1MZFA

Human factor inhibiting hif (fih1) in complex with 2-oxoglutarate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
total genus 92
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzfA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzfA01
4Z1VA 3KCYA 2CGNA 4BIOA 1H2LA 3P3PA 2XUMA 1MZEA 1H2MA 4Z2WA 2ILMA 3P3NA 2W0XA 2CGOA 1YCIA 2WA3A 2WA4A 4B7EA 3D8CA 1MZFA 4NR1A 4JAAA 1H2KA 3KCXA 2Y0IA 5JWPA 3OD4A 4AI8A 4B7KA 1H2NA 4QU2A 2YDEA 2YC0A 1IZ3A
chains in the Genus database with same CATH superfamily
4J41A 4XILA 1WKYA 4J6GA 1GQGA 1AJPA 1XQ8A 4FFBA 4YM2A 4QB6A 1AHSA 4XFAA 4PHZA 4LMFA 5BNNA 3CCSV 2XL7A 4XF0A 1DGWA 1NLQA 1MSDA 2LS6A 5KX5A 1GFF2 1KQRA 1AX1A 1UY2A 2DUOA 5E16A 1VB2A 1JI6A 4BMEA 1LHVA 5LBEA 5JUVA 4BIOA 4N9IA 1KS5A 1RUF2 2AH2A 4PA4A 1AL21 1HNZB 5IE9A 2A9HA 3TN91 1L7QA 2XLAA 3N2GA 1GLHA 3ZHVA 2Y6FA 1W0JG 3CCEV 1V6IA 3D36A 1XYNA 2ARAA 3JD2A 4AQYO 2WDBA 3RNSA 4NIAA 1D5AA 3WG1A 3JD0A 5A3WA 3SNMA 5DUUA 2ZKNA 4Z07A 5B4XA 1RTVA 2IC1A 3S6PA 1BXHA 1VMFA 3I7DA 1F9KA 3OD4A 1HRV1 1K5MB 3JD3A 1SQXH 2Q5TA 4GKYA 1GK9A 2XAFA 1V9PA 3E89A 2RG4A 2BTOA 2RCVA 1AROP 3ATGA 4FFIA 3RPQA 3C7GA 1KQSU 1M57C 1V9U3 2HWF2 1UOGA 3MHSC 2DYCA 3OBZA 2JX9A 4MH0E 4TYSA 4HFSA 3L2HA 3H1KH 1VALA 1UQXA 2OQ7A 4MG2A 1G1XB 5A7QA 3KVAA 1Y4WA 3WHTA 3HQUA 5H9QA 5CADA 2UU9O 1O8PA 3BTAA 2VUAA 4A5UB 3R4SA 2EAAA 4KBBA 1QJY3 5L7OA 4Q4Y2 1ZRCA 1LEDA 4JPRA 2CGNA 1POV1 2W08A 2XJSA 4YJ3B 1HW5A 3LPGA 5HBAA 5J09A 1ULDA 2JDMA 3HD8B 2RR12 4LF8B 2VR4A 1GYKA 2PN5A 1GM7A 2BVVA 1CP9A 2GNMA 4M0NA 2P34A 5EBMC 3IBMA 1NI8A 2QWOB 2G4IA 1OHHG 2EIEA 5FO7B 4O7XA 4W4KA 4TSFG 1O5LA 4AW7A 4S2DA 3HN3A 3VBFC 2BTQA 1CAVA 4PA6A 4CP0A 3RZMA 3A0HZ 4BQYA 4JZ2A 3T1CA 1G4YB 1W05A 4YG3A 2QWNB 4YARA 3HKEA 2JDZA 2QM4A 1GWLA 4B8EA 3KV5A 1SG3A 1JHNA 1FX5A 1NA1C 1LR1A 4LHNA 5FZOB 2VJXA 2G19A 2PA7A 4GZRB 2A3YA 3AC0A 3ASNC 3AM2A 1SF9A 2RJLA 2OQ6A 4XJAA 1ZA7A 2RS33 1RUJ3 3ZIXA 4DR2B 1SBFA 3AVSA 2JG9B 4QM9A 1GRJA 2A0LA 2X5IB 2Y6GA 3INAA 1IOAA 1V6LA 2ZGPA 5HCBA 3QO7A 2R0HA 4IEQA 2XDVA 5L7OB 1CAWB 4E4DX 3RZJA 1QHTA 1P4RA 2O8OA 4UWDA 3E5XA 4X1YA 3LEGA 4CA9A 1KKDA 4WBBA 5KMGA 5D2AA 3QH6A 3ABZA 2JDUA 4N43A 2X0LA 5FZHA 1R082 5A32A 1OCCC 5EXOA 3OF1A 3SPHA 1RM1B 4UCVA 3IMMA 3L75H 2V09A 3AP9A 3NWKA 4BIFA 1EV11 5DXDA 2BGPA 1LODA 2HWF1 3IDCB 4C90A 4LTAA 1NZ6A 1CVNA 1VBB3 2CWSA 3ZXAC 3NV4A 3FKSG 3M4FA 4CP9B 1G6NA 4KHPB 4I3PA 3A0RA 2X7RB 3RYHA 4Y5Z0 1UIJA 2ZM6O 2HWB2 3RZLA 1HWYA 1N1VA 1JOJA 3OUFA 5IY5C 4HL0A 2QA4V 4DV1B 1YJLA 1HRI2 4FM2A 4Y5SA 1XQNA 1BCCH 2VNRA 3X2QB 2GALA 4CYDA 3RI9A 4GJYA 3BOWA 4QXBA 4AEDA 1YJKA 4WVZA 1SERA 1SFPA 4AI9A 4Z8BA 2F17A 2GP5A 4COZA 1H4GA 3FLPA 3HVDA 2IH1C 3AG3B 3B8MA 1TME3 5B66Z 4G3YC 5FY4A 2BERA 2DWEC 1WMFA 2R042 5FO8B 2P3IA 4NAMA 2IUWA 1UWWA 4IEZA 2ZMKA 2D6NA 4FZ1A 4DV7O 4YGBA 3R65A 3J8F3 3ZVXA 5CB4B 2QTWB 2FDHA 5FR3A 2ZHMA 1FOD2 1UOFA 3MF9A 3A4UA 4M3CB 1D4VB 3E2EA 3ZPOA 1ZBA2 1HN1A 4HKOA 2ARHA 4DV6B 5E79Z 3P32A 5FYBA 1NOVA 5LHGA 1YRZA 4JAAA 1ULFA 4NHXA 2P22C 3VHPA 2CTWA 2WZ8A 2NPIA 3ENRA 3KHCA 2QNKA 5FZCA 2DYSB 3HR9A 5K8SA 1WA4A 1IHMA 4BWAA 1Q8SA 2QDRA 4WVMA 1US3A 5J2UA 5FZ7A 1VBE1 1SQQH 2ZCEA 4LOTA 1YSCA 5CFCA 3VD3A 1F35A 2Y4TA 5KR7A 1SQPH 4MVQA 5AG2A 1H9PA 3P1IA 5I93A 2O8QA 1OF3A 1QOOA 2BRTA 4UVCA 5ANNA 2JS3A 1OMIA 3GNEA 1KECA 2VCBA 1V0AA 4RHV1 3CPWU 4QE9A 4B3NA 2WLQA 4LO4B 3B9CA 1D2SA 4Y1VA 4NXMO 1S2KA 2LALA 4YZ2A 1C8M2 1W3XA 1QDCA 2HBTA 1UU6A 1HXS2 3QNEA 2DCKA 1BMV2 4MTGA 5JJNB 3JBG1 3L73H 5IFTA 3MW3A 3W9AA 1EAH2 2DUQA 4N43C 1RUD2 2YPJA 4MTOA 1FOD1 2LROA 1EV13 3NKGA 2GSYA 5DG1A 4CZZA 1DGLA 1BYHA 3FBYA 2CTRA 2WLNA 2RM23 2VZQA 1WCKA 1NQTA 1AVMA 1XYOA 4UW5A 3CBNA 1ND2B 3L74H 4MVRA 4PQ9A 4AWDA 3OGCC 2XLGA 4LKEA 5IHRA 1N1YA 3OW2U 4RR3B 4WM7C 3RWRD 2BOBC 3SYQA 4IESA 3SJCC 3HNBM 4DR6B 3WU2Z 1OCZB 1KC8W 4EEQA 2VM9A 2P6JA 4XHXA 1Y74A 3CMAV 5FV3A 2WNUC 4FFFA 1B09A 1UYZA 3G80A 1LULA 1YJNV 2DWDC 1PX3A 4ZS3A 4QX0A 3UYJA 1OVPA 2EXJA 4J9ZB 4QKBA 1PNFA 1F5JA 1KRIA 3M3CA 2JWPA 3PIJA 3VDAA 1RUC1 5K9YA 1DHKB 1IPKA 2WT0A 1E5IA 1W2BU 1Z0HA 3ZSMA 3V56A 2CUGA 3H42B 3POIA 4JQTA 4PIZA 3BTXA 1CESA 4CU9A 3W7SA 4X62B 4CDWC 1SLBA 3T08A 2R063 4N7UA 4BDVB 2F6BA 4KGGA 1FI2A 3DPRA 4LC1A 1XE7A 5LA9A 4CBCA 4DR4B 1DBNA 1OLMA 3WQ7A 4LOSA 2WAOA 1JMUB 4J9YB 2IWGB 4K8FA 3JD71 4EWEA 3ZFEC 2Y69C 5EFUA 3VGIA 3VBBA 4H3WA 2R0FA 2XJPA 2DVBA 2J1SA 3JZVA 5IAXA 1OLME 2WIIB 4Q4W3 1IZ3A 1SZTA 3LE0A 4RUFA 4GB31 4JGYB 4AEMA 1FNZA 4ZIBA 1GICA 4O2BA 1MABG 1XNRB 3LEKA 4XDQA 5FPVA 1CD3G 4UXNA 1OXCA 2PELA 1MPXA 4IV3C 3KGLA 1X59A 4XFGA 2XJUA 3FWEA 2ZDIA 1QLEC 1JQ0A 4JI1B 4FPFA 3C7EA 4CCMA 4AXOA 2SLIA 1OV9A 1CAXB 3LSUA 2JD9A 4CH6A 2QQJA 2R072 1R1ZA 1VQ6V 1ZRDA 3TXSA 3AZVA 3K77A 1GM8A 3VD9A 3I4IA 1ULCA 2E74B 4FPKA 1DG6A 5FZ1A 3OEEG 1XYPA 3OY8A 2PXJA 4JI0B 3OBAA 3VD7A 1FT9A 1FAYA 4XQWA 1JZ6A 3TRSB 4Q4V1 5DUXA 5H9PA 3HPNA 2QVSB 1L7RA 1BEV2 3EMRA 2PHDA 1VBD2 1R091 1QOSA 2MW2B 2B39A 3BOPA 1MS4A 1JYCA 3JASA 1H8EG 1H1AA 2KSDA 2EILC 2HG5C 1W3VA 4OPAA 1SHWB 4CPBA 4DXSA 1ND2C 1SFYA 3OCPA 3IPVB 5IJ0B 3D0SA 4LA3A 3OUJA 4GH4A 1AI6A 3AK3A 2VVEA 4BQ3A 3JAKA 4XBNA 3J7HA 4O61A 3O0VA 1PO21 4I01A 4L97A 1PIV2 2DYRB 4P9WA 3KS7A 1Q8QA 3AKQA 2B45X 1VPHA 1YFUA 1QJEA 1PNLA 2Q4SA 2GNTA 1AL23 4NKGB 1BK0A 1SC5B 2VWKA 5LBBA 2BWAA 3WV6A 1PGW1 3MGUA 1REDA 3LOBA 4GKKB 1VMGA 5L9BA 4PF1A 4CEYB 2ERFA 1Y66A 5L3GA 5C3PA 1H4HA 4G4FA 2XL9A 3BYWA 3A2FA 1W8HA 4PF5A 2MHFA 3L72H 4HANA 4AGGA 4P2ZA 3N2KA 5EQUA 1UZZA 5J96B 1W0NA 5LP6B 1KBHA 1V6MA 3PVOA 1XL4A 3VBOA 1N3QA 2YV8A 3JAMN 1W6OB 3WSOA 1QQCA 3SCHA 1IVSA 1HNXO 5KLVH 2YHJA 2WO3A 5F6KA 3VDDA 2VOXA 5ERLA 2FDIA 3K46A 1R6KA 1KB9F 5FYCA 4RFT0 1PGL2 1LHUA 1YLLA 4KQ7A 3NNJA 3UO3A 4MHRA 3HNYM 2AR6A 1S0EA 1OZ0A 4HZFA 3SC7X 3CJIA 4UVAA 2ZGNA 3RYCB 2I74A 2ORXA 3VBSC 2P7TC 1O91A 2D97A 4XQDA 5B1BC 2VY0A 2P5BA 5C3RA 4CDUB 4CDQC 2GMEA 1HB1A 1I08A 4IE7A 3U75A 4DXTA 3GBWA 1VEWA 1XNQO 4GKXA 3J4UH 1IS4A 3MEPA 2JG8B 3DUIA 2RHPA 2NR5A 5FKBA 3LCPA 1XE8A 4XUNA 2QQLA 3ZIWA 1BHAA 1UCXA 1FMD3 3WINE 4YVSC 2UY9A 1N1TA 4O4HB 3PNAA 5F2SA 2EIJB 2L6LA 1ZAUA 2VGDA 1EPZA 3HT2A 3WW2A 1SETA 1V6OA 4EE2A 1WPBA 3BKZA 2JKXA 3W5MA 1VP7A 1SBEA 2VXRA 3RDIA 5JXIA 4E2QA 2FB5A 3G6JB 2RDCA 5T54A 2OCCB 1XL6A 1YVWA 5GZFA 4JCKA 3ZFGA 1OOPC 4C1XA 4JAUA 4YHHO 4TN7A 4QU1A 3ZFEA 2Q0AA 1ACCA 3ST7A 2PAMA 1BE3H 1K73W 3LDCA 3L9DA 1W28A 1D2QA 3KM5A 3PJYA 2JVDA 1VBA1 4LO6B 2TNFA 3C7HA 3LIHA 4GKKO 1NY72 5LBQA 1QNWA 1YI2V 2JGDA 2QQVA 1KKCA 3OM3B 2JIZG 1YTFD 1G8MA 4EYUA 5BNOB 1SS3A 3HIFA 3ITQA 4GWNA 4IUGA 2Q4PA 3ETGA 1PMJX 3VQYA 3O1SA 1PKXA 3T1LA 2FCVA 1VIWB 3DGEA 2BNNA 4J42A 2JGUA 4WF9V 4Y24A 2ARXA 2W47A 1ST8A 1B35A 2Q8DA 5BV6A 3M99B 2DUPA 2HWC2 4Q0UA 4E4EA 4D6RA 4IW3A 3AZXA 2QQIA 2XXZA 1BKZA 3TGUH 1M57B 2YEVA 5LMNO 1J95A 3RWKX 2VZVA 1AJQA 1R3JC 1ZX3A 5AC92 1NE4A 5FPUA 1YFWA 5CYYA 2LW8A 2Y0OA 5LGUA 4AHYA 3PDQA 1EAH3 2DFBA 2DBIA 1ULOA 4JKKA 4FOYA 3IB3A 2OKXA 3BABA 2K9ZA 4A2UA 3K03A 1CAUA 2GC0A 3UCSC 4QX8A 3FYIB 1CAXA 1XSQA 5KHIA 3AMHA 4GALA 4C0BA 2YSUB 1ZZBA 4URAA 1DTOA 5FBJA 4LO8A 4EB6B 3ZXGA 2WLIA 3N2GB 3JUUA 4JYAB 4LO5B 3VD4A 1W04A 4A7KA 4CS4A 4X64B 1K3IA 5H2FZ 3VBUB 4DV3B 1RUG1 5I8TA 1HDJA 1CQ9A 2Q5ZA 3JBG2 2OA2A 4BPZA 4H14A 2OTLV 3FC0A 4ZHQA 1NT2B 5LBFA 4UCOA 2ZACA 4IE4A 1FV3A 1W6PA 5LXTB 4YZ3A 4JHTA 5FPAA 1NXD1 3A22A 1GZWB 3TN92 1JUHA 4GIQA 5K4LA 1PGW2 3SGIA 3WQ1A 4JGZC 4BOWA 3P5BA 2AENA 4QPGB 4AI1A 1F4AA 3BIEA 2RE9A 1DIWA 1TVKB 5JDBA 1G86A 1R1A2 3ZEDA 5K0UC 3ICXA 2WO2A 2I07B 1YQ8A 1XNKA 2FMYA 1XRUA 5ANQA 3L70H 5L7OC 5I0DA 5J48A 1V54C 1WLDA 5FK7A 1H8TB 2Y4UA 1IX9A 3RGBA 2Y34A 4HETA 1CAWA 1WLWA 2X53S 5DUVA 1SLTA 1KDKA 1CIWA 1YJ9V 5B2GB 2FZ2A 1AXZA 2EF6A 4Q20A 2F4LA 2BJSA 3LOIA 3OR6C 2ZE8A 5H6RA 4ATEA 2ZR2A 3AB0A 4QPIB 4JI3O 2ZNJA 2R1DA 2UU9B 2HJFC 4DY3A 4CCKA 2DV9A 3B40A 1OH3A 1PD3A 5HXVA 3VBRC 1GUIA 1K33A 1RVF2 4SLIA 1UKRA 4BB3A 2D6LX 4HOOA 4AVBA 4I0XA 4R9AA 3T2QA 3WLUA 3H1JH 1DGWX 1ND3C 3TJTA 3THOA 3RI8A 2VQEO 1LECA 3MIGA 2AEZA 2R062 2Q8EA 3AYDA 3ROUA 2UXCB 2F4VO 5I8YA 3WG7C 4IQPA 1W6QB 4RS5C 2HWE1 3RS6A 3J7MA 2HEVF 2ITDC 2P06A 4MGIE 2HKOA 2D6PA 2VQAA 4URTA 5FP7A 2B9VA 4PDVA 2D6OX 3KVBA 3OUSA 4H44B 2RMU2 1JYNA 2IXKA 4JV4A 1H8TA 4PJYA 2JEXA 5GTIZ 2PHFA 1TUBB 1JZ7A 4LUMA 3JQWA 4COWA 5EYYA 2VZTA 3APOA 3N9OA 4FP3A 2BWCA 2IXIA 2DE0X 3E22B 1UZYA 2EZOA 2YXYA 4EWAA 4DV4O 4NPLA 4IHJB 2WLJA 2WFF3 1FYJA 5GTHZ 5H9CA 2VW1A 2OS2A 1QNMA 2R32A 2XLFA 5TISZ 3UGHA 3I2HA 5LY2A 3LFIA 3VBRB 4LNUA 4D7TA 4X9QA 4XJWA 1QJY1 4JZRA 2N05A 1JFFB 4GWMA 3OGIB 5T5PA 1RUD3 3ZFEB 1H2MA 1I9RA 3OYWA 5HPOA 4MGTA 3SXWA 2YFUA 1R73A 1UX6A 1GBGA 3BU0A 1NE6A 5JMOA 3KHBA 2HVJC 3EB7A 3O5SA 1FFXA 4KWLA 4C8DA 2VOTA 4MVTA 4MS2A 4DV2B 3KCCA 1AP6A 4XXAA 4AGRA 1KU9A 4O2AA 1L1FA 1S5JA 1YIJV 1EZJA 2ZTNA 4MSWC 4PBOA 4W50A 1I5PA 1E79G 4Q4Y3 4QPJA 4R9CA 4E8CA 4GX2A 3RFRA 2Y33A 3WG7B 3MD0A 4OULA 3PU3A 1RUH1 1DYKA 4XQ4A 1QXJA 1Z5VA 4RN5A 2NMNA 4CDUC 1RUC3 4J1XA 3BTYA 2YBPA 4QQ2A 2RDSA 2GZWA 2EXKA 3CCJV 2YS8A 2E76B 4ATFA 2WO7A 5C8CC 3QD6A 4QD2A 5FZAA 5AVPA 4I2OA 1QQP3 3FHIB 5KHHA 2QWQB 4DO2A 2YEVB 5DPNA 3UT5A 3N9MA 4LE3A 4WVMB 1ND2A 1KS4A 5GJ6A 4AVTA 2RN9A 4OHZA 1G6UA 1QGLA 4F6RA 2RJ2A 5FP3A 4FM1A 3X2QC 2QQPA 5DECA 1K3EA 5LBCA 1RIRA 2PI5A 1SPPA 2VZ3A 2HWD1 2Z5UA 1LNQA 1WLCA 3Q8FA 4XFCA 4HSJA 3G7DA 5DDJ1 1CPMA 1M06G 4DUWA 5K1XA 5FZBA 2D5HA 3WP3A 1VBC3 2BSKA 1VBD3 3H8RA 4P9GA 4YYOA 4TUYB 4LH6A 2E5LO 4H33A 4XABA 1W8WA 1LGBA 4I4TA 1YJWV 1GWKA 4ZI7A 3L9JT 4E27A 2TUNA 1MNGA 2E6VA 1D0HA 3RZGA 2GH2A 5C3SA 4HPKA 2F43G 3SR2C 1U5ZA 4ZY9A 1ZX5A 2V1DA 3IMNA 4OHWA 1WW7A 1DLBA 5D8AA 4MGZE 3IIAA 5IWFA 5C33A 3WP4A 3ZXKA 2WN2A 3AMNA 2W0FC 5APAA 4R50A 4Q4X2 2QM7A 4YW6A 1RXGA 2WQ8A 4JQRA 3EYPA 2DOSA 1UY3A 3ZS8C 1COWG 1VIBA 3FL7A 4OZXA 3S0MA 4QQLA 1GTOA 1NCRA 3CCLV 1VRH1 4A41A 1ULGA 2VW0A 3GZAA 1US2A 4YZ4A 1RUJ2 4EZ4A 1IS5A 4JYYA 2ZIOA 4A6SA 3NO8A 3BFRA 5CFDA 5F39A 1AR61 4CC6A 2VUJA 3K0DA 2Y8KA 4GAZA 1FXHA 3JAWB 4JV5O 4P9JA 5IJ9B 5A1LA 3LA7A 3THDA 3H1LH 1WZXA 5T50A 1VBC2 4J7ZA 1EUTA 3DXTA 2HWB1 4LH7A 4INDA 5KMGB 2DVGA 1AYN1 3SH4A 1JYXA 2B1GA 4TV8B 1W9TA 1LEMA 4RUEA 4E2GA 4KP4A 2SBAA 1VB4A 1DGRA 3PIGA 5CA3A 2K46A 1N8RW 1K5MC 3NMBA 3HQRA 5FLHA 5A1FA 3OPZA 2P37A 2D93A 1RUD1 4DRXB 2ZEWA 5D5QA 5DN6G 1WWYA 3ECQA 1WA8A 4PDMA 1SA0B 4F3JA 1QLEB 3ZMNA 1AI4A 5HFLA 2JXAA 1PVXA 1GZWA 1R081 3B09A 1IPJA 5FZKA 3POEA 4W6YA 4HLTA 3POWA 2VW2A 1RJ7A 1R1A1 5ISLA 4W4LA 2X10A 4CDQA 1MSWD 2VOVA 5FUPA 1XU1A 4SBVA 4FLWA 3X29B 5CBLA 4HVQA 5IAVA 1JZ2A 1Q8PA 2EJRA 3ABKB 1CX4A 3OR7C 2WLHA 5IJ9A 4TLFA 1RYYA 2A3XA 4ISQA 5A33A 4QB1A 1TQ5A 3JYCA 2ADQB 2XB6C 3N7KA 2HWE3 3O1VA 2ZEYA 1S4CA 2CDYA 3AP5A 3QOPA 1RUE1 2B5HA 2G38A 2VCMA 4JI3B 2A6WA 2EINB 2VWJA 4DR7B 4M3CF 3ETEA 5C4WC 4LF6O 1AR83 5KC6A 1VBD1 2P4EA 1C8M3 2G1MA 4P9XA 2JJ1G 2XOKG 4N53B 1B06A 4UCTA 2DWRA 1XC6A 4FLUA 2WFF2 4UV8A 3T3YA 2ZHKA 3M7MX 3H1HH 5JOYA 3VZNA 3IN9A 2HWF3 1NVPB 3FUOA 4XJ9A 2GH8A 3K3NA 4N90A 1ROPA 4KHPO 4CEWB 1SCSA 2HVKC 4LBJA 3RVZA 2WN3A 2ADEA 1C28A 2A6VA 2W1SA 2YXSA 1PM4A 4LBLA 4ES8A 3CL1A 3DSQA 3EBRA 5JVDB 1XMOB 3RMXA 4WVVA 2ZXWC 2Z0AA 5JZGB 4KL1A 2ZS6B 4V2VA 3WG3A 3S7IA 1N1SA 1DGRN 1RPRA 3WQBA 4OX9B 4DOUA 3OBTA 1Y43B 1TMF2 2HFEC 2JK5C 3E35A 4LBEC 2QBXA 5LA6A 4YG6A 2LP7A 1AR81 3CMGA 2Q6AA 3A0KA 3BTZA 4QE7A 3D8CA 3CX5F 5IVCA 2AHZA 4K40A 3USSA 3VHRA 4NTXA 3OG2A 5FY8A 4E4ZA 4B3SB 1NCQC 4YLZA 4M4PA 2IXJA 4MVOA 5CA6A 5FZGA 4K1YA 1K9MW 4WBNB 5EPAA 5A6QA 4FLTA 3CC4V 3H7JA 4CCOA 3T1YB 5HCAA 3LSQA 1FXKB 1CIYA 3K4ZA 4KMQA 4UYBA 4UCSA 4O9EA 3UV9A 1TG7A 4FM0A 3JD1A 5FBZA 4D69A 3UT5B 3J7NA 2WSVA 1SZXA 2RMU1 2LTNA 3C3VA 1Z78A 2YZ4A 5FMOS 1QDOA 3IC9A 5IYCO 3KT4A 4TTGA 1RUI3 4QX5A 2JE9A 4QGMA 4B4RA 1U97A 4PQQA 4LWSB 4XDPA 1S0JA 3ZYIB 2CDOA 3MV01 3AG2B 2EIGA 1JOYA 1PO22 1R1A3 2DCZA 3SPJA 4TUYA 2RDRA 4DIQA 2ZEXA 3B69A 1H8TC 3HBKA 3T4HB 4YG0A 1BEV1 4LFBO 4L2NA 4HSLA 4LHKA 4Q27A 2PY5A 4FCAA 2B8MA 4RQPA 3ZYGA 1AL0G 3THPA 3OMAB 1W6PB 3ZX7A 1UXZA 4HYOA 1J1TA 1F51A 2Z69A 1DQ1A 1JR9A 1M4WA 4D7YA 3AX4A 1O9HA 3QH7A 3ABUA 3QACA 1ORQC 2BUKA 2GU9A 2Q8CA 2O0OA 4RYDA 1ZBA1 2UXBB 3K48A 4UFJA 1OKOA 4WZFA 4Q8LA 3K59A 4DR1B 1EY2A 3KV6A 2NLJC 1QQP2 3CZUA 5L3FA 1V54B 4LCUC 3VB9A 1QH7A 3UM7A 1QJX3 3K3WA 1Y7BA 5C71A 1BT8A 2JIJA 2UWAA 3FN9A 4I0WB 3ZRWB 5DN2A 5ACA3 1U5IA 3OPTA 4A4AA 2PI4A 4YW3A 4C91A 3CCUV 3GALA 1JODA 4BR6A 2DU1A 3K57A 1I6XA 3LZZA 3OEAA 1RHI1 4TWKA 5BZBA 2E7QA 5CBGA 3ACLA 5EBLC 4IV3A 2RS11 5A3TA 3ZRSA 1XBFA 1NKDA 1MMMA 1POV0 1AJNA 4FPPA 4HKLA 5GZEA 2VUDA 3WF3A 1FATA 2NP0A 5GLWA 2FMDA 3I59B 4JI5B 2N04A 3LDDA 1H30A 5B1NA 4ARXA 1CEZA 1JTZX 2GC2A 4FVMA 3WF1A 5JJJB 2A7WA 1PPJH 4B3RO 2MEV2 2UWBA 1QNYA 1M93A 1IGOA 3ZN5A 2ZPXA 3B94A 3ZXLA 5IATA 2E26A 3IPVA 5ITZA 5FXVA 1REFA 1XNCA 3RMYA 1ZRIA 3BALA 4ZHNA 3LNMB 1IXMA 4RSUA 5FPZA 1LHOA 1AVBA 5JXGA 1AR62 4CDQB 2WFPA 1MZEA 2MPFA 5CU1A 5B1OA 2BE3A 3AP6A 1DF4A 5IYDO 3F95A 3UK9A 4EN8B 2EXHA 4YFWA 4PA9A 1F7YA 3CJIB 3KKYA 1FKAO 1N33B 1W59A 1AYM2 1F15A 4FQ4A 3VBOC 1VE0A 2IXLA 3W7XA 5SV8A 5JSPA 2RM22 4LF7O 5FP8A 2JS5A 3OGSA 1VRH2 2CH7B 3IC7A 1J3QA 4IV3B 1URXA 3WDWA 2ODMA 1AR4A 5D21A 5E88A 4DR1O 4JGZB 3V0AA 4BQ4A 1UN1A 1UOJA 4UF0B 1IURA 4HNAA 1DYPA 1DLCA 4XUTA 2CYFA 4CDXB 3N2KB 4QNHB 3CDZB 1QBZA 1JYVA 4K7JA 1IS6A 1JXNA 1RUF3 5FY1A 5JMCA 1AYM3 1NXMA 1B6QA 5CKMA 5FK8A 4P02B 1EV12 1RL3A 2VNGA 2CK3G 4W4ZA 1XE0A 3RYRA 3WEZA 4B1LA 4QT6A 3K75B 1KD1W 4HG6B 3BPSA 5A7PA 1JBCA 2YI8A 5KBFA 3U78A 1OLQA 1UMZA 1I94O 1WGPA 4CDWB 2HLDG 1JS9A 4IGGA 1AR72 4AR2A 3E86A 1H2LA 4JYAO 1A78A 4JI5O 3GXUA 2ARCA 1K5JA 3M3OA 3ME2A 4OXSA 1Q8IA 5F8PA 1NH2B 5JVDA 2KR2A 1JW6A 4XF9A 4K8XA 3IT8A 1O7FA 2WJSA 4FPGA 3CRRA 2BOIA 2FDGA 4YVWB 1AR71 3BA9A 2XQRA 1LKNA 2UXXA 4AF9A 1RHI3 1WW5A 3UNPA 1H1IA 4HT1T 2R72A 2B46X 4ASLA 4BLIA 3CD6V 1W2OA 4LF9B 3LWCA 1OJHA 2CWMA 3FYEB 5I91A 2QUOA 4X66O 4PLMA 5BNOC 3OE7G 4QMAA 4ARYA 2FQPA 1A3KA 3OBRA 4KUMA 4CP9A 1HLCA 5FP9A 2GUZA 4EN9B 4MV2A 3I3MA 1N36O 2OPKA 3SH5A 3U11A 2YGLA 3BEHA 3ZHRA 5BMVA 2E7AA 1YIPA 2DYSC 4Q8KA 1YITV 4I0BA 4QDRA 3NV1A 3WDVA 4M3CE 4PIXA 4O9GA 4AEDB 3FE5A 1K92A 1OKQA 4XBQA 3CO2A 1G9BA 2HEYF 4W6XA 4WFBV 2PGGA 2WBKA 2XGXA 3S5QA 5AC91 2BBAA 2YC2A 3OOXA 2HWB3 3NJZA 4NO4A 3SQOA 4D7SA 4K21A 4IEPA 1NTMH 3RYIA 4BIZA 4P30A 4FLXA 4I0AA 2AXTZ 1MACA 4CZSA 4QQPA 1W8UA 1G8WA 1DZRA 1OA4A 1U96A 4AG4A 2ZMNA 1BMFG 2JDPA 5FLXN 1VAVA 2W2IA 1PO12 1Y9MA 2V4AA 2ZX1A 2CSGA 3N7JA 1NR1A 2HHHB 5J3UA 3AP7A 5IJRA 2D5FA 5EYXA 5BNPC 2WNVB 1WW4A 3JCUZ 2G9FA 5IK5A 1DZQA 4LR3A 1U0AA 1W6MA 4BQXA 1IQAA 2VBBA 3H1YA 3H8UA 4CC5A 5FKCA 2W91A 1FXKA 1X36A 1HN0A 2GMMA 4IHJA 5IYBO 4AVSA 2D3OW 3FX3A 1W03A 3BHPA 1S55A 5LK5A 4GKJB 2D98A 5J2UB 3UETA 2F95B 2C9AA 1BMV1 1Z7S3 1UYYA 4M01A 3A23A 1WW6A 2W3JA 2EJ7A 1QJU1 1YQ5A 2JG9A 4LF8O 3EQEA 1LOFC 5CN0A 1SLAA 1HNWO 4ZU5A 2YROA 5AVAA 4B3TB 1JFFA 5BNNB 4Y1ZA 5J98B 3ETPA 4DUYO 4M4RA 1W6NA 2UUBB 4HVRA 3MW2A 1Y76A 2R061 3AYCA 1EPWA 3TYJA 1GN4A 1F31A 1DF5A 1RM1C 4AEKA 1YEWA 4QAWA 3AZWA 4NYKA 3I3DA 2PHWA 2WNUB 3ILFA 2J1VA 4U3FH 1GSLA 1OPOA 1D4M1 1H2NA 2CNAA 5EIBC 2XTAA 3UGFA 4B4PA 1VQMV 3WG4A 2ZKOA 4EZHA 5A7WA 4CH5A 3AL6A 1KUQA 1NA1A 3TEZA 2X5IC 4B3MB 3B93A 1TNRA 3E5QA 3I56V 1QH6A 5LB6A 4Z2WA 1W9WA 3H7YA 4KWKA 2VU9A 1NT0A 2VNOA 3OTOB 2D43A 3H01A 1K5QA 3GJBA 1GKBA 1SRYA 1HQWA 2OXBA 4D0QA 1VJ2A 2QTSA 4EN0A 3RVHA 3CSXA 1P7BA 4AGVA 2X6CA 3JB8A 5GKAC 5HCFA 1JU4A 3ZHQA 5F32A 4YJ2B 2OIGA 3ZYHA 3FAVA 5KHJA 2PMWB 3O9OA 3OFNG 4CPBD 4JKMA 1P84F 5FWJA 2B4KA 5GM0A 1XILA 3K5NA 3AFGA 2HH9A 4ASUG 4FBFA 1EN4A 4MYEA 5JSOA 2VMFA 5HV0A 2ADPA 2RQ6A 5BPXA 1MR5A 4FVVA 2M7WA 2EALA 1WMXA 2AC1A 3WNOA 4JTDB 1R093 1CZTA 5EIYB 3SJAC 2AGSA 2C26A 5EK0A 2VZPA 4UT5A 3WNNA 3DEMA 3K9AA 4O4LA 1OT5A 4FOVA 4TXWA 2EIDA 3RYHB 5IT9N 4XURA 1ODMA 4K6BA 4QPYA 4MLOA 4AZZA 4TV9B 1K42A 2R6QA 1RUNA 2MK3A 2DCTA 1JZ5A 4JI6O 1B04A 1MS1A 1SACA 5IJ0A 2J1RA 3HKEB 1NX9A 5LW9A 1H8HG 1C5IA 2HWD2 2P67A 4YGDA 3AXDA 1UU5A 4RGKA 5HCHA 4Y5TA 3JALA 3LSSA 2UXBO 3B3QE 2I2SA 3OMNB 3CS5A 2J1TA 5CBFA 5T3NA 4YZ5A 4MXVA 2LFRA 4JF3A 4MVSA 1OBNA 1OSGA 1WB7A 1M9NA 5DZEA 2Q67A 2EICA 2AREA 3H8OA 1M90W 3LSDA 4AEJA 5EJ1B 1TUBA 1UMHA 2RVAA 1N0JA 1T2XA 4IV1B 1VQNV 1ZVFA 3CP1A 4XFFA 1NG0A 1LAJA 1XPWA 4O4IB 1WBLA 4DS0A 4F8AA 2V73A 5DDJ3 1UW8A 1S0DA 2YGMA 3KZIZ 2D3PA 3RYFB 2XKPA 4NIGA 3O7OA 3SCFA 1PIV3 1VQ9V 3KT7A 3O65A 1LOBA 3JASB 3UKVA 4XPVA 5KXEA 4XEZA 3T2MA 1QJFA 3OTOO 3H1IH 4GJZA 4X1IA 2PF4E 1OUSA 2J7MA 5LMUB 1RJ8A 3VZLA 4Z92B 1WCSA 3CKHA 4MX3A 5IFPA 2IZWA 5HFMA 1Q56A 2Y0PA 3ELNA 1AILA 1Y74B 4YHHB 5F1RA 5FXXA 2GNDA 2W94A 4F83A 5H9RA 1OCZC 3E8BA 4NXNO 1XNBA 2ZBJA 2G9GA 5CZKA 3PU8A 1PL4A 1X4TA 1GZTA 4JVAA 2K9PA 1H2SB 2PFWA 4AYUA 3KGZA 1S0BA 2EIMB 1M4UA 4WFEA 3K08A 3T4ZA 3CJHB 2VUCA 2E32A 3MO4A 3P6BA 2JDNA 1PNKA 2V72A 2VTXJ 4I30A 3WDUA 3TOJA 1UIKA 4L8JA 1HV0A 4YNIA 2RS31 3W21A 1LR5A 1RUG2 5A3OA 2BZDA 3JBG3 2H3OA 1S0VA 4AQ6A 3CCMV 1WMDA 1MEC3 3H8XA 1YCIA 2XMLA 4UFIA 1GP5A 3S30A 4K3AA 2XJVA 3U10A 4IYHA 2ID4A 1AYN2 4XBLA 1FV2A 5LEKA 1SZBA 5IY5B 4QM8A 1W6OA 4JI6B 1S5LZ 3E6DA 3N36A 4XJUA 3MUZ1 4X1IB 1F8VA 1RUH3 2NLRA 1RHI2 5IVFA 3F7YC 3KCXA 2XHNA 2XT9A 5GALA 5FZ8A 3TCUA 4NPRA 4DR5B 5DUWA 1FMD2 1ULEA 1SFNA 4QXCA 2V4VA 4B29A 5EZYB 1SMVA 3HMYA 1E1QG 4LF6B 1AR92 4GMP3 3VBHB 3AZZA 1S2BA 4U3JA 1FXKC 5J36A 2WFF1 2EIJC 4JI8O 2E51A 1SQVH 1HR0B 2ZGLA 4QPKA 3KQRA 2YU2A 4Y3OA 4Q4W2 4UW6A 4K0KB 2JDKA 1QKQA 4KI5M 1W6MB 1K5SA 5H9SA 1POQA 4YM1A 3O12A 3ZX6A 5DZFA 2HR3A 1UZWA 1Q82W 4K1ZA 3WB2A 2VE1A 1XNRO 2WRAA 4JI0O 1BSMA 3CCVV 4BA6A 1W9SA 1MEC1 5DDJ2 1NLRA 1CPNA 2RMU3 1O4TA 1ODNA 4JGSA 4ZXEA 1EUUA 2GTAA 4WZCA 2DQ0A 4O65A 5IVVA 5I0UA 5FDBA 4ZOLA 3ASIA 3AG1B 5JR2A 3AFKA 1BQ0A 4K3UA 1E5RA 4V2WA 3FAVB 3T2OA 2W95A 1EN6A 1H38A 5G04L 1UAIA 4BISA 5LL6Y 4DV7B 1AR63 2R7EB 1HQNA 4NMIA 2VH9A 2WNUA 3TWIA 1YHFA 1CAUB 3DV8A 3POFA 4EWDA 5FAXA 3QLQA 4JZGA 2QE3A 3WNKA 1IPSA 4QQHA 4NIDA 1FXVA 1K34A 1XMQB 4S2FA 3B7MA 2MEV3 2RMKB 4W6WA 4CUGA 1AR5A 2ET1A 5L9VA 4MZUA 2A71A 1GWMA 4CEYC 3VDCA 4WVWA 5FXZA 1LOFA 2GHYA 5EC1C 1OD5A 5GW7A 4N8MA 3WDTA 3ZMOA 4CS2A 2PLV3 3I2GA 2WT1A 1N3OA 2QDNA 1VQ8V 3HAGA 5LXTA 3QTCA 3IM0A 1VBC1 5EP9A 5CISA 4AILC 5FZLA 1ZSPA 2A7AA 3F2ZA 2IU3A 1VF5B 2J1UA 1HXS3 2QQMA 2ZGQA 5A80A 1AI5A 4JTOA 3RG0A 4I7ZB 4B4QA 2YIBD 1HNXB 2QFEA 3NRUA 1FJGB 2Y6JA 2YB7A 3ZYRA 3VZJA 3M8AA 4ONUA 3L2YA 2E75B 4RWUA 1AXYA 3I2DA 4EN6B 2QZ2A 2WLIB 1FPOA 5LYJA 4PA7A 5L3EA 2DVDA 4PDLA 3IWZA 4JTAB 5JWPA 5K0UB 2LO1A 4KH9A 2EIKC 1F4NA 4CDXC 2PHRA 1N32B 4EN7B 1K12A 4TOIA 3KF5A 4IIJA 1OC1A 4DR6O 1RSOB 5FY7A 4N53A 3HKCA 3K58A 3SYPA 1B3QA 3GHMA 3SJQC 4J11A 1ZA4A 4W65A 5C9AC 3BCWA 3H1WA 5L3CA 3CNAA 3BB6A 1J5EB 1TUEB 3W20A 4UW3A 1SQ4A 3CRCA 5FMCA 3QBQA 1POV3 1V6NA 3MYXA 3FB8C 4DK1A 1Z2GA 1TZOA 3CHXA 4RL7A 3H1MA 4COVA 2ZCWA 1KDMA 5JZGA 2EILB 2W6IG 4DV4B 1XJAA 2GMPA 2WL1A 4YGCA 4L92A 4WCEV 3AG3C 4LWSA 4ZKIA 2FCUA 4XHBA 3USUA 5LRRA 5FTTC 4BWOA 2ZE6A 4I9WA 3CJHA 4LIUA 1IDSA 2Y6LA 1KXGA 4XDOA 4YW5A 3D36C 1G9CA 1CX1A 4UFLA 2QTOA 1JOPA 3OGRA 1NKGA 1TE1B 5A3NA 2ZXQA 2W5FA 5CFCC 2NZ9A 1PP9H 4NROA 2WWJA 4X1KB 4Q1PA 5B3SC 3CMEV 3HBZA 3N7LA 4NR1A 3JXSA 1JYWA 4FTSA 2HBUA 3CLPA 3MZHA 1FD9A 2CTPA 1MZFA 1A8MA 2P3KA 2X09A 4C1WA 4BCUA 2PLV2 2R49A 2YYOA 2BBVA 1GP4A 2WLKA 1AR91 2QQKA 5LHIA 3G6BA 1E5SA 5FZDA 5CFCB 2JJ6A 5BMVB 2WZR1 1WPXA 5GONA 4JI1O 4NTYA 3PUIA 3E6CC 1PHMA 4B7KA 1MS5A 3G71V 3ZN4A 2BFUL 4MTXA 2UYBA 4XETA 4OX9O 5E6HA 2CTVA 3POGA 2VQTA 1J3RA 5FMBA 5C8YA 3STZC 2Y48A 5CA0A 4UFMA 3T1YO 1R6TA 4AVCA 1W99A 4MO3M 4N7IA 3IFXA 2F66C 4K9SA 1AP5A 4Q4X1 1SCRA 3OUHA 2Z2SB 1UKGA 1L0NH 1VQLV 4CCDA 2FCTA 2KKWA 3EHKA 1DP0A 4WFAV 4KNCA 2D3SA 5FY5A 1QJU3 1XNAA 2WYFA 1VBB1 1VLNA 2VMGA 2VNVA 4ZZ8A 2YBKA 2W68A 2YC0A 4AHZA 2C6SA 5F3EA 4B08A 2P5OA 1HB4A 4B3SO 2XG3A 3VN4A 5E8AA 2AZ0A 4K35A 4XUQA 2WAMA 3AG4C 2WKKA 1BK1A 3DECA 1AI7A 2CU5A 1NJIW 4JGYC 2VO5A 3EXUA 1E1RG 5ACA1 2HWE2 4HAMA 5JXHA 3CWBH 3E83A 4X65B 1FYUA 5CFDC 1SDWA 5FYSA 4F4LA 4TLGA 3UKTA 1HX6A 1CZVA 5FREA 4AHCA 2UUAB 3Q8CA 1THZA 5GONB 2RR13 2Q68A 3T1HB 1ZBA3 4R8CA 2P6CA 1RP3B 1E5HA 4EB6A 3WB0A 4N43B 2GSMB 3NV3A 4U3JB 5FQ0A 4CCEA 5A1AA 1GOHA 4QPWA 2WS91 4LEJA 2XAJA 2BFUS 2IU0A 1IKQA 4L9BA 1R3IC 5FOBB 1QR9A 3A7QA 1DU3D 2FL4A 3D82A 2NN4A 4EKWA 1YXBA 3BIWE 2W1UA 5D8AB 3QVNA 5A2QN 2W52A 5EIBD 3KF3A 4ZS2A 4OI2A 1TNFA 4P5HA 1PNGA 4OHVA 4WM8C 4G2KA 2EXIA 1TA8A 2Q7EA 4AL9A 3T2PA 4RA0A 5GLTA 1B35B 3JALB 2CDPA 1SQGA 4N23A 3MIHA 2ATFA 1PO23 3MFAA 3UJOA 2HYXA 1NS1A 1XHZA 5DAPA 4OPHA 2IXHA 4RHV3 2W46A 3ES1A 4QHBA 2ES3A 5GZDA 3ZR5A 2Y6KA 2GDFA 1QVFU 3UJQA 3LDEA 1G9FA 4YJ2A 2YXHA 1PK6B 1VBE2 2R043 4GQ7A 3C7OA 1VMHA 4XBFA 2BU9A 2DTYA 4IV1A 5FOJB 4M0HA 1OH4A 1XNQB 4COUA 4B3MO 4KWUA 1PZ9A 4GH4C 4YVWC 3O1RA 2LUWA 3JARA 4YGEA 4TQFA 3ZOIA 4P00B 4AFCA 3OY8B 1CONA 3AYAA 2YIBA 3OTFA 2D6MA 3RQ0A 3PURA 1RC6A 2FBEA 1A34A 2OX0A 2DYRC 4Q6GA 4U7NA 4J80A 5A7OA 1ZLZA 2M6YA 3OMIB 4UUJC 2ARBA 4UFKA 4QDSA 2W0XA 3VV1A 1GO3F 4DEVA 4RFRB 1VR3A 2HEPA 3BCCH 4NRMA 2VQEB 3QO8A 3GF6A 4NOTA 3VKFC 5C5UA 1MA1A 2UXCO 3OEBA 1BZWA 1ASJ3 1GQPA 4R9DA 4UOJA 1PZ8A 4GH4B 4LHSA 4DK0A 1TME2 4EV0A 4XFBA 3T4VA 3LNNA 1BJQA 1NCQA 4K8RB 4EFBA 3VBSB 3PVBB 4DXWA 3OSDA 4X20B 5IUQA 2FKXA 2Q7GA 4ISRA 3USUB 3WW3A 1C1FA 2AZ2A 3R0RA 1Z7S1 1Q7YW 2VZRA 3CRQA 4XF3A 3ZSEA 1F23A 4JI4B 4CDUA 4ZONA 3JCZA 1JX9A 3JSNA 2X6BA 4BZ4A 4A42A 3J9SA 4J25A 4IIJB 5LEJA 5EC2C 2ZEZA 2PLV1 2YG0A 2WNVA 1S72V 1XMOO 1H1MA 2H0VA 1COV2 4ICGA 3I2OA 1FPN3 2HP8A 2VXJA 1NBMG 3AKTA 1XXNA 4CUAA 1S76D 1O6UA 2IH3C 1TVGA 4O4HA 4HZ3A 4PIYA 4NWWA 2KA3A 5CMUA 1ZTEA 1N34B 2IFRA 2HJDA 1MS8A 2ZA9A 3OGVA 3WF2A 2VZSA 5F2VO 2YI9A 1CZSA 1URFA 1RGSA 4DZGA 3LF7A 5IVJA 1BBT1 3ASNB 2BOJA 3D0JA 3PUSA 5DAXA 4TWTA 4UVBA 4FPOB 3VBHA 1YZBA 1UYXA 5FMOL 4QIWF 4DV1O 3RYIB 4WFFA 3ZHTA 3PUHA 2ZNIA 4OLLA 4AFMA 3T30A 1XUQA 4X88A 1UZVA 2IVIB 1TMF3 4JDMA 2GC1A 3K0GA 4MADA 3SH3A 1VF6C 4GKJO 2C5DA 4KBZA 3LAGA 2IJIA 2R9RB 1HB3A 5T5OA 4QXHA 2B1IA 2QM8A 1K5MA 4FXGB 4DXZA 4K8ZA 4Q29A 4RQPC 1SESA 3ACFA 5FUIA 5B5EZ 5FYTA 2O57A 4JI2O 2WPDG 2A1XA 4QWNA 4CCLA 2YIDA 2FMLA 1I7FA 2TBVA 3HOBA 1ZZ8A 1YI9A 2UY8A 3GBFA 4BQ1A 1K97A 3DC6A 5BXZA 3KWVA 3FZ3A 5IK8A 3F5WC 2WSUA 4X6RB 4FIPC 1Z7S2 1QEXA 2EIMC 4GB32 3NVCA 2FTKA 1P7GA 3KD4A 4YSFA 2ZGTA 4CCJA 2QQUA 4Q2FA 4KFMA 4AI2A 1DQ4A 3DKQA 1REEA 4I9QA 3NNFA 4DV6O 1YQ2A 1J1LA 3R66A 3LEMA 2XNDG 5KUMA 1UPSA 4A45A 1NTZH 4AQYB 3WOGA 4AFAA 1O8SA 4ZI7B 1UY0A 5DEDA 1PZ7A 3AMPA 3G4SV 4UCUA 3POJA 1C5HA 2JGDB 3JSLA 4S2HA 1NUKA 3BGAA 5F5AA 3JD72 5F3GA 4U36A 4A3ZA 1CWPA 2JDYA 1Q90D 3L71H 1JZ8A 4XF1A 2WAAA 4ABMA 2PQSA 2EIKB 4G9SB 4OMCA 2V4DA 4YY3O 1D4M3 2JE7A 4X8PA 3AEIA 4B3TO 1K4DC 2UUCB 4FTBA 2RJZA 3NR7A 2YC4A 2JEMA 2A3WA 4O4JB 2ZM6B 4MXWA 1NZCA 4FAHA 5GLVA 1NYWA 2DFCA 1WN7A 4LT5A 4LFCO 1GQHA 2DVAA 3WHUA 3URFA 2YIAA 3ZN1A 3Q8EA 4UBGA 2RS52 5J9PC 5AFEA 4DV0O 1IQDC 5KUKA 4R4XA 4DW0A 1BCXA 3ILRA 4D8MA 1S3JA 3FJSA 1IBMB 4AQ2A 3SKJE 2OT5A 4RR3A 4XXPA 3ZN6A 1UYPA 4MW3A 4WFHA 3E97A 1O3QA 2ZDIC 4E9KA 3VBFB 1OLRA 3UKNA 3I2JA 2C4XA 1HNWB 3BVCA 2P4KA 2XAQA 3GWKC 1ZRRA 3AP4A 2A70A 1H6YA 4LFAO 2ETNA 4JI2B 1UU4A 2H94A 2KB1A 2UU8A 4TV8A 4I55B 4JI4O 4JC1A 2P1BA 1TGOA 4RGGA 3HKBA 4NPMA 4X1YB 3IDBB 4NUBA 2IW5A 5IT6A 3J80N 5LP6C 2BSKB 5EZWA 1LRHA 4OFGA 3SYCA 3J8F2 2XAGA 1AJOA 1OCOC 1SLCA 3JCIA 2IJHA 3M8LA 3ZDSA 1MEC2 1HJGA 2W39A 1HXS1 3E5UA 4FOQA 4BU2A 3EVKA 5KA5A 3IGAC 4L87A 1AB3A 3AK2A 3THTA 3O1TA 4A7ZA 1KP2A 3CZJA 3DPRB 2N74A 4ZHQB 3BUCA 2C0ZA 3VDDB 2QZ3A 2DDUA 1LOCA 3IKWA 4LBQA 2RJKA 3VQXA 1FNYA 1WBFA 4HK9A 1MQTA 2BNOA 3ZBHA 4FZ0A 2VD7A 1D4M2 5F9TA 2RM21 1LHWA 2WLMA 1W2NA 1ENXA 5LA0A 1D2DA 3AG1C 3CQOA 4CH4A 4AFBA 1RINA 5JSRA 5DMYA 1L7LA 5FLIA 3ABTA 3ZR6A 1C3HA 4PA3A 1PMHX 1W9YA 2VTXA 5CKNA 1TVKA 4LBOA 3JD4A 3U14A 1K45A 2Q73A 4Q1RA 3B02A 4L99A 2HKXA 4H13B 2P2KA 2OCHA 3C8XA 2YPDA 2KQXA 4BIUA 4YW4A 5GLUA 2FDJA 1BGYH 3AKSA 4LF4B 4WFGA 1UZ0A 1WMEA 1S2EA 4RGAA 3SITA 1RPOA 3UT0A 1BHBA 3RWNA 5FPBA 3FFQA 2HYKA 5LMUO 5LRSA 1GH6A 3T2TA 1R083 4FLZA 3T0AA 4FFGA 1OOPA 4PD4F 4QPIA 2A5ZA 2PHUA 1IBLB 2ZJCA 2OTJV 3N35A 1CJDA 4CU7A 2KD7A 3ABMB 1A6CA 4X66B 3GZUC 4PDWC 1M5IA 1RSOA 3B77A 1R3KC 3ZLIA 3SPIA 3ORJA 1DQ5A 1KJRA 1ZZ7A 4HN1A 1AZDA 4L0PA 3ZPYA 3KSCA 2VMDA 3IZOA 4Y22A 4CEWC 3ACGA 4EJRA 1LESA 1V9U1 4FI9A 1EN5A 2P3JA 4ASMB 3STLC 2KG7B 1VBE3 3UL2A 5C8CB 5LA2A 5JCOA 3FBMA 1JZ3A 3DXUA 3JU9A 3DL3A 4E2LA 2PTMA 3IIIA 5FFOC 4MGQA 1GMGA 2VOWA 5CEHA 3H9VA 2A3QA 4Z1VA 2X8KA 4AQTA 3J7LA 3VZOA 4NIIA 3ZFFC 2ZR3A 1X7NA 1KGYA 3D3AA 1OCRB 1QHDA 3E8GA 1XNTA 2VULA 1DLLA 4XCBA 1Z5WA 4MVZA 2AUYA 3M2MA 4QPIC 4AVVA 1JYTA 1EM1A 5IYZB 2VECA 5BUVA 5B3SB 1GN3A 4NHKA 3DCQA 2WS93 5KHGA 2DTWA 2W9XA 5FYZA 4E4SA 2CL2A 1GP6A 1GN6A 2XH6A 4CDXA 4QB2A 1HP8A 3PLQA 4Q4V3 4YM3A 3PJQA 4IYIA 3OPWA 4XFIA 3NJYA 5DABA 3EXAA 1I3HA 1GMMA 2CGOA 1PMIA 3I2IA 5BNPB 1WB8A 5FYIA 2V5YA 3TXQA 3BU7A 3PVNA 5DG2A 1Q3EA 4BE3A 1UO9A 1QR8A 2ZKLA 5E1AC 4CCNA 1M56B 1QOTA 2JDHA 2GV9A 2W1WA 2Y64A 4B3RB 2ZHNA 4P5YA 2GP3A 4OZOA 3GCWA 1OCCB 1BBT3 2R16A 3LEIA 3VUOA 4AI8A 1FPN1 2DURA 5JQGB 1HIXA 4FPHA 1I5ZA 5M0TA 3SYOA 3WNXA 4XMIA 5C7GA 5CBHA 2E3CA 2G9ZA 5LGNA 2JIGA 4AEDC 4RAIA 4LF4O 3RYCA 2RS51 4O2AB 1ZM1A 4FLVA 4CP2A 3VBUC 4JTCB 1Y6XA 1HNZO 3N9PA 2OYQA 2ET7A 1SDDB 2BV4A 1UL9A 1JU3A 1N3PA 3U4XA 4WM8B 1BQZA 2Z42A 2XVLA 1EZVH 2BW8A 4V1PA 5CA1A 3MDSA 5LHHA 4HPKB 4QXKA 4X1KA 2WNOA 1HQLA 3RRDA 2HEWF 4GB33 1LUWA 1S0GA 2H6BA 3K79A 1QJX2 5D1IA 3W59A 1KFUL 3MF6A 2Y38A 3WQ0A 4OUEA 2CGPA 3AG4B 2J42A 5JLVA 3RT3C 5LK7B 5JCTA 3P3PA 1NR7A 4DUZO 5FRAA 1DF0A 4MTFA 4PI2A 3VLBB 1VQ4V 4AHXA 2NMOA 5A3LA 2VRZA 2XWJB 2Y60A 4NVPA 2XVKA 1R1BA 4O2BB 4UFHA 4DEQA 4ITCA 3GBGA 3HNMA 3Q4HB 2E7TA 2J22A 3VBFA 1NVPD 2PZSA 2KM2A 4UI9L 4PDRA 3AL5A 1LOAA 4UV9A 1CPYA 1ASJ2 1LOGA 1YWKA 3I59A 4E8DA 2QKAA 1P8JA 4NB5A 2VQFB 3V0BA 3MUY1 2ZABA 2WZR3 2VOKA 4QKFA 3ZMTA 3NJVA 1LENA 1Q8VA 1X50A 3KG2A 2LM3A 1GZCA 4TSVA 5IK4A 1NLSA 2FDKA 1DZTA 4G28B 3HKCB 3ZFFB 1ZUQA 5A7NA 1PO13 4DV0B 4NRPA 5ITZB 5A7SA 3ZXDA 4NXMB 2VMIA 1WAZA 3NL1A 2OYZA 5A3MA 4LBQB 4GWIA 2VVFA 1NCRB 2DU0A 2R073 4JTNA 5KXBA 5JOWA 1ZZCA 2DN9A 4CDWA 4PI0A 4LIVA 2DJVA 1H6XA 5L3DA 2ZAAA 3AYEA 1YYNA 1LUVA 3ZYPA 1Y9QA 3U1XA 3GM8A 4WM7A 2D2CB 3ZYBA 1W6NB 4LE4A 1O3SA 3ZXJA 1JUIA 4RHV2 3HT1A 2PHLA 4NIHA 3GZTB 2DF7A 3DGTA 5JH7B 2CH7A 1GAXA 1EFRG 4HMZA 1V55B 4EROA 2UXNA 1T6GC 4OHYA 4DV2O 2BVBA 5FQ0B 3AKRA 1V6JA 3WP5A 1L0LH 2PQQA 2ZIMA 3W7WA 3GB7C 3D5OA 1Y67A 2PHTA 1H2GA 4Z1MG 3PUQA 4JDNA 4IXLA 5LATA 1ZREA 3K5LA 3JD73 1VF6A 5JI7A 1COV1 4XTMA 1RMU2 4BJ0A 4R4ZA 2N7GA 1WUVA 3I2KA 2E33A 5CG9A 3WG2A 2ZAHA 4P9OA 4IE0A 3N4MA 1JVMA 4FSJA 1Q8OA 1US6A 1QLNA 5BY5A 4MUVA 4FPYA 1SQFA 1I0HA 5KXCA 3O0XA 2R071 3TEXA 4ZKTB 1WA8B 3J8F1 5JVVA 2VMCA 4XVHA 3UGGA 1U5XA 1ENRA 3I5DA 2IJKA 4LNUB 5EYPA 2JE8A 3WDXA 1MOFA 4FT8A 1N4CA 4LORA 5BY1A 4JKLA 4QHOA 2B5UA 3T0DA 3B8NA 2KG7A 4S2GA 2BCCH 4XJZA 3POYA 3HKDA 4MHUA 1TME1 3MPPG 3M3IA 3AG2C 3J81N 3T0BA 4DYLA 1BS3A 2A79B 5KAFZ 3KT1A 2E53A 4LJHA 4RD7A 3RJ2X 5IWAB 2AACA 2Z5WA 4IGOA 5F5CA 4KG0A 2FZ1A 4YPJA 3MLJA 3SLIA 1IG3A 3SISA 1Y9GA 4R7CA 3WD5A 2YU1A 2MEV1 1KD7A 3OJBA 4LK6A 3E1F1 4J7KA 4X8AA 1VAMA 4J7JA 4M3CA 1S0FA 2XVGA 2PYLA 3PHMA 2C2AA 3ZIAG 2HWC3 4Y1YA 5GZCA 4FMTA 4CE8A 1Q6UA 1WCUA 2RS13 2ETEA 2Y26A 3ML0A 3CB2A 3S7EA 4PELA 3LDKA 4YWAA 5A3UA 3DYOA 2HHHO 1MS0A 2JJ2G 3VQWA 2P17A 2YBSA 2WQ4A 1HB2A 1ZBE1 4IEOA 2Q30A 2XPJA 2YUEA 2BGOA 1ZYBA 4I0XB 4NTWA 4QGLA 1GM9A 1AL22 3A0BZ 3BVOA 2PYTA 2J1AA 4ZU4A 3APQA 2ENRA 4B1MA 3NKTA 3E8FA 2F93B 4YVSA 3CE2A 2A6XA 3HKDB 3S5AA 4QJFB 4GUNA 1AR93 4HVOA 4XOGA 3DTUB 4LF5O 3LFMA 4KU7A 3TNQA 2WSSG 1PGSA 2AGAA 4DRVA 4QGPA 1FPN2 1ENSA 3ILNA 5FYHA 3N27A 4LK7A 4LUKA 2QE7G 1OPMA 2W92A 2A06H 3SCGA 1V55C 2JECA 2L9LA 3OT7A 4BYYA 5BNQA 3OAAG 5GZGA 3ZSKA 2GTSA 3VBHC 1QU0A 2VZOA 2AEYA 1NA1B 1RUH2 3N7MA 3VDBA 2UXDO 3NV2A 2X29A 3RYFA 4LFBB 3SJBC 1GV9A 1G9DA 4Q26A 5IWAO 2X6AA 5CIRA 4G27B 3LDBA 3K5OA 3H0OA 4XW3A 2B9ZA 2QGNA 2QQWA 1X8EA 1MZ6A 2WO1A 1OURA 3K51A 3SHRA 1KYOF 1HR0O 3WNLA 3ZN6B 4BQWA 4OHXA 5C4WB 3IDEA 4OUMA 4BMBA 3LKJA 3R4UA 3RYPA 2ZZQA 1NAEA 1IBLO 5JQGA 3M3EA 4GMP1 4A3XA 1O4ZA 1YDXA 4BAYA 5FZ4A 1QJU2 3A21A 2Y69B 2ZGSA 2EULA 3K2OA 3GYDA 4YW2A 3P30A 3OYWB 2GAUA 2VL4A 2JD4A 3A8TA 4AVAA 1N0NA 2ZGMA 5LOVA 3MICA 3CJIC 2ZHLA 3BY6A 3GVMA 1FAFA 4HN0A 3O0WA 3ABKC 4D6SA 4NN0A 5BR8B 2QWRB 1YNAA 3CC2V 4YIPA 4NHLA 2ZX0A 1AYN3 3FB7C 1WJZA 2OWOA 5D8AC 4WV8A 2Z3YA 2H8PC 1VBB2 2FDFA 3ES4A 3PTRB 4JYBA 3KV9A 4XDLA 2K2SA 4GXLA 4DINB 3CEIA 3MW4A 2WINB 3H3UA 1IS3A 1UX7A 3K3OA 3CXCU 1MQTB 3I54A 1UNBA 2ATKC 1VBA3 1MS3A 3UQ8A 2O14A 1NCRC 2XBO2 1H8VA 1QF3A 4AI3A 2ZX4A 2QKCA 2OT7A 1GOFA 1J59A 2UURA 1M56C 3RZZA 1UJWB 3MLKA 3LA3A 5LGTA 4TQDA 5DM6V 3RBZA 4PJ0Z 3PMEA 5FYMA 3T4DA 3IJ4A 3VL8A 1DDLA 2GC3A 4D6TH 3G67A 3ZXEA 1ZNPA 2RV9A 3ZRWA 4ZOLB 3G6EV 4JI7O 4F6RB 4XACA 3MBWA 2VG9A 2K1EA 1RXFA 5JOZA 1B35C 1YUDA 4MVMA 5HI0A 4FK5C 2VQFO 2XWBB 4CEYA 5CAZA 3D3IA 4RO2A 3LB9A 4H55A 4E4HA 4QX7A 1FJGO 1Y76B 4QGNA 4ZBMA 1RUJ1 4Y20A 5LOVB 3I55V 5A32B 5BYNA 5JPNB 3MHHC 1X82A 4HKWA 4YZ1A 4JHZA 5C93A 4IE5A 4UXAA 2NYYA 4RQFA 3I97A 2R9AA 2Q69A 4JGZA 2I45A 4I50B 3KZ4C 5JIUA 2XJTA 1YFXA 4YRDA 4DXRA 3SMHA 5B1AB 1SLIA 3J26N 1YFYA 4ES9A 1NQDA 4O4JA 2VTFA 2LW7A 5F37A 3ZMVA 3LIGA 4ZU7A 3HWJA 5C8CA 4LBQD 4MGYE 5LWBA 1M1KW 2YUAA 5DAVA 4L8QA 5F2WA 5I0RA 1RUE2 4N21A 4DW1A 5EJ3A 2WZPP 3QCWA 1AXKA 4DUXA 4R52A 1A32A 4Z2AA 5F5QA 3K06A 2Y0IA 1VQKV 3VBSA 1YTFB 3N3HA 5H5NA 4X20A 5JH7A 4J10A 1IBKO 1XB9A 1Q86W 2HWD3 2IM9A 3Q9OA 3NJXA 5JXJA 4LA2A 5K7PA 1QVGU 4BXSV 5J37A 4DPNA 4JDOA 5KA6A 4CUCA 1BBT2 3H50A 5CB4A 4YIOA 3WCRA 1AF9A 4IT5A 2CAUA 3ABLC 3CXHF 3NAPC 3VHNA 3GWOA 4AAPA 4YW7A 5FPOA 5IVEA 1XU2A 4HNAB 3B00A 4BLJA 2OCCC 3H3LA 5D5PA 4WBNA 2OPWA 1IBMO 2Z4FA 5EBWC 1C1LA 2C1FA 4LKDA 4AK3A 5JOXA 3ZSLA 2DW4A 3O1OA 3CF6E 1T5EA 4MT8A 3BA8A 5EYPB 5FXWA 5FYUA 1BHGA 2Q9LA 5JCOC 3DYPA 5JI9A 5CKQA 1S0CA 4D6QA 4CXWA 2WS92 3ZRXA 2VMHA 3NNLA 5JPMB 4MSVA 5FZ0A 2HJIA 2YMZA 1VARA 1CGPA 4JV5B 4CRQA 3TN93 3WW4A 1XEQA 2GN7A 2R041 4JRLA 4OQ9A 3ZJZA 4LP8A 5G05L 1O4YA 2AYHA 1V9U2 5I0TA 1YIFA 4H7LA 1PK6C 2Q8OA 2QSAA 4C7UA 2A75A 3GGLA 1LGCA 4IDZA 1FMD1 4QDQA 3AK0A 4YVWA 3FX7A 3M3QA 3FHQA 1D5NA 1N33O 5IW0A 2ZGOA 2BPA2 4N53C 4Y1UA 4DR5O 3C7FA 4P08A 5K0UA 2GNBA 1XHXA 1YF2A 3RN4A 5T5JA 3OB8A 3E22A 4I09A 4LBMA 1KEXA 5B4NA 4NHYA 3LPFA 4OGQB 1DYOA 1OHFA 2EX3A 5L3BA 2OIEA 1GNHA 3I8TA 1TMF1 1YC61 5FJHA 3E8HA 1W2TA 5BNNC 3JQXA 4XTPA 3FB6C 4Q0QA 3HQXA 1H0BA 4DNYA 3ACHA 2XKOA 4UFZA 1MVEA 4E2SA 4IGPA 3DC5A 3BN6A 1I5YA 3ZYFA 5C4WA 3W5NA 2X05A 2D3RA 3I3QA 1GN2A 1LB2A 2CAZC 1XBLA 1RUF1 2RDNA 5KX5B 4AI0A 4CEWA 3LD8A 4LO7A 4DV5B 3I2FA 3K4AA 4YVSB 1V6KA 4OYUA 5LY1A 5A6YA 3MIBA 4X62O 3RSJA 1CR7A 5LASA 3POBA 3ZN0A 3ZFGC 1I1EA 4R8HA 4N9HA 3KMHA 1GNZA 3WF0A 2VS0A 2GBOA 1UFIA 2UUBO 1PVC1 1VMJA 4MW8A 5A6ZA 5C8YB 1UF2C 4XDJA 1HJFA 5FPRA 3B4SA 4DB5A 4DR7O 2ZD9A 5I8SA 1AR1B 1ENQA 1QMJA 4ET7A 4YXWG 4PLNA 3O1PA 1KMIZ 2UUAO 3K9SA 2VMEA 1UPIA 4QKNA 2HLEA 2XBO3 3EHBB 2VPVA 2BOCC 1C57A 1H9WA 2P90A 2YXLA 4YW1A 3MFCA 1BQPA 1VBA2 1JYIA 2PHXA 4XCAA 2BGCA 3ZXFA 2RR11 3GZEA 4NRQA 2B7YA 1X33A 4NHMA 1WP8A 1UXXX 3CRMA 5FZEA 4LF7B 1FOD3 3B01A 4LLFA 3IAPA 3FUQA 3AJYA 1R64A 2XR4A 4Q5OA 3UESA 4Q4Y1 1W0OA 4IE6A 5FMDA 4QHZA 1D0GA 3OD0A 1S1AA 2H6CA 1W90A 2IFWA 2VBDA 4TZDA 3HN1A 4DR2O 2BNMA 2ILMA 1EP0A 2RS53 3PN1A 1W2AX 1OF4A 4Y33A 3MDPA 3ZRVA 4META 1RUG3 4OI1A 4YJ3A 4LFCB 4KXRA 3W7UA 4XC9A 4OMDA 3NNMA 1ENVA 5EJZB 3LSEA 5J7MA 2VCAA 5EV7A 4LNVA 1W39A 5FPXA 1QWRA 4MGKE 4FJCC 4H0LB 5BNOA 4KG8A 1BL8A 1NQJA 2A6YA 1JCHA 2LJ2A 2C9KA 3CEWA 3RYKA 1W8TA 3RZHA 4X64O 4Y4RA 3VKOA 3CRAA 1KJLA 2RS32 3ZSJA 1O9GA 1G7YA 5ABJA 5TSWA 4QKDA 4R6ZA 2QQNA 3N9LA 1OD3A 4XIKA 3ZFFA 1QJZA 4UB6Z 1DFQA 2Q1FA 3LGRA 3TAYA 2ZT9B 1YO8A 3RVYA 2NM1A 2V5DA 3ASOB 5B1BB 4TV9A 1OA3A 4B7EA 1PM7A 4BHPA 4PV1B 4Q0VA 3JAKB 4CTEA 1VQ5V 4CS3A 1F5FA 4Y22B 3JAWA 4XDKA 4QU2A 4CSWA 5C70A 5KC5A 3KB5A 1XSRA 1OUXA 3NQHA 2IVJA 2VVDA 3M1HA 3GCXA 4P14A 5KXDA 2QDOA 1MS9A 3BODA 3FLRA 3FMGA 3U37A 1HRI1 1Q81W 4LQRA 1N32O 2ZZJA 2K0GA 2WWWA 1ZWIC 3DXRA 4LFAB 4UAPA 3W7TA 3MPBA 1JPXA 1IKPA 1VAKA 1JH5A 1O3TA 4C0HA 1HDKA 4GMP0 5A9GA 4AE2A 1J3PA 1U5YA 3ETQA 4I3GA 2FD8A 2AW9A 4FPLA 5FL7G 1K8AW 1G9AA 2Q7HA 2A73B 3KLSA 4JX0A 2WC2A 4COYA 1R092 1N36B 4IL7A 5DZGA 1WD3A 1OOPB 4BK4A 2WWUA 5LMNB 5BR8O 1STMA 1J5EO 2L35A 3I3EA 1QIQA 3V65A 3CC7V 4O4IA 4YM0A 4O4LB 4UW4A 3ZKUA 1RVF3 4DQAA 3RW0A 4DRXA 2PAKA 5FUNA 5FZMA 3SEEA 1VF7A 5A70A 4PDWB 1NY71 2Y6HA 5BNPA 4BW5A 4NAOA 4ASKA 5A6XA 4HXCA 1YQ6A 5JAXA 5IVYA 3C3SA 3EJKA 3M7AA 4XZUG 4FPJA 1HKDA 3ZFGB 1IXBA 1X8MA 2WABA 2ORZA 1NTKH 4MGSA 5HXMA 3PVEA 4FO9A 1IBKB 4ORFA 3S3WA 2R70A 1XREA 1E57A 3GJAA 4P9IA 2OZ6A 4BQ2A 3F5TA 4QPGA 2WLLA 1CXZB 3APBA 4P9YA 4LBKA 1R3LC 1SQBH 4OCTA 2ADDA 2O1QA 4NJ4A 2J1EA 1OI6A 4PT6A 3PMSA 3MIFA 3P3NA 4LLOA 3ACIA 5J1XA 5IYZA 1YQCA 4HONA 3U0ZA 4LHLA 3WP6A 5FZ6A 4MVUA 3CIHA 5LA6B 1VQ7V 2V7QG 5FLJA 2JG8A 1WLEA 3T1HO 3DYMA 4UB8Z 2DQ3A 3ETDA 3WB1A 1WCQA 3MV11 5AFBA 1FS0G 2Q0OC 4MOAA 2QQOA 5FY0A 4RS5A 1Q6IA 1W0KG 3VD5A 5T52A 4K20A 4ZZ5A 4FXKB 3NXSA 1YI7A 3T09A 3N9QA 1TAEA 3RJRA 4U7OA 5KHKA 1QCEA 1AJKA 2NNUA 2F1MA 5F3CA 5FNVB 3AKPA 3NSTA 4CVUA 5FYYA 3CCRV 4J1WA 1BLZA 5C9AA 3O1UA 4GLXA 2BEOA 4JYCA 3ZMSA 1JOBA 2Q1MA 4ZXKA 2VQ0A 5FYVA 3ZDVA 1W8FA 3T1MA 3ABMC 1WCDJ 3VBRA 3UKMA 4XFHA 5FZ3A 1UOBA 1UMIA 3AK1A 1XMQO 1SBDA 5J2TB 5FWEA 3OGGA 5B1AC 4PCRA 2VQUA 3U4SA 2D40A 3IAYA 2VCCA 1I94B 3TBDA 3ABLB 2W6JG 3LQCA 3D6EA 1WD4A 1AR73 2EINC 3MHZA 2JDAA 3K4DA 4XUOA 5ABJC 3Q8BA 2BTQB 3WW1A 3SPGA 2PAEA 4QX2A 4IV1C 1XDCA 2Q8VA 5DQ0A 3V64A 5IYYA 3U07A 3QO5A 3WFVA 2EA7A 1HV1A 2CV6A 3F7VC 5C5TA 2RDQA 2WNEA 1XNDA 1HRI3 4LF9O 3UO2A 2WQZC 4LULA 3BRCA 2DCJA 1Q5OA 3B2EE 5CFDB 1BZKA 3H9AA 1BVP1 1Q43A 4X65O 1OA2A 4IEUA 5F7UA 2RS12 4IEWA 2A6ZA 1ND3A 1SLLA 1JHJA 2R1BA 3OEHG 1Q6HA 1O3RA 1W2UA 3AJZA 2E63A 4FFBB 2DBNA 2NN8A 4YY3B 2WZR2 4GA9A 3S3XA 3ZMUA 2P6HA 1PK6A 1W06A 2EAKA 5EZYA 1APNA 4DR4O 3WNMA 1OCRC 3VQVA 2UXDB 1CN1A 1P49A 1LCLA 3AMQA 1GR3A 1AX2A 4IGQA 3V0BB 2R9IA 4QPGC 1UY4A 1FXZA 4P9PA 3JARB 1BVVA 4Z82A 4BK5A 2P4VA 3WUDA 2IJJA 3K5MA 1EAH1 1OQDA 2B9UA 3SEPA 3DPRC 4BH9A 5CG8A 1RUI1 3VZKA 1BEV3 1C4RA 5C8WA 2LW1A 2ZX3A 4R9BA 2VBPA 1D7PM 5C3OA 3VHOA 4RR3C 3WVJA 1DQ6A 4ZPIA 2ZX2A 1OCOB 1PVC2 2WA3A 2YY1A 1JA8A 4LBNA 2IBZH 2WYSA 1NU1H 1WP7A 4DO0A 4AHWA 1VRH3 3C3TA 4LPLA 1PO11 4FLYA 3LA2A 2DVFA 4KU8A 4RQEA 2EBOA 4H37A 2IXCA 1KP3A 4FFHA 2VC9A 4JGYA 5DAWA 1NCQB 4DUZB 1J84A 2E31A 1KFXL 4P9LA 2JEUA 1LU1A 3HJRA 3NAPB 4IETA 5A3PA 4DMIA 2JB8A 1XI1A 1ZBE2 3KV4A 5LCWL 1YXWA 3POSA 4A44A 1ZZ6A 4XAEA 4OUSA 5CVRA 2GDSA 2XBO1 3ZM8A 1OFNA 3GDBA 1KITA 5ACA2 4BQ5A 2XQXA 5I0SA 2BP6A 3EO6A 4OI0A 4KWJA 2R30A 3HB3B 4DUYB 3ZCCA 1MQTC 1O59A 2LRPA 5EHDA 2WUHA 1T6BX 4NXNB 4W8JA 3WUCA 2OW4A 4HK8A 4FPEA 3ZHUA 2XOMA 1PM9A 1AR82 3LUTB 1J83A 2NQYA 1S5HC 4CCCA 1ZL8B 4H7MA 2WA4A 4GX1A 3N9NA 2QJ1A 5LA1A 1ZBE3 3WXPA 4CU6A 2LFSA 2BTVC 1EYBA 4I02A 3A0NA 1ASJ1 4GX0A 5FZFA 2FHRA 1PL0A 4BXFA 1RUE3 2ZE7A 3WX5A 2E5LB 3THCA 2ZGRA 5HV4A 5H6QA 4BW9A 1CJPA 4DRRA 4DR3O 3DXRB 2WLLB 3O14A 5F3IA 2XUMA 1X9TA 2ZINA 1PVC3 1JMKC 3SPCA 3NAPA 3HR0A 1ONAA 2XJQA 4I55A 2P3YA 4GWJA 1VQPV 4Y4YA 4HBNA 4LKFA 1WLTA 3KCYA 3TETA 2TEPA 3MI8A 2D44A 3GHNA 3KQ4B 5K1PA 5E1RA 1LHNA 4UF0A 2DCYA 1DQ2A 1NZIA 1RMU1 4A6OA 1QJX1 5BXXA 4CH3A 4F6EA 4PDWA 1ULPA 5F5IA 4AAXA 5LP6A 3O1MA 2GUZB 3B9IA 4X6QB 4FP2A 4JI8B 3M70A 1COV3 1W8ZA 2ZE5A 1WNSA 2CY6A 2QKDA 5C3QA 2KXLA 4UCRA 1R6NA 1DGSA 1N47A 5EWSA 4A7YA 5C9AB 2ZGUA 4K0KO 2UUCO 1GOGA 2Q1ZB 1OFSA 4FFKA 3D4KA 3W58A 2OVUA 4BM8A 2EZPA 2WZEA 1DCSA 3VZMA 3QG5A 1AX0A 1FFXB 3OGJA 4LR4A 1L8DA 1SPPB 1W8NA 2BDRA 5IK7A 2QEXV 5E89A 4D3WA 1L3JA 5CA0B 1RMU3 1WA6X 2XASA 3FB5C 1RITA 3WY6A 4RQPB 1V70A 1PV0A 4Q4W1 2AZ5A 4U2AA 4EQVA 1HW7A 1F2NA 3FD9A 2F4PA 4XYXA 4MXWB 1JN2P 1RUOA 4JRAA 3NNGA 1JZ4A 1PNMA 3CJXA 5FCCA 1OQ1A 2ZGKA 1HRV2 2ZQMA 4UBHA 4NWVA 1MVQA 1FFTB 4I5SA 1RUC2 2JKBA 4AQSA 1YHQV 2ZMLA 1QXRA 3Q8AA 2LGQA 5DAQA 4CUBA 1ND3B 4XUPA 2VAUA 2BQPA 5J2TA 4LKSA 1PGL1 4FTEA 2XUEA 3WZ1A 4XZPA 3MIDA 3J7AU 2H0BA 3PUAA 4CU8A 2WT2A 2YICA 1EBOA 3E6BA 3WCSA 5CB7A 3DN7A 1UPGA 1QQP1 1LJ7A 3PTYA 3AG7A 3PJSK 4OVEA 4XMAA 3FLTA 4I4TB 2QR4A 4Y20B 4GULA 5FZ9A 2OIIA 1XOUA 4LF5B 2EVXA 3R05A 4IERA 5L19A 4XF4A 3ZMZA 3OUIA 4FAGA 2BYVE 1O5UA 1U12A 3ASOC 5ABJB 5CNAA 4Y1XA 5A7WB 5CA1B 2VZ1A 1IG0A 4IL6Z 4I50A 3IAQA 3C90A 3HPLC 1W8OA 2W1QA 4GYCB 3TEYA 1UD1A 1RFYA 1CAVB 3AXEA 4JI7B 4FQZA 2VZUA 3ZYJB 1Y3TA 5GLZA 5FJKA 3AMMA 3HEIA 3JATB 2LQTA 4L11A 4XE9A 1S77D 4Q4V2 3I49A 4KGQA 2YFZA 2WR9A 3DKWA 2JB4A 1V00A 4QQOA 3TB0A 2B42B 5FZOA 4XIOA 1C8M1 1PIV1 4DY5A 4JASA 2PYJA 3D3QA 1I5XA 4LXLA 4PBPA 1GANA 4GCZA 3ZHSA 4DFSA 1LOEA 1Y4MA 5FY9A 2CE4A 4QX3A 4XAAA 1C8NA 2LGWA 4DUVA 5L9RA 2X5IA 3Q4HA 2ITCC 3BAAA 3HKBB 5A33B 1X9PA 2WWSA 1JJ2U 2Z79A 5FO9B 1VP6A 5FP4A 4XJ8A 5L36A 1W9FA 1XOYA 2XHKA 3SYAA 1GNYA 1K7DA 2XJRA 1GU3A 2YDEA 4AOCA 2XAHA 2C24A 2JICA 5FIXA 2UWCA 1GKFA 1TEIA 3MLLA 1J58A 4QX1A 5FZIA 1DK1A 3CCQV 3VBUA 2OZJA 5FPLA 2PUSA 3DF0A 1SA0A 1S0IA 4D94A 4IEYA 3WT3A 3QF7A 3ON7A 1W0PA 2XONA 4TT3G 1OVSA 5LZ6A 2DMXA 1MG1A 1QXPA 3JATA 2QCSB 3VKNA 1QY4A 1HRV3 4NE9A 2JENA 4DV3O 3BPZA 2OUJA 4YFZA 1QJY2 2QKSA 1AYM1 2MNGA 4GD4A 4AFDA 4Y26A 4X8NA 3PL0A 1F4HA 2JG8C 2AHYA 1NH2D 3WR0A 2WNVC 4GX5A 2F4VB 4CXYA 3TEWA 4IEVA 2CHHA 2JG9C 3JB4C 4CP1A 4M00A 1LGNA 3K04A 2W87A 1H2KA 1A8DA 4PLOA 3ALQA 2GN3A 3S57A 4RS5B 3VKLA 3R4DB 1F4MA 3I3BA 2WLPA 4EFEA 1K4CC 5SV5A 2FYUH 5KWRA 5F6LB 2RNBA 3IDAA 5IVBA 1ZL8A 1LTEA 3ZO0B 3RZKA 3MIEA 1OQEA 3WDYA 3VBOB 1SEFA 3WNPA 3FFZA 1ZRFA 5FNVA 2CTQA 5IDJA 4Q0SA 2UYAA 2JDIG 4FPCA 1UY1A 2QWPB 3LDRA 4OI4A 4GT1A 3NW4A 1AUYA 2D6KA 1RUI2 4CXXA 4LITA 3ZKYA 3CU7A 2QJVA 1RB8G 1LU2A 2CAVA 3EFFK 4DR3B 1N34O 5L73A 4JAVA 2ZXWB 5JZGC 1JJOA 4WM7B 5KAIZ 1VRBA 2EIBA 3SDLA 2JRIA 4Q0PA 1QU7A 3VDDC 3TK1A 5T5LA 3R6SA 4IEXA 1SKVA 2D7FA 5JIAA 3BI3A 4Q4X3 2ZOEB 5T55A 1W6QA 3C2UA 3B5LB 2HWC1 3FHAA 2OUHA 3MAQA 3AVRA 1PX4A 1VQOV 3H3ZA 4H2AA 1ZZ9A 2E9QA 4FOWA 1LNSA 3VL9A 4F7ZA 1GZ9A 4OQ8A 3WF4A 4GZ9A 1RVF1 4X89A 4WM8A 5LYJB 3VOUA 1MZ5A 5JR7B 2XHBA 5AC93 3V0AB 3SKVA 5JJEB 2F23A 5C6CA 3TNPB 3VKMA 1DQ0A 3CYOA 3AZYA 1ALYA 4DV5O
chains in the Genus database with same CATH topology
3MZHA 1B35C 1YUDA 4XILA 5HI0A 2XWBB 4J6GA 2HWB1 4CEYA 5CAZA 1GQGA 3LB9A 1MZFA 1A8MA 2P3KA 4INDA 4H55A 4QGNA 2DVGA 1AYN1 1RUJ1 4C1WA 4Y20A 5A32B 3SH4A 5BYNA 1X82A 5JPNB 4YM2A 4BCUA 2PLV2 3PVJA 2R49A 2YYOA 1AHSA 4HKWA 2BBVA 4XFAA 5BNNA 2XL7A 4YZ1A 1AR91 4XF0A 1DGWA 1LEMA 4UXAA 2NYYA 4E2GA 2SBAA 2OG6A 1VB4A 5CFCB 2JJ6A 1GFF2 1DGRA 2WZR1 1JR7A 1KQRA 1AX1A 2DUOA 5E16A 4JGZA 1VB2A 2I45A 1K5MC 3E6CC 4BMEA 1PHMA 4B7KA 4M2GA 1LHVA 3KZ4C 5FLHA 1MS5A 3ZN4A 5JIUA 2BFUL 2XJTA 1YFXA 3OPZA 2UYBA 4YRDA 4XETA 2P37A 3SMHA 4BIOA 2D93A 1SLIA 2CTVA 1RUD1 3J26N 1YFYA 4ES9A 4N9IA 1KS5A 1RUF2 1NQDA 3ECQA 1J3RA 2AH2A 1AL21 4F3JA 3TN91 4AVCA 2XLAA 3ZMNA 1GLHA 4N7IA 4ZU7A 2JXAA 3HWJA 1PVXA 1GZWA 4K9SA 5C8CA 4LBQD 1V6IA 1R081 4Q4X1 1XYNA 1IPJA 4MGYE 1SCRA 2Z2SB 1UKGA 4W6YA 4HLTA 3RNSA 3WG1A 4L8QA 5I0RA 3POWA 1RUE2 3SNMA 5DUUA 2ZKNA 2VW2A 5EJ3A 1RJ7A 1R1A1 4Z07A 1RTVA 2WZPP 3EHKA 2IC1A 4CDQA 3QCWA 3S6PA 1NX8A 1AXKA 1BXHA 2VOVA 4R52A 4KNCA 3I7DA 2D3SA 5F5QA 1XU1A 1QJU3 1F9KA 2Y0IA 3OD4A 4SBVA 1HRV1 3VBSA 3X29B 1VBB1 1K5MB 3N3HA 1VLNA 5CBLA 2VMGA 4HVQA 2Q5TA 4GKYA 2W68A 2YC0A 1Q8PA 1CX4A 4AHZA 4TLFA 2A3XA 2HWD3 4ISQA 5A33A 1TQ5A 3Q9OA 4LA2A 2XG3A 3VN4A 2XB6C 3ATGA 3N7KA 5K7PA 5E8AA 2HWE3 3RPQA 3AP5A 2WKKA 3QOPA 1V9U3 1BK1A 5J37A 2HWF2 4DPNA 2DYCA 4TYSA 2JX9A 4MH0E 1RUE1 2B5HA 4JDOA 4HFSA 1BBT2 3H50A 4JGYC 3L2HA 3WCRA 3EXUA 1VALA 1AF9A 2CAUA 5ACA1 2HWE2 2A6WA 3NAPC 3VHNA 3WHTA 1FYUA 4M3CF 5H9QA 5CFDC 5CADA 1SDWA 5C4WC 1XU2A 3B00A 3UKTA 4BLJA 3BTAA 1HX6A 2VUAA 1AR83 5KC6A 1VBD1 3R4SA 1C8M3 2EAAA 5FREA 4KBBA 4C8RA 1QJY3 2RR13 4P9XA 5L7OA 4Q4Y2 1ZRCA 1LEDA 1POV1 2CGNA 2W08A 2XJSA 1C1LA 1ZBA3 2DWRA 4N53B 2C1FA 4AK3A 5JOXA 3ZSLA 3CF6E 2WFF2 2ZHKA 1HW5A 5HBAA 5J09A 5JOYA 4N43B 3NV3A 1ULDA 5FQ0A 3HD8B 2RR12 3VZNA 3IN9A 2HWF3 3FUOA 4XJ9A 2GH8A 1GYKA 2PN5A 2WS91 1GQWA 4LEJA 4N90A 5JI9A 2BFUS 1S0CA 2BVVA 2GNMA 2WS92 4M0NA 1IKQA 2P34A 2VMHA 5JPMB 4CEWB 1SCSA 4L9BA 4LBJA 2HJIA 4MSVA 5FOBB 3IBMA 1C28A 2G4IA 2YMZA 1CGPA 2A6VA 1DU3D 3TN93 4CRQA 3WW4A 5FO7B 3D82A 2YXSA 2GN7A 1O5LA 2R041 4JRLA 4AW7A 4S2DA 4LBLA 4ES8A 3CL1A 4FFAA 1O4YA 3VBFC 2AYHA 3BIWE 3EBRA 1CAVA 1VZ4A 1V9U2 5I0TA 1YIFA 4H7LA 1PK6C 2Q8OA 3RMXA 4CP0A 4WVVA 5D8AB 5JZGB 2W52A 2A75A 1LGCA 4KL1A 2ZS6B 3WG3A 1FMD1 3S7IA 3AK0A 1N1SA 4OI2A 4YG3A 1DGRN 1TNFA 4P5HA 4YVWA 4YARA 1PNGA 3M3QA 4OHVA 4DOUA