1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
b'SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
2ILMA 2XUMA 3KCYA 1H2MA 3OD4A 1MZFA 2Y0IA 5JWPA 4Z1VA 3D8CA 3KCXA 2CGNA 1H2KA 1MZEA 4AI8A 2WA4A 4Z2WA 2WA3A 1H2NA 2CGOA 4NR1A 3P3PA 4BIOA 3P3NA 4JAAA 1YCIA 2YDEA 4B7EA 2YC0A 4QU2A 1H2LA 4B7KA 1IZ3A 2W0XA
chains in the Genus database with same CATH superfamily
3GYDA 3LA2A 5JQGB 1HRI2 2GMMA 4U2AA 4E2QA 3EXUA 4LK7A 3LNMB 2EVXA 2ZZJA 3NQHA 3U1XA 5ISLA 3AG1C 4XFCA 1NE6A 4BLIA 4BK4A 1S0VA 2RM22 1G8WA 1QMJA 4P9LA 1PK6B 2UXNA 3JAKB 1CEZA 1HXS1 2P2KA 2B1GA 3GBFA 3M1HA 3E22A 2BSKB 1ST8A 1WBFA 2GV9A 1VBA2 3OOXA 3AEIA 4ES9A 3AXDA 1ACCA 1FD9A 1IBMB 1C5HA 4RD7A 1IBLB 4GWJA 2WT2A 1JR9A 3H3UA 1O6UA 2JG9B 1CD3G 3AG2C 4JV5O 1XYPA 3H1KH 4HOOA 2Y0PA 5H2FZ 5GLZA 1Z5VA 3O1PA 3N27A 2WLJA 5KC5A 1FXHA 3C7HA 1V6OA 2PQSA 4UW5A 2UURA 3QH7A 4JC1A 4A41A 3HVDA 1MVQA 1SDWA 5KXBA 2BOIA 4MH0E 4Q0QA 3CNAA 1W28A 3WUDA 4NVPA 1JW6A 4CDUB 1R1A1 3T09A 2GN7A 5CA1B 3ML0A 4LBOA 2GNMA 1AI7A 3AM2A 1G9FA 4YVSB 4MHUA 1HIXA 1XYOA 4JYAO 3OM3B 1JBCA 3VHPA 3VBSB 4QHBA 4DR1B 1HQWA 3D82A 1C1FA 4I4TB 4L9BA 4RN5A 1ZL8A 1F31A 5B1BC 3ZKUA 3L71H 3NV1A 2C9KA 4PLNA 1M4UA 1GO3F 1CAXB 1EN4A 5T5OA 4Q0VA 3KWVA 4J10A 3UKTA 5LOVA 1Q81W 1AVBA 4FFFA 4DO0A 2ZE8A 2FCUA 2LROA 4ZHQA 4AVTA 3ZFFB 2VBPA 3DXTA 4NKGB 2LGQA 3IC9A 4X1KB 3MPPG 2FMYA 2ZGQA 2D43A 4S2FA 2D6OX 4DV6B 3L2YA 2VNOA 3MLKA 2ZX3A 4HSLA 3ZKYA 1W9WA 4NHLA 5CEHA 2XONA 2AZ5A 4Z2AA 4B3RB 1JPXA 1K5MB 3ZFGB 3VDCA 4YG0A 5LMNB 4XF9A 4ARXA 2VPVA 1JUIA 2YXYA 5JVVA 2P3KA 1G9DA 3V0AB 3T2MA 4UW6A 1IPSA 3W7UA 2CGPA 2IXLA 1OVSA 1JFFA 1L0LH 5GZCA 5C3SA 4Z1MG 3TETA 2E5LO 3EHKA 4WVVA 3AJYA 2YC4A 2YG0A 1GOGA 3QLQA 4P14A 1JJOA 4URTA 1S2EA 2WQZC 5IYYA 2XVLA 4BK5A 3HAGA 2IWGB 1Q7YW 1S0CA 1XEQA 1HJFA 1QCEA 2YC0A 4GKXA 1W6PB 2R9IA 3VLBB 2UYBA 3ORJA 4DV1B 4LO8A 3ABUA 3VKMA 2IM9A 4LBQA 4DR2B 2VNGA 4TXWA 3CCUV 3RVZA 1XU1A 3LNNA 1GN6A 1MQTB 3L2HA 4LULA 1VJ2A 4I3PA 4Z8BA 4DRVA 3OMAB 2Z79A 3M7AA 3ZN5A 3DTUB 3NAPA 1VRH2 1HRV3 2JGDB 4GJYA 1PGL2 3HJRA 1JZ6A 5T52A 4K3AA 5C8CB 1G6UA 3CC7V 2YHJA 2OIGA 4PA4A 2WNUA 1R3LC 1KDMA 3DYMA 5KHGA 4YRDA 4MTFA 4N53C 3VZOA 4ZS2A 5CADA 1AB3A 3HKCA 2R041 2HJDA 5CBGA 1BEV1 1OLRA 5A7QA 4F3JA 5FXZA 2QCSB 4XW3A 4LIUA 5FOBB 2J1TA 5IJ9B 2QTOA 1OXCA 4GD4A 5L7OB 1N4CA 3B8MA 2RS32 2QWPB 1YIPA 3AKTA 1ZBE2 4B3SB 4W50A 4FFIA 3JATB 1SBFA 1MNGA 1ND3B 5JJNB 4CUGA 1SBEA 1W9SA 3C7FA 2LW8A 3WNLA 4FOYA 1X82A 1OI6A 2BTOA 3INAA 3OBZA 2PAEA 3TAYA 4QXHA 5EYXA 5K1PA 3ZHQA 4AILC 4WV8A 5EYPA 1SCRA 4B08A 5FYIA 3R4UA 4JI0B 3H7YA 2DVFA 3Q8AA 4DB5A 4LWSA 3BCWA 2E75B 1SBDA 3K48A 1R092 4FP2A 4LE3A 2JD9A 3X2QB 2G19A 4CEWA 3T0DA 5C93A 3WP4A 3FJSA 1RP3B 3G6JB 4QHZA 3FBMA 4RHV3 4FT8A 1B06A 1TEIA 2ZTNA 4X1YB 1FNZA 4QDRA 2XAFA 4ZZ8A 4IETA 2Q30A 3MHSC 2Q5TA 5F8PA 4D6TH 5J36A 1QLEC 5JZGC 4U36A 5I8YA 1HW5A 1EY2A 3BA8A 5FP3A 5ACA1 3IN9A 4PD4F 2PLV2 3NO8A 4GKKO 4X64O 1H1AA 2DTWA 2WBKA 1Q8OA 3TJTA 2JIJA 4XAAA 4X89A 4DR3O 3T1YO 3FYIB 1PX4A 1RUD2 3UGGA 1HV1A 2XQRA 3ZN6B 1S1AA 1WPBA 4ZS3A 1JOBA 2K9ZA 4Q29A 1FPN2 3JBG3 3K0DA 2F66C 4G2KA 4MVMA 5DQ0A 5DZEA 5CMUA 1CWPA 3IIAA 4LA2A 2N74A 4Q4Y1 2ZPXA 2R6QA 1GP6A 4EN9B 5FZ8A 3HBZA 2H94A 2ET7A 4CDWC 1JOPA 2PI4A 4YHHB 2JDNA 4AW7A 1SLIA 2H0BA 2NR5A 5HBAA 3ECQA 5IFPA 4JDOA 3ZRSA 4GH4B 1NTZH 5FBJA 1SERA 2YEVA 5FWEA 1L3JA 3JCZA 2AZ2A 2OTJV 2WNOA 3VBFC 4FQ4A 1DIWA 2DOSA 2NM1A 1NBMG 1PVXA 3S5AA 1QQP3 3CQOA 3KCYA 1WA6X 4IE0A 5FQ0A 3OD4A 4MGKE 3P30A 3NR7A 3K0GA 2HWE2 3NNGA 4RWUA 5LEKA 1SA0B 4BM8A 3G4SV 3TEYA 1JUHA 3OR6C 1F4NA 2X10A 1EV11 3RYHA 2HJFC 1U5IA 1DGRA 4ZI7A 3ITQA 1VBE2 5ABJA 2WZEA 1W6NB 1NT0A 5BXXA 1LOAA 4RR3C 3LKJA 4JZGA 4YWAA 5A3MA 1C1LA 1GM7A 3HT2A 1MG1A 4H7LA 2LQTA 4ITCA 2EILC 5FJKA 4CC5A 2Q0OC 1OSGA 1L7LA 4O65A 2W95A 1ENSA 4CC6A 1RUJ2 5A7SA 3DC6A 4CCJA 3KLSA 1S77D 3I3EA 3KF5A 4QKBA 1AR71 1X33A 2D44A 5EK0A 5FXWA 5D2AA 2RR13 4A5UB 1XI1A 4GT1A 2HWC3 2ZX1A 5LGTA 4JHTA 2GP3A 4A7KA 4PF5A 3VB9A 3L74H 5CU1A 2HWF1 4DV4B 5J9PC 1ULOA 3K4AA 4DUXA 4HNAA 1DF0A 3POYA 4DV7O 1MVEA 1F8VA 5ITZA 1OCRC 1YLLA 4UVCA 3E22B 5FPAA 2ATFA 2XASA 4WM8C 4DR4O 5CA0A 2EIGA 3DGEA 4LO5B 3J7HA 4GZ9A 3U4XA 3VKLA 5LBFA 2LFRA 1RVF1 1C8M1 1UWWA 2CWSA 4GMP1 4GAZA 1NY72 4R9CA 2QR4A 2JDAA 4IGPA 3ALQA 4CXWA 2WFF1 4JVAA 5FY7A 4RS5C 1JZ4A 2XAJA 5FUIA 4F6EA 2BU9A 3FFZA 4JI7O 2B1IA 1WGPA 1HNZO 1N33B 3WDUA 1FS0G 1XXNA 2XL7A 3HKEA 3ETDA 4IV3C 3BY6A 2IXHA 1ZRIA 1PIV1 3GBWA 4I9QA 2Q8CA 5I0TA 1RINA 1SRYA 1TNRA 3AP7A 1AL23 2QFEA 3FX7A 1X8EA 2ZXWB 1ZL8B 4N9HA 1E1RG 2BW8A 3TK1A 2CUGA 5K1XA 4XFAA 1VF5B 1XNCA 1RIRA 1UPSA 3MLLA 3H1YA 1ENVA 2LS6A 5LOVB 3W7WA 3T30A 2R071 3B3QE 1WA4A 4ZHQB 1N3QA 2V73A 2VNRA 2RV9A 4NTXA 4BOWA 3D0JA 4DYLA 5BNNA 2UXBO 4Y26A 3PVOA 4UAPA 2D2CB 3B7MA 1PNLA 3MIHA 4KQ7A 4UV9A 4PQ9A 4B4PA 1O91A 3LEMA 2R063 5E1RA 1QJEA 1YDXA 5E88A 4R52A 1V54B 3ACGA 4O4HA 3U11A 3DXRA 3J7NA 1W2BU 3QO5A 2K9PA 3K58A 4K40A 4F7ZA 2XNDG 2VNVA 5FZIA 3VBHA 1KMIZ 3ZR6A 4QX7A 2ZCWA 1JFFB 5J3UA 3C8XA 3ZMSA 3R4SA 1W59A 4DRRA 5AC93 1DZRA 3IFXA 3CRMA 2ZEYA 4KMQA 4G4FA 1ODNA 3SITA 3HWJA 4B3NA 1XMQB 3EQEA 3VQWA 1VAKA 2BNNA 3BIEA 1OOPA 5DUUA 1IXMA 5KXDA 1JYTA 1IBMO 4DUZB 2JG8B 4H0LB 1NCQB 4KH9A 3CEWA 2QQKA 3A4UA 1PNMA 4IESA 2HEVF 1O5LA 3Q8CA 4XABA 1JMKC 1AJNA 2A6ZA 3H50A 3OMNB 1UZVA 2A7WA 2JB4A 4TQDA 1LGNA 4LBQB 4LJHA 2ZMLA 1AYM2 4F6RA 4FO9A 2NQYA 3AL6A 4GULA 3RYCA 1W8ZA 4QX0A 4CBCA 4QB6A 2DBIA 1J83A 2WS92 1FMD2 4LUKA 4MXVA 3I3DA 4DZGA 3BUCA 2EICA 4LFAO 4JI1O 1S5LZ 5A6QA 1ZA7A 1SFNA 1WP8A 3JD72 1AR92 1TME1 4MVTA 1OCZB 4JGYC 3K46A 1UFIA 1EP0A 4CU6A 1W2UA 1G1XB 3PTRB 3PHMA 2O8QA 2XXZA 3HNYM 1LESA 2ZOEB 4DR1O 1S0IA 2O1QA 1BQ0A 1XB9A 4YG3A 2BGPA 4CZZA 1N36B 5JVDA 1XE0A 4MGTA 4C7UA 5KBFA 1MZEA 4WZFA 4P9IA 4CCKA 4Q8KA 4BQWA 4Q0UA 5C9AA 4XUTA 3NNLA 3OUSA 2AEYA 2RMU1 4LEJA 5JXIA 5I0DA 4XIOA 4Q0PA 1N34B 2BTVC 4R9DA 4BW9A 5A7WB 5IYBO 4HN0A 4NIGA 1OD3A 4ONUA 1W0PA 4EJRA 1VMJA 3BVOA 4OHWA 3C7EA 1MS0A 3U07A 3BODA 4LOSA 4LWSB 1JVMA 3IBMA 1VB2A 1XE8A 1MS8A 4QB2A 4EB6A 1EAH2 1CJPA 4CEWB 3NVCA 1F35A 1HV0A 5F5QA 3B2EE 1XSQA 4DV6O 2YGLA 1W3VA 2DQ3A 5FZ7A 4CZSA 4OHZA 5KHJA 1CN1A 1MSDA 3TEWA 2VY0A 3S3WA 3WEZA 1RUE2 1GM9A 4B3RO 2Q8EA 4P02B 1R3IC 4RL7A 5EPAA 5DUVA 2RMKB 4CCOA 4IEUA 4PCRA 1CX4A 5A6XA 1NA1C 3A2FA 1AR82 4DW0A 2H8PC 2WWWA 3L9JT 2ARAA 1D0GA 2W5FA 1FFXA 3BFRA 2OQ6A 2Y33A 1M56C 1XC6A 5CYYA 4RFT0 5KA5A 1JH5A 5BYNA 3ROUA 4HZFA 1ZUQA 2PYLA 2MNGA 1XOUA 4FAHA 5F5CA 5EBMC 2WLPA 3BTZA 1XBLA 3BEHA 4O61A 1PZ9A 3SNMA 2B9ZA 4URAA 5KXCA 1IKPA 3WINE 2IXIA 4K3UA 5FIXA 1N1YA 5JR2A 4O2AA 4JF3A 5JSOA 5H9SA 5LEJA 5GM0A 3QCWA 2GZWA 3I56V 3PIJA 3POJA 4DV1O 4YW3A 3AK2A 2BNMA 4BYYA 5C8YA 5GLWA 4DR2O 2WN3A 4W8JA 5K9YA 2CTWA 3ACHA 4OUEA 3P3NA 3OSDA 5FBZA 3CXCU 4E4DX 1SFYA 3M3IA 3E5XA 1D5NA 3W7XA 5FMOL 3CRAA 5IWAB 1KQSU 4HAMA 5BNPC 2K46A 3POEA 1AP5A 4TV9A 3QG5A 1PO22 3D3AA 4Q4W3 1CAWA 2BBAA 3AMNA 5FQ0B 1Q8IA 1X9PA 4CU7A 4V1PA 1QOSA 3OGVA 3ZIWA 2F6BA 4S2DA 3RWRD 5KMGB 1X50A 2QKAA 2VCCA 3OGGA 2VMHA 4TTGA 1WW5A 2DVAA 3NJXA 1YVWA 3AZZA 3RYHB 1SF9A 3UT0A 4H55A 5F3GA 2QJ1A 4ZI7B 5ABJB 5AFEA 1J84A 1KS5A 3PVBB 4H13B 5LRSA 3ZO0B 5LA6A 2VCAA 2M7WA 4R8HA 1RUG1 1TUEB 2EXIA 1RUI2 1OF3A 2OUHA 1MMMA 1GWMA 4O9GA 4JI0O 2GUZA 3HQXA 1KKCA 1H38A 5FZ6A 3LDRA 4OHYA 4YZ1A 1URXA 2ORXA 4AL9A 1ROPA 2KD7A 2WKKA 1E5HA 1AR63 4LE4A 2P4VA 2RS53 3CPWU 1DGWX 1QWRA 4S2GA 4AWDA 4A4AA 1K7DA 1STMA 4NMIA 2YUAA 2VZUA 2DYRB 3CCQV 1UIKA 5FZLA 1QR8A 1F4HA 3O0XA 1F9KA 2FMDA 1PZ8A 2JJ2G 4U7OA 2GBOA 2UY9A 1M57C 4B29A 4Q4Y3 4AGGA 1V9U3 5A70A 4MZUA 4FI9A 2RS12 5A1AA 4HT1T 1JOJA 4BIZA 5ITZB 4FTSA 2HWB1 2HHHB 1CAVA 4QXCA 5FLHA 4PIXA 2JJ1G 3I2GA 3OY8A 3IJ4A 2QA4V 1Q43A 3KZ4C 2XLGA 4MSWC 2QWNB 2YU2A 1RUH2 5CA0B 4XXAA 1IKQA 3CD6V 3E8GA 5IDJA 4Z1VA 4YIPA 4JAUA 5LHHA 3ZXGA 5FZDA 4M3CF 5IJRA 4K7JA 3TNPB 1UYXA 3UYJA 1SG3A 5L3GA 1N47A 1PO13 4X20B 5LA1A 3SJCC 5FZ4A 1NH2B 4LHNA 1VBD2 2E3CA 3GZUC 3H42B 4QWNA 3VD5A 1JYVA 1SLLA 1EV13 4CDQC 2P22C 5D21A 2PYTA 3OGSA 3R65A 5CFCC 3HKEB 1WUVA 4Y4RA 3LQCA 3POFA 3KMHA 3OFNG 4ZHNA 3SHRA 2NN4A 4LFBB 5FZ9A 2Y4TA 1VF6A 4GLXA 2XJVA 1XL6A 3V0BA 5A3OA 2NLJC 3I2KA 2E26A 4YFZA 3WDXA 1R1A2 1K97A 4ARYA 2VZVA 1N1VA 2OCCC 4PDMA 4NHXA 4FPCA 3RI9A 3P1IA 1VF7A 2ADPA 2E31A 4HVQA 1H1IA 3M3QA 2J22A 4N43A 3TXQA 2QQUA 3CZJA 2DVBA 4HONA 4BWOA 3BABA 4UFKA 3WHTA 5C3RA 1XU2A 2V5YA 2BP6A 1W6QA 2E51A 4EKWA 4N9IA 2ARXA 2HWF3 4JGZA 1NQJA 2AHZA 5BNNB 2WAAA 4CTEA 2JDMA 3H0OA 2VO5A 3IMNA 5E6HA 3MLJA 1O3SA 3VHOA 2BZDA 1CZVA 4QAWA 3CDZB 1YQ2A 4O2BA 4O4HB 4IV1A 3I2IA 3DXRB 5FPUA 2CAUA 2UY8A 1JZ8A 1IX9A 2OXBA 4XBLA 2CDOA 4QPGA 3GZAA 2YIAA 1MZ5A 4LF8B 5J09A 5FY8A 4PDVA 2WFF3 3VBHB 3WP3A 1OLMA 1BL8A 1H0BA 5CFDA 3ETQA 3T4DA 3AG3C 4DV4O 3ZXEA 1BZKA 3ES1A 4RQFA 3E8HA 4LIVA 4BJ0A 2DU1A 5JUVA 3TRSB 4META 5CA3A 4IHJA 1LR5A 2A73B 1UX7A 3PDQA 2YI8A 1OOPB 1NQDA 4SBVA 4LPLA 1GN2A 1T2XA 1J5EB 1UU4A 1DK1A 1WW6A 1X9TA 3WHUA 2EINC 2K2SA 4LF7B 1WCDJ 1QJU3 5GW7A 5L3BA 2WWUA 4HK9A 3EO6A 2WO1A 1WP7A 3SEEA 1G9BA 4DV3O 3CBNA 2E32A 2J1VA 3LEKA 4F6RB 4R50A 3AFKA 4YJ2A 1R081 3KVAA 1W9TA 4NO4A 2RQ6A 2WNVA 3GZTB 1N33O 1HRI1 3E6BA 3QH6A 1W8FA 1VQ4V 1SQPH 3IPVA 3ZXFA 4JRLA 5CZKA 4YGEA 4B3MO 1DLCA 1Y66A 2R073 2RM21 1MOFA 5EQUA 2SBAA 1ZX3A 3WXPA 5EJ3A 2Q0AA 4IGQA 2Y69C 2NN8A 2QUOA 3A0NA 3KS7A 4OUMA 3K59A 4IEXA 1VBA1 5JVDB 1KEXA 1ZRFA 4QU1A 3VZJA 1N32B 5C9AB 3SYCA 2CK3G 2ZX0A 1GUIA 1MPXA 3F5WC 3WU2Z 3TEZA 1OCOC 4H3WA 2RDCA 1CXZB 5FMBA 4L11A 3WR0A 3H7JA 1PVC3 4CVUA 1KU9A 1KD1W 4XQ4A 5CA6A 2V7QG 1JMUB 1QHDA 4UFJA 2BPA2 2JD4A 2EIJC 1W8HA 3THDA 5FO8B 4V2VA 5EZYA 2ATKC 4GJZA 1YFYA 1B35C 2IFWA 4A6SA 4EROA 1PM7A 5IFTA 5CVRA 1SETA 2JE7A 3B5LB 4J7JA 4DR7B 1VARA 2CDPA 1JZ3A 4J7KA 2BVBA 1YJWV 4IE6A 2F1MA 2ZHNA 4JYYA 3FAVA 2LALA 1FXZA 1FYUA 2ZM6B 2YBKA 4IXLA 2QE3A 2BBVA 1FFXB 2EIMB 4PI0A 3K4ZA 1W8OA 3NKGA 4MS2A 3QNEA 4B7EA 4ZKIA 4J7ZA 2H6BA 2A9HA 2WJSA 1ZX5A 1LU2A 3ZSJA 3DPRC 4XJ8A 3GWKC 4JI6B 1BBT2 1VAMA 1UZ0A 4E4SA 3VKNA 3N7KA 2TUNA 1XMQO 4YW7A 3K3NA 1SCSA 2WAOA 1QY4A 4MT8A 1AR5A 4IT5A 4LF6O 4O2AB 3ZXAC 3MW2A 4NHYA 3T1CA 4FFKA 4QQ2A 5LHGA 5KR7A 1TMF3 3UV9A 1JCHA 3RWNA 5C8YB 4UCVA 2A71A 3KT4A 2QQPA 3PIGA 4QGMA 4RQPC 1W9YA 4FPGA 2HLEA 3S7IA 3ZS8C 1BLZA 3JASB 4KG0A 1NR7A 1OQ1A 5CISA 2Q1FA 2UUBB 3N35A 5KHKA 5IUQA 3T1MA 1W8TA 3BTYA 4KL1A 3A23A 2HWD3 2FB5A 4HKLA 4CCCA 2YUEA 3I7DA 4JQRA 5BUVA 4P9PA 4RO2A 4XJWA 1CAWB 2W91A 1L1FA 2C4XA 3KQRA 2C26A 2DUPA 4NR1A 3AL5A 4YNIA 4NYKA 4HYOA 2X6BA 3N2GA 2CAZC 4NOTA 3AX4A 1N36O 1J58A 5FKCA 3TNQA 2WZR3 4UFIA 5C70A 5DM6V 2CV6A 3ZLIA 3OD0A 3G80A 3KCXA 2B5UA 3ABKB 3WY6A 1UMHA 5HCHA 4XEZA 2ETEA 2YGMA 2HH9A 3EB7A 3D0SA 3ZFEC 4XYXA 4QPKA 5LA6B 1IDSA 1U97A 3MBWA 3J7MA 3VUOA 4I7ZB 3POWA 4HG6B 3VZMA 2EZOA 1UD1A 1JXNA 5LWBA 1S55A 2GUZB 3ABZA 2GALA 2CU5A 1O9GA 1GYKA 4FPJA 1CJDA 2HLDG 1A3KA 4WVWA 1A78A 1PGL1 4N23A 1SQ4A 3RGBA 5L9BA 2XBO2 1N0NA 1QIQA 4QE7A 4FPLA 4Q4V3 2QEXV 4JZ2A 1JHNA 2DFCA 2R16A 3WDWA 1EZJA 5I0UA 5FY1A 1GQHA 1KXGA 2Q8DA 3ZYBA 5A9GA 2EX3A 1QDCA 1MA1A 3J9SA 4YFWA 2UUCB 5CB7A 2WSUA 2RS31 4E2SA 5FZGA 4BMBA 5J2TA 1ZBE1 3J81N 1SZBA 2RCVA 5FYVA 2VMCA 1DLLA 5LGNA 1RITA 3C2UA 4FOWA 4P5HA 1CAVB 4Y4YA 1AR72 5D1IA 5JZGA 3NV4A 3JARA 3J7AU 3BTAA 1YQ8A 4WFEA 5JOZA 1TZOA 3C90A 3L72H 2ET1A 4WFHA 1RJ7A 1H8TC 4Z2WA 3POGA 3T1HO 2Z5WA 3IAPA 4JQTA 5DMYA 3VQVA 1OZ0A 3GHMA 1SZXA 4CS3A 2ZMKA 2A6WA 1R091 4IQPA 2KQXA 3USUA 3JQXA 5B1AC 1BKZA 4FM2A 1YQ6A 3ILNA 1NOVA 2BFUL 4LBQD 2WT0A 1LOFC 4BH9A 3NJVA 5IVFA 3ABLC 4M01A 1GLHA 2F4LA 1SC5B 1SLTA 2XAHA 5HXMA 2ZE5A 2Q5ZA 3SKJE 3WUCA 2PLV1 3VDDA 3GM8A 2P5OA 1PMJX 1LOGA 5BXZA 1E5RA 1UW8A 3DKQA 4S2HA 5IWAO 3MDSA 1RUG3 4CDWA 2Y6JA 1WMDA 1XUQA 3SC7X 1RUD1 3I2OA 2A6VA 2HVJC 2IW5A 3V0BB 4J41A 3L70H 3U4SA 3VBFA 1WCUA 4OMDA 1PIV2 1FPN1 2P4KA 2E33A 1X4TA 4QQHA 3ACLA 1Z7S3 1YI2V 3SCGA 4P30A 1UYYA 4DV5O 2L9LA 1DQ0A 2UU8A 1U0AA 4N43B 4RHV2 4PDWA 2ADDA 2D3SA 5GONA 4AGRA 3ES4A 1GWLA 3VD9A 4TYSA 3KM5A 2VQFB 4JGZB 4W4LA 2BDRA 3OTFA 5LXTA 2WYFA 5FYZA 4QPIB 5BNOC 2BE3A 3JB8A 1MEC3 5D8AC 1UKGA 4ASKA 2BWAA 3F7YC 1CAUA 2UWAA 4QQOA 2MHFA 3TGUH 3GHNA 3APBA 4YSFA 4O2BB 5F5AA 4NXMO 1W2NA 3E6CC 4IV1B 3H9AA 5FKBA 3GXUA 3AG4B 1Q8QA 4E4EA 1NT2B 1OHFA 2HWE1 4PELA 5DN6G 1OA2A 1H8VA 3JBG2 4YVWC 5BY1A 2RHPA 4QPGB 4LLOA 1H2GA 2B9VA 1H2MA 1WLDA 3VBOB 4BA6A 2IJJA 1E79G 4DQAA 2Y4UA 3RFRA 1U12A 3SH4A 4YZ4A 5CFDB 2CL2A 1OA4A 3DEMA 2ZA9A 1WB7A 4GXLA 2HHHO 4NB5A 4GCZA 4IHJB 1MQTC 4R9BA 5L36A 5G05L 3K9AA 4ES8A 3RJ2X 3D4KA 1COV3 3AG1B 4Y3OA 5HV0A 1GN4A 3K77A 3HKDA 4FPOB 3C7GA 3ZOIA 4I09A 3A0KA 4Y22B 2HG5C 1I9RA 1XNKA 1LTEA 3ZYGA 3ZYIB 1IPJA 3CIHA 3SJQC 1SPPB 2L6LA 4RQEA 4WM8A 2XJQA 5FZFA 5FYCA 4BQ3A 4OI2A 3D6EA 3IC7A 3F2ZA 1YXBA 4YJ2B 3ENRA 3KV6A 1POV1 5LA2A 2XJTA 2JEXA 2WNVB 3AG2B 5IYZB 1G9CA 3PUIA 2X6AA 3IPVB 2EBOA 1XHXA 1CIYA 1ND3C 2G9ZA 3TN93 4RS5A 1KC8W 2P6CA 2WO7A 3SDLA 4DY5A 5C3PA 1DDLA 4LKFA 4AVSA 2YC2A 4MYEA 3CB2A 2VR4A 2Q1MA 4IV3A 2C5DA 2ZX4A 3WNKA 3X2QC 1QXRA 3P6BA 2BRTA 1NY71 4AXOA 3KZIZ 4RAIA 4WVZA 4GYCB 1NCRC 4NPMA 3T2TA 1HKDA 1T5EA 2E7AA 1Q6UA 1NTKH 4HVOA 2L35A 5K7PA 5B1BB 1KP2A 2VC9A 5H9PA 4MG2A 1JYCA 1FNYA 5B1NA 4E27A 2NMOA 1UYZA 3WLUA 5EZYB 2YBPA 3MGUA 1LKNA 4QT6A 1VIWB 2DWRA 1PMIA 3AK3A 4FBFA 1JTZX 2KXLA 3UJOA 5F39A 3ZSLA 2CSGA 4KGGA 3C3VA 3CMAV 2DCYA 4KWLA 4PJYA 5BV6A 4ZPIA 3I59A 3H8UA 5B4NA 1D4M1 2QQIA 4PV1B 5F6LB 3X29B 4LF5B 4LF8O 2LFSA 5LYJB 3PU3A 3ZSMA 3PU8A 1DTOA 4HLTA 4N7IA 2P5BA 3PVEA 3K08A 4A45A 4EV0A 1H2SB 2DUOA 2PHXA 1I5PA 1YRZA 4KUMA 5LRRA 5EFUA 5KAIZ 4MW3A 4YZ5A 3IZOA 1MS5A 2ZEXA 3AB0A 3VN4A 4DO2A 4L97A 4DY3A 2Z42A 3P5BA 2GDSA 4TV8A 1KS4A 2RM23 4FXGB 5CBHA 1CAXA 1O4TA 5KLVH 1FATA 5FTTC 1UU5A 5K0UC 4DXWA 4LF7O 1IURA 5I0RA 1NH2D 4X88A 1JZ5A 5L9VA 3E35A 1VBA3 3D36C 1AL22 3OBTA 4FPKA 4X1KA 5GZDA 1GP4A 1RHI3 4OI0A 3K5OA 3V65A 4Y5Z0 3U0ZA 4XTPA 2WA4A 2DU0A 3KHCA 1NAEA 1ND2C 3CHXA 1RUF3 1HB1A 3OBRA 2RNBA 1SDDB 1DCSA 4PBPA 1K5MA 1E57A 4XF3A 4COYA 1IG0A 1VQ8V 1IS4A 1WW4A 3N2GB 2GSYA 4OLLA 2WABA 4YJ3A 1YUDA 4KP4A 4DR3B 3WF1A 2D6NA 4JGYA 3T1YB 3GJAA 3D3IA 3QD6A 2AH2A 4DINB 4H2AA 3G6EV 4RGKA 3N2KA 4W4KA 1ZZ8A 4K21A 4N53B 1NKGA 4XIKA 1FOD3 4XBQA 4DOUA 3PL0A 3WQBA 4GMP0 1AYM1 1GK9A 1S0JA 1FKAO 1A34A 4AI2A 2YIDA 2JGUA 1BHBA 5EIBC 1K12A 1W6PA 1O59A 2VTXA 2WS91 3FKSG 1FMD1 3CE2A 1BVVA 4QKNA 1IOAA 2A75A 3OGRA 4Y24A 1M93A 4LR3A 5AC92 3CCRV 4DR7O 1AR91 2VUDA 4OI1A 2BJSA 1F4MA 1NU1H 2WSSG 1WCKA 4MTGA 1O8PA 2ITCC 3JD0A 1IG3A 3OMIB 3WG2A 4U3FH 1J59A 1K5SA 3ZPOA 4IEZA 2EIEA 2ZM6O 4OVEA 3SPIA 3IT8A 3UQ8A 2KSDA 2VW2A 4CUBA 2FYUH 2WIIB 1UPIA 5BR8B 5J2TB 4LT5A 3KSCA 4LQRA 1VR3A 3DV8A 5FK8A 3KT7A 4JI6O 1QLEB 1EPWA 1PMHX 5JZGB 5H9RA 3JARB 1CVNA 3W5NA 4Q27A 1WCQA 1P7BA 4IL6Z 1KYOF 3ZDSA 1US2A 1K3EA 4UXAA 2B5HA 2VMFA 4COZA 4E8CA 3WNOA 4QE9A 5LBBA 3H8XA 1PV0A 2D5HA 4LXLA 4CDXA 3JATA 1W9FA 3USUB 1EAH1 2UU9B 4AFMA 4QHOA 3NV2A 4HSJA 3OB8A 4I5SA 5EC1C 4XACA 1RUE1 1D5AA 3ZIXA 4P9JA 4LLFA 3RN4A 2IFRA 3KGLA 5JOWA 5EZWA 1WB8A 4X65O 4LF4B 1AR81 4QXBA 4QPWA 4AE2A 4FM1A 2UUBO 1RMU3 3BAAA 4Y1VA 2WSVA 3VDDB 2W3JA 2XOMA 1KGYA 2Y6LA 3CCJV 2JIZG 5FR3A 4CDWB 1YHFA 4EQVA 2PFWA 3WG7C 4NRMA 4X1YA 5SV5A 3T0BA 4YW1A 1FXKA 4XFGA 2WPDG 4A2UA 1G86A 1W2TA 1VRH3 1XYNA 1W6OA 2NMNA 1JI6A 2ZGSA 2B45X 3VBFB 1IXBA 1AXZA 5I91A 3K5LA 2J1SA 1SEFA 3ASOC 2W47A 1P8JA 2VTFA 3ETEA 2V5DA 4M0HA 1M4WA 3HB3B 4ORFA 4UCUA 1O3RA 3OE7G 2ZQMA 3JSNA 4YM3A 5GONB 2X6CA 1VMFA 1TAEA 2ZIOA 4HXCA 5IAVA 1XQ8A 1ZBE3 3WG3A 5A7NA 5JJEB 3W7TA 4LO7A 4AQ2A 5LXTB 4YGDA 4TUYA 1AI4A 5EJZB 3L73H 1CAUB 3P3PA 1C3HA 4K1YA 1KQRA 4JI2B 4UYBA 1QBZA 2H0VA 2OYQA 1PO21 4RR3B 1VRBA 4JI7B 1BCCH 5H9CA 3MV01 1AX2A 2ETNA 1R093 4KBZA 1QR9A 1LNSA 3EXAA 2OWOA 2EULA 4KWUA 1WBLA 3ZRVA 5J7MA 2R7EB 2EILB 2UUCO 4LKSA 2W2IA 5HV4A 1AR1B 1NE4A 2BVVA 4AEMA 4JGSA 3CL1A 1GQGA 3ASNC 4AQSA 2D5FA 4MVSA 1B3QA 1D2QA 5FZAA 3QO7A 2PLV3 4FOQA 4QKFA 3K75B 1RUI1 3NAPC 4ZXKA 2Y64A 2QWRB 4AI1A 2Q7GA 3KG2A 3MUZ1 4QNHB 2P90A 1URFA 2DYCA 2W08A 4FFBA 3EJKA 5FUPA 4HPKB 4DUYB 1RUD3 4O4JA 1ZZBA 1OCRB 2W92A 4H37A 1UYPA 3PUAA 2WNUC 3MI8A 1QXJA 4Q4W2 4BE3A 4DMIA 3M3CA 1SLBA 4LFCO 2FDHA 4WM8B 1EBOA 1REDA 2VCMA 5JXGA 3O1RA 4GB33 2YXSA 2CH7A 4OQ9A 2J1RA 2XPJA 4LR4A 1PL0A 4FLWA 4FLYA 3VBRA 3MIEA 2R9RB 4D7YA 5H6RA 4CP9A 1ZLZA 2XMLA 2RS11 3O12A 5JMCA 1ZRDA 4RS5B 4AVVA 4BIFA 2RDNA 1QJX2 4PA7A 5LZ6A 4BXFA 4LF9O 1ZYBA 4I30A 2RDSA 2WLKA 3NMBA 1YJ9V 4CDQA 1BMV2 4M3CE 3ZYHA 3ZMTA 3MZHA 3N9LA 4IV3B 2R32A 3JALA 1FT9A 2OKXA 4CEWC 1RUH1 3IDEA 4IDZA 5J1XA 2ZMNA 2VZSA 1AR62 1QGLA 4JI5B 3FB8C 4Y33A 3TBDA 3HEIA 4A42A 4BIUA 2F23A 4NE9A 3AG7A 1XNQO 1JZ7A 2VQTA 2OT5A 3N7MA 2E53A 1AROP 1VBD1 5FY9A 4Q26A 3WD5A 5J96B 1X59A 5KC6A 1H2LA 1V9U2 3FWEA 2VQFO 2ZEWA 3SPJA 3H8RA 2LO1A 1LUVA 1ALYA 1VBE3 4FOVA 1VQPV 2E6VA 3K51A 3LDCA 5C5TA 2GAUA 3T08A 4J6GA 5DABA 4UCSA 3LSQA 4CH6A 4DNYA 4LP8A 2EZPA 4AVCA 2VZTA 4OGQB 5F32A 4MOAA 4CRQA 2V4VA 1VMGA 4A7ZA 4NAOA 4XMIA 3K3OA 2DV9A 3KQ4B 3QO8A 3I55V 2W1WA 4FXKB 1EPZA 3SJBC 2AUYA 3SYPA 3I59B 1KDKA 3NSTA 1LOCA 1HB2A 4JZRA 1U5XA 4LFAB 4JI1B 3K5MA 3L9DA 5A32A 3QTCA 1VAVA 1PO12 1RUJ3 4QX5A 5I0SA 2Q68A 3I5DA 1R1BA 3DKWA 1ZA4A 3J8F3 4HL0A 1UCXA 4E2GA 2LW1A 2WWJA 3QACA 4AK3A 5I8SA 4TV8B 4X8PA 2YXLA 3AK0A 2WLLA 3M3OA 1Y9QA 3PURA 2JDPA 2GH2A 5JMOA 4JTAB 3ELNA 5LA0A 2P1BA 4BQYA 1HNXB 3BALA 3BU0A 1MSWD 1CZSA 3OF1A 3POSA 5HI0A 2GMEA 3AYDA 2VVFA 2VULA 4OXSA 3FHAA 3HKBB 4AYUA 4AFCA 1V55C 2ZE7A 1THZA 4HMZA 3BYWA 4UF0B 5FJHA 4RA0A 5FY0A 4GQ7A 3UT5A 4OHXA 5LHIA 1BGYH 2A6XA 4XZPA 2WUHA 3T4ZA 4OX9O 4MO3M 4CCLA 2A6YA 1LHVA 3AFGA 1WWYA 1RB8G 4YJ3B 1S0EA 2PZSA 2X05A 2VM9A 1ASJ2 4JGYB 4MTOA 4PF1A 3N2KB 3OJBA 3E8FA 4MVRA 1PGW1 3JAMN 2I74A 3P32A 5IT6A 2DYRC 4A3ZA 1SZTA 5BMVB 3LPFA 1OQEA 1WD3A 1R3JC 2ZXQA 1NJIW 3RMXA 2JG8A 1NCQA 3LEGA 1B6QA 4R9AA 5DAQA 2UXXA 4QD2A 2VMDA 4O7XA 2Y8KA 1D4VB 1GN3A 1GQPA 3QF7A 1DQ4A 2QM4A 1F15A 4E4HA 2DCTA 1HQLA 4GZRB 1IVSA 2KKWA 1LHUA 2B8MA 5JXJA 3OEHG 2XL9A 1B35A 2V1DA 1W39A 3B02A 4LF5O 3HBKA 2WQ8A 1JQ0A 3DC5A 3HN1A 3CKHA 4DR6O 2Q9LA 4DIQA 2NP0A 1GZTA 1QJU2 1RTVA 3T1LA 4PDRA 4X6QB 3UGFA 2FZ2A 2ENRA 4YGCA 4Q1PA 5B2GB 5JPMB 4CEYC 3VDAA 1MR5A 1REEA 1QJZA 1XBFA 4KWJA 4LBMA 1AL0G 3GJBA 5FMCA 2XJUA 3Q8FA 2OPKA 3ZRWA 5L3FA 1M56B 2G38A 3R4DB 1DGWA 4PJ0Z 5CB4A 4CDXB 2KG7B 2ODMA 2QSAA 4EN8B 1VQ9V 1H9PA 3JUUA 1WD4A 4WFAV 3T3YA 2QM8A 5A7WA 4YM2A 1YWKA 4GWNA 2N05A 2FBEA 3SYAA 1JHJA 1BCXA 2Y38A 4WVMA 1RL3A 5GTIZ 4UT5A 5F9TA 1I1EA 2RG4A 2CGNA 3M99B 1XJAA 1C5IA 1N1TA 5LY1A 5T55A 2F43G 3AZWA 1SLAA 1GM8A 5I8TA 2PN5A 2I07B 3UCSC 2P67A 1ZRRA 1CX1A 1OT5A 5B1OA 3WP6A 1S76D 2QBXA 1PVC2 2ES3A 4PA3A 1FXKB 1BBT1 1W90A 4QU2A 1BQPA 2QWQB 1W6OB 3OPTA 3OUJA 4QQPA 4UFLA 3JD73 5GLTA 3THPA 5BNPB 5FYHA 1O4YA 3RSJA 1RM1B 4QPYA 4ICGA 2K1EA 4E4ZA 2B9UA 1QJY3 4JV4A 2XH6A 1AUYA 3ZCCA 3OTOB 4LH7A 2IXCA 1QQCA 4Q20A 5B4XA 5A2QN 2FDJA 2F4VB 4AOCA 4FPFA 4MGIE 2XHBA 4O4LA 1PL4A 5J2UA 3ZFEA 1NYWA 4CSWA 1L0NH 4TUYB 2XWBB 4B4RA 2J7MA 4H44B 3CJXA 4AI8A 1AJQA 5T50A 4R4XA 2VOTA 3EYPA 3STZC 1QH7A 1OFNA 4Z82A 3RWKX 4Q1RA 2GHYA 3CCVV 5F2SA 2JDYA 1J1TA 1KP3A 2X8KA 3E89A 2JIGA 4EN0A 4HVRA 3FMGA 4FIPC 3OYWA 3LDKA 3N9NA 5IAXA 2ITDC 2WA3A 5FPXA 5A80A 1TMF2 1OBNA 2P4EA 2WFPA 2YDEA 3CJHA 5BR8O 5DAVA 3LE0A 4P9OA 1ORQC 2CTRA 1EZVH 4FPEA 2XVKA 5JWPA 2A3QA 3B69A 3BPZA 1AR83 1H6XA 3ACIA 3KD4A 1M57B 1UU6A 1K45A 5KMGA 1RJ8A 1OMIA 4I0AA 4C1WA 1ZREA 4CYDA 2VBDA 4FFBB 3NKTA 1GOHA 1MZFA 3ZM8A 4CUCA 4O4JB 3IDCB 1HN1A 2QQOA 4NXNB 4L2NA 3EMRA 4GALA 2UU9O 3ZHSA 1ULCA 4PT6A 2XBO1 2WN2A 1K4CC 3T4VA 3UKVA 1WMEA 2QNKA 4JDMA 5DDJ3 3POIA 3TEXA 4BMEA 2HBUA 1H8TA 2XLFA 1M06G 3WDVA 4ZZ5A 2CH7B 5IE9A 3HOBA 3UM7A 4DUVA 1A6CA 4NRQA 4C0HA 4KU8A 3VBRB 5C9AC 2WZR2 2A79B 5FMOS 4LF4O 4BB3A 2QQVA 3ZMZA 4CP9B 2AYHA 2HJIA 2PI5A 4NWWA 4Q4X3 2FDKA 2YS8A 1O3QA 4F83A 1SQVH 4BR6A 4OFGA 4CUAA 4DR5O 3M8AA 2Y6KA 4CDQB 3DECA 2J1AA 2V09A 2W68A 5FO7B 1J95A 4BISA 1KKDA 3JALB 2P17A 3LWCA 1VQKV 4AEDC 1HRV1 2JEMA 3WF3A 1PO23 1WKYA 3WW2A 4J1WA 1SMVA 5FP7A 2ZR2A 2XR4A 3OGIB 1DG6A 3AP4A 1UY4A 1PM4A 4UBGA 1YO8A 3DXUA 3FBYA 4AFAA 1RGSA 2PA7A 2OCCB 2YIBA 2FCVA 3RI8A 3RYKA 2DYSC 3ZYRA 4UFZA 4LITA 3K5NA 3WOGA 4HN1A 3S5QA 3VDBA 4PQQA 4YZ2A 3ETGA 3TB0A 4X20A 4DV3B 3PJSK 2JENA 1OA3A 4JI2O 1AYN3 4JYBA 1AHSA 1BQZA 3LIHA 4FCAA 1L8DA 1V6MA 1LRHA 4LMFA 2QQLA 2QKSA 2Q6AA 2ZKLA 1UOGA 1LODA 5BNOA 3B8NA 5D8AA 5F2WA 2EIKB 4B3MB 1W04A 4B1LA 4EZHA 2W87A 5A32B 2MEV2 2W9XA 1OCCC 3E5UA 1V6LA 4RHV1 3K03A 4YVWA 2HEYF 2RJKA 3LEIA 1D4M2 3HT1A 2RS13 2ZGRA 4WCEV 4KFMA 1DYKA 1FXVA 2PAKA 4EN7B 1Y7BA 3RW0A 1TGOA 1O7FA 1R6TA 4AEJA 2WLLB 4DUYO 2ZGNA 1I5ZA 4KWKA 2DVGA 4XF4A 4DXTA 2Q7HA 1WNSA 2JS5A 2CGOA 3F7VC 2NNUA 3UO3A 4LK6A 2ZCEA 1QDOA 3K2OA 1TNFA 1LJ7A 2VXRA 1LOEA 2CWMA 2VUJA 4CH3A 5SV8A 4B8EA 3JBG1 1HXS3 3E5QA 4HZ3A 5F3EA 3ZX7A 4KU7A 1UQXA 4KGQA 4FQZA 3ZSKA 3ILFA 3ZXLA 1CPYA 1EN5A 3Q9OA 1MS3A 5EP9A 5JOYA 1Y76A 4JPRA 3UT5B 3VBBA 1RXGA 3B9IA 2QDRA 3ZYPA 3FLTA 1GZ9A 4YGBA 3MHHC 1XHZA 2XJRA 3APQA 2JXAA 1HJGA 2R30A 4CCDA 4XQWA 2DWEC 2W6IG 4QXKA 1I5YA 2BV4A 1WMFA 3THOA 5FZKA 4DK0A 2YFZA 1MEC2 2XHNA 3L75H 2N7GA 2UYAA 3D8CA 4W65A 4JI5O 2KA3A 3JU9A 1QQP1 3H01A 3W7SA 1UOJA 5LK7B 3MV11 1DYPA 3JXSA 5FLJA 1YQCA 3RYRA 1LHOA 2WYSA 2Q67A 2LJ2A 1R1A3 2OQ7A 2P7TC 3ZN4A 4IIJA 1ODMA 1NXD1 4LF6B 2ZGUA 3VGIA 2OYZA 3E97A 3AVRA 5IT9N 5KX5B 4I55A 5A3NA 2ZGKA 4BQ4A 4UW3A 5FYMA 4BDVB 3RDIA 1OCOB 1NCRA 2W39A 3CWBH 4E8DA 1N3OA 4INDA 2O0OA 3ZMUA 4UFHA 1JU4A 2EIJB 4X66B 3WB0A 1F5FA 4NIIA 4CA9A 1WAZA 2ZDIC 3RZZA 1UL9A 3ON7A 1B35B 2A70A 2JDKA 2ZBJA 4FLVA 4KHPB 4FAGA 2VCBA 3Q8EA 4U7NA 3K3WA 4XFIA 1W05A 1Y6XA 5LP6C 4GWMA 3IM0A 1UMIA 1UAIA 5FZ3A 2R1BA 1OKQA 2EXJA 1NTMH 4Q0SA 2FZ1A 3ZRWB 2HWC1 1U5ZA 1XOYA 3JQWA 2GC0A 3ZN1A 5LW9A 3TN92 5CB4B 3DPRB 2QQJA 2HEPA 3ZMVA 2UUAB 4XF0A 4K9SA 1VF6C 4LBJA 1ZBA2 3UO2A 4UUJC 4L99A 3DSQA 4CXXA 1WLWA 2VQEB 1HNXO 3SCHA 4LBEC 2V4DA 3AMQA 1OKOA 2NLRA 2WRAA 4WVMB 4P08A 3BKZA 5E16A 4R6ZA 1GICA 3J7LA 3KGZA 3CCSV 3OPZA 5A1LA 3NJYA 5K0UA 2MW2B 3AKRA 1BT8A 1ULEA 2E9QA 1OV9A 4I0BA 1H4HA 1YI9A 2P3JA 3ZYFA 4O4IA 2JE8A 1W2OA 3OGJA 3AYEA 1H6YA 4EN6B 2D3PA 4RQPB 4YYOA 3I3QA 2YI9A 4AVAA 1XNRB 4K35A 4DEQA 5JOXA 1BVP1 4ET7A 2ZS6B 2XG3A 3PVNA 3AYAA 1S3JA 1DFQA 1VIBA 1HP8A 1ND2A 3WF4A 1S2BA 4NPLA 4XZUG 5LCWL 4BAYA 1HR0B 3ZDVA 5JSPA 5F6KA 5A3TA 3VKFC 1OUSA 3KCCA 4BQ2A 2VQAA 2JK5C 2HKOA 5FYSA 1AL21 1R64A 1OD5A 3T1HB 3OUIA 2V72A 3S7EA 3A0RA 4FSJA 1US6A 2OW4A 4O4LB 1KRIA 1G8MA 3AK1A 5J2UB 2ZJCA 3ZFEB 2R043 3Q4HA 1BEV3 1US3A 2IH3C 2QKCA 1YJNV 1POV0 5FYTA 4AI9A 2OPWA 1R1ZA 3SQOA 3OGCC 3JASA 1K42A 1BK0A 3USSA 4Z92B 1FPOA 1VBC2 3WCSA 5KHIA 1S5HC 5CAZA 3OYWB 3VZNA 4MADA 2BYVE 3SR2C 2ZACA 2VZPA 3CJHB 3FLRA 5FPZA 3SJAC 4Y1YA 3AKPA 2R061 1AR4A 4ASUG 2BGOA 4XBFA 4XAEA 5A3WA 4PLOA 3IAQA 1ENRA 1TE1B 1W0JG 4UCOA 2WNVC 2QQWA 4P9XA 2TNFA 3G67A 3ZRXA 2Y6HA 2WC2A 5ERLA 3FB5C 1RHI2 5J37A 2DMXA 4NRPA 5F7UA 4P9WA 2ZHLA 3E1F1 2W1SA 1VQOV 4DV5B 3JZVA 3WVJA 1RUF2 4DV2O 2JDUA 1BBT3 1OH4A 1NLRA 1I94B 5CG8A 4C90A 5FPVA 5AC91 3O0WA 3JD4A 5ACA3 3UGHA 5EV7A 3FYEB 1X36A 3MW3A 5GJ6A 1H8TB 4LC1A 3BPSA 2ADEA 3RZLA 1SQQH 3WF2A 2ARBA 4M0NA 1AX1A 4GWIA 4W6YA 2VECA 4RGGA 1YIJV 5B1AB 4HANA 4BZ4A 1QVFU 1HW7A 5JLVA 2Y34A 2WLHA 4NXMB 4YIOA 4WM7C 1FOD2 3ABLB 3HMYA 1UPGA 5H6QA 1T6GC 5IYCO 1ULGA 2FDIA 2QQMA 3LDEA 2WDBA 5KUMA 3AC0A 1Y67A 5EBWC 3A21A 3ZSEA 1S5JA 2EF6A 2ZZQA 4H7MA 3VBUC 4Y5SA 2ILMA 1SQFA 2VS0A 1ZWIC 1AP6A 2FMLA 4C1XA 2CY6A 1UZYA 3BN6A 4AQ6A 1JN2P 3OTOO 4IEOA 4YY3B 2Z3YA 3LIGA 2XKOA 3AKSA 2F4VO 4MX3A 5A7OA 3SCFA 3NJZA 3OW2U 3MFCA 3H8OA 5FP8A 2XAGA 3RT3C 3PJYA 1M9NA 1Q6HA 1EUUA 5L9RA 3B4SA 1YCIA 3VQYA 1Y74A 2R9AA 4AGVA 2Y60A 3N9PA 1H8EG 2B42B 1LGCA 4RUEA 4M4PA 4AR2A 4M4RA 3C3TA 3OBAA 4HFSA 4P9GA 3C3SA 1FJGO 3AZVA 4CPBA 4JKLA 2R72A 5KHHA 3TCUA 5BNOB 5D8AB 5DUWA 4LHLA 4YPJA 3WP5A 3H3ZA 2XBO3 5IK5A 2IXJA 3ZYJB 1KBHA 1WA8A 4AI3A 3H1IH 3LSUA 1Y4WA 4EFBA 4YVWB 5E89A 1ZZ7A 1AJKA 3I2HA 2DCJA 4FPPA 5CN0A 3OG2A 1RPOA 3F5TA 3ETPA 1RMU2 2WWSA 2OA2A 3MPBA 4FTBA 4JKKA 2BFUS 3VQXA 2VXJA 3GF6A 4AQYB 3N3HA 5IVJA 1BK1A 2VQ0A 3U75A 1KFUL 5LK5A 1AR73 4NXNO 3GWOA 4L8QA 1O3TA 5H5NA 3RYPA 5JCOC 4MLOA 3J80N 3AMMA 4G9SB 2X09A 2WZPP 1JX9A 2XLAA 2YPJA 5C3OA 4RSUA 1XPWA 5JPNB 4FVVA 1FX5A 4QGLA 3ZJZA 3CS5A 3M8LA 2C2AA 3RYFA 2ADQB 4QPIA 2ZNJA 5EYYA 2PUSA 1M1KW 1G6NA 2A06H 3I3MA 5EJ1B 1TG7A 1Y76B 2A3YA 4PHZA 3KF3A 4TLGA 5KXEA 3CXHF 3LZZA 1NVPB 1RVF3 1C8M3 3AP5A 4GMP3 4AAPA 3O9OA 2NPIA 4JAVA 2O14A 2JKBA 3CJIA 3I49A 3VBOA 3JB4C 2GU9A 3W58A 5H9QA 1RUC2 3H1HH 1QJFA 1NZCA 2PF4E 4X1IA 3CCMV 1GKFA 1K5QA 3BIWE 1S0DA 4Q4W1 4WF9V 4MVUA 4IGGA 4Y1XA 1PIV3 5C71A 2IJKA 2CTVA 4IIJB 1VBB2 1I7FA 4Z07A 1Z78A 4DK1A 3RZMA 1UF2C 4I55B 1VPHA 1S0GA 4PDLA 3LGRA 4Y22A 3ACFA 1PGW2 1NCRB 2VQUA 3O1SA 1BHAA 2WLMA 1SPPA 1F51A 1QJX1 1XL4A 4QIWF 3HR9A 2JDHA 3WB1A 3E8BA 1AZDA 2YICA 2PMWB 3IWZA 5F5IA 4GKJB 2BUKA 2YB7A 1BMV1 2LP7A 3LSEA 3NV3A 5FFOC 2UWCA 1O4ZA 5LMUB 2H3OA 1PNFA 3PNAA 3WF0A 5IYZA 4GX1A 1QLNA 2PGGA 5FMDA 2O57A 5F2VO 1XRUA 2G1MA 4YZ3A 1PD3A 4AG4A 5GTHZ 3S3XA 1GR3A 5FY4A 3ZEDA 5FZOA 5DAXA 1P84F 3LD8A 5GLUA 1AR61 2E63A 1AXYA 2RS51 2VOKA 5FPRA 1IHMA 4GB32 2A3XA 3W21A 1W06A 3BA9A 2PXJA 4MXWA 1RUNA 1G7YA 4BPZA 1HNWB 5JSRA 1K4DC 2G9FA 3MHZA 2CE4A 2BWCA 3VDDC 1IBKO 1J3QA 1V9U1 3MFAA 3ABMC 2X5IC 4EZ4A 3ST7A 2Q4PA 4TT3G 1XNDA 5FYUA 2VZ3A 1SACA 1SESA 1PZ7A 5IK7A 3RBZA 4NTYA 4QKDA 2QM7A 5LBEA 1QU7A 1E5SA 2C6SA 4CH4A 3S30A 1ZSPA 2JEUA 1AX0A 2VE1A 4COVA 1B09A 4PA9A 3C7OA 1F4AA 1SFPA 5BPXA 5K0UB 2WR9A 5IY5C 4JTOA 2XUMA 2VRZA 3M3EA 2ZNIA 3VZLA 1QU0A 4EWAA 2OT7A 4UXNA 4O4IB 1G9AA 1PO11 3R6SA 4YW2A 5FYYA 4PDWC 2E76B 2DW4A 5B3SB 4LOTA 1HLCA 1SS3A 1D2DA 3AXEA 1JYIA 2RJZA 2P3IA 2YROA 3ZXKA 1VP7A 3CC2V 5LYJA 3N4MA 1ND2B 4P9YA 3EBRA 5DEDA 3CF6E 4OUSA 3SPHA 1KJRA 2P6HA 2VVEA 2HYKA 1VP6A 1WJZA 3G7DA 1RSOA 4MV2A 3WFVA 4IEQA 2PYJA 4ZU4A 5FO9B 1KITA 3PLQA 2FCTA 1NXMA 1TME3 3FHIB 2GC1A 4BLJA 4DV0O 4Q6GA 3FHQA 4YM0A 2JX9A 1KD7A 3IGAC 1CR7A 4D7SA 3Q4HB 4LKDA 3H3LA 3J8F2 3VKOA 2X7RB 2DVDA 1PX3A 1UO9A 2P37A 4X66O 2RMU3 1O9HA 3RVHA 3ICXA 1OLQA 4X65B 4XJ9A 5IK8A 5L3CA 4JI3B 4KHPO 1ASJ1 1YJKA 4FVMA 4CE8A 5IVCA 4K1ZA 1AJPA 4P00B 4AHCA 5FNVA 4NTWA 5AVPA 4UBHA 1QVGU 2YYOA 4UOJA 3CX5F 1HDJA 1IS5A 3LA7A 3AYCA 2F93B 2QJVA 2XDVA 1RUOA 3LFIA 4LNVA 4YG6A 4AHXA 4AFBA 2AXTZ 2B39A 2JB8A 3BU7A 4N53A 5C4WC 4CEYA 2UUAO 3LFMA 1ZM1A 1W03A 1OFSA 2Y6GA 2VQEO 4KI5M 4L87A 2WLQA 2FHRA 3OUFA 4ABMA 2YMZA 5FZBA 3QBQA 2A1XA 2EJRA 1JU3A 4D0QA 4EEQA 1PK6C 2P6JA 4I02A 2YU1A 2WAMA 1L7RA 3PTYA 1QJU1 1YF2A 4I50A 5J98B 1XQNA 2IUWA 4ATFA 4XMAA 5C5UA 1XNRO 4K6BA 2JG9C 2R70A 1FAFA 3CRCA 3GCXA 2RDRA 2CAVA 3I54A 4DXRA 5EIYB 3DN7A 1FFTB 3WG7B 4MGQA 2WNEA 1HR0O 3WW1A 2IH1C 1C28A 2LUWA 2D6KA 1JOYA 3RQ0A 3ZBHA 3B94A 4EYUA 1SHWB 2OZ6A 2JDIG 4COWA 2C1FA 1OQDA 2EA7A 2JWPA 4CDUC 3HNBM 1HRV2 2D6PA 2AZ0A 2JE9A 3ASOB 1V70A 2ZE6A 1V00A 4I9WA 4XUNA 2I45A 4YVSC 3AMHA 1VE0A 3K79A 5TSWA 5KWRA 4EWDA 1Y74B 4IYHA 3JCUZ 3BB6A 4LFCB 3VBSC 3WT3A 3N9QA 2OIEA 2ZINA 1S4CA 4MGZE 3AJZA 1PP9H 1QF3A 5IW0A 1PVC1 3CU7A 2XVGA 3JYCA 4PBOA 1LHNA 5BY5A 4FJCC 4TWKA 2ORZA 3F95A 2OX0A 3PN1A 1DF4A 2ZEZA 1QNMA 1NS1A 1W0NA 3M70A 5C8WA 2NZ9A 5LGUA 4LF9B 1UZWA 5JI9A 3HD8B 1MABG 1WA8B 2W52A 3ZFFC 5LATA 1APNA 1DQ1A 2ZGLA 1DQ6A 2SLIA 4AAXA 4QDSA 5FPLA 1IBLO 3D5OA 4CCNA 1BMFG 1EFRG 3VZKA 4FLTA 2RN9A 5K8SA 1GNHA 3K57A 1XMOB 3MIDA 3ME2A 2XOKG 1FV2A 3ASNB 4WFGA 1I94O 4ZOLA 1XNQB 1K5MC 2IC1A 2MK3A 3ZFGC 1V6NA 5T3NA 2VJXA 3NAPB 5JIAA 5IVBA 3LOBA 3FX3A 5FZEA 3GB7C 5C7GA 3EVKA 1YI7A 3T2QA 3O14A 3RYFB 1MS9A 3WNNA 2HWB3 2WNUB 5A6ZA 1ZNPA 2A5ZA 3MEPA 2RDQA 1TMF1 2VZQA 2IVIB 3HKCB 4RR3A 5DZFA 4X6RB 1QJY2 3J26N 4J80A 1M5IA 4KXRA 4F8AA 1RPRA 4NHMA 3G71V 3HIFA 3CJIB 1WLTA 2W0FC 2PELA 3PMEA 3I8TA 2DJVA 3ZXJA 1GMGA 3I4IA 3MF9A 1DHKB 2HWD1 4X8AA 2LTNA 5AVAA 4DUWA 4ZKTB 4FFGA 2BOCC 3D3QA 4X1IB 1ZZCA 5CBLA 1YHQV 5EYPB 3PUQA 5IVYA 3M2MA 2DWDC 2IU0A 4BQ1A 4X8NA 4A7YA 4XURA 4D6RA 2O8OA 3UKMA 1KFXL 2JDZA 3TXSA 2ERFA 1GWKA 5K4LA 4AEDA 3NRUA 3LCPA 4XBNA 4XDQA 4XCAA 2QQNA 3JD2A 4YY3O 5FP4A 3BCCH 1M90W 2WZR1 4FZ1A 4HPKA 3Q8BA 2OVUA 5C8CC 4XFFA 4D94A 1JYNA 3SMHA 3SLIA 1QQP2 3FLPA 5DAPA 5GKAC 4LCUC 3FZ3A 3ZXDA 2A3WA 3T2OA 2BOBC 3U78A 4KBBA 4DPNA 4OZOA 1W8WA 5FL7G 5LMNO 2YY1A 1KUQA 1Z5WA 3R66A 2EJ7A 1LGBA 3CC4V 2UXCB 4UW4A 3AP6A 5IATA 5L7OC 1VQ5V 3CCEV 2YPDA 4X62B 4EWEA 3LSSA 1Z0HA 3O1OA 1XDCA 4CDXC 2DBNA 3MW4A 1FI2A 4R8CA 4Q8LA 5FZOB 1ZTEA 3RVYA 4WBNA 1TUBA 5EHDA 4BWAA 1E1QG 2BNOA 1AVMA 3WQ1A 4WFBV 5DDJ2 1CESA 2GC2A 4OX9B 4Q4V1 1G4YB 3HQUA 2XWJB 3DUIA 1CQ9A 4MXWB 4XCBA 1H9WA 2D6MA 3THCA 4ZONA 4WFFA 4O9EA 1MS4A 1NR1A 4JI8B 4IL7A 3AMPA 1F2NA 1IQDC 2VU9A 4JX0A 4Q4X2 3HR0A 3QVNA 3WW4A 2BGCA 1Q5OA 3SEPA 3WG4A 1DZQA 5CBFA 3V64A 4AQYO 5T5LA 3TOJA 4XF1A 2F4PA 5FCCA 3OT7A 3ZHTA 1FXKC 4B3TB 5A1FA 1PHMA 2YEVB 1K73W 4F4LA 2RR12 2WO3A 2AC1A 4FPYA 4MSVA 2HWC2 4UB8Z 1PNGA 1GSLA 3JSLA 3U37A 1JA8A 4AVBA 4J1XA 2B7YA 1GV9A 2AHYA 1RM1C 2E74B 4MGSA 1R6KA 5L73A 4L92A 3KHBA 2MEV1 5JCTA 2R0HA 4K8FA 1NLSA 2CTPA 1HWYA 1Y3TA 4AF9A 4A6OA 1V55B 3CCLV 5CG9A 4LKEA 4B3SO 2Y48A 4JCKA 3OUHA 4DR6B 2WLNA 1QJX3 4I2OA 2ZR3A 3GCWA 4RFRB 3RS6A 1ULFA 1R083 1H30A 4M00A 1PPJH 3B93A 1AYN2 1J3RA 3UESA 1W6MA 1HRI3 4GH4C 4B7KA 1RSOB 1KECA 2YIBD 3SKVA 3WZ1A 3CO2A 2F17A 4UB6Z 3THTA 1LULA 5JAXA 3AZXA 4CCEA 5F37A 1UN1A 2ZABA 5IYDO 4UFMA 1OURA 5GZEA 1Z7S1 4YW6A 4NJ4A 3LF7A 2GP5A 2HYXA 1W0OA 1VQMV 1C57A 1Y43B 2TBVA 2ID4A 4XOGA 1GH6A 4GKJO 1LB2A 2W94A 4GX0A 2VW0A 5LMUO 1GU3A 4PIZA 3HKBA 3WG1A 5HPOA 1DYOA 4HNAB 3CEIA 2LW7A 3BVCA 2KR2A 4UF0A 1MEC1 1YIFA 3GGLA 3O5SA 1J1LA 5HCFA 3O1UA 1OLME 4Y5TA 4ASLA 5FNVB 3PMSA 4RUFA 3VHRA 4BW5A 4I0WB 2ZDIA 3G6BA 2QZ2A 5FOJB 3VBRC 3WCRA 5C33A 3UKNA 3MDPA 1HXS2 1HNWO 4IEPA 5A3LA 4NIDA 2FQPA 2J1UA 3STLC 2HVKC 5LP6A 5AFBA 1DU3D 4OZXA 2R062 4J9YB 5BNQA 4YHHO 1GBGA 4CEYB 4IUGA 3IIIA 2C24A 3MD0A 5BMVA 1I5XA 5D5PA 4OPAA 4GIQA 4E9KA 5DG1A 4R4ZA 3O65A 5IK4A 4NUBA 2D93A 3JD3A 5FXVA 1COV1 1F5JA 2OZJA 4UCRA 1GZCA 3QOPA 1F23A 4XDKA 4BHPA 3OAAG 4YW4A 1RXFA 1JODA 1NVPD 4I50B 3UL2A 4XUQA 4QX1A 3R0RA 3N36A 2ZGPA 4YW5A 2A7AA 1GZWA 2KB1A 3RNSA 3VD4A 4Y1UA 4XQDA 3UNPA 4XXPA 3I2FA 2VMGA 2E7QA 5DAWA 3IB3A 4ZBMA 2IJIA 3TN91 2J42A 3WNMA 2R0FA 5HFLA 3LAGA 2EAAA 1ZBA1 2GC3A 1NA1A 2CYFA 1GP5A 2VUCA 4AQTA 1DBNA 2EIKC 4BXSV 1UXXX 3VD3A 1ASJ3 5JH7A 1N3PA 3NNFA 3I2DA 1UOFA 2KG7A 2JECA 4XC9A 4MVQA 2QTSA 2GNTA 1N0JA 2QDNA 2D3OW 3NNJA 2Z2SB 4IEYA 2C9AA 2LM3A 2ZXWC 1K33A 1FV3A 3FFQA 1AI6A 2BEOA 5HFMA 4D3WA 1NZ6A 3S57A 3BGAA 5C3QA 2VOWA 1JJ2U 4XDJA 4JI3O 2FL4A 4UV8A 2EAKA 4HKWA 4SLIA 3HQRA 3NW4A 4W6XA 4DR5B 2BQPA 1Y9MA 4QGPA 2HP8A 2VG9A 2ZHKA 4ISRA 3ABTA 4YXWG 4FMTA 1B04A 2ZD9A 2C0ZA 4FP3A 4QQLA 3M7MX 4ZIBA 1IS6A 5LB6A 1DLBA 2E7TA 5FP9A 1SKVA 2FTKA 3EFFK 1C8NA 1QOTA 5BNPA 3H1JH 1HX6A 3GZEA 3SH5A 1CIWA 1GOFA 1IPKA 2LRPA 4HETA 1V54C 1OPMA 1Q8SA 1K8AW 2ZGTA 3RYCB 4ZOLB 1DZTA 4HK8A 2QZ3A 2OUJA 3GVMA 3E83A 2WL1A 3HN3A 3O0VA 1EYBA 4U3JA 4N8MA 4KG8A 1XREA 2RS33 4LBKA 3NXSA 4LBLA 2DDUA 3RG0A 3ZVXA 1VBC1 2D98A 3CYOA 4QJFB 1GMMA 3SISA 2HFEC 2QTWB 1ZRCA 5F1RA 3I97A 4LBNA 2IZWA 4NHKA 5CIRA 1YC61 3WNXA 5M0TA 2GTSA 1OC1A 2JG8C 2G4IA 3HPLC 1NCQC 2IVJA 3AP9A 4Y1ZA 3URFA 1ENQA 2VAUA 2QWOB 3FD9A 1RHI1 4NPRA 5G04L 5FLIA 2IBZH 3GNEA 1AJOA 4MVOA 1H4GA 4WM7A 2R042 2RJ2A 2UWBA 1TVKA 4TLFA 1BEV2 1U5YA 3SH3A 4QX2A 1DGRN 1RUF1 2DE0X 4XUOA 5FPOA 3CZUA 4NIAA 3EHBB 1MACA 5BZBA 4TOIA 2D6LX 4MTXA 2K0GA 3BRCA 1UOBA 4EB6B 3FC0A 1H8HG 4AEDB 1AI5A 4LNUA 4BQ5A 3OEAA 3VBUA 5AG2A 3KVBA 4OHVA 1OUXA 1OCZC 3B09A 1LCLA 1S0BA 2VD7A 2UXDB 2PHUA 4BU2A 1UX6A 2PY5A 4XILA 3LDBA 2R49A 4TN7A 3IDBB 2TEPA 2HKXA 2H6CA 1FOD1 5JJJB 1FPN3 5EIBD 2VMEA 4OULA 5FDBA 3UK9A 3KB5A 2DYSB 1ULPA 2GH8A 3A8TA 4J42A 2FKXA 4FTEA 5L3EA 1ZZ9A 5FK7A 3PUHA 1COWG 2PHWA 2PHRA 3FB7C 3AVSA 4QPJA 4WBNB 1NLQA 1TUBB 1O5UA 1ZVFA 5ACA2 3BI3A 2I2SA 5ANNA 2GDFA 5CFCA 5LASA 4R7CA 2DCKA 4DUZO 1OPOA 3OR7C 1ONAA 1Q8VA 2VWJA 4Y20A 1BZWA 1W2AX 3K9SA 3ZHVA 5IVEA 1UZZA 1VQLV 3O1MA 1YTFB 2X53S 5DUXA 4I0XA 3BOWA 1XMOO 1V0AA 2WLIA 4QX3A 2RS52 4XJUA 3GALA 3LPGA 1OCCB 1W8UA 5GLVA 2HWE3 4JI4B 3A0BZ 2RJLA 2ZKNA 1L7QA 3DYOA 2W46A 2Z4FA 3GBGA 3KV5A 4XTMA 4MHRA 4Q4Y2 1UY1A 4D8MA 1GFF2 3POBA 4PLMA 2BTQA 3CRQA 2XKPA 4TV9B 2YXHA 4CS4A 4GX2A 5JCOA 5EWSA 5FYBA 5C6CA 4UVBA 5LBQA 3WW3A 4ATEA 4AHYA 3FN9A 2AEZA 2Q8VA 4WZCA 3CP1A 1QEXA 1DQ5A 1HB3A 3N7LA 2OIIA 4CCMA 5F3IA 5KAFZ 4H14A 4DXSA 1RMU1 1N34O 4UCTA 3TYJA 1OH3A 4XJZA 2OTLV 2A0LA 1Z2GA 1POV3 3A22A 1POQA 1W6MB 1BHGA 5A6YA 2HBTA 2VGDA 4FLUA 2ZT9B 4K8ZA 1EV12 3KV4A 2AGAA 5LA9A 3N7JA 1GNYA 1VRH1 1I6XA 4ZU5A 3ZR5A 3SGIA 3HNMA 3DF0A 4TSVA 1XILA 3B77A 1YQ5A 4K0KB 1VB4A 5FZCA 1UY0A 1J3PA 3KKYA 3B01A 1NI8A 2Q7EA 1FAYA 5JDBA 2D40A 1UXZA 4JTDB 3V56A 4J9ZB 5FZHA 5FAXA 1AILA 1JZ2A 5T54A 1A8DA 4CPBD 3E2EA 2VUAA 3FB6C 1X8MA 2XGXA 4GUNA 4XFHA 1GKBA 2UXCO 2Y6FA 4M3CA 4G28B 4X62O 3R05A 2ZHMA 3JAWA 5ABJC 1RUC1 1UJWB 1DQ2A 1UY2A 3OY8B 3MIBA 2PHDA 3T0AA 4OPHA 2YV8A 1XNBA 2FDFA 4MUVA 2HWF2 3CSXA 4LH6A 4RYDA 2ZIMA 1I0HA 5J48A 1VBB1 4JI8O 4TZDA 2VW1A 4FLXA 3FUQA 5LP6B 1IQAA 2MEV3 2VVDA 3SXWA 4LUMA 2DF7A 1IS3A 2VMIA 4N7UA 1SQBH 5CKQA 1N8RW 1E5IA 4B3TO 1RVF2 1C8M2 3N9MA 1D4M3 2DTYA 2V4AA 2GNBA 2OCHA 4XPVA 1VQNV 2XTAA 4QMAA 1WLEA 3K4DA 5JI7A 2WFF2 2X5IA 5IVVA 1U96A 1GAXA 5KX5A 4ASMB 1O8SA 1R3KC 1LNQA 4MW8A 1RYYA 3MIFA 1W3XA 2AGSA 4BCUA 4JTCB 5A7PA 3MYXA 2YFUA 4K8RB 5E1AC 3LSDA 1ZAUA 5JR7B 3B9CA 1SLCA 4N21A 3MICA 3TWIA 4GB31 4J11A 4XDLA 1Q8PA 1CPMA 1GZWB 5A3UA 3E86A 3CLPA 1K3IA 2QDOA 2R1DA 4XE9A 2LGWA 4ISQA 4AFDA 2AACA 4P5YA 1Q6IA 3MIGA 5HCAA 5A33A 4IEWA 3WSOA 1NG0A 3OEEG 3OEBA 4IE4A 4JDNA 1W6QB 1WCSA 2EIDA 4FK5C 3WNPA 3O1VA 4JASA 1YITV 1V9PA 2PQQA 2CNAA 2IU3A 1NA1B 2VZRA 3UETA 1WPXA 4JV5B 2YZ4A 1CGPA 1TVGA 1CONA 4I01A 3I2JA 1PM9A 1SQGA 1PNKA 5JH7B 3ZHUA 2WZ8A 4DV2B 2R072 4TSFG 3DPRA 5APAA 1LECA 4DXZA 2W6JG 3SPCA 2ARCA 2VTXJ 3WV6A 2JICA 4OYUA 4PA6A 2IXKA 2DFBA 1P49A 2XB6C 3H9VA 5FZ0A 4A44A 4UI9L 4V2WA 5KA6A 2KM2A 1Q86W 1X7NA 1Q90D 1UIJA 4LO6B 4H33A 3KT1A 5T5JA 4BIOA 2AREA 5IJ0A 3IAYA 1BXHA 1VBE1 2ARHA 1YYNA 1IGOA 4QM8A 4JYAB 1YZBA 3ZHRA 2AW9A 4DRXA 4JRAA 3RZKA 1QNYA 1AYM3 3RJRA 4PIYA 2DURA 4RQPA 1H1MA 3RYIA 1R73A 3S0MA 2WS93 2XUEA 1I08A 1FMD3 4YM1A 5BNNC 1YXWA 3JCIA 3E6DA 3K04A 2CDYA 4G27B 1AR93 1MS1A 2AENA 3MAQA 5IHRA 3H1MA 2F95B 1DGSA 1FYJA 1BJQA 1RUJ1 4X9QA 2FD8A 5E79Z 3J8F1 1ENXA 4U3JB 2VBBA 2Y26A 2G9GA 5FUNA 2W1UA 3VBHC 3RZJA 2RVAA 2JVDA 4XHBA 1XE7A 4LFBO 1AF9A 4QB1A 1DF5A 4EFEA 1YNAA 5C4WA 3J4UH 2X29A 2Y0OA 1ZBA3 2GN3A 1WLCA 3RZHA 5JQGA 2PAMA 4TQFA 2Q4SA 4LHKA 1YSCA 5F3CA 5DZGA 1BSMA 4KNCA 3LDDA 1OOPC 1T6BX 3VV1A 4B1MA 1FJGB 3CMGA 4XDPA 4ZXEA 5LBCA 1EAH3 3N9OA 1TME2 1LOBA 5GZFA 3FE5A 2XJPA 2E5LB 1PK6A 3JAKA 2Q69A 1R6NA 1UKRA 5FY5A 3B40A 2QVSB 4WM7B 1V6IA 1TVKB 2BSKA 1RUE3 3KV9A 4D6QA 4QGNA 1OHHG 5DG2A 3RZGA 1VEWA 3LUTB 3VOUA 2JG9A 2P34A 2RMU2 4JKMA 2ZKOA 4PI2A 3ILRA 4LNUB 4DEVA 2HWD2 3VBUB 3K06A 1Y9GA 5CKMA 4E2LA 3VL8A 2HEWF 3AKQA 3FL7A 1HB4A 1HN0A 1F7YA 4C8DA 5EBLC 2IJHA 3SPGA 3FAVB 2ZAAA 1W0KG 4XUPA 1WW7A 4FFHA 4CDUA 2DN9A 3O1TA 4YARA 3T4HB 5LY2A 4ZU7A 2BCCH 2B4KA 5CA1A 1TQ5A 4AZZA 5D5QA 1D0HA 3T2PA 2CHHA 1A8MA 4W6WA 2JS3A 5EXOA 4YVSA 4QX8A 1S0FA 1WMXA 3I3BA 1LOFA 3VBSA 4NIHA 2BERA 4I4TA 1UY3A 4J25A 1HDKA 5KUKA 1W99A 3PJQA 2PHLA 1H2KA 3RRDA 5CFCB 4OQ8A 2ZX2A 1GANA 1J5EO 1VBC3 1S72V 3DL3A 1VQ7V 1YFWA 2QE7G 4Y20B 3BOPA 1XSRA 1ZZ6A 4JTNA 4LHSA 2OS2A 2B46X 5FREA 4IE7A 4I0XB 1W8NA 3JD1A 4HKOA 1DGLA 1QNWA 2WLIB 3ZFFA 3GDBA 2XHKA 1NX9A 5B3SC 4Q4V2 5T5PA 5ANQA 3O7OA 5A3PA 1YFUA 2Z0AA 4YLZA 3LA3A 4TWTA 1EM1A 4CP0A 2EIMC 1C4RA 2EXKA 4D6SA 2Q1ZB 1H2NA 2JJ6A 4Q2FA 5FLXN 1ULDA 4CS2A 2BTQB 3OCPA 1CPNA 1HQNA 4DW1A 3ZFGA 3A7QA 2GSMB 3WQ0A 4CP1A 3AZYA 2D7FA 1RUI3 2GNDA 2MPFA 2N04A 3ZMOA 4GKKB 2VZOA 4X64B 4XJAA 4D7TA 3V0AA 4K20A 5DXDA 1N32O 4NAMA 3HPNA 4BQXA 1BYHA 1NQTA 4D69A 2FDGA 1VALA 3SYQA 4GKYA 3M4FA 1QHTA 5FRAA 1REFA 4MVZA 2YSUB 2ZGOA 1AXKA 1N1SA 1IBKB 4NWVA 4QM9A 3AG3B 3JD71 2VL4A 3FUOA 3NNMA 3RMYA 1RUG2 1RFYA 3LB9A 4N90A 4IERA 4FZ0A 2RE9A 2UXDO 4WBBA 5CNAA 1MQTA 1S2KA 1KB9F 1D2SA 4IGOA 2DCZA 2D97A 1RUH3 2NYYA 2GMPA 1QJY1 2WQ4A 2JGDA 3WDTA 1I3HA 1LUWA 1Q3EA 2Y0IA 3W5MA 2VZ1A 4COUA 5C8CA 5JIUA 4M3CB 2EINB 3S6PA 3ABKC 2JKXA 1LEMA 1Z7S2 3WX5A 5L3DA 4IW3A 2YBSA 3JAWB 1Q82W 4OI4A 1D7PM 1GRJA 1QH6A 1V6KA 4A3XA 2W0XA 1VBD3 4CXYA 1A32A 4CU9A 5IJ9A 4GA9A 2X0LA 4I3GA 5L7OA 1JYWA 3CRRA 4IYIA 4RGAA 1XNAA 4LO4B 3LOIA 2Z5UA 2P3YA 4JYCA 1ND3A 5LL6Y 4W4ZA 4OMCA 5FXXA 3NWKA 1LENA 2HWB2 1BE3H 1K34A 2M6YA 3ZIAG 3PUSA 2Y69B 3B00A 1LAJA 4UVAA 1WN7A 4AHWA 4AHZA 3OPWA 1K9MW 2PHFA 4JAAA 4C0BA 5L19A 4JI4O 5B5EZ 1OF4A 3H1LH 2VH9A 1JYXA 1LEDA 2XT9A 4AEKA 1EUTA 1XNTA 3BTXA 4IEVA 1SQXH 3ABMB 1OVPA 5I93A 2X5IB 4DV0B 1PKXA 2ZAHA 4FLZA 3DCQA 1YJLA 5FZ1A 3VL9A 4XDOA 1NKDA 3ZX6A 5FWJA 3VD7A 5GZGA 3IDAA 4XFBA 5HXVA 2PHTA 5HCBA 1GNZA 5DDJ1 1QOOA 5FZMA 1LU1A 2HR3A 1COV2 2DUQA 1CZTA 5FV3A 5IY5B 4C91A 4DV7B 4DFSA 4FPHA 1JS9A 5DPNA 5A33B 3DYPA 1MZ6A 3ATGA 4Q4X1 4B4QA 3ZN6A 3ZPYA 4LA3A 1QXPA 2W1QA 4PDWB 1BS3A 4K8XA 1PGSA 1P7GA 2Q73A 4EE2A 2PTMA 2ZGMA 4DR4B 3W9AA 3ZN0A 3WDYA 2CTQA 2Z69A 1VLNA 3ASIA 3MO4A 4CU8A 5GALA 2XQXA 4NN0A 5IWFA 2RR11 1RUC3 2WT1A 2QGNA 4IE5A 3MUY1 1YFXA 3VHNA 1LHWA 1DP0A 4L0PA 3BHPA 5DECA 3W20A 1RC6A 2EIBA 2QKDA 1UNBA 2WINB 2BOJA 3H1WA 1VQ6V 4K0KO 2JRIA 2WO2A 4GH4A 4UWDA 5DN2A 1HNZB 3UJQA 4QDQA 2VOXA 3ZMNA 3CMEV 1VBB3 2VOVA 5EC2C 4G3YC 1EN6A 1K92A 5JXHA 2AR6A 5IJ0B 4FM0A 4P2ZA 1LR1A 4N43C 5CKNA 4XHXA 3D36A 4NROA 4DRXB 1P4RA 1WZXA 1SA0A 3WQ7A 3DGTA 4JHZA 3RYIB 4LTAA 1AYN1 4L8JA 3W59A 2VWKA 4HBNA 3SYOA 1V6JA 4JGZC 2D3RA 1YTFD 3HKDB 4LORA 1CP9A 3IMMA 4OCTA 4AI0A 4QPIC 2P06A 1W6NA 1TA8A 2J1EA 5B66Z 1Y4MA 5FPBA 1Q56A 1YEWA 1OJHA 2XJSA 1K5JA 4CH5A 4IV1C 2XAQA 1KJLA 4GX5A 4CP2A 3U14A 3A0HZ 2DQ0A 3AG4C 3NL1A 2Q8OA 3WB2A 1NUKA 2UXBB 3IKWA 4ZY9A 4QPGC 4XETA 3CJIC 3VBOC 2EALA 5TISZ 1QKQA 4DS0A 1GTOA 2EXHA 1NZIA 3MF6A 3RPQA 2GTAA 3APOA 1UMZA 4MGYE 3U10A 4Q5OA 5CFDC 5C4WB 4XVHA 1R082 1VMHA 5E8AA 1IZ3A
chains in the Genus database with same CATH topology
1LU2A 4CYDA 2RR12 3GYDA 3ZSJA 3DPRC 3LA2A 1HRI2 3NKTA 4XJ8A 4FPYA 4MSVA 2HWC2 1BBT2 1VAMA 2GMMA 1MZFA 4U2AA 4E2QA 3IDCB 4E4SA 1PNGA 1GSLA 3VKNA 3EXUA 3N7KA 4L2NA 4AVBA 2TUNA 4GALA 4J1XA 2EVXA 2B7YA 2ZZJA 1SCSA 1ULCA 1OS7A 1GV9A 1DRTA 1QY4A 2XBO1 4XFCA 1NE6A 4BLIA 3UKVA 1WMEA 2QNKA 2RM22 4JDMA 5DDJ3 4BMEA 1H8TA 2XLFA 3ZXAC 1G8WA 1QMJA 1M06G 3WDVA 4P9LA 1PK6B 5L73A 1HXS1 3MW2A 2P2KA 4L92A 3GBFA 4QQ2A 3M1HA 2MEV1 1A6CA 5JCTA 1TMF3 4KU8A 3VBRB 4C0HA 3UV9A 2R0HA 2WZR2 5C9AC 4K8FA 1WBFA 1NLSA 5FMOS 1VBA2 4ES9A 1Y3TA 3AXDA 4AF9A 2AYHA 2HJIA 4NWWA 4Q4X3 3RWNA 5CG9A 3KT4A 1C5HA 2A71A 4RD7A 2QQPA 2WT2A 4QGMA 3H3UA 1O3QA 4F83A 2JG9B 1CD3G 4RQPC 1XYPA 4FPGA 4JCKA 4OFGA 1QJX3 3S7IA 1GQWA 4I2OA 5GLZA 4KG0A 4CDQB 1OQ1A 2V09A 3N35A 3RS6A 1ULFA 5IUQA 3T1MA 5KHKA 1R083 1H30A 2W68A 5KC5A 4KL1A 4M00A 2HWD3 1AYN2 1J3RA 3B93A 5FO7B 1W6MA 1HRI3 2P17A 4GH4C 4B7KA 1V6OA 4HKLA 3LWCA 2YUEA 3I7DA 4JQRA 2UURA 3QH7A 4UW5A 5BUVA 4AEDC 1HRV1 2JEMA 4JC1A 3WZ1A 4XJWA 3CO2A 1MVQA 1SDWA 1CAWB 5KXBA 4MH0E 1PO23 3KQRA 4Q0QA 3CNAA 3THTA 3WUDA 4NVPA 3WW2A 1JW6A 1OIKA 4J1WA 1SMVA 2DUPA 4CDUB 1LULA 5JAXA 4NR1A 3AZXA 1R1A1 4YNIA 2GN7A 1UN1A 2ZABA 5GZEA 1Z7S1 4NOTA 3AX4A 1J58A 4LBOA 1DG6A 3AP4A 2GNMA 3AM2A 3TNQA 1W0OA 2WZR3 4UBGA 1YO8A 2CV6A 1G9FA 4YVSB 3OD0A 3FBYA 4AFAA 3KCXA 1RGSA 1HIXA 2PA7A 1C57A 1Y43B 1XYOA 2TBVA 1JBCA 3WY6A 3VHPA 4XEZA 4XOGA 3VBSB 3RI8A 2ETEA 2YGMA 3RYKA 4QHBA 1HQWA 3D82A 1C1FA 3D0SA 1LB2A 4L9BA 2VW0A 3ZFEC 4XYXA 1F31A 3ZYRA 3WOGA 4PIZA 3VUOA 4HN1A 3POWA 3WG1A 4YZ2A 3NV1A 3TB0A 3VZMA 2JENA 1OA3A 4PLNA 1UD1A 1JXNA 1CAXB 1AYN3 1AHSA 1S55A 3R1JA 5T5OA 1MEC1 1YIFA 2GALA 4Q0VA 4FCAA 3O5SA 3UKTA 1GYKA 1V6MA 1J1LA 4FPJA 1LRHA 1AVBA 2OG5A 1CJDA 5HCFA 4ASLA 4WVWA 1A3KA 2ZKLA 1A78A 3PMSA 1PGL1 1LODA 3VHRA 5BNOA 1SQ4A 3ZFFB 4AVTA 5D8AA 2XBO2 4I0WB 2QZ2A 5FOJB 3VBRC 3WCRA 5C33A 3UKNA 3MDPA 4FPLA 4Q4V3 5A32B 1HXS2 4IEPA 5A3LA 2FQPA 3MPPG 2FMYA 1JHNA 2DFCA 2R16A 3WDWA 2ZGQA 2MEV2 2D43A 4S2FA 5I0UA 3E5UA 1V6LA 4RHV1 2D6OX 1GQHA 5AFBA 1DU3D 1KXGA 3L2YA 2VNOA 3MLKA 4OZXA 2ZX3A 4HSLA 2R062 4YVWA 1QDCA 2HEYF 5BNQA 2RJKA 3J9SA 4YFWA 1GBGA 4NHLA 4CEYB 5CB7A 1D4M2 3HT1A 2AZ5A 2WSUA 2RS13 2RS31 4E2SA 4BMBA 1ZBE1 2ZGRA 1K5MB 1DYKA 2PAKA 3ZFGB 4EN7B 1Y7BA 1DLLA 4GIQA 4E9KA 5DG1A 4R4ZA 1O7FA 1RITA 3C2UA 4YG0A 4FOWA 4AEJA 4P5HA 5IK4A 1CAVB 4Y4YA 4XF9A