FYBA 1W8WA 4WVMB 1UY4A 1MMMA 2UUBB 1E5HA 1CWPA 2A9HA 5T5OA 2YEVB 4E2SA 4N53C 4ZY9A 4BCUA 2PAEA 5J2TA 3S7IA 4FT8A 4ZIBA 5J3UA 4DR1O 2ZGPA 3EJKA 2LO1A 1FXZA 2PHUA 4I4TA 3N7KA 4GX1A 2KB1A 1LRHA 4Y1XA 3RFRA 2JB8A 1ULFA 1Q8SA 3PUIA 2FBEA 3ZXLA 2LW1A 3V56A 4PDWB 2ZOEB 3I2FA 4A3XA 1CAUB 1NVPB 2OA2A 3U75A 1POV3 1GUIA 3KT7A 1P4RA 5FZOA 2R49A 4QKBA 3S3WA 1HIXA 4NWVA 2VQFO 1HN0A 5JZGA 1NE6A 4OI2A 1AVMA 2WLHA 1JN2P 4ZS2A 1MNGA 1W8NA 4H7MA 1IBMO 2BQPA 4Y1YA 5JJNB 5LP6B 3OYWA 2EALA 1PX3A 4RQPB 1WGPA 2C2AA 1FD9A 3H1LH 5DAXA 1Q7YW 3O5SA 4U3JB 1OLME 2Z42A 3ML0A 3BTZA 4TUYA 1B6QA 3PU3A 4HYOA 1EN5A 4Y26A 4QX5A 4JI5O 4CUGA 1W9TA 4HPKA 5T55A 1GQHA 3DN7A 4K8ZA 3KB5A 4K21A 1DYKA 3G6JB 3UQ8A 5CFCA 5KR7A 4I50A 3GB7C 2ZE7A 3SJBC 2VUDA 3VZOA 3TYJA 5CKNA 4OHXA 1AR1B 1H4HA 5JI9A 1EN6A 1CJDA 4R9BA 3VB9A 4PJYA 2Q69A 1OOPA 1YQCA 3WG1A 2X09A 1IQAA 1IBKB 1W06A 4QPGC 3GBWA 4HG6B 2VG9A 3POBA 2OVUA 4LNUB 2CAZC 4J6GA 1V9U3 3BA8A 4NOTA 5J98B 3CJHA 1XMOO 1UPSA 3IAYA 4IHJA 3ZDVA 1H8TC 3V0AB 1QJX1 1T2XA 3W7UA 1MS3A 2JDKA 4DUXA 1K5MB 1HQLA 3MW3A 3CEWA 2P3YA 1PP9H 3RYHB 1XYPA 4C0BA 1PNFA 1MSWD 4IEVA 3K4AA 3VBSA 1FOD3 4ZI7A 5GM0A 2Y6GA 3FHIB 3EQEA 2D6OX 4L11A 1QQP1 2Y6JA 1MS5A 4LMFA 2VZ3A 4PDWC 2GZWA 2F1MA 2B8MA 2HEPA 2IXHA 2QM8A 2WAMA 3JYCA 1KXGA 1URFA 5FUPA 1KJLA 1NCRC 2ZABA 2UYBA 4YW4A 1SPPB 1HP8A 4RSUA 4FLUA 3S57A 3ZXDA 1P7GA 4JKMA 4IL7A 1XPWA 2PF4E 5A7OA 4CEYB 3ZN5A 5FO8B 2VUJA 2PHXA 3AG1C 4WZFA 2E76B 3N27A 2DV9A 4AW7A 3ZSMA 1NA1B 4JGSA 1NCQA 3AYAA 2YU1A 2G9GA 1W9SA 3HKDB 5FXWA 2GALA 1GOGA 2JE7A 1TZOA 4AQYO 1AL21 2KM2A 1YI7A 3PJQA 3ACHA 3JD4A 4DXZA 2WFF2 4LBKA 1A78A 2RCVA 5JH7A 2UXNA 1WB8A 1HRI1 1W2TA 4M4RA 2ZGUA 2VD7A 1HQWA 3VZLA 1SQQH 1SACA 1JYTA 2DU1A 3ZFFB 3K77A 4NPMA 4CP0A 1VMHA 1QJU3 4X20A 3HKEB 3T1YO 4DR1B 1NBMG 2CH7A 1UJWB 2P17A 3H8UA 3ZFEB 4A45A 4YVSA 2WO3A 1VMJA 3G4SV 2NN8A 1RUG3 2R9IA 2QTWB 3PVBB 4EB6B 2JICA 2GUZA 4I0WB 4MXWA 2FMYA 3KQRA 2Q7GA 1US6A 2EIJB 2VO5A 4PI2A 5AC92 3OJBA 1QDCA 4QB1A 5KXBA 4GMP0 4HSJA 5FZ9A 1W05A 5HV4A 2JRIA 5EZYA 1C4RA 5HXMA 4IV3B 2A3YA 3B8MA 1B35C 3AK1A 2VQFB 3VOUA 3WG7B 1QGLA 4MV2A 2QWRB 4Q0VA 4HETA 1IBMB 2ATKC 5EXOA 4XABA 3PJYA 2DWRA 3H1MA 1LR5A 3MHSC 2V72A 2F93B 3AX4A 3J8F1 4LH7A 3LB9A 4RQFA 3T0AA 4QPIB 4D6RA 2HLEA 4CCNA 3E6BA 2W9XA 4ZOLA 4DR3O 2VZTA 3HT2A 4MVMA 3OPWA 5FDBA 2Z5WA 5JIUA 5A6YA 3JARB 2ZBJA 5C7GA 1O59A 3L71H 1FPN3 1RUC2 3FC0A 4P9GA 2PHLA 1J59A 3I2HA 1PGW2 4CEYC 5EIYB 1YQ6A 3UKNA 1TNRA 3W7TA 5FJKA 2R0HA 4N53A 3OBRA 5LGNA 2WLNA 1NX9A 3U78A 5H9SA 5FY5A 3MV01 5KUMA 4C8DA 5B4NA 2IXCA 3RDIA 5FUIA 4UF0B 5BXXA 2ZIOA 3J7AU 4RGAA 1N4CA 1I6XA 2ZE8A 5GONA 4FZ0A 4QHBA 2R6QA 2HEVF 3THCA 1IKPA 1IXMA 5K9YA 5LMUO 1DHKB 5H2FZ 3OR7C 2IBZH 1N1TA 5IJRA 2BOIA 3CJIB 1TME3 4FFFA 1FAFA 1XMOB 2W92A 4IE5A 2A79B 3C7FA 2HBTA 2A6XA 4MZUA 4FOYA 3JBG2 4NXMO 3WF3A 5BY1A 5A70A 4B3MO 4BHPA 3M3QA 3I3QA 2ENRA 3BFRA 4HK9A 4YGEA 5C4WC 1LESA 1OLQA 2Z2SB 1N0NA 4M01A 2Q73A 3SITA 3BPSA 3MAQA 5C93A 1C8M3 4XHXA 3ZX7A 4RUEA 3ZN6A 4DV4O 3T09A 3S5QA 5FYCA 2JDMA 4QB2A 1BJQA 1LOCA 1KC8W 3DEMA 3DL3A 2DVGA 2YI9A 5KUKA 1KU9A 4M3CB 5GW7A 4Y1VA 3GBGA 2X5IB 2UURA 2O8OA 3OMNB 4FPOB 2VC9A 4DUZO 4YRDA 4BB3A 4IV3C 4JTCB 5HXVA 3JAMN 2PXJA 2LALA 4MGSA 4H55A 2BUKA 1WLCA 1Y9GA 4AQTA 2GHYA 1LULA 4IEPA 3KGZA 2D6KA 4UCOA 4D7YA 3EXAA 3DF0A 4JZGA 2UY9A 2BU9A 3NJVA 3C8XA 4AQYB 4QHZA 5IVYA 2E3CA 4QPGA 1JUIA 3WNNA 1RUJ1 4FLTA 4FOWA 1UPGA 4RO2A 1IS4A 1J3PA 2QQMA 2W0XA 4NPLA 2R043 3I2KA 2Q8DA 3H1HH 3PJSK 2VZVA 1H8TA 1XB9A 1Q81W 4YW3A 2NLJC 1W2BU 4IXLA 4DV6O 5FZ7A 3F2ZA 4QB6A 2ODMA 3T1YB 4LITA 3O0VA 3B94A 4XETA 4X66O 2HYKA 3ELNA 2OTJV 2IW5A 5D21A 1OSGA 3OBTA 3K0GA 2QDNA 3PIGA 2CSGA 3ZPYA 3HKCA 4AFBA 2V7QG 2VM9A 1RM1B 1RXFA 4PDWA 3H8XA 5G05L 2XT9A 2EIGA 3VBOB 4HOOA 5BY5A 1QJFA 3WINE 3CCJV 5KC5A 2BGCA 5B3SC 5FZ6A 1NCRA 4XURA 1UZWA 3K0DA 1YQ8A 3T30A 3R4DB 4P5HA 3WXPA 1L7RA 2ARAA 1BHAA 3OB8A 1D2DA 5FYIA 1K3EA 4OMCA 3JD71 2CYFA 5ABJB 2HVJC 5F5QA 2LGQA 4J25A 1IVSA 4GKXA 1QJX2 1XNTA 4Q26A 2CGOA 1JYCA 3H1WA 1ENXA 4LPLA 1YSCA 4CXWA 5KXEA 3RYFB 4UVAA 2ZX3A 3WQ7A 2ZMKA 4U2AA 5FMDA 3VN4A 3VGIA 4META 4X62O 5JPNB 4DR3B 3WDVA 2XXZA 2J1UA 1GP5A 1QQP2 2CL2A 4TV9A 2CK3G 3ILFA 1EZVH 3R4UA 4JYCA 3VBRB 3W9AA 4ASMB 1O3SA 4HAMA 2OUHA 1NZCA 3AYCA 2O14A 2ERFA 2Y69B 2ZR2A 1LEMA 1DLCA 1DQ5A 2B42B 1NS1A 1P84F 1CX1A 3E8GA 1G6UA 3BKZA 4D8MA 1H2NA 2YXSA 2K2SA 2ARCA 3QF7A 2LW7A 4X1KB 5FZAA 3V65A 4WM8B 3K06A 2XAFA 3RMXA 4XYXA 4LNUA 1F4HA 5LMUB 1APNA 1X36A 5JSPA 5J1XA 1RPRA 3POFA 2XKOA 1QXJA 2JDNA 1AL22 3V0AA 3FB6C 4O4IA 1WP8A 4QKFA 1HRI2 2O57A 4NXMB 2RVAA 3L9DA 2PI5A 4WFGA 4QDRA 1QJY1 1DZRA 4B3MB 3OE7G 3IFXA 1RUE3 2FCUA 3RYHA 4B3RO 4IE7A 1S2KA 2CDYA 1NQDA 3J26N 5LK5A 4LR3A 3M3CA 4NRPA 2VVDA 5CVRA 3TEXA 4GWIA 4PA3A 4BU2A 1LB2A 1RM1C 4R4ZA 5JXGA 3AL6A 3U0ZA 3M99B 4G3YC 2ZAAA 3BUCA 1YRZA 5JOWA 3JAWB 4I55B 3IDEA 2BVBA 4EN9B 1EV11 3PMSA 2JDZA 4DUZB 3H1YA 4AVTA 2PHDA 4R52A 5FKCA 4ZXKA 5HFLA 5FQ0A 3WB2A 3U07A 4CEYA 2BERA 5JOXA 3FFQA 2EIEA 1NY71 4XF3A 3OG2A 3CKHA 5IAXA 2OZJA 4G28B 1VLNA 3HD8B 1T5EA 3T4ZA 2VTXA 4OLLA 2F4PA 4E9KA 2ZEWA 4LA2A 4Q1PA 4HXCA 2A7AA 1UY1A 2E7TA 4EZ4A 2BP6A 1RJ7A 2WLLA 1ULCA 2BNOA 4B7KA 4O9GA 3AP6A 1ULEA 2R061 1LHUA 2JIJA 1GNYA 3J8F2 1VBA3 2FMDA 1XBFA 4GA9A 4O2BB 4EWAA 3VV1A 5BMVA 5HV0A 2HHHO 2PYLA 5FY9A 3B01A 1B06A 4B3NA 2JEMA 4MVRA 3X2QB 2Y69C 2RDRA 3TN91 4DV6B 1UIJA 5C4WA 4X66B 1H4GA 1TVKB 1YTFB 1BHGA 2P90A 1NZ6A 2GN3A 1EPWA 3I8TA 4X6QB 1S0IA 3AXEA 2LW8A 1F4AA 1VEWA 2K1EA 3HJRA 2VCAA 1MEC3 1MS4A 1KDKA 1ENRA 2QWQB 5FP9A 3H1IH 5TSWA 1RTVA 3F7VC 1HNWO 1QXPA 3O14A 1XL4A 1W03A 5BPXA 5JAXA 4DK1A 4NO4A 1H1MA 4IV3A 2WUHA 2D7FA 1Z2GA 5DUXA 4NE9A 5F5CA 2VCMA 1CAWB 3BPZA 4NRQA 5KHHA 4UXNA 2OCHA 3ACIA 5A3PA 5ISLA 3SKVA 5IVBA 4KL1A 2TBVA 3S3XA 4BIOA 1KITA 1W8UA 2K46A 2M7WA 4FMTA 3ZJZA 2EXHA 5GTHZ 4YHHO 4PLMA 4JKKA 4PDRA 3JARA 4ZPIA 1K4CC 4AQSA 5A1AA 1ZA4A 5CZKA 1NXMA 3EXUA 1BQPA 1KD7A 3WB1A 1W2UA 3CX5F 2ZGNA 1N0JA 3U11A 1PGSA 3GCXA 1LAJA 4PQQA 3B7MA 4D7SA 2R16A 5FMOL 3VDAA 1VMFA 3ASIA 1XOYA 4CCJA 3CXHF 5EBMC 4UI9L 4KI5M 3MBWA 4LF4O 4PLOA 4TQDA 4QX7A 3ABUA 2BDRA 3TOJA 3QVNA 3ETQA 2OQ7A 3OBAA 4LK7A 2IFRA 4TQFA 1FMD1 2CTVA 1RC6A 2BTQB 1AI7A 1W0PA 4LFCB 3PU8A 3OGIB 5I0UA 1IXBA 5JXIA 1YJKA 1EZJA 3ZHUA 2X05A 3RVYA 2YUEA 3G80A 1RUJ2 1FFTB 3AMNA 1ZX3A 1SHWB 4Y22B 4IT5A 4BAYA 4P00B 3E5UA 3ZYIB 3O1VA 3P6BA 1W8HA 2VTFA 2ZGRA 4B3RB 2DFCA 3WG3A 3FD9A 3ZHTA 3CDZB 2EIKB 3H7YA 1C5HA 3VD3A 3BYWA 1ZA7A 5GKAC 5LY2A 4QGPA 4AL9A 4B29A 3AK3A 4B3SO 3VD5A 4GKYA 4UCTA 1OCOB 5DUUA 4XDQA 4BQYA 4L92A 4YG6A 3ABTA 5EYPB 1BS3A 5E79Z 4QQ2A 5T52A 4W50A 3N35A 3BABA 2WLIA 2PUSA 1W59A 3ETPA 1WKYA 4AI1A 1R3KC 1POV1 4DIQA 1HWYA 1KYOF 1UOBA 2G4IA 5A32B 1SDWA 1BCCH 2GDSA 4LOTA 1S0EA 5H9CA 1CJPA 4BQWA 1DZTA 1AR4A 3K5OA 4RN5A 5FBJA 3TEYA 2VQTA 2WT0A 2JK5C 1GZCA 2EIMC 4XJZA 4N23A 4MLOA 1YQ2A 2WRAA 4RGGA 1YZBA 5LWBA 4YIPA 3JD72 2JEXA 4N9IA 4JI4O 5GALA 4GB31 4KUMA 2HEYF 3DYMA 3BCWA 1UMZA 2GC3A 4GAZA 3M1HA 4OUSA 1WW7A 4OULA 1HR0O 4N9HA 1QOSA 2V4AA 2X6AA 5FZKA 1O7FA 2P3IA 4DR7O 2WLQA 5F5IA 4DINB 5A3WA 5CIRA 5EFUA 1KBHA 4UAPA 3MFCA 2HHHB 2CAUA 2IVJA 2QQPA 4D94A 4KMQA 3JD2A 4HK8A 2XL7A 3LA7A 4MT8A 4NIIA 4RR3B 3ZCCA 4UOJA 1KFXL 3WF2A 5JCTA 2ZMLA 1LCLA 4PBOA 3INAA 5FYYA 2LRPA 5JI7A 4LF6O 3ST7A 1QF3A 1H8HG 3FX7A 3ASOC 4LBLA 1FXHA 2J1TA 1AYM1 4MGTA 1DF0A 1XXNA 2R0FA 4Q1RA 5EBWC 5LA0A 1O3RA 3AVRA 3GXUA 1H9WA 2VMCA 4CVUA 3WP5A 3RSJA 3JD1A 5B1NA 2X29A 1HNWB 4NAOA 4V1PA 1G9FA 1ZZBA 4EQVA 4CDQB 1WW5A 3O1MA 5FJHA 3MZHA 1OQDA 4JGZC 2GN7A 1GM9A 1JX9A 2NLRA 1K33A 1MR5A 1Q90D 1G86A 3UK9A 5GJ6A 1PNKA 3MEPA 2FYUH 4AE2A 5FO9B 4QU2A 4FFIA 1Z5VA 1Y7BA 2IFWA 4XDLA 1ENSA 1VIBA 1PNLA 4UW6A 4EN8B 4LP8A 3RYFA 5C8WA 3IDBB 4WM7B 1TA8A 1S0JA 2DVBA 3NR7A 1AXKA 5DM6V 5KA5A 3F95A 1GWLA 4QT6A 4YARA 5LGTA 4YHHB 2WFF3 4CUBA 2N05A 3P30A 1GKFA 2XONA 4L2NA 3B2EE 4IW3A 3CMEV 3MD0A 1YFXA 1DG6A 3HOBA 4CSWA 1NTZH 3ZS8C 5KMGB 1F4MA 2X6BA 1D0HA 2R32A 2OIGA 2X8KA 3KG2A 4COVA 3AZYA 2O8QA 3AG3C 1WA6X 4YNIA 2EIDA 4QPJA 3B8NA 1EV12 2G9FA 4XACA 1RUNA 5EWSA 2MHFA 4LF4B 2XLAA 4DXTA 4MS2A 5A1FA 4UBHA 1NY72 4BQ3A 5HI0A 1GN6A 4X6RB 1Y76B 4X1KA 2DYSB 3JATB 5FUNA 4UFMA 4XFGA 4KHPO 2B5HA 4HSLA 4IYIA 2JWPA 4CU6A 1UMHA 1QWRA 3X29B 2H6BA 1Q56A 2GBOA 3IM0A 4GCZA 2R062 2D3SA 5F39A 4FPEA 4MVTA 1Q6UA 4EJRA 1JOYA 5I8TA 5EK0A 4XBNA 3NAPC 4HN0A 3JASB 2AXTZ 3BOPA 4MVQA 1GWMA 1BLZA 2Q8OA 2XTAA 1Q6HA 1F7YA 1KD1W 3J7LA 4HMZA 3BY6A 1UYPA 1VQNV 5JSRA 3TN92 1RHI1 5JLVA 4B3SB 1WN7A 2PFWA 2EILB 5F37A 1J3QA 3GDBA 4LBQD 3JAWA 2WQ8A 4I55A 3VHNA 2Y34A 3KCXA 4FPPA 1H6YA 4I0XB 1Z5WA 1GAXA 4MH0E 1Z78A 3CSXA 1RUC3 4ASLA 5DUVA 4Y24A 1UAIA 4I09A 1BL8A 4GD4A 3F5TA 4ZXEA 4JYYA 5ITZB 5JVVA 4A6OA 2PMWB 3F5WC 2BOCC 3M2MA 1K4DC 5HCAA 1NLSA 4K20A 4LK6A 1RMU1 4JI4B 1ZBA3 3O1UA 2DCTA 1S55A 4NHYA 3JB8A 2YXLA 4LLOA 4IL6Z 2QQUA 2JENA 3LCPA 1HR0B 5DXDA 3CS5A 1OA3A 3SPIA 3AKTA 4GH4B 4DR7B 1EM1A 4KWLA 1PIV1 5IWFA 2DW4A 3SDLA 4TWTA 5K1PA 1ALYA 1GZWB 3CCEV 2JKXA 3I97A 3WCSA 2XVGA 3JBG3 5A6QA 3ABLC 1OF4A 4ABMA 1JJOA 2RS51 3B40A 3BHPA 4DEQA 3O65A 3OUSA 2GU9A 1QBZA 3AMHA 5EJZB 1QR8A 1DQ6A 4LF6B 2DYSC 2Q8CA 5C9AB 1WW6A 3RMYA 4CH5A 2Q1MA 5FTTC 5L36A 2UY8A 3F7YC 4AG4A 3J81N 1DYOA 1IZ3A 4LWSB 2IUWA 2V1DA 4CUAA 3BIWE 4CUCA 5A7PA 4OFGA 1FMD2 1ZRRA 2JJ1G 4AFDA 1ORQC 2ZM6B 2LFSA 1H9PA 3VDBA 1FV3A 4KU8A 3D4KA 1Y4MA 4QPYA 1OQ1A 3STLC 3T2QA 4UVCA 1N32O 4ZKIA 2AH2A 3CQOA 5KXCA 4YLZA 3NWKA 5SV8A 5DZFA 4JX0A 3D82A 4LTAA 4RS5C 4ITCA 1YJ9V 2DYRB 1VF7A 4X89A 5F5AA 1F5FA 1VIWB 2QE3A 2Q9LA 1TUEB 4PV1B 1JFFA 3PVOA 5KHJA 4BPZA 4DUWA 2B4KA 3QNEA 3AZXA 3WZ1A 2RR12 1OLMA 1YI2V 4NHKA 2QWOB 1H1IA 2X6CA 1ENQA 3MDPA 1BMV1 1SA0B 4YZ2A 1XNRO 2GDFA 1GNZA 4JV5O 3EHBB 2VZRA 4BXSV 1W0JG 1SLIA 5DABA 1XE7A 2RS11 1W39A 1SBFA 2W1QA 2VXJA 1SS3A 2BNMA 2WLJA 1SCRA 4TZDA 1NOVA 3RT3C 2I2SA 4Z2WA 1PO11 3V0BA 2UU9O 4I5SA 2VW0A 3UT0A 3ZN4A 4XVHA 4OI1A 3R4SA 4MGQA 1H2SB 4IV1B 2BTQA 1CVNA 3SYCA 4QQOA 5C8CC 2HJFC 4DR6O 1VQOV 3GJBA 5JQGA 3CCLV 4M0HA 2VQAA 2WAAA 3EBRA 4GB32 1JQ0A 4FK5C 1JODA 4IQPA 3UJOA 1J84A 4JGZA 4JAAA 1MG1A 1BYHA 5ANQA 4Y22A 4F8AA 4WFEA 3K3WA 3IIAA 5DMYA 5C70A 3UKVA 3I49A 3FYIB 4P9YA 4BWOA 1UW8A 1L7QA 1WLWA 3QCWA 3ZMZA 1LGCA 3KM5A 1QJX3 1SLBA 4DPNA 2P34A 2QCSB 1BZWA 1WCKA 3VKOA 3PTYA 4CRQA 1QMJA 2GSMB 2BBAA 5LL6Y 4BLIA 1F35A 4CDXC 2KR2A 2VAUA 1SZBA 1KECA 3CRAA 5FK7A 2QE7G 1OA2A 5A7SA 1X59A 4CS2A 4H2AA 2OKXA 3HT1A 3C7OA 3WF0A 1M56C 1N3QA 3BODA 3MPPG 2IXLA 5FYTA 1PO21 5FZLA 1AYM2 3AP7A 3OGSA 4Y5Z0 5F7UA 1Y3TA 4ZZ8A 2LFRA 3AYEA 1JOJA 2A6WA 3ZRWA 4FM2A 4OPHA 3KV5A 4IGGA 3RZZA 3CC2V 1O9GA 5IY5C 1ODNA 2DYRC 1NKDA 1IPKA 1JYVA 4PJ0Z 3LNNA 2YB7A 4J10A 2A6YA 3LSSA 2VVFA 1RGSA 3VDDB 3H8OA 2VGDA 4PCRA 3RRDA 3OEHG 3J80N 4QX2A 3SCGA 2RHPA 1VR3A 2YC4A 3Q9OA 4MW3A 1ZL8A 3FAVB 4GX5A 1K45A 2C4XA 5F2SA 4CU9A 1CN1A 4PLNA 3U14A 1ACCA 1W6NB 4AXOA 2CGPA 3ASNC 4LA3A 1AL23 3O7OA 4LR4A 2A6ZA 1HRI3 4YSFA 2BW8A 1TQ5A 4NN0A 2W3JA 1OCCC 3WW4A 2CGNA 2H0VA 5IK7A 3NAPA 2JKBA 3WX5A 3QO5A 5CB7A 3SPHA 2ZE6A 2UWAA 3RZLA 1X9PA 3HPLC 1YYNA 2VOTA 1XE8A 5F3CA 3A0RA 4S2HA 5IFTA 2QSAA 5EBLC 2ZCWA 2B45X 3FHAA 1COV1 3B3QE 1PNGA 2QM4A 1ULPA 4CDQA 4E2QA 1AX2A 1HW5A 1CGPA 1O8PA 4DO2A 1JYIA 4L99A 4P9IA 1N32B 2VE1A 1YXBA 5IYZB 5AVAA 5EZWA 5DPNA 4AQ6A 1SLTA 4YWAA 1AF9A 3ZR6A 4Z1VA 3R6SA 2XJRA 4CP9A 1SG3A 1VBB1 4FTEA 4Z8BA 1IS5A 4BW9A 4UV9A 4D6TH 3NXSA 4MOAA 3THPA 1RHI2 3J8F3 4ARXA 2HVKC 1V6IA 3ZHSA 1I94O 1XNRB 3VBHC 4BA6A 1XBLA 4OXSA 4JGYB 4JV5B 3NMBA 1JYNA 5LA9A 3KLSA 2JE9A 2D3RA 2W08A 1G8WA 1BKZA 3NJYA 5LA6A 3K3NA 5IYDO 1AJOA 1V6NA 3VDCA 2ZAHA 2UU9B 3EB7A 3JCIA 4JI1O 4XIKA 2IZWA 1MOFA 3JATA 1S77D 3I7DA 4FFBA 3LDDA 3B77A 5IK8A 3DC5A 3WDYA 2C0ZA 4LOSA 5FOBB 1QLEB 4TXWA 3ZN0A 4DR6B 2UXCO 3MIEA 1GQGA 3TNPB 1RMU2 3ZMSA 2DJVA 1H2LA 1CD3G 1T6GC 2ZJCA 3M3IA 4AHWA 1LHOA 1BE3H 4DW0A 1JA8A 1I7FA 3ZFGB 5FK8A 1JU3A 1PIV2 2CUGA 3C2UA 3JASA 3KHBA 1M57B 4LORA 4MGZE 3IDAA 1UNBA 4MTOA 3KVAA 3H3UA 3SQOA 1MZEA 1O9HA 5EV7A 4CEWC 2F17A 1VRH2 3CC7V 4KFMA 1R73A 5L3CA 1ZZ7A 2VNGA 5DUWA 1UZ0A 3LDKA 2RS52 4EN6B 1AI4A 2D97A 3L73H 4DB5A 3ETEA 4ZU7A 2ARXA 4Y20A 2RMKB 5FZDA 4YW6A 3SEEA 3WUDA 2R9RB 1VQ7V 5GZDA 2O1QA 5J36A 1F15A 3CC4V 4WFHA 4I4TB 5J48A 3SKJE 4XFIA 3UESA 1PM4A 3ILRA 3OAAG 1GP4A 4TT3G 2LGWA 2PN5A 4ISRA 4QIWF 1PK6C 3WU2Z 2P4VA 1VQMV 3B09A 1YIFA 2WNUC 1L8DA 4Q4Y2 3TBDA 2Y6FA 4FPFA 3CYOA 2WC2A 1RVF3 2WT1A 2WS91 1IOAA 4FOQA 5FZ8A 1OHHG 4Q29A 2P3KA 4EV0A 4Q5OA 5JZGB 3I59A 4IEUA 1J83A 5JUVA 5FP7A 3G71V 1I5YA 2HWD2 1WA8B 5C8CA 3MGUA 5C3PA 3E1F1 5DG1A 2JG9B 2NN4A 3UT5B 1XHXA 4CTEA 3LSEA 4LE3A 3O1RA 2Y33A 1JU4A 2YHJA 5HCBA 2HLDG 1GTOA 1RUJ3 2EXKA 4Y5TA 3W59A 4TUYB 2WZPP 2TEPA 1BMV2 1PVC1 3E5XA 3URFA 3EO6A 2D40A 5B1AB 1BVVA 4FJCC 2RS12 4ZONA 5I91A 3ZX6A 1BZKA 5C9AA 4X8PA 4AVBA 4X1YB 5D8AC 3K2OA 1K5QA 4NMIA 5FBZA 5CFCB 4LWSA 2QQKA 1PO12 5DZGA 1QLEC 4CDXA 5ERLA 1IDSA 1N33O 5JOZA 2QWNB 4IGQA 5L3EA 4FPKA 1YUDA 3DKWA 3T08A 1NLRA 2XAQA 2WNVC 1OOPB 4LO5B 3VKFC 3THOA 4GKKO 1NH2B 2LUWA 4XF0A 2VMIA 3WHUA 1QH6A 2RDNA 5BR8O 3POIA 4XZPA 1KP3A 1MZFA 3I54A 5FXZA 4BQ4A 1US2A 1SRYA 1VPHA 4AI2A 1FKAO 3T4DA 3CMGA 1AVBA 3CJHB 3FLPA 3NNGA 5F2WA 3LUTB 4IHJB 4LF7O 2ZIMA 1W9WA 3SPCA 2PHWA 4YM1A 5L9VA 4F83A 2XAHA 4BIFA 3L74H 3NKTA 1LR1A 5BNPC 4QDSA 4A5UB 2WO2A 4P9XA 2UUCO 1AXYA 4D7TA 3N4MA 4PBPA 2HJDA 1Q8QA 2CTWA 4IETA 3D3QA 2WYSA 1HJFA 3OF1A 3VBSB 3FYEB 3OD0A 4PDLA 3JSNA 3LGRA 2VZQA 5ACA1 1I94B 5JCOC 3L72H 1RIRA 4E4EA 1V00A 4XE9A 3FBYA 4EN7B 1PO22 2DCYA 5FXVA 5CADA 3STZC 1Q3EA 2P06A 3P32A 1UWWA 3ZDSA 5FLJA 3LIHA 5E88A 1FATA 1GR3A 2C26A 4XIOA 3WG4A 4JI1B 3ZEDA 2PLV1 4Y4YA 2E6VA 3CRMA 2GMMA 2VL4A 2MEV1 4K7JA 1POQA 2Q68A 4R50A 4FXKB 2WWUA 1WD3A 2JG9C 4FVVA 4NIAA 2UXCB 1C8NA 1QNYA 1DGWA 2DWEC 4TSVA 4XJUA 4YZ3A 5HCHA 5FZHA 4YVWB 3ZSLA 5DEDA 1FFXA 2EF6A 4ES8A 1UKRA 4NIGA 4P9JA 3H42B 3SJCC 1EAH1 3WNXA 4G9SB 2L35A 5B1AC 1PL4A 2KA3A 5A7WB 3SMHA 1VAVA 4BMBA 5J09A 4Q2FA 1KRIA 3MHZA 4NAMA 1K34A 3KQ4B 3HQXA 2DCKA 4H0LB 4JI8O 1OPMA 5FFOC 3A7QA 4DV5O 3C7GA 4ZZ5A 2ADPA 4R9DA 4IEQA 1I5XA 3WF4A 1COWG 4ZKTB 2CH7B 2PGGA 1OCRC 1WAZA 3ABMC 3R65A 4OVEA 2GMEA 2HWB1 3ZHRA 2XUMA 5GZFA 4AQ2A 3VBHA 1AR71 5FZ1A 4MXWB 1COV2 2VR4A 1IHMA 5K1XA 2W1WA 1PPJH 1D7PM 3E8FA 3I2IA 2OUJA 1EV13 3CIHA 4JHZA 3LAGA 2WL1A 4O2AA 4GLXA 3E86A 3A4UA 4BWAA 2PAKA 3RYRA 2OS2A 2BCCH 2AACA 3HR9A 4GX2A 2NQYA 3AL5A 5E1RA 3HQRA 4JCKA 3N7LA 3PMEA 1VB2A 4BJ0A 2XWBB 3L2HA 4DOUA 1UMIA 2WIIB 4TV8A 1VBB2 5CFDB 1ZWIC 2P6HA 2ADQB 4FQ4A 2DCJA 2R063 1AROP 1MPXA 2RG4A 3J7HA 3K9AA 4QKDA 4WVZA 1LNSA 1JUHA 3I2DA 3SYOA 4TLFA 3H1JH 3ROUA 5JJJB 5FY7A 2JDHA 3ZIXA 2NZ9A 2AZ0A 1Y4WA 4CEWA 4YZ4A 3O9OA 1VQ9V 4Y1UA 3NJZA 1UD1A 4F4LA 3E97A 3OOXA 3SHRA 5I0SA 3SEPA 4H44B 3NNFA 1PX4A 1XNAA 3AG7A 4N53B 1X82A 1E5RA 3PUSA 1ZRIA 3SCFA 2IJJA 4X1IA 1L7LA 3AZWA 3PVNA 1XILA 5F1RA 3ALQA 3MLJA 4GJYA 3GWKC 2Z79A 2NPIA 3K75B 3MIFA 4YVWC 5FZ4A 2VH9A 4O4HA 5KHKA 5L7OC 4PELA 4EYUA 5GONB 3ZIAG 4R9CA 4JASA 4FLXA 1OUXA 2KQXA 5IYZA 2VQ0A 3CBNA 1S4CA 1PK6A 2WNUA 5IK4A 2VMEA 1UOJA 1W8FA 3RJ2X 4CU7A 3NVCA 4XDPA 3G67A 1NLQA 1WMFA 2YMZA 3WT3A 2AUYA 1S0DA 2Q7HA 5GLUA 3RWRD 1AR81 4TWKA 2UUCB 1H0BA 1ST8A 1SCSA 5FWJA 4ISQA 5FYHA 4J80A 1TAEA 4P30A 2W91A 1RUC1 3E8BA 1L3JA 1PZ8A 5BXZA 1D4VB 1C28A 1DU3D 4LBQA 4GX0A 2P22C 2ZS6B 1H38A 3IBMA 3UCSC 5L9BA 2RV9A 1S2EA 4I7ZB 5EP9A 1G9BA 2X0LA 5T50A 2QTOA 1YO8A 3PNAA 5D8AA 3KD4A 3VD9A 5BV6A 4B4RA 1ZBA1 5T5PA 1XJAA 1I3HA 5KAIZ 3W5MA 4H33A 3DC6A 3VLBB 4DY5A 2WS92 5IWAO 3WY6A 3POWA 1HJGA 1OJHA 1GOHA 4ZU5A 1VQLV 1X8MA 1FMD3 1XUQA 2WNVA 4YW7A 2XGXA 2BSKA 3FLRA 1J5EB 3Q4HB 4EWEA 4Y33A 3PLQA 4RUFA 1REFA 2P6CA 4LKSA 4E4ZA 4AEDC 5DDJ1 1EFRG 1W6PA 1AHSA 1PV0A
chains in the Genus database with same CATH topology
4PLOA 5KHGA 4JGYC 2B9UA 4I30A 4Q4Y1 3TOJA 2UYAA 2CY6A 3ETQA 1GZWA 1MS8A 3B9CA 1PVC2 1H8TB 2IFRA 1FMD1 1O3QA 2V5YA 2CTVA 2RE9A 1RC6A 4QQLA 4FSJA 4WZCA 1PGL1 3KCYA 4OJ8A 2RR13 5BNPA 3VL8A 1W0PA 3PHMA 3S6PA 4LO7A 4AEKA 1C1LA 2WA3A 3LA3A 2YZ4A 2XJSA 5D1IA 4FBFA 4FPLA 1R092 3RNSA 1H2MA 1AXZA 2WLPA 5I0UA 1V6MA 2RS33 1ULDA 1YJKA 2XB6C 2HWD1 2Q5TA 4HPKB 4CDWC 1RINA 4QGNA 5BNNA 3WVJA 2SLIA 2YUEA 4QPIC 1UIKA 2PHRA 1WW4A 3RWNA 1NYWA 1OQEA 3HN1A 1RUJ2 5T3NA 4YFZA 2E9QA 1Y9QA 1DLLA 3AMNA 2C5DA 2FHRA 4Y22B 2WSUA 4AI0A 3E5UA 3ZYIB 4W65A 2ZGRA 1NE4A 1E57A 1RJ8A 2DFCA 2Z69A 4B8EA 5CNAA 3WG3A 3DPRC 4RD7A 2BNNA 3H7YA 3SLIA 1C5HA 4WBBA 4LBMA 3U4XA 1NCRB 5GKAC 4R8HA 3HWJA 4JV4A 4B29A 4CDUC 1V6OA 2RS31 3ZFGC 2TUNA 4WVMA 2OIIA 1H1AA 2GSYA 1ZZ6A 4GKYA 5DUUA 4XDQA 4E4SA 4L92A 2YY1A 4GMP1 4Y1ZA 4YG6A 4KG8A 4UW3A 3E5QA 4HANA 1I5ZA 4QQ2A 5T52A 1VBC3 4HKLA 3N35A 3LOBA 4LHKA 3D0SA 3RYPA 2R042 1S0CA 4HZFA 2DVDA 3KSCA 2JG9A 2QKDA 1NQJA 2JD4A 1RUF3 4XFFA 2NMOA 4AI1A 1PM7A 1POV1 3D5OA 4GB33 1DYPA 4A7YA 1ZZ9A 1ZRDA 3K48A 2A6VA 2G4IA 2OYZA 2Q4SA 1JH5A 1TMF3 5A32B 1SDWA 1Z0HA 2NYYA 1Q8OA 2NMNA 3USUA 4JC1A 4XQWA 4YM3A 1OMIA 1S0EA 1W6MB 1U5XA 2ZGQA 1CJPA 3TB0A 3JD73 1VP6A 1MQTA 3JB4C 1UU4A 1DZTA 1ZBE3 2IXIA 1DGRN 3NV3A 4PQ9A 3RJRA 3T2TA 3L2YA 3AJYA 2HEWF 3OPZA 5ACA2 1CAUA 2WT0A 2DURA 3CJIC 2XVKA 1GZCA 1SLAA 5JOYA 1VBC1 2WQ4A 4XJZA 1DS0A 4MLOA 4RGGA 5DG2A 1RUF1 4NE0A 4XMAA 3AMPA 3JD72 1W0OA 4N9IA 5GALA 4GB31 1VBE2 1HKDA 1QOOA 2HEYF 4JTNA 2A3WA 3O0WA 4FCAA 3BCWA 1N3OA 1UMZA 1LGNA 1TMF1 2GC3A 3FX3A 3M1HA 4OUSA 1N1VA 4YGBA 1WW7A 2ILMA 1VBD3 3AB0A 4OULA 4N9HA 3VKLA 1QOSA 2DVAA 2FZ1A 1ZBE1 3TWIA 2PLV2 1O7FA 2P3IA 4JQRA 2WLQA 1BCXA 1FNZA 4BE3A 4DINB 4RQPA 5CIRA 1FNYA 1AYM3 1DGRA 5EFUA 4OHVA 3MFCA 2E53A 4RA0A 2XVLA 2ZGLA 1QNWA 1WD4A 2CAUA 2MEV2 2QQPA 4D94A 5JZGC 1V6LA 4IV1A 4M23A 2P2KA 4HK8A 2XL7A 3LA7A 4FXGB 4COZA 4RR3B 3KMHA 2YGLA 2ZHKA 1KFXL 1S2BA 2X5IC 4GULA 4HLTA 2D44A 5JCTA 2ZMLA 2R6SA 1VBD1 4XFCA 1LCLA 4Q0UA 4PBOA 3INAA 3R0RA 1N1SA 4XF1A 5JI7A 4YM2A 1N3PA 1NCQB 3ST7A 1WA4A 1QF3A 2Q1ZB 3TNQA 4LBLA 4HVRA 1U5ZA 3VBHB 4ATFA 1AYM1 1EAH2 4X8NA 3WOGA 1KDMA 1JTZX 1B35B 1DF0A 5KBFA 1XXNA 2R0FA 2QDRA 4Q1RA 4HVQA 3AZVA 4Q27A 1O3RA 3VUOA 2HJIA 2ET7A 5CAZA 2XJPA 2FZ2A 1H9WA 4HKOA 1CAXA 3AP5A 1YLLA 3WP5A 3JQXA 1XNKA 4DS0A 3RSJA 4WVWA 2X29A 3WG2A 4Q8KA 4YZ5A